data_3IKM
# 
_entry.id   3IKM 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.289 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3IKM         
RCSB  RCSB054529   
WWPDB D_1000054529 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3IKM 
_pdbx_database_status.recvd_initial_deposition_date   2009-08-06 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Lee, Y.-S.'    1 
'Kennedy, W.D.' 2 
'Yin, Y.W.'     3 
# 
_citation.id                        primary 
_citation.title                     
'Structural insight into processive human mitochondrial DNA synthesis and disease-related polymerase mutations.' 
_citation.journal_abbrev            'Cell(Cambridge,Mass.)' 
_citation.journal_volume            139 
_citation.page_first                312 
_citation.page_last                 324 
_citation.year                      2009 
_citation.journal_id_ASTM           CELLB5 
_citation.country                   US 
_citation.journal_id_ISSN           0092-8674 
_citation.journal_id_CSD            0998 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19837034 
_citation.pdbx_database_id_DOI      10.1016/j.cell.2009.07.050 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Lee, Y.S.'     1 
primary 'Kennedy, W.D.' 2 
primary 'Yin, Y.W.'     3 
# 
_cell.entry_id           3IKM 
_cell.length_a           138.394 
_cell.length_b           138.394 
_cell.length_c           226.312 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3IKM 
_symmetry.space_group_name_H-M             'P 32' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                145 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer nat 'DNA polymerase subunit gamma-1' 132384.688 2 2.7.7.7 ? 'UNP residues 70-1239' ? 
2 polymer nat 'DNA polymerase subunit gamma-2' 48757.902  4 2.7.7.7 ? 'UNP residues 59-485'  ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1 'Mitochondrial DNA polymerase catalytic subunit, PolG-alpha'                                                            
2 'Mitochondrial DNA polymerase accessory subunit, PolG-beta, MtPolB, DNA polymerase gamma accessory 55 kDa subunit, p55' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;RHNPLDIQMLSRGLHEQIFGQGGEMPGEAAVRRSVEHLQKHGLWGQPAVPLPDVELRLPPLYGDNLDQHFRLLAQKQSLP
YLEAANLLLQAQLPPKPPAWAWAEGWTRYGPEGEAVPVAIPEERALVFDVEVCLAEGTCPTLAVAISPSAWYSWCSQRLV
EERYSWTSQLSPADLIPLEVPTGASSPTQRDWQEQLVVGHNVSFDRAHIREQYLIQGSRMRFLDTMSMHMAISGLSSFQR
SLWIAAKQGKHKVQPPTKQGQKSQRKARRGPAISSWDWLDISSVNSNSLAEVHRLYVGGPPLEKEPRELFVKGTMKDIRE
NFQDLMQYCAQDVWATHEVFQQQLPLFLERCPHPVTLAGMLEMGVSYLPVNQNWERYLAEAQGTYEELQREMKKSLMDLA
NDACQLLSGERYKEDPWLWDLEWDLQEFKQKKAKKVKKEPATASKLPIEGAGAPGDPMDQEDLGPCSEEEEFQQDVMARA
CLQKLKGTTELLPKRPQHLPGHPGWYRKLCPRLDDPAWTPGPSLLSLQMRVTPKLMALTWDGFPLHYSERHGWGYLVPGR
RDNLAKLPTGTTLESAGVVCPYRAIESLYRKHCLEQGKQQLMPQEAGLAEEFLLTDNSAIWQTVEELDYLEVEAEAKMEN
LRAAVPGQPLALTARGGPKDTQPSYHHGNGPYNDVDIPGCWFFKLPHKDGNSCNVGSPFAKDFLPKMEDGTLQAGPGGAS
GPRALEINKMISFWRNAHKRISSQMVVWLPRSALPRAVIRHPDYDEEGLYGAILPQVVTAGTITRRAVEPTWLTASNARP
DRVGSELKAMVQAPPGYTLVGADVDSQELWIAAVLGDAHFAGMHGCTAFGWMTLQGRKSRGTDLHSKTATTVGISREHAK
IFNYGRIYGAGQPFAERLLMQFNHRLTQQEAAEKAQQMYAATKGLRWYRLSDEGEWLVRELNLPVDRTEGGWISLQDLRK
VQRETARKSQWKKWEVVAERAWKGGTESEMFNKLESIATSDIPRTPVLGCCISRALEPSAVQEEFMTSRVNWVVQSSAVD
YLHLMLVAMKWLFEEFAIDGRFCISIHDEVRYLVREEDRYRAALALQITNLLTRCMFAYKLGLNDLPQSVAFFSAVDIDR
CLRKEVTMDCKTPSNPTGMERRYGIPQGEALDIYQIIELTKGSLEKRSQPGP
;
;RHNPLDIQMLSRGLHEQIFGQGGEMPGEAAVRRSVEHLQKHGLWGQPAVPLPDVELRLPPLYGDNLDQHFRLLAQKQSLP
YLEAANLLLQAQLPPKPPAWAWAEGWTRYGPEGEAVPVAIPEERALVFDVEVCLAEGTCPTLAVAISPSAWYSWCSQRLV
EERYSWTSQLSPADLIPLEVPTGASSPTQRDWQEQLVVGHNVSFDRAHIREQYLIQGSRMRFLDTMSMHMAISGLSSFQR
SLWIAAKQGKHKVQPPTKQGQKSQRKARRGPAISSWDWLDISSVNSNSLAEVHRLYVGGPPLEKEPRELFVKGTMKDIRE
NFQDLMQYCAQDVWATHEVFQQQLPLFLERCPHPVTLAGMLEMGVSYLPVNQNWERYLAEAQGTYEELQREMKKSLMDLA
NDACQLLSGERYKEDPWLWDLEWDLQEFKQKKAKKVKKEPATASKLPIEGAGAPGDPMDQEDLGPCSEEEEFQQDVMARA
CLQKLKGTTELLPKRPQHLPGHPGWYRKLCPRLDDPAWTPGPSLLSLQMRVTPKLMALTWDGFPLHYSERHGWGYLVPGR
RDNLAKLPTGTTLESAGVVCPYRAIESLYRKHCLEQGKQQLMPQEAGLAEEFLLTDNSAIWQTVEELDYLEVEAEAKMEN
LRAAVPGQPLALTARGGPKDTQPSYHHGNGPYNDVDIPGCWFFKLPHKDGNSCNVGSPFAKDFLPKMEDGTLQAGPGGAS
GPRALEINKMISFWRNAHKRISSQMVVWLPRSALPRAVIRHPDYDEEGLYGAILPQVVTAGTITRRAVEPTWLTASNARP
DRVGSELKAMVQAPPGYTLVGADVDSQELWIAAVLGDAHFAGMHGCTAFGWMTLQGRKSRGTDLHSKTATTVGISREHAK
IFNYGRIYGAGQPFAERLLMQFNHRLTQQEAAEKAQQMYAATKGLRWYRLSDEGEWLVRELNLPVDRTEGGWISLQDLRK
VQRETARKSQWKKWEVVAERAWKGGTESEMFNKLESIATSDIPRTPVLGCCISRALEPSAVQEEFMTSRVNWVVQSSAVD
YLHLMLVAMKWLFEEFAIDGRFCISIHDEVRYLVREEDRYRAALALQITNLLTRCMFAYKLGLNDLPQSVAFFSAVDIDR
CLRKEVTMDCKTPSNPTGMERRYGIPQGEALDIYQIIELTKGSLEKRSQPGP
;
A,D     ? 
2 'polypeptide(L)' no no 
;APGSGEGSEALLEICQRRHFLSGSKQQLSRDSLLSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPVDALHHKPGPL
LPGDSAFRLVSAETLREILQDKELSKEQLVAFLENVLKTSGKLRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPV
FDTKQIRNGVKSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNFPWGKE
LIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQLTENSFTRKKNLHRKVLKLHPCL
APIKVALDVGRGPTLELRQVCQGLFNELLENGISVWPGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSR
DTTMKEMMHISKLKDFLIKYISSAKNV
;
;APGSGEGSEALLEICQRRHFLSGSKQQLSRDSLLSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPVDALHHKPGPL
LPGDSAFRLVSAETLREILQDKELSKEQLVAFLENVLKTSGKLRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPV
FDTKQIRNGVKSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNFPWGKE
LIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQLTENSFTRKKNLHRKVLKLHPCL
APIKVALDVGRGPTLELRQVCQGLFNELLENGISVWPGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSR
DTTMKEMMHISKLKDFLIKYISSAKNV
;
B,C,E,F ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1    ARG n 
1 2    HIS n 
1 3    ASN n 
1 4    PRO n 
1 5    LEU n 
1 6    ASP n 
1 7    ILE n 
1 8    GLN n 
1 9    MET n 
1 10   LEU n 
1 11   SER n 
1 12   ARG n 
1 13   GLY n 
1 14   LEU n 
1 15   HIS n 
1 16   GLU n 
1 17   GLN n 
1 18   ILE n 
1 19   PHE n 
1 20   GLY n 
1 21   GLN n 
1 22   GLY n 
1 23   GLY n 
1 24   GLU n 
1 25   MET n 
1 26   PRO n 
1 27   GLY n 
1 28   GLU n 
1 29   ALA n 
1 30   ALA n 
1 31   VAL n 
1 32   ARG n 
1 33   ARG n 
1 34   SER n 
1 35   VAL n 
1 36   GLU n 
1 37   HIS n 
1 38   LEU n 
1 39   GLN n 
1 40   LYS n 
1 41   HIS n 
1 42   GLY n 
1 43   LEU n 
1 44   TRP n 
1 45   GLY n 
1 46   GLN n 
1 47   PRO n 
1 48   ALA n 
1 49   VAL n 
1 50   PRO n 
1 51   LEU n 
1 52   PRO n 
1 53   ASP n 
1 54   VAL n 
1 55   GLU n 
1 56   LEU n 
1 57   ARG n 
1 58   LEU n 
1 59   PRO n 
1 60   PRO n 
1 61   LEU n 
1 62   TYR n 
1 63   GLY n 
1 64   ASP n 
1 65   ASN n 
1 66   LEU n 
1 67   ASP n 
1 68   GLN n 
1 69   HIS n 
1 70   PHE n 
1 71   ARG n 
1 72   LEU n 
1 73   LEU n 
1 74   ALA n 
1 75   GLN n 
1 76   LYS n 
1 77   GLN n 
1 78   SER n 
1 79   LEU n 
1 80   PRO n 
1 81   TYR n 
1 82   LEU n 
1 83   GLU n 
1 84   ALA n 
1 85   ALA n 
1 86   ASN n 
1 87   LEU n 
1 88   LEU n 
1 89   LEU n 
1 90   GLN n 
1 91   ALA n 
1 92   GLN n 
1 93   LEU n 
1 94   PRO n 
1 95   PRO n 
1 96   LYS n 
1 97   PRO n 
1 98   PRO n 
1 99   ALA n 
1 100  TRP n 
1 101  ALA n 
1 102  TRP n 
1 103  ALA n 
1 104  GLU n 
1 105  GLY n 
1 106  TRP n 
1 107  THR n 
1 108  ARG n 
1 109  TYR n 
1 110  GLY n 
1 111  PRO n 
1 112  GLU n 
1 113  GLY n 
1 114  GLU n 
1 115  ALA n 
1 116  VAL n 
1 117  PRO n 
1 118  VAL n 
1 119  ALA n 
1 120  ILE n 
1 121  PRO n 
1 122  GLU n 
1 123  GLU n 
1 124  ARG n 
1 125  ALA n 
1 126  LEU n 
1 127  VAL n 
1 128  PHE n 
1 129  ASP n 
1 130  VAL n 
1 131  GLU n 
1 132  VAL n 
1 133  CYS n 
1 134  LEU n 
1 135  ALA n 
1 136  GLU n 
1 137  GLY n 
1 138  THR n 
1 139  CYS n 
1 140  PRO n 
1 141  THR n 
1 142  LEU n 
1 143  ALA n 
1 144  VAL n 
1 145  ALA n 
1 146  ILE n 
1 147  SER n 
1 148  PRO n 
1 149  SER n 
1 150  ALA n 
1 151  TRP n 
1 152  TYR n 
1 153  SER n 
1 154  TRP n 
1 155  CYS n 
1 156  SER n 
1 157  GLN n 
1 158  ARG n 
1 159  LEU n 
1 160  VAL n 
1 161  GLU n 
1 162  GLU n 
1 163  ARG n 
1 164  TYR n 
1 165  SER n 
1 166  TRP n 
1 167  THR n 
1 168  SER n 
1 169  GLN n 
1 170  LEU n 
1 171  SER n 
1 172  PRO n 
1 173  ALA n 
1 174  ASP n 
1 175  LEU n 
1 176  ILE n 
1 177  PRO n 
1 178  LEU n 
1 179  GLU n 
1 180  VAL n 
1 181  PRO n 
1 182  THR n 
1 183  GLY n 
1 184  ALA n 
1 185  SER n 
1 186  SER n 
1 187  PRO n 
1 188  THR n 
1 189  GLN n 
1 190  ARG n 
1 191  ASP n 
1 192  TRP n 
1 193  GLN n 
1 194  GLU n 
1 195  GLN n 
1 196  LEU n 
1 197  VAL n 
1 198  VAL n 
1 199  GLY n 
1 200  HIS n 
1 201  ASN n 
1 202  VAL n 
1 203  SER n 
1 204  PHE n 
1 205  ASP n 
1 206  ARG n 
1 207  ALA n 
1 208  HIS n 
1 209  ILE n 
1 210  ARG n 
1 211  GLU n 
1 212  GLN n 
1 213  TYR n 
1 214  LEU n 
1 215  ILE n 
1 216  GLN n 
1 217  GLY n 
1 218  SER n 
1 219  ARG n 
1 220  MET n 
1 221  ARG n 
1 222  PHE n 
1 223  LEU n 
1 224  ASP n 
1 225  THR n 
1 226  MET n 
1 227  SER n 
1 228  MET n 
1 229  HIS n 
1 230  MET n 
1 231  ALA n 
1 232  ILE n 
1 233  SER n 
1 234  GLY n 
1 235  LEU n 
1 236  SER n 
1 237  SER n 
1 238  PHE n 
1 239  GLN n 
1 240  ARG n 
1 241  SER n 
1 242  LEU n 
1 243  TRP n 
1 244  ILE n 
1 245  ALA n 
1 246  ALA n 
1 247  LYS n 
1 248  GLN n 
1 249  GLY n 
1 250  LYS n 
1 251  HIS n 
1 252  LYS n 
1 253  VAL n 
1 254  GLN n 
1 255  PRO n 
1 256  PRO n 
1 257  THR n 
1 258  LYS n 
1 259  GLN n 
1 260  GLY n 
1 261  GLN n 
1 262  LYS n 
1 263  SER n 
1 264  GLN n 
1 265  ARG n 
1 266  LYS n 
1 267  ALA n 
1 268  ARG n 
1 269  ARG n 
1 270  GLY n 
1 271  PRO n 
1 272  ALA n 
1 273  ILE n 
1 274  SER n 
1 275  SER n 
1 276  TRP n 
1 277  ASP n 
1 278  TRP n 
1 279  LEU n 
1 280  ASP n 
1 281  ILE n 
1 282  SER n 
1 283  SER n 
1 284  VAL n 
1 285  ASN n 
1 286  SER n 
1 287  ASN n 
1 288  SER n 
1 289  LEU n 
1 290  ALA n 
1 291  GLU n 
1 292  VAL n 
1 293  HIS n 
1 294  ARG n 
1 295  LEU n 
1 296  TYR n 
1 297  VAL n 
1 298  GLY n 
1 299  GLY n 
1 300  PRO n 
1 301  PRO n 
1 302  LEU n 
1 303  GLU n 
1 304  LYS n 
1 305  GLU n 
1 306  PRO n 
1 307  ARG n 
1 308  GLU n 
1 309  LEU n 
1 310  PHE n 
1 311  VAL n 
1 312  LYS n 
1 313  GLY n 
1 314  THR n 
1 315  MET n 
1 316  LYS n 
1 317  ASP n 
1 318  ILE n 
1 319  ARG n 
1 320  GLU n 
1 321  ASN n 
1 322  PHE n 
1 323  GLN n 
1 324  ASP n 
1 325  LEU n 
1 326  MET n 
1 327  GLN n 
1 328  TYR n 
1 329  CYS n 
1 330  ALA n 
1 331  GLN n 
1 332  ASP n 
1 333  VAL n 
1 334  TRP n 
1 335  ALA n 
1 336  THR n 
1 337  HIS n 
1 338  GLU n 
1 339  VAL n 
1 340  PHE n 
1 341  GLN n 
1 342  GLN n 
1 343  GLN n 
1 344  LEU n 
1 345  PRO n 
1 346  LEU n 
1 347  PHE n 
1 348  LEU n 
1 349  GLU n 
1 350  ARG n 
1 351  CYS n 
1 352  PRO n 
1 353  HIS n 
1 354  PRO n 
1 355  VAL n 
1 356  THR n 
1 357  LEU n 
1 358  ALA n 
1 359  GLY n 
1 360  MET n 
1 361  LEU n 
1 362  GLU n 
1 363  MET n 
1 364  GLY n 
1 365  VAL n 
1 366  SER n 
1 367  TYR n 
1 368  LEU n 
1 369  PRO n 
1 370  VAL n 
1 371  ASN n 
1 372  GLN n 
1 373  ASN n 
1 374  TRP n 
1 375  GLU n 
1 376  ARG n 
1 377  TYR n 
1 378  LEU n 
1 379  ALA n 
1 380  GLU n 
1 381  ALA n 
1 382  GLN n 
1 383  GLY n 
1 384  THR n 
1 385  TYR n 
1 386  GLU n 
1 387  GLU n 
1 388  LEU n 
1 389  GLN n 
1 390  ARG n 
1 391  GLU n 
1 392  MET n 
1 393  LYS n 
1 394  LYS n 
1 395  SER n 
1 396  LEU n 
1 397  MET n 
1 398  ASP n 
1 399  LEU n 
1 400  ALA n 
1 401  ASN n 
1 402  ASP n 
1 403  ALA n 
1 404  CYS n 
1 405  GLN n 
1 406  LEU n 
1 407  LEU n 
1 408  SER n 
1 409  GLY n 
1 410  GLU n 
1 411  ARG n 
1 412  TYR n 
1 413  LYS n 
1 414  GLU n 
1 415  ASP n 
1 416  PRO n 
1 417  TRP n 
1 418  LEU n 
1 419  TRP n 
1 420  ASP n 
1 421  LEU n 
1 422  GLU n 
1 423  TRP n 
1 424  ASP n 
1 425  LEU n 
1 426  GLN n 
1 427  GLU n 
1 428  PHE n 
1 429  LYS n 
1 430  GLN n 
1 431  LYS n 
1 432  LYS n 
1 433  ALA n 
1 434  LYS n 
1 435  LYS n 
1 436  VAL n 
1 437  LYS n 
1 438  LYS n 
1 439  GLU n 
1 440  PRO n 
1 441  ALA n 
1 442  THR n 
1 443  ALA n 
1 444  SER n 
1 445  LYS n 
1 446  LEU n 
1 447  PRO n 
1 448  ILE n 
1 449  GLU n 
1 450  GLY n 
1 451  ALA n 
1 452  GLY n 
1 453  ALA n 
1 454  PRO n 
1 455  GLY n 
1 456  ASP n 
1 457  PRO n 
1 458  MET n 
1 459  ASP n 
1 460  GLN n 
1 461  GLU n 
1 462  ASP n 
1 463  LEU n 
1 464  GLY n 
1 465  PRO n 
1 466  CYS n 
1 467  SER n 
1 468  GLU n 
1 469  GLU n 
1 470  GLU n 
1 471  GLU n 
1 472  PHE n 
1 473  GLN n 
1 474  GLN n 
1 475  ASP n 
1 476  VAL n 
1 477  MET n 
1 478  ALA n 
1 479  ARG n 
1 480  ALA n 
1 481  CYS n 
1 482  LEU n 
1 483  GLN n 
1 484  LYS n 
1 485  LEU n 
1 486  LYS n 
1 487  GLY n 
1 488  THR n 
1 489  THR n 
1 490  GLU n 
1 491  LEU n 
1 492  LEU n 
1 493  PRO n 
1 494  LYS n 
1 495  ARG n 
1 496  PRO n 
1 497  GLN n 
1 498  HIS n 
1 499  LEU n 
1 500  PRO n 
1 501  GLY n 
1 502  HIS n 
1 503  PRO n 
1 504  GLY n 
1 505  TRP n 
1 506  TYR n 
1 507  ARG n 
1 508  LYS n 
1 509  LEU n 
1 510  CYS n 
1 511  PRO n 
1 512  ARG n 
1 513  LEU n 
1 514  ASP n 
1 515  ASP n 
1 516  PRO n 
1 517  ALA n 
1 518  TRP n 
1 519  THR n 
1 520  PRO n 
1 521  GLY n 
1 522  PRO n 
1 523  SER n 
1 524  LEU n 
1 525  LEU n 
1 526  SER n 
1 527  LEU n 
1 528  GLN n 
1 529  MET n 
1 530  ARG n 
1 531  VAL n 
1 532  THR n 
1 533  PRO n 
1 534  LYS n 
1 535  LEU n 
1 536  MET n 
1 537  ALA n 
1 538  LEU n 
1 539  THR n 
1 540  TRP n 
1 541  ASP n 
1 542  GLY n 
1 543  PHE n 
1 544  PRO n 
1 545  LEU n 
1 546  HIS n 
1 547  TYR n 
1 548  SER n 
1 549  GLU n 
1 550  ARG n 
1 551  HIS n 
1 552  GLY n 
1 553  TRP n 
1 554  GLY n 
1 555  TYR n 
1 556  LEU n 
1 557  VAL n 
1 558  PRO n 
1 559  GLY n 
1 560  ARG n 
1 561  ARG n 
1 562  ASP n 
1 563  ASN n 
1 564  LEU n 
1 565  ALA n 
1 566  LYS n 
1 567  LEU n 
1 568  PRO n 
1 569  THR n 
1 570  GLY n 
1 571  THR n 
1 572  THR n 
1 573  LEU n 
1 574  GLU n 
1 575  SER n 
1 576  ALA n 
1 577  GLY n 
1 578  VAL n 
1 579  VAL n 
1 580  CYS n 
1 581  PRO n 
1 582  TYR n 
1 583  ARG n 
1 584  ALA n 
1 585  ILE n 
1 586  GLU n 
1 587  SER n 
1 588  LEU n 
1 589  TYR n 
1 590  ARG n 
1 591  LYS n 
1 592  HIS n 
1 593  CYS n 
1 594  LEU n 
1 595  GLU n 
1 596  GLN n 
1 597  GLY n 
1 598  LYS n 
1 599  GLN n 
1 600  GLN n 
1 601  LEU n 
1 602  MET n 
1 603  PRO n 
1 604  GLN n 
1 605  GLU n 
1 606  ALA n 
1 607  GLY n 
1 608  LEU n 
1 609  ALA n 
1 610  GLU n 
1 611  GLU n 
1 612  PHE n 
1 613  LEU n 
1 614  LEU n 
1 615  THR n 
1 616  ASP n 
1 617  ASN n 
1 618  SER n 
1 619  ALA n 
1 620  ILE n 
1 621  TRP n 
1 622  GLN n 
1 623  THR n 
1 624  VAL n 
1 625  GLU n 
1 626  GLU n 
1 627  LEU n 
1 628  ASP n 
1 629  TYR n 
1 630  LEU n 
1 631  GLU n 
1 632  VAL n 
1 633  GLU n 
1 634  ALA n 
1 635  GLU n 
1 636  ALA n 
1 637  LYS n 
1 638  MET n 
1 639  GLU n 
1 640  ASN n 
1 641  LEU n 
1 642  ARG n 
1 643  ALA n 
1 644  ALA n 
1 645  VAL n 
1 646  PRO n 
1 647  GLY n 
1 648  GLN n 
1 649  PRO n 
1 650  LEU n 
1 651  ALA n 
1 652  LEU n 
1 653  THR n 
1 654  ALA n 
1 655  ARG n 
1 656  GLY n 
1 657  GLY n 
1 658  PRO n 
1 659  LYS n 
1 660  ASP n 
1 661  THR n 
1 662  GLN n 
1 663  PRO n 
1 664  SER n 
1 665  TYR n 
1 666  HIS n 
1 667  HIS n 
1 668  GLY n 
1 669  ASN n 
1 670  GLY n 
1 671  PRO n 
1 672  TYR n 
1 673  ASN n 
1 674  ASP n 
1 675  VAL n 
1 676  ASP n 
1 677  ILE n 
1 678  PRO n 
1 679  GLY n 
1 680  CYS n 
1 681  TRP n 
1 682  PHE n 
1 683  PHE n 
1 684  LYS n 
1 685  LEU n 
1 686  PRO n 
1 687  HIS n 
1 688  LYS n 
1 689  ASP n 
1 690  GLY n 
1 691  ASN n 
1 692  SER n 
1 693  CYS n 
1 694  ASN n 
1 695  VAL n 
1 696  GLY n 
1 697  SER n 
1 698  PRO n 
1 699  PHE n 
1 700  ALA n 
1 701  LYS n 
1 702  ASP n 
1 703  PHE n 
1 704  LEU n 
1 705  PRO n 
1 706  LYS n 
1 707  MET n 
1 708  GLU n 
1 709  ASP n 
1 710  GLY n 
1 711  THR n 
1 712  LEU n 
1 713  GLN n 
1 714  ALA n 
1 715  GLY n 
1 716  PRO n 
1 717  GLY n 
1 718  GLY n 
1 719  ALA n 
1 720  SER n 
1 721  GLY n 
1 722  PRO n 
1 723  ARG n 
1 724  ALA n 
1 725  LEU n 
1 726  GLU n 
1 727  ILE n 
1 728  ASN n 
1 729  LYS n 
1 730  MET n 
1 731  ILE n 
1 732  SER n 
1 733  PHE n 
1 734  TRP n 
1 735  ARG n 
1 736  ASN n 
1 737  ALA n 
1 738  HIS n 
1 739  LYS n 
1 740  ARG n 
1 741  ILE n 
1 742  SER n 
1 743  SER n 
1 744  GLN n 
1 745  MET n 
1 746  VAL n 
1 747  VAL n 
1 748  TRP n 
1 749  LEU n 
1 750  PRO n 
1 751  ARG n 
1 752  SER n 
1 753  ALA n 
1 754  LEU n 
1 755  PRO n 
1 756  ARG n 
1 757  ALA n 
1 758  VAL n 
1 759  ILE n 
1 760  ARG n 
1 761  HIS n 
1 762  PRO n 
1 763  ASP n 
1 764  TYR n 
1 765  ASP n 
1 766  GLU n 
1 767  GLU n 
1 768  GLY n 
1 769  LEU n 
1 770  TYR n 
1 771  GLY n 
1 772  ALA n 
1 773  ILE n 
1 774  LEU n 
1 775  PRO n 
1 776  GLN n 
1 777  VAL n 
1 778  VAL n 
1 779  THR n 
1 780  ALA n 
1 781  GLY n 
1 782  THR n 
1 783  ILE n 
1 784  THR n 
1 785  ARG n 
1 786  ARG n 
1 787  ALA n 
1 788  VAL n 
1 789  GLU n 
1 790  PRO n 
1 791  THR n 
1 792  TRP n 
1 793  LEU n 
1 794  THR n 
1 795  ALA n 
1 796  SER n 
1 797  ASN n 
1 798  ALA n 
1 799  ARG n 
1 800  PRO n 
1 801  ASP n 
1 802  ARG n 
1 803  VAL n 
1 804  GLY n 
1 805  SER n 
1 806  GLU n 
1 807  LEU n 
1 808  LYS n 
1 809  ALA n 
1 810  MET n 
1 811  VAL n 
1 812  GLN n 
1 813  ALA n 
1 814  PRO n 
1 815  PRO n 
1 816  GLY n 
1 817  TYR n 
1 818  THR n 
1 819  LEU n 
1 820  VAL n 
1 821  GLY n 
1 822  ALA n 
1 823  ASP n 
1 824  VAL n 
1 825  ASP n 
1 826  SER n 
1 827  GLN n 
1 828  GLU n 
1 829  LEU n 
1 830  TRP n 
1 831  ILE n 
1 832  ALA n 
1 833  ALA n 
1 834  VAL n 
1 835  LEU n 
1 836  GLY n 
1 837  ASP n 
1 838  ALA n 
1 839  HIS n 
1 840  PHE n 
1 841  ALA n 
1 842  GLY n 
1 843  MET n 
1 844  HIS n 
1 845  GLY n 
1 846  CYS n 
1 847  THR n 
1 848  ALA n 
1 849  PHE n 
1 850  GLY n 
1 851  TRP n 
1 852  MET n 
1 853  THR n 
1 854  LEU n 
1 855  GLN n 
1 856  GLY n 
1 857  ARG n 
1 858  LYS n 
1 859  SER n 
1 860  ARG n 
1 861  GLY n 
1 862  THR n 
1 863  ASP n 
1 864  LEU n 
1 865  HIS n 
1 866  SER n 
1 867  LYS n 
1 868  THR n 
1 869  ALA n 
1 870  THR n 
1 871  THR n 
1 872  VAL n 
1 873  GLY n 
1 874  ILE n 
1 875  SER n 
1 876  ARG n 
1 877  GLU n 
1 878  HIS n 
1 879  ALA n 
1 880  LYS n 
1 881  ILE n 
1 882  PHE n 
1 883  ASN n 
1 884  TYR n 
1 885  GLY n 
1 886  ARG n 
1 887  ILE n 
1 888  TYR n 
1 889  GLY n 
1 890  ALA n 
1 891  GLY n 
1 892  GLN n 
1 893  PRO n 
1 894  PHE n 
1 895  ALA n 
1 896  GLU n 
1 897  ARG n 
1 898  LEU n 
1 899  LEU n 
1 900  MET n 
1 901  GLN n 
1 902  PHE n 
1 903  ASN n 
1 904  HIS n 
1 905  ARG n 
1 906  LEU n 
1 907  THR n 
1 908  GLN n 
1 909  GLN n 
1 910  GLU n 
1 911  ALA n 
1 912  ALA n 
1 913  GLU n 
1 914  LYS n 
1 915  ALA n 
1 916  GLN n 
1 917  GLN n 
1 918  MET n 
1 919  TYR n 
1 920  ALA n 
1 921  ALA n 
1 922  THR n 
1 923  LYS n 
1 924  GLY n 
1 925  LEU n 
1 926  ARG n 
1 927  TRP n 
1 928  TYR n 
1 929  ARG n 
1 930  LEU n 
1 931  SER n 
1 932  ASP n 
1 933  GLU n 
1 934  GLY n 
1 935  GLU n 
1 936  TRP n 
1 937  LEU n 
1 938  VAL n 
1 939  ARG n 
1 940  GLU n 
1 941  LEU n 
1 942  ASN n 
1 943  LEU n 
1 944  PRO n 
1 945  VAL n 
1 946  ASP n 
1 947  ARG n 
1 948  THR n 
1 949  GLU n 
1 950  GLY n 
1 951  GLY n 
1 952  TRP n 
1 953  ILE n 
1 954  SER n 
1 955  LEU n 
1 956  GLN n 
1 957  ASP n 
1 958  LEU n 
1 959  ARG n 
1 960  LYS n 
1 961  VAL n 
1 962  GLN n 
1 963  ARG n 
1 964  GLU n 
1 965  THR n 
1 966  ALA n 
1 967  ARG n 
1 968  LYS n 
1 969  SER n 
1 970  GLN n 
1 971  TRP n 
1 972  LYS n 
1 973  LYS n 
1 974  TRP n 
1 975  GLU n 
1 976  VAL n 
1 977  VAL n 
1 978  ALA n 
1 979  GLU n 
1 980  ARG n 
1 981  ALA n 
1 982  TRP n 
1 983  LYS n 
1 984  GLY n 
1 985  GLY n 
1 986  THR n 
1 987  GLU n 
1 988  SER n 
1 989  GLU n 
1 990  MET n 
1 991  PHE n 
1 992  ASN n 
1 993  LYS n 
1 994  LEU n 
1 995  GLU n 
1 996  SER n 
1 997  ILE n 
1 998  ALA n 
1 999  THR n 
1 1000 SER n 
1 1001 ASP n 
1 1002 ILE n 
1 1003 PRO n 
1 1004 ARG n 
1 1005 THR n 
1 1006 PRO n 
1 1007 VAL n 
1 1008 LEU n 
1 1009 GLY n 
1 1010 CYS n 
1 1011 CYS n 
1 1012 ILE n 
1 1013 SER n 
1 1014 ARG n 
1 1015 ALA n 
1 1016 LEU n 
1 1017 GLU n 
1 1018 PRO n 
1 1019 SER n 
1 1020 ALA n 
1 1021 VAL n 
1 1022 GLN n 
1 1023 GLU n 
1 1024 GLU n 
1 1025 PHE n 
1 1026 MET n 
1 1027 THR n 
1 1028 SER n 
1 1029 ARG n 
1 1030 VAL n 
1 1031 ASN n 
1 1032 TRP n 
1 1033 VAL n 
1 1034 VAL n 
1 1035 GLN n 
1 1036 SER n 
1 1037 SER n 
1 1038 ALA n 
1 1039 VAL n 
1 1040 ASP n 
1 1041 TYR n 
1 1042 LEU n 
1 1043 HIS n 
1 1044 LEU n 
1 1045 MET n 
1 1046 LEU n 
1 1047 VAL n 
1 1048 ALA n 
1 1049 MET n 
1 1050 LYS n 
1 1051 TRP n 
1 1052 LEU n 
1 1053 PHE n 
1 1054 GLU n 
1 1055 GLU n 
1 1056 PHE n 
1 1057 ALA n 
1 1058 ILE n 
1 1059 ASP n 
1 1060 GLY n 
1 1061 ARG n 
1 1062 PHE n 
1 1063 CYS n 
1 1064 ILE n 
1 1065 SER n 
1 1066 ILE n 
1 1067 HIS n 
1 1068 ASP n 
1 1069 GLU n 
1 1070 VAL n 
1 1071 ARG n 
1 1072 TYR n 
1 1073 LEU n 
1 1074 VAL n 
1 1075 ARG n 
1 1076 GLU n 
1 1077 GLU n 
1 1078 ASP n 
1 1079 ARG n 
1 1080 TYR n 
1 1081 ARG n 
1 1082 ALA n 
1 1083 ALA n 
1 1084 LEU n 
1 1085 ALA n 
1 1086 LEU n 
1 1087 GLN n 
1 1088 ILE n 
1 1089 THR n 
1 1090 ASN n 
1 1091 LEU n 
1 1092 LEU n 
1 1093 THR n 
1 1094 ARG n 
1 1095 CYS n 
1 1096 MET n 
1 1097 PHE n 
1 1098 ALA n 
1 1099 TYR n 
1 1100 LYS n 
1 1101 LEU n 
1 1102 GLY n 
1 1103 LEU n 
1 1104 ASN n 
1 1105 ASP n 
1 1106 LEU n 
1 1107 PRO n 
1 1108 GLN n 
1 1109 SER n 
1 1110 VAL n 
1 1111 ALA n 
1 1112 PHE n 
1 1113 PHE n 
1 1114 SER n 
1 1115 ALA n 
1 1116 VAL n 
1 1117 ASP n 
1 1118 ILE n 
1 1119 ASP n 
1 1120 ARG n 
1 1121 CYS n 
1 1122 LEU n 
1 1123 ARG n 
1 1124 LYS n 
1 1125 GLU n 
1 1126 VAL n 
1 1127 THR n 
1 1128 MET n 
1 1129 ASP n 
1 1130 CYS n 
1 1131 LYS n 
1 1132 THR n 
1 1133 PRO n 
1 1134 SER n 
1 1135 ASN n 
1 1136 PRO n 
1 1137 THR n 
1 1138 GLY n 
1 1139 MET n 
1 1140 GLU n 
1 1141 ARG n 
1 1142 ARG n 
1 1143 TYR n 
1 1144 GLY n 
1 1145 ILE n 
1 1146 PRO n 
1 1147 GLN n 
1 1148 GLY n 
1 1149 GLU n 
1 1150 ALA n 
1 1151 LEU n 
1 1152 ASP n 
1 1153 ILE n 
1 1154 TYR n 
1 1155 GLN n 
1 1156 ILE n 
1 1157 ILE n 
1 1158 GLU n 
1 1159 LEU n 
1 1160 THR n 
1 1161 LYS n 
1 1162 GLY n 
1 1163 SER n 
1 1164 LEU n 
1 1165 GLU n 
1 1166 LYS n 
1 1167 ARG n 
1 1168 SER n 
1 1169 GLN n 
1 1170 PRO n 
1 1171 GLY n 
1 1172 PRO n 
2 1    ALA n 
2 2    PRO n 
2 3    GLY n 
2 4    SER n 
2 5    GLY n 
2 6    GLU n 
2 7    GLY n 
2 8    SER n 
2 9    GLU n 
2 10   ALA n 
2 11   LEU n 
2 12   LEU n 
2 13   GLU n 
2 14   ILE n 
2 15   CYS n 
2 16   GLN n 
2 17   ARG n 
2 18   ARG n 
2 19   HIS n 
2 20   PHE n 
2 21   LEU n 
2 22   SER n 
2 23   GLY n 
2 24   SER n 
2 25   LYS n 
2 26   GLN n 
2 27   GLN n 
2 28   LEU n 
2 29   SER n 
2 30   ARG n 
2 31   ASP n 
2 32   SER n 
2 33   LEU n 
2 34   LEU n 
2 35   SER n 
2 36   GLY n 
2 37   CYS n 
2 38   HIS n 
2 39   PRO n 
2 40   GLY n 
2 41   PHE n 
2 42   GLY n 
2 43   PRO n 
2 44   LEU n 
2 45   GLY n 
2 46   VAL n 
2 47   GLU n 
2 48   LEU n 
2 49   ARG n 
2 50   LYS n 
2 51   ASN n 
2 52   LEU n 
2 53   ALA n 
2 54   ALA n 
2 55   GLU n 
2 56   TRP n 
2 57   TRP n 
2 58   THR n 
2 59   SER n 
2 60   VAL n 
2 61   VAL n 
2 62   VAL n 
2 63   PHE n 
2 64   ARG n 
2 65   GLU n 
2 66   GLN n 
2 67   VAL n 
2 68   PHE n 
2 69   PRO n 
2 70   VAL n 
2 71   ASP n 
2 72   ALA n 
2 73   LEU n 
2 74   HIS n 
2 75   HIS n 
2 76   LYS n 
2 77   PRO n 
2 78   GLY n 
2 79   PRO n 
2 80   LEU n 
2 81   LEU n 
2 82   PRO n 
2 83   GLY n 
2 84   ASP n 
2 85   SER n 
2 86   ALA n 
2 87   PHE n 
2 88   ARG n 
2 89   LEU n 
2 90   VAL n 
2 91   SER n 
2 92   ALA n 
2 93   GLU n 
2 94   THR n 
2 95   LEU n 
2 96   ARG n 
2 97   GLU n 
2 98   ILE n 
2 99   LEU n 
2 100  GLN n 
2 101  ASP n 
2 102  LYS n 
2 103  GLU n 
2 104  LEU n 
2 105  SER n 
2 106  LYS n 
2 107  GLU n 
2 108  GLN n 
2 109  LEU n 
2 110  VAL n 
2 111  ALA n 
2 112  PHE n 
2 113  LEU n 
2 114  GLU n 
2 115  ASN n 
2 116  VAL n 
2 117  LEU n 
2 118  LYS n 
2 119  THR n 
2 120  SER n 
2 121  GLY n 
2 122  LYS n 
2 123  LEU n 
2 124  ARG n 
2 125  GLU n 
2 126  ASN n 
2 127  LEU n 
2 128  LEU n 
2 129  HIS n 
2 130  GLY n 
2 131  ALA n 
2 132  LEU n 
2 133  GLU n 
2 134  HIS n 
2 135  TYR n 
2 136  VAL n 
2 137  ASN n 
2 138  CYS n 
2 139  LEU n 
2 140  ASP n 
2 141  LEU n 
2 142  VAL n 
2 143  ASN n 
2 144  LYS n 
2 145  ARG n 
2 146  LEU n 
2 147  PRO n 
2 148  TYR n 
2 149  GLY n 
2 150  LEU n 
2 151  ALA n 
2 152  GLN n 
2 153  ILE n 
2 154  GLY n 
2 155  VAL n 
2 156  CYS n 
2 157  PHE n 
2 158  HIS n 
2 159  PRO n 
2 160  VAL n 
2 161  PHE n 
2 162  ASP n 
2 163  THR n 
2 164  LYS n 
2 165  GLN n 
2 166  ILE n 
2 167  ARG n 
2 168  ASN n 
2 169  GLY n 
2 170  VAL n 
2 171  LYS n 
2 172  SER n 
2 173  ILE n 
2 174  GLY n 
2 175  GLU n 
2 176  LYS n 
2 177  THR n 
2 178  GLU n 
2 179  ALA n 
2 180  SER n 
2 181  LEU n 
2 182  VAL n 
2 183  TRP n 
2 184  PHE n 
2 185  THR n 
2 186  PRO n 
2 187  PRO n 
2 188  ARG n 
2 189  THR n 
2 190  SER n 
2 191  ASN n 
2 192  GLN n 
2 193  TRP n 
2 194  LEU n 
2 195  ASP n 
2 196  PHE n 
2 197  TRP n 
2 198  LEU n 
2 199  ARG n 
2 200  HIS n 
2 201  ARG n 
2 202  LEU n 
2 203  GLN n 
2 204  TRP n 
2 205  TRP n 
2 206  ARG n 
2 207  LYS n 
2 208  PHE n 
2 209  ALA n 
2 210  MET n 
2 211  SER n 
2 212  PRO n 
2 213  SER n 
2 214  ASN n 
2 215  PHE n 
2 216  SER n 
2 217  SER n 
2 218  SER n 
2 219  ASP n 
2 220  CYS n 
2 221  GLN n 
2 222  ASP n 
2 223  GLU n 
2 224  GLU n 
2 225  GLY n 
2 226  ARG n 
2 227  LYS n 
2 228  GLY n 
2 229  ASN n 
2 230  LYS n 
2 231  LEU n 
2 232  TYR n 
2 233  TYR n 
2 234  ASN n 
2 235  PHE n 
2 236  PRO n 
2 237  TRP n 
2 238  GLY n 
2 239  LYS n 
2 240  GLU n 
2 241  LEU n 
2 242  ILE n 
2 243  GLU n 
2 244  THR n 
2 245  LEU n 
2 246  TRP n 
2 247  ASN n 
2 248  LEU n 
2 249  GLY n 
2 250  ASP n 
2 251  HIS n 
2 252  GLU n 
2 253  LEU n 
2 254  LEU n 
2 255  HIS n 
2 256  MET n 
2 257  TYR n 
2 258  PRO n 
2 259  GLY n 
2 260  ASN n 
2 261  VAL n 
2 262  SER n 
2 263  LYS n 
2 264  LEU n 
2 265  HIS n 
2 266  GLY n 
2 267  ARG n 
2 268  ASP n 
2 269  GLY n 
2 270  ARG n 
2 271  LYS n 
2 272  ASN n 
2 273  VAL n 
2 274  VAL n 
2 275  PRO n 
2 276  CYS n 
2 277  VAL n 
2 278  LEU n 
2 279  SER n 
2 280  VAL n 
2 281  ASN n 
2 282  GLY n 
2 283  ASP n 
2 284  LEU n 
2 285  ASP n 
2 286  ARG n 
2 287  GLY n 
2 288  MET n 
2 289  LEU n 
2 290  ALA n 
2 291  TYR n 
2 292  LEU n 
2 293  TYR n 
2 294  ASP n 
2 295  SER n 
2 296  PHE n 
2 297  GLN n 
2 298  LEU n 
2 299  THR n 
2 300  GLU n 
2 301  ASN n 
2 302  SER n 
2 303  PHE n 
2 304  THR n 
2 305  ARG n 
2 306  LYS n 
2 307  LYS n 
2 308  ASN n 
2 309  LEU n 
2 310  HIS n 
2 311  ARG n 
2 312  LYS n 
2 313  VAL n 
2 314  LEU n 
2 315  LYS n 
2 316  LEU n 
2 317  HIS n 
2 318  PRO n 
2 319  CYS n 
2 320  LEU n 
2 321  ALA n 
2 322  PRO n 
2 323  ILE n 
2 324  LYS n 
2 325  VAL n 
2 326  ALA n 
2 327  LEU n 
2 328  ASP n 
2 329  VAL n 
2 330  GLY n 
2 331  ARG n 
2 332  GLY n 
2 333  PRO n 
2 334  THR n 
2 335  LEU n 
2 336  GLU n 
2 337  LEU n 
2 338  ARG n 
2 339  GLN n 
2 340  VAL n 
2 341  CYS n 
2 342  GLN n 
2 343  GLY n 
2 344  LEU n 
2 345  PHE n 
2 346  ASN n 
2 347  GLU n 
2 348  LEU n 
2 349  LEU n 
2 350  GLU n 
2 351  ASN n 
2 352  GLY n 
2 353  ILE n 
2 354  SER n 
2 355  VAL n 
2 356  TRP n 
2 357  PRO n 
2 358  GLY n 
2 359  TYR n 
2 360  LEU n 
2 361  GLU n 
2 362  THR n 
2 363  MET n 
2 364  GLN n 
2 365  SER n 
2 366  SER n 
2 367  LEU n 
2 368  GLU n 
2 369  GLN n 
2 370  LEU n 
2 371  TYR n 
2 372  SER n 
2 373  LYS n 
2 374  TYR n 
2 375  ASP n 
2 376  GLU n 
2 377  MET n 
2 378  SER n 
2 379  ILE n 
2 380  LEU n 
2 381  PHE n 
2 382  THR n 
2 383  VAL n 
2 384  LEU n 
2 385  VAL n 
2 386  THR n 
2 387  GLU n 
2 388  THR n 
2 389  THR n 
2 390  LEU n 
2 391  GLU n 
2 392  ASN n 
2 393  GLY n 
2 394  LEU n 
2 395  ILE n 
2 396  HIS n 
2 397  LEU n 
2 398  ARG n 
2 399  SER n 
2 400  ARG n 
2 401  ASP n 
2 402  THR n 
2 403  THR n 
2 404  MET n 
2 405  LYS n 
2 406  GLU n 
2 407  MET n 
2 408  MET n 
2 409  HIS n 
2 410  ILE n 
2 411  SER n 
2 412  LYS n 
2 413  LEU n 
2 414  LYS n 
2 415  ASP n 
2 416  PHE n 
2 417  LEU n 
2 418  ILE n 
2 419  LYS n 
2 420  TYR n 
2 421  ILE n 
2 422  SER n 
2 423  SER n 
2 424  ALA n 
2 425  LYS n 
2 426  ASN n 
2 427  VAL n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1 1 sample ? ? human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP DPOG1_HUMAN P54098 1 
;RHNPLDIQMLSRGLHEQIFGQGGEMPGEAAVRRSVEHLQKHGLWGQPAVPLPDVELRLPPLYGDNLDQHFRLLAQKQSLP
YLEAANLLLQAQLPPKPPAWAWAEGWTRYGPEGEAVPVAIPEERALVFDVEVCLAEGTCPTLAVAISPSAWYSWCSQRLV
EERYSWTSQLSPADLIPLEVPTGASSPTQRDWQEQLVVGHNVSFDRAHIREQYLIQGSRMRFLDTMSMHMAISGLSSFQR
SLWIAAKQGKHKVQPPTKQGQKSQRKARRGPAISSWDWLDISSVNSLAEVHRLYVGGPPLEKEPRELFVKGTMKDIRENF
QDLMQYCAQDVWATHEVFQQQLPLFLERCPHPVTLAGMLEMGVSYLPVNQNWERYLAEAQGTYEELQREMKKSLMDLAND
ACQLLSGERYKEDPWLWDLEWDLQEFKQKKAKKVKKEPATASKLPIEGAGAPGDPMDQEDLGPCSEEEEFQQDVMARACL
QKLKGTTELLPKRPQHLPGHPGWYRKLCPRLDDPAWTPGPSLLSLQMRVTPKLMALTWDGFPLHYSERHGWGYLVPGRRD
NLAKLPTGTTLESAGVVCPYRAIESLYRKHCLEQGKQQLMPQEAGLAEEFLLTDNSAIWQTVEELDYLEVEAEAKMENLR
AAVPGQPLALTARGGPKDTQPSYHHGNGPYNDVDIPGCWFFKLPHKDGNSCNVGSPFAKDFLPKMEDGTLQAGPGGASGP
RALEINKMISFWRNAHKRISSQMVVWLPRSALPRAVIRHPDYDEEGLYGAILPQVVTAGTITRRAVEPTWLTASNARPDR
VGSELKAMVQAPPGYTLVGADVDSQELWIAAVLGDAHFAGMHGCTAFGWMTLQGRKSRGTDLHSKTATTVGISREHAKIF
NYGRIYGAGQPFAERLLMQFNHRLTQQEAAEKAQQMYAATKGLRWYRLSDEGEWLVRELNLPVDRTEGGWISLQDLRKVQ
RETARKSQWKKWEVVAERAWKGGTESEMFNKLESIATSDIPRTPVLGCCISRALEPSAVQEEFMTSRVNWVVQSSAVDYL
HLMLVAMKWLFEEFAIDGRFCISIHDEVRYLVREEDRYRAALALQITNLLTRCMFAYKLGLNDLPQSVAFFSAVDIDRCL
RKEVTMDCKTPSNPTGMERRYGIPQGEALDIYQIIELTKGSLEKRSQPGP
;
70 ? 
2 UNP DPOG2_HUMAN Q9UHN1 2 
;APGSGEGSEALLEICQRRHFLSGSKQQLSRDSLLSGCHPGFGPLGVELRKNLAAEWWTSVVVFREQVFPVDALHHKPGPL
LPGDSAFRLVSAETLREILQDKELSKEQLVAFLENVLKTSGKLRENLLHGALEHYVNCLDLVNKRLPYGLAQIGVCFHPV
FDTKQIRNGVKSIGEKTEASLVWFTPPRTSNQWLDFWLRHRLQWWRKFAMSPSNFSSSDCQDEEGRKGNKLYYNFPWGKE
LIETLWNLGDHELLHMYPGNVSKLHGRDGRKNVVPCVLSVNGDLDRGMLAYLYDSFQLTENSFTRKKNLHRKVLKLHPCL
APIKVALDVGRGPTLELRQVCQGLFNELLENGISVWPGYLETMQSSLEQLYSKYDEMSILFTVLVTETTLENGLIHLRSR
DTTMKEMMHISKLKDFLIKYISSAKNV
;
59 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3IKM A 1 ? 1172 ? P54098 70 ? 1239 ? 70 1239 
2 2 3IKM B 1 ? 427  ? Q9UHN1 59 ? 485  ? 59 485  
3 2 3IKM C 1 ? 427  ? Q9UHN1 59 ? 485  ? 59 485  
4 1 3IKM D 1 ? 1172 ? P54098 70 ? 1239 ? 70 1239 
5 2 3IKM E 1 ? 427  ? Q9UHN1 59 ? 485  ? 59 485  
6 2 3IKM F 1 ? 427  ? Q9UHN1 59 ? 485  ? 59 485  
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3IKM ASN A 285 ? UNP P54098 ? ? 'SEE REMARK 999' 354 1 
1 3IKM SER A 286 ? UNP P54098 ? ? 'SEE REMARK 999' 355 2 
4 3IKM ASN D 285 ? UNP P54098 ? ? 'SEE REMARK 999' 354 3 
4 3IKM SER D 286 A UNP P54098 ? ? 'SEE REMARK 999' 354 4 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3IKM 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.72 
_exptl_crystal.density_percent_sol   54.80 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.temp            ? 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              ? 
_exptl_crystal_grow.pdbx_details    'VAPOR DIFFUSION' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2008-06-30 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.979 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 19-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   19-ID 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.979 
# 
_reflns.entry_id                     3IKM 
_reflns.observed_criterion_sigma_I   2.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             47.0 
_reflns.d_resolution_high            3.24 
_reflns.number_obs                   76584 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.0 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_refine.entry_id                                 3IKM 
_refine.ls_number_reflns_obs                     68650 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               41884.52 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             46.92 
_refine.ls_d_res_high                            3.24 
_refine.ls_percent_reflns_obs                    89.5 
_refine.ls_R_factor_obs                          0.284 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.284 
_refine.ls_R_factor_R_free                       0.303 
_refine.ls_R_factor_R_free_error                 0.007 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.8 
_refine.ls_number_reflns_R_free                  3275 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               83.9 
_refine.aniso_B[1][1]                            -2.33 
_refine.aniso_B[2][2]                            -2.33 
_refine.aniso_B[3][3]                            4.66 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.25 
_refine.solvent_model_param_bsol                 46.2435 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'BULK SOLVENT MODEL USED' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          SAD 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.entry_id                        3IKM 
_refine_analyze.Luzzati_coordinate_error_obs    0.86 
_refine_analyze.Luzzati_sigma_a_obs             0.74 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.85 
_refine_analyze.Luzzati_sigma_a_free            1.14 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
_refine_analyze.pdbx_Luzzati_d_res_high_obs     ? 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        29480 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               29480 
_refine_hist.d_res_high                       3.24 
_refine_hist.d_res_low                        46.92 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d           0.011 ? ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg        2.1   ? ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d 24.7  ? ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d 1.97  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_restr_ncs.pdbx_refine_id      'X-RAY DIFFRACTION' 
_refine_ls_restr_ncs.dom_id              1 
_refine_ls_restr_ncs.ncs_model_details   NONE 
_refine_ls_restr_ncs.rms_dev_position    ? 
_refine_ls_restr_ncs.weight_position     ? 
_refine_ls_restr_ncs.rms_dev_B_iso       ? 
_refine_ls_restr_ncs.weight_B_iso        ? 
_refine_ls_restr_ncs.pdbx_ordinal        1 
_refine_ls_restr_ncs.pdbx_type           . 
_refine_ls_restr_ncs.pdbx_auth_asym_id   . 
_refine_ls_restr_ncs.pdbx_ens_id         1 
_refine_ls_restr_ncs.pdbx_number         ? 
# 
_pdbx_xplor_file.serial_no        1 
_pdbx_xplor_file.param_file       protein_rep.param 
_pdbx_xplor_file.topol_file       protein.top 
_pdbx_xplor_file.pdbx_refine_id   'X-RAY DIFFRACTION' 
# 
_struct_ncs_dom.id            1 
_struct_ncs_dom.details       ? 
_struct_ncs_dom.pdbx_ens_id   1 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  3IKM 
_struct.title                     'Crystal structure of human mitochondrial DNA polymerase holoenzyme' 
_struct.pdbx_descriptor           'DNA polymerase subunit gamma-1 (E.C.2.7.7.7), DNA polymerase subunit gamma-2 (E.C.2.7.7.7)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3IKM 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            
;Human mitochondrial DNA polymerase, Disease mutation, DNA replication, DNA-binding, DNA-directed DNA polymerase, Magnesium, Mitochondrion, Neuropathy, Nucleotidyltransferase, Progressive external ophthalmoplegia, Transferase, Transit peptide
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 2 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   
'THE BIOLOGICAL UNIT (HOLOENZYME) CONTAINS ONE MONOMERIC CATALYTIC SUBUNIT AND ONE DIMERIC ACCESSORY SUBUNIT.' 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   GLY A 13   ? ILE A 18   ? GLY A 82   ILE A 87   1 ? 6  
HELX_P HELX_P2   2   GLY A 27   ? HIS A 37   ? GLY A 96   HIS A 106  1 ? 11 
HELX_P HELX_P3   3   ASN A 65   ? ALA A 91   ? ASN A 134  ALA A 160  1 ? 27 
HELX_P HELX_P4   4   TRP A 154  ? LEU A 159  ? TRP A 223  LEU A 228  1 ? 6  
HELX_P HELX_P5   5   LEU A 178  ? GLY A 183  ? LEU A 247  GLY A 252  1 ? 6  
HELX_P HELX_P6   6   ALA A 207  ? GLU A 211  ? ALA A 276  GLU A 280  5 ? 5  
HELX_P HELX_P7   7   MET A 226  ? SER A 233  ? MET A 295  SER A 302  1 ? 8  
HELX_P HELX_P8   8   SER A 236  ? GLY A 249  ? SER A 305  GLY A 318  1 ? 14 
HELX_P HELX_P9   9   SER A 286  ? ARG A 294  ? SER A 355  ARG A 363  1 ? 9  
HELX_P HELX_P10  10  ASP A 317  ? GLU A 349  ? ASP A 384  GLU A 416  1 ? 33 
HELX_P HELX_P11  11  PRO A 354  ? VAL A 365  ? PRO A 421  VAL A 432  1 ? 12 
HELX_P HELX_P12  12  GLN A 372  ? LEU A 407  ? GLN A 439  LEU A 474  1 ? 36 
HELX_P HELX_P13  13  ASP A 415  ? ASP A 424  ? ASP A 482  ASP A 491  1 ? 10 
HELX_P HELX_P14  14  GLN A 473  ? LEU A 492  ? GLN A 540  LEU A 559  1 ? 20 
HELX_P HELX_P15  15  PRO A 568  ? VAL A 578  ? PRO A 635  VAL A 645  1 ? 11 
HELX_P HELX_P16  16  VAL A 579  ? GLU A 605  ? VAL A 646  GLU A 672  1 ? 27 
HELX_P HELX_P17  17  GLN A 648  ? ARG A 655  ? GLN A 715  ARG A 722  1 ? 8  
HELX_P HELX_P18  18  ASP A 702  ? ASP A 709  ? ASP A 769  ASP A 776  1 ? 8  
HELX_P HELX_P19  19  ALA A 719  ? GLN A 744  ? ALA A 786  GLN A 811  1 ? 26 
HELX_P HELX_P20  20  THR A 791  ? ALA A 795  ? THR A 858  ALA A 862  5 ? 5  
HELX_P HELX_P21  21  LEU A 807  ? GLN A 812  ? LEU A 874  GLN A 879  1 ? 6  
HELX_P HELX_P22  22  SER A 826  ? PHE A 840  ? SER A 893  PHE A 907  1 ? 15 
HELX_P HELX_P23  23  GLY A 861  ? THR A 871  ? GLY A 928  THR A 938  1 ? 11 
HELX_P HELX_P24  24  ARG A 876  ? GLY A 889  ? ARG A 943  GLY A 956  1 ? 14 
HELX_P HELX_P25  25  GLN A 892  ? ASN A 903  ? GLN A 959  ASN A 970  1 ? 12 
HELX_P HELX_P26  26  LEU A 906  ? GLY A 924  ? LEU A 973  GLY A 991  1 ? 19 
HELX_P HELX_P27  27  GLU A 933  ? LEU A 943  ? GLU A 1000 LEU A 1010 1 ? 11 
HELX_P HELX_P28  28  ARG A 959  ? GLU A 964  ? ARG A 1026 GLU A 1031 1 ? 6  
HELX_P HELX_P29  29  SER A 969  ? TRP A 974  ? SER A 1036 TRP A 1041 1 ? 6  
HELX_P HELX_P30  30  GLU A 979  ? ASN A 992  ? GLU A 1046 ASN A 1059 1 ? 14 
HELX_P HELX_P31  31  PHE A 1025 ? GLU A 1055 ? PHE A 1092 GLU A 1122 1 ? 31 
HELX_P HELX_P32  32  ASP A 1078 ? GLY A 1102 ? ASP A 1145 GLY A 1169 1 ? 25 
HELX_P HELX_P33  33  PRO A 1107 ? PHE A 1112 ? PRO A 1174 PHE A 1179 1 ? 6  
HELX_P HELX_P34  34  GLU A 1125 ? ASP A 1129 ? GLU A 1192 ASP A 1196 5 ? 5  
HELX_P HELX_P35  35  ASP A 1152 ? LYS A 1161 ? ASP A 1219 LYS A 1228 1 ? 10 
HELX_P HELX_P36  36  GLU B 9    ? ARG B 17   ? GLU B 67   ARG B 75   1 ? 9  
HELX_P HELX_P37  37  GLY B 42   ? VAL B 60   ? GLY B 100  VAL B 118  1 ? 19 
HELX_P HELX_P38  38  LEU B 127  ? ASP B 140  ? LEU B 185  ASP B 198  1 ? 14 
HELX_P HELX_P39  39  LEU B 141  ? ASN B 143  ? LEU B 199  ASN B 201  5 ? 3  
HELX_P HELX_P40  40  PRO B 187  ? SER B 190  ? PRO B 245  SER B 248  5 ? 4  
HELX_P HELX_P41  41  ASN B 191  ? LYS B 207  ? ASN B 249  LYS B 265  1 ? 17 
HELX_P HELX_P42  42  ASN B 260  ? LEU B 264  ? ASN B 318  LEU B 322  5 ? 5  
HELX_P HELX_P43  43  ASP B 283  ? ASP B 285  ? ASP B 341  ASP B 343  5 ? 3  
HELX_P HELX_P44  44  ARG B 286  ? SER B 295  ? ARG B 344  SER B 353  1 ? 10 
HELX_P HELX_P45  45  LEU B 335  ? GLY B 352  ? LEU B 393  GLY B 410  1 ? 18 
HELX_P HELX_P46  46  LEU B 370  ? MET B 377  ? LEU B 428  MET B 435  1 ? 8  
HELX_P HELX_P47  47  LYS B 414  ? SER B 423  ? LYS B 472  SER B 481  1 ? 10 
HELX_P HELX_P48  48  ALA B 424  ? ASN B 426  ? ALA B 482  ASN B 484  5 ? 3  
HELX_P HELX_P49  49  ALA C 1    ? ARG C 17   ? ALA C 59   ARG C 75   1 ? 17 
HELX_P HELX_P50  50  ARG C 18   ? PHE C 20   ? ARG C 76   PHE C 78   5 ? 3  
HELX_P HELX_P51  51  SER C 29   ? GLY C 36   ? SER C 87   GLY C 94   1 ? 8  
HELX_P HELX_P52  52  GLY C 42   ? VAL C 62   ? GLY C 100  VAL C 120  1 ? 21 
HELX_P HELX_P53  53  ASN C 126  ? HIS C 134  ? ASN C 184  HIS C 192  1 ? 9  
HELX_P HELX_P54  54  HIS C 134  ? LEU C 141  ? HIS C 192  LEU C 199  1 ? 8  
HELX_P HELX_P55  55  VAL C 142  ? LYS C 144  ? VAL C 200  LYS C 202  5 ? 3  
HELX_P HELX_P56  56  ARG C 188  ? ALA C 209  ? ARG C 246  ALA C 267  1 ? 22 
HELX_P HELX_P57  57  GLU C 252  ? TYR C 257  ? GLU C 310  TYR C 315  1 ? 6  
HELX_P HELX_P58  58  ASP C 285  ? LEU C 298  ? ASP C 343  LEU C 356  1 ? 14 
HELX_P HELX_P59  59  PRO C 333  ? GLN C 339  ? PRO C 391  GLN C 397  1 ? 7  
HELX_P HELX_P60  60  VAL C 340  ? GLY C 352  ? VAL C 398  GLY C 410  1 ? 13 
HELX_P HELX_P61  61  PRO C 357  ? THR C 362  ? PRO C 415  THR C 420  1 ? 6  
HELX_P HELX_P62  62  SER C 366  ? GLU C 376  ? SER C 424  GLU C 434  1 ? 11 
HELX_P HELX_P63  63  HIS C 409  ? VAL C 427  ? HIS C 467  VAL C 485  1 ? 19 
HELX_P HELX_P64  64  ARG D 12   ? ILE D 18   ? ARG D 81   ILE D 87   1 ? 7  
HELX_P HELX_P65  65  GLY D 27   ? HIS D 41   ? GLY D 96   HIS D 110  1 ? 15 
HELX_P HELX_P66  66  ASN D 65   ? ALA D 91   ? ASN D 134  ALA D 160  1 ? 27 
HELX_P HELX_P67  67  TRP D 154  ? GLU D 162  ? TRP D 223  GLU D 231  1 ? 9  
HELX_P HELX_P68  68  LEU D 170  ? ASP D 174  ? LEU D 239  ASP D 243  5 ? 5  
HELX_P HELX_P69  69  ASP D 205  ? TYR D 213  ? ASP D 274  TYR D 282  1 ? 9  
HELX_P HELX_P70  70  ASP D 224  ? GLY D 234  ? ASP D 293  GLY D 303  1 ? 11 
HELX_P HELX_P71  71  SER D 236  ? GLN D 248  ? SER D 305  GLN D 317  1 ? 13 
HELX_P HELX_P72  72  ALA D 290  ? TYR D 296  ? ALA D 357  TYR D 363  1 ? 7  
HELX_P HELX_P73  73  GLU D 308  ? LYS D 312  ? GLU D 375  LYS D 379  5 ? 5  
HELX_P HELX_P74  74  MET D 315  ? GLN D 323  ? MET D 382  GLN D 390  1 ? 9  
HELX_P HELX_P75  75  ASP D 324  ? GLU D 349  ? ASP D 391  GLU D 416  1 ? 26 
HELX_P HELX_P76  76  PRO D 354  ? SER D 366  ? PRO D 421  SER D 433  1 ? 13 
HELX_P HELX_P77  77  ASN D 371  ? LEU D 407  ? ASN D 438  LEU D 474  1 ? 37 
HELX_P HELX_P78  78  ASP D 415  ? LEU D 425  ? ASP D 482  LEU D 492  1 ? 11 
HELX_P HELX_P79  79  GLN D 473  ? LEU D 492  ? GLN D 540  LEU D 559  1 ? 20 
HELX_P HELX_P80  80  LEU D 524  ? GLN D 528  ? LEU D 591  GLN D 595  5 ? 5  
HELX_P HELX_P81  81  VAL D 531  ? MET D 536  ? VAL D 598  MET D 603  1 ? 6  
HELX_P HELX_P82  82  THR D 569  ? GLU D 574  ? THR D 636  GLU D 641  1 ? 6  
HELX_P HELX_P83  83  TYR D 582  ? MET D 602  ? TYR D 649  MET D 669  1 ? 21 
HELX_P HELX_P84  84  GLN D 648  ? THR D 653  ? GLN D 715  THR D 720  1 ? 6  
HELX_P HELX_P85  85  ASP D 702  ? GLU D 708  ? ASP D 769  GLU D 775  1 ? 7  
HELX_P HELX_P86  86  PRO D 722  ? SER D 742  ? PRO D 789  SER D 809  1 ? 21 
HELX_P HELX_P87  87  PRO D 755  ? HIS D 761  ? PRO D 822  HIS D 828  1 ? 7  
HELX_P HELX_P88  88  ARG D 802  ? GLN D 812  ? ARG D 869  GLN D 879  1 ? 11 
HELX_P HELX_P89  89  VAL D 824  ? PHE D 840  ? VAL D 891  PHE D 907  1 ? 17 
HELX_P HELX_P90  90  GLY D 861  ? THR D 871  ? GLY D 928  THR D 938  1 ? 11 
HELX_P HELX_P91  91  ARG D 876  ? ILE D 887  ? ARG D 943  ILE D 954  1 ? 12 
HELX_P HELX_P92  92  GLN D 892  ? ASN D 903  ? GLN D 959  ASN D 970  1 ? 12 
HELX_P HELX_P93  93  LEU D 906  ? THR D 922  ? LEU D 973  THR D 989  1 ? 17 
HELX_P HELX_P94  94  GLU D 935  ? LEU D 943  ? GLU D 1002 LEU D 1010 1 ? 9  
HELX_P HELX_P95  95  VAL D 977  ? TRP D 982  ? VAL D 1044 TRP D 1049 1 ? 6  
HELX_P HELX_P96  96  TRP D 982  ? ASN D 992  ? TRP D 1049 ASN D 1059 1 ? 11 
HELX_P HELX_P97  97  MET D 1026 ? GLU D 1055 ? MET D 1093 GLU D 1122 1 ? 30 
HELX_P HELX_P98  98  ASP D 1078 ? LEU D 1101 ? ASP D 1145 LEU D 1168 1 ? 24 
HELX_P HELX_P99  99  SER D 1134 ? ARG D 1142 ? SER D 1201 ARG D 1209 1 ? 9  
HELX_P HELX_P100 100 ILE D 1153 ? THR D 1160 ? ILE D 1220 THR D 1227 1 ? 8  
HELX_P HELX_P101 101 ALA E 10   ? ARG E 17   ? ALA E 68   ARG E 75   1 ? 8  
HELX_P HELX_P102 102 GLY E 42   ? TRP E 57   ? GLY E 100  TRP E 115  1 ? 16 
HELX_P HELX_P103 103 ASN E 126  ? GLU E 133  ? ASN E 184  GLU E 191  1 ? 8  
HELX_P HELX_P104 104 HIS E 134  ? ASP E 140  ? HIS E 192  ASP E 198  1 ? 7  
HELX_P HELX_P105 105 THR E 189  ? ARG E 206  ? THR E 247  ARG E 264  1 ? 18 
HELX_P HELX_P106 106 LYS E 207  ? ALA E 209  ? LYS E 265  ALA E 267  5 ? 3  
HELX_P HELX_P107 107 SER E 211  ? SER E 213  ? SER E 269  SER E 271  5 ? 3  
HELX_P HELX_P108 108 ASN E 260  ? LEU E 264  ? ASN E 318  LEU E 322  5 ? 5  
HELX_P HELX_P109 109 ARG E 267  ? LYS E 271  ? ARG E 325  LYS E 329  5 ? 5  
HELX_P HELX_P110 110 ASP E 283  ? LEU E 292  ? ASP E 341  LEU E 350  1 ? 10 
HELX_P HELX_P111 111 GLN E 339  ? GLU E 350  ? GLN E 397  GLU E 408  1 ? 12 
HELX_P HELX_P112 112 GLU E 387  ? ASN E 392  ? GLU E 445  ASN E 450  1 ? 6  
HELX_P HELX_P113 113 LYS E 412  ? SER E 423  ? LYS E 470  SER E 481  1 ? 12 
HELX_P HELX_P114 114 ALA E 424  ? ASN E 426  ? ALA E 482  ASN E 484  5 ? 3  
HELX_P HELX_P115 115 ALA F 1    ? ARG F 17   ? ALA F 59   ARG F 75   1 ? 17 
HELX_P HELX_P116 116 ARG F 18   ? PHE F 20   ? ARG F 76   PHE F 78   5 ? 3  
HELX_P HELX_P117 117 SER F 29   ? GLY F 36   ? SER F 87   GLY F 94   1 ? 8  
HELX_P HELX_P118 118 GLY F 42   ? PHE F 63   ? GLY F 100  PHE F 121  1 ? 22 
HELX_P HELX_P119 119 ASN F 126  ? HIS F 134  ? ASN F 184  HIS F 192  1 ? 9  
HELX_P HELX_P120 120 HIS F 134  ? LEU F 141  ? HIS F 192  LEU F 199  1 ? 8  
HELX_P HELX_P121 121 VAL F 142  ? LYS F 144  ? VAL F 200  LYS F 202  5 ? 3  
HELX_P HELX_P122 122 THR F 189  ? ALA F 209  ? THR F 247  ALA F 267  1 ? 21 
HELX_P HELX_P123 123 SER F 211  ? PHE F 215  ? SER F 269  PHE F 273  5 ? 5  
HELX_P HELX_P124 124 HIS F 251  ? TYR F 257  ? HIS F 309  TYR F 315  1 ? 7  
HELX_P HELX_P125 125 ASP F 285  ? LEU F 298  ? ASP F 343  LEU F 356  1 ? 14 
HELX_P HELX_P126 126 PRO F 333  ? GLY F 352  ? PRO F 391  GLY F 410  1 ? 20 
HELX_P HELX_P127 127 PRO F 357  ? MET F 363  ? PRO F 415  MET F 421  1 ? 7  
HELX_P HELX_P128 128 SER F 366  ? GLU F 376  ? SER F 424  GLU F 434  1 ? 11 
HELX_P HELX_P129 129 HIS F 409  ? VAL F 427  ? HIS F 467  VAL F 485  1 ? 19 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  SER 186  A . ? SER 255  A PRO 187  A ? PRO 256  A 1 0.18   
2  LEU 567  A . ? LEU 634  A PRO 568  A ? PRO 635  A 1 0.08   
3  GLY 657  A . ? GLY 724  A PRO 658  A ? PRO 725  A 1 -0.47  
4  LEU 685  A . ? LEU 752  A PRO 686  A ? PRO 753  A 1 -0.80  
5  THR 1132 A . ? THR 1199 A PRO 1133 A ? PRO 1200 A 1 0.51   
6  ASN 1135 A . ? ASN 1202 A PRO 1136 A ? PRO 1203 A 1 -1.07  
7  LEU 146  B . ? LEU 204  B PRO 147  B ? PRO 205  B 1 -0.48  
8  GLY 332  B . ? GLY 390  B PRO 333  B ? PRO 391  B 1 0.07   
9  GLY 332  C . ? GLY 390  C PRO 333  C ? PRO 391  C 1 0.01   
10 SER 147  D . ? SER 216  D PRO 148  D ? PRO 217  D 1 26.43  
11 SER 186  D . ? SER 255  D PRO 187  D ? PRO 256  D 1 13.89  
12 PRO 301  D . ? PRO 368  D LEU 302  D ? LEU 369  D 1 -23.90 
13 LEU 499  D . ? LEU 566  D PRO 500  D ? PRO 567  D 1 10.48  
14 MET 602  D . ? MET 669  D PRO 603  D ? PRO 670  D 1 -1.14  
15 GLY 657  D . ? GLY 724  D PRO 658  D ? PRO 725  D 1 -0.71  
16 LEU 685  D . ? LEU 752  D PRO 686  D ? PRO 753  D 1 0.11   
17 LEU 754  D . ? LEU 821  D PRO 755  D ? PRO 822  D 1 8.13   
18 THR 1132 D . ? THR 1199 D PRO 1133 D ? PRO 1200 D 1 -0.54  
19 LEU 146  E . ? LEU 204  E PRO 147  E ? PRO 205  E 1 12.02  
20 HIS 317  E . ? HIS 375  E PRO 318  E ? PRO 376  E 1 -0.29  
21 GLY 332  F . ? GLY 390  F PRO 333  F ? PRO 391  F 1 0.01   
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 2 ? 
C ? 4 ? 
D ? 2 ? 
E ? 2 ? 
F ? 2 ? 
G ? 2 ? 
H ? 2 ? 
I ? 2 ? 
J ? 2 ? 
K ? 2 ? 
L ? 5 ? 
M ? 2 ? 
N ? 2 ? 
O ? 4 ? 
P ? 2 ? 
Q ? 2 ? 
R ? 2 ? 
S ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? anti-parallel 
G 1 2 ? anti-parallel 
H 1 2 ? anti-parallel 
I 1 2 ? parallel      
J 1 2 ? anti-parallel 
K 1 2 ? anti-parallel 
L 1 2 ? anti-parallel 
L 2 3 ? anti-parallel 
L 3 4 ? anti-parallel 
L 4 5 ? anti-parallel 
M 1 2 ? anti-parallel 
N 1 2 ? anti-parallel 
O 1 2 ? parallel      
O 2 3 ? anti-parallel 
O 3 4 ? anti-parallel 
P 1 2 ? anti-parallel 
Q 1 2 ? anti-parallel 
R 1 2 ? anti-parallel 
S 1 2 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLU A 1069 ? ARG A 1075 ? GLU A 1136 ARG A 1142 
A 2 TYR A 817  ? ASP A 823  ? TYR A 884  ASP A 890  
A 3 ASP A 1117 ? ASP A 1119 ? ASP A 1184 ASP A 1186 
B 1 CYS B 156  ? PHE B 157  ? CYS B 214  PHE B 215  
B 2 GLU B 175  ? LYS B 176  ? GLU B 233  LYS B 234  
C 1 PHE B 215  ? SER B 218  ? PHE B 273  SER B 276  
C 2 LYS B 230  ? TYR B 233  ? LYS B 288  TYR B 291  
C 3 GLU B 240  ? LEU B 245  ? GLU B 298  LEU B 303  
C 4 VAL B 280  ? ASN B 281  ? VAL B 338  ASN B 339  
D 1 GLY B 266  ? ARG B 267  ? GLY B 324  ARG B 325  
D 2 ASN B 272  ? VAL B 273  ? ASN B 330  VAL B 331  
E 1 LEU B 394  ? LEU B 397  ? LEU B 452  LEU B 455  
E 2 GLU B 406  ? HIS B 409  ? GLU B 464  HIS B 467  
F 1 ALA C 151  ? HIS C 158  ? ALA C 209  HIS C 216  
F 2 GLY C 174  ? LEU C 181  ? GLY C 232  LEU C 239  
G 1 SER C 217  ? SER C 218  ? SER C 275  SER C 276  
G 2 LYS C 230  ? LEU C 231  ? LYS C 288  LEU C 289  
H 1 TYR C 233  ? PHE C 235  ? TYR C 291  PHE C 293  
H 2 GLY C 238  ? GLU C 240  ? GLY C 296  GLU C 298  
I 1 VAL C 325  ? VAL C 329  ? VAL C 383  VAL C 387  
I 2 PHE C 381  ? VAL C 385  ? PHE C 439  VAL C 443  
J 1 GLU D 131  ? VAL D 132  ? GLU D 200  VAL D 201  
J 2 PRO D 140  ? THR D 141  ? PRO D 209  THR D 210  
K 1 TRP D 553  ? GLY D 554  ? TRP D 620  GLY D 621  
K 2 TRP D 681  ? PHE D 682  ? TRP D 748  PHE D 749  
L 1 GLY D 1060 ? ILE D 1066 ? GLY D 1127 ILE D 1133 
L 2 GLU D 1069 ? ARG D 1075 ? GLU D 1136 ARG D 1142 
L 3 TYR D 817  ? GLY D 821  ? TYR D 884  GLY D 888  
L 4 VAL D 1116 ? ASP D 1119 ? VAL D 1183 ASP D 1186 
L 5 GLU D 1149 ? LEU D 1151 ? GLU D 1216 LEU D 1218 
M 1 PHE E 215  ? CYS E 220  ? PHE E 273  CYS E 278  
M 2 GLY E 228  ? TYR E 233  ? GLY E 286  TYR E 291  
N 1 GLU E 243  ? GLY E 249  ? GLU E 301  GLY E 307  
N 2 VAL E 277  ? GLY E 282  ? VAL E 335  GLY E 340  
O 1 GLY E 330  ? ARG E 331  ? GLY E 388  ARG E 389  
O 2 THR E 382  ? THR E 386  ? THR E 440  THR E 444  
O 3 ILE E 395  ? ARG E 398  ? ILE E 453  ARG E 456  
O 4 LYS E 405  ? MET E 408  ? LYS E 463  MET E 466  
P 1 ALA F 151  ? HIS F 158  ? ALA F 209  HIS F 216  
P 2 GLY F 174  ? LEU F 181  ? GLY F 232  LEU F 239  
Q 1 SER F 217  ? SER F 218  ? SER F 275  SER F 276  
Q 2 LYS F 230  ? LEU F 231  ? LYS F 288  LEU F 289  
R 1 TYR F 233  ? PHE F 235  ? TYR F 291  PHE F 293  
R 2 GLY F 238  ? GLU F 240  ? GLY F 296  GLU F 298  
S 1 VAL F 325  ? VAL F 329  ? VAL F 383  VAL F 387  
S 2 PHE F 381  ? VAL F 385  ? PHE F 439  VAL F 443  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O TYR A 1072 ? O TYR A 1139 N VAL A 820  ? N VAL A 887  
A 2 3 N LEU A 819  ? N LEU A 886  O ASP A 1119 ? O ASP A 1186 
B 1 2 N CYS B 156  ? N CYS B 214  O LYS B 176  ? O LYS B 234  
C 1 2 N SER B 216  ? N SER B 274  O TYR B 232  ? O TYR B 290  
C 2 3 N LEU B 231  ? N LEU B 289  O GLU B 243  ? O GLU B 301  
C 3 4 N THR B 244  ? N THR B 302  O ASN B 281  ? O ASN B 339  
D 1 2 N GLY B 266  ? N GLY B 324  O VAL B 273  ? O VAL B 331  
E 1 2 N LEU B 397  ? N LEU B 455  O GLU B 406  ? O GLU B 464  
F 1 2 N HIS C 158  ? N HIS C 216  O GLY C 174  ? O GLY C 232  
G 1 2 N SER C 218  ? N SER C 276  O LYS C 230  ? O LYS C 288  
H 1 2 N PHE C 235  ? N PHE C 293  O GLY C 238  ? O GLY C 296  
I 1 2 N ASP C 328  ? N ASP C 386  O VAL C 385  ? O VAL C 443  
J 1 2 N GLU D 131  ? N GLU D 200  O THR D 141  ? O THR D 210  
K 1 2 N TRP D 553  ? N TRP D 620  O PHE D 682  ? O PHE D 749  
L 1 2 N ILE D 1066 ? N ILE D 1133 O GLU D 1069 ? O GLU D 1136 
L 2 3 O TYR D 1072 ? O TYR D 1139 N VAL D 820  ? N VAL D 887  
L 3 4 N LEU D 819  ? N LEU D 886  O ASP D 1119 ? O ASP D 1186 
L 4 5 N VAL D 1116 ? N VAL D 1183 O LEU D 1151 ? O LEU D 1218 
M 1 2 N CYS E 220  ? N CYS E 278  O GLY E 228  ? O GLY E 286  
N 1 2 N GLY E 249  ? N GLY E 307  O VAL E 277  ? O VAL E 335  
O 1 2 N ARG E 331  ? N ARG E 389  O VAL E 385  ? O VAL E 443  
O 2 3 N THR E 382  ? N THR E 440  O ARG E 398  ? O ARG E 456  
O 3 4 N LEU E 397  ? N LEU E 455  O GLU E 406  ? O GLU E 464  
P 1 2 N HIS F 158  ? N HIS F 216  O GLY F 174  ? O GLY F 232  
Q 1 2 N SER F 218  ? N SER F 276  O LYS F 230  ? O LYS F 288  
R 1 2 N PHE F 235  ? N PHE F 293  O GLY F 238  ? O GLY F 296  
S 1 2 N ASP F 328  ? N ASP F 386  O VAL F 385  ? O VAL F 443  
# 
_database_PDB_matrix.entry_id          3IKM 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3IKM 
_atom_sites.fract_transf_matrix[1][1]   0.007226 
_atom_sites.fract_transf_matrix[1][2]   0.004172 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008344 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.004419 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N   . ARG A 1 1    ? 299.314 -6.070  -3.019  1.00 84.99  ? 70   ARG A N   1 
ATOM 2     C CA  . ARG A 1 1    ? 300.271 -7.122  -2.587  1.00 85.06  ? 70   ARG A CA  1 
ATOM 3     C C   . ARG A 1 1    ? 300.099 -8.465  -3.257  1.00 85.10  ? 70   ARG A C   1 
ATOM 4     O O   . ARG A 1 1    ? 298.988 -8.951  -3.431  1.00 83.77  ? 70   ARG A O   1 
ATOM 5     C CB  . ARG A 1 1    ? 300.184 -7.380  -1.079  1.00 85.40  ? 70   ARG A CB  1 
ATOM 6     C CG  . ARG A 1 1    ? 301.306 -6.777  -0.263  1.00 85.79  ? 70   ARG A CG  1 
ATOM 7     C CD  . ARG A 1 1    ? 301.101 -5.289  -0.212  1.00 85.98  ? 70   ARG A CD  1 
ATOM 8     N NE  . ARG A 1 1    ? 302.282 -4.560  0.231   1.00 86.93  ? 70   ARG A NE  1 
ATOM 9     C CZ  . ARG A 1 1    ? 303.100 -3.894  -0.582  1.00 86.91  ? 70   ARG A CZ  1 
ATOM 10    N NH1 . ARG A 1 1    ? 302.868 -3.866  -1.889  1.00 87.72  ? 70   ARG A NH1 1 
ATOM 11    N NH2 . ARG A 1 1    ? 304.143 -3.238  -0.088  1.00 86.16  ? 70   ARG A NH2 1 
ATOM 12    N N   . HIS A 1 2    ? 301.236 -9.062  -3.593  1.00 86.28  ? 71   HIS A N   1 
ATOM 13    C CA  . HIS A 1 2    ? 301.332 -10.392 -4.184  1.00 88.32  ? 71   HIS A CA  1 
ATOM 14    C C   . HIS A 1 2    ? 300.315 -10.864 -5.212  1.00 88.81  ? 71   HIS A C   1 
ATOM 15    O O   . HIS A 1 2    ? 300.342 -10.491 -6.378  1.00 89.24  ? 71   HIS A O   1 
ATOM 16    C CB  . HIS A 1 2    ? 301.361 -11.415 -3.048  1.00 91.16  ? 71   HIS A CB  1 
ATOM 17    C CG  . HIS A 1 2    ? 302.437 -11.158 -2.054  1.00 93.90  ? 71   HIS A CG  1 
ATOM 18    N ND1 . HIS A 1 2    ? 303.699 -11.693 -2.181  1.00 95.02  ? 71   HIS A ND1 1 
ATOM 19    C CD2 . HIS A 1 2    ? 302.476 -10.339 -0.979  1.00 94.35  ? 71   HIS A CD2 1 
ATOM 20    C CE1 . HIS A 1 2    ? 304.473 -11.208 -1.227  1.00 94.41  ? 71   HIS A CE1 1 
ATOM 21    N NE2 . HIS A 1 2    ? 303.756 -10.383 -0.485  1.00 94.36  ? 71   HIS A NE2 1 
ATOM 22    N N   . ASN A 1 3    ? 299.447 -11.723 -4.704  1.00 89.25  ? 72   ASN A N   1 
ATOM 23    C CA  . ASN A 1 3    ? 298.381 -12.456 -5.367  1.00 90.06  ? 72   ASN A CA  1 
ATOM 24    C C   . ASN A 1 3    ? 298.862 -13.815 -4.877  1.00 91.72  ? 72   ASN A C   1 
ATOM 25    O O   . ASN A 1 3    ? 299.918 -14.285 -5.288  1.00 91.70  ? 72   ASN A O   1 
ATOM 26    C CB  . ASN A 1 3    ? 298.433 -12.444 -6.911  1.00 88.15  ? 72   ASN A CB  1 
ATOM 27    C CG  . ASN A 1 3    ? 298.050 -11.102 -7.522  1.00 86.01  ? 72   ASN A CG  1 
ATOM 28    O OD1 . ASN A 1 3    ? 297.192 -10.378 -7.013  1.00 85.59  ? 72   ASN A OD1 1 
ATOM 29    N ND2 . ASN A 1 3    ? 298.668 -10.786 -8.653  1.00 85.33  ? 72   ASN A ND2 1 
ATOM 30    N N   . PRO A 1 4    ? 298.150 -14.400 -3.907  1.00 93.53  ? 73   PRO A N   1 
ATOM 31    C CA  . PRO A 1 4    ? 298.415 -15.698 -3.286  1.00 94.55  ? 73   PRO A CA  1 
ATOM 32    C C   . PRO A 1 4    ? 297.142 -16.515 -3.373  1.00 95.22  ? 73   PRO A C   1 
ATOM 33    O O   . PRO A 1 4    ? 296.045 -15.960 -3.411  1.00 95.32  ? 73   PRO A O   1 
ATOM 34    C CB  . PRO A 1 4    ? 298.747 -15.313 -1.863  1.00 94.93  ? 73   PRO A CB  1 
ATOM 35    C CG  . PRO A 1 4    ? 297.697 -14.256 -1.597  1.00 93.65  ? 73   PRO A CG  1 
ATOM 36    C CD  . PRO A 1 4    ? 297.504 -13.508 -2.928  1.00 93.89  ? 73   PRO A CD  1 
ATOM 37    N N   . LEU A 1 5    ? 297.258 -17.832 -3.364  1.00 94.86  ? 74   LEU A N   1 
ATOM 38    C CA  . LEU A 1 5    ? 296.045 -18.587 -3.524  1.00 94.46  ? 74   LEU A CA  1 
ATOM 39    C C   . LEU A 1 5    ? 295.940 -20.004 -3.062  1.00 94.32  ? 74   LEU A C   1 
ATOM 40    O O   . LEU A 1 5    ? 295.934 -20.879 -3.919  1.00 95.14  ? 74   LEU A O   1 
ATOM 41    C CB  . LEU A 1 5    ? 295.664 -18.628 -5.007  1.00 94.63  ? 74   LEU A CB  1 
ATOM 42    C CG  . LEU A 1 5    ? 295.218 -17.456 -5.881  1.00 93.50  ? 74   LEU A CG  1 
ATOM 43    C CD1 . LEU A 1 5    ? 294.109 -16.753 -5.153  1.00 93.11  ? 74   LEU A CD1 1 
ATOM 44    C CD2 . LEU A 1 5    ? 296.356 -16.511 -6.211  1.00 93.23  ? 74   LEU A CD2 1 
ATOM 45    N N   . ASP A 1 6    ? 295.865 -20.337 -1.786  1.00 93.60  ? 75   ASP A N   1 
ATOM 46    C CA  . ASP A 1 6    ? 295.629 -21.754 -1.702  1.00 92.64  ? 75   ASP A CA  1 
ATOM 47    C C   . ASP A 1 6    ? 294.208 -21.766 -2.254  1.00 92.79  ? 75   ASP A C   1 
ATOM 48    O O   . ASP A 1 6    ? 293.628 -22.827 -2.483  1.00 93.68  ? 75   ASP A O   1 
ATOM 49    C CB  . ASP A 1 6    ? 295.657 -22.361 -0.316  1.00 91.91  ? 75   ASP A CB  1 
ATOM 50    C CG  . ASP A 1 6    ? 295.315 -23.850 -0.363  1.00 90.59  ? 75   ASP A CG  1 
ATOM 51    O OD1 . ASP A 1 6    ? 295.989 -24.611 -1.099  1.00 90.08  ? 75   ASP A OD1 1 
ATOM 52    O OD2 . ASP A 1 6    ? 294.353 -24.262 0.311   1.00 88.91  ? 75   ASP A OD2 1 
ATOM 53    N N   . ILE A 1 7    ? 293.658 -20.565 -2.478  1.00 92.24  ? 76   ILE A N   1 
ATOM 54    C CA  . ILE A 1 7    ? 292.319 -20.431 -3.059  1.00 92.31  ? 76   ILE A CA  1 
ATOM 55    C C   . ILE A 1 7    ? 291.900 -19.207 -3.847  1.00 92.23  ? 76   ILE A C   1 
ATOM 56    O O   . ILE A 1 7    ? 291.841 -19.223 -5.069  1.00 91.37  ? 76   ILE A O   1 
ATOM 57    C CB  . ILE A 1 7    ? 291.220 -20.541 -2.050  1.00 92.78  ? 76   ILE A CB  1 
ATOM 58    C CG1 . ILE A 1 7    ? 289.898 -20.565 -2.811  1.00 93.67  ? 76   ILE A CG1 1 
ATOM 59    C CG2 . ILE A 1 7    ? 291.270 -19.395 -1.009  1.00 93.05  ? 76   ILE A CG2 1 
ATOM 60    C CD1 . ILE A 1 7    ? 289.887 -21.587 -3.921  1.00 91.71  ? 76   ILE A CD1 1 
ATOM 61    N N   . GLN A 1 8    ? 291.511 -18.171 -3.120  1.00 92.85  ? 77   GLN A N   1 
ATOM 62    C CA  . GLN A 1 8    ? 291.042 -16.973 -3.746  1.00 92.77  ? 77   GLN A CA  1 
ATOM 63    C C   . GLN A 1 8    ? 291.831 -15.825 -3.197  1.00 92.29  ? 77   GLN A C   1 
ATOM 64    O O   . GLN A 1 8    ? 292.145 -15.760 -2.006  1.00 92.15  ? 77   GLN A O   1 
ATOM 65    C CB  . GLN A 1 8    ? 289.532 -16.802 -3.507  1.00 94.10  ? 77   GLN A CB  1 
ATOM 66    C CG  . GLN A 1 8    ? 288.660 -18.012 -4.002  1.00 95.17  ? 77   GLN A CG  1 
ATOM 67    C CD  . GLN A 1 8    ? 287.131 -17.737 -4.174  1.00 95.91  ? 77   GLN A CD  1 
ATOM 68    O OE1 . GLN A 1 8    ? 286.472 -17.180 -3.299  1.00 95.25  ? 77   GLN A OE1 1 
ATOM 69    N NE2 . GLN A 1 8    ? 286.578 -18.166 -5.309  1.00 96.26  ? 77   GLN A NE2 1 
ATOM 70    N N   . MET A 1 9    ? 292.194 -14.939 -4.106  1.00 91.90  ? 78   MET A N   1 
ATOM 71    C CA  . MET A 1 9    ? 292.967 -13.780 -3.754  1.00 91.85  ? 78   MET A CA  1 
ATOM 72    C C   . MET A 1 9    ? 292.520 -13.190 -2.464  1.00 91.80  ? 78   MET A C   1 
ATOM 73    O O   . MET A 1 9    ? 291.357 -13.235 -2.093  1.00 91.40  ? 78   MET A O   1 
ATOM 74    C CB  . MET A 1 9    ? 292.868 -12.696 -4.812  1.00 91.63  ? 78   MET A CB  1 
ATOM 75    C CG  . MET A 1 9    ? 293.161 -11.300 -4.260  1.00 91.47  ? 78   MET A CG  1 
ATOM 76    S SD  . MET A 1 9    ? 291.693 -10.266 -4.256  1.00 92.08  ? 78   MET A SD  1 
ATOM 77    C CE  . MET A 1 9    ? 291.185 -10.294 -2.583  1.00 90.44  ? 78   MET A CE  1 
ATOM 78    N N   . LEU A 1 10   ? 293.503 -12.605 -1.819  1.00 92.06  ? 79   LEU A N   1 
ATOM 79    C CA  . LEU A 1 10   ? 293.417 -11.926 -0.561  1.00 92.09  ? 79   LEU A CA  1 
ATOM 80    C C   . LEU A 1 10   ? 294.697 -11.200 -0.881  1.00 91.35  ? 79   LEU A C   1 
ATOM 81    O O   . LEU A 1 10   ? 295.502 -11.709 -1.649  1.00 92.02  ? 79   LEU A O   1 
ATOM 82    C CB  . LEU A 1 10   ? 293.536 -12.960 0.555   1.00 94.01  ? 79   LEU A CB  1 
ATOM 83    C CG  . LEU A 1 10   ? 292.313 -13.872 0.477   1.00 96.13  ? 79   LEU A CG  1 
ATOM 84    C CD1 . LEU A 1 10   ? 292.207 -15.000 1.512   1.00 97.31  ? 79   LEU A CD1 1 
ATOM 85    C CD2 . LEU A 1 10   ? 291.182 -12.879 0.602   1.00 97.95  ? 79   LEU A CD2 1 
ATOM 86    N N   . SER A 1 11   ? 294.927 -10.021 -0.361  1.00 89.92  ? 80   SER A N   1 
ATOM 87    C CA  . SER A 1 11   ? 296.133 -9.402  -0.826  1.00 87.95  ? 80   SER A CA  1 
ATOM 88    C C   . SER A 1 11   ? 296.970 -8.614  0.129   1.00 85.74  ? 80   SER A C   1 
ATOM 89    O O   . SER A 1 11   ? 298.051 -9.034  0.531   1.00 85.29  ? 80   SER A O   1 
ATOM 90    C CB  . SER A 1 11   ? 295.781 -8.480  -1.961  1.00 88.96  ? 80   SER A CB  1 
ATOM 91    O OG  . SER A 1 11   ? 295.061 -7.405  -1.411  1.00 89.10  ? 80   SER A OG  1 
ATOM 92    N N   . ARG A 1 12   ? 296.455 -7.449  0.486   1.00 83.57  ? 81   ARG A N   1 
ATOM 93    C CA  . ARG A 1 12   ? 297.200 -6.521  1.306   1.00 81.12  ? 81   ARG A CA  1 
ATOM 94    C C   . ARG A 1 12   ? 296.288 -5.634  2.111   1.00 79.66  ? 81   ARG A C   1 
ATOM 95    O O   . ARG A 1 12   ? 296.738 -4.688  2.739   1.00 78.34  ? 81   ARG A O   1 
ATOM 96    C CB  . ARG A 1 12   ? 297.986 -5.634  0.379   1.00 80.41  ? 81   ARG A CB  1 
ATOM 97    C CG  . ARG A 1 12   ? 297.078 -5.092  -0.699  1.00 80.04  ? 81   ARG A CG  1 
ATOM 98    C CD  . ARG A 1 12   ? 297.695 -3.984  -1.457  1.00 81.58  ? 81   ARG A CD  1 
ATOM 99    N NE  . ARG A 1 12   ? 297.800 -2.764  -0.672  1.00 82.91  ? 81   ARG A NE  1 
ATOM 100   C CZ  . ARG A 1 12   ? 296.795 -2.160  -0.041  1.00 83.77  ? 81   ARG A CZ  1 
ATOM 101   N NH1 . ARG A 1 12   ? 295.564 -2.651  -0.076  1.00 84.28  ? 81   ARG A NH1 1 
ATOM 102   N NH2 . ARG A 1 12   ? 297.029 -1.033  0.614   1.00 83.73  ? 81   ARG A NH2 1 
ATOM 103   N N   . GLY A 1 13   ? 294.995 -5.874  2.034   1.00 79.05  ? 82   GLY A N   1 
ATOM 104   C CA  . GLY A 1 13   ? 294.116 -5.056  2.824   1.00 77.59  ? 82   GLY A CA  1 
ATOM 105   C C   . GLY A 1 13   ? 294.259 -5.813  4.108   1.00 75.83  ? 82   GLY A C   1 
ATOM 106   O O   . GLY A 1 13   ? 294.341 -5.237  5.191   1.00 76.03  ? 82   GLY A O   1 
ATOM 107   N N   . LEU A 1 14   ? 294.340 -7.133  3.940   1.00 73.64  ? 83   LEU A N   1 
ATOM 108   C CA  . LEU A 1 14   ? 294.460 -8.076  5.040   1.00 73.41  ? 83   LEU A CA  1 
ATOM 109   C C   . LEU A 1 14   ? 295.600 -7.700  5.941   1.00 74.88  ? 83   LEU A C   1 
ATOM 110   O O   . LEU A 1 14   ? 295.389 -7.394  7.104   1.00 74.53  ? 83   LEU A O   1 
ATOM 111   C CB  . LEU A 1 14   ? 294.689 -9.494  4.526   1.00 72.05  ? 83   LEU A CB  1 
ATOM 112   C CG  . LEU A 1 14   ? 294.004 -9.721  3.200   1.00 73.65  ? 83   LEU A CG  1 
ATOM 113   C CD1 . LEU A 1 14   ? 295.080 -9.841  2.179   1.00 74.56  ? 83   LEU A CD1 1 
ATOM 114   C CD2 . LEU A 1 14   ? 293.119 -10.943 3.234   1.00 73.84  ? 83   LEU A CD2 1 
ATOM 115   N N   . HIS A 1 15   ? 296.813 -7.739  5.412   1.00 77.69  ? 84   HIS A N   1 
ATOM 116   C CA  . HIS A 1 15   ? 297.976 -7.403  6.207   1.00 80.26  ? 84   HIS A CA  1 
ATOM 117   C C   . HIS A 1 15   ? 297.614 -6.512  7.410   1.00 80.73  ? 84   HIS A C   1 
ATOM 118   O O   . HIS A 1 15   ? 298.111 -6.750  8.513   1.00 80.53  ? 84   HIS A O   1 
ATOM 119   C CB  . HIS A 1 15   ? 299.034 -6.741  5.317   1.00 83.19  ? 84   HIS A CB  1 
ATOM 120   C CG  . HIS A 1 15   ? 299.488 -7.603  4.175   1.00 86.83  ? 84   HIS A CG  1 
ATOM 121   N ND1 . HIS A 1 15   ? 299.432 -8.980  4.213   1.00 88.31  ? 84   HIS A ND1 1 
ATOM 122   C CD2 . HIS A 1 15   ? 300.034 -7.284  2.977   1.00 87.87  ? 84   HIS A CD2 1 
ATOM 123   C CE1 . HIS A 1 15   ? 299.921 -9.471  3.089   1.00 88.29  ? 84   HIS A CE1 1 
ATOM 124   N NE2 . HIS A 1 15   ? 300.294 -8.462  2.322   1.00 87.91  ? 84   HIS A NE2 1 
ATOM 125   N N   . GLU A 1 16   ? 296.725 -5.525  7.206   1.00 82.37  ? 85   GLU A N   1 
ATOM 126   C CA  . GLU A 1 16   ? 296.276 -4.593  8.274   1.00 84.70  ? 85   GLU A CA  1 
ATOM 127   C C   . GLU A 1 16   ? 295.387 -5.185  9.368   1.00 86.98  ? 85   GLU A C   1 
ATOM 128   O O   . GLU A 1 16   ? 295.522 -4.829  10.536  1.00 88.43  ? 85   GLU A O   1 
ATOM 129   C CB  . GLU A 1 16   ? 295.496 -3.417  7.704   1.00 82.92  ? 85   GLU A CB  1 
ATOM 130   C CG  . GLU A 1 16   ? 295.848 -3.020  6.320   1.00 81.98  ? 85   GLU A CG  1 
ATOM 131   C CD  . GLU A 1 16   ? 295.041 -1.840  5.913   1.00 82.23  ? 85   GLU A CD  1 
ATOM 132   O OE1 . GLU A 1 16   ? 295.298 -0.739  6.444   1.00 81.37  ? 85   GLU A OE1 1 
ATOM 133   O OE2 . GLU A 1 16   ? 294.136 -2.027  5.088   1.00 83.18  ? 85   GLU A OE2 1 
ATOM 134   N N   . GLN A 1 17   ? 294.444 -6.043  8.989   1.00 88.57  ? 86   GLN A N   1 
ATOM 135   C CA  . GLN A 1 17   ? 293.564 -6.661  9.970   1.00 89.53  ? 86   GLN A CA  1 
ATOM 136   C C   . GLN A 1 17   ? 293.307 -8.150  9.722   1.00 91.37  ? 86   GLN A C   1 
ATOM 137   O O   . GLN A 1 17   ? 292.527 -8.776  10.434  1.00 90.87  ? 86   GLN A O   1 
ATOM 138   C CB  . GLN A 1 17   ? 292.251 -5.894  10.026  1.00 87.33  ? 86   GLN A CB  1 
ATOM 139   C CG  . GLN A 1 17   ? 291.873 -5.500  11.438  1.00 84.67  ? 86   GLN A CG  1 
ATOM 140   C CD  . GLN A 1 17   ? 291.191 -4.142  11.508  1.00 83.62  ? 86   GLN A CD  1 
ATOM 141   O OE1 . GLN A 1 17   ? 290.945 -3.513  10.488  1.00 81.77  ? 86   GLN A OE1 1 
ATOM 142   N NE2 . GLN A 1 17   ? 290.886 -3.687  12.715  1.00 83.52  ? 86   GLN A NE2 1 
ATOM 143   N N   . ILE A 1 18   ? 294.002 -8.703  8.727   1.00 93.77  ? 87   ILE A N   1 
ATOM 144   C CA  . ILE A 1 18   ? 293.897 -10.110 8.321   1.00 96.21  ? 87   ILE A CA  1 
ATOM 145   C C   . ILE A 1 18   ? 295.122 -10.492 7.476   1.00 97.68  ? 87   ILE A C   1 
ATOM 146   O O   . ILE A 1 18   ? 296.035 -9.696  7.282   1.00 97.05  ? 87   ILE A O   1 
ATOM 147   C CB  . ILE A 1 18   ? 292.638 -10.332 7.451   1.00 97.48  ? 87   ILE A CB  1 
ATOM 148   C CG1 . ILE A 1 18   ? 291.385 -10.101 8.285   1.00 98.62  ? 87   ILE A CG1 1 
ATOM 149   C CG2 . ILE A 1 18   ? 292.642 -11.717 6.851   1.00 97.47  ? 87   ILE A CG2 1 
ATOM 150   C CD1 . ILE A 1 18   ? 290.177 -9.803  7.455   1.00 91.71  ? 87   ILE A CD1 1 
ATOM 151   N N   . PHE A 1 19   ? 295.149 -11.722 6.987   1.00 100.20 ? 88   PHE A N   1 
ATOM 152   C CA  . PHE A 1 19   ? 296.239 -12.164 6.145   1.00 102.14 ? 88   PHE A CA  1 
ATOM 153   C C   . PHE A 1 19   ? 295.563 -12.624 4.875   1.00 103.89 ? 88   PHE A C   1 
ATOM 154   O O   . PHE A 1 19   ? 294.497 -13.228 4.906   1.00 103.54 ? 88   PHE A O   1 
ATOM 155   C CB  . PHE A 1 19   ? 297.008 -13.334 6.779   1.00 100.97 ? 88   PHE A CB  1 
ATOM 156   C CG  . PHE A 1 19   ? 297.173 -13.224 8.276   1.00 99.51  ? 88   PHE A CG  1 
ATOM 157   C CD1 . PHE A 1 19   ? 296.508 -14.110 9.123   1.00 99.06  ? 88   PHE A CD1 1 
ATOM 158   C CD2 . PHE A 1 19   ? 297.958 -12.217 8.840   1.00 98.84  ? 88   PHE A CD2 1 
ATOM 159   C CE1 . PHE A 1 19   ? 296.615 -14.000 10.498  1.00 98.61  ? 88   PHE A CE1 1 
ATOM 160   C CE2 . PHE A 1 19   ? 298.073 -12.097 10.222  1.00 98.39  ? 88   PHE A CE2 1 
ATOM 161   C CZ  . PHE A 1 19   ? 297.396 -12.992 11.050  1.00 98.16  ? 88   PHE A CZ  1 
ATOM 162   N N   . GLY A 1 20   ? 296.175 -12.313 3.750   1.00 106.08 ? 89   GLY A N   1 
ATOM 163   C CA  . GLY A 1 20   ? 295.603 -12.732 2.493   1.00 109.18 ? 89   GLY A CA  1 
ATOM 164   C C   . GLY A 1 20   ? 295.546 -14.240 2.293   1.00 111.52 ? 89   GLY A C   1 
ATOM 165   O O   . GLY A 1 20   ? 294.478 -14.820 2.177   1.00 111.58 ? 89   GLY A O   1 
ATOM 166   N N   . GLN A 1 21   ? 296.698 -14.891 2.242   1.00 113.59 ? 90   GLN A N   1 
ATOM 167   C CA  . GLN A 1 21   ? 296.722 -16.330 2.031   1.00 116.07 ? 90   GLN A CA  1 
ATOM 168   C C   . GLN A 1 21   ? 296.858 -17.043 3.366   1.00 117.77 ? 90   GLN A C   1 
ATOM 169   O O   . GLN A 1 21   ? 297.151 -18.239 3.396   1.00 118.92 ? 90   GLN A O   1 
ATOM 170   C CB  . GLN A 1 21   ? 297.912 -16.706 1.152   1.00 115.50 ? 90   GLN A CB  1 
ATOM 171   C CG  . GLN A 1 21   ? 299.225 -16.798 1.921   1.00 114.98 ? 90   GLN A CG  1 
ATOM 172   C CD  . GLN A 1 21   ? 300.325 -15.963 1.317   1.00 114.71 ? 90   GLN A CD  1 
ATOM 173   O OE1 . GLN A 1 21   ? 300.701 -16.162 0.163   1.00 114.20 ? 90   GLN A OE1 1 
ATOM 174   N NE2 . GLN A 1 21   ? 300.855 -15.022 2.096   1.00 115.50 ? 90   GLN A NE2 1 
ATOM 175   N N   . GLY A 1 22   ? 296.622 -16.311 4.457   1.00 118.57 ? 91   GLY A N   1 
ATOM 176   C CA  . GLY A 1 22   ? 296.778 -16.861 5.799   1.00 117.82 ? 91   GLY A CA  1 
ATOM 177   C C   . GLY A 1 22   ? 295.630 -17.472 6.585   1.00 117.01 ? 91   GLY A C   1 
ATOM 178   O O   . GLY A 1 22   ? 294.905 -16.797 7.312   1.00 116.12 ? 91   GLY A O   1 
ATOM 179   N N   . GLY A 1 23   ? 295.497 -18.780 6.439   1.00 116.75 ? 92   GLY A N   1 
ATOM 180   C CA  . GLY A 1 23   ? 294.500 -19.558 7.140   1.00 116.19 ? 92   GLY A CA  1 
ATOM 181   C C   . GLY A 1 23   ? 295.354 -20.786 7.339   1.00 116.06 ? 92   GLY A C   1 
ATOM 182   O O   . GLY A 1 23   ? 296.022 -21.212 6.402   1.00 115.98 ? 92   GLY A O   1 
ATOM 183   N N   . GLU A 1 24   ? 295.397 -21.347 8.534   1.00 115.64 ? 93   GLU A N   1 
ATOM 184   C CA  . GLU A 1 24   ? 296.240 -22.511 8.709   1.00 114.82 ? 93   GLU A CA  1 
ATOM 185   C C   . GLU A 1 24   ? 295.568 -23.763 8.214   1.00 112.79 ? 93   GLU A C   1 
ATOM 186   O O   . GLU A 1 24   ? 295.110 -24.580 9.006   1.00 111.33 ? 93   GLU A O   1 
ATOM 187   C CB  . GLU A 1 24   ? 296.611 -22.688 10.166  1.00 117.35 ? 93   GLU A CB  1 
ATOM 188   C CG  . GLU A 1 24   ? 295.723 -21.929 11.099  1.00 121.11 ? 93   GLU A CG  1 
ATOM 189   C CD  . GLU A 1 24   ? 295.640 -22.583 12.454  1.00 123.30 ? 93   GLU A CD  1 
ATOM 190   O OE1 . GLU A 1 24   ? 296.694 -22.945 13.009  1.00 124.16 ? 93   GLU A OE1 1 
ATOM 191   O OE2 . GLU A 1 24   ? 294.517 -22.735 12.968  1.00 124.46 ? 93   GLU A OE2 1 
ATOM 192   N N   . MET A 1 25   ? 295.492 -23.915 6.898   1.00 111.59 ? 94   MET A N   1 
ATOM 193   C CA  . MET A 1 25   ? 294.884 -25.116 6.357   1.00 110.80 ? 94   MET A CA  1 
ATOM 194   C C   . MET A 1 25   ? 295.926 -26.205 6.561   1.00 109.39 ? 94   MET A C   1 
ATOM 195   O O   . MET A 1 25   ? 297.058 -26.114 6.070   1.00 110.08 ? 94   MET A O   1 
ATOM 196   C CB  . MET A 1 25   ? 294.547 -24.979 4.864   1.00 112.03 ? 94   MET A CB  1 
ATOM 197   C CG  . MET A 1 25   ? 293.575 -26.062 4.352   1.00 113.35 ? 94   MET A CG  1 
ATOM 198   S SD  . MET A 1 25   ? 291.826 -25.565 4.320   1.00 114.99 ? 94   MET A SD  1 
ATOM 199   C CE  . MET A 1 25   ? 291.639 -24.754 5.935   1.00 115.85 ? 94   MET A CE  1 
ATOM 200   N N   . PRO A 1 26   ? 295.558 -27.234 7.328   1.00 107.10 ? 95   PRO A N   1 
ATOM 201   C CA  . PRO A 1 26   ? 296.380 -28.397 7.672   1.00 104.50 ? 95   PRO A CA  1 
ATOM 202   C C   . PRO A 1 26   ? 296.695 -29.319 6.489   1.00 102.06 ? 95   PRO A C   1 
ATOM 203   O O   . PRO A 1 26   ? 295.910 -29.440 5.550   1.00 101.30 ? 95   PRO A O   1 
ATOM 204   C CB  . PRO A 1 26   ? 295.548 -29.092 8.752   1.00 104.95 ? 95   PRO A CB  1 
ATOM 205   C CG  . PRO A 1 26   ? 294.773 -27.950 9.368   1.00 106.69 ? 95   PRO A CG  1 
ATOM 206   C CD  . PRO A 1 26   ? 294.336 -27.199 8.149   1.00 107.17 ? 95   PRO A CD  1 
ATOM 207   N N   . GLY A 1 27   ? 297.850 -29.973 6.576   1.00 99.85  ? 96   GLY A N   1 
ATOM 208   C CA  . GLY A 1 27   ? 298.340 -30.882 5.550   1.00 98.38  ? 96   GLY A CA  1 
ATOM 209   C C   . GLY A 1 27   ? 297.421 -31.737 4.692   1.00 96.99  ? 96   GLY A C   1 
ATOM 210   O O   . GLY A 1 27   ? 296.311 -31.349 4.334   1.00 96.92  ? 96   GLY A O   1 
ATOM 211   N N   . GLU A 1 28   ? 297.913 -32.929 4.364   1.00 95.23  ? 97   GLU A N   1 
ATOM 212   C CA  . GLU A 1 28   ? 297.198 -33.870 3.511   1.00 92.31  ? 97   GLU A CA  1 
ATOM 213   C C   . GLU A 1 28   ? 295.731 -34.119 3.876   1.00 89.40  ? 97   GLU A C   1 
ATOM 214   O O   . GLU A 1 28   ? 294.855 -33.692 3.141   1.00 87.41  ? 97   GLU A O   1 
ATOM 215   C CB  . GLU A 1 28   ? 297.980 -35.203 3.417   1.00 93.82  ? 97   GLU A CB  1 
ATOM 216   C CG  . GLU A 1 28   ? 299.491 -35.090 3.760   1.00 96.18  ? 97   GLU A CG  1 
ATOM 217   C CD  . GLU A 1 28   ? 300.420 -35.927 2.857   1.00 97.94  ? 97   GLU A CD  1 
ATOM 218   O OE1 . GLU A 1 28   ? 300.688 -35.501 1.710   1.00 98.72  ? 97   GLU A OE1 1 
ATOM 219   O OE2 . GLU A 1 28   ? 300.886 -37.008 3.295   1.00 98.55  ? 97   GLU A OE2 1 
ATOM 220   N N   . ALA A 1 29   ? 295.445 -34.777 4.994   1.00 86.46  ? 98   ALA A N   1 
ATOM 221   C CA  . ALA A 1 29   ? 294.048 -35.046 5.342   1.00 83.74  ? 98   ALA A CA  1 
ATOM 222   C C   . ALA A 1 29   ? 293.149 -33.874 5.018   1.00 82.22  ? 98   ALA A C   1 
ATOM 223   O O   . ALA A 1 29   ? 292.380 -33.936 4.067   1.00 82.48  ? 98   ALA A O   1 
ATOM 224   C CB  . ALA A 1 29   ? 293.895 -35.400 6.816   1.00 83.37  ? 98   ALA A CB  1 
ATOM 225   N N   . ALA A 1 30   ? 293.262 -32.804 5.802   1.00 80.35  ? 99   ALA A N   1 
ATOM 226   C CA  . ALA A 1 30   ? 292.440 -31.612 5.619   1.00 78.88  ? 99   ALA A CA  1 
ATOM 227   C C   . ALA A 1 30   ? 292.459 -31.060 4.202   1.00 78.48  ? 99   ALA A C   1 
ATOM 228   O O   . ALA A 1 30   ? 291.415 -30.942 3.579   1.00 78.13  ? 99   ALA A O   1 
ATOM 229   C CB  . ALA A 1 30   ? 292.859 -30.542 6.591   1.00 78.04  ? 99   ALA A CB  1 
ATOM 230   N N   . VAL A 1 31   ? 293.628 -30.710 3.683   1.00 77.62  ? 100  VAL A N   1 
ATOM 231   C CA  . VAL A 1 31   ? 293.672 -30.183 2.322   1.00 76.62  ? 100  VAL A CA  1 
ATOM 232   C C   . VAL A 1 31   ? 293.157 -31.218 1.329   1.00 74.43  ? 100  VAL A C   1 
ATOM 233   O O   . VAL A 1 31   ? 292.539 -30.864 0.329   1.00 74.21  ? 100  VAL A O   1 
ATOM 234   C CB  . VAL A 1 31   ? 295.099 -29.807 1.863   1.00 77.91  ? 100  VAL A CB  1 
ATOM 235   C CG1 . VAL A 1 31   ? 295.029 -29.046 0.553   1.00 78.19  ? 100  VAL A CG1 1 
ATOM 236   C CG2 . VAL A 1 31   ? 295.792 -28.980 2.905   1.00 77.06  ? 100  VAL A CG2 1 
ATOM 237   N N   . ARG A 1 32   ? 293.418 -32.494 1.609   1.00 71.57  ? 101  ARG A N   1 
ATOM 238   C CA  . ARG A 1 32   ? 293.010 -33.587 0.721   1.00 69.15  ? 101  ARG A CA  1 
ATOM 239   C C   . ARG A 1 32   ? 291.533 -33.991 0.766   1.00 67.59  ? 101  ARG A C   1 
ATOM 240   O O   . ARG A 1 32   ? 290.929 -34.180 -0.289  1.00 66.92  ? 101  ARG A O   1 
ATOM 241   C CB  . ARG A 1 32   ? 293.873 -34.845 0.966   1.00 70.59  ? 101  ARG A CB  1 
ATOM 242   C CG  . ARG A 1 32   ? 294.777 -35.300 -0.210  1.00 70.55  ? 101  ARG A CG  1 
ATOM 243   C CD  . ARG A 1 32   ? 294.811 -36.850 -0.345  1.00 71.94  ? 101  ARG A CD  1 
ATOM 244   N NE  . ARG A 1 32   ? 296.153 -37.456 -0.326  1.00 72.17  ? 101  ARG A NE  1 
ATOM 245   C CZ  . ARG A 1 32   ? 296.731 -37.996 0.748   1.00 72.37  ? 101  ARG A CZ  1 
ATOM 246   N NH1 . ARG A 1 32   ? 296.100 -38.015 1.917   1.00 73.16  ? 101  ARG A NH1 1 
ATOM 247   N NH2 . ARG A 1 32   ? 297.940 -38.530 0.648   1.00 72.34  ? 101  ARG A NH2 1 
ATOM 248   N N   . ARG A 1 33   ? 290.949 -34.141 1.956   1.00 67.07  ? 102  ARG A N   1 
ATOM 249   C CA  . ARG A 1 33   ? 289.546 -34.551 2.025   1.00 67.90  ? 102  ARG A CA  1 
ATOM 250   C C   . ARG A 1 33   ? 288.721 -33.689 1.104   1.00 68.24  ? 102  ARG A C   1 
ATOM 251   O O   . ARG A 1 33   ? 287.973 -34.190 0.254   1.00 68.04  ? 102  ARG A O   1 
ATOM 252   C CB  . ARG A 1 33   ? 288.976 -34.443 3.436   1.00 68.49  ? 102  ARG A CB  1 
ATOM 253   C CG  . ARG A 1 33   ? 289.839 -33.721 4.383   1.00 70.47  ? 102  ARG A CG  1 
ATOM 254   C CD  . ARG A 1 33   ? 290.087 -34.600 5.557   1.00 71.22  ? 102  ARG A CD  1 
ATOM 255   N NE  . ARG A 1 33   ? 288.976 -34.533 6.493   1.00 73.45  ? 102  ARG A NE  1 
ATOM 256   C CZ  . ARG A 1 33   ? 288.626 -35.521 7.310   1.00 74.50  ? 102  ARG A CZ  1 
ATOM 257   N NH1 . ARG A 1 33   ? 289.300 -36.670 7.296   1.00 74.75  ? 102  ARG A NH1 1 
ATOM 258   N NH2 . ARG A 1 33   ? 287.623 -35.347 8.168   1.00 74.50  ? 102  ARG A NH2 1 
ATOM 259   N N   . SER A 1 34   ? 288.870 -32.383 1.275   1.00 69.33  ? 103  SER A N   1 
ATOM 260   C CA  . SER A 1 34   ? 288.145 -31.426 0.459   1.00 70.05  ? 103  SER A CA  1 
ATOM 261   C C   . SER A 1 34   ? 288.392 -31.730 -1.031  1.00 69.96  ? 103  SER A C   1 
ATOM 262   O O   . SER A 1 34   ? 287.451 -31.810 -1.826  1.00 70.05  ? 103  SER A O   1 
ATOM 263   C CB  . SER A 1 34   ? 288.592 -29.994 0.816   1.00 70.85  ? 103  SER A CB  1 
ATOM 264   O OG  . SER A 1 34   ? 288.389 -29.698 2.192   1.00 69.37  ? 103  SER A OG  1 
ATOM 265   N N   . VAL A 1 35   ? 289.656 -31.926 -1.392  1.00 69.70  ? 104  VAL A N   1 
ATOM 266   C CA  . VAL A 1 35   ? 290.032 -32.214 -2.772  1.00 69.24  ? 104  VAL A CA  1 
ATOM 267   C C   . VAL A 1 35   ? 289.559 -33.566 -3.303  1.00 69.63  ? 104  VAL A C   1 
ATOM 268   O O   . VAL A 1 35   ? 289.141 -33.671 -4.461  1.00 69.47  ? 104  VAL A O   1 
ATOM 269   C CB  . VAL A 1 35   ? 291.553 -32.098 -2.944  1.00 68.76  ? 104  VAL A CB  1 
ATOM 270   C CG1 . VAL A 1 35   ? 292.066 -33.122 -3.936  1.00 69.22  ? 104  VAL A CG1 1 
ATOM 271   C CG2 . VAL A 1 35   ? 291.885 -30.704 -3.410  1.00 68.20  ? 104  VAL A CG2 1 
ATOM 272   N N   . GLU A 1 36   ? 289.633 -34.601 -2.471  1.00 71.36  ? 105  GLU A N   1 
ATOM 273   C CA  . GLU A 1 36   ? 289.187 -35.915 -2.902  1.00 74.07  ? 105  GLU A CA  1 
ATOM 274   C C   . GLU A 1 36   ? 287.798 -35.725 -3.502  1.00 76.01  ? 105  GLU A C   1 
ATOM 275   O O   . GLU A 1 36   ? 287.468 -36.294 -4.547  1.00 76.55  ? 105  GLU A O   1 
ATOM 276   C CB  . GLU A 1 36   ? 289.142 -36.885 -1.715  1.00 74.18  ? 105  GLU A CB  1 
ATOM 277   C CG  . GLU A 1 36   ? 290.516 -37.193 -1.113  1.00 75.54  ? 105  GLU A CG  1 
ATOM 278   C CD  . GLU A 1 36   ? 290.507 -38.395 -0.172  1.00 76.58  ? 105  GLU A CD  1 
ATOM 279   O OE1 . GLU A 1 36   ? 290.066 -39.482 -0.608  1.00 77.68  ? 105  GLU A OE1 1 
ATOM 280   O OE2 . GLU A 1 36   ? 290.950 -38.261 0.994   1.00 76.89  ? 105  GLU A OE2 1 
ATOM 281   N N   . HIS A 1 37   ? 286.998 -34.889 -2.851  1.00 77.98  ? 106  HIS A N   1 
ATOM 282   C CA  . HIS A 1 37   ? 285.660 -34.619 -3.340  1.00 80.22  ? 106  HIS A CA  1 
ATOM 283   C C   . HIS A 1 37   ? 285.666 -33.896 -4.662  1.00 81.67  ? 106  HIS A C   1 
ATOM 284   O O   . HIS A 1 37   ? 286.713 -33.593 -5.217  1.00 82.76  ? 106  HIS A O   1 
ATOM 285   C CB  . HIS A 1 37   ? 284.844 -33.833 -2.315  1.00 80.32  ? 106  HIS A CB  1 
ATOM 286   C CG  . HIS A 1 37   ? 284.055 -34.709 -1.397  1.00 80.20  ? 106  HIS A CG  1 
ATOM 287   N ND1 . HIS A 1 37   ? 282.765 -35.116 -1.675  1.00 80.12  ? 106  HIS A ND1 1 
ATOM 288   C CD2 . HIS A 1 37   ? 284.408 -35.340 -0.253  1.00 80.86  ? 106  HIS A CD2 1 
ATOM 289   C CE1 . HIS A 1 37   ? 282.361 -35.961 -0.744  1.00 80.06  ? 106  HIS A CE1 1 
ATOM 290   N NE2 . HIS A 1 37   ? 283.340 -36.115 0.130   1.00 80.22  ? 106  HIS A NE2 1 
ATOM 291   N N   . LEU A 1 38   ? 284.467 -33.621 -5.148  1.00 82.29  ? 107  LEU A N   1 
ATOM 292   C CA  . LEU A 1 38   ? 284.256 -32.977 -6.426  1.00 83.42  ? 107  LEU A CA  1 
ATOM 293   C C   . LEU A 1 38   ? 284.664 -33.908 -7.553  1.00 83.81  ? 107  LEU A C   1 
ATOM 294   O O   . LEU A 1 38   ? 284.338 -33.642 -8.711  1.00 83.93  ? 107  LEU A O   1 
ATOM 295   C CB  . LEU A 1 38   ? 285.016 -31.672 -6.539  1.00 84.24  ? 107  LEU A CB  1 
ATOM 296   C CG  . LEU A 1 38   ? 284.879 -30.646 -5.422  1.00 86.44  ? 107  LEU A CG  1 
ATOM 297   C CD1 . LEU A 1 38   ? 283.543 -30.796 -4.719  1.00 86.88  ? 107  LEU A CD1 1 
ATOM 298   C CD2 . LEU A 1 38   ? 286.010 -30.837 -4.448  1.00 88.01  ? 107  LEU A CD2 1 
ATOM 299   N N   . GLN A 1 39   ? 285.411 -34.973 -7.246  1.00 83.62  ? 108  GLN A N   1 
ATOM 300   C CA  . GLN A 1 39   ? 285.720 -35.928 -8.304  1.00 82.89  ? 108  GLN A CA  1 
ATOM 301   C C   . GLN A 1 39   ? 284.331 -36.542 -8.350  1.00 82.32  ? 108  GLN A C   1 
ATOM 302   O O   . GLN A 1 39   ? 283.817 -36.901 -9.405  1.00 82.44  ? 108  GLN A O   1 
ATOM 303   C CB  . GLN A 1 39   ? 286.759 -36.988 -7.898  1.00 82.86  ? 108  GLN A CB  1 
ATOM 304   C CG  . GLN A 1 39   ? 287.345 -37.707 -9.127  1.00 82.05  ? 108  GLN A CG  1 
ATOM 305   C CD  . GLN A 1 39   ? 288.447 -38.689 -8.804  1.00 81.16  ? 108  GLN A CD  1 
ATOM 306   O OE1 . GLN A 1 39   ? 289.060 -38.625 -7.749  1.00 79.94  ? 108  GLN A OE1 1 
ATOM 307   N NE2 . GLN A 1 39   ? 288.717 -39.594 -9.728  1.00 79.02  ? 108  GLN A NE2 1 
ATOM 308   N N   . LYS A 1 40   ? 283.713 -36.604 -7.175  1.00 81.94  ? 109  LYS A N   1 
ATOM 309   C CA  . LYS A 1 40   ? 282.360 -37.116 -7.036  1.00 81.71  ? 109  LYS A CA  1 
ATOM 310   C C   . LYS A 1 40   ? 281.324 -36.010 -7.337  1.00 81.44  ? 109  LYS A C   1 
ATOM 311   O O   . LYS A 1 40   ? 280.284 -36.277 -7.956  1.00 82.53  ? 109  LYS A O   1 
ATOM 312   C CB  . LYS A 1 40   ? 282.137 -37.640 -5.618  1.00 81.73  ? 109  LYS A CB  1 
ATOM 313   C CG  . LYS A 1 40   ? 283.330 -37.519 -4.706  1.00 83.84  ? 109  LYS A CG  1 
ATOM 314   C CD  . LYS A 1 40   ? 284.345 -38.589 -5.008  1.00 87.26  ? 109  LYS A CD  1 
ATOM 315   C CE  . LYS A 1 40   ? 285.407 -38.622 -3.933  1.00 88.98  ? 109  LYS A CE  1 
ATOM 316   N NZ  . LYS A 1 40   ? 286.179 -39.898 -3.955  1.00 89.40  ? 109  LYS A NZ  1 
ATOM 317   N N   . HIS A 1 41   ? 281.607 -34.777 -6.907  1.00 79.25  ? 110  HIS A N   1 
ATOM 318   C CA  . HIS A 1 41   ? 280.688 -33.658 -7.127  1.00 76.12  ? 110  HIS A CA  1 
ATOM 319   C C   . HIS A 1 41   ? 281.039 -32.849 -8.403  1.00 75.32  ? 110  HIS A C   1 
ATOM 320   O O   . HIS A 1 41   ? 280.454 -31.809 -8.701  1.00 75.57  ? 110  HIS A O   1 
ATOM 321   C CB  . HIS A 1 41   ? 280.619 -32.811 -5.836  1.00 73.13  ? 110  HIS A CB  1 
ATOM 322   C CG  . HIS A 1 41   ? 280.063 -33.568 -4.649  1.00 70.58  ? 110  HIS A CG  1 
ATOM 323   N ND1 . HIS A 1 41   ? 278.827 -34.185 -4.671  1.00 69.54  ? 110  HIS A ND1 1 
ATOM 324   C CD2 . HIS A 1 41   ? 280.582 -33.825 -3.420  1.00 69.48  ? 110  HIS A CD2 1 
ATOM 325   C CE1 . HIS A 1 41   ? 278.611 -34.788 -3.513  1.00 68.14  ? 110  HIS A CE1 1 
ATOM 326   N NE2 . HIS A 1 41   ? 279.659 -34.585 -2.736  1.00 67.83  ? 110  HIS A NE2 1 
ATOM 327   N N   . GLY A 1 42   ? 281.979 -33.409 -9.161  1.00 73.87  ? 111  GLY A N   1 
ATOM 328   C CA  . GLY A 1 42   ? 282.438 -32.883 -10.434 1.00 73.30  ? 111  GLY A CA  1 
ATOM 329   C C   . GLY A 1 42   ? 282.802 -31.433 -10.621 1.00 73.23  ? 111  GLY A C   1 
ATOM 330   O O   . GLY A 1 42   ? 282.273 -30.800 -11.536 1.00 72.67  ? 111  GLY A O   1 
ATOM 331   N N   . LEU A 1 43   ? 283.724 -30.901 -9.822  1.00 73.67  ? 112  LEU A N   1 
ATOM 332   C CA  . LEU A 1 43   ? 284.083 -29.492 -9.988  1.00 75.67  ? 112  LEU A CA  1 
ATOM 333   C C   . LEU A 1 43   ? 285.485 -29.127 -10.488 1.00 78.96  ? 112  LEU A C   1 
ATOM 334   O O   . LEU A 1 43   ? 285.624 -28.267 -11.368 1.00 79.14  ? 112  LEU A O   1 
ATOM 335   C CB  . LEU A 1 43   ? 283.822 -28.729 -8.688  1.00 71.88  ? 112  LEU A CB  1 
ATOM 336   C CG  . LEU A 1 43   ? 282.371 -28.649 -8.212  1.00 68.68  ? 112  LEU A CG  1 
ATOM 337   C CD1 . LEU A 1 43   ? 281.917 -30.005 -7.753  1.00 66.69  ? 112  LEU A CD1 1 
ATOM 338   C CD2 . LEU A 1 43   ? 282.261 -27.670 -7.064  1.00 68.10  ? 112  LEU A CD2 1 
ATOM 339   N N   . TRP A 1 44   ? 286.515 -29.775 -9.949  1.00 82.78  ? 113  TRP A N   1 
ATOM 340   C CA  . TRP A 1 44   ? 287.880 -29.430 -10.331 1.00 87.15  ? 113  TRP A CA  1 
ATOM 341   C C   . TRP A 1 44   ? 288.511 -29.912 -11.636 1.00 89.52  ? 113  TRP A C   1 
ATOM 342   O O   . TRP A 1 44   ? 287.938 -30.716 -12.382 1.00 90.92  ? 113  TRP A O   1 
ATOM 343   C CB  . TRP A 1 44   ? 288.846 -29.743 -9.188  1.00 88.02  ? 113  TRP A CB  1 
ATOM 344   C CG  . TRP A 1 44   ? 288.558 -30.985 -8.442  1.00 88.56  ? 113  TRP A CG  1 
ATOM 345   C CD1 . TRP A 1 44   ? 287.654 -31.138 -7.449  1.00 88.30  ? 113  TRP A CD1 1 
ATOM 346   C CD2 . TRP A 1 44   ? 289.212 -32.246 -8.592  1.00 88.64  ? 113  TRP A CD2 1 
ATOM 347   N NE1 . TRP A 1 44   ? 287.697 -32.417 -6.954  1.00 87.62  ? 113  TRP A NE1 1 
ATOM 348   C CE2 . TRP A 1 44   ? 288.648 -33.122 -7.639  1.00 88.00  ? 113  TRP A CE2 1 
ATOM 349   C CE3 . TRP A 1 44   ? 290.223 -32.723 -9.437  1.00 89.97  ? 113  TRP A CE3 1 
ATOM 350   C CZ2 . TRP A 1 44   ? 289.060 -34.450 -7.503  1.00 88.12  ? 113  TRP A CZ2 1 
ATOM 351   C CZ3 . TRP A 1 44   ? 290.635 -34.040 -9.304  1.00 90.36  ? 113  TRP A CZ3 1 
ATOM 352   C CH2 . TRP A 1 44   ? 290.053 -34.891 -8.342  1.00 89.16  ? 113  TRP A CH2 1 
ATOM 353   N N   . GLY A 1 45   ? 289.720 -29.380 -11.862 1.00 91.13  ? 114  GLY A N   1 
ATOM 354   C CA  . GLY A 1 45   ? 290.537 -29.634 -13.040 1.00 93.54  ? 114  GLY A CA  1 
ATOM 355   C C   . GLY A 1 45   ? 290.569 -28.354 -13.861 1.00 95.24  ? 114  GLY A C   1 
ATOM 356   O O   . GLY A 1 45   ? 291.621 -27.795 -14.189 1.00 94.67  ? 114  GLY A O   1 
ATOM 357   N N   . GLN A 1 46   ? 289.364 -27.890 -14.164 1.00 98.04  ? 115  GLN A N   1 
ATOM 358   C CA  . GLN A 1 46   ? 289.126 -26.687 -14.940 1.00 101.35 ? 115  GLN A CA  1 
ATOM 359   C C   . GLN A 1 46   ? 288.905 -25.459 -14.070 1.00 103.43 ? 115  GLN A C   1 
ATOM 360   O O   . GLN A 1 46   ? 288.954 -24.341 -14.561 1.00 103.27 ? 115  GLN A O   1 
ATOM 361   C CB  . GLN A 1 46   ? 287.898 -26.887 -15.825 1.00 101.81 ? 115  GLN A CB  1 
ATOM 362   C CG  . GLN A 1 46   ? 287.990 -28.090 -16.734 1.00 102.47 ? 115  GLN A CG  1 
ATOM 363   C CD  . GLN A 1 46   ? 289.045 -27.914 -17.794 1.00 102.96 ? 115  GLN A CD  1 
ATOM 364   O OE1 . GLN A 1 46   ? 289.950 -28.737 -17.932 1.00 103.74 ? 115  GLN A OE1 1 
ATOM 365   N NE2 . GLN A 1 46   ? 288.935 -26.833 -18.557 1.00 102.98 ? 115  GLN A NE2 1 
ATOM 366   N N   . PRO A 1 47   ? 288.631 -25.644 -12.770 1.00 105.37 ? 116  PRO A N   1 
ATOM 367   C CA  . PRO A 1 47   ? 288.421 -24.457 -11.942 1.00 106.70 ? 116  PRO A CA  1 
ATOM 368   C C   . PRO A 1 47   ? 289.616 -23.528 -12.090 1.00 108.42 ? 116  PRO A C   1 
ATOM 369   O O   . PRO A 1 47   ? 289.528 -22.322 -11.838 1.00 108.91 ? 116  PRO A O   1 
ATOM 370   C CB  . PRO A 1 47   ? 288.303 -25.043 -10.541 1.00 105.87 ? 116  PRO A CB  1 
ATOM 371   C CG  . PRO A 1 47   ? 289.152 -26.271 -10.622 1.00 105.51 ? 116  PRO A CG  1 
ATOM 372   C CD  . PRO A 1 47   ? 288.710 -26.842 -11.926 1.00 105.50 ? 116  PRO A CD  1 
ATOM 373   N N   . ALA A 1 48   ? 290.731 -24.118 -12.514 1.00 110.05 ? 117  ALA A N   1 
ATOM 374   C CA  . ALA A 1 48   ? 291.962 -23.382 -12.728 1.00 111.40 ? 117  ALA A CA  1 
ATOM 375   C C   . ALA A 1 48   ? 291.903 -22.674 -14.085 1.00 112.17 ? 117  ALA A C   1 
ATOM 376   O O   . ALA A 1 48   ? 292.764 -22.885 -14.940 1.00 111.73 ? 117  ALA A O   1 
ATOM 377   C CB  . ALA A 1 48   ? 293.155 -24.334 -12.668 1.00 111.59 ? 117  ALA A CB  1 
ATOM 378   N N   . VAL A 1 49   ? 290.861 -21.858 -14.274 1.00 113.10 ? 118  VAL A N   1 
ATOM 379   C CA  . VAL A 1 49   ? 290.644 -21.062 -15.490 1.00 113.49 ? 118  VAL A CA  1 
ATOM 380   C C   . VAL A 1 49   ? 290.086 -19.675 -15.127 1.00 113.09 ? 118  VAL A C   1 
ATOM 381   O O   . VAL A 1 49   ? 289.322 -19.095 -15.895 1.00 113.16 ? 118  VAL A O   1 
ATOM 382   C CB  . VAL A 1 49   ? 289.614 -21.721 -16.449 1.00 113.81 ? 118  VAL A CB  1 
ATOM 383   C CG1 . VAL A 1 49   ? 290.068 -23.118 -16.839 1.00 113.23 ? 118  VAL A CG1 1 
ATOM 384   C CG2 . VAL A 1 49   ? 288.236 -21.753 -15.796 1.00 114.27 ? 118  VAL A CG2 1 
ATOM 385   N N   . PRO A 1 50   ? 290.463 -19.127 -13.953 1.00 112.93 ? 119  PRO A N   1 
ATOM 386   C CA  . PRO A 1 50   ? 290.024 -17.823 -13.441 1.00 112.55 ? 119  PRO A CA  1 
ATOM 387   C C   . PRO A 1 50   ? 290.290 -16.495 -14.140 1.00 111.57 ? 119  PRO A C   1 
ATOM 388   O O   . PRO A 1 50   ? 291.174 -16.341 -14.984 1.00 111.71 ? 119  PRO A O   1 
ATOM 389   C CB  . PRO A 1 50   ? 290.606 -17.802 -12.029 1.00 113.27 ? 119  PRO A CB  1 
ATOM 390   C CG  . PRO A 1 50   ? 290.572 -19.214 -11.649 1.00 113.94 ? 119  PRO A CG  1 
ATOM 391   C CD  . PRO A 1 50   ? 291.152 -19.854 -12.873 1.00 113.80 ? 119  PRO A CD  1 
ATOM 392   N N   . LEU A 1 51   ? 289.490 -15.529 -13.704 1.00 110.84 ? 120  LEU A N   1 
ATOM 393   C CA  . LEU A 1 51   ? 289.516 -14.139 -14.137 1.00 110.17 ? 120  LEU A CA  1 
ATOM 394   C C   . LEU A 1 51   ? 289.690 -13.421 -12.777 1.00 109.10 ? 120  LEU A C   1 
ATOM 395   O O   . LEU A 1 51   ? 288.817 -12.673 -12.340 1.00 109.22 ? 120  LEU A O   1 
ATOM 396   C CB  . LEU A 1 51   ? 288.167 -13.767 -14.790 1.00 111.26 ? 120  LEU A CB  1 
ATOM 397   C CG  . LEU A 1 51   ? 287.031 -14.797 -14.951 1.00 112.69 ? 120  LEU A CG  1 
ATOM 398   C CD1 . LEU A 1 51   ? 287.468 -15.915 -15.873 1.00 113.79 ? 120  LEU A CD1 1 
ATOM 399   C CD2 . LEU A 1 51   ? 286.626 -15.350 -13.596 1.00 113.47 ? 120  LEU A CD2 1 
ATOM 400   N N   . PRO A 1 52   ? 290.840 -13.650 -12.108 1.00 107.95 ? 121  PRO A N   1 
ATOM 401   C CA  . PRO A 1 52   ? 291.351 -13.184 -10.810 1.00 106.45 ? 121  PRO A CA  1 
ATOM 402   C C   . PRO A 1 52   ? 291.519 -11.725 -10.341 1.00 104.58 ? 121  PRO A C   1 
ATOM 403   O O   . PRO A 1 52   ? 291.287 -11.435 -9.175  1.00 104.46 ? 121  PRO A O   1 
ATOM 404   C CB  . PRO A 1 52   ? 292.677 -13.923 -10.712 1.00 107.41 ? 121  PRO A CB  1 
ATOM 405   C CG  . PRO A 1 52   ? 293.155 -13.864 -12.109 1.00 107.71 ? 121  PRO A CG  1 
ATOM 406   C CD  . PRO A 1 52   ? 291.933 -14.297 -12.861 1.00 107.81 ? 121  PRO A CD  1 
ATOM 407   N N   . ASP A 1 53   ? 291.920 -10.820 -11.221 1.00 102.75 ? 122  ASP A N   1 
ATOM 408   C CA  . ASP A 1 53   ? 292.220 -9.425  -10.858 1.00 101.88 ? 122  ASP A CA  1 
ATOM 409   C C   . ASP A 1 53   ? 291.476 -8.486  -9.900  1.00 101.45 ? 122  ASP A C   1 
ATOM 410   O O   . ASP A 1 53   ? 290.259 -8.533  -9.721  1.00 100.30 ? 122  ASP A O   1 
ATOM 411   C CB  . ASP A 1 53   ? 292.448 -8.646  -12.132 1.00 101.54 ? 122  ASP A CB  1 
ATOM 412   C CG  . ASP A 1 53   ? 291.316 -8.797  -13.093 1.00 100.91 ? 122  ASP A CG  1 
ATOM 413   O OD1 . ASP A 1 53   ? 291.495 -8.441  -14.270 1.00 100.40 ? 122  ASP A OD1 1 
ATOM 414   O OD2 . ASP A 1 53   ? 290.244 -9.270  -12.673 1.00 100.19 ? 122  ASP A OD2 1 
ATOM 415   N N   . VAL A 1 54   ? 292.302 -7.605  -9.330  1.00 102.07 ? 123  VAL A N   1 
ATOM 416   C CA  . VAL A 1 54   ? 291.973 -6.534  -8.389  1.00 103.56 ? 123  VAL A CA  1 
ATOM 417   C C   . VAL A 1 54   ? 293.329 -5.997  -7.941  1.00 104.00 ? 123  VAL A C   1 
ATOM 418   O O   . VAL A 1 54   ? 294.341 -6.697  -7.967  1.00 104.05 ? 123  VAL A O   1 
ATOM 419   C CB  . VAL A 1 54   ? 291.234 -7.007  -7.095  1.00 104.18 ? 123  VAL A CB  1 
ATOM 420   C CG1 . VAL A 1 54   ? 292.239 -7.576  -6.080  1.00 104.49 ? 123  VAL A CG1 1 
ATOM 421   C CG2 . VAL A 1 54   ? 290.494 -5.827  -6.458  1.00 104.53 ? 123  VAL A CG2 1 
ATOM 422   N N   . GLU A 1 55   ? 293.339 -4.742  -7.542  1.00 104.69 ? 124  GLU A N   1 
ATOM 423   C CA  . GLU A 1 55   ? 294.535 -4.101  -7.047  1.00 104.67 ? 124  GLU A CA  1 
ATOM 424   C C   . GLU A 1 55   ? 293.904 -3.359  -5.890  1.00 103.41 ? 124  GLU A C   1 
ATOM 425   O O   . GLU A 1 55   ? 293.154 -2.411  -6.089  1.00 103.58 ? 124  GLU A O   1 
ATOM 426   C CB  . GLU A 1 55   ? 295.091 -3.140  -8.097  1.00 105.92 ? 124  GLU A CB  1 
ATOM 427   C CG  . GLU A 1 55   ? 296.523 -3.423  -8.503  1.00 107.39 ? 124  GLU A CG  1 
ATOM 428   C CD  . GLU A 1 55   ? 296.877 -2.800  -9.835  1.00 107.65 ? 124  GLU A CD  1 
ATOM 429   O OE1 . GLU A 1 55   ? 297.067 -1.569  -9.908  1.00 107.85 ? 124  GLU A OE1 1 
ATOM 430   O OE2 . GLU A 1 55   ? 296.952 -3.552  -10.822 1.00 108.50 ? 124  GLU A OE2 1 
ATOM 431   N N   . LEU A 1 56   ? 294.160 -3.813  -4.679  1.00 101.16 ? 125  LEU A N   1 
ATOM 432   C CA  . LEU A 1 56   ? 293.547 -3.175  -3.538  1.00 98.84  ? 125  LEU A CA  1 
ATOM 433   C C   . LEU A 1 56   ? 294.541 -2.380  -2.760  1.00 97.27  ? 125  LEU A C   1 
ATOM 434   O O   . LEU A 1 56   ? 295.652 -2.840  -2.513  1.00 95.86  ? 125  LEU A O   1 
ATOM 435   C CB  . LEU A 1 56   ? 292.897 -4.222  -2.661  1.00 99.42  ? 125  LEU A CB  1 
ATOM 436   C CG  . LEU A 1 56   ? 293.724 -5.449  -2.311  1.00 99.94  ? 125  LEU A CG  1 
ATOM 437   C CD1 . LEU A 1 56   ? 292.720 -6.492  -1.887  1.00 99.90  ? 125  LEU A CD1 1 
ATOM 438   C CD2 . LEU A 1 56   ? 294.558 -5.977  -3.482  1.00 101.15 ? 125  LEU A CD2 1 
ATOM 439   N N   . ARG A 1 57   ? 294.127 -1.176  -2.380  1.00 96.74  ? 126  ARG A N   1 
ATOM 440   C CA  . ARG A 1 57   ? 294.991 -0.279  -1.638  1.00 96.68  ? 126  ARG A CA  1 
ATOM 441   C C   . ARG A 1 57   ? 294.269 0.520   -0.561  1.00 95.68  ? 126  ARG A C   1 
ATOM 442   O O   . ARG A 1 57   ? 293.988 1.699   -0.779  1.00 96.14  ? 126  ARG A O   1 
ATOM 443   C CB  . ARG A 1 57   ? 295.672 0.718   -2.586  1.00 98.05  ? 126  ARG A CB  1 
ATOM 444   C CG  . ARG A 1 57   ? 296.661 0.131   -3.577  1.00 99.87  ? 126  ARG A CG  1 
ATOM 445   C CD  . ARG A 1 57   ? 297.714 1.175   -3.955  1.00 101.17 ? 126  ARG A CD  1 
ATOM 446   N NE  . ARG A 1 57   ? 298.440 0.846   -5.182  1.00 102.77 ? 126  ARG A NE  1 
ATOM 447   C CZ  . ARG A 1 57   ? 299.553 1.457   -5.580  1.00 103.77 ? 126  ARG A CZ  1 
ATOM 448   N NH1 . ARG A 1 57   ? 300.075 2.424   -4.847  1.00 103.82 ? 126  ARG A NH1 1 
ATOM 449   N NH2 . ARG A 1 57   ? 300.138 1.112   -6.715  1.00 104.55 ? 126  ARG A NH2 1 
ATOM 450   N N   . LEU A 1 58   ? 293.980 -0.083  0.594   1.00 93.62  ? 127  LEU A N   1 
ATOM 451   C CA  . LEU A 1 58   ? 293.317 0.670   1.667   1.00 91.18  ? 127  LEU A CA  1 
ATOM 452   C C   . LEU A 1 58   ? 293.810 0.426   3.094   1.00 88.98  ? 127  LEU A C   1 
ATOM 453   O O   . LEU A 1 58   ? 293.936 -0.714  3.528   1.00 88.16  ? 127  LEU A O   1 
ATOM 454   C CB  . LEU A 1 58   ? 291.807 0.481   1.591   1.00 92.07  ? 127  LEU A CB  1 
ATOM 455   C CG  . LEU A 1 58   ? 291.156 1.724   0.977   1.00 92.41  ? 127  LEU A CG  1 
ATOM 456   C CD1 . LEU A 1 58   ? 289.679 1.458   0.768   1.00 92.06  ? 127  LEU A CD1 1 
ATOM 457   C CD2 . LEU A 1 58   ? 291.385 2.954   1.882   1.00 93.03  ? 127  LEU A CD2 1 
ATOM 458   N N   . PRO A 1 59   ? 294.089 1.519   3.834   1.00 86.97  ? 128  PRO A N   1 
ATOM 459   C CA  . PRO A 1 59   ? 294.585 1.554   5.214   1.00 84.10  ? 128  PRO A CA  1 
ATOM 460   C C   . PRO A 1 59   ? 293.654 2.088   6.289   1.00 82.33  ? 128  PRO A C   1 
ATOM 461   O O   . PRO A 1 59   ? 294.084 2.361   7.409   1.00 81.40  ? 128  PRO A O   1 
ATOM 462   C CB  . PRO A 1 59   ? 295.792 2.453   5.083   1.00 85.88  ? 128  PRO A CB  1 
ATOM 463   C CG  . PRO A 1 59   ? 295.203 3.554   4.205   1.00 86.24  ? 128  PRO A CG  1 
ATOM 464   C CD  . PRO A 1 59   ? 294.355 2.813   3.176   1.00 85.90  ? 128  PRO A CD  1 
ATOM 465   N N   . PRO A 1 60   ? 292.375 2.238   5.981   1.00 81.15  ? 129  PRO A N   1 
ATOM 466   C CA  . PRO A 1 60   ? 291.541 2.765   7.047   1.00 79.12  ? 129  PRO A CA  1 
ATOM 467   C C   . PRO A 1 60   ? 291.528 2.061   8.379   1.00 78.30  ? 129  PRO A C   1 
ATOM 468   O O   . PRO A 1 60   ? 291.125 2.679   9.345   1.00 76.69  ? 129  PRO A O   1 
ATOM 469   C CB  . PRO A 1 60   ? 290.165 2.786   6.421   1.00 80.11  ? 129  PRO A CB  1 
ATOM 470   C CG  . PRO A 1 60   ? 290.202 1.597   5.561   1.00 80.00  ? 129  PRO A CG  1 
ATOM 471   C CD  . PRO A 1 60   ? 291.543 1.730   4.887   1.00 79.96  ? 129  PRO A CD  1 
ATOM 472   N N   . LEU A 1 61   ? 291.929 0.795   8.486   1.00 78.81  ? 130  LEU A N   1 
ATOM 473   C CA  . LEU A 1 61   ? 291.848 0.240   9.833   1.00 80.61  ? 130  LEU A CA  1 
ATOM 474   C C   . LEU A 1 61   ? 292.982 -0.348  10.651  1.00 80.67  ? 130  LEU A C   1 
ATOM 475   O O   . LEU A 1 61   ? 293.997 -0.882  10.179  1.00 81.14  ? 130  LEU A O   1 
ATOM 476   C CB  . LEU A 1 61   ? 290.609 -0.637  9.990   1.00 82.29  ? 130  LEU A CB  1 
ATOM 477   C CG  . LEU A 1 61   ? 289.603 0.327   10.644  1.00 83.05  ? 130  LEU A CG  1 
ATOM 478   C CD1 . LEU A 1 61   ? 288.823 1.018   9.538   1.00 83.17  ? 130  LEU A CD1 1 
ATOM 479   C CD2 . LEU A 1 61   ? 288.670 -0.387  11.612  1.00 83.39  ? 130  LEU A CD2 1 
ATOM 480   N N   . TYR A 1 62   ? 292.687 -0.239  11.936  1.00 80.87  ? 131  TYR A N   1 
ATOM 481   C CA  . TYR A 1 62   ? 293.536 -0.505  13.076  1.00 81.55  ? 131  TYR A CA  1 
ATOM 482   C C   . TYR A 1 62   ? 293.633 -1.804  13.868  1.00 84.19  ? 131  TYR A C   1 
ATOM 483   O O   . TYR A 1 62   ? 294.717 -2.378  13.976  1.00 85.13  ? 131  TYR A O   1 
ATOM 484   C CB  . TYR A 1 62   ? 293.213 0.646   14.016  1.00 77.82  ? 131  TYR A CB  1 
ATOM 485   C CG  . TYR A 1 62   ? 292.525 1.741   13.224  1.00 73.11  ? 131  TYR A CG  1 
ATOM 486   C CD1 . TYR A 1 62   ? 291.152 1.974   13.332  1.00 71.11  ? 131  TYR A CD1 1 
ATOM 487   C CD2 . TYR A 1 62   ? 293.241 2.474   12.282  1.00 71.34  ? 131  TYR A CD2 1 
ATOM 488   C CE1 . TYR A 1 62   ? 290.525 2.909   12.517  1.00 70.04  ? 131  TYR A CE1 1 
ATOM 489   C CE2 . TYR A 1 62   ? 292.627 3.396   11.472  1.00 69.22  ? 131  TYR A CE2 1 
ATOM 490   C CZ  . TYR A 1 62   ? 291.275 3.613   11.591  1.00 69.53  ? 131  TYR A CZ  1 
ATOM 491   O OH  . TYR A 1 62   ? 290.687 4.529   10.754  1.00 69.40  ? 131  TYR A OH  1 
ATOM 492   N N   . GLY A 1 63   ? 292.510 -2.230  14.438  1.00 86.66  ? 132  GLY A N   1 
ATOM 493   C CA  . GLY A 1 63   ? 292.438 -3.401  15.311  1.00 88.73  ? 132  GLY A CA  1 
ATOM 494   C C   . GLY A 1 63   ? 293.069 -4.785  15.209  1.00 90.26  ? 132  GLY A C   1 
ATOM 495   O O   . GLY A 1 63   ? 293.670 -5.181  14.201  1.00 90.84  ? 132  GLY A O   1 
ATOM 496   N N   . ASP A 1 64   ? 292.919 -5.517  16.319  1.00 91.18  ? 133  ASP A N   1 
ATOM 497   C CA  . ASP A 1 64   ? 293.391 -6.895  16.451  1.00 92.51  ? 133  ASP A CA  1 
ATOM 498   C C   . ASP A 1 64   ? 292.083 -7.660  16.492  1.00 93.44  ? 133  ASP A C   1 
ATOM 499   O O   . ASP A 1 64   ? 291.273 -7.471  17.398  1.00 94.21  ? 133  ASP A O   1 
ATOM 500   C CB  . ASP A 1 64   ? 294.175 -7.093  17.752  1.00 91.51  ? 133  ASP A CB  1 
ATOM 501   C CG  . ASP A 1 64   ? 295.295 -8.110  17.604  1.00 91.17  ? 133  ASP A CG  1 
ATOM 502   O OD1 . ASP A 1 64   ? 295.830 -8.242  16.488  1.00 91.48  ? 133  ASP A OD1 1 
ATOM 503   O OD2 . ASP A 1 64   ? 295.657 -8.764  18.599  1.00 89.98  ? 133  ASP A OD2 1 
ATOM 504   N N   . ASN A 1 65   ? 291.879 -8.512  15.496  1.00 93.42  ? 134  ASN A N   1 
ATOM 505   C CA  . ASN A 1 65   ? 290.637 -9.257  15.367  1.00 93.18  ? 134  ASN A CA  1 
ATOM 506   C C   . ASN A 1 65   ? 289.642 -8.161  15.016  1.00 92.59  ? 134  ASN A C   1 
ATOM 507   O O   . ASN A 1 65   ? 289.194 -7.408  15.876  1.00 94.17  ? 134  ASN A O   1 
ATOM 508   C CB  . ASN A 1 65   ? 290.239 -9.948  16.680  1.00 92.90  ? 134  ASN A CB  1 
ATOM 509   C CG  . ASN A 1 65   ? 289.691 -11.348 16.456  1.00 92.53  ? 134  ASN A CG  1 
ATOM 510   O OD1 . ASN A 1 65   ? 289.577 -11.811 15.320  1.00 91.28  ? 134  ASN A OD1 1 
ATOM 511   N ND2 . ASN A 1 65   ? 289.355 -12.031 17.539  1.00 92.51  ? 134  ASN A ND2 1 
ATOM 512   N N   . LEU A 1 66   ? 289.353 -8.053  13.727  1.00 90.49  ? 135  LEU A N   1 
ATOM 513   C CA  . LEU A 1 66   ? 288.433 -7.062  13.203  1.00 88.36  ? 135  LEU A CA  1 
ATOM 514   C C   . LEU A 1 66   ? 287.241 -6.892  14.123  1.00 86.41  ? 135  LEU A C   1 
ATOM 515   O O   . LEU A 1 66   ? 286.854 -5.767  14.454  1.00 85.98  ? 135  LEU A O   1 
ATOM 516   C CB  . LEU A 1 66   ? 287.976 -7.485  11.806  1.00 89.92  ? 135  LEU A CB  1 
ATOM 517   C CG  . LEU A 1 66   ? 288.283 -8.924  11.369  1.00 91.73  ? 135  LEU A CG  1 
ATOM 518   C CD1 . LEU A 1 66   ? 287.778 -9.086  9.949   1.00 92.17  ? 135  LEU A CD1 1 
ATOM 519   C CD2 . LEU A 1 66   ? 289.791 -9.239  11.429  1.00 92.92  ? 135  LEU A CD2 1 
ATOM 520   N N   . ASP A 1 67   ? 286.675 -8.017  14.547  1.00 84.19  ? 136  ASP A N   1 
ATOM 521   C CA  . ASP A 1 67   ? 285.526 -7.987  15.429  1.00 81.43  ? 136  ASP A CA  1 
ATOM 522   C C   . ASP A 1 67   ? 285.861 -7.282  16.715  1.00 79.74  ? 136  ASP A C   1 
ATOM 523   O O   . ASP A 1 67   ? 285.008 -6.616  17.298  1.00 80.72  ? 136  ASP A O   1 
ATOM 524   C CB  . ASP A 1 67   ? 285.019 -9.393  15.745  1.00 82.04  ? 136  ASP A CB  1 
ATOM 525   C CG  . ASP A 1 67   ? 286.031 -10.239 16.492  1.00 82.63  ? 136  ASP A CG  1 
ATOM 526   O OD1 . ASP A 1 67   ? 286.721 -9.736  17.395  1.00 82.43  ? 136  ASP A OD1 1 
ATOM 527   O OD2 . ASP A 1 67   ? 286.121 -11.440 16.189  1.00 83.81  ? 136  ASP A OD2 1 
ATOM 528   N N   . GLN A 1 68   ? 287.097 -7.435  17.176  1.00 77.34  ? 137  GLN A N   1 
ATOM 529   C CA  . GLN A 1 68   ? 287.483 -6.759  18.402  1.00 75.29  ? 137  GLN A CA  1 
ATOM 530   C C   . GLN A 1 68   ? 287.213 -5.285  18.123  1.00 72.30  ? 137  GLN A C   1 
ATOM 531   O O   . GLN A 1 68   ? 286.749 -4.553  18.998  1.00 71.06  ? 137  GLN A O   1 
ATOM 532   C CB  . GLN A 1 68   ? 288.965 -6.982  18.747  1.00 77.52  ? 137  GLN A CB  1 
ATOM 533   C CG  . GLN A 1 68   ? 289.343 -6.447  20.127  1.00 78.93  ? 137  GLN A CG  1 
ATOM 534   C CD  . GLN A 1 68   ? 290.800 -6.634  20.469  1.00 79.47  ? 137  GLN A CD  1 
ATOM 535   O OE1 . GLN A 1 68   ? 291.653 -5.839  20.073  1.00 79.93  ? 137  GLN A OE1 1 
ATOM 536   N NE2 . GLN A 1 68   ? 291.097 -7.694  21.206  1.00 77.93  ? 137  GLN A NE2 1 
ATOM 537   N N   . HIS A 1 69   ? 287.481 -4.850  16.894  1.00 69.45  ? 138  HIS A N   1 
ATOM 538   C CA  . HIS A 1 69   ? 287.216 -3.464  16.555  1.00 67.97  ? 138  HIS A CA  1 
ATOM 539   C C   . HIS A 1 69   ? 285.748 -3.251  16.235  1.00 65.71  ? 138  HIS A C   1 
ATOM 540   O O   . HIS A 1 69   ? 285.271 -2.122  16.225  1.00 66.87  ? 138  HIS A O   1 
ATOM 541   C CB  . HIS A 1 69   ? 288.112 -2.985  15.412  1.00 70.22  ? 138  HIS A CB  1 
ATOM 542   C CG  . HIS A 1 69   ? 289.278 -2.170  15.887  1.00 73.18  ? 138  HIS A CG  1 
ATOM 543   N ND1 . HIS A 1 69   ? 290.030 -2.527  16.987  1.00 73.87  ? 138  HIS A ND1 1 
ATOM 544   C CD2 . HIS A 1 69   ? 289.805 -1.008  15.433  1.00 73.73  ? 138  HIS A CD2 1 
ATOM 545   C CE1 . HIS A 1 69   ? 290.966 -1.620  17.192  1.00 73.38  ? 138  HIS A CE1 1 
ATOM 546   N NE2 . HIS A 1 69   ? 290.852 -0.688  16.262  1.00 73.53  ? 138  HIS A NE2 1 
ATOM 547   N N   . PHE A 1 70   ? 285.022 -4.336  15.996  1.00 62.13  ? 139  PHE A N   1 
ATOM 548   C CA  . PHE A 1 70   ? 283.596 -4.216  15.736  1.00 58.61  ? 139  PHE A CA  1 
ATOM 549   C C   . PHE A 1 70   ? 282.874 -3.948  17.050  1.00 57.25  ? 139  PHE A C   1 
ATOM 550   O O   . PHE A 1 70   ? 282.024 -3.072  17.122  1.00 57.76  ? 139  PHE A O   1 
ATOM 551   C CB  . PHE A 1 70   ? 283.027 -5.494  15.130  1.00 58.07  ? 139  PHE A CB  1 
ATOM 552   C CG  . PHE A 1 70   ? 283.078 -5.542  13.631  1.00 57.80  ? 139  PHE A CG  1 
ATOM 553   C CD1 . PHE A 1 70   ? 284.280 -5.771  12.967  1.00 58.26  ? 139  PHE A CD1 1 
ATOM 554   C CD2 . PHE A 1 70   ? 281.913 -5.387  12.877  1.00 57.24  ? 139  PHE A CD2 1 
ATOM 555   C CE1 . PHE A 1 70   ? 284.323 -5.856  11.563  1.00 58.82  ? 139  PHE A CE1 1 
ATOM 556   C CE2 . PHE A 1 70   ? 281.944 -5.468  11.475  1.00 57.00  ? 139  PHE A CE2 1 
ATOM 557   C CZ  . PHE A 1 70   ? 283.151 -5.703  10.819  1.00 58.16  ? 139  PHE A CZ  1 
ATOM 558   N N   . ARG A 1 71   ? 283.203 -4.712  18.088  1.00 56.76  ? 140  ARG A N   1 
ATOM 559   C CA  . ARG A 1 71   ? 282.556 -4.526  19.380  1.00 59.17  ? 140  ARG A CA  1 
ATOM 560   C C   . ARG A 1 71   ? 282.832 -3.094  19.842  1.00 60.27  ? 140  ARG A C   1 
ATOM 561   O O   . ARG A 1 71   ? 282.031 -2.516  20.575  1.00 59.46  ? 140  ARG A O   1 
ATOM 562   C CB  . ARG A 1 71   ? 283.105 -5.520  20.397  1.00 61.09  ? 140  ARG A CB  1 
ATOM 563   C CG  . ARG A 1 71   ? 283.539 -6.871  19.826  1.00 67.41  ? 140  ARG A CG  1 
ATOM 564   C CD  . ARG A 1 71   ? 282.395 -7.859  19.625  1.00 69.07  ? 140  ARG A CD  1 
ATOM 565   N NE  . ARG A 1 71   ? 282.825 -9.264  19.705  1.00 69.37  ? 140  ARG A NE  1 
ATOM 566   C CZ  . ARG A 1 71   ? 282.677 -10.037 20.781  1.00 68.10  ? 140  ARG A CZ  1 
ATOM 567   N NH1 . ARG A 1 71   ? 282.108 -9.545  21.868  1.00 69.10  ? 140  ARG A NH1 1 
ATOM 568   N NH2 . ARG A 1 71   ? 283.105 -11.295 20.777  1.00 65.52  ? 140  ARG A NH2 1 
ATOM 569   N N   . LEU A 1 72   ? 283.968 -2.531  19.405  1.00 62.96  ? 141  LEU A N   1 
ATOM 570   C CA  . LEU A 1 72   ? 284.360 -1.150  19.745  1.00 64.04  ? 141  LEU A CA  1 
ATOM 571   C C   . LEU A 1 72   ? 283.366 -0.201  19.090  1.00 64.04  ? 141  LEU A C   1 
ATOM 572   O O   . LEU A 1 72   ? 282.764 0.651   19.753  1.00 63.61  ? 141  LEU A O   1 
ATOM 573   C CB  . LEU A 1 72   ? 285.772 -0.799  19.214  1.00 63.98  ? 141  LEU A CB  1 
ATOM 574   C CG  . LEU A 1 72   ? 286.986 -0.645  20.147  1.00 62.64  ? 141  LEU A CG  1 
ATOM 575   C CD1 . LEU A 1 72   ? 287.772 -1.944  20.184  1.00 62.26  ? 141  LEU A CD1 1 
ATOM 576   C CD2 . LEU A 1 72   ? 287.893 0.467   19.655  1.00 62.16  ? 141  LEU A CD2 1 
ATOM 577   N N   . LEU A 1 73   ? 283.212 -0.354  17.775  1.00 63.88  ? 142  LEU A N   1 
ATOM 578   C CA  . LEU A 1 73   ? 282.297 0.477   16.992  1.00 64.17  ? 142  LEU A CA  1 
ATOM 579   C C   . LEU A 1 73   ? 280.918 0.402   17.661  1.00 64.43  ? 142  LEU A C   1 
ATOM 580   O O   . LEU A 1 73   ? 280.246 1.420   17.871  1.00 64.62  ? 142  LEU A O   1 
ATOM 581   C CB  . LEU A 1 73   ? 282.229 -0.048  15.541  1.00 64.27  ? 142  LEU A CB  1 
ATOM 582   C CG  . LEU A 1 73   ? 283.524 -0.567  14.876  1.00 64.01  ? 142  LEU A CG  1 
ATOM 583   C CD1 . LEU A 1 73   ? 283.191 -1.356  13.607  1.00 63.58  ? 142  LEU A CD1 1 
ATOM 584   C CD2 . LEU A 1 73   ? 284.464 0.582   14.557  1.00 63.61  ? 142  LEU A CD2 1 
ATOM 585   N N   . ALA A 1 74   ? 280.528 -0.825  18.004  1.00 65.46  ? 143  ALA A N   1 
ATOM 586   C CA  . ALA A 1 74   ? 279.257 -1.105  18.652  1.00 66.66  ? 143  ALA A CA  1 
ATOM 587   C C   . ALA A 1 74   ? 279.271 -0.348  19.942  1.00 68.51  ? 143  ALA A C   1 
ATOM 588   O O   . ALA A 1 74   ? 278.258 0.198   20.360  1.00 69.61  ? 143  ALA A O   1 
ATOM 589   C CB  . ALA A 1 74   ? 279.117 -2.607  18.937  1.00 65.69  ? 143  ALA A CB  1 
ATOM 590   N N   . GLN A 1 75   ? 280.451 -0.314  20.550  1.00 70.52  ? 144  GLN A N   1 
ATOM 591   C CA  . GLN A 1 75   ? 280.670 0.341   21.829  1.00 72.54  ? 144  GLN A CA  1 
ATOM 592   C C   . GLN A 1 75   ? 280.298 1.815   21.871  1.00 73.17  ? 144  GLN A C   1 
ATOM 593   O O   . GLN A 1 75   ? 279.565 2.239   22.774  1.00 71.99  ? 144  GLN A O   1 
ATOM 594   C CB  . GLN A 1 75   ? 282.128 0.190   22.259  1.00 73.81  ? 144  GLN A CB  1 
ATOM 595   C CG  . GLN A 1 75   ? 282.264 -0.084  23.728  1.00 75.22  ? 144  GLN A CG  1 
ATOM 596   C CD  . GLN A 1 75   ? 281.816 -1.487  24.075  1.00 75.53  ? 144  GLN A CD  1 
ATOM 597   O OE1 . GLN A 1 75   ? 282.581 -2.434  23.929  1.00 75.22  ? 144  GLN A OE1 1 
ATOM 598   N NE2 . GLN A 1 75   ? 280.568 -1.630  24.516  1.00 76.15  ? 144  GLN A NE2 1 
ATOM 599   N N   . LYS A 1 76   ? 280.807 2.597   20.916  1.00 74.17  ? 145  LYS A N   1 
ATOM 600   C CA  . LYS A 1 76   ? 280.515 4.026   20.881  1.00 75.25  ? 145  LYS A CA  1 
ATOM 601   C C   . LYS A 1 76   ? 279.021 4.308   20.783  1.00 75.99  ? 145  LYS A C   1 
ATOM 602   O O   . LYS A 1 76   ? 278.475 5.001   21.629  1.00 75.89  ? 145  LYS A O   1 
ATOM 603   C CB  . LYS A 1 76   ? 281.255 4.693   19.730  1.00 75.29  ? 145  LYS A CB  1 
ATOM 604   C CG  . LYS A 1 76   ? 282.752 4.801   19.933  1.00 75.30  ? 145  LYS A CG  1 
ATOM 605   C CD  . LYS A 1 76   ? 283.102 5.849   20.968  1.00 73.25  ? 145  LYS A CD  1 
ATOM 606   C CE  . LYS A 1 76   ? 284.612 6.153   21.008  1.00 71.69  ? 145  LYS A CE  1 
ATOM 607   N NZ  . LYS A 1 76   ? 285.119 7.047   19.912  1.00 69.80  ? 145  LYS A NZ  1 
ATOM 608   N N   . GLN A 1 77   ? 278.356 3.760   19.771  1.00 76.67  ? 146  GLN A N   1 
ATOM 609   C CA  . GLN A 1 77   ? 276.921 3.981   19.603  1.00 78.16  ? 146  GLN A CA  1 
ATOM 610   C C   . GLN A 1 77   ? 276.137 3.486   20.818  1.00 78.67  ? 146  GLN A C   1 
ATOM 611   O O   . GLN A 1 77   ? 275.386 4.232   21.446  1.00 78.65  ? 146  GLN A O   1 
ATOM 612   C CB  . GLN A 1 77   ? 276.425 3.271   18.338  1.00 80.03  ? 146  GLN A CB  1 
ATOM 613   C CG  . GLN A 1 77   ? 277.520 3.042   17.290  1.00 83.06  ? 146  GLN A CG  1 
ATOM 614   C CD  . GLN A 1 77   ? 276.998 2.951   15.851  1.00 82.70  ? 146  GLN A CD  1 
ATOM 615   O OE1 . GLN A 1 77   ? 276.608 3.956   15.243  1.00 82.72  ? 146  GLN A OE1 1 
ATOM 616   N NE2 . GLN A 1 77   ? 276.994 1.742   15.303  1.00 81.40  ? 146  GLN A NE2 1 
ATOM 617   N N   . SER A 1 78   ? 276.320 2.218   21.149  1.00 79.85  ? 147  SER A N   1 
ATOM 618   C CA  . SER A 1 78   ? 275.637 1.629   22.287  1.00 80.71  ? 147  SER A CA  1 
ATOM 619   C C   . SER A 1 78   ? 275.806 2.427   23.590  1.00 80.54  ? 147  SER A C   1 
ATOM 620   O O   . SER A 1 78   ? 274.848 2.594   24.326  1.00 80.54  ? 147  SER A O   1 
ATOM 621   C CB  . SER A 1 78   ? 276.117 0.182   22.486  1.00 81.83  ? 147  SER A CB  1 
ATOM 622   O OG  . SER A 1 78   ? 277.526 0.117   22.655  1.00 82.48  ? 147  SER A OG  1 
ATOM 623   N N   . LEU A 1 79   ? 276.998 2.956   23.860  1.00 79.91  ? 148  LEU A N   1 
ATOM 624   C CA  . LEU A 1 79   ? 277.238 3.676   25.116  1.00 79.55  ? 148  LEU A CA  1 
ATOM 625   C C   . LEU A 1 79   ? 276.500 4.971   25.470  1.00 78.68  ? 148  LEU A C   1 
ATOM 626   O O   . LEU A 1 79   ? 275.885 5.049   26.530  1.00 77.86  ? 148  LEU A O   1 
ATOM 627   C CB  . LEU A 1 79   ? 278.745 3.872   25.324  1.00 79.21  ? 148  LEU A CB  1 
ATOM 628   C CG  . LEU A 1 79   ? 279.336 2.673   26.079  1.00 78.53  ? 148  LEU A CG  1 
ATOM 629   C CD1 . LEU A 1 79   ? 280.848 2.814   26.259  1.00 76.22  ? 148  LEU A CD1 1 
ATOM 630   C CD2 . LEU A 1 79   ? 278.625 2.567   27.427  1.00 78.12  ? 148  LEU A CD2 1 
ATOM 631   N N   . PRO A 1 80   ? 276.558 6.010   24.625  1.00 77.94  ? 149  PRO A N   1 
ATOM 632   C CA  . PRO A 1 80   ? 275.819 7.198   25.054  1.00 77.49  ? 149  PRO A CA  1 
ATOM 633   C C   . PRO A 1 80   ? 274.378 6.870   25.402  1.00 77.43  ? 149  PRO A C   1 
ATOM 634   O O   . PRO A 1 80   ? 273.832 7.410   26.348  1.00 77.11  ? 149  PRO A O   1 
ATOM 635   C CB  . PRO A 1 80   ? 275.927 8.125   23.850  1.00 76.79  ? 149  PRO A CB  1 
ATOM 636   C CG  . PRO A 1 80   ? 276.060 7.182   22.714  1.00 76.90  ? 149  PRO A CG  1 
ATOM 637   C CD  . PRO A 1 80   ? 277.036 6.176   23.251  1.00 77.05  ? 149  PRO A CD  1 
ATOM 638   N N   . TYR A 1 81   ? 273.769 5.969   24.643  1.00 77.40  ? 150  TYR A N   1 
ATOM 639   C CA  . TYR A 1 81   ? 272.382 5.585   24.886  1.00 76.90  ? 150  TYR A CA  1 
ATOM 640   C C   . TYR A 1 81   ? 272.251 4.602   26.002  1.00 77.17  ? 150  TYR A C   1 
ATOM 641   O O   . TYR A 1 81   ? 271.174 4.430   26.566  1.00 76.69  ? 150  TYR A O   1 
ATOM 642   C CB  . TYR A 1 81   ? 271.759 4.983   23.635  1.00 75.01  ? 150  TYR A CB  1 
ATOM 643   C CG  . TYR A 1 81   ? 271.621 6.006   22.567  1.00 74.08  ? 150  TYR A CG  1 
ATOM 644   C CD1 . TYR A 1 81   ? 270.550 6.902   22.566  1.00 74.51  ? 150  TYR A CD1 1 
ATOM 645   C CD2 . TYR A 1 81   ? 272.628 6.171   21.628  1.00 73.82  ? 150  TYR A CD2 1 
ATOM 646   C CE1 . TYR A 1 81   ? 270.501 7.943   21.659  1.00 74.94  ? 150  TYR A CE1 1 
ATOM 647   C CE2 . TYR A 1 81   ? 272.590 7.198   20.730  1.00 74.63  ? 150  TYR A CE2 1 
ATOM 648   C CZ  . TYR A 1 81   ? 271.536 8.079   20.749  1.00 74.40  ? 150  TYR A CZ  1 
ATOM 649   O OH  . TYR A 1 81   ? 271.581 9.111   19.867  1.00 74.44  ? 150  TYR A OH  1 
ATOM 650   N N   . LEU A 1 82   ? 273.337 3.918   26.305  1.00 78.43  ? 151  LEU A N   1 
ATOM 651   C CA  . LEU A 1 82   ? 273.258 2.976   27.387  1.00 81.12  ? 151  LEU A CA  1 
ATOM 652   C C   . LEU A 1 82   ? 273.090 3.823   28.631  1.00 83.22  ? 151  LEU A C   1 
ATOM 653   O O   . LEU A 1 82   ? 272.200 3.575   29.442  1.00 83.03  ? 151  LEU A O   1 
ATOM 654   C CB  . LEU A 1 82   ? 274.530 2.115   27.479  1.00 81.77  ? 151  LEU A CB  1 
ATOM 655   C CG  . LEU A 1 82   ? 274.682 0.962   26.469  1.00 81.61  ? 151  LEU A CG  1 
ATOM 656   C CD1 . LEU A 1 82   ? 275.786 0.008   26.917  1.00 81.60  ? 151  LEU A CD1 1 
ATOM 657   C CD2 . LEU A 1 82   ? 273.360 0.205   26.351  1.00 80.87  ? 151  LEU A CD2 1 
ATOM 658   N N   . GLU A 1 83   ? 273.923 4.856   28.743  1.00 86.11  ? 152  GLU A N   1 
ATOM 659   C CA  . GLU A 1 83   ? 273.908 5.744   29.902  1.00 89.79  ? 152  GLU A CA  1 
ATOM 660   C C   . GLU A 1 83   ? 272.584 6.466   30.170  1.00 90.33  ? 152  GLU A C   1 
ATOM 661   O O   . GLU A 1 83   ? 272.117 6.482   31.308  1.00 90.45  ? 152  GLU A O   1 
ATOM 662   C CB  . GLU A 1 83   ? 275.057 6.763   29.801  1.00 92.04  ? 152  GLU A CB  1 
ATOM 663   C CG  . GLU A 1 83   ? 276.477 6.182   30.015  1.00 94.94  ? 152  GLU A CG  1 
ATOM 664   C CD  . GLU A 1 83   ? 276.790 5.805   31.477  1.00 95.77  ? 152  GLU A CD  1 
ATOM 665   O OE1 . GLU A 1 83   ? 277.964 5.481   31.773  1.00 96.30  ? 152  GLU A OE1 1 
ATOM 666   O OE2 . GLU A 1 83   ? 275.875 5.827   32.330  1.00 94.91  ? 152  GLU A OE2 1 
ATOM 667   N N   . ALA A 1 84   ? 271.981 7.061   29.143  1.00 90.61  ? 153  ALA A N   1 
ATOM 668   C CA  . ALA A 1 84   ? 270.712 7.765   29.327  1.00 90.12  ? 153  ALA A CA  1 
ATOM 669   C C   . ALA A 1 84   ? 269.571 6.778   29.606  1.00 89.25  ? 153  ALA A C   1 
ATOM 670   O O   . ALA A 1 84   ? 268.590 7.122   30.275  1.00 89.52  ? 153  ALA A O   1 
ATOM 671   C CB  . ALA A 1 84   ? 270.401 8.610   28.104  1.00 90.51  ? 153  ALA A CB  1 
ATOM 672   N N   . ALA A 1 85   ? 269.710 5.555   29.090  1.00 88.03  ? 154  ALA A N   1 
ATOM 673   C CA  . ALA A 1 85   ? 268.725 4.488   29.296  1.00 87.58  ? 154  ALA A CA  1 
ATOM 674   C C   . ALA A 1 85   ? 268.852 3.986   30.739  1.00 87.47  ? 154  ALA A C   1 
ATOM 675   O O   . ALA A 1 85   ? 267.855 3.797   31.439  1.00 87.40  ? 154  ALA A O   1 
ATOM 676   C CB  . ALA A 1 85   ? 268.983 3.343   28.315  1.00 87.55  ? 154  ALA A CB  1 
ATOM 677   N N   . ASN A 1 86   ? 270.097 3.782   31.166  1.00 87.41  ? 155  ASN A N   1 
ATOM 678   C CA  . ASN A 1 86   ? 270.414 3.325   32.521  1.00 87.38  ? 155  ASN A CA  1 
ATOM 679   C C   . ASN A 1 86   ? 269.531 4.015   33.544  1.00 87.89  ? 155  ASN A C   1 
ATOM 680   O O   . ASN A 1 86   ? 268.777 3.381   34.278  1.00 87.25  ? 155  ASN A O   1 
ATOM 681   C CB  . ASN A 1 86   ? 271.870 3.664   32.908  1.00 86.88  ? 155  ASN A CB  1 
ATOM 682   C CG  . ASN A 1 86   ? 272.899 2.772   32.244  1.00 86.18  ? 155  ASN A CG  1 
ATOM 683   O OD1 . ASN A 1 86   ? 272.840 1.550   32.349  1.00 86.32  ? 155  ASN A OD1 1 
ATOM 684   N ND2 . ASN A 1 86   ? 273.868 3.385   31.572  1.00 85.73  ? 155  ASN A ND2 1 
ATOM 685   N N   . LEU A 1 87   ? 269.662 5.336   33.585  1.00 88.88  ? 156  LEU A N   1 
ATOM 686   C CA  . LEU A 1 87   ? 268.944 6.168   34.534  1.00 89.22  ? 156  LEU A CA  1 
ATOM 687   C C   . LEU A 1 87   ? 267.423 6.115   34.378  1.00 89.42  ? 156  LEU A C   1 
ATOM 688   O O   . LEU A 1 87   ? 266.685 6.272   35.358  1.00 90.01  ? 156  LEU A O   1 
ATOM 689   C CB  . LEU A 1 87   ? 269.464 7.611   34.438  1.00 89.23  ? 156  LEU A CB  1 
ATOM 690   C CG  . LEU A 1 87   ? 270.986 7.835   34.511  1.00 90.08  ? 156  LEU A CG  1 
ATOM 691   C CD1 . LEU A 1 87   ? 271.242 9.029   35.417  1.00 89.41  ? 156  LEU A CD1 1 
ATOM 692   C CD2 . LEU A 1 87   ? 271.729 6.603   35.047  1.00 90.51  ? 156  LEU A CD2 1 
ATOM 693   N N   . LEU A 1 88   ? 266.946 5.890   33.160  1.00 88.64  ? 157  LEU A N   1 
ATOM 694   C CA  . LEU A 1 88   ? 265.509 5.810   32.961  1.00 88.23  ? 157  LEU A CA  1 
ATOM 695   C C   . LEU A 1 88   ? 265.055 4.516   33.577  1.00 88.42  ? 157  LEU A C   1 
ATOM 696   O O   . LEU A 1 88   ? 264.002 4.450   34.210  1.00 88.66  ? 157  LEU A O   1 
ATOM 697   C CB  . LEU A 1 88   ? 265.161 5.819   31.479  1.00 87.98  ? 157  LEU A CB  1 
ATOM 698   C CG  . LEU A 1 88   ? 264.339 7.030   31.039  1.00 87.97  ? 157  LEU A CG  1 
ATOM 699   C CD1 . LEU A 1 88   ? 263.069 6.554   30.376  1.00 88.00  ? 157  LEU A CD1 1 
ATOM 700   C CD2 . LEU A 1 88   ? 264.006 7.905   32.235  1.00 88.64  ? 157  LEU A CD2 1 
ATOM 701   N N   . LEU A 1 89   ? 265.886 3.496   33.398  1.00 88.83  ? 158  LEU A N   1 
ATOM 702   C CA  . LEU A 1 89   ? 265.612 2.170   33.918  1.00 88.93  ? 158  LEU A CA  1 
ATOM 703   C C   . LEU A 1 89   ? 265.638 2.050   35.435  1.00 88.15  ? 158  LEU A C   1 
ATOM 704   O O   . LEU A 1 89   ? 264.758 1.413   36.002  1.00 87.35  ? 158  LEU A O   1 
ATOM 705   C CB  . LEU A 1 89   ? 266.581 1.153   33.318  1.00 90.40  ? 158  LEU A CB  1 
ATOM 706   C CG  . LEU A 1 89   ? 266.156 0.574   31.969  1.00 91.25  ? 158  LEU A CG  1 
ATOM 707   C CD1 . LEU A 1 89   ? 265.891 1.711   30.988  1.00 89.73  ? 158  LEU A CD1 1 
ATOM 708   C CD2 . LEU A 1 89   ? 267.245 -0.358  31.438  1.00 92.60  ? 158  LEU A CD2 1 
ATOM 709   N N   . GLN A 1 90   ? 266.627 2.643   36.103  1.00 87.60  ? 159  GLN A N   1 
ATOM 710   C CA  . GLN A 1 90   ? 266.696 2.540   37.571  1.00 87.45  ? 159  GLN A CA  1 
ATOM 711   C C   . GLN A 1 90   ? 265.794 3.547   38.301  1.00 88.26  ? 159  GLN A C   1 
ATOM 712   O O   . GLN A 1 90   ? 265.577 3.424   39.514  1.00 88.79  ? 159  GLN A O   1 
ATOM 713   C CB  . GLN A 1 90   ? 268.159 2.674   38.056  1.00 85.66  ? 159  GLN A CB  1 
ATOM 714   C CG  . GLN A 1 90   ? 268.391 2.704   39.599  1.00 83.25  ? 159  GLN A CG  1 
ATOM 715   C CD  . GLN A 1 90   ? 267.822 1.503   40.369  1.00 82.04  ? 159  GLN A CD  1 
ATOM 716   O OE1 . GLN A 1 90   ? 268.067 0.339   40.028  1.00 82.11  ? 159  GLN A OE1 1 
ATOM 717   N NE2 . GLN A 1 90   ? 267.076 1.793   41.430  1.00 81.45  ? 159  GLN A NE2 1 
ATOM 718   N N   . ALA A 1 91   ? 265.255 4.516   37.555  1.00 88.60  ? 160  ALA A N   1 
ATOM 719   C CA  . ALA A 1 91   ? 264.364 5.561   38.091  1.00 89.76  ? 160  ALA A CA  1 
ATOM 720   C C   . ALA A 1 91   ? 263.331 5.061   39.127  1.00 90.27  ? 160  ALA A C   1 
ATOM 721   O O   . ALA A 1 91   ? 262.641 4.056   38.913  1.00 89.79  ? 160  ALA A O   1 
ATOM 722   C CB  . ALA A 1 91   ? 263.658 6.275   36.933  1.00 89.39  ? 160  ALA A CB  1 
ATOM 723   N N   . GLN A 1 92   ? 263.207 5.811   40.224  1.00 91.44  ? 161  GLN A N   1 
ATOM 724   C CA  . GLN A 1 92   ? 262.345 5.456   41.348  1.00 92.79  ? 161  GLN A CA  1 
ATOM 725   C C   . GLN A 1 92   ? 260.908 5.933   41.443  1.00 93.39  ? 161  GLN A C   1 
ATOM 726   O O   . GLN A 1 92   ? 260.075 5.195   41.937  1.00 93.80  ? 161  GLN A O   1 
ATOM 727   C CB  . GLN A 1 92   ? 263.026 5.871   42.648  1.00 92.93  ? 161  GLN A CB  1 
ATOM 728   C CG  . GLN A 1 92   ? 262.932 4.875   43.786  1.00 92.06  ? 161  GLN A CG  1 
ATOM 729   C CD  . GLN A 1 92   ? 264.249 4.136   44.011  1.00 91.39  ? 161  GLN A CD  1 
ATOM 730   O OE1 . GLN A 1 92   ? 265.332 4.713   43.859  1.00 90.85  ? 161  GLN A OE1 1 
ATOM 731   N NE2 . GLN A 1 92   ? 264.164 2.861   44.391  1.00 90.92  ? 161  GLN A NE2 1 
ATOM 732   N N   . LEU A 1 93   ? 260.610 7.147   40.999  1.00 93.65  ? 162  LEU A N   1 
ATOM 733   C CA  . LEU A 1 93   ? 259.254 7.705   41.137  1.00 93.27  ? 162  LEU A CA  1 
ATOM 734   C C   . LEU A 1 93   ? 258.132 7.262   40.159  1.00 92.87  ? 162  LEU A C   1 
ATOM 735   O O   . LEU A 1 93   ? 257.869 7.942   39.169  1.00 90.69  ? 162  LEU A O   1 
ATOM 736   C CB  . LEU A 1 93   ? 259.367 9.231   41.128  1.00 93.46  ? 162  LEU A CB  1 
ATOM 737   C CG  . LEU A 1 93   ? 260.635 9.799   41.777  1.00 93.43  ? 162  LEU A CG  1 
ATOM 738   C CD1 . LEU A 1 93   ? 260.545 11.312  41.822  1.00 94.88  ? 162  LEU A CD1 1 
ATOM 739   C CD2 . LEU A 1 93   ? 260.804 9.234   43.173  1.00 93.19  ? 162  LEU A CD2 1 
ATOM 740   N N   . PRO A 1 94   ? 257.416 6.155   40.472  1.00 93.66  ? 163  PRO A N   1 
ATOM 741   C CA  . PRO A 1 94   ? 256.309 5.504   39.737  1.00 95.64  ? 163  PRO A CA  1 
ATOM 742   C C   . PRO A 1 94   ? 255.234 6.356   38.982  1.00 94.71  ? 163  PRO A C   1 
ATOM 743   O O   . PRO A 1 94   ? 255.582 7.259   38.214  1.00 95.44  ? 163  PRO A O   1 
ATOM 744   C CB  . PRO A 1 94   ? 255.719 4.570   40.804  1.00 95.57  ? 163  PRO A CB  1 
ATOM 745   C CG  . PRO A 1 94   ? 256.919 4.155   41.572  1.00 95.37  ? 163  PRO A CG  1 
ATOM 746   C CD  . PRO A 1 94   ? 257.594 5.497   41.781  1.00 94.66  ? 163  PRO A CD  1 
ATOM 747   N N   . PRO A 1 95   ? 253.920 6.060   39.161  1.00 93.04  ? 164  PRO A N   1 
ATOM 748   C CA  . PRO A 1 95   ? 252.948 6.884   38.427  1.00 92.77  ? 164  PRO A CA  1 
ATOM 749   C C   . PRO A 1 95   ? 252.171 7.940   39.230  1.00 92.21  ? 164  PRO A C   1 
ATOM 750   O O   . PRO A 1 95   ? 251.829 7.731   40.402  1.00 92.59  ? 164  PRO A O   1 
ATOM 751   C CB  . PRO A 1 95   ? 251.988 5.845   37.832  1.00 92.04  ? 164  PRO A CB  1 
ATOM 752   C CG  . PRO A 1 95   ? 252.442 4.474   38.430  1.00 92.54  ? 164  PRO A CG  1 
ATOM 753   C CD  . PRO A 1 95   ? 253.252 4.832   39.623  1.00 93.55  ? 164  PRO A CD  1 
ATOM 754   N N   . LYS A 1 96   ? 251.867 9.064   38.582  1.00 91.35  ? 165  LYS A N   1 
ATOM 755   C CA  . LYS A 1 96   ? 251.102 10.127  39.228  1.00 89.52  ? 165  LYS A CA  1 
ATOM 756   C C   . LYS A 1 96   ? 250.029 10.670  38.271  1.00 89.47  ? 165  LYS A C   1 
ATOM 757   O O   . LYS A 1 96   ? 250.313 11.552  37.466  1.00 89.41  ? 165  LYS A O   1 
ATOM 758   C CB  . LYS A 1 96   ? 252.037 11.256  39.669  1.00 88.02  ? 165  LYS A CB  1 
ATOM 759   C CG  . LYS A 1 96   ? 253.308 10.797  40.390  1.00 87.30  ? 165  LYS A CG  1 
ATOM 760   C CD  . LYS A 1 96   ? 253.029 10.159  41.743  1.00 84.97  ? 165  LYS A CD  1 
ATOM 761   C CE  . LYS A 1 96   ? 253.684 10.944  42.870  1.00 84.07  ? 165  LYS A CE  1 
ATOM 762   N NZ  . LYS A 1 96   ? 255.171 11.043  42.744  1.00 83.21  ? 165  LYS A NZ  1 
ATOM 763   N N   . PRO A 1 97   ? 248.803 10.102  38.328  1.00 89.07  ? 166  PRO A N   1 
ATOM 764   C CA  . PRO A 1 97   ? 247.656 10.484  37.507  1.00 87.34  ? 166  PRO A CA  1 
ATOM 765   C C   . PRO A 1 97   ? 247.008 11.619  38.241  1.00 86.89  ? 166  PRO A C   1 
ATOM 766   O O   . PRO A 1 97   ? 246.208 11.423  39.166  1.00 87.64  ? 166  PRO A O   1 
ATOM 767   C CB  . PRO A 1 97   ? 246.756 9.267   37.533  1.00 87.88  ? 166  PRO A CB  1 
ATOM 768   C CG  . PRO A 1 97   ? 247.612 8.209   37.938  1.00 87.78  ? 166  PRO A CG  1 
ATOM 769   C CD  . PRO A 1 97   ? 248.529 8.804   38.941  1.00 88.74  ? 166  PRO A CD  1 
ATOM 770   N N   . PRO A 1 98   ? 247.384 12.841  37.878  1.00 86.12  ? 167  PRO A N   1 
ATOM 771   C CA  . PRO A 1 98   ? 246.804 14.005  38.537  1.00 85.49  ? 167  PRO A CA  1 
ATOM 772   C C   . PRO A 1 98   ? 245.400 14.178  37.919  1.00 85.90  ? 167  PRO A C   1 
ATOM 773   O O   . PRO A 1 98   ? 244.869 13.211  37.365  1.00 86.27  ? 167  PRO A O   1 
ATOM 774   C CB  . PRO A 1 98   ? 247.833 15.098  38.211  1.00 85.31  ? 167  PRO A CB  1 
ATOM 775   C CG  . PRO A 1 98   ? 249.075 14.230  37.621  1.00 83.64  ? 167  PRO A CG  1 
ATOM 776   C CD  . PRO A 1 98   ? 248.362 13.263  36.868  1.00 84.33  ? 167  PRO A CD  1 
ATOM 777   N N   . ALA A 1 99   ? 244.761 15.340  38.019  1.00 85.54  ? 168  ALA A N   1 
ATOM 778   C CA  . ALA A 1 99   ? 243.445 15.436  37.418  1.00 84.99  ? 168  ALA A CA  1 
ATOM 779   C C   . ALA A 1 99   ? 243.540 14.753  36.065  1.00 83.93  ? 168  ALA A C   1 
ATOM 780   O O   . ALA A 1 99   ? 242.964 13.693  35.859  1.00 83.99  ? 168  ALA A O   1 
ATOM 781   C CB  . ALA A 1 99   ? 243.039 16.892  37.269  1.00 85.81  ? 168  ALA A CB  1 
ATOM 782   N N   . TRP A 1 100  ? 244.328 15.360  35.175  1.00 82.51  ? 169  TRP A N   1 
ATOM 783   C CA  . TRP A 1 100  ? 244.593 14.916  33.783  1.00 82.23  ? 169  TRP A CA  1 
ATOM 784   C C   . TRP A 1 100  ? 245.321 15.982  32.943  1.00 83.43  ? 169  TRP A C   1 
ATOM 785   O O   . TRP A 1 100  ? 246.490 15.750  32.603  1.00 84.37  ? 169  TRP A O   1 
ATOM 786   C CB  . TRP A 1 100  ? 243.308 14.506  33.064  1.00 80.53  ? 169  TRP A CB  1 
ATOM 787   C CG  . TRP A 1 100  ? 242.108 15.213  33.572  1.00 77.43  ? 169  TRP A CG  1 
ATOM 788   C CD1 . TRP A 1 100  ? 242.014 16.534  33.928  1.00 76.54  ? 169  TRP A CD1 1 
ATOM 789   C CD2 . TRP A 1 100  ? 240.796 14.664  33.725  1.00 74.50  ? 169  TRP A CD2 1 
ATOM 790   N NE1 . TRP A 1 100  ? 240.723 16.841  34.287  1.00 74.66  ? 169  TRP A NE1 1 
ATOM 791   C CE2 . TRP A 1 100  ? 239.952 15.711  34.169  1.00 73.69  ? 169  TRP A CE2 1 
ATOM 792   C CE3 . TRP A 1 100  ? 240.247 13.392  33.527  1.00 71.74  ? 169  TRP A CE3 1 
ATOM 793   C CZ2 . TRP A 1 100  ? 238.578 15.515  34.414  1.00 71.89  ? 169  TRP A CZ2 1 
ATOM 794   C CZ3 . TRP A 1 100  ? 238.886 13.204  33.772  1.00 69.85  ? 169  TRP A CZ3 1 
ATOM 795   C CH2 . TRP A 1 100  ? 238.070 14.255  34.207  1.00 69.71  ? 169  TRP A CH2 1 
ATOM 796   N N   . ALA A 1 101  ? 244.651 17.110  32.607  1.00 84.77  ? 170  ALA A N   1 
ATOM 797   C CA  . ALA A 1 101  ? 245.263 18.241  31.847  1.00 86.06  ? 170  ALA A CA  1 
ATOM 798   C C   . ALA A 1 101  ? 244.714 18.713  30.455  1.00 86.47  ? 170  ALA A C   1 
ATOM 799   O O   . ALA A 1 101  ? 243.528 18.967  30.308  1.00 85.45  ? 170  ALA A O   1 
ATOM 800   C CB  . ALA A 1 101  ? 246.739 17.999  31.730  1.00 87.05  ? 170  ALA A CB  1 
ATOM 801   N N   . TRP A 1 102  ? 245.621 18.947  29.487  1.00 86.91  ? 171  TRP A N   1 
ATOM 802   C CA  . TRP A 1 102  ? 245.289 19.361  28.108  1.00 86.75  ? 171  TRP A CA  1 
ATOM 803   C C   . TRP A 1 102  ? 246.372 19.338  26.983  1.00 85.99  ? 171  TRP A C   1 
ATOM 804   O O   . TRP A 1 102  ? 246.603 18.278  26.407  1.00 86.04  ? 171  TRP A O   1 
ATOM 805   C CB  . TRP A 1 102  ? 244.539 20.712  28.102  1.00 87.61  ? 171  TRP A CB  1 
ATOM 806   C CG  . TRP A 1 102  ? 245.199 21.887  28.763  1.00 88.67  ? 171  TRP A CG  1 
ATOM 807   C CD1 . TRP A 1 102  ? 245.236 22.170  30.102  1.00 89.87  ? 171  TRP A CD1 1 
ATOM 808   C CD2 . TRP A 1 102  ? 245.841 22.988  28.104  1.00 88.61  ? 171  TRP A CD2 1 
ATOM 809   N NE1 . TRP A 1 102  ? 245.856 23.383  30.314  1.00 90.27  ? 171  TRP A NE1 1 
ATOM 810   C CE2 . TRP A 1 102  ? 246.237 23.905  29.104  1.00 89.08  ? 171  TRP A CE2 1 
ATOM 811   C CE3 . TRP A 1 102  ? 246.119 23.289  26.764  1.00 87.95  ? 171  TRP A CE3 1 
ATOM 812   C CZ2 . TRP A 1 102  ? 246.895 25.107  28.803  1.00 88.56  ? 171  TRP A CZ2 1 
ATOM 813   C CZ3 . TRP A 1 102  ? 246.774 24.484  26.467  1.00 86.94  ? 171  TRP A CZ3 1 
ATOM 814   C CH2 . TRP A 1 102  ? 247.152 25.377  27.483  1.00 87.00  ? 171  TRP A CH2 1 
ATOM 815   N N   . ALA A 1 103  ? 247.048 20.444  26.664  1.00 84.82  ? 172  ALA A N   1 
ATOM 816   C CA  . ALA A 1 103  ? 247.991 20.379  25.536  1.00 83.37  ? 172  ALA A CA  1 
ATOM 817   C C   . ALA A 1 103  ? 249.433 20.878  25.552  1.00 82.55  ? 172  ALA A C   1 
ATOM 818   O O   . ALA A 1 103  ? 249.694 22.036  25.855  1.00 82.45  ? 172  ALA A O   1 
ATOM 819   C CB  . ALA A 1 103  ? 247.328 20.981  24.329  1.00 83.07  ? 172  ALA A CB  1 
ATOM 820   N N   . GLU A 1 104  ? 250.345 19.989  25.148  1.00 81.25  ? 173  GLU A N   1 
ATOM 821   C CA  . GLU A 1 104  ? 251.786 20.251  24.998  1.00 79.09  ? 173  GLU A CA  1 
ATOM 822   C C   . GLU A 1 104  ? 252.768 19.873  26.077  1.00 77.92  ? 173  GLU A C   1 
ATOM 823   O O   . GLU A 1 104  ? 253.975 20.043  25.887  1.00 76.39  ? 173  GLU A O   1 
ATOM 824   C CB  . GLU A 1 104  ? 252.045 21.703  24.640  1.00 78.89  ? 173  GLU A CB  1 
ATOM 825   C CG  . GLU A 1 104  ? 251.452 22.116  23.326  1.00 77.33  ? 173  GLU A CG  1 
ATOM 826   C CD  . GLU A 1 104  ? 251.696 23.566  23.055  1.00 76.18  ? 173  GLU A CD  1 
ATOM 827   O OE1 . GLU A 1 104  ? 252.278 24.231  23.914  1.00 75.69  ? 173  GLU A OE1 1 
ATOM 828   O OE2 . GLU A 1 104  ? 251.316 24.060  21.993  1.00 74.26  ? 173  GLU A OE2 1 
ATOM 829   N N   . GLY A 1 105  ? 252.294 19.395  27.218  1.00 76.92  ? 174  GLY A N   1 
ATOM 830   C CA  . GLY A 1 105  ? 253.262 18.973  28.213  1.00 76.73  ? 174  GLY A CA  1 
ATOM 831   C C   . GLY A 1 105  ? 253.200 19.348  29.669  1.00 75.95  ? 174  GLY A C   1 
ATOM 832   O O   . GLY A 1 105  ? 252.294 18.926  30.390  1.00 74.51  ? 174  GLY A O   1 
ATOM 833   N N   . TRP A 1 106  ? 254.236 20.084  30.071  1.00 69.10  ? 175  TRP A N   1 
ATOM 834   C CA  . TRP A 1 106  ? 254.466 20.588  31.414  1.00 69.38  ? 175  TRP A CA  1 
ATOM 835   C C   . TRP A 1 106  ? 254.977 19.640  32.489  1.00 63.42  ? 175  TRP A C   1 
ATOM 836   O O   . TRP A 1 106  ? 256.078 19.846  32.989  1.00 63.74  ? 175  TRP A O   1 
ATOM 837   C CB  . TRP A 1 106  ? 253.258 21.335  31.934  1.00 68.71  ? 175  TRP A CB  1 
ATOM 838   C CG  . TRP A 1 106  ? 252.020 20.619  32.122  1.00 68.57  ? 175  TRP A CG  1 
ATOM 839   C CD1 . TRP A 1 106  ? 251.714 19.696  33.086  1.00 80.73  ? 175  TRP A CD1 1 
ATOM 840   C CD2 . TRP A 1 106  ? 250.854 20.795  31.341  1.00 68.46  ? 175  TRP A CD2 1 
ATOM 841   N NE1 . TRP A 1 106  ? 250.412 19.290  32.949  1.00 80.60  ? 175  TRP A NE1 1 
ATOM 842   C CE2 . TRP A 1 106  ? 249.864 19.952  31.879  1.00 72.07  ? 175  TRP A CE2 1 
ATOM 843   C CE3 . TRP A 1 106  ? 250.548 21.589  30.223  1.00 73.52  ? 175  TRP A CE3 1 
ATOM 844   C CZ2 . TRP A 1 106  ? 248.594 19.885  31.344  1.00 73.78  ? 175  TRP A CZ2 1 
ATOM 845   C CZ3 . TRP A 1 106  ? 249.286 21.521  29.692  1.00 73.22  ? 175  TRP A CZ3 1 
ATOM 846   C CH2 . TRP A 1 106  ? 248.317 20.670  30.253  1.00 63.90  ? 175  TRP A CH2 1 
ATOM 847   N N   . THR A 1 107  ? 254.196 18.630  32.862  1.00 63.45  ? 176  THR A N   1 
ATOM 848   C CA  . THR A 1 107  ? 254.591 17.642  33.877  1.00 64.10  ? 176  THR A CA  1 
ATOM 849   C C   . THR A 1 107  ? 253.434 17.069  34.631  1.00 63.70  ? 176  THR A C   1 
ATOM 850   O O   . THR A 1 107  ? 252.675 16.249  34.161  1.00 58.21  ? 176  THR A O   1 
ATOM 851   C CB  . THR A 1 107  ? 255.573 18.168  35.018  1.00 63.46  ? 176  THR A CB  1 
ATOM 852   O OG1 . THR A 1 107  ? 255.741 17.117  35.987  1.00 64.14  ? 176  THR A OG1 1 
ATOM 853   C CG2 . THR A 1 107  ? 255.068 19.433  35.721  1.00 64.33  ? 176  THR A CG2 1 
ATOM 854   N N   . ARG A 1 108  ? 253.419 17.468  35.878  1.00 57.69  ? 177  ARG A N   1 
ATOM 855   C CA  . ARG A 1 108  ? 252.400 17.162  36.794  1.00 58.36  ? 177  ARG A CA  1 
ATOM 856   C C   . ARG A 1 108  ? 252.423 15.925  37.656  1.00 58.24  ? 177  ARG A C   1 
ATOM 857   O O   . ARG A 1 108  ? 251.590 15.813  38.565  1.00 58.06  ? 177  ARG A O   1 
ATOM 858   C CB  . ARG A 1 108  ? 251.098 17.398  36.078  1.00 58.05  ? 177  ARG A CB  1 
ATOM 859   C CG  . ARG A 1 108  ? 250.307 16.297  35.561  1.00 57.45  ? 177  ARG A CG  1 
ATOM 860   C CD  . ARG A 1 108  ? 248.957 16.953  35.563  1.00 57.69  ? 177  ARG A CD  1 
ATOM 861   N NE  . ARG A 1 108  ? 248.735 17.427  36.930  1.00 57.64  ? 177  ARG A NE  1 
ATOM 862   C CZ  . ARG A 1 108  ? 247.616 17.962  37.372  1.00 57.95  ? 177  ARG A CZ  1 
ATOM 863   N NH1 . ARG A 1 108  ? 246.605 18.117  36.538  1.00 57.80  ? 177  ARG A NH1 1 
ATOM 864   N NH2 . ARG A 1 108  ? 247.499 18.255  38.658  1.00 57.98  ? 177  ARG A NH2 1 
ATOM 865   N N   . TYR A 1 109  ? 253.341 14.988  37.418  1.00 58.23  ? 178  TYR A N   1 
ATOM 866   C CA  . TYR A 1 109  ? 253.418 13.904  38.390  1.00 59.39  ? 178  TYR A CA  1 
ATOM 867   C C   . TYR A 1 109  ? 253.827 14.928  39.434  1.00 55.31  ? 178  TYR A C   1 
ATOM 868   O O   . TYR A 1 109  ? 254.810 15.640  39.239  1.00 55.11  ? 178  TYR A O   1 
ATOM 869   C CB  . TYR A 1 109  ? 254.561 12.889  38.098  1.00 50.67  ? 178  TYR A CB  1 
ATOM 870   C CG  . TYR A 1 109  ? 256.036 13.317  38.271  1.00 50.67  ? 178  TYR A CG  1 
ATOM 871   C CD1 . TYR A 1 109  ? 256.860 12.739  39.269  1.00 50.67  ? 178  TYR A CD1 1 
ATOM 872   C CD2 . TYR A 1 109  ? 256.639 14.195  37.360  1.00 50.67  ? 178  TYR A CD2 1 
ATOM 873   C CE1 . TYR A 1 109  ? 258.247 13.020  39.333  1.00 50.67  ? 178  TYR A CE1 1 
ATOM 874   C CE2 . TYR A 1 109  ? 258.023 14.483  37.417  1.00 50.67  ? 178  TYR A CE2 1 
ATOM 875   C CZ  . TYR A 1 109  ? 258.821 13.892  38.397  1.00 41.67  ? 178  TYR A CZ  1 
ATOM 876   O OH  . TYR A 1 109  ? 260.188 14.154  38.401  1.00 50.67  ? 178  TYR A OH  1 
ATOM 877   N N   . GLY A 1 110  ? 253.063 15.099  40.500  1.00 62.69  ? 179  GLY A N   1 
ATOM 878   C CA  . GLY A 1 110  ? 253.493 16.138  41.408  1.00 62.55  ? 179  GLY A CA  1 
ATOM 879   C C   . GLY A 1 110  ? 253.272 16.082  42.893  1.00 62.70  ? 179  GLY A C   1 
ATOM 880   O O   . GLY A 1 110  ? 252.383 15.384  43.405  1.00 62.86  ? 179  GLY A O   1 
ATOM 881   N N   . PRO A 1 111  ? 254.118 16.834  43.619  1.00 66.63  ? 180  PRO A N   1 
ATOM 882   C CA  . PRO A 1 111  ? 254.035 16.915  45.083  1.00 67.08  ? 180  PRO A CA  1 
ATOM 883   C C   . PRO A 1 111  ? 252.627 17.495  45.178  1.00 66.88  ? 180  PRO A C   1 
ATOM 884   O O   . PRO A 1 111  ? 251.865 17.303  46.143  1.00 67.25  ? 180  PRO A O   1 
ATOM 885   C CB  . PRO A 1 111  ? 255.109 17.957  45.430  1.00 67.04  ? 180  PRO A CB  1 
ATOM 886   C CG  . PRO A 1 111  ? 256.066 17.910  44.232  1.00 66.77  ? 180  PRO A CG  1 
ATOM 887   C CD  . PRO A 1 111  ? 255.122 17.775  43.081  1.00 67.33  ? 180  PRO A CD  1 
ATOM 888   N N   . GLU A 1 112  ? 252.332 18.194  44.084  1.00 72.58  ? 181  GLU A N   1 
ATOM 889   C CA  . GLU A 1 112  ? 251.082 18.850  43.827  1.00 75.20  ? 181  GLU A CA  1 
ATOM 890   C C   . GLU A 1 112  ? 250.747 18.866  42.330  1.00 74.87  ? 181  GLU A C   1 
ATOM 891   O O   . GLU A 1 112  ? 249.995 18.010  41.839  1.00 74.94  ? 181  GLU A O   1 
ATOM 892   C CB  . GLU A 1 112  ? 251.111 20.285  44.362  1.00 72.80  ? 181  GLU A CB  1 
ATOM 893   C CG  . GLU A 1 112  ? 250.087 21.226  43.694  1.00 73.28  ? 181  GLU A CG  1 
ATOM 894   C CD  . GLU A 1 112  ? 248.755 20.542  43.357  1.00 73.04  ? 181  GLU A CD  1 
ATOM 895   O OE1 . GLU A 1 112  ? 248.142 19.918  44.251  1.00 72.55  ? 181  GLU A OE1 1 
ATOM 896   O OE2 . GLU A 1 112  ? 248.322 20.629  42.189  1.00 72.63  ? 181  GLU A OE2 1 
ATOM 897   N N   . GLY A 1 113  ? 251.338 19.799  41.588  1.00 75.32  ? 182  GLY A N   1 
ATOM 898   C CA  . GLY A 1 113  ? 250.924 19.912  40.208  1.00 75.37  ? 182  GLY A CA  1 
ATOM 899   C C   . GLY A 1 113  ? 251.709 19.989  38.922  1.00 74.41  ? 182  GLY A C   1 
ATOM 900   O O   . GLY A 1 113  ? 252.459 19.082  38.594  1.00 74.94  ? 182  GLY A O   1 
ATOM 901   N N   . GLU A 1 114  ? 251.545 21.097  38.194  1.00 86.78  ? 183  GLU A N   1 
ATOM 902   C CA  . GLU A 1 114  ? 252.134 21.178  36.860  1.00 85.85  ? 183  GLU A CA  1 
ATOM 903   C C   . GLU A 1 114  ? 252.488 22.478  36.132  1.00 85.67  ? 183  GLU A C   1 
ATOM 904   O O   . GLU A 1 114  ? 252.562 23.570  36.690  1.00 84.72  ? 183  GLU A O   1 
ATOM 905   C CB  . GLU A 1 114  ? 251.190 20.429  35.924  1.00 85.34  ? 183  GLU A CB  1 
ATOM 906   C CG  . GLU A 1 114  ? 250.011 21.269  35.319  1.00 85.40  ? 183  GLU A CG  1 
ATOM 907   C CD  . GLU A 1 114  ? 249.806 22.675  35.931  1.00 85.07  ? 183  GLU A CD  1 
ATOM 908   O OE1 . GLU A 1 114  ? 249.813 23.684  35.181  1.00 84.92  ? 183  GLU A OE1 1 
ATOM 909   O OE2 . GLU A 1 114  ? 249.628 22.772  37.161  1.00 84.63  ? 183  GLU A OE2 1 
ATOM 910   N N   . ALA A 1 115  ? 252.644 22.276  34.821  1.00 86.17  ? 184  ALA A N   1 
ATOM 911   C CA  . ALA A 1 115  ? 252.925 23.266  33.784  1.00 86.64  ? 184  ALA A CA  1 
ATOM 912   C C   . ALA A 1 115  ? 254.370 23.541  33.377  1.00 87.06  ? 184  ALA A C   1 
ATOM 913   O O   . ALA A 1 115  ? 255.196 22.635  33.350  1.00 86.31  ? 184  ALA A O   1 
ATOM 914   C CB  . ALA A 1 115  ? 252.187 24.561  34.062  1.00 86.30  ? 184  ALA A CB  1 
ATOM 915   N N   . VAL A 1 116  ? 254.639 24.787  33.002  1.00 87.97  ? 185  VAL A N   1 
ATOM 916   C CA  . VAL A 1 116  ? 255.949 25.254  32.530  1.00 88.61  ? 185  VAL A CA  1 
ATOM 917   C C   . VAL A 1 116  ? 256.376 24.682  31.172  1.00 89.61  ? 185  VAL A C   1 
ATOM 918   O O   . VAL A 1 116  ? 257.552 24.778  30.804  1.00 88.97  ? 185  VAL A O   1 
ATOM 919   C CB  . VAL A 1 116  ? 257.114 25.009  33.563  1.00 88.37  ? 185  VAL A CB  1 
ATOM 920   C CG1 . VAL A 1 116  ? 257.598 23.565  33.527  1.00 87.96  ? 185  VAL A CG1 1 
ATOM 921   C CG2 . VAL A 1 116  ? 258.286 25.943  33.253  1.00 87.46  ? 185  VAL A CG2 1 
ATOM 922   N N   . PRO A 1 117  ? 255.442 24.078  30.401  1.00 90.77  ? 186  PRO A N   1 
ATOM 923   C CA  . PRO A 1 117  ? 255.984 23.591  29.138  1.00 91.55  ? 186  PRO A CA  1 
ATOM 924   C C   . PRO A 1 117  ? 255.920 24.723  28.122  1.00 92.87  ? 186  PRO A C   1 
ATOM 925   O O   . PRO A 1 117  ? 254.880 24.974  27.502  1.00 92.97  ? 186  PRO A O   1 
ATOM 926   C CB  . PRO A 1 117  ? 255.047 22.454  28.779  1.00 91.07  ? 186  PRO A CB  1 
ATOM 927   C CG  . PRO A 1 117  ? 253.722 23.018  29.159  1.00 91.35  ? 186  PRO A CG  1 
ATOM 928   C CD  . PRO A 1 117  ? 253.989 23.818  30.462  1.00 91.16  ? 186  PRO A CD  1 
ATOM 929   N N   . VAL A 1 118  ? 257.023 25.450  28.006  1.00 93.96  ? 187  VAL A N   1 
ATOM 930   C CA  . VAL A 1 118  ? 257.100 26.512  27.027  1.00 94.41  ? 187  VAL A CA  1 
ATOM 931   C C   . VAL A 1 118  ? 257.744 25.704  25.915  1.00 95.61  ? 187  VAL A C   1 
ATOM 932   O O   . VAL A 1 118  ? 257.562 26.011  24.739  1.00 96.05  ? 187  VAL A O   1 
ATOM 933   C CB  . VAL A 1 118  ? 258.099 27.681  27.429  1.00 93.58  ? 187  VAL A CB  1 
ATOM 934   C CG1 . VAL A 1 118  ? 257.420 29.048  27.303  1.00 92.95  ? 187  VAL A CG1 1 
ATOM 935   C CG2 . VAL A 1 118  ? 258.634 27.478  28.836  1.00 93.66  ? 187  VAL A CG2 1 
ATOM 936   N N   . ALA A 1 119  ? 258.440 24.618  26.276  1.00 96.49  ? 188  ALA A N   1 
ATOM 937   C CA  . ALA A 1 119  ? 259.147 23.920  25.223  1.00 96.70  ? 188  ALA A CA  1 
ATOM 938   C C   . ALA A 1 119  ? 259.570 22.465  25.072  1.00 96.39  ? 188  ALA A C   1 
ATOM 939   O O   . ALA A 1 119  ? 259.913 22.143  23.955  1.00 95.94  ? 188  ALA A O   1 
ATOM 940   C CB  . ALA A 1 119  ? 260.357 24.757  24.884  1.00 96.42  ? 188  ALA A CB  1 
ATOM 941   N N   . ILE A 1 120  ? 259.613 21.600  26.091  1.00 95.82  ? 189  ILE A N   1 
ATOM 942   C CA  . ILE A 1 120  ? 260.058 20.186  25.874  1.00 95.01  ? 189  ILE A CA  1 
ATOM 943   C C   . ILE A 1 120  ? 260.774 19.528  27.062  1.00 94.46  ? 189  ILE A C   1 
ATOM 944   O O   . ILE A 1 120  ? 261.067 20.178  28.058  1.00 93.71  ? 189  ILE A O   1 
ATOM 945   C CB  . ILE A 1 120  ? 261.115 20.024  24.745  1.00 95.57  ? 189  ILE A CB  1 
ATOM 946   C CG1 . ILE A 1 120  ? 262.163 21.117  24.918  1.00 96.11  ? 189  ILE A CG1 1 
ATOM 947   C CG2 . ILE A 1 120  ? 260.466 19.914  23.371  1.00 94.93  ? 189  ILE A CG2 1 
ATOM 948   C CD1 . ILE A 1 120  ? 263.354 20.938  24.063  1.00 91.71  ? 189  ILE A CD1 1 
ATOM 949   N N   . PRO A 1 121  ? 261.089 18.218  26.945  1.00 94.56  ? 190  PRO A N   1 
ATOM 950   C CA  . PRO A 1 121  ? 261.784 17.438  27.970  1.00 95.00  ? 190  PRO A CA  1 
ATOM 951   C C   . PRO A 1 121  ? 263.256 17.808  28.198  1.00 95.69  ? 190  PRO A C   1 
ATOM 952   O O   . PRO A 1 121  ? 264.085 17.646  27.302  1.00 95.83  ? 190  PRO A O   1 
ATOM 953   C CB  . PRO A 1 121  ? 261.647 16.023  27.434  1.00 94.59  ? 190  PRO A CB  1 
ATOM 954   C CG  . PRO A 1 121  ? 260.322 16.018  26.916  1.00 94.45  ? 190  PRO A CG  1 
ATOM 955   C CD  . PRO A 1 121  ? 260.363 17.279  26.068  1.00 94.45  ? 190  PRO A CD  1 
ATOM 956   N N   . GLU A 1 122  ? 263.561 18.312  29.395  1.00 96.15  ? 191  GLU A N   1 
ATOM 957   C CA  . GLU A 1 122  ? 264.932 18.669  29.794  1.00 96.95  ? 191  GLU A CA  1 
ATOM 958   C C   . GLU A 1 122  ? 265.298 17.412  30.557  1.00 97.83  ? 191  GLU A C   1 
ATOM 959   O O   . GLU A 1 122  ? 266.295 17.319  31.250  1.00 97.79  ? 191  GLU A O   1 
ATOM 960   C CB  . GLU A 1 122  ? 264.951 19.886  30.750  1.00 97.25  ? 191  GLU A CB  1 
ATOM 961   C CG  . GLU A 1 122  ? 265.180 21.293  30.125  1.00 96.93  ? 191  GLU A CG  1 
ATOM 962   C CD  . GLU A 1 122  ? 265.596 22.345  31.165  1.00 97.55  ? 191  GLU A CD  1 
ATOM 963   O OE1 . GLU A 1 122  ? 266.586 22.110  31.884  1.00 96.99  ? 191  GLU A OE1 1 
ATOM 964   O OE2 . GLU A 1 122  ? 264.949 23.407  31.270  1.00 98.22  ? 191  GLU A OE2 1 
ATOM 965   N N   . GLU A 1 123  ? 264.391 16.473  30.412  1.00 98.66  ? 192  GLU A N   1 
ATOM 966   C CA  . GLU A 1 123  ? 264.377 15.156  30.984  1.00 99.12  ? 192  GLU A CA  1 
ATOM 967   C C   . GLU A 1 123  ? 265.576 14.249  30.872  1.00 98.04  ? 192  GLU A C   1 
ATOM 968   O O   . GLU A 1 123  ? 265.870 13.508  31.814  1.00 98.41  ? 192  GLU A O   1 
ATOM 969   C CB  . GLU A 1 123  ? 263.223 14.482  30.345  1.00 100.74 ? 192  GLU A CB  1 
ATOM 970   C CG  . GLU A 1 123  ? 263.261 14.698  28.910  1.00 102.65 ? 192  GLU A CG  1 
ATOM 971   C CD  . GLU A 1 123  ? 264.291 13.897  28.269  1.00 103.83 ? 192  GLU A CD  1 
ATOM 972   O OE1 . GLU A 1 123  ? 264.891 14.305  27.260  1.00 103.84 ? 192  GLU A OE1 1 
ATOM 973   O OE2 . GLU A 1 123  ? 264.483 12.822  28.805  1.00 105.20 ? 192  GLU A OE2 1 
ATOM 974   N N   . ARG A 1 124  ? 266.240 14.315  29.719  1.00 95.55  ? 193  ARG A N   1 
ATOM 975   C CA  . ARG A 1 124  ? 267.407 13.507  29.375  1.00 92.13  ? 193  ARG A CA  1 
ATOM 976   C C   . ARG A 1 124  ? 267.111 12.018  28.977  1.00 90.82  ? 193  ARG A C   1 
ATOM 977   O O   . ARG A 1 124  ? 267.998 11.334  28.461  1.00 90.27  ? 193  ARG A O   1 
ATOM 978   C CB  . ARG A 1 124  ? 268.489 13.632  30.483  1.00 91.16  ? 193  ARG A CB  1 
ATOM 979   C CG  . ARG A 1 124  ? 268.111 14.636  31.586  1.00 90.20  ? 193  ARG A CG  1 
ATOM 980   C CD  . ARG A 1 124  ? 269.230 15.287  32.360  1.00 88.66  ? 193  ARG A CD  1 
ATOM 981   N NE  . ARG A 1 124  ? 268.670 16.258  33.303  1.00 88.58  ? 193  ARG A NE  1 
ATOM 982   C CZ  . ARG A 1 124  ? 268.411 17.534  33.024  1.00 89.21  ? 193  ARG A CZ  1 
ATOM 983   N NH1 . ARG A 1 124  ? 268.665 18.035  31.819  1.00 90.01  ? 193  ARG A NH1 1 
ATOM 984   N NH2 . ARG A 1 124  ? 267.884 18.312  33.957  1.00 88.26  ? 193  ARG A NH2 1 
ATOM 985   N N   . ALA A 1 125  ? 265.893 11.524  29.241  1.00 89.40  ? 194  ALA A N   1 
ATOM 986   C CA  . ALA A 1 125  ? 265.455 10.155  28.866  1.00 87.64  ? 194  ALA A CA  1 
ATOM 987   C C   . ALA A 1 125  ? 264.006 9.861   29.370  1.00 86.46  ? 194  ALA A C   1 
ATOM 988   O O   . ALA A 1 125  ? 263.705 10.119  30.545  1.00 84.97  ? 194  ALA A O   1 
ATOM 989   C CB  . ALA A 1 125  ? 266.458 9.121   29.433  1.00 87.72  ? 194  ALA A CB  1 
ATOM 990   N N   . LEU A 1 126  ? 263.110 9.350   28.504  1.00 85.93  ? 195  LEU A N   1 
ATOM 991   C CA  . LEU A 1 126  ? 261.694 9.055   28.870  1.00 86.05  ? 195  LEU A CA  1 
ATOM 992   C C   . LEU A 1 126  ? 261.117 7.979   27.942  1.00 85.38  ? 195  LEU A C   1 
ATOM 993   O O   . LEU A 1 126  ? 261.845 7.274   27.254  1.00 85.21  ? 195  LEU A O   1 
ATOM 994   C CB  . LEU A 1 126  ? 260.789 10.307  28.703  1.00 87.65  ? 195  LEU A CB  1 
ATOM 995   C CG  . LEU A 1 126  ? 261.110 11.824  28.680  1.00 88.62  ? 195  LEU A CG  1 
ATOM 996   C CD1 . LEU A 1 126  ? 259.920 12.711  28.137  1.00 88.59  ? 195  LEU A CD1 1 
ATOM 997   C CD2 . LEU A 1 126  ? 261.440 12.263  29.942  1.00 89.53  ? 195  LEU A CD2 1 
ATOM 998   N N   . VAL A 1 127  ? 259.793 7.881   27.944  1.00 84.66  ? 196  VAL A N   1 
ATOM 999   C CA  . VAL A 1 127  ? 259.042 6.965   27.097  1.00 84.59  ? 196  VAL A CA  1 
ATOM 1000  C C   . VAL A 1 127  ? 257.827 7.812   26.673  1.00 85.17  ? 196  VAL A C   1 
ATOM 1001  O O   . VAL A 1 127  ? 257.623 8.883   27.237  1.00 85.00  ? 196  VAL A O   1 
ATOM 1002  C CB  . VAL A 1 127  ? 258.645 5.692   27.896  1.00 83.60  ? 196  VAL A CB  1 
ATOM 1003  C CG1 . VAL A 1 127  ? 257.679 4.859   27.142  1.00 83.24  ? 196  VAL A CG1 1 
ATOM 1004  C CG2 . VAL A 1 127  ? 259.865 4.872   28.171  1.00 82.43  ? 196  VAL A CG2 1 
ATOM 1005  N N   . PHE A 1 128  ? 257.034 7.368   25.697  1.00 86.10  ? 197  PHE A N   1 
ATOM 1006  C CA  . PHE A 1 128  ? 255.879 8.140   25.210  1.00 87.44  ? 197  PHE A CA  1 
ATOM 1007  C C   . PHE A 1 128  ? 254.961 7.260   24.382  1.00 87.83  ? 197  PHE A C   1 
ATOM 1008  O O   . PHE A 1 128  ? 255.351 6.184   23.942  1.00 88.90  ? 197  PHE A O   1 
ATOM 1009  C CB  . PHE A 1 128  ? 256.353 9.263   24.302  1.00 88.54  ? 197  PHE A CB  1 
ATOM 1010  C CG  . PHE A 1 128  ? 256.123 10.655  24.834  1.00 91.65  ? 197  PHE A CG  1 
ATOM 1011  C CD1 . PHE A 1 128  ? 254.840 11.184  24.971  1.00 92.73  ? 197  PHE A CD1 1 
ATOM 1012  C CD2 . PHE A 1 128  ? 257.211 11.474  25.120  1.00 93.58  ? 197  PHE A CD2 1 
ATOM 1013  C CE1 . PHE A 1 128  ? 254.649 12.517  25.384  1.00 94.16  ? 197  PHE A CE1 1 
ATOM 1014  C CE2 . PHE A 1 128  ? 257.031 12.804  25.530  1.00 94.63  ? 197  PHE A CE2 1 
ATOM 1015  C CZ  . PHE A 1 128  ? 255.749 13.323  25.659  1.00 94.38  ? 197  PHE A CZ  1 
ATOM 1016  N N   . ASP A 1 129  ? 253.747 7.739   24.151  1.00 87.61  ? 198  ASP A N   1 
ATOM 1017  C CA  . ASP A 1 129  ? 252.780 7.006   23.351  1.00 87.14  ? 198  ASP A CA  1 
ATOM 1018  C C   . ASP A 1 129  ? 252.068 8.049   22.539  1.00 86.13  ? 198  ASP A C   1 
ATOM 1019  O O   . ASP A 1 129  ? 252.253 9.240   22.777  1.00 87.07  ? 198  ASP A O   1 
ATOM 1020  C CB  . ASP A 1 129  ? 251.789 6.272   24.234  1.00 87.03  ? 198  ASP A CB  1 
ATOM 1021  N N   . VAL A 1 130  ? 251.266 7.611   21.574  1.00 84.21  ? 199  VAL A N   1 
ATOM 1022  C CA  . VAL A 1 130  ? 250.520 8.543   20.734  1.00 82.70  ? 199  VAL A CA  1 
ATOM 1023  C C   . VAL A 1 130  ? 249.227 7.925   20.179  1.00 82.93  ? 199  VAL A C   1 
ATOM 1024  O O   . VAL A 1 130  ? 249.173 6.724   19.863  1.00 82.35  ? 199  VAL A O   1 
ATOM 1025  C CB  . VAL A 1 130  ? 251.379 9.037   19.544  1.00 82.26  ? 199  VAL A CB  1 
ATOM 1026  C CG1 . VAL A 1 130  ? 250.825 10.355  19.015  1.00 82.60  ? 199  VAL A CG1 1 
ATOM 1027  C CG2 . VAL A 1 130  ? 252.825 9.178   19.966  1.00 81.72  ? 199  VAL A CG2 1 
ATOM 1028  N N   . GLU A 1 131  ? 248.186 8.753   20.078  1.00 82.97  ? 200  GLU A N   1 
ATOM 1029  C CA  . GLU A 1 131  ? 246.894 8.325   19.549  1.00 82.98  ? 200  GLU A CA  1 
ATOM 1030  C C   . GLU A 1 131  ? 246.669 9.110   18.278  1.00 82.47  ? 200  GLU A C   1 
ATOM 1031  O O   . GLU A 1 131  ? 247.251 10.175  18.091  1.00 82.15  ? 200  GLU A O   1 
ATOM 1032  C CB  . GLU A 1 131  ? 245.779 8.619   20.545  1.00 82.94  ? 200  GLU A CB  1 
ATOM 1033  N N   . VAL A 1 132  ? 245.843 8.582   17.392  1.00 82.28  ? 201  VAL A N   1 
ATOM 1034  C CA  . VAL A 1 132  ? 245.560 9.279   16.150  1.00 82.49  ? 201  VAL A CA  1 
ATOM 1035  C C   . VAL A 1 132  ? 244.174 8.900   15.682  1.00 83.53  ? 201  VAL A C   1 
ATOM 1036  O O   . VAL A 1 132  ? 243.824 7.720   15.590  1.00 83.61  ? 201  VAL A O   1 
ATOM 1037  C CB  . VAL A 1 132  ? 246.609 8.957   15.077  1.00 81.33  ? 201  VAL A CB  1 
ATOM 1038  C CG1 . VAL A 1 132  ? 245.960 8.887   13.715  1.00 80.15  ? 201  VAL A CG1 1 
ATOM 1039  C CG2 . VAL A 1 132  ? 247.692 10.032  15.094  1.00 79.82  ? 201  VAL A CG2 1 
ATOM 1040  N N   . CYS A 1 133  ? 243.379 9.908   15.367  1.00 84.56  ? 202  CYS A N   1 
ATOM 1041  C CA  . CYS A 1 133  ? 242.019 9.627   14.991  1.00 84.77  ? 202  CYS A CA  1 
ATOM 1042  C C   . CYS A 1 133  ? 241.682 9.027   13.669  1.00 85.17  ? 202  CYS A C   1 
ATOM 1043  O O   . CYS A 1 133  ? 242.446 9.005   12.703  1.00 84.77  ? 202  CYS A O   1 
ATOM 1044  C CB  . CYS A 1 133  ? 241.151 10.859  15.169  1.00 85.13  ? 202  CYS A CB  1 
ATOM 1045  S SG  . CYS A 1 133  ? 242.098 12.252  15.664  1.00 81.59  ? 202  CYS A SG  1 
ATOM 1046  N N   . LEU A 1 134  ? 240.461 8.537   13.695  1.00 85.53  ? 203  LEU A N   1 
ATOM 1047  C CA  . LEU A 1 134  ? 239.825 7.920   12.584  1.00 86.18  ? 203  LEU A CA  1 
ATOM 1048  C C   . LEU A 1 134  ? 239.226 9.102   11.870  1.00 85.90  ? 203  LEU A C   1 
ATOM 1049  O O   . LEU A 1 134  ? 238.430 8.985   10.958  1.00 85.18  ? 203  LEU A O   1 
ATOM 1050  C CB  . LEU A 1 134  ? 238.845 6.905   13.132  1.00 87.47  ? 203  LEU A CB  1 
ATOM 1051  C CG  . LEU A 1 134  ? 239.788 6.190   14.109  1.00 89.58  ? 203  LEU A CG  1 
ATOM 1052  C CD1 . LEU A 1 134  ? 239.081 5.129   14.697  1.00 90.84  ? 203  LEU A CD1 1 
ATOM 1053  C CD2 . LEU A 1 134  ? 241.048 5.640   13.441  1.00 90.40  ? 203  LEU A CD2 1 
ATOM 1054  N N   . ALA A 1 135  ? 239.686 10.268  12.314  1.00 86.31  ? 204  ALA A N   1 
ATOM 1055  C CA  . ALA A 1 135  ? 239.365 11.536  11.683  1.00 86.61  ? 204  ALA A CA  1 
ATOM 1056  C C   . ALA A 1 135  ? 240.377 11.257  10.582  1.00 87.35  ? 204  ALA A C   1 
ATOM 1057  O O   . ALA A 1 135  ? 240.787 12.122  9.815   1.00 87.20  ? 204  ALA A O   1 
ATOM 1058  C CB  . ALA A 1 135  ? 239.845 12.687  12.531  1.00 85.03  ? 204  ALA A CB  1 
ATOM 1059  N N   . GLU A 1 136  ? 240.777 9.986   10.602  1.00 88.77  ? 205  GLU A N   1 
ATOM 1060  C CA  . GLU A 1 136  ? 241.731 9.298   9.763   1.00 90.71  ? 205  GLU A CA  1 
ATOM 1061  C C   . GLU A 1 136  ? 243.048 10.012  9.695   1.00 90.15  ? 205  GLU A C   1 
ATOM 1062  O O   . GLU A 1 136  ? 244.071 9.396   9.388   1.00 91.18  ? 205  GLU A O   1 
ATOM 1063  C CB  . GLU A 1 136  ? 241.168 9.052   8.374   1.00 93.61  ? 205  GLU A CB  1 
ATOM 1064  C CG  . GLU A 1 136  ? 242.119 8.280   7.463   1.00 97.49  ? 205  GLU A CG  1 
ATOM 1065  C CD  . GLU A 1 136  ? 242.886 7.156   8.165   1.00 99.26  ? 205  GLU A CD  1 
ATOM 1066  O OE1 . GLU A 1 136  ? 242.756 6.971   9.393   1.00 99.62  ? 205  GLU A OE1 1 
ATOM 1067  O OE2 . GLU A 1 136  ? 243.645 6.451   7.473   1.00 100.90 ? 205  GLU A OE2 1 
ATOM 1068  N N   . GLY A 1 137  ? 243.031 11.306  10.009  1.00 88.82  ? 206  GLY A N   1 
ATOM 1069  C CA  . GLY A 1 137  ? 244.260 12.069  10.002  1.00 86.94  ? 206  GLY A CA  1 
ATOM 1070  C C   . GLY A 1 137  ? 245.307 11.292  10.775  1.00 85.55  ? 206  GLY A C   1 
ATOM 1071  O O   . GLY A 1 137  ? 245.094 10.950  11.944  1.00 86.79  ? 206  GLY A O   1 
ATOM 1072  N N   . THR A 1 138  ? 246.425 11.006  10.106  1.00 82.04  ? 207  THR A N   1 
ATOM 1073  C CA  . THR A 1 138  ? 247.548 10.274  10.688  1.00 77.84  ? 207  THR A CA  1 
ATOM 1074  C C   . THR A 1 138  ? 248.190 11.150  11.773  1.00 75.71  ? 207  THR A C   1 
ATOM 1075  O O   . THR A 1 138  ? 249.129 10.729  12.467  1.00 74.75  ? 207  THR A O   1 
ATOM 1076  C CB  . THR A 1 138  ? 248.590 9.938   9.596   1.00 76.33  ? 207  THR A CB  1 
ATOM 1077  O OG1 . THR A 1 138  ? 249.445 11.064  9.379   1.00 74.58  ? 207  THR A OG1 1 
ATOM 1078  C CG2 . THR A 1 138  ? 247.889 9.616   8.285   1.00 76.27  ? 207  THR A CG2 1 
ATOM 1079  N N   . CYS A 1 139  ? 247.646 12.368  11.901  1.00 74.17  ? 208  CYS A N   1 
ATOM 1080  C CA  . CYS A 1 139  ? 248.086 13.380  12.864  1.00 72.32  ? 208  CYS A CA  1 
ATOM 1081  C C   . CYS A 1 139  ? 247.603 13.121  14.289  1.00 72.19  ? 208  CYS A C   1 
ATOM 1082  O O   . CYS A 1 139  ? 246.630 12.396  14.517  1.00 71.49  ? 208  CYS A O   1 
ATOM 1083  C CB  . CYS A 1 139  ? 247.678 14.790  12.400  1.00 71.49  ? 208  CYS A CB  1 
ATOM 1084  S SG  . CYS A 1 139  ? 246.422 14.860  11.110  1.00 67.67  ? 208  CYS A SG  1 
ATOM 1085  N N   . PRO A 1 140  ? 248.260 13.760  15.267  1.00 72.29  ? 209  PRO A N   1 
ATOM 1086  C CA  . PRO A 1 140  ? 247.928 13.580  16.671  1.00 71.65  ? 209  PRO A CA  1 
ATOM 1087  C C   . PRO A 1 140  ? 246.803 14.224  17.427  1.00 71.50  ? 209  PRO A C   1 
ATOM 1088  O O   . PRO A 1 140  ? 246.211 15.253  17.080  1.00 70.46  ? 209  PRO A O   1 
ATOM 1089  C CB  . PRO A 1 140  ? 249.257 13.832  17.380  1.00 71.31  ? 209  PRO A CB  1 
ATOM 1090  C CG  . PRO A 1 140  ? 250.295 13.949  16.265  1.00 72.44  ? 209  PRO A CG  1 
ATOM 1091  C CD  . PRO A 1 140  ? 249.501 14.534  15.152  1.00 72.74  ? 209  PRO A CD  1 
ATOM 1092  N N   . THR A 1 141  ? 246.620 13.588  18.570  1.00 72.22  ? 210  THR A N   1 
ATOM 1093  C CA  . THR A 1 141  ? 245.565 13.892  19.474  1.00 73.24  ? 210  THR A CA  1 
ATOM 1094  C C   . THR A 1 141  ? 245.936 13.607  20.935  1.00 76.50  ? 210  THR A C   1 
ATOM 1095  O O   . THR A 1 141  ? 245.047 13.365  21.738  1.00 75.44  ? 210  THR A O   1 
ATOM 1096  C CB  . THR A 1 141  ? 244.355 13.018  19.066  1.00 70.88  ? 210  THR A CB  1 
ATOM 1097  O OG1 . THR A 1 141  ? 244.557 11.661  19.486  1.00 69.03  ? 210  THR A OG1 1 
ATOM 1098  C CG2 . THR A 1 141  ? 244.192 13.038  17.566  1.00 69.52  ? 210  THR A CG2 1 
ATOM 1099  N N   . LEU A 1 142  ? 247.219 13.652  21.296  1.00 80.84  ? 211  LEU A N   1 
ATOM 1100  C CA  . LEU A 1 142  ? 247.623 13.336  22.674  1.00 83.97  ? 211  LEU A CA  1 
ATOM 1101  C C   . LEU A 1 142  ? 248.883 12.485  22.662  1.00 85.14  ? 211  LEU A C   1 
ATOM 1102  O O   . LEU A 1 142  ? 249.004 11.582  21.842  1.00 86.40  ? 211  LEU A O   1 
ATOM 1103  C CB  . LEU A 1 142  ? 246.563 12.490  23.357  1.00 84.76  ? 211  LEU A CB  1 
ATOM 1104  C CG  . LEU A 1 142  ? 245.939 12.961  24.649  1.00 84.79  ? 211  LEU A CG  1 
ATOM 1105  C CD1 . LEU A 1 142  ? 245.299 14.317  24.436  1.00 86.23  ? 211  LEU A CD1 1 
ATOM 1106  C CD2 . LEU A 1 142  ? 244.931 11.936  25.112  1.00 82.97  ? 211  LEU A CD2 1 
ATOM 1107  N N   . ALA A 1 143  ? 249.801 12.734  23.584  1.00 85.89  ? 212  ALA A N   1 
ATOM 1108  C CA  . ALA A 1 143  ? 251.017 11.941  23.653  1.00 85.98  ? 212  ALA A CA  1 
ATOM 1109  C C   . ALA A 1 143  ? 251.352 11.817  25.121  1.00 85.37  ? 212  ALA A C   1 
ATOM 1110  O O   . ALA A 1 143  ? 251.533 12.820  25.800  1.00 85.36  ? 212  ALA A O   1 
ATOM 1111  C CB  . ALA A 1 143  ? 252.139 12.623  22.902  1.00 87.21  ? 212  ALA A CB  1 
ATOM 1112  N N   . VAL A 1 144  ? 251.436 10.577  25.593  1.00 84.63  ? 213  VAL A N   1 
ATOM 1113  C CA  . VAL A 1 144  ? 251.691 10.237  27.002  1.00 83.97  ? 213  VAL A CA  1 
ATOM 1114  C C   . VAL A 1 144  ? 253.151 10.237  27.522  1.00 83.25  ? 213  VAL A C   1 
ATOM 1115  O O   . VAL A 1 144  ? 254.027 9.706   26.851  1.00 82.36  ? 213  VAL A O   1 
ATOM 1116  C CB  . VAL A 1 144  ? 251.054 8.884   27.265  1.00 83.94  ? 213  VAL A CB  1 
ATOM 1117  C CG1 . VAL A 1 144  ? 250.876 8.701   28.694  1.00 84.42  ? 213  VAL A CG1 1 
ATOM 1118  C CG2 . VAL A 1 144  ? 249.708 8.793   26.547  1.00 85.56  ? 213  VAL A CG2 1 
ATOM 1119  N N   . ALA A 1 145  ? 253.421 10.777  28.725  1.00 83.68  ? 214  ALA A N   1 
ATOM 1120  C CA  . ALA A 1 145  ? 254.821 10.824  29.218  1.00 85.43  ? 214  ALA A CA  1 
ATOM 1121  C C   . ALA A 1 145  ? 255.200 10.422  30.661  1.00 86.92  ? 214  ALA A C   1 
ATOM 1122  O O   . ALA A 1 145  ? 254.512 10.789  31.633  1.00 87.08  ? 214  ALA A O   1 
ATOM 1123  C CB  . ALA A 1 145  ? 255.402 12.164  28.917  1.00 85.61  ? 214  ALA A CB  1 
ATOM 1124  N N   . ILE A 1 146  ? 256.347 9.726   30.776  1.00 89.48  ? 215  ILE A N   1 
ATOM 1125  C CA  . ILE A 1 146  ? 256.840 9.204   32.057  1.00 92.70  ? 215  ILE A CA  1 
ATOM 1126  C C   . ILE A 1 146  ? 257.971 9.867   32.894  1.00 94.29  ? 215  ILE A C   1 
ATOM 1127  O O   . ILE A 1 146  ? 257.658 10.796  33.605  1.00 94.80  ? 215  ILE A O   1 
ATOM 1128  C CB  . ILE A 1 146  ? 257.069 7.673   31.924  1.00 92.73  ? 215  ILE A CB  1 
ATOM 1129  C CG1 . ILE A 1 146  ? 256.562 7.034   33.197  1.00 94.08  ? 215  ILE A CG1 1 
ATOM 1130  C CG2 . ILE A 1 146  ? 258.516 7.296   31.700  1.00 92.35  ? 215  ILE A CG2 1 
ATOM 1131  C CD1 . ILE A 1 146  ? 256.253 5.587   33.051  1.00 91.71  ? 215  ILE A CD1 1 
ATOM 1132  N N   . SER A 1 147  ? 259.231 9.397   32.874  1.00 96.03  ? 216  SER A N   1 
ATOM 1133  C CA  . SER A 1 147  ? 260.307 10.034  33.686  1.00 97.80  ? 216  SER A CA  1 
ATOM 1134  C C   . SER A 1 147  ? 260.029 11.565  33.893  1.00 99.02  ? 216  SER A C   1 
ATOM 1135  O O   . SER A 1 147  ? 259.399 11.889  34.922  1.00 97.58  ? 216  SER A O   1 
ATOM 1136  C CB  . SER A 1 147  ? 261.690 9.690   33.166  1.00 98.60  ? 216  SER A CB  1 
ATOM 1137  O OG  . SER A 1 147  ? 261.654 9.454   31.865  1.00 99.60  ? 216  SER A OG  1 
ATOM 1138  N N   . PRO A 1 148  ? 260.597 12.515  33.100  1.00 101.30 ? 217  PRO A N   1 
ATOM 1139  C CA  . PRO A 1 148  ? 260.009 13.746  33.604  1.00 103.31 ? 217  PRO A CA  1 
ATOM 1140  C C   . PRO A 1 148  ? 258.508 13.778  33.465  1.00 105.24 ? 217  PRO A C   1 
ATOM 1141  O O   . PRO A 1 148  ? 257.764 13.166  34.220  1.00 106.11 ? 217  PRO A O   1 
ATOM 1142  C CB  . PRO A 1 148  ? 260.653 14.812  32.738  1.00 102.60 ? 217  PRO A CB  1 
ATOM 1143  C CG  . PRO A 1 148  ? 261.970 14.427  32.812  1.00 102.06 ? 217  PRO A CG  1 
ATOM 1144  C CD  . PRO A 1 148  ? 261.967 12.874  32.692  1.00 101.84 ? 217  PRO A CD  1 
ATOM 1145  N N   . SER A 1 149  ? 258.051 14.459  32.444  1.00 106.85 ? 218  SER A N   1 
ATOM 1146  C CA  . SER A 1 149  ? 256.659 14.638  32.390  1.00 107.63 ? 218  SER A CA  1 
ATOM 1147  C C   . SER A 1 149  ? 256.477 15.381  31.133  1.00 107.80 ? 218  SER A C   1 
ATOM 1148  O O   . SER A 1 149  ? 257.277 16.253  30.805  1.00 107.50 ? 218  SER A O   1 
ATOM 1149  C CB  . SER A 1 149  ? 256.405 15.497  33.567  1.00 107.79 ? 218  SER A CB  1 
ATOM 1150  O OG  . SER A 1 149  ? 257.543 16.330  33.639  1.00 108.73 ? 218  SER A OG  1 
ATOM 1151  N N   . ALA A 1 150  ? 255.379 15.099  30.467  1.00 108.20 ? 219  ALA A N   1 
ATOM 1152  C CA  . ALA A 1 150  ? 255.145 15.742  29.202  1.00 108.53 ? 219  ALA A CA  1 
ATOM 1153  C C   . ALA A 1 150  ? 253.690 15.542  28.885  1.00 108.68 ? 219  ALA A C   1 
ATOM 1154  O O   . ALA A 1 150  ? 252.992 14.912  29.665  1.00 108.69 ? 219  ALA A O   1 
ATOM 1155  C CB  . ALA A 1 150  ? 256.034 15.105  28.159  1.00 108.86 ? 219  ALA A CB  1 
ATOM 1156  N N   . TRP A 1 151  ? 253.219 16.009  27.737  1.00 109.11 ? 220  TRP A N   1 
ATOM 1157  C CA  . TRP A 1 151  ? 251.807 15.848  27.560  1.00 109.57 ? 220  TRP A CA  1 
ATOM 1158  C C   . TRP A 1 151  ? 251.039 15.912  26.251  1.00 108.85 ? 220  TRP A C   1 
ATOM 1159  O O   . TRP A 1 151  ? 251.530 16.263  25.167  1.00 108.91 ? 220  TRP A O   1 
ATOM 1160  C CB  . TRP A 1 151  ? 251.130 16.760  28.596  1.00 111.29 ? 220  TRP A CB  1 
ATOM 1161  C CG  . TRP A 1 151  ? 250.147 16.052  29.461  1.00 113.33 ? 220  TRP A CG  1 
ATOM 1162  C CD1 . TRP A 1 151  ? 248.848 15.809  29.149  1.00 114.07 ? 220  TRP A CD1 1 
ATOM 1163  C CD2 . TRP A 1 151  ? 250.393 15.362  30.709  1.00 113.47 ? 220  TRP A CD2 1 
ATOM 1164  N NE1 . TRP A 1 151  ? 248.266 15.000  30.094  1.00 114.35 ? 220  TRP A NE1 1 
ATOM 1165  C CE2 . TRP A 1 151  ? 249.189 14.698  31.059  1.00 113.66 ? 220  TRP A CE2 1 
ATOM 1166  C CE3 . TRP A 1 151  ? 251.514 15.213  31.543  1.00 112.89 ? 220  TRP A CE3 1 
ATOM 1167  C CZ2 . TRP A 1 151  ? 249.060 13.913  32.226  1.00 113.17 ? 220  TRP A CZ2 1 
ATOM 1168  C CZ3 . TRP A 1 151  ? 251.391 14.429  32.699  1.00 112.51 ? 220  TRP A CZ3 1 
ATOM 1169  C CH2 . TRP A 1 151  ? 250.170 13.780  33.022  1.00 112.61 ? 220  TRP A CH2 1 
ATOM 1170  N N   . TYR A 1 152  ? 249.782 15.542  26.468  1.00 108.27 ? 221  TYR A N   1 
ATOM 1171  C CA  . TYR A 1 152  ? 248.690 15.426  25.527  1.00 107.92 ? 221  TYR A CA  1 
ATOM 1172  C C   . TYR A 1 152  ? 248.415 16.704  24.785  1.00 106.76 ? 221  TYR A C   1 
ATOM 1173  O O   . TYR A 1 152  ? 248.906 17.784  25.143  1.00 106.61 ? 221  TYR A O   1 
ATOM 1174  C CB  . TYR A 1 152  ? 247.468 14.912  26.305  1.00 109.29 ? 221  TYR A CB  1 
ATOM 1175  C CG  . TYR A 1 152  ? 247.816 13.627  27.043  1.00 110.48 ? 221  TYR A CG  1 
ATOM 1176  C CD1 . TYR A 1 152  ? 247.218 13.292  28.258  1.00 111.19 ? 221  TYR A CD1 1 
ATOM 1177  C CD2 . TYR A 1 152  ? 248.878 12.840  26.605  1.00 110.01 ? 221  TYR A CD2 1 
ATOM 1178  C CE1 . TYR A 1 152  ? 247.701 12.218  29.027  1.00 111.35 ? 221  TYR A CE1 1 
ATOM 1179  C CE2 . TYR A 1 152  ? 249.355 11.791  27.357  1.00 109.99 ? 221  TYR A CE2 1 
ATOM 1180  C CZ  . TYR A 1 152  ? 248.783 11.484  28.569  1.00 110.74 ? 221  TYR A CZ  1 
ATOM 1181  O OH  . TYR A 1 152  ? 249.356 10.521  29.361  1.00 111.48 ? 221  TYR A OH  1 
ATOM 1182  N N   . SER A 1 153  ? 247.605 16.604  23.753  1.00 105.89 ? 222  SER A N   1 
ATOM 1183  C CA  . SER A 1 153  ? 247.450 17.797  23.020  1.00 105.66 ? 222  SER A CA  1 
ATOM 1184  C C   . SER A 1 153  ? 246.132 18.166  22.385  1.00 105.42 ? 222  SER A C   1 
ATOM 1185  O O   . SER A 1 153  ? 245.069 18.018  22.972  1.00 105.22 ? 222  SER A O   1 
ATOM 1186  C CB  . SER A 1 153  ? 248.578 17.827  22.003  1.00 105.43 ? 222  SER A CB  1 
ATOM 1187  O OG  . SER A 1 153  ? 248.399 16.842  20.998  1.00 105.91 ? 222  SER A OG  1 
ATOM 1188  N N   . TRP A 1 154  ? 246.232 18.632  21.149  1.00 105.24 ? 223  TRP A N   1 
ATOM 1189  C CA  . TRP A 1 154  ? 245.137 19.192  20.376  1.00 104.74 ? 223  TRP A CA  1 
ATOM 1190  C C   . TRP A 1 154  ? 244.095 18.336  19.692  1.00 104.46 ? 223  TRP A C   1 
ATOM 1191  O O   . TRP A 1 154  ? 243.413 18.818  18.818  1.00 103.93 ? 223  TRP A O   1 
ATOM 1192  C CB  . TRP A 1 154  ? 245.759 20.193  19.395  1.00 105.10 ? 223  TRP A CB  1 
ATOM 1193  C CG  . TRP A 1 154  ? 246.965 20.904  20.034  1.00 104.72 ? 223  TRP A CG  1 
ATOM 1194  C CD1 . TRP A 1 154  ? 247.808 20.376  20.969  1.00 105.14 ? 223  TRP A CD1 1 
ATOM 1195  C CD2 . TRP A 1 154  ? 247.494 22.210  19.735  1.00 103.64 ? 223  TRP A CD2 1 
ATOM 1196  N NE1 . TRP A 1 154  ? 248.814 21.241  21.271  1.00 103.88 ? 223  TRP A NE1 1 
ATOM 1197  C CE2 . TRP A 1 154  ? 248.653 22.378  20.531  1.00 103.39 ? 223  TRP A CE2 1 
ATOM 1198  C CE3 . TRP A 1 154  ? 247.109 23.249  18.880  1.00 102.70 ? 223  TRP A CE3 1 
ATOM 1199  C CZ2 . TRP A 1 154  ? 249.427 23.525  20.497  1.00 102.13 ? 223  TRP A CZ2 1 
ATOM 1200  C CZ3 . TRP A 1 154  ? 247.890 24.400  18.852  1.00 101.46 ? 223  TRP A CZ3 1 
ATOM 1201  C CH2 . TRP A 1 154  ? 249.040 24.523  19.661  1.00 100.74 ? 223  TRP A CH2 1 
ATOM 1202  N N   . CYS A 1 155  ? 243.943 17.088  20.114  1.00 104.83 ? 224  CYS A N   1 
ATOM 1203  C CA  . CYS A 1 155  ? 242.917 16.194  19.553  1.00 105.31 ? 224  CYS A CA  1 
ATOM 1204  C C   . CYS A 1 155  ? 241.584 16.687  19.925  1.00 106.11 ? 224  CYS A C   1 
ATOM 1205  O O   . CYS A 1 155  ? 240.639 16.773  19.175  1.00 105.51 ? 224  CYS A O   1 
ATOM 1206  C CB  . CYS A 1 155  ? 242.917 14.861  20.251  1.00 104.19 ? 224  CYS A CB  1 
ATOM 1207  S SG  . CYS A 1 155  ? 241.254 14.090  20.258  1.00 101.30 ? 224  CYS A SG  1 
ATOM 1208  N N   . SER A 1 156  ? 241.565 16.880  21.215  1.00 107.29 ? 225  SER A N   1 
ATOM 1209  C CA  . SER A 1 156  ? 240.424 17.231  21.946  1.00 109.44 ? 225  SER A CA  1 
ATOM 1210  C C   . SER A 1 156  ? 240.084 18.668  22.120  1.00 110.44 ? 225  SER A C   1 
ATOM 1211  O O   . SER A 1 156  ? 239.183 19.002  22.812  1.00 109.85 ? 225  SER A O   1 
ATOM 1212  C CB  . SER A 1 156  ? 240.513 16.558  23.264  1.00 110.25 ? 225  SER A CB  1 
ATOM 1213  O OG  . SER A 1 156  ? 239.221 16.493  23.772  1.00 112.12 ? 225  SER A OG  1 
ATOM 1214  N N   . GLN A 1 157  ? 240.839 19.547  21.522  1.00 112.04 ? 226  GLN A N   1 
ATOM 1215  C CA  . GLN A 1 157  ? 240.417 20.921  21.499  1.00 113.28 ? 226  GLN A CA  1 
ATOM 1216  C C   . GLN A 1 157  ? 240.151 20.955  20.000  1.00 112.76 ? 226  GLN A C   1 
ATOM 1217  O O   . GLN A 1 157  ? 239.356 21.751  19.528  1.00 112.79 ? 226  GLN A O   1 
ATOM 1218  C CB  . GLN A 1 157  ? 241.537 21.883  21.854  1.00 114.11 ? 226  GLN A CB  1 
ATOM 1219  C CG  . GLN A 1 157  ? 241.887 22.950  20.796  1.00 114.51 ? 226  GLN A CG  1 
ATOM 1220  C CD  . GLN A 1 157  ? 240.692 23.626  20.095  1.00 114.59 ? 226  GLN A CD  1 
ATOM 1221  O OE1 . GLN A 1 157  ? 239.638 23.858  20.689  1.00 115.34 ? 226  GLN A OE1 1 
ATOM 1222  N NE2 . GLN A 1 157  ? 240.866 23.929  18.806  1.00 113.93 ? 226  GLN A NE2 1 
ATOM 1223  N N   . ARG A 1 158  ? 240.835 20.069  19.262  1.00 111.36 ? 227  ARG A N   1 
ATOM 1224  C CA  . ARG A 1 158  ? 240.693 19.943  17.796  1.00 110.01 ? 227  ARG A CA  1 
ATOM 1225  C C   . ARG A 1 158  ? 239.224 19.692  17.527  1.00 110.25 ? 227  ARG A C   1 
ATOM 1226  O O   . ARG A 1 158  ? 238.626 20.282  16.666  1.00 109.67 ? 227  ARG A O   1 
ATOM 1227  C CB  . ARG A 1 158  ? 241.528 18.757  17.224  1.00 108.94 ? 227  ARG A CB  1 
ATOM 1228  C CG  . ARG A 1 158  ? 241.239 18.387  15.750  1.00 107.67 ? 227  ARG A CG  1 
ATOM 1229  C CD  . ARG A 1 158  ? 240.004 17.485  15.612  1.00 106.70 ? 227  ARG A CD  1 
ATOM 1230  N NE  . ARG A 1 158  ? 239.420 17.520  14.269  1.00 104.61 ? 227  ARG A NE  1 
ATOM 1231  C CZ  . ARG A 1 158  ? 238.488 16.678  13.838  1.00 103.05 ? 227  ARG A CZ  1 
ATOM 1232  N NH1 . ARG A 1 158  ? 238.041 15.731  14.645  1.00 101.79 ? 227  ARG A NH1 1 
ATOM 1233  N NH2 . ARG A 1 158  ? 238.002 16.795  12.608  1.00 101.91 ? 227  ARG A NH2 1 
ATOM 1234  N N   . LEU A 1 159  ? 238.627 18.787  18.273  1.00 111.59 ? 228  LEU A N   1 
ATOM 1235  C CA  . LEU A 1 159  ? 237.218 18.532  18.047  1.00 112.56 ? 228  LEU A CA  1 
ATOM 1236  C C   . LEU A 1 159  ? 236.290 19.747  18.050  1.00 113.85 ? 228  LEU A C   1 
ATOM 1237  O O   . LEU A 1 159  ? 235.108 19.653  17.665  1.00 114.21 ? 228  LEU A O   1 
ATOM 1238  C CB  . LEU A 1 159  ? 236.723 17.558  19.029  1.00 111.28 ? 228  LEU A CB  1 
ATOM 1239  C CG  . LEU A 1 159  ? 236.650 18.080  20.437  1.00 110.35 ? 228  LEU A CG  1 
ATOM 1240  C CD1 . LEU A 1 159  ? 237.389 17.184  21.262  1.00 110.15 ? 228  LEU A CD1 1 
ATOM 1241  C CD2 . LEU A 1 159  ? 237.257 19.451  20.545  1.00 109.63 ? 228  LEU A CD2 1 
ATOM 1242  N N   . VAL A 1 160  ? 236.745 20.922  18.523  1.00 114.84 ? 229  VAL A N   1 
ATOM 1243  C CA  . VAL A 1 160  ? 235.795 22.155  18.342  1.00 115.95 ? 229  VAL A CA  1 
ATOM 1244  C C   . VAL A 1 160  ? 236.366 22.945  17.223  1.00 116.63 ? 229  VAL A C   1 
ATOM 1245  O O   . VAL A 1 160  ? 236.182 24.170  17.212  1.00 117.04 ? 229  VAL A O   1 
ATOM 1246  C CB  . VAL A 1 160  ? 235.591 23.222  19.593  1.00 116.01 ? 229  VAL A CB  1 
ATOM 1247  C CG1 . VAL A 1 160  ? 234.723 22.598  20.683  1.00 115.14 ? 229  VAL A CG1 1 
ATOM 1248  C CG2 . VAL A 1 160  ? 237.041 23.427  20.133  1.00 116.39 ? 229  VAL A CG2 1 
ATOM 1249  N N   . GLU A 1 161  ? 237.123 22.290  16.344  1.00 116.70 ? 230  GLU A N   1 
ATOM 1250  C CA  . GLU A 1 161  ? 237.633 23.147  15.330  1.00 116.77 ? 230  GLU A CA  1 
ATOM 1251  C C   . GLU A 1 161  ? 236.915 22.979  14.080  1.00 117.18 ? 230  GLU A C   1 
ATOM 1252  O O   . GLU A 1 161  ? 236.297 21.962  13.793  1.00 117.11 ? 230  GLU A O   1 
ATOM 1253  C CB  . GLU A 1 161  ? 239.132 22.989  15.065  1.00 117.12 ? 230  GLU A CB  1 
ATOM 1254  C CG  . GLU A 1 161  ? 239.593 23.024  13.538  1.00 116.91 ? 230  GLU A CG  1 
ATOM 1255  C CD  . GLU A 1 161  ? 239.194 24.276  12.705  1.00 117.20 ? 230  GLU A CD  1 
ATOM 1256  O OE1 . GLU A 1 161  ? 238.764 25.296  13.286  1.00 117.62 ? 230  GLU A OE1 1 
ATOM 1257  O OE2 . GLU A 1 161  ? 239.327 24.241  11.457  1.00 117.82 ? 230  GLU A OE2 1 
ATOM 1258  N N   . GLU A 1 162  ? 236.991 23.940  13.209  1.00 118.01 ? 231  GLU A N   1 
ATOM 1259  C CA  . GLU A 1 162  ? 236.282 23.784  11.951  1.00 119.74 ? 231  GLU A CA  1 
ATOM 1260  C C   . GLU A 1 162  ? 236.298 22.676  11.029  1.00 120.06 ? 231  GLU A C   1 
ATOM 1261  O O   . GLU A 1 162  ? 236.916 21.766  11.174  1.00 120.42 ? 231  GLU A O   1 
ATOM 1262  C CB  . GLU A 1 162  ? 236.419 25.171  11.241  1.00 120.98 ? 231  GLU A CB  1 
ATOM 1263  C CG  . GLU A 1 162  ? 235.506 26.325  11.673  1.00 123.66 ? 231  GLU A CG  1 
ATOM 1264  C CD  . GLU A 1 162  ? 234.012 26.000  11.839  1.00 125.61 ? 231  GLU A CD  1 
ATOM 1265  O OE1 . GLU A 1 162  ? 233.328 25.499  10.923  1.00 127.00 ? 231  GLU A OE1 1 
ATOM 1266  O OE2 . GLU A 1 162  ? 233.496 26.325  12.924  1.00 126.67 ? 231  GLU A OE2 1 
ATOM 1267  N N   . ARG A 1 163  ? 235.686 23.089  9.959   1.00 119.96 ? 232  ARG A N   1 
ATOM 1268  C CA  . ARG A 1 163  ? 235.192 22.409  8.991   1.00 119.51 ? 232  ARG A CA  1 
ATOM 1269  C C   . ARG A 1 163  ? 234.348 21.254  9.419   1.00 119.12 ? 232  ARG A C   1 
ATOM 1270  O O   . ARG A 1 163  ? 234.647 20.604  10.421  1.00 119.38 ? 232  ARG A O   1 
ATOM 1271  C CB  . ARG A 1 163  ? 236.173 22.228  8.053   1.00 119.49 ? 232  ARG A CB  1 
ATOM 1272  C CG  . ARG A 1 163  ? 236.686 23.707  7.357   1.00 119.15 ? 232  ARG A CG  1 
ATOM 1273  C CD  . ARG A 1 163  ? 237.108 23.774  5.860   1.00 118.69 ? 232  ARG A CD  1 
ATOM 1274  N NE  . ARG A 1 163  ? 238.322 24.580  5.785   1.00 119.53 ? 232  ARG A NE  1 
ATOM 1275  C CZ  . ARG A 1 163  ? 238.752 25.149  4.673   1.00 120.09 ? 232  ARG A CZ  1 
ATOM 1276  N NH1 . ARG A 1 163  ? 238.045 24.999  3.569   1.00 119.85 ? 232  ARG A NH1 1 
ATOM 1277  N NH2 . ARG A 1 163  ? 239.894 25.817  4.649   1.00 120.72 ? 232  ARG A NH2 1 
ATOM 1278  N N   . TYR A 1 164  ? 233.141 21.323  8.812   1.00 118.81 ? 233  TYR A N   1 
ATOM 1279  C CA  . TYR A 1 164  ? 231.882 20.613  8.946   1.00 118.40 ? 233  TYR A CA  1 
ATOM 1280  C C   . TYR A 1 164  ? 231.652 19.188  9.462   1.00 118.11 ? 233  TYR A C   1 
ATOM 1281  O O   . TYR A 1 164  ? 230.686 19.061  10.209  1.00 118.10 ? 233  TYR A O   1 
ATOM 1282  C CB  . TYR A 1 164  ? 231.165 20.843  7.629   1.00 118.57 ? 233  TYR A CB  1 
ATOM 1283  C CG  . TYR A 1 164  ? 231.066 22.343  7.268   1.00 118.72 ? 233  TYR A CG  1 
ATOM 1284  C CD1 . TYR A 1 164  ? 230.514 23.290  8.169   1.00 118.44 ? 233  TYR A CD1 1 
ATOM 1285  C CD2 . TYR A 1 164  ? 231.626 22.834  6.077   1.00 118.28 ? 233  TYR A CD2 1 
ATOM 1286  C CE1 . TYR A 1 164  ? 230.548 24.660  7.888   1.00 118.17 ? 233  TYR A CE1 1 
ATOM 1287  C CE2 . TYR A 1 164  ? 231.658 24.203  5.802   1.00 117.36 ? 233  TYR A CE2 1 
ATOM 1288  C CZ  . TYR A 1 164  ? 231.125 25.099  6.710   1.00 117.80 ? 233  TYR A CZ  1 
ATOM 1289  O OH  . TYR A 1 164  ? 231.204 26.446  6.460   1.00 117.99 ? 233  TYR A OH  1 
ATOM 1290  N N   . SER A 1 165  ? 232.392 18.124  9.068   1.00 117.48 ? 234  SER A N   1 
ATOM 1291  C CA  . SER A 1 165  ? 232.071 16.789  9.622   1.00 116.26 ? 234  SER A CA  1 
ATOM 1292  C C   . SER A 1 165  ? 232.996 15.664  9.186   1.00 115.30 ? 234  SER A C   1 
ATOM 1293  O O   . SER A 1 165  ? 234.192 15.693  9.485   1.00 114.90 ? 234  SER A O   1 
ATOM 1294  C CB  . SER A 1 165  ? 230.608 16.410  9.306   1.00 116.69 ? 234  SER A CB  1 
ATOM 1295  O OG  . SER A 1 165  ? 230.213 15.270  10.048  1.00 117.56 ? 234  SER A OG  1 
ATOM 1296  N N   . TRP A 1 166  ? 232.440 14.667  8.501   1.00 114.63 ? 235  TRP A N   1 
ATOM 1297  C CA  . TRP A 1 166  ? 233.224 13.492  8.098   1.00 114.46 ? 235  TRP A CA  1 
ATOM 1298  C C   . TRP A 1 166  ? 233.184 13.064  6.609   1.00 113.97 ? 235  TRP A C   1 
ATOM 1299  O O   . TRP A 1 166  ? 232.305 13.473  5.848   1.00 112.73 ? 235  TRP A O   1 
ATOM 1300  C CB  . TRP A 1 166  ? 232.780 12.271  8.938   1.00 115.51 ? 235  TRP A CB  1 
ATOM 1301  C CG  . TRP A 1 166  ? 231.355 11.802  8.631   1.00 117.06 ? 235  TRP A CG  1 
ATOM 1302  C CD1 . TRP A 1 166  ? 230.694 11.946  7.445   1.00 117.89 ? 235  TRP A CD1 1 
ATOM 1303  C CD2 . TRP A 1 166  ? 230.453 11.081  9.501   1.00 117.56 ? 235  TRP A CD2 1 
ATOM 1304  N NE1 . TRP A 1 166  ? 229.459 11.367  7.510   1.00 118.72 ? 235  TRP A NE1 1 
ATOM 1305  C CE2 . TRP A 1 166  ? 229.280 10.825  8.755   1.00 117.93 ? 235  TRP A CE2 1 
ATOM 1306  C CE3 . TRP A 1 166  ? 230.525 10.622  10.829  1.00 117.45 ? 235  TRP A CE3 1 
ATOM 1307  C CZ2 . TRP A 1 166  ? 228.182 10.142  9.288   1.00 117.82 ? 235  TRP A CZ2 1 
ATOM 1308  C CZ3 . TRP A 1 166  ? 229.424 9.939   11.362  1.00 117.55 ? 235  TRP A CZ3 1 
ATOM 1309  C CH2 . TRP A 1 166  ? 228.272 9.706   10.585  1.00 118.01 ? 235  TRP A CH2 1 
ATOM 1310  N N   . THR A 1 167  ? 234.150 12.216  6.235   1.00 114.52 ? 236  THR A N   1 
ATOM 1311  C CA  . THR A 1 167  ? 234.306 11.596  4.901   1.00 114.85 ? 236  THR A CA  1 
ATOM 1312  C C   . THR A 1 167  ? 234.571 12.400  3.629   1.00 115.13 ? 236  THR A C   1 
ATOM 1313  O O   . THR A 1 167  ? 234.769 11.802  2.568   1.00 114.45 ? 236  THR A O   1 
ATOM 1314  C CB  . THR A 1 167  ? 233.130 10.682  4.569   1.00 114.50 ? 236  THR A CB  1 
ATOM 1315  O OG1 . THR A 1 167  ? 232.132 10.793  5.587   1.00 113.85 ? 236  THR A OG1 1 
ATOM 1316  C CG2 . THR A 1 167  ? 233.616 9.242   4.483   1.00 114.70 ? 236  THR A CG2 1 
ATOM 1317  N N   . SER A 1 168  ? 234.533 13.730  3.700   1.00 115.95 ? 237  SER A N   1 
ATOM 1318  C CA  . SER A 1 168  ? 234.825 14.537  2.513   1.00 116.72 ? 237  SER A CA  1 
ATOM 1319  C C   . SER A 1 168  ? 235.823 15.586  2.845   1.00 118.11 ? 237  SER A C   1 
ATOM 1320  O O   . SER A 1 168  ? 235.756 16.174  3.931   1.00 118.07 ? 237  SER A O   1 
ATOM 1321  C CB  . SER A 1 168  ? 233.600 15.235  1.928   1.00 115.37 ? 237  SER A CB  1 
ATOM 1322  O OG  . SER A 1 168  ? 233.980 16.284  1.032   1.00 113.49 ? 237  SER A OG  1 
ATOM 1323  N N   . GLN A 1 169  ? 236.761 15.876  1.935   1.00 119.30 ? 238  GLN A N   1 
ATOM 1324  C CA  . GLN A 1 169  ? 237.696 16.957  2.239   1.00 120.40 ? 238  GLN A CA  1 
ATOM 1325  C C   . GLN A 1 169  ? 238.609 17.266  3.380   1.00 120.69 ? 238  GLN A C   1 
ATOM 1326  O O   . GLN A 1 169  ? 239.752 16.935  3.331   1.00 120.32 ? 238  GLN A O   1 
ATOM 1327  C CB  . GLN A 1 169  ? 236.878 18.193  2.258   1.00 121.39 ? 238  GLN A CB  1 
ATOM 1328  C CG  . GLN A 1 169  ? 235.988 18.960  1.273   1.00 123.25 ? 238  GLN A CG  1 
ATOM 1329  C CD  . GLN A 1 169  ? 236.289 20.415  1.485   1.00 124.46 ? 238  GLN A CD  1 
ATOM 1330  O OE1 . GLN A 1 169  ? 235.671 21.232  0.862   1.00 124.78 ? 238  GLN A OE1 1 
ATOM 1331  N NE2 . GLN A 1 169  ? 237.276 20.744  2.342   1.00 125.28 ? 238  GLN A NE2 1 
ATOM 1332  N N   . LEU A 1 170  ? 237.829 17.915  4.306   1.00 121.56 ? 239  LEU A N   1 
ATOM 1333  C CA  . LEU A 1 170  ? 238.025 18.683  5.519   1.00 121.70 ? 239  LEU A CA  1 
ATOM 1334  C C   . LEU A 1 170  ? 239.058 18.966  6.553   1.00 121.60 ? 239  LEU A C   1 
ATOM 1335  O O   . LEU A 1 170  ? 238.951 18.224  7.593   1.00 121.33 ? 239  LEU A O   1 
ATOM 1336  C CB  . LEU A 1 170  ? 236.783 18.551  6.152   1.00 121.08 ? 239  LEU A CB  1 
ATOM 1337  C CG  . LEU A 1 170  ? 235.754 19.301  5.218   1.00 119.49 ? 239  LEU A CG  1 
ATOM 1338  C CD1 . LEU A 1 170  ? 234.299 19.077  5.570   1.00 118.34 ? 239  LEU A CD1 1 
ATOM 1339  C CD2 . LEU A 1 170  ? 236.047 20.888  5.420   1.00 119.70 ? 239  LEU A CD2 1 
ATOM 1340  N N   . SER A 1 171  ? 239.591 20.163  6.441   1.00 121.46 ? 240  SER A N   1 
ATOM 1341  C CA  . SER A 1 171  ? 240.563 20.806  7.292   1.00 120.66 ? 240  SER A CA  1 
ATOM 1342  C C   . SER A 1 171  ? 241.774 19.925  7.527   1.00 119.77 ? 240  SER A C   1 
ATOM 1343  O O   . SER A 1 171  ? 242.877 20.424  7.377   1.00 119.82 ? 240  SER A O   1 
ATOM 1344  C CB  . SER A 1 171  ? 239.767 21.189  8.544   1.00 120.72 ? 240  SER A CB  1 
ATOM 1345  O OG  . SER A 1 171  ? 240.556 21.856  9.520   1.00 119.88 ? 240  SER A OG  1 
ATOM 1346  N N   . PRO A 1 172  ? 241.599 18.672  7.999   1.00 118.70 ? 241  PRO A N   1 
ATOM 1347  C CA  . PRO A 1 172  ? 242.837 17.918  8.146   1.00 116.99 ? 241  PRO A CA  1 
ATOM 1348  C C   . PRO A 1 172  ? 243.544 17.746  6.775   1.00 114.68 ? 241  PRO A C   1 
ATOM 1349  O O   . PRO A 1 172  ? 244.740 17.469  6.735   1.00 114.21 ? 241  PRO A O   1 
ATOM 1350  C CB  . PRO A 1 172  ? 242.354 16.616  8.752   1.00 118.10 ? 241  PRO A CB  1 
ATOM 1351  C CG  . PRO A 1 172  ? 241.223 17.037  9.650   1.00 118.21 ? 241  PRO A CG  1 
ATOM 1352  C CD  . PRO A 1 172  ? 240.735 18.395  9.162   1.00 118.28 ? 241  PRO A CD  1 
ATOM 1353  N N   . ALA A 1 173  ? 242.808 17.878  5.663   1.00 112.41 ? 242  ALA A N   1 
ATOM 1354  C CA  . ALA A 1 173  ? 243.417 17.778  4.332   1.00 110.01 ? 242  ALA A CA  1 
ATOM 1355  C C   . ALA A 1 173  ? 244.464 18.884  4.345   1.00 107.99 ? 242  ALA A C   1 
ATOM 1356  O O   . ALA A 1 173  ? 245.627 18.648  4.017   1.00 107.20 ? 242  ALA A O   1 
ATOM 1357  C CB  . ALA A 1 173  ? 242.384 18.019  3.246   1.00 110.49 ? 242  ALA A CB  1 
ATOM 1358  N N   . ASP A 1 174  ? 244.036 20.089  4.737   1.00 105.63 ? 243  ASP A N   1 
ATOM 1359  C CA  . ASP A 1 174  ? 244.944 21.224  4.886   1.00 103.54 ? 243  ASP A CA  1 
ATOM 1360  C C   . ASP A 1 174  ? 245.742 20.960  6.160   1.00 102.40 ? 243  ASP A C   1 
ATOM 1361  O O   . ASP A 1 174  ? 246.665 21.693  6.481   1.00 102.29 ? 243  ASP A O   1 
ATOM 1362  C CB  . ASP A 1 174  ? 244.213 22.586  5.011   1.00 102.60 ? 243  ASP A CB  1 
ATOM 1363  C CG  . ASP A 1 174  ? 243.128 22.603  6.089   1.00 101.40 ? 243  ASP A CG  1 
ATOM 1364  O OD1 . ASP A 1 174  ? 243.406 22.916  7.275   1.00 100.73 ? 243  ASP A OD1 1 
ATOM 1365  O OD2 . ASP A 1 174  ? 241.974 22.305  5.724   1.00 101.12 ? 243  ASP A OD2 1 
ATOM 1366  N N   . LEU A 1 175  ? 245.380 19.942  6.931   1.00 100.55 ? 244  LEU A N   1 
ATOM 1367  C CA  . LEU A 1 175  ? 246.202 19.671  8.096   1.00 98.30  ? 244  LEU A CA  1 
ATOM 1368  C C   . LEU A 1 175  ? 247.457 19.030  7.556   1.00 97.20  ? 244  LEU A C   1 
ATOM 1369  O O   . LEU A 1 175  ? 248.299 18.624  8.336   1.00 95.67  ? 244  LEU A O   1 
ATOM 1370  C CB  . LEU A 1 175  ? 245.576 18.702  9.103   1.00 96.56  ? 244  LEU A CB  1 
ATOM 1371  C CG  . LEU A 1 175  ? 244.740 19.307  10.225  1.00 94.10  ? 244  LEU A CG  1 
ATOM 1372  C CD1 . LEU A 1 175  ? 244.383 18.247  11.273  1.00 92.76  ? 244  LEU A CD1 1 
ATOM 1373  C CD2 . LEU A 1 175  ? 245.531 20.444  10.839  1.00 92.88  ? 244  LEU A CD2 1 
ATOM 1374  N N   . ILE A 1 176  ? 247.604 18.897  6.236   1.00 97.39  ? 245  ILE A N   1 
ATOM 1375  C CA  . ILE A 1 176  ? 248.849 18.308  5.768   1.00 97.72  ? 245  ILE A CA  1 
ATOM 1376  C C   . ILE A 1 176  ? 249.887 19.428  5.902   1.00 97.29  ? 245  ILE A C   1 
ATOM 1377  O O   . ILE A 1 176  ? 251.073 19.174  6.008   1.00 98.51  ? 245  ILE A O   1 
ATOM 1378  C CB  . ILE A 1 176  ? 248.734 17.652  4.341   1.00 97.86  ? 245  ILE A CB  1 
ATOM 1379  C CG1 . ILE A 1 176  ? 248.432 18.676  3.265   1.00 97.84  ? 245  ILE A CG1 1 
ATOM 1380  C CG2 . ILE A 1 176  ? 247.687 16.566  4.366   1.00 96.45  ? 245  ILE A CG2 1 
ATOM 1381  C CD1 . ILE A 1 176  ? 249.659 19.300  2.657   1.00 91.71  ? 245  ILE A CD1 1 
ATOM 1382  N N   . PRO A 1 177  ? 249.456 20.690  5.810   1.00 96.02  ? 246  PRO A N   1 
ATOM 1383  C CA  . PRO A 1 177  ? 250.528 21.660  6.009   1.00 94.45  ? 246  PRO A CA  1 
ATOM 1384  C C   . PRO A 1 177  ? 250.794 21.756  7.527   1.00 93.01  ? 246  PRO A C   1 
ATOM 1385  O O   . PRO A 1 177  ? 251.668 22.500  7.953   1.00 92.14  ? 246  PRO A O   1 
ATOM 1386  C CB  . PRO A 1 177  ? 249.940 22.921  5.419   1.00 94.25  ? 246  PRO A CB  1 
ATOM 1387  C CG  . PRO A 1 177  ? 249.267 22.381  4.214   1.00 94.71  ? 246  PRO A CG  1 
ATOM 1388  C CD  . PRO A 1 177  ? 248.544 21.173  4.754   1.00 95.32  ? 246  PRO A CD  1 
ATOM 1389  N N   . LEU A 1 178  ? 250.038 20.990  8.325   1.00 91.97  ? 247  LEU A N   1 
ATOM 1390  C CA  . LEU A 1 178  ? 250.182 20.953  9.797   1.00 90.59  ? 247  LEU A CA  1 
ATOM 1391  C C   . LEU A 1 178  ? 251.530 20.400  10.211  1.00 89.78  ? 247  LEU A C   1 
ATOM 1392  O O   . LEU A 1 178  ? 252.126 20.824  11.199  1.00 90.00  ? 247  LEU A O   1 
ATOM 1393  C CB  . LEU A 1 178  ? 249.133 20.038  10.458  1.00 90.38  ? 247  LEU A CB  1 
ATOM 1394  C CG  . LEU A 1 178  ? 249.758 18.784  11.113  1.00 90.24  ? 247  LEU A CG  1 
ATOM 1395  C CD1 . LEU A 1 178  ? 249.299 18.668  12.516  1.00 90.53  ? 247  LEU A CD1 1 
ATOM 1396  C CD2 . LEU A 1 178  ? 249.414 17.524  10.363  1.00 89.70  ? 247  LEU A CD2 1 
ATOM 1397  N N   . GLU A 1 179  ? 251.975 19.408  9.459   1.00 88.28  ? 248  GLU A N   1 
ATOM 1398  C CA  . GLU A 1 179  ? 253.217 18.744  9.754   1.00 86.30  ? 248  GLU A CA  1 
ATOM 1399  C C   . GLU A 1 179  ? 254.298 19.666  10.227  1.00 83.74  ? 248  GLU A C   1 
ATOM 1400  O O   . GLU A 1 179  ? 254.618 19.681  11.408  1.00 82.89  ? 248  GLU A O   1 
ATOM 1401  C CB  . GLU A 1 179  ? 253.737 17.955  8.551   1.00 88.56  ? 248  GLU A CB  1 
ATOM 1402  C CG  . GLU A 1 179  ? 253.003 18.149  7.241   1.00 92.16  ? 248  GLU A CG  1 
ATOM 1403  C CD  . GLU A 1 179  ? 251.772 17.250  7.092   1.00 93.97  ? 248  GLU A CD  1 
ATOM 1404  O OE1 . GLU A 1 179  ? 250.969 17.168  8.043   1.00 93.27  ? 248  GLU A OE1 1 
ATOM 1405  O OE2 . GLU A 1 179  ? 251.590 16.645  6.011   1.00 95.70  ? 248  GLU A OE2 1 
ATOM 1406  N N   . VAL A 1 180  ? 254.874 20.438  9.321   1.00 81.91  ? 249  VAL A N   1 
ATOM 1407  C CA  . VAL A 1 180  ? 255.940 21.295  9.763   1.00 80.90  ? 249  VAL A CA  1 
ATOM 1408  C C   . VAL A 1 180  ? 255.536 22.013  11.024  1.00 79.34  ? 249  VAL A C   1 
ATOM 1409  O O   . VAL A 1 180  ? 256.148 21.812  12.063  1.00 77.96  ? 249  VAL A O   1 
ATOM 1410  C CB  . VAL A 1 180  ? 256.385 22.253  8.666   1.00 81.68  ? 249  VAL A CB  1 
ATOM 1411  C CG1 . VAL A 1 180  ? 257.080 23.476  9.249   1.00 81.31  ? 249  VAL A CG1 1 
ATOM 1412  C CG2 . VAL A 1 180  ? 257.341 21.518  7.812   1.00 82.15  ? 249  VAL A CG2 1 
ATOM 1413  N N   . PRO A 1 181  ? 254.478 22.822  10.978  1.00 77.92  ? 250  PRO A N   1 
ATOM 1414  C CA  . PRO A 1 181  ? 254.111 23.500  12.215  1.00 77.76  ? 250  PRO A CA  1 
ATOM 1415  C C   . PRO A 1 181  ? 254.148 22.647  13.480  1.00 78.36  ? 250  PRO A C   1 
ATOM 1416  O O   . PRO A 1 181  ? 254.618 23.129  14.508  1.00 78.46  ? 250  PRO A O   1 
ATOM 1417  C CB  . PRO A 1 181  ? 252.722 24.020  11.905  1.00 76.85  ? 250  PRO A CB  1 
ATOM 1418  C CG  . PRO A 1 181  ? 252.879 24.442  10.493  1.00 74.89  ? 250  PRO A CG  1 
ATOM 1419  C CD  . PRO A 1 181  ? 253.604 23.251  9.876   1.00 76.39  ? 250  PRO A CD  1 
ATOM 1420  N N   . THR A 1 182  ? 253.688 21.390  13.410  1.00 78.43  ? 251  THR A N   1 
ATOM 1421  C CA  . THR A 1 182  ? 253.648 20.514  14.604  1.00 77.57  ? 251  THR A CA  1 
ATOM 1422  C C   . THR A 1 182  ? 254.960 19.995  15.198  1.00 77.83  ? 251  THR A C   1 
ATOM 1423  O O   . THR A 1 182  ? 255.190 20.157  16.404  1.00 77.18  ? 251  THR A O   1 
ATOM 1424  C CB  . THR A 1 182  ? 252.713 19.296  14.407  1.00 77.72  ? 251  THR A CB  1 
ATOM 1425  O OG1 . THR A 1 182  ? 253.073 18.587  13.221  1.00 77.19  ? 251  THR A OG1 1 
ATOM 1426  C CG2 . THR A 1 182  ? 251.285 19.752  14.316  1.00 75.94  ? 251  THR A CG2 1 
ATOM 1427  N N   . GLY A 1 183  ? 255.788 19.336  14.386  1.00 78.82  ? 252  GLY A N   1 
ATOM 1428  C CA  . GLY A 1 183  ? 257.079 18.865  14.876  1.00 80.88  ? 252  GLY A CA  1 
ATOM 1429  C C   . GLY A 1 183  ? 257.350 17.429  15.307  1.00 81.39  ? 252  GLY A C   1 
ATOM 1430  O O   . GLY A 1 183  ? 258.011 16.689  14.579  1.00 81.89  ? 252  GLY A O   1 
ATOM 1431  N N   . ALA A 1 184  ? 256.867 17.077  16.503  1.00 81.44  ? 253  ALA A N   1 
ATOM 1432  C CA  . ALA A 1 184  ? 257.011 15.769  17.172  1.00 80.82  ? 253  ALA A CA  1 
ATOM 1433  C C   . ALA A 1 184  ? 257.557 16.141  18.514  1.00 80.32  ? 253  ALA A C   1 
ATOM 1434  O O   . ALA A 1 184  ? 258.445 15.476  19.041  1.00 79.96  ? 253  ALA A O   1 
ATOM 1435  C CB  . ALA A 1 184  ? 258.012 14.891  16.508  1.00 80.32  ? 253  ALA A CB  1 
ATOM 1436  N N   . SER A 1 185  ? 257.040 17.232  19.048  1.00 79.81  ? 254  SER A N   1 
ATOM 1437  C CA  . SER A 1 185  ? 257.502 17.730  20.320  1.00 79.29  ? 254  SER A CA  1 
ATOM 1438  C C   . SER A 1 185  ? 258.699 18.635  20.085  1.00 79.99  ? 254  SER A C   1 
ATOM 1439  O O   . SER A 1 185  ? 259.440 18.904  21.028  1.00 78.91  ? 254  SER A O   1 
ATOM 1440  C CB  . SER A 1 185  ? 257.903 16.592  21.256  1.00 77.79  ? 254  SER A CB  1 
ATOM 1441  O OG  . SER A 1 185  ? 258.258 17.102  22.522  1.00 75.54  ? 254  SER A OG  1 
ATOM 1442  N N   . SER A 1 186  ? 258.901 19.054  18.825  1.00 82.12  ? 255  SER A N   1 
ATOM 1443  C CA  . SER A 1 186  ? 259.969 20.000  18.413  1.00 85.38  ? 255  SER A CA  1 
ATOM 1444  C C   . SER A 1 186  ? 261.084 19.713  17.370  1.00 87.28  ? 255  SER A C   1 
ATOM 1445  O O   . SER A 1 186  ? 261.920 20.583  17.115  1.00 88.38  ? 255  SER A O   1 
ATOM 1446  C CB  . SER A 1 186  ? 260.635 20.610  19.655  1.00 85.03  ? 255  SER A CB  1 
ATOM 1447  O OG  . SER A 1 186  ? 259.688 21.299  20.456  1.00 86.56  ? 255  SER A OG  1 
ATOM 1448  N N   . PRO A 1 187  ? 261.182 18.486  16.833  1.00 88.49  ? 256  PRO A N   1 
ATOM 1449  C CA  . PRO A 1 187  ? 260.328 17.335  17.119  1.00 89.41  ? 256  PRO A CA  1 
ATOM 1450  C C   . PRO A 1 187  ? 261.036 16.918  18.394  1.00 90.45  ? 256  PRO A C   1 
ATOM 1451  O O   . PRO A 1 187  ? 260.478 16.430  19.382  1.00 90.78  ? 256  PRO A O   1 
ATOM 1452  C CB  . PRO A 1 187  ? 260.656 16.363  15.978  1.00 88.88  ? 256  PRO A CB  1 
ATOM 1453  C CG  . PRO A 1 187  ? 261.530 17.136  15.003  1.00 89.09  ? 256  PRO A CG  1 
ATOM 1454  C CD  . PRO A 1 187  ? 262.233 18.126  15.863  1.00 88.46  ? 256  PRO A CD  1 
ATOM 1455  N N   . THR A 1 188  ? 262.319 17.215  18.306  1.00 91.69  ? 257  THR A N   1 
ATOM 1456  C CA  . THR A 1 188  ? 263.312 16.946  19.289  1.00 92.54  ? 257  THR A CA  1 
ATOM 1457  C C   . THR A 1 188  ? 263.308 17.829  20.498  1.00 93.02  ? 257  THR A C   1 
ATOM 1458  O O   . THR A 1 188  ? 262.458 18.687  20.746  1.00 92.56  ? 257  THR A O   1 
ATOM 1459  C CB  . THR A 1 188  ? 264.720 17.057  18.662  1.00 92.82  ? 257  THR A CB  1 
ATOM 1460  O OG1 . THR A 1 188  ? 265.713 16.600  19.590  1.00 92.65  ? 257  THR A OG1 1 
ATOM 1461  C CG2 . THR A 1 188  ? 265.013 18.514  18.287  1.00 93.35  ? 257  THR A CG2 1 
ATOM 1462  N N   . GLN A 1 189  ? 264.343 17.545  21.244  1.00 94.42  ? 258  GLN A N   1 
ATOM 1463  C CA  . GLN A 1 189  ? 264.682 18.185  22.452  1.00 96.13  ? 258  GLN A CA  1 
ATOM 1464  C C   . GLN A 1 189  ? 265.970 18.796  21.850  1.00 96.87  ? 258  GLN A C   1 
ATOM 1465  O O   . GLN A 1 189  ? 265.918 19.196  20.689  1.00 96.56  ? 258  GLN A O   1 
ATOM 1466  C CB  . GLN A 1 189  ? 264.815 17.063  23.485  1.00 96.72  ? 258  GLN A CB  1 
ATOM 1467  C CG  . GLN A 1 189  ? 263.454 16.266  23.717  1.00 96.69  ? 258  GLN A CG  1 
ATOM 1468  C CD  . GLN A 1 189  ? 262.746 15.758  22.430  1.00 97.01  ? 258  GLN A CD  1 
ATOM 1469  O OE1 . GLN A 1 189  ? 263.394 15.374  21.463  1.00 96.25  ? 258  GLN A OE1 1 
ATOM 1470  N NE2 . GLN A 1 189  ? 261.415 15.739  22.444  1.00 97.05  ? 258  GLN A NE2 1 
ATOM 1471  N N   . ARG A 1 190  ? 267.121 18.839  22.514  1.00 98.37  ? 259  ARG A N   1 
ATOM 1472  C CA  . ARG A 1 190  ? 268.251 19.537  21.865  1.00 100.71 ? 259  ARG A CA  1 
ATOM 1473  C C   . ARG A 1 190  ? 269.378 18.957  20.975  1.00 103.02 ? 259  ARG A C   1 
ATOM 1474  O O   . ARG A 1 190  ? 269.855 19.681  20.096  1.00 103.80 ? 259  ARG A O   1 
ATOM 1475  C CB  . ARG A 1 190  ? 268.913 20.458  22.906  1.00 99.50  ? 259  ARG A CB  1 
ATOM 1476  C CG  . ARG A 1 190  ? 269.317 21.827  22.352  1.00 98.24  ? 259  ARG A CG  1 
ATOM 1477  C CD  . ARG A 1 190  ? 268.394 22.265  21.202  1.00 97.37  ? 259  ARG A CD  1 
ATOM 1478  N NE  . ARG A 1 190  ? 267.020 21.777  21.375  1.00 95.78  ? 259  ARG A NE  1 
ATOM 1479  C CZ  . ARG A 1 190  ? 266.012 21.990  20.529  1.00 92.69  ? 259  ARG A CZ  1 
ATOM 1480  N NH1 . ARG A 1 190  ? 266.195 22.699  19.423  1.00 90.86  ? 259  ARG A NH1 1 
ATOM 1481  N NH2 . ARG A 1 190  ? 264.813 21.476  20.784  1.00 91.23  ? 259  ARG A NH2 1 
ATOM 1482  N N   . ASP A 1 191  ? 269.799 17.703  21.159  1.00 105.40 ? 260  ASP A N   1 
ATOM 1483  C CA  . ASP A 1 191  ? 270.920 17.125  20.386  1.00 107.22 ? 260  ASP A CA  1 
ATOM 1484  C C   . ASP A 1 191  ? 272.172 17.712  21.064  1.00 108.49 ? 260  ASP A C   1 
ATOM 1485  O O   . ASP A 1 191  ? 273.316 17.482  20.656  1.00 107.98 ? 260  ASP A O   1 
ATOM 1486  C CB  . ASP A 1 191  ? 270.829 17.497  18.880  1.00 107.12 ? 260  ASP A CB  1 
ATOM 1487  C CG  . ASP A 1 191  ? 271.994 18.379  18.391  1.00 106.94 ? 260  ASP A CG  1 
ATOM 1488  O OD1 . ASP A 1 191  ? 273.140 17.875  18.301  1.00 106.15 ? 260  ASP A OD1 1 
ATOM 1489  O OD2 . ASP A 1 191  ? 271.757 19.577  18.086  1.00 106.88 ? 260  ASP A OD2 1 
ATOM 1490  N N   . TRP A 1 192  ? 271.904 18.465  22.131  1.00 110.34 ? 261  TRP A N   1 
ATOM 1491  C CA  . TRP A 1 192  ? 272.915 19.111  22.964  1.00 112.37 ? 261  TRP A CA  1 
ATOM 1492  C C   . TRP A 1 192  ? 273.085 18.290  24.233  1.00 112.84 ? 261  TRP A C   1 
ATOM 1493  O O   . TRP A 1 192  ? 272.288 18.400  25.177  1.00 113.07 ? 261  TRP A O   1 
ATOM 1494  C CB  . TRP A 1 192  ? 272.496 20.549  23.303  1.00 114.13 ? 261  TRP A CB  1 
ATOM 1495  C CG  . TRP A 1 192  ? 272.853 21.534  22.213  1.00 116.00 ? 261  TRP A CG  1 
ATOM 1496  C CD1 . TRP A 1 192  ? 272.357 22.802  22.042  1.00 116.54 ? 261  TRP A CD1 1 
ATOM 1497  C CD2 . TRP A 1 192  ? 273.795 21.327  21.151  1.00 116.88 ? 261  TRP A CD2 1 
ATOM 1498  N NE1 . TRP A 1 192  ? 272.931 23.389  20.936  1.00 117.65 ? 261  TRP A NE1 1 
ATOM 1499  C CE2 . TRP A 1 192  ? 273.816 22.507  20.373  1.00 117.41 ? 261  TRP A CE2 1 
ATOM 1500  C CE3 . TRP A 1 192  ? 274.625 20.256  20.781  1.00 117.10 ? 261  TRP A CE3 1 
ATOM 1501  C CZ2 . TRP A 1 192  ? 274.634 22.645  19.251  1.00 117.23 ? 261  TRP A CZ2 1 
ATOM 1502  C CZ3 . TRP A 1 192  ? 275.437 20.393  19.668  1.00 117.01 ? 261  TRP A CZ3 1 
ATOM 1503  C CH2 . TRP A 1 192  ? 275.434 21.580  18.915  1.00 116.83 ? 261  TRP A CH2 1 
ATOM 1504  N N   . GLN A 1 193  ? 274.134 17.464  24.220  1.00 113.45 ? 262  GLN A N   1 
ATOM 1505  C CA  . GLN A 1 193  ? 274.495 16.545  25.303  1.00 113.82 ? 262  GLN A CA  1 
ATOM 1506  C C   . GLN A 1 193  ? 273.766 15.205  25.192  1.00 113.83 ? 262  GLN A C   1 
ATOM 1507  O O   . GLN A 1 193  ? 273.692 14.614  24.111  1.00 113.52 ? 262  GLN A O   1 
ATOM 1508  C CB  . GLN A 1 193  ? 274.251 17.170  26.691  1.00 113.57 ? 262  GLN A CB  1 
ATOM 1509  C CG  . GLN A 1 193  ? 275.475 17.875  27.243  1.00 113.72 ? 262  GLN A CG  1 
ATOM 1510  C CD  . GLN A 1 193  ? 276.735 17.478  26.484  1.00 113.64 ? 262  GLN A CD  1 
ATOM 1511  O OE1 . GLN A 1 193  ? 277.079 16.295  26.393  1.00 113.63 ? 262  GLN A OE1 1 
ATOM 1512  N NE2 . GLN A 1 193  ? 277.420 18.469  25.923  1.00 112.68 ? 262  GLN A NE2 1 
ATOM 1513  N N   . GLU A 1 194  ? 273.236 14.726  26.312  1.00 113.64 ? 263  GLU A N   1 
ATOM 1514  C CA  . GLU A 1 194  ? 272.520 13.458  26.344  1.00 113.17 ? 263  GLU A CA  1 
ATOM 1515  C C   . GLU A 1 194  ? 271.151 13.549  25.700  1.00 113.04 ? 263  GLU A C   1 
ATOM 1516  O O   . GLU A 1 194  ? 270.367 14.444  26.037  1.00 113.21 ? 263  GLU A O   1 
ATOM 1517  C CB  . GLU A 1 194  ? 272.352 13.001  27.784  1.00 113.03 ? 263  GLU A CB  1 
ATOM 1518  C CG  . GLU A 1 194  ? 272.718 14.065  28.794  1.00 113.02 ? 263  GLU A CG  1 
ATOM 1519  C CD  . GLU A 1 194  ? 272.467 13.613  30.202  1.00 113.49 ? 263  GLU A CD  1 
ATOM 1520  O OE1 . GLU A 1 194  ? 272.590 12.395  30.460  1.00 113.91 ? 263  GLU A OE1 1 
ATOM 1521  O OE2 . GLU A 1 194  ? 272.160 14.475  31.049  1.00 113.61 ? 263  GLU A OE2 1 
ATOM 1522  N N   . GLN A 1 195  ? 270.874 12.613  24.787  1.00 112.67 ? 264  GLN A N   1 
ATOM 1523  C CA  . GLN A 1 195  ? 269.585 12.535  24.082  1.00 112.08 ? 264  GLN A CA  1 
ATOM 1524  C C   . GLN A 1 195  ? 268.722 11.396  24.569  1.00 110.33 ? 264  GLN A C   1 
ATOM 1525  O O   . GLN A 1 195  ? 269.147 10.240  24.542  1.00 110.24 ? 264  GLN A O   1 
ATOM 1526  C CB  . GLN A 1 195  ? 269.769 12.337  22.581  1.00 114.26 ? 264  GLN A CB  1 
ATOM 1527  C CG  . GLN A 1 195  ? 269.985 13.620  21.835  1.00 116.93 ? 264  GLN A CG  1 
ATOM 1528  C CD  . GLN A 1 195  ? 269.284 14.788  22.503  1.00 118.02 ? 264  GLN A CD  1 
ATOM 1529  O OE1 . GLN A 1 195  ? 268.080 14.737  22.788  1.00 118.88 ? 264  GLN A OE1 1 
ATOM 1530  N NE2 . GLN A 1 195  ? 270.040 15.849  22.765  1.00 118.08 ? 264  GLN A NE2 1 
ATOM 1531  N N   . LEU A 1 196  ? 267.496 11.710  24.976  1.00 108.49 ? 265  LEU A N   1 
ATOM 1532  C CA  . LEU A 1 196  ? 266.623 10.668  25.471  1.00 106.06 ? 265  LEU A CA  1 
ATOM 1533  C C   . LEU A 1 196  ? 266.355 9.642   24.372  1.00 105.11 ? 265  LEU A C   1 
ATOM 1534  O O   . LEU A 1 196  ? 265.966 9.987   23.252  1.00 104.54 ? 265  LEU A O   1 
ATOM 1535  C CB  . LEU A 1 196  ? 265.309 11.266  26.029  1.00 104.54 ? 265  LEU A CB  1 
ATOM 1536  C CG  . LEU A 1 196  ? 264.111 11.765  25.213  1.00 103.10 ? 265  LEU A CG  1 
ATOM 1537  C CD1 . LEU A 1 196  ? 263.477 10.607  24.446  1.00 102.47 ? 265  LEU A CD1 1 
ATOM 1538  C CD2 . LEU A 1 196  ? 263.077 12.358  26.160  1.00 102.85 ? 265  LEU A CD2 1 
ATOM 1539  N N   . VAL A 1 197  ? 266.650 8.385   24.687  1.00 104.06 ? 266  VAL A N   1 
ATOM 1540  C CA  . VAL A 1 197  ? 266.390 7.274   23.781  1.00 103.33 ? 266  VAL A CA  1 
ATOM 1541  C C   . VAL A 1 197  ? 264.931 7.045   24.143  1.00 103.31 ? 266  VAL A C   1 
ATOM 1542  O O   . VAL A 1 197  ? 264.416 7.720   25.033  1.00 103.64 ? 266  VAL A O   1 
ATOM 1543  C CB  . VAL A 1 197  ? 267.239 6.004   24.151  1.00 103.15 ? 266  VAL A CB  1 
ATOM 1544  C CG1 . VAL A 1 197  ? 267.022 5.617   25.608  1.00 101.77 ? 266  VAL A CG1 1 
ATOM 1545  C CG2 . VAL A 1 197  ? 266.854 4.834   23.269  1.00 102.58 ? 266  VAL A CG2 1 
ATOM 1546  N N   . VAL A 1 198  ? 264.237 6.139   23.472  1.00 102.91 ? 267  VAL A N   1 
ATOM 1547  C CA  . VAL A 1 198  ? 262.858 5.909   23.866  1.00 101.57 ? 267  VAL A CA  1 
ATOM 1548  C C   . VAL A 1 198  ? 262.439 4.464   23.674  1.00 101.06 ? 267  VAL A C   1 
ATOM 1549  O O   . VAL A 1 198  ? 262.586 3.881   22.604  1.00 102.11 ? 267  VAL A O   1 
ATOM 1550  C CB  . VAL A 1 198  ? 261.899 6.872   23.146  1.00 100.90 ? 267  VAL A CB  1 
ATOM 1551  C CG1 . VAL A 1 198  ? 261.205 7.748   24.164  1.00 100.64 ? 267  VAL A CG1 1 
ATOM 1552  C CG2 . VAL A 1 198  ? 262.657 7.771   22.237  1.00 100.50 ? 267  VAL A CG2 1 
ATOM 1553  N N   . GLY A 1 199  ? 261.947 3.874   24.751  1.00 98.70  ? 268  GLY A N   1 
ATOM 1554  C CA  . GLY A 1 199  ? 261.526 2.494   24.690  1.00 97.00  ? 268  GLY A CA  1 
ATOM 1555  C C   . GLY A 1 199  ? 260.027 2.428   24.553  1.00 95.70  ? 268  GLY A C   1 
ATOM 1556  O O   . GLY A 1 199  ? 259.299 2.885   25.440  1.00 96.43  ? 268  GLY A O   1 
ATOM 1557  N N   . HIS A 1 200  ? 259.563 1.867   23.440  1.00 93.99  ? 269  HIS A N   1 
ATOM 1558  C CA  . HIS A 1 200  ? 258.134 1.759   23.200  1.00 92.00  ? 269  HIS A CA  1 
ATOM 1559  C C   . HIS A 1 200  ? 257.737 0.508   22.465  1.00 90.56  ? 269  HIS A C   1 
ATOM 1560  O O   . HIS A 1 200  ? 258.574 -0.266  21.997  1.00 90.07  ? 269  HIS A O   1 
ATOM 1561  C CB  . HIS A 1 200  ? 257.637 2.976   22.430  1.00 91.38  ? 269  HIS A CB  1 
ATOM 1562  C CG  . HIS A 1 200  ? 257.924 4.263   23.123  1.00 91.70  ? 269  HIS A CG  1 
ATOM 1563  N ND1 . HIS A 1 200  ? 258.687 5.261   22.562  1.00 91.49  ? 269  HIS A ND1 1 
ATOM 1564  C CD2 . HIS A 1 200  ? 257.613 4.682   24.368  1.00 91.48  ? 269  HIS A CD2 1 
ATOM 1565  C CE1 . HIS A 1 200  ? 258.837 6.239   23.437  1.00 91.78  ? 269  HIS A CE1 1 
ATOM 1566  N NE2 . HIS A 1 200  ? 258.198 5.910   24.541  1.00 91.80  ? 269  HIS A NE2 1 
ATOM 1567  N N   . ASN A 1 201  ? 256.433 0.325   22.365  1.00 89.62  ? 270  ASN A N   1 
ATOM 1568  C CA  . ASN A 1 201  ? 255.893 -0.829  21.703  1.00 88.78  ? 270  ASN A CA  1 
ATOM 1569  C C   . ASN A 1 201  ? 255.269 -0.494  20.376  1.00 88.40  ? 270  ASN A C   1 
ATOM 1570  O O   . ASN A 1 201  ? 254.174 0.057   20.296  1.00 89.03  ? 270  ASN A O   1 
ATOM 1571  C CB  . ASN A 1 201  ? 254.861 -1.497  22.593  1.00 87.87  ? 270  ASN A CB  1 
ATOM 1572  C CG  . ASN A 1 201  ? 254.772 -0.845  23.950  1.00 88.72  ? 270  ASN A CG  1 
ATOM 1573  O OD1 . ASN A 1 201  ? 255.792 -0.527  24.554  1.00 89.20  ? 270  ASN A OD1 1 
ATOM 1574  N ND2 . ASN A 1 201  ? 253.552 -0.648  24.443  1.00 88.22  ? 270  ASN A ND2 1 
ATOM 1575  N N   . VAL A 1 202  ? 256.000 -0.821  19.327  1.00 87.63  ? 271  VAL A N   1 
ATOM 1576  C CA  . VAL A 1 202  ? 255.519 -0.646  17.980  1.00 85.79  ? 271  VAL A CA  1 
ATOM 1577  C C   . VAL A 1 202  ? 255.386 0.747   17.426  1.00 84.49  ? 271  VAL A C   1 
ATOM 1578  O O   . VAL A 1 202  ? 256.018 1.715   17.856  1.00 83.97  ? 271  VAL A O   1 
ATOM 1579  C CB  . VAL A 1 202  ? 254.135 -1.317  17.809  1.00 86.23  ? 271  VAL A CB  1 
ATOM 1580  C CG1 . VAL A 1 202  ? 253.926 -1.770  16.380  1.00 85.14  ? 271  VAL A CG1 1 
ATOM 1581  C CG2 . VAL A 1 202  ? 254.015 -2.472  18.739  1.00 86.97  ? 271  VAL A CG2 1 
ATOM 1582  N N   . SER A 1 203  ? 254.498 0.765   16.442  1.00 83.49  ? 272  SER A N   1 
ATOM 1583  C CA  . SER A 1 203  ? 254.077 1.871   15.601  1.00 83.86  ? 272  SER A CA  1 
ATOM 1584  C C   . SER A 1 203  ? 253.410 3.106   16.182  1.00 84.27  ? 272  SER A C   1 
ATOM 1585  O O   . SER A 1 203  ? 253.019 3.168   17.349  1.00 84.12  ? 272  SER A O   1 
ATOM 1586  C CB  . SER A 1 203  ? 253.134 1.324   14.521  1.00 84.16  ? 272  SER A CB  1 
ATOM 1587  O OG  . SER A 1 203  ? 253.787 1.123   13.285  1.00 85.19  ? 272  SER A OG  1 
ATOM 1588  N N   . PHE A 1 204  ? 253.277 4.076   15.285  1.00 85.12  ? 273  PHE A N   1 
ATOM 1589  C CA  . PHE A 1 204  ? 252.647 5.355   15.517  1.00 85.83  ? 273  PHE A CA  1 
ATOM 1590  C C   . PHE A 1 204  ? 252.979 6.050   16.832  1.00 86.27  ? 273  PHE A C   1 
ATOM 1591  O O   . PHE A 1 204  ? 252.387 7.047   17.215  1.00 86.46  ? 273  PHE A O   1 
ATOM 1592  C CB  . PHE A 1 204  ? 251.158 5.189   15.226  1.00 86.08  ? 273  PHE A CB  1 
ATOM 1593  C CG  . PHE A 1 204  ? 250.894 4.709   13.804  1.00 86.33  ? 273  PHE A CG  1 
ATOM 1594  C CD1 . PHE A 1 204  ? 250.430 5.582   12.823  1.00 85.33  ? 273  PHE A CD1 1 
ATOM 1595  C CD2 . PHE A 1 204  ? 251.218 3.404   13.426  1.00 86.24  ? 273  PHE A CD2 1 
ATOM 1596  C CE1 . PHE A 1 204  ? 250.298 5.161   11.487  1.00 85.09  ? 273  PHE A CE1 1 
ATOM 1597  C CE2 . PHE A 1 204  ? 251.092 2.975   12.098  1.00 85.38  ? 273  PHE A CE2 1 
ATOM 1598  C CZ  . PHE A 1 204  ? 250.634 3.855   11.128  1.00 85.11  ? 273  PHE A CZ  1 
ATOM 1599  N N   . ASP A 1 205  ? 253.988 5.491   17.475  1.00 86.70  ? 274  ASP A N   1 
ATOM 1600  C CA  . ASP A 1 205  ? 254.618 5.986   18.682  1.00 86.97  ? 274  ASP A CA  1 
ATOM 1601  C C   . ASP A 1 205  ? 255.828 6.081   17.784  1.00 87.01  ? 274  ASP A C   1 
ATOM 1602  O O   . ASP A 1 205  ? 256.649 6.978   17.868  1.00 87.45  ? 274  ASP A O   1 
ATOM 1603  C CB  . ASP A 1 205  ? 254.792 4.863   19.688  1.00 87.37  ? 274  ASP A CB  1 
ATOM 1604  C CG  . ASP A 1 205  ? 253.566 4.007   19.795  1.00 88.61  ? 274  ASP A CG  1 
ATOM 1605  O OD1 . ASP A 1 205  ? 253.658 2.889   20.340  1.00 88.52  ? 274  ASP A OD1 1 
ATOM 1606  O OD2 . ASP A 1 205  ? 252.505 4.459   19.324  1.00 89.98  ? 274  ASP A OD2 1 
ATOM 1607  N N   . ARG A 1 206  ? 255.868 5.112   16.873  1.00 86.99  ? 275  ARG A N   1 
ATOM 1608  C CA  . ARG A 1 206  ? 256.860 5.052   15.828  1.00 87.93  ? 275  ARG A CA  1 
ATOM 1609  C C   . ARG A 1 206  ? 256.439 6.348   15.163  1.00 86.06  ? 275  ARG A C   1 
ATOM 1610  O O   . ARG A 1 206  ? 257.166 6.907   14.357  1.00 86.51  ? 275  ARG A O   1 
ATOM 1611  C CB  . ARG A 1 206  ? 256.544 3.924   14.852  1.00 91.69  ? 275  ARG A CB  1 
ATOM 1612  C CG  . ARG A 1 206  ? 257.624 2.919   14.612  1.00 96.84  ? 275  ARG A CG  1 
ATOM 1613  C CD  . ARG A 1 206  ? 257.545 1.847   15.654  1.00 100.81 ? 275  ARG A CD  1 
ATOM 1614  N NE  . ARG A 1 206  ? 258.046 0.575   15.165  1.00 102.63 ? 275  ARG A NE  1 
ATOM 1615  C CZ  . ARG A 1 206  ? 259.284 0.379   14.733  1.00 103.23 ? 275  ARG A CZ  1 
ATOM 1616  N NH1 . ARG A 1 206  ? 260.164 1.367   14.720  1.00 104.25 ? 275  ARG A NH1 1 
ATOM 1617  N NH2 . ARG A 1 206  ? 259.645 -0.813  14.327  1.00 102.81 ? 275  ARG A NH2 1 
ATOM 1618  N N   . ALA A 1 207  ? 255.216 6.783   15.486  1.00 82.93  ? 276  ALA A N   1 
ATOM 1619  C CA  . ALA A 1 207  ? 254.659 8.013   14.953  1.00 79.85  ? 276  ALA A CA  1 
ATOM 1620  C C   . ALA A 1 207  ? 254.925 9.133   15.881  1.00 77.96  ? 276  ALA A C   1 
ATOM 1621  O O   . ALA A 1 207  ? 254.834 10.286  15.496  1.00 78.87  ? 276  ALA A O   1 
ATOM 1622  C CB  . ALA A 1 207  ? 253.190 7.920   14.716  1.00 78.41  ? 276  ALA A CB  1 
ATOM 1623  N N   . HIS A 1 208  ? 255.204 8.820   17.133  1.00 75.36  ? 277  HIS A N   1 
ATOM 1624  C CA  . HIS A 1 208  ? 255.565 9.910   18.001  1.00 72.19  ? 277  HIS A CA  1 
ATOM 1625  C C   . HIS A 1 208  ? 256.856 10.173  17.259  1.00 69.61  ? 277  HIS A C   1 
ATOM 1626  O O   . HIS A 1 208  ? 257.356 11.294  17.140  1.00 70.14  ? 277  HIS A O   1 
ATOM 1627  C CB  . HIS A 1 208  ? 255.847 9.436   19.421  1.00 73.02  ? 277  HIS A CB  1 
ATOM 1628  C CG  . HIS A 1 208  ? 256.060 10.563  20.388  1.00 72.82  ? 277  HIS A CG  1 
ATOM 1629  N ND1 . HIS A 1 208  ? 255.715 11.867  20.096  1.00 72.37  ? 277  HIS A ND1 1 
ATOM 1630  C CD2 . HIS A 1 208  ? 256.576 10.586  21.638  1.00 72.19  ? 277  HIS A CD2 1 
ATOM 1631  C CE1 . HIS A 1 208  ? 256.010 12.644  21.124  1.00 70.73  ? 277  HIS A CE1 1 
ATOM 1632  N NE2 . HIS A 1 208  ? 256.534 11.891  22.073  1.00 70.39  ? 277  HIS A NE2 1 
ATOM 1633  N N   . ILE A 1 209  ? 257.334 9.068   16.705  1.00 66.97  ? 278  ILE A N   1 
ATOM 1634  C CA  . ILE A 1 209  ? 258.537 9.001   15.908  1.00 65.26  ? 278  ILE A CA  1 
ATOM 1635  C C   . ILE A 1 209  ? 258.056 9.157   14.465  1.00 66.04  ? 278  ILE A C   1 
ATOM 1636  O O   . ILE A 1 209  ? 258.676 8.676   13.527  1.00 63.45  ? 278  ILE A O   1 
ATOM 1637  C CB  . ILE A 1 209  ? 259.253 7.625   16.152  1.00 63.28  ? 278  ILE A CB  1 
ATOM 1638  C CG1 . ILE A 1 209  ? 259.625 7.518   17.638  1.00 61.69  ? 278  ILE A CG1 1 
ATOM 1639  C CG2 . ILE A 1 209  ? 260.522 7.490   15.301  1.00 63.79  ? 278  ILE A CG2 1 
ATOM 1640  C CD1 . ILE A 1 209  ? 259.861 6.102   18.146  1.00 91.71  ? 278  ILE A CD1 1 
ATOM 1641  N N   . ARG A 1 210  ? 256.907 9.798   14.300  1.00 68.21  ? 279  ARG A N   1 
ATOM 1642  C CA  . ARG A 1 210  ? 256.403 10.044  12.969  1.00 70.33  ? 279  ARG A CA  1 
ATOM 1643  C C   . ARG A 1 210  ? 256.881 11.412  12.673  1.00 71.31  ? 279  ARG A C   1 
ATOM 1644  O O   . ARG A 1 210  ? 256.852 11.867  11.525  1.00 71.01  ? 279  ARG A O   1 
ATOM 1645  C CB  . ARG A 1 210  ? 254.896 10.069  12.929  1.00 71.01  ? 279  ARG A CB  1 
ATOM 1646  C CG  . ARG A 1 210  ? 254.356 9.018   12.037  1.00 72.34  ? 279  ARG A CG  1 
ATOM 1647  C CD  . ARG A 1 210  ? 255.326 7.863   11.995  1.00 74.19  ? 279  ARG A CD  1 
ATOM 1648  N NE  . ARG A 1 210  ? 254.647 6.591   11.849  1.00 74.83  ? 279  ARG A NE  1 
ATOM 1649  C CZ  . ARG A 1 210  ? 255.239 5.492   11.406  1.00 74.47  ? 279  ARG A CZ  1 
ATOM 1650  N NH1 . ARG A 1 210  ? 256.517 5.526   11.066  1.00 74.29  ? 279  ARG A NH1 1 
ATOM 1651  N NH2 . ARG A 1 210  ? 254.559 4.360   11.305  1.00 72.78  ? 279  ARG A NH2 1 
ATOM 1652  N N   . GLU A 1 211  ? 257.329 12.067  13.741  1.00 72.87  ? 280  GLU A N   1 
ATOM 1653  C CA  . GLU A 1 211  ? 257.800 13.428  13.643  1.00 74.41  ? 280  GLU A CA  1 
ATOM 1654  C C   . GLU A 1 211  ? 259.154 13.728  14.312  1.00 75.71  ? 280  GLU A C   1 
ATOM 1655  O O   . GLU A 1 211  ? 259.753 14.769  14.032  1.00 76.25  ? 280  GLU A O   1 
ATOM 1656  C CB  . GLU A 1 211  ? 256.718 14.357  14.198  1.00 74.43  ? 280  GLU A CB  1 
ATOM 1657  C CG  . GLU A 1 211  ? 255.281 14.086  13.739  1.00 74.00  ? 280  GLU A CG  1 
ATOM 1658  C CD  . GLU A 1 211  ? 254.656 12.865  14.390  1.00 74.98  ? 280  GLU A CD  1 
ATOM 1659  O OE1 . GLU A 1 211  ? 255.217 12.360  15.378  1.00 76.01  ? 280  GLU A OE1 1 
ATOM 1660  O OE2 . GLU A 1 211  ? 253.596 12.420  13.915  1.00 74.52  ? 280  GLU A OE2 1 
ATOM 1661  N N   . GLN A 1 212  ? 259.628 12.837  15.189  1.00 77.17  ? 281  GLN A N   1 
ATOM 1662  C CA  . GLN A 1 212  ? 260.916 13.028  15.883  1.00 78.59  ? 281  GLN A CA  1 
ATOM 1663  C C   . GLN A 1 212  ? 262.150 12.965  14.971  1.00 78.85  ? 281  GLN A C   1 
ATOM 1664  O O   . GLN A 1 212  ? 263.205 13.550  15.249  1.00 79.90  ? 281  GLN A O   1 
ATOM 1665  C CB  . GLN A 1 212  ? 261.074 11.996  16.988  1.00 80.52  ? 281  GLN A CB  1 
ATOM 1666  C CG  . GLN A 1 212  ? 260.091 12.138  18.116  1.00 82.56  ? 281  GLN A CG  1 
ATOM 1667  C CD  . GLN A 1 212  ? 260.545 11.356  19.329  1.00 84.93  ? 281  GLN A CD  1 
ATOM 1668  O OE1 . GLN A 1 212  ? 260.958 10.200  19.205  1.00 87.55  ? 281  GLN A OE1 1 
ATOM 1669  N NE2 . GLN A 1 212  ? 260.475 11.978  20.511  1.00 85.78  ? 281  GLN A NE2 1 
ATOM 1670  N N   . TYR A 1 213  ? 262.018 12.204  13.900  1.00 78.77  ? 282  TYR A N   1 
ATOM 1671  C CA  . TYR A 1 213  ? 263.061 12.088  12.900  1.00 78.30  ? 282  TYR A CA  1 
ATOM 1672  C C   . TYR A 1 213  ? 262.338 12.723  11.715  1.00 77.90  ? 282  TYR A C   1 
ATOM 1673  O O   . TYR A 1 213  ? 261.109 12.752  11.712  1.00 77.63  ? 282  TYR A O   1 
ATOM 1674  C CB  . TYR A 1 213  ? 263.348 10.623  12.601  1.00 78.34  ? 282  TYR A CB  1 
ATOM 1675  C CG  . TYR A 1 213  ? 263.791 9.831   13.787  1.00 78.01  ? 282  TYR A CG  1 
ATOM 1676  C CD1 . TYR A 1 213  ? 264.684 10.373  14.708  1.00 78.33  ? 282  TYR A CD1 1 
ATOM 1677  C CD2 . TYR A 1 213  ? 263.396 8.501   13.944  1.00 79.22  ? 282  TYR A CD2 1 
ATOM 1678  C CE1 . TYR A 1 213  ? 265.190 9.604   15.763  1.00 78.80  ? 282  TYR A CE1 1 
ATOM 1679  C CE2 . TYR A 1 213  ? 263.893 7.717   14.988  1.00 78.98  ? 282  TYR A CE2 1 
ATOM 1680  C CZ  . TYR A 1 213  ? 264.795 8.271   15.895  1.00 78.30  ? 282  TYR A CZ  1 
ATOM 1681  O OH  . TYR A 1 213  ? 265.312 7.476   16.907  1.00 76.34  ? 282  TYR A OH  1 
ATOM 1682  N N   . LEU A 1 214  ? 263.066 13.241  10.728  1.00 77.28  ? 283  LEU A N   1 
ATOM 1683  C CA  . LEU A 1 214  ? 262.429 13.851  9.555   1.00 76.57  ? 283  LEU A CA  1 
ATOM 1684  C C   . LEU A 1 214  ? 263.201 15.044  9.010   1.00 74.92  ? 283  LEU A C   1 
ATOM 1685  O O   . LEU A 1 214  ? 263.300 15.244  7.803   1.00 73.34  ? 283  LEU A O   1 
ATOM 1686  C CB  . LEU A 1 214  ? 260.999 14.299  9.891   1.00 77.78  ? 283  LEU A CB  1 
ATOM 1687  C CG  . LEU A 1 214  ? 260.104 14.967  8.851   1.00 78.18  ? 283  LEU A CG  1 
ATOM 1688  C CD1 . LEU A 1 214  ? 260.614 16.358  8.526   1.00 77.88  ? 283  LEU A CD1 1 
ATOM 1689  C CD2 . LEU A 1 214  ? 260.045 14.113  7.619   1.00 79.60  ? 283  LEU A CD2 1 
ATOM 1690  N N   . ILE A 1 215  ? 263.754 15.838  9.905   1.00 73.72  ? 284  ILE A N   1 
ATOM 1691  C CA  . ILE A 1 215  ? 264.458 17.015  9.484   1.00 72.53  ? 284  ILE A CA  1 
ATOM 1692  C C   . ILE A 1 215  ? 265.877 16.731  9.031   1.00 73.03  ? 284  ILE A C   1 
ATOM 1693  O O   . ILE A 1 215  ? 266.584 17.617  8.581   1.00 71.99  ? 284  ILE A O   1 
ATOM 1694  C CB  . ILE A 1 215  ? 264.363 18.030  10.597  1.00 70.91  ? 284  ILE A CB  1 
ATOM 1695  C CG1 . ILE A 1 215  ? 262.880 18.302  10.836  1.00 69.61  ? 284  ILE A CG1 1 
ATOM 1696  C CG2 . ILE A 1 215  ? 265.002 19.318  10.197  1.00 70.33  ? 284  ILE A CG2 1 
ATOM 1697  C CD1 . ILE A 1 215  ? 262.520 18.520  12.255  1.00 91.71  ? 284  ILE A CD1 1 
ATOM 1698  N N   . GLN A 1 216  ? 266.285 15.475  9.137   1.00 74.42  ? 285  GLN A N   1 
ATOM 1699  C CA  . GLN A 1 216  ? 267.603 15.047  8.685   1.00 75.26  ? 285  GLN A CA  1 
ATOM 1700  C C   . GLN A 1 216  ? 268.775 15.598  9.470   1.00 75.52  ? 285  GLN A C   1 
ATOM 1701  O O   . GLN A 1 216  ? 269.616 16.362  8.986   1.00 75.14  ? 285  GLN A O   1 
ATOM 1702  C CB  . GLN A 1 216  ? 267.694 15.347  7.207   1.00 74.90  ? 285  GLN A CB  1 
ATOM 1703  C CG  . GLN A 1 216  ? 266.504 14.689  6.539   1.00 75.11  ? 285  GLN A CG  1 
ATOM 1704  C CD  . GLN A 1 216  ? 265.928 15.460  5.367   1.00 77.79  ? 285  GLN A CD  1 
ATOM 1705  O OE1 . GLN A 1 216  ? 266.145 16.656  5.225   1.00 80.03  ? 285  GLN A OE1 1 
ATOM 1706  N NE2 . GLN A 1 216  ? 265.160 14.772  4.531   1.00 78.49  ? 285  GLN A NE2 1 
ATOM 1707  N N   . GLY A 1 217  ? 268.805 15.112  10.701  1.00 76.10  ? 286  GLY A N   1 
ATOM 1708  C CA  . GLY A 1 217  ? 269.790 15.456  11.696  1.00 76.70  ? 286  GLY A CA  1 
ATOM 1709  C C   . GLY A 1 217  ? 269.022 15.082  12.946  1.00 77.38  ? 286  GLY A C   1 
ATOM 1710  O O   . GLY A 1 217  ? 267.827 15.373  13.032  1.00 77.43  ? 286  GLY A O   1 
ATOM 1711  N N   . SER A 1 218  ? 269.678 14.408  13.886  1.00 77.09  ? 287  SER A N   1 
ATOM 1712  C CA  . SER A 1 218  ? 269.049 13.991  15.140  1.00 75.25  ? 287  SER A CA  1 
ATOM 1713  C C   . SER A 1 218  ? 269.720 12.732  15.665  1.00 73.47  ? 287  SER A C   1 
ATOM 1714  O O   . SER A 1 218  ? 269.793 11.721  14.961  1.00 71.67  ? 287  SER A O   1 
ATOM 1715  C CB  . SER A 1 218  ? 267.556 13.702  14.950  1.00 75.65  ? 287  SER A CB  1 
ATOM 1716  O OG  . SER A 1 218  ? 267.366 12.581  14.112  1.00 75.22  ? 287  SER A OG  1 
ATOM 1717  N N   . ARG A 1 219  ? 270.198 12.807  16.908  1.00 72.22  ? 288  ARG A N   1 
ATOM 1718  C CA  . ARG A 1 219  ? 270.864 11.691  17.564  1.00 71.02  ? 288  ARG A CA  1 
ATOM 1719  C C   . ARG A 1 219  ? 269.998 11.044  18.611  1.00 68.04  ? 288  ARG A C   1 
ATOM 1720  O O   . ARG A 1 219  ? 270.432 10.749  19.714  1.00 68.75  ? 288  ARG A O   1 
ATOM 1721  C CB  . ARG A 1 219  ? 272.198 12.130  18.168  1.00 73.81  ? 288  ARG A CB  1 
ATOM 1722  C CG  . ARG A 1 219  ? 273.403 11.571  17.424  1.00 76.87  ? 288  ARG A CG  1 
ATOM 1723  C CD  . ARG A 1 219  ? 273.176 11.516  15.904  1.00 80.74  ? 288  ARG A CD  1 
ATOM 1724  N NE  . ARG A 1 219  ? 271.978 10.743  15.570  1.00 85.10  ? 288  ARG A NE  1 
ATOM 1725  C CZ  . ARG A 1 219  ? 271.937 9.704   14.745  1.00 86.85  ? 288  ARG A CZ  1 
ATOM 1726  N NH1 . ARG A 1 219  ? 273.036 9.290   14.141  1.00 86.42  ? 288  ARG A NH1 1 
ATOM 1727  N NH2 . ARG A 1 219  ? 270.793 9.066   14.544  1.00 88.27  ? 288  ARG A NH2 1 
ATOM 1728  N N   . MET A 1 220  ? 268.740 10.858  18.260  1.00 63.63  ? 289  MET A N   1 
ATOM 1729  C CA  . MET A 1 220  ? 267.817 10.190  19.142  1.00 59.51  ? 289  MET A CA  1 
ATOM 1730  C C   . MET A 1 220  ? 267.802 8.807   18.555  1.00 58.81  ? 289  MET A C   1 
ATOM 1731  O O   . MET A 1 220  ? 267.897 8.643   17.340  1.00 60.50  ? 289  MET A O   1 
ATOM 1732  C CB  . MET A 1 220  ? 266.417 10.765  19.002  1.00 56.64  ? 289  MET A CB  1 
ATOM 1733  C CG  . MET A 1 220  ? 266.265 12.204  19.409  1.00 52.72  ? 289  MET A CG  1 
ATOM 1734  S SD  . MET A 1 220  ? 264.597 12.756  19.126  1.00 42.98  ? 289  MET A SD  1 
ATOM 1735  C CE  . MET A 1 220  ? 263.719 11.769  20.324  1.00 43.65  ? 289  MET A CE  1 
ATOM 1736  N N   . ARG A 1 221  ? 267.730 7.802   19.399  1.00 57.29  ? 290  ARG A N   1 
ATOM 1737  C CA  . ARG A 1 221  ? 267.626 6.452   18.884  1.00 57.56  ? 290  ARG A CA  1 
ATOM 1738  C C   . ARG A 1 221  ? 266.659 5.798   19.844  1.00 59.98  ? 290  ARG A C   1 
ATOM 1739  O O   . ARG A 1 221  ? 266.532 6.241   20.979  1.00 58.87  ? 290  ARG A O   1 
ATOM 1740  C CB  . ARG A 1 221  ? 269.001 5.802   18.768  1.00 54.81  ? 290  ARG A CB  1 
ATOM 1741  C CG  . ARG A 1 221  ? 269.647 6.172   17.418  1.00 52.36  ? 290  ARG A CG  1 
ATOM 1742  C CD  . ARG A 1 221  ? 271.144 5.934   17.368  1.00 50.54  ? 290  ARG A CD  1 
ATOM 1743  N NE  . ARG A 1 221  ? 271.882 7.141   16.983  1.00 49.55  ? 290  ARG A NE  1 
ATOM 1744  C CZ  . ARG A 1 221  ? 273.198 7.309   17.156  1.00 50.41  ? 290  ARG A CZ  1 
ATOM 1745  N NH1 . ARG A 1 221  ? 273.931 6.347   17.705  1.00 49.81  ? 290  ARG A NH1 1 
ATOM 1746  N NH2 . ARG A 1 221  ? 273.787 8.449   16.803  1.00 49.93  ? 290  ARG A NH2 1 
ATOM 1747  N N   . PHE A 1 222  ? 265.943 4.773   19.399  1.00 63.70  ? 291  PHE A N   1 
ATOM 1748  C CA  . PHE A 1 222  ? 264.882 4.215   20.235  1.00 67.43  ? 291  PHE A CA  1 
ATOM 1749  C C   . PHE A 1 222  ? 264.872 2.774   20.711  1.00 69.60  ? 291  PHE A C   1 
ATOM 1750  O O   . PHE A 1 222  ? 265.421 2.474   21.768  1.00 71.01  ? 291  PHE A O   1 
ATOM 1751  C CB  . PHE A 1 222  ? 263.580 4.537   19.526  1.00 69.89  ? 291  PHE A CB  1 
ATOM 1752  C CG  . PHE A 1 222  ? 263.475 5.975   19.145  1.00 72.19  ? 291  PHE A CG  1 
ATOM 1753  C CD1 . PHE A 1 222  ? 262.728 6.379   18.060  1.00 72.39  ? 291  PHE A CD1 1 
ATOM 1754  C CD2 . PHE A 1 222  ? 264.122 6.935   19.907  1.00 73.20  ? 291  PHE A CD2 1 
ATOM 1755  C CE1 . PHE A 1 222  ? 262.626 7.709   17.751  1.00 73.23  ? 291  PHE A CE1 1 
ATOM 1756  C CE2 . PHE A 1 222  ? 264.030 8.261   19.605  1.00 73.52  ? 291  PHE A CE2 1 
ATOM 1757  C CZ  . PHE A 1 222  ? 263.277 8.655   18.524  1.00 73.84  ? 291  PHE A CZ  1 
ATOM 1758  N N   . LEU A 1 223  ? 264.175 1.912   19.969  1.00 71.07  ? 292  LEU A N   1 
ATOM 1759  C CA  . LEU A 1 223  ? 264.076 0.469   20.247  1.00 72.72  ? 292  LEU A CA  1 
ATOM 1760  C C   . LEU A 1 223  ? 262.780 -0.023  20.903  1.00 71.93  ? 292  LEU A C   1 
ATOM 1761  O O   . LEU A 1 223  ? 262.399 0.398   21.995  1.00 71.55  ? 292  LEU A O   1 
ATOM 1762  C CB  . LEU A 1 223  ? 265.304 -0.009  21.042  1.00 75.20  ? 292  LEU A CB  1 
ATOM 1763  C CG  . LEU A 1 223  ? 266.652 0.238   20.319  1.00 77.24  ? 292  LEU A CG  1 
ATOM 1764  C CD1 . LEU A 1 223  ? 267.731 0.596   21.339  1.00 78.07  ? 292  LEU A CD1 1 
ATOM 1765  C CD2 . LEU A 1 223  ? 267.070 -0.981  19.481  1.00 75.89  ? 292  LEU A CD2 1 
ATOM 1766  N N   . ASP A 1 224  ? 262.125 -0.935  20.188  1.00 71.21  ? 293  ASP A N   1 
ATOM 1767  C CA  . ASP A 1 224  ? 260.865 -1.538  20.578  1.00 70.09  ? 293  ASP A CA  1 
ATOM 1768  C C   . ASP A 1 224  ? 260.904 -2.360  21.807  1.00 68.34  ? 293  ASP A C   1 
ATOM 1769  O O   . ASP A 1 224  ? 261.884 -3.002  22.135  1.00 67.45  ? 293  ASP A O   1 
ATOM 1770  C CB  . ASP A 1 224  ? 260.328 -2.441  19.486  1.00 71.20  ? 293  ASP A CB  1 
ATOM 1771  C CG  . ASP A 1 224  ? 259.223 -1.823  18.738  1.00 71.27  ? 293  ASP A CG  1 
ATOM 1772  O OD1 . ASP A 1 224  ? 259.382 -1.620  17.522  1.00 70.47  ? 293  ASP A OD1 1 
ATOM 1773  O OD2 . ASP A 1 224  ? 258.198 -1.538  19.375  1.00 71.10  ? 293  ASP A OD2 1 
ATOM 1774  N N   . THR A 1 225  ? 259.776 -2.353  22.467  1.00 67.32  ? 294  THR A N   1 
ATOM 1775  C CA  . THR A 1 225  ? 259.608 -3.112  23.660  1.00 67.23  ? 294  THR A CA  1 
ATOM 1776  C C   . THR A 1 225  ? 258.968 -4.383  23.169  1.00 66.84  ? 294  THR A C   1 
ATOM 1777  O O   . THR A 1 225  ? 258.955 -5.393  23.856  1.00 66.94  ? 294  THR A O   1 
ATOM 1778  C CB  . THR A 1 225  ? 258.674 -2.380  24.571  1.00 67.95  ? 294  THR A CB  1 
ATOM 1779  O OG1 . THR A 1 225  ? 257.714 -1.676  23.779  1.00 69.22  ? 294  THR A OG1 1 
ATOM 1780  C CG2 . THR A 1 225  ? 259.436 -1.390  25.398  1.00 69.08  ? 294  THR A CG2 1 
ATOM 1781  N N   . MET A 1 226  ? 258.438 -4.311  21.955  1.00 65.90  ? 295  MET A N   1 
ATOM 1782  C CA  . MET A 1 226  ? 257.765 -5.439  21.317  1.00 64.75  ? 295  MET A CA  1 
ATOM 1783  C C   . MET A 1 226  ? 258.761 -6.224  20.484  1.00 63.82  ? 295  MET A C   1 
ATOM 1784  O O   . MET A 1 226  ? 258.649 -7.438  20.303  1.00 63.64  ? 295  MET A O   1 
ATOM 1785  C CB  . MET A 1 226  ? 256.664 -4.934  20.393  1.00 63.56  ? 295  MET A CB  1 
ATOM 1786  C CG  . MET A 1 226  ? 256.564 -5.750  19.119  1.00 64.20  ? 295  MET A CG  1 
ATOM 1787  S SD  . MET A 1 226  ? 255.586 -4.995  17.831  1.00 65.42  ? 295  MET A SD  1 
ATOM 1788  C CE  . MET A 1 226  ? 253.925 -5.443  18.391  1.00 65.48  ? 295  MET A CE  1 
ATOM 1789  N N   . SER A 1 227  ? 259.715 -5.491  19.941  1.00 62.35  ? 296  SER A N   1 
ATOM 1790  C CA  . SER A 1 227  ? 260.760 -6.066  19.123  1.00 59.58  ? 296  SER A CA  1 
ATOM 1791  C C   . SER A 1 227  ? 261.543 -7.071  19.935  1.00 58.05  ? 296  SER A C   1 
ATOM 1792  O O   . SER A 1 227  ? 261.574 -8.256  19.646  1.00 57.28  ? 296  SER A O   1 
ATOM 1793  C CB  . SER A 1 227  ? 261.698 -4.965  18.716  1.00 59.85  ? 296  SER A CB  1 
ATOM 1794  O OG  . SER A 1 227  ? 262.162 -4.282  19.863  1.00 58.58  ? 296  SER A OG  1 
ATOM 1795  N N   . MET A 1 228  ? 262.213 -6.535  20.939  1.00 57.28  ? 297  MET A N   1 
ATOM 1796  C CA  . MET A 1 228  ? 263.026 -7.280  21.878  1.00 55.90  ? 297  MET A CA  1 
ATOM 1797  C C   . MET A 1 228  ? 262.275 -8.506  22.310  1.00 55.63  ? 297  MET A C   1 
ATOM 1798  O O   . MET A 1 228  ? 262.833 -9.589  22.415  1.00 55.12  ? 297  MET A O   1 
ATOM 1799  C CB  . MET A 1 228  ? 263.234 -6.427  23.089  1.00 54.20  ? 297  MET A CB  1 
ATOM 1800  C CG  . MET A 1 228  ? 261.924 -5.811  23.484  1.00 52.28  ? 297  MET A CG  1 
ATOM 1801  S SD  . MET A 1 228  ? 262.083 -5.163  25.041  1.00 50.31  ? 297  MET A SD  1 
ATOM 1802  C CE  . MET A 1 228  ? 263.631 -4.375  24.832  1.00 52.15  ? 297  MET A CE  1 
ATOM 1803  N N   . HIS A 1 229  ? 261.002 -8.303  22.609  1.00 56.06  ? 298  HIS A N   1 
ATOM 1804  C CA  . HIS A 1 229  ? 260.157 -9.391  23.036  1.00 58.53  ? 298  HIS A CA  1 
ATOM 1805  C C   . HIS A 1 229  ? 260.291 -10.490 22.004  1.00 59.94  ? 298  HIS A C   1 
ATOM 1806  O O   . HIS A 1 229  ? 260.664 -11.620 22.310  1.00 59.72  ? 298  HIS A O   1 
ATOM 1807  C CB  . HIS A 1 229  ? 258.712 -8.932  23.102  1.00 59.76  ? 298  HIS A CB  1 
ATOM 1808  C CG  . HIS A 1 229  ? 257.740 -10.004 22.738  1.00 62.24  ? 298  HIS A CG  1 
ATOM 1809  N ND1 . HIS A 1 229  ? 257.737 -10.613 21.503  1.00 63.58  ? 298  HIS A ND1 1 
ATOM 1810  C CD2 . HIS A 1 229  ? 256.757 -10.593 23.452  1.00 63.80  ? 298  HIS A CD2 1 
ATOM 1811  C CE1 . HIS A 1 229  ? 256.790 -11.532 21.470  1.00 65.33  ? 298  HIS A CE1 1 
ATOM 1812  N NE2 . HIS A 1 229  ? 256.180 -11.538 22.640  1.00 65.93  ? 298  HIS A NE2 1 
ATOM 1813  N N   . MET A 1 230  ? 259.954 -10.145 20.770  1.00 62.54  ? 299  MET A N   1 
ATOM 1814  C CA  . MET A 1 230  ? 260.058 -11.091 19.681  1.00 64.91  ? 299  MET A CA  1 
ATOM 1815  C C   . MET A 1 230  ? 261.403 -11.735 19.882  1.00 65.59  ? 299  MET A C   1 
ATOM 1816  O O   . MET A 1 230  ? 261.513 -12.940 20.032  1.00 65.77  ? 299  MET A O   1 
ATOM 1817  C CB  . MET A 1 230  ? 260.029 -10.347 18.352  1.00 66.12  ? 299  MET A CB  1 
ATOM 1818  C CG  . MET A 1 230  ? 258.723 -9.655  18.132  1.00 69.00  ? 299  MET A CG  1 
ATOM 1819  S SD  . MET A 1 230  ? 257.474 -10.925 18.176  1.00 71.86  ? 299  MET A SD  1 
ATOM 1820  C CE  . MET A 1 230  ? 256.254 -10.236 17.084  1.00 73.26  ? 299  MET A CE  1 
ATOM 1821  N N   . ALA A 1 231  ? 262.419 -10.886 19.935  1.00 66.76  ? 300  ALA A N   1 
ATOM 1822  C CA  . ALA A 1 231  ? 263.792 -11.302 20.118  1.00 67.82  ? 300  ALA A CA  1 
ATOM 1823  C C   . ALA A 1 231  ? 264.014 -12.325 21.228  1.00 68.80  ? 300  ALA A C   1 
ATOM 1824  O O   . ALA A 1 231  ? 264.571 -13.388 20.985  1.00 68.82  ? 300  ALA A O   1 
ATOM 1825  C CB  . ALA A 1 231  ? 264.641 -10.088 20.370  1.00 66.68  ? 300  ALA A CB  1 
ATOM 1826  N N   . ILE A 1 232  ? 263.580 -12.019 22.444  1.00 70.15  ? 301  ILE A N   1 
ATOM 1827  C CA  . ILE A 1 232  ? 263.802 -12.945 23.549  1.00 72.65  ? 301  ILE A CA  1 
ATOM 1828  C C   . ILE A 1 232  ? 262.687 -13.952 23.785  1.00 73.83  ? 301  ILE A C   1 
ATOM 1829  O O   . ILE A 1 232  ? 262.894 -15.159 23.748  1.00 73.49  ? 301  ILE A O   1 
ATOM 1830  C CB  . ILE A 1 232  ? 264.093 -12.170 24.858  1.00 74.17  ? 301  ILE A CB  1 
ATOM 1831  C CG1 . ILE A 1 232  ? 264.903 -13.069 25.777  1.00 75.10  ? 301  ILE A CG1 1 
ATOM 1832  C CG2 . ILE A 1 232  ? 262.808 -11.741 25.574  1.00 73.88  ? 301  ILE A CG2 1 
ATOM 1833  C CD1 . ILE A 1 232  ? 265.727 -12.310 26.702  1.00 91.71  ? 301  ILE A CD1 1 
ATOM 1834  N N   . SER A 1 233  ? 261.500 -13.443 24.040  1.00 76.40  ? 302  SER A N   1 
ATOM 1835  C CA  . SER A 1 233  ? 260.360 -14.288 24.261  1.00 79.85  ? 302  SER A CA  1 
ATOM 1836  C C   . SER A 1 233  ? 259.534 -14.101 23.004  1.00 81.92  ? 302  SER A C   1 
ATOM 1837  O O   . SER A 1 233  ? 258.715 -13.189 22.902  1.00 82.34  ? 302  SER A O   1 
ATOM 1838  C CB  . SER A 1 233  ? 259.590 -13.802 25.480  1.00 79.63  ? 302  SER A CB  1 
ATOM 1839  O OG  . SER A 1 233  ? 258.994 -12.537 25.230  1.00 79.36  ? 302  SER A OG  1 
ATOM 1840  N N   . GLY A 1 234  ? 259.777 -14.937 22.015  1.00 84.01  ? 303  GLY A N   1 
ATOM 1841  C CA  . GLY A 1 234  ? 259.011 -14.804 20.797  1.00 86.08  ? 303  GLY A CA  1 
ATOM 1842  C C   . GLY A 1 234  ? 258.547 -16.189 20.447  1.00 87.18  ? 303  GLY A C   1 
ATOM 1843  O O   . GLY A 1 234  ? 258.981 -17.130 21.105  1.00 87.50  ? 303  GLY A O   1 
ATOM 1844  N N   . LEU A 1 235  ? 257.679 -16.318 19.439  1.00 87.73  ? 304  LEU A N   1 
ATOM 1845  C CA  . LEU A 1 235  ? 257.167 -17.627 18.989  1.00 88.18  ? 304  LEU A CA  1 
ATOM 1846  C C   . LEU A 1 235  ? 257.129 -17.675 17.443  1.00 88.02  ? 304  LEU A C   1 
ATOM 1847  O O   . LEU A 1 235  ? 257.033 -16.626 16.804  1.00 88.30  ? 304  LEU A O   1 
ATOM 1848  C CB  . LEU A 1 235  ? 255.758 -17.873 19.561  1.00 88.76  ? 304  LEU A CB  1 
ATOM 1849  C CG  . LEU A 1 235  ? 255.505 -17.747 21.072  1.00 90.63  ? 304  LEU A CG  1 
ATOM 1850  C CD1 . LEU A 1 235  ? 254.021 -17.918 21.327  1.00 92.12  ? 304  LEU A CD1 1 
ATOM 1851  C CD2 . LEU A 1 235  ? 256.294 -18.785 21.856  1.00 90.46  ? 304  LEU A CD2 1 
ATOM 1852  N N   . SER A 1 236  ? 257.197 -18.873 16.847  1.00 87.44  ? 305  SER A N   1 
ATOM 1853  C CA  . SER A 1 236  ? 257.183 -19.015 15.377  1.00 86.35  ? 305  SER A CA  1 
ATOM 1854  C C   . SER A 1 236  ? 255.817 -18.851 14.731  1.00 85.61  ? 305  SER A C   1 
ATOM 1855  O O   . SER A 1 236  ? 254.795 -18.958 15.395  1.00 85.60  ? 305  SER A O   1 
ATOM 1856  C CB  . SER A 1 236  ? 257.747 -20.366 14.950  1.00 86.55  ? 305  SER A CB  1 
ATOM 1857  O OG  . SER A 1 236  ? 259.049 -20.548 15.465  1.00 85.90  ? 305  SER A OG  1 
ATOM 1858  N N   . SER A 1 237  ? 255.810 -18.619 13.422  1.00 85.60  ? 306  SER A N   1 
ATOM 1859  C CA  . SER A 1 237  ? 254.567 -18.412 12.695  1.00 85.42  ? 306  SER A CA  1 
ATOM 1860  C C   . SER A 1 237  ? 253.456 -19.384 13.074  1.00 84.93  ? 306  SER A C   1 
ATOM 1861  O O   . SER A 1 237  ? 252.499 -18.986 13.736  1.00 85.05  ? 306  SER A O   1 
ATOM 1862  C CB  . SER A 1 237  ? 254.818 -18.454 11.186  1.00 85.03  ? 306  SER A CB  1 
ATOM 1863  O OG  . SER A 1 237  ? 255.259 -19.723 10.765  1.00 86.24  ? 306  SER A OG  1 
ATOM 1864  N N   . PHE A 1 238  ? 253.576 -20.650 12.673  1.00 83.40  ? 307  PHE A N   1 
ATOM 1865  C CA  . PHE A 1 238  ? 252.537 -21.636 12.990  1.00 81.93  ? 307  PHE A CA  1 
ATOM 1866  C C   . PHE A 1 238  ? 252.452 -22.077 14.436  1.00 80.66  ? 307  PHE A C   1 
ATOM 1867  O O   . PHE A 1 238  ? 251.360 -22.162 14.990  1.00 81.38  ? 307  PHE A O   1 
ATOM 1868  C CB  . PHE A 1 238  ? 252.636 -22.886 12.103  1.00 83.68  ? 307  PHE A CB  1 
ATOM 1869  C CG  . PHE A 1 238  ? 254.008 -23.496 12.033  1.00 84.75  ? 307  PHE A CG  1 
ATOM 1870  C CD1 . PHE A 1 238  ? 255.103 -22.744 11.592  1.00 85.11  ? 307  PHE A CD1 1 
ATOM 1871  C CD2 . PHE A 1 238  ? 254.195 -24.849 12.316  1.00 84.99  ? 307  PHE A CD2 1 
ATOM 1872  C CE1 . PHE A 1 238  ? 256.363 -23.329 11.426  1.00 84.38  ? 307  PHE A CE1 1 
ATOM 1873  C CE2 . PHE A 1 238  ? 255.458 -25.449 12.153  1.00 84.47  ? 307  PHE A CE2 1 
ATOM 1874  C CZ  . PHE A 1 238  ? 256.539 -24.685 11.705  1.00 83.95  ? 307  PHE A CZ  1 
ATOM 1875  N N   . GLN A 1 239  ? 253.580 -22.367 15.068  1.00 79.30  ? 308  GLN A N   1 
ATOM 1876  C CA  . GLN A 1 239  ? 253.476 -22.782 16.452  1.00 78.10  ? 308  GLN A CA  1 
ATOM 1877  C C   . GLN A 1 239  ? 252.677 -21.785 17.269  1.00 76.98  ? 308  GLN A C   1 
ATOM 1878  O O   . GLN A 1 239  ? 251.715 -22.185 17.927  1.00 76.75  ? 308  GLN A O   1 
ATOM 1879  C CB  . GLN A 1 239  ? 254.841 -23.002 17.115  1.00 78.20  ? 308  GLN A CB  1 
ATOM 1880  C CG  . GLN A 1 239  ? 256.035 -22.300 16.525  1.00 78.06  ? 308  GLN A CG  1 
ATOM 1881  C CD  . GLN A 1 239  ? 257.252 -22.423 17.428  1.00 77.95  ? 308  GLN A CD  1 
ATOM 1882  O OE1 . GLN A 1 239  ? 257.334 -21.761 18.465  1.00 77.27  ? 308  GLN A OE1 1 
ATOM 1883  N NE2 . GLN A 1 239  ? 258.192 -23.283 17.047  1.00 77.94  ? 308  GLN A NE2 1 
ATOM 1884  N N   . ARG A 1 240  ? 253.041 -20.498 17.217  1.00 75.40  ? 309  ARG A N   1 
ATOM 1885  C CA  . ARG A 1 240  ? 252.311 -19.516 18.017  1.00 73.99  ? 309  ARG A CA  1 
ATOM 1886  C C   . ARG A 1 240  ? 250.815 -19.587 17.722  1.00 73.01  ? 309  ARG A C   1 
ATOM 1887  O O   . ARG A 1 240  ? 250.018 -19.696 18.646  1.00 73.40  ? 309  ARG A O   1 
ATOM 1888  C CB  . ARG A 1 240  ? 252.872 -18.071 17.866  1.00 74.80  ? 309  ARG A CB  1 
ATOM 1889  C CG  . ARG A 1 240  ? 252.616 -17.295 16.570  1.00 75.98  ? 309  ARG A CG  1 
ATOM 1890  C CD  . ARG A 1 240  ? 252.723 -15.749 16.793  1.00 75.94  ? 309  ARG A CD  1 
ATOM 1891  N NE  . ARG A 1 240  ? 254.008 -15.252 17.334  1.00 73.99  ? 309  ARG A NE  1 
ATOM 1892  C CZ  . ARG A 1 240  ? 254.250 -14.932 18.617  1.00 73.76  ? 309  ARG A CZ  1 
ATOM 1893  N NH1 . ARG A 1 240  ? 253.293 -15.054 19.534  1.00 74.00  ? 309  ARG A NH1 1 
ATOM 1894  N NH2 . ARG A 1 240  ? 255.449 -14.465 18.988  1.00 71.97  ? 309  ARG A NH2 1 
ATOM 1895  N N   . SER A 1 241  ? 250.424 -19.587 16.455  1.00 72.23  ? 310  SER A N   1 
ATOM 1896  C CA  . SER A 1 241  ? 248.999 -19.666 16.126  1.00 72.44  ? 310  SER A CA  1 
ATOM 1897  C C   . SER A 1 241  ? 248.248 -20.835 16.816  1.00 73.11  ? 310  SER A C   1 
ATOM 1898  O O   . SER A 1 241  ? 247.130 -20.674 17.313  1.00 72.74  ? 310  SER A O   1 
ATOM 1899  C CB  . SER A 1 241  ? 248.831 -19.743 14.602  1.00 71.18  ? 310  SER A CB  1 
ATOM 1900  O OG  . SER A 1 241  ? 249.699 -20.703 14.024  1.00 70.45  ? 310  SER A OG  1 
ATOM 1901  N N   . LEU A 1 242  ? 248.860 -22.011 16.835  1.00 73.97  ? 311  LEU A N   1 
ATOM 1902  C CA  . LEU A 1 242  ? 248.252 -23.178 17.465  1.00 75.04  ? 311  LEU A CA  1 
ATOM 1903  C C   . LEU A 1 242  ? 248.291 -22.882 18.932  1.00 75.19  ? 311  LEU A C   1 
ATOM 1904  O O   . LEU A 1 242  ? 247.347 -23.157 19.665  1.00 75.15  ? 311  LEU A O   1 
ATOM 1905  C CB  . LEU A 1 242  ? 249.101 -24.402 17.197  1.00 75.59  ? 311  LEU A CB  1 
ATOM 1906  C CG  . LEU A 1 242  ? 249.580 -24.422 15.749  1.00 76.95  ? 311  LEU A CG  1 
ATOM 1907  C CD1 . LEU A 1 242  ? 251.023 -24.913 15.698  1.00 78.44  ? 311  LEU A CD1 1 
ATOM 1908  C CD2 . LEU A 1 242  ? 248.624 -25.273 14.897  1.00 77.01  ? 311  LEU A CD2 1 
ATOM 1909  N N   . TRP A 1 243  ? 249.432 -22.330 19.332  1.00 76.55  ? 312  TRP A N   1 
ATOM 1910  C CA  . TRP A 1 243  ? 249.702 -21.927 20.703  1.00 78.47  ? 312  TRP A CA  1 
ATOM 1911  C C   . TRP A 1 243  ? 248.667 -20.889 21.110  1.00 78.20  ? 312  TRP A C   1 
ATOM 1912  O O   . TRP A 1 243  ? 248.207 -20.894 22.239  1.00 77.57  ? 312  TRP A O   1 
ATOM 1913  C CB  . TRP A 1 243  ? 251.112 -21.308 20.821  1.00 82.05  ? 312  TRP A CB  1 
ATOM 1914  C CG  . TRP A 1 243  ? 252.146 -22.129 21.589  1.00 86.00  ? 312  TRP A CG  1 
ATOM 1915  C CD1 . TRP A 1 243  ? 253.476 -22.256 21.290  1.00 87.33  ? 312  TRP A CD1 1 
ATOM 1916  C CD2 . TRP A 1 243  ? 251.932 -22.909 22.776  1.00 87.76  ? 312  TRP A CD2 1 
ATOM 1917  N NE1 . TRP A 1 243  ? 254.100 -23.067 22.214  1.00 88.95  ? 312  TRP A NE1 1 
ATOM 1918  C CE2 . TRP A 1 243  ? 253.177 -23.477 23.137  1.00 88.80  ? 312  TRP A CE2 1 
ATOM 1919  C CE3 . TRP A 1 243  ? 250.813 -23.178 23.576  1.00 87.54  ? 312  TRP A CE3 1 
ATOM 1920  C CZ2 . TRP A 1 243  ? 253.326 -24.304 24.248  1.00 88.83  ? 312  TRP A CZ2 1 
ATOM 1921  C CZ3 . TRP A 1 243  ? 250.969 -24.006 24.690  1.00 88.04  ? 312  TRP A CZ3 1 
ATOM 1922  C CH2 . TRP A 1 243  ? 252.218 -24.553 25.014  1.00 88.25  ? 312  TRP A CH2 1 
ATOM 1923  N N   . ILE A 1 244  ? 248.290 -20.006 20.189  1.00 78.15  ? 313  ILE A N   1 
ATOM 1924  C CA  . ILE A 1 244  ? 247.311 -18.964 20.505  1.00 77.31  ? 313  ILE A CA  1 
ATOM 1925  C C   . ILE A 1 244  ? 245.894 -19.507 20.785  1.00 77.43  ? 313  ILE A C   1 
ATOM 1926  O O   . ILE A 1 244  ? 245.280 -19.171 21.812  1.00 77.80  ? 313  ILE A O   1 
ATOM 1927  C CB  . ILE A 1 244  ? 247.234 -17.868 19.374  1.00 75.92  ? 313  ILE A CB  1 
ATOM 1928  C CG1 . ILE A 1 244  ? 246.344 -18.317 18.215  1.00 75.78  ? 313  ILE A CG1 1 
ATOM 1929  C CG2 . ILE A 1 244  ? 248.609 -17.558 18.845  1.00 74.75  ? 313  ILE A CG2 1 
ATOM 1930  C CD1 . ILE A 1 244  ? 244.880 -17.960 18.402  1.00 91.71  ? 313  ILE A CD1 1 
ATOM 1931  N N   . ALA A 1 245  ? 245.387 -20.342 19.874  1.00 75.82  ? 314  ALA A N   1 
ATOM 1932  C CA  . ALA A 1 245  ? 244.051 -20.934 19.991  1.00 73.71  ? 314  ALA A CA  1 
ATOM 1933  C C   . ALA A 1 245  ? 243.835 -21.586 21.360  1.00 72.64  ? 314  ALA A C   1 
ATOM 1934  O O   . ALA A 1 245  ? 242.973 -21.179 22.148  1.00 71.99  ? 314  ALA A O   1 
ATOM 1935  C CB  . ALA A 1 245  ? 243.855 -21.968 18.881  1.00 73.04  ? 314  ALA A CB  1 
ATOM 1936  N N   . ALA A 1 246  ? 244.633 -22.608 21.630  1.00 72.77  ? 315  ALA A N   1 
ATOM 1937  C CA  . ALA A 1 246  ? 244.568 -23.324 22.888  1.00 73.30  ? 315  ALA A CA  1 
ATOM 1938  C C   . ALA A 1 246  ? 244.918 -22.448 24.124  1.00 73.62  ? 315  ALA A C   1 
ATOM 1939  O O   . ALA A 1 246  ? 244.250 -22.560 25.157  1.00 73.38  ? 315  ALA A O   1 
ATOM 1940  C CB  . ALA A 1 246  ? 245.497 -24.548 22.806  1.00 73.13  ? 315  ALA A CB  1 
ATOM 1941  N N   . LYS A 1 247  ? 245.919 -21.561 24.000  1.00 73.80  ? 316  LYS A N   1 
ATOM 1942  C CA  . LYS A 1 247  ? 246.407 -20.713 25.113  1.00 74.05  ? 316  LYS A CA  1 
ATOM 1943  C C   . LYS A 1 247  ? 245.484 -19.742 25.830  1.00 75.53  ? 316  LYS A C   1 
ATOM 1944  O O   . LYS A 1 247  ? 245.450 -19.702 27.061  1.00 76.19  ? 316  LYS A O   1 
ATOM 1945  C CB  . LYS A 1 247  ? 247.665 -19.935 24.700  1.00 72.63  ? 316  LYS A CB  1 
ATOM 1946  C CG  . LYS A 1 247  ? 247.463 -18.721 23.822  1.00 70.95  ? 316  LYS A CG  1 
ATOM 1947  C CD  . LYS A 1 247  ? 248.826 -18.155 23.526  1.00 67.22  ? 316  LYS A CD  1 
ATOM 1948  C CE  . LYS A 1 247  ? 248.813 -16.901 22.689  1.00 63.79  ? 316  LYS A CE  1 
ATOM 1949  N NZ  . LYS A 1 247  ? 250.212 -16.419 22.553  1.00 60.64  ? 316  LYS A NZ  1 
ATOM 1950  N N   . GLN A 1 248  ? 244.758 -18.923 25.095  1.00 76.72  ? 317  GLN A N   1 
ATOM 1951  C CA  . GLN A 1 248  ? 243.889 -18.013 25.796  1.00 78.44  ? 317  GLN A CA  1 
ATOM 1952  C C   . GLN A 1 248  ? 242.595 -18.723 26.129  1.00 79.02  ? 317  GLN A C   1 
ATOM 1953  O O   . GLN A 1 248  ? 242.322 -18.989 27.299  1.00 79.15  ? 317  GLN A O   1 
ATOM 1954  C CB  . GLN A 1 248  ? 243.651 -16.758 24.967  1.00 78.30  ? 317  GLN A CB  1 
ATOM 1955  C CG  . GLN A 1 248  ? 244.935 -15.962 24.722  1.00 78.70  ? 317  GLN A CG  1 
ATOM 1956  C CD  . GLN A 1 248  ? 245.603 -15.455 26.004  1.00 79.54  ? 317  GLN A CD  1 
ATOM 1957  O OE1 . GLN A 1 248  ? 245.145 -15.722 27.115  1.00 81.23  ? 317  GLN A OE1 1 
ATOM 1958  N NE2 . GLN A 1 248  ? 246.697 -14.717 25.845  1.00 79.41  ? 317  GLN A NE2 1 
ATOM 1959  N N   . GLY A 1 249  ? 241.814 -19.059 25.104  1.00 79.14  ? 318  GLY A N   1 
ATOM 1960  C CA  . GLY A 1 249  ? 240.552 -19.743 25.339  1.00 78.70  ? 318  GLY A CA  1 
ATOM 1961  C C   . GLY A 1 249  ? 239.963 -20.428 24.123  1.00 78.29  ? 318  GLY A C   1 
ATOM 1962  O O   . GLY A 1 249  ? 240.480 -20.287 23.021  1.00 81.71  ? 318  GLY A O   1 
ATOM 1963  N N   . TRP A 1 276  ? 250.602 -29.621 25.578  1.00 90.70  ? 345  TRP A N   1 
ATOM 1964  C CA  . TRP A 1 276  ? 250.515 -28.264 26.109  1.00 90.73  ? 345  TRP A CA  1 
ATOM 1965  C C   . TRP A 1 276  ? 251.856 -27.812 26.655  1.00 91.35  ? 345  TRP A C   1 
ATOM 1966  O O   . TRP A 1 276  ? 252.118 -27.970 27.838  1.00 90.55  ? 345  TRP A O   1 
ATOM 1967  C CB  . TRP A 1 276  ? 249.457 -28.199 27.223  1.00 91.06  ? 345  TRP A CB  1 
ATOM 1968  C CG  . TRP A 1 276  ? 249.587 -29.262 28.295  1.00 91.24  ? 345  TRP A CG  1 
ATOM 1969  C CD1 . TRP A 1 276  ? 250.286 -29.179 29.476  1.00 90.70  ? 345  TRP A CD1 1 
ATOM 1970  C CD2 . TRP A 1 276  ? 249.001 -30.567 28.273  1.00 90.77  ? 345  TRP A CD2 1 
ATOM 1971  N NE1 . TRP A 1 276  ? 250.169 -30.355 30.188  1.00 90.82  ? 345  TRP A NE1 1 
ATOM 1972  C CE2 . TRP A 1 276  ? 249.387 -31.223 29.473  1.00 90.75  ? 345  TRP A CE2 1 
ATOM 1973  C CE3 . TRP A 1 276  ? 248.184 -31.248 27.355  1.00 91.13  ? 345  TRP A CE3 1 
ATOM 1974  C CZ2 . TRP A 1 276  ? 248.985 -32.524 29.776  1.00 90.53  ? 345  TRP A CZ2 1 
ATOM 1975  C CZ3 . TRP A 1 276  ? 247.780 -32.543 27.654  1.00 90.66  ? 345  TRP A CZ3 1 
ATOM 1976  C CH2 . TRP A 1 276  ? 248.182 -33.168 28.858  1.00 90.63  ? 345  TRP A CH2 1 
ATOM 1977  N N   . ASP A 1 277  ? 252.725 -27.234 25.835  1.00 93.27  ? 346  ASP A N   1 
ATOM 1978  C CA  . ASP A 1 277  ? 253.971 -26.869 26.458  1.00 93.13  ? 346  ASP A CA  1 
ATOM 1979  C C   . ASP A 1 277  ? 254.783 -25.610 26.254  1.00 93.13  ? 346  ASP A C   1 
ATOM 1980  O O   . ASP A 1 277  ? 255.424 -25.360 25.224  1.00 93.03  ? 346  ASP A O   1 
ATOM 1981  C CB  . ASP A 1 277  ? 254.886 -28.066 26.420  1.00 93.25  ? 346  ASP A CB  1 
ATOM 1982  C CG  . ASP A 1 277  ? 255.268 -28.505 27.803  1.00 93.13  ? 346  ASP A CG  1 
ATOM 1983  O OD1 . ASP A 1 277  ? 254.764 -27.883 28.758  1.00 92.90  ? 346  ASP A OD1 1 
ATOM 1984  O OD2 . ASP A 1 277  ? 256.058 -29.454 27.945  1.00 92.93  ? 346  ASP A OD2 1 
ATOM 1985  N N   . TRP A 1 278  ? 254.752 -24.854 27.343  1.00 89.70  ? 347  TRP A N   1 
ATOM 1986  C CA  . TRP A 1 278  ? 255.417 -23.586 27.533  1.00 90.84  ? 347  TRP A CA  1 
ATOM 1987  C C   . TRP A 1 278  ? 254.765 -22.441 26.825  1.00 84.04  ? 347  TRP A C   1 
ATOM 1988  O O   . TRP A 1 278  ? 255.161 -22.041 25.727  1.00 83.45  ? 347  TRP A O   1 
ATOM 1989  C CB  . TRP A 1 278  ? 256.904 -23.682 27.188  1.00 89.58  ? 347  TRP A CB  1 
ATOM 1990  C CG  . TRP A 1 278  ? 257.601 -24.691 28.064  1.00 89.42  ? 347  TRP A CG  1 
ATOM 1991  C CD1 . TRP A 1 278  ? 258.192 -25.845 27.651  1.00 90.30  ? 347  TRP A CD1 1 
ATOM 1992  C CD2 . TRP A 1 278  ? 257.670 -24.700 29.506  1.00 89.83  ? 347  TRP A CD2 1 
ATOM 1993  N NE1 . TRP A 1 278  ? 258.615 -26.581 28.733  1.00 90.05  ? 347  TRP A NE1 1 
ATOM 1994  C CE2 . TRP A 1 278  ? 258.306 -25.904 29.884  1.00 91.12  ? 347  TRP A CE2 1 
ATOM 1995  C CE3 . TRP A 1 278  ? 257.251 -23.815 30.513  1.00 89.93  ? 347  TRP A CE3 1 
ATOM 1996  C CZ2 . TRP A 1 278  ? 258.538 -26.247 31.228  1.00 89.49  ? 347  TRP A CZ2 1 
ATOM 1997  C CZ3 . TRP A 1 278  ? 257.484 -24.160 31.859  1.00 90.31  ? 347  TRP A CZ3 1 
ATOM 1998  C CH2 . TRP A 1 278  ? 258.118 -25.366 32.196  1.00 89.92  ? 347  TRP A CH2 1 
ATOM 1999  N N   . LEU A 1 279  ? 253.710 -21.956 27.469  1.00 83.45  ? 348  LEU A N   1 
ATOM 2000  C CA  . LEU A 1 279  ? 253.015 -20.798 26.981  1.00 85.08  ? 348  LEU A CA  1 
ATOM 2001  C C   . LEU A 1 279  ? 254.180 -19.863 27.109  1.00 91.35  ? 348  LEU A C   1 
ATOM 2002  O O   . LEU A 1 279  ? 254.979 -19.780 26.169  1.00 91.59  ? 348  LEU A O   1 
ATOM 2003  C CB  . LEU A 1 279  ? 251.884 -20.406 27.922  1.00 85.00  ? 348  LEU A CB  1 
ATOM 2004  C CG  . LEU A 1 279  ? 250.599 -21.172 27.635  1.00 85.36  ? 348  LEU A CG  1 
ATOM 2005  C CD1 . LEU A 1 279  ? 250.100 -20.736 26.281  1.00 91.30  ? 348  LEU A CD1 1 
ATOM 2006  C CD2 . LEU A 1 279  ? 250.847 -22.679 27.685  1.00 92.09  ? 348  LEU A CD2 1 
ATOM 2007  N N   . ASP A 1 280  ? 254.317 -19.183 28.258  1.00 73.97  ? 349  ASP A N   1 
ATOM 2008  C CA  . ASP A 1 280  ? 255.459 -18.272 28.436  1.00 73.51  ? 349  ASP A CA  1 
ATOM 2009  C C   . ASP A 1 280  ? 255.379 -17.728 27.016  1.00 73.69  ? 349  ASP A C   1 
ATOM 2010  O O   . ASP A 1 280  ? 256.357 -17.368 26.366  1.00 73.50  ? 349  ASP A O   1 
ATOM 2011  C CB  . ASP A 1 280  ? 256.711 -19.147 28.683  1.00 74.13  ? 349  ASP A CB  1 
ATOM 2012  C CG  . ASP A 1 280  ? 258.011 -18.355 28.802  1.00 73.55  ? 349  ASP A CG  1 
ATOM 2013  O OD1 . ASP A 1 280  ? 258.265 -17.749 29.870  1.00 73.68  ? 349  ASP A OD1 1 
ATOM 2014  O OD2 . ASP A 1 280  ? 258.786 -18.369 27.817  1.00 73.46  ? 349  ASP A OD2 1 
ATOM 2015  N N   . ILE A 1 281  ? 254.127 -17.754 26.568  1.00 68.73  ? 350  ILE A N   1 
ATOM 2016  C CA  . ILE A 1 281  ? 253.676 -17.406 25.253  1.00 68.47  ? 350  ILE A CA  1 
ATOM 2017  C C   . ILE A 1 281  ? 254.323 -16.221 24.607  1.00 69.03  ? 350  ILE A C   1 
ATOM 2018  O O   . ILE A 1 281  ? 254.656 -16.276 23.432  1.00 68.47  ? 350  ILE A O   1 
ATOM 2019  C CB  . ILE A 1 281  ? 252.142 -17.284 25.272  1.00 69.28  ? 350  ILE A CB  1 
ATOM 2020  C CG1 . ILE A 1 281  ? 251.591 -18.205 24.211  1.00 68.78  ? 350  ILE A CG1 1 
ATOM 2021  C CG2 . ILE A 1 281  ? 251.686 -15.854 25.064  1.00 69.03  ? 350  ILE A CG2 1 
ATOM 2022  C CD1 . ILE A 1 281  ? 252.231 -19.554 24.202  1.00 68.71  ? 350  ILE A CD1 1 
ATOM 2023  N N   . SER A 1 282  ? 254.514 -15.152 25.366  1.00 56.67  ? 351  SER A N   1 
ATOM 2024  C CA  . SER A 1 282  ? 255.154 -13.972 24.823  1.00 56.67  ? 351  SER A CA  1 
ATOM 2025  C C   . SER A 1 282  ? 254.627 -13.740 23.428  1.00 56.67  ? 351  SER A C   1 
ATOM 2026  O O   . SER A 1 282  ? 255.373 -13.843 22.437  1.00 56.67  ? 351  SER A O   1 
ATOM 2027  C CB  . SER A 1 282  ? 256.652 -14.195 24.775  1.00 56.67  ? 351  SER A CB  1 
ATOM 2028  O OG  . SER A 1 282  ? 256.930 -15.582 24.812  1.00 56.67  ? 351  SER A OG  1 
ATOM 2029  N N   . SER A 1 283  ? 253.329 -13.460 23.354  1.00 50.67  ? 352  SER A N   1 
ATOM 2030  C CA  . SER A 1 283  ? 252.690 -13.187 22.070  1.00 50.67  ? 352  SER A CA  1 
ATOM 2031  C C   . SER A 1 283  ? 252.667 -11.669 21.817  1.00 50.67  ? 352  SER A C   1 
ATOM 2032  O O   . SER A 1 283  ? 252.044 -10.903 22.576  1.00 50.67  ? 352  SER A O   1 
ATOM 2033  C CB  . SER A 1 283  ? 251.257 -13.763 22.035  1.00 50.67  ? 352  SER A CB  1 
ATOM 2034  O OG  . SER A 1 283  ? 251.101 -14.750 21.015  1.00 50.67  ? 352  SER A OG  1 
ATOM 2035  N N   . VAL A 1 284  ? 253.386 -11.267 20.767  1.00 41.67  ? 353  VAL A N   1 
ATOM 2036  C CA  . VAL A 1 284  ? 253.519 -9.889  20.304  1.00 41.67  ? 353  VAL A CA  1 
ATOM 2037  C C   . VAL A 1 284  ? 252.323 -9.003  20.601  1.00 41.67  ? 353  VAL A C   1 
ATOM 2038  O O   . VAL A 1 284  ? 251.233 -9.506  20.784  1.00 41.67  ? 353  VAL A O   1 
ATOM 2039  C CB  . VAL A 1 284  ? 253.717 -9.884  18.777  1.00 41.67  ? 353  VAL A CB  1 
ATOM 2040  C CG1 . VAL A 1 284  ? 252.638 -10.729 18.105  1.00 41.67  ? 353  VAL A CG1 1 
ATOM 2041  C CG2 . VAL A 1 284  ? 253.653 -8.474  18.245  1.00 41.67  ? 353  VAL A CG2 1 
ATOM 2042  N N   . ASN A 1 285  ? 252.546 -7.690  20.632  1.00 41.67  ? 354  ASN A N   1 
ATOM 2043  C CA  . ASN A 1 285  ? 251.523 -6.637  20.840  1.00 41.67  ? 354  ASN A CA  1 
ATOM 2044  C C   . ASN A 1 285  ? 251.703 -5.724  22.045  1.00 41.67  ? 354  ASN A C   1 
ATOM 2045  O O   . ASN A 1 285  ? 251.669 -4.492  21.903  1.00 41.67  ? 354  ASN A O   1 
ATOM 2046  C CB  . ASN A 1 285  ? 250.052 -7.185  20.780  1.00 41.67  ? 354  ASN A CB  1 
ATOM 2047  C CG  . ASN A 1 285  ? 249.418 -7.532  22.166  1.00 41.67  ? 354  ASN A CG  1 
ATOM 2048  O OD1 . ASN A 1 285  ? 250.022 -7.373  23.216  1.00 41.67  ? 354  ASN A OD1 1 
ATOM 2049  N ND2 . ASN A 1 285  ? 248.172 -8.021  22.133  1.00 41.67  ? 354  ASN A ND2 1 
ATOM 2050  N N   . SER A 1 286  ? 251.934 -6.324  23.207  1.00 41.67  ? 355  SER A N   1 
ATOM 2051  C CA  . SER A 1 286  ? 252.103 -5.599  24.457  1.00 41.67  ? 355  SER A CA  1 
ATOM 2052  C C   . SER A 1 286  ? 251.468 -6.505  25.494  1.00 41.67  ? 355  SER A C   1 
ATOM 2053  O O   . SER A 1 286  ? 252.111 -7.357  26.099  1.00 41.67  ? 355  SER A O   1 
ATOM 2054  C CB  . SER A 1 286  ? 251.366 -4.247  24.411  1.00 41.67  ? 355  SER A CB  1 
ATOM 2055  O OG  . SER A 1 286  ? 251.267 -3.631  25.680  1.00 41.67  ? 355  SER A OG  1 
ATOM 2056  N N   . ASN A 1 287  ? 250.174 -6.317  25.658  1.00 52.73  ? 356  ASN A N   1 
ATOM 2057  C CA  . ASN A 1 287  ? 249.354 -7.062  26.594  1.00 52.89  ? 356  ASN A CA  1 
ATOM 2058  C C   . ASN A 1 287  ? 249.818 -8.490  26.950  1.00 53.10  ? 356  ASN A C   1 
ATOM 2059  O O   . ASN A 1 287  ? 250.111 -8.747  28.125  1.00 52.54  ? 356  ASN A O   1 
ATOM 2060  C CB  . ASN A 1 287  ? 247.932 -7.054  26.034  1.00 52.82  ? 356  ASN A CB  1 
ATOM 2061  C CG  . ASN A 1 287  ? 247.530 -5.659  25.483  1.00 52.64  ? 356  ASN A CG  1 
ATOM 2062  O OD1 . ASN A 1 287  ? 248.355 -4.946  24.874  1.00 52.46  ? 356  ASN A OD1 1 
ATOM 2063  N ND2 . ASN A 1 287  ? 246.259 -5.275  25.689  1.00 52.93  ? 356  ASN A ND2 1 
ATOM 2064  N N   . SER A 1 288  ? 249.894 -9.392  25.957  1.00 67.74  ? 357  SER A N   1 
ATOM 2065  C CA  . SER A 1 288  ? 250.298 -10.803 26.172  1.00 67.85  ? 357  SER A CA  1 
ATOM 2066  C C   . SER A 1 288  ? 251.739 -11.025 26.626  1.00 68.15  ? 357  SER A C   1 
ATOM 2067  O O   . SER A 1 288  ? 252.114 -12.107 27.111  1.00 67.84  ? 357  SER A O   1 
ATOM 2068  C CB  . SER A 1 288  ? 250.064 -11.626 24.906  1.00 67.63  ? 357  SER A CB  1 
ATOM 2069  O OG  . SER A 1 288  ? 248.690 -11.896 24.726  1.00 67.82  ? 357  SER A OG  1 
ATOM 2070  N N   . LEU A 1 289  ? 252.534 -9.979  26.456  1.00 74.42  ? 358  LEU A N   1 
ATOM 2071  C CA  . LEU A 1 289  ? 253.943 -9.972  26.824  1.00 74.65  ? 358  LEU A CA  1 
ATOM 2072  C C   . LEU A 1 289  ? 254.037 -9.577  28.302  1.00 75.08  ? 358  LEU A C   1 
ATOM 2073  O O   . LEU A 1 289  ? 254.806 -10.156 29.080  1.00 74.99  ? 358  LEU A O   1 
ATOM 2074  C CB  . LEU A 1 289  ? 254.668 -8.956  25.934  1.00 75.17  ? 358  LEU A CB  1 
ATOM 2075  C CG  . LEU A 1 289  ? 253.965 -8.753  24.574  1.00 74.59  ? 358  LEU A CG  1 
ATOM 2076  C CD1 . LEU A 1 289  ? 254.700 -7.757  23.677  1.00 74.69  ? 358  LEU A CD1 1 
ATOM 2077  C CD2 . LEU A 1 289  ? 253.873 -10.085 23.897  1.00 74.82  ? 358  LEU A CD2 1 
ATOM 2078  N N   . ALA A 1 290  ? 253.237 -8.581  28.671  1.00 83.15  ? 359  ALA A N   1 
ATOM 2079  C CA  . ALA A 1 290  ? 253.168 -8.102  30.044  1.00 81.72  ? 359  ALA A CA  1 
ATOM 2080  C C   . ALA A 1 290  ? 252.666 -9.257  30.887  1.00 81.22  ? 359  ALA A C   1 
ATOM 2081  O O   . ALA A 1 290  ? 253.021 -9.399  32.053  1.00 80.99  ? 359  ALA A O   1 
ATOM 2082  C CB  . ALA A 1 290  ? 252.195 -6.944  30.144  1.00 81.12  ? 359  ALA A CB  1 
ATOM 2083  N N   . GLU A 1 291  ? 251.816 -10.071 30.273  1.00 81.02  ? 360  GLU A N   1 
ATOM 2084  C CA  . GLU A 1 291  ? 251.236 -11.240 30.919  1.00 81.22  ? 360  GLU A CA  1 
ATOM 2085  C C   . GLU A 1 291  ? 252.395 -12.134 31.355  1.00 82.53  ? 360  GLU A C   1 
ATOM 2086  O O   . GLU A 1 291  ? 252.326 -12.772 32.405  1.00 82.47  ? 360  GLU A O   1 
ATOM 2087  C CB  . GLU A 1 291  ? 250.322 -11.982 29.919  1.00 80.03  ? 360  GLU A CB  1 
ATOM 2088  C CG  . GLU A 1 291  ? 248.950 -12.452 30.462  1.00 79.31  ? 360  GLU A CG  1 
ATOM 2089  C CD  . GLU A 1 291  ? 247.978 -12.959 29.351  1.00 79.14  ? 360  GLU A CD  1 
ATOM 2090  O OE1 . GLU A 1 291  ? 248.455 -13.466 28.304  1.00 79.61  ? 360  GLU A OE1 1 
ATOM 2091  O OE2 . GLU A 1 291  ? 246.733 -12.865 29.531  1.00 78.82  ? 360  GLU A OE2 1 
ATOM 2092  N N   . VAL A 1 292  ? 253.460 -12.156 30.546  1.00 84.18  ? 361  VAL A N   1 
ATOM 2093  C CA  . VAL A 1 292  ? 254.647 -12.974 30.825  1.00 85.88  ? 361  VAL A CA  1 
ATOM 2094  C C   . VAL A 1 292  ? 255.745 -12.287 31.640  1.00 87.05  ? 361  VAL A C   1 
ATOM 2095  O O   . VAL A 1 292  ? 256.372 -12.927 32.483  1.00 87.67  ? 361  VAL A O   1 
ATOM 2096  C CB  . VAL A 1 292  ? 255.278 -13.570 29.506  1.00 86.18  ? 361  VAL A CB  1 
ATOM 2097  C CG1 . VAL A 1 292  ? 254.871 -12.753 28.296  1.00 85.83  ? 361  VAL A CG1 1 
ATOM 2098  C CG2 . VAL A 1 292  ? 256.800 -13.629 29.622  1.00 85.88  ? 361  VAL A CG2 1 
ATOM 2099  N N   . HIS A 1 293  ? 255.982 -11.002 31.404  1.00 88.30  ? 362  HIS A N   1 
ATOM 2100  C CA  . HIS A 1 293  ? 257.014 -10.291 32.153  1.00 89.22  ? 362  HIS A CA  1 
ATOM 2101  C C   . HIS A 1 293  ? 256.631 -9.945  33.576  1.00 89.73  ? 362  HIS A C   1 
ATOM 2102  O O   . HIS A 1 293  ? 257.362 -10.251 34.520  1.00 88.39  ? 362  HIS A O   1 
ATOM 2103  C CB  . HIS A 1 293  ? 257.410 -9.032  31.413  1.00 89.61  ? 362  HIS A CB  1 
ATOM 2104  C CG  . HIS A 1 293  ? 258.379 -9.288  30.311  1.00 90.10  ? 362  HIS A CG  1 
ATOM 2105  N ND1 . HIS A 1 293  ? 259.711 -9.552  30.544  1.00 90.58  ? 362  HIS A ND1 1 
ATOM 2106  C CD2 . HIS A 1 293  ? 258.204 -9.382  28.973  1.00 90.39  ? 362  HIS A CD2 1 
ATOM 2107  C CE1 . HIS A 1 293  ? 260.317 -9.796  29.395  1.00 90.33  ? 362  HIS A CE1 1 
ATOM 2108  N NE2 . HIS A 1 293  ? 259.424 -9.699  28.426  1.00 90.14  ? 362  HIS A NE2 1 
ATOM 2109  N N   . ARG A 1 294  ? 255.485 -9.297  33.730  1.00 91.17  ? 363  ARG A N   1 
ATOM 2110  C CA  . ARG A 1 294  ? 255.025 -8.933  35.054  1.00 93.38  ? 363  ARG A CA  1 
ATOM 2111  C C   . ARG A 1 294  ? 253.722 -9.574  35.486  1.00 94.40  ? 363  ARG A C   1 
ATOM 2112  O O   . ARG A 1 294  ? 253.625 -9.998  36.623  1.00 94.46  ? 363  ARG A O   1 
ATOM 2113  C CB  . ARG A 1 294  ? 254.973 -7.421  35.186  1.00 94.13  ? 363  ARG A CB  1 
ATOM 2114  C CG  . ARG A 1 294  ? 256.310 -6.924  35.650  1.00 97.84  ? 363  ARG A CG  1 
ATOM 2115  C CD  . ARG A 1 294  ? 256.555 -5.482  35.364  1.00 100.84 ? 363  ARG A CD  1 
ATOM 2116  N NE  . ARG A 1 294  ? 257.993 -5.260  35.340  1.00 103.89 ? 363  ARG A NE  1 
ATOM 2117  C CZ  . ARG A 1 294  ? 258.581 -4.079  35.192  1.00 104.93 ? 363  ARG A CZ  1 
ATOM 2118  N NH1 . ARG A 1 294  ? 257.865 -2.970  35.049  1.00 106.11 ? 363  ARG A NH1 1 
ATOM 2119  N NH2 . ARG A 1 294  ? 259.900 -4.009  35.194  1.00 105.34 ? 363  ARG A NH2 1 
ATOM 2120  N N   . LEU A 1 295  ? 252.724 -9.628  34.606  1.00 96.20  ? 364  LEU A N   1 
ATOM 2121  C CA  . LEU A 1 295  ? 251.444 -10.300 34.895  1.00 96.32  ? 364  LEU A CA  1 
ATOM 2122  C C   . LEU A 1 295  ? 250.294 -9.646  35.710  1.00 95.99  ? 364  LEU A C   1 
ATOM 2123  O O   . LEU A 1 295  ? 249.186 -10.204 35.734  1.00 95.05  ? 364  LEU A O   1 
ATOM 2124  C CB  . LEU A 1 295  ? 251.707 -11.694 35.523  1.00 96.02  ? 364  LEU A CB  1 
ATOM 2125  C CG  . LEU A 1 295  ? 253.018 -12.497 35.410  1.00 95.40  ? 364  LEU A CG  1 
ATOM 2126  C CD1 . LEU A 1 295  ? 253.574 -12.731 36.805  1.00 94.74  ? 364  LEU A CD1 1 
ATOM 2127  C CD2 . LEU A 1 295  ? 252.779 -13.839 34.753  1.00 95.58  ? 364  LEU A CD2 1 
ATOM 2128  N N   . TYR A 1 296  ? 250.510 -8.511  36.385  1.00 96.22  ? 365  TYR A N   1 
ATOM 2129  C CA  . TYR A 1 296  ? 249.412 -7.896  37.168  1.00 84.72  ? 365  TYR A CA  1 
ATOM 2130  C C   . TYR A 1 296  ? 248.906 -6.609  36.543  1.00 84.60  ? 365  TYR A C   1 
ATOM 2131  O O   . TYR A 1 296  ? 249.627 -5.964  35.776  1.00 85.12  ? 365  TYR A O   1 
ATOM 2132  C CB  . TYR A 1 296  ? 249.823 -7.579  38.605  1.00 84.85  ? 365  TYR A CB  1 
ATOM 2133  C CG  . TYR A 1 296  ? 251.170 -8.100  39.003  1.00 84.81  ? 365  TYR A CG  1 
ATOM 2134  C CD1 . TYR A 1 296  ? 252.085 -7.284  39.654  1.00 84.79  ? 365  TYR A CD1 1 
ATOM 2135  C CD2 . TYR A 1 296  ? 251.536 -9.405  38.722  1.00 85.38  ? 365  TYR A CD2 1 
ATOM 2136  C CE1 . TYR A 1 296  ? 253.334 -7.756  40.006  1.00 85.26  ? 365  TYR A CE1 1 
ATOM 2137  C CE2 . TYR A 1 296  ? 252.778 -9.887  39.071  1.00 84.52  ? 365  TYR A CE2 1 
ATOM 2138  C CZ  . TYR A 1 296  ? 253.674 -9.061  39.707  1.00 85.00  ? 365  TYR A CZ  1 
ATOM 2139  O OH  . TYR A 1 296  ? 254.919 -9.545  40.013  1.00 85.06  ? 365  TYR A OH  1 
ATOM 2140  N N   . VAL A 1 297  ? 247.685 -6.216  36.917  1.00 75.84  ? 366  VAL A N   1 
ATOM 2141  C CA  . VAL A 1 297  ? 247.028 -5.034  36.348  1.00 75.88  ? 366  VAL A CA  1 
ATOM 2142  C C   . VAL A 1 297  ? 247.037 -5.419  34.866  1.00 75.68  ? 366  VAL A C   1 
ATOM 2143  O O   . VAL A 1 297  ? 246.874 -4.592  33.957  1.00 75.68  ? 366  VAL A O   1 
ATOM 2144  C CB  . VAL A 1 297  ? 247.819 -3.687  36.664  1.00 76.38  ? 366  VAL A CB  1 
ATOM 2145  C CG1 . VAL A 1 297  ? 248.378 -3.740  38.078  1.00 75.57  ? 366  VAL A CG1 1 
ATOM 2146  C CG2 . VAL A 1 297  ? 248.921 -3.413  35.655  1.00 75.65  ? 366  VAL A CG2 1 
ATOM 2147  N N   . GLY A 1 298  ? 247.211 -6.735  34.687  1.00 68.34  ? 367  GLY A N   1 
ATOM 2148  C CA  . GLY A 1 298  ? 247.300 -7.381  33.393  1.00 68.39  ? 367  GLY A CA  1 
ATOM 2149  C C   . GLY A 1 298  ? 245.949 -7.557  32.766  1.00 67.81  ? 367  GLY A C   1 
ATOM 2150  O O   . GLY A 1 298  ? 245.232 -8.517  33.030  1.00 68.13  ? 367  GLY A O   1 
ATOM 2151  N N   . GLY A 1 299  ? 245.621 -6.586  31.934  1.00 67.95  ? 368  GLY A N   1 
ATOM 2152  C CA  . GLY A 1 299  ? 244.369 -6.558  31.220  1.00 68.30  ? 368  GLY A CA  1 
ATOM 2153  C C   . GLY A 1 299  ? 244.477 -5.283  30.410  1.00 67.62  ? 368  GLY A C   1 
ATOM 2154  O O   . GLY A 1 299  ? 245.583 -4.794  30.151  1.00 67.70  ? 368  GLY A O   1 
ATOM 2155  N N   . PRO A 1 300  ? 243.361 -4.705  29.991  1.00 60.98  ? 369  PRO A N   1 
ATOM 2156  C CA  . PRO A 1 300  ? 243.719 -3.511  29.244  1.00 60.82  ? 369  PRO A CA  1 
ATOM 2157  C C   . PRO A 1 300  ? 243.155 -2.251  29.865  1.00 61.29  ? 369  PRO A C   1 
ATOM 2158  O O   . PRO A 1 300  ? 241.979 -1.935  29.651  1.00 60.56  ? 369  PRO A O   1 
ATOM 2159  C CB  . PRO A 1 300  ? 243.112 -3.791  27.888  1.00 61.18  ? 369  PRO A CB  1 
ATOM 2160  C CG  . PRO A 1 300  ? 241.768 -4.354  28.296  1.00 61.15  ? 369  PRO A CG  1 
ATOM 2161  C CD  . PRO A 1 300  ? 242.109 -5.285  29.473  1.00 60.66  ? 369  PRO A CD  1 
ATOM 2162  N N   . PRO A 1 301  ? 243.941 -1.564  30.720  1.00 48.99  ? 370  PRO A N   1 
ATOM 2163  C CA  . PRO A 1 301  ? 243.288 -0.354  31.220  1.00 49.35  ? 370  PRO A CA  1 
ATOM 2164  C C   . PRO A 1 301  ? 243.010 0.330   29.893  1.00 48.85  ? 370  PRO A C   1 
ATOM 2165  O O   . PRO A 1 301  ? 243.954 0.594   29.150  1.00 48.71  ? 370  PRO A O   1 
ATOM 2166  C CB  . PRO A 1 301  ? 244.398 0.340   31.995  1.00 49.23  ? 370  PRO A CB  1 
ATOM 2167  C CG  . PRO A 1 301  ? 245.123 -0.833  32.602  1.00 48.44  ? 370  PRO A CG  1 
ATOM 2168  C CD  . PRO A 1 301  ? 245.183 -1.850  31.462  1.00 48.60  ? 370  PRO A CD  1 
ATOM 2169  N N   . LYS A 1 304  ? 241.727 0.543   29.586  1.00 41.67  ? 371  LYS A N   1 
ATOM 2170  C CA  . LYS A 1 304  ? 241.257 1.147   28.324  1.00 41.67  ? 371  LYS A CA  1 
ATOM 2171  C C   . LYS A 1 304  ? 241.074 0.004   27.315  1.00 41.67  ? 371  LYS A C   1 
ATOM 2172  O O   . LYS A 1 304  ? 241.022 -1.181  27.690  1.00 41.67  ? 371  LYS A O   1 
ATOM 2173  C CB  . LYS A 1 304  ? 242.275 2.175   27.750  1.00 41.67  ? 371  LYS A CB  1 
ATOM 2174  C CG  . LYS A 1 304  ? 243.415 1.544   26.884  1.00 41.67  ? 371  LYS A CG  1 
ATOM 2175  C CD  . LYS A 1 304  ? 244.537 2.496   26.478  1.00 41.67  ? 371  LYS A CD  1 
ATOM 2176  C CE  . LYS A 1 304  ? 245.847 1.734   26.254  1.00 41.67  ? 371  LYS A CE  1 
ATOM 2177  N NZ  . LYS A 1 304  ? 246.917 2.603   25.731  1.00 41.67  ? 371  LYS A NZ  1 
ATOM 2178  N N   . GLU A 1 305  ? 240.977 0.384   26.043  1.00 41.67  ? 372  GLU A N   1 
ATOM 2179  C CA  . GLU A 1 305  ? 240.851 -0.522  24.909  1.00 41.67  ? 372  GLU A CA  1 
ATOM 2180  C C   . GLU A 1 305  ? 239.485 -1.172  24.582  1.00 41.67  ? 372  GLU A C   1 
ATOM 2181  O O   . GLU A 1 305  ? 239.257 -1.495  23.403  1.00 41.67  ? 372  GLU A O   1 
ATOM 2182  C CB  . GLU A 1 305  ? 241.967 -1.606  24.930  1.00 41.67  ? 372  GLU A CB  1 
ATOM 2183  C CG  . GLU A 1 305  ? 243.054 -1.495  26.046  1.00 41.67  ? 372  GLU A CG  1 
ATOM 2184  C CD  . GLU A 1 305  ? 244.513 -1.286  25.564  1.00 41.67  ? 372  GLU A CD  1 
ATOM 2185  O OE1 . GLU A 1 305  ? 244.755 -1.211  24.337  1.00 41.67  ? 372  GLU A OE1 1 
ATOM 2186  O OE2 . GLU A 1 305  ? 245.424 -1.193  26.426  1.00 41.67  ? 372  GLU A OE2 1 
ATOM 2187  N N   . PRO A 1 306  ? 238.564 -1.399  25.578  1.00 41.67  ? 373  PRO A N   1 
ATOM 2188  C CA  . PRO A 1 306  ? 237.270 -2.013  25.173  1.00 41.67  ? 373  PRO A CA  1 
ATOM 2189  C C   . PRO A 1 306  ? 236.599 -0.851  24.467  1.00 41.67  ? 373  PRO A C   1 
ATOM 2190  O O   . PRO A 1 306  ? 235.737 -0.968  23.598  1.00 41.67  ? 373  PRO A O   1 
ATOM 2191  C CB  . PRO A 1 306  ? 236.582 -2.312  26.509  1.00 41.67  ? 373  PRO A CB  1 
ATOM 2192  C CG  . PRO A 1 306  ? 237.736 -2.382  27.492  1.00 41.67  ? 373  PRO A CG  1 
ATOM 2193  C CD  . PRO A 1 306  ? 238.591 -1.233  27.045  1.00 41.67  ? 373  PRO A CD  1 
ATOM 2194  N N   . ARG A 1 307  ? 237.084 0.285   24.923  1.00 41.67  ? 374  ARG A N   1 
ATOM 2195  C CA  . ARG A 1 307  ? 236.763 1.611   24.488  1.00 41.67  ? 374  ARG A CA  1 
ATOM 2196  C C   . ARG A 1 307  ? 237.916 1.811   23.513  1.00 41.67  ? 374  ARG A C   1 
ATOM 2197  O O   . ARG A 1 307  ? 238.854 1.019   23.502  1.00 41.67  ? 374  ARG A O   1 
ATOM 2198  C CB  . ARG A 1 307  ? 237.010 2.540   25.665  1.00 41.67  ? 374  ARG A CB  1 
ATOM 2199  C CG  . ARG A 1 307  ? 238.439 2.295   26.209  1.00 41.67  ? 374  ARG A CG  1 
ATOM 2200  C CD  . ARG A 1 307  ? 238.910 3.320   27.187  1.00 41.67  ? 374  ARG A CD  1 
ATOM 2201  N NE  . ARG A 1 307  ? 238.047 3.452   28.354  1.00 41.67  ? 374  ARG A NE  1 
ATOM 2202  C CZ  . ARG A 1 307  ? 237.293 2.492   28.895  1.00 41.67  ? 374  ARG A CZ  1 
ATOM 2203  N NH1 . ARG A 1 307  ? 237.239 1.258   28.385  1.00 41.67  ? 374  ARG A NH1 1 
ATOM 2204  N NH2 . ARG A 1 307  ? 236.610 2.771   30.002  1.00 41.67  ? 374  ARG A NH2 1 
ATOM 2205  N N   . GLU A 1 308  ? 237.872 2.884   22.732  1.00 41.67  ? 375  GLU A N   1 
ATOM 2206  C CA  . GLU A 1 308  ? 238.965 3.191   21.806  1.00 41.67  ? 375  GLU A CA  1 
ATOM 2207  C C   . GLU A 1 308  ? 238.939 2.225   20.636  1.00 41.67  ? 375  GLU A C   1 
ATOM 2208  O O   . GLU A 1 308  ? 239.650 2.416   19.638  1.00 41.67  ? 375  GLU A O   1 
ATOM 2209  C CB  . GLU A 1 308  ? 240.322 3.089   22.531  1.00 41.67  ? 375  GLU A CB  1 
ATOM 2210  C CG  . GLU A 1 308  ? 241.374 4.092   22.072  1.00 41.67  ? 375  GLU A CG  1 
ATOM 2211  C CD  . GLU A 1 308  ? 241.166 5.497   22.664  1.00 41.67  ? 375  GLU A CD  1 
ATOM 2212  O OE1 . GLU A 1 308  ? 241.767 6.464   22.136  1.00 41.67  ? 375  GLU A OE1 1 
ATOM 2213  O OE2 . GLU A 1 308  ? 240.418 5.637   23.659  1.00 41.67  ? 375  GLU A OE2 1 
ATOM 2214  N N   . LEU A 1 309  ? 238.133 1.175   20.792  1.00 41.67  ? 376  LEU A N   1 
ATOM 2215  C CA  . LEU A 1 309  ? 237.955 0.158   19.763  1.00 41.67  ? 376  LEU A CA  1 
ATOM 2216  C C   . LEU A 1 309  ? 236.465 0.033   19.546  1.00 41.67  ? 376  LEU A C   1 
ATOM 2217  O O   . LEU A 1 309  ? 236.012 -0.283  18.441  1.00 41.67  ? 376  LEU A O   1 
ATOM 2218  C CB  . LEU A 1 309  ? 238.551 -1.182  20.194  1.00 41.67  ? 376  LEU A CB  1 
ATOM 2219  C CG  . LEU A 1 309  ? 239.624 -1.725  19.243  1.00 41.67  ? 376  LEU A CG  1 
ATOM 2220  C CD1 . LEU A 1 309  ? 240.650 -0.643  18.880  1.00 41.67  ? 376  LEU A CD1 1 
ATOM 2221  C CD2 . LEU A 1 309  ? 240.271 -2.916  19.916  1.00 41.67  ? 376  LEU A CD2 1 
ATOM 2222  N N   . PHE A 1 310  ? 235.683 0.260   20.597  1.00 47.67  ? 377  PHE A N   1 
ATOM 2223  C CA  . PHE A 1 310  ? 234.279 0.225   20.335  1.00 47.67  ? 377  PHE A CA  1 
ATOM 2224  C C   . PHE A 1 310  ? 234.059 1.560   19.690  1.00 47.67  ? 377  PHE A C   1 
ATOM 2225  O O   . PHE A 1 310  ? 233.394 2.464   20.192  1.00 47.67  ? 377  PHE A O   1 
ATOM 2226  C CB  . PHE A 1 310  ? 233.422 0.014   21.565  1.00 47.67  ? 377  PHE A CB  1 
ATOM 2227  C CG  . PHE A 1 310  ? 232.344 -0.981  21.307  1.00 47.67  ? 377  PHE A CG  1 
ATOM 2228  C CD1 . PHE A 1 310  ? 231.337 -1.262  22.228  1.00 47.67  ? 377  PHE A CD1 1 
ATOM 2229  C CD2 . PHE A 1 310  ? 232.343 -1.644  20.076  1.00 47.67  ? 377  PHE A CD2 1 
ATOM 2230  C CE1 . PHE A 1 310  ? 230.335 -2.201  21.911  1.00 47.67  ? 377  PHE A CE1 1 
ATOM 2231  C CE2 . PHE A 1 310  ? 231.365 -2.568  19.752  1.00 47.67  ? 377  PHE A CE2 1 
ATOM 2232  C CZ  . PHE A 1 310  ? 230.353 -2.852  20.668  1.00 47.67  ? 377  PHE A CZ  1 
ATOM 2233  N N   . VAL A 1 311  ? 234.726 1.620   18.549  1.00 50.67  ? 378  VAL A N   1 
ATOM 2234  C CA  . VAL A 1 311  ? 234.798 2.716   17.637  1.00 50.67  ? 378  VAL A CA  1 
ATOM 2235  C C   . VAL A 1 311  ? 236.188 3.245   17.594  1.00 50.67  ? 378  VAL A C   1 
ATOM 2236  O O   . VAL A 1 311  ? 236.424 4.373   18.007  1.00 50.67  ? 378  VAL A O   1 
ATOM 2237  C CB  . VAL A 1 311  ? 233.872 3.812   18.006  1.00 50.67  ? 378  VAL A CB  1 
ATOM 2238  N N   . LYS A 1 312  ? 237.151 2.435   17.186  1.00 59.73  ? 379  LYS A N   1 
ATOM 2239  C CA  . LYS A 1 312  ? 238.410 3.074   16.972  1.00 59.43  ? 379  LYS A CA  1 
ATOM 2240  C C   . LYS A 1 312  ? 237.644 3.542   15.748  1.00 60.21  ? 379  LYS A C   1 
ATOM 2241  O O   . LYS A 1 312  ? 237.726 2.976   14.679  1.00 60.11  ? 379  LYS A O   1 
ATOM 2242  C CB  . LYS A 1 312  ? 239.535 2.092   16.638  1.00 59.49  ? 379  LYS A CB  1 
ATOM 2243  C CG  . LYS A 1 312  ? 239.293 1.117   15.531  1.00 59.56  ? 379  LYS A CG  1 
ATOM 2244  C CD  . LYS A 1 312  ? 238.499 -0.072  16.014  1.00 59.90  ? 379  LYS A CD  1 
ATOM 2245  C CE  . LYS A 1 312  ? 238.514 -1.194  14.979  1.00 59.45  ? 379  LYS A CE  1 
ATOM 2246  N NZ  . LYS A 1 312  ? 237.829 -2.412  15.487  1.00 59.57  ? 379  LYS A NZ  1 
ATOM 2247  N N   . GLY A 1 313  ? 236.821 4.562   15.963  1.00 59.67  ? 380  GLY A N   1 
ATOM 2248  C CA  . GLY A 1 313  ? 235.962 5.084   14.931  1.00 60.02  ? 380  GLY A CA  1 
ATOM 2249  C C   . GLY A 1 313  ? 235.036 6.246   15.292  1.00 59.80  ? 380  GLY A C   1 
ATOM 2250  O O   . GLY A 1 313  ? 234.613 6.932   14.357  1.00 60.27  ? 380  GLY A O   1 
ATOM 2251  N N   . THR A 1 314  ? 234.693 6.492   16.570  1.00 72.63  ? 381  THR A N   1 
ATOM 2252  C CA  . THR A 1 314  ? 233.792 7.631   16.882  1.00 73.27  ? 381  THR A CA  1 
ATOM 2253  C C   . THR A 1 314  ? 234.407 8.869   17.534  1.00 73.09  ? 381  THR A C   1 
ATOM 2254  O O   . THR A 1 314  ? 234.938 8.818   18.646  1.00 72.62  ? 381  THR A O   1 
ATOM 2255  C CB  . THR A 1 314  ? 232.585 7.271   17.796  1.00 72.90  ? 381  THR A CB  1 
ATOM 2256  O OG1 . THR A 1 314  ? 232.997 7.292   19.166  1.00 72.71  ? 381  THR A OG1 1 
ATOM 2257  C CG2 . THR A 1 314  ? 232.001 5.938   17.438  1.00 72.71  ? 381  THR A CG2 1 
ATOM 2258  N N   . MET A 1 315  ? 234.277 9.999   16.850  1.00 73.24  ? 382  MET A N   1 
ATOM 2259  C CA  . MET A 1 315  ? 234.813 11.235  17.365  1.00 73.25  ? 382  MET A CA  1 
ATOM 2260  C C   . MET A 1 315  ? 233.870 12.410  17.248  1.00 72.83  ? 382  MET A C   1 
ATOM 2261  O O   . MET A 1 315  ? 233.018 12.494  16.360  1.00 72.74  ? 382  MET A O   1 
ATOM 2262  C CB  . MET A 1 315  ? 236.105 11.579  16.660  1.00 72.83  ? 382  MET A CB  1 
ATOM 2263  C CG  . MET A 1 315  ? 237.082 12.315  17.532  1.00 73.39  ? 382  MET A CG  1 
ATOM 2264  S SD  . MET A 1 315  ? 236.421 13.778  18.292  1.00 72.61  ? 382  MET A SD  1 
ATOM 2265  C CE  . MET A 1 315  ? 236.282 14.872  16.903  1.00 72.74  ? 382  MET A CE  1 
ATOM 2266  N N   . LYS A 1 316  ? 234.106 13.327  18.172  1.00 89.26  ? 383  LYS A N   1 
ATOM 2267  C CA  . LYS A 1 316  ? 233.402 14.576  18.405  1.00 89.30  ? 383  LYS A CA  1 
ATOM 2268  C C   . LYS A 1 316  ? 233.098 14.291  19.859  1.00 88.69  ? 383  LYS A C   1 
ATOM 2269  O O   . LYS A 1 316  ? 233.312 15.119  20.734  1.00 89.28  ? 383  LYS A O   1 
ATOM 2270  C CB  . LYS A 1 316  ? 232.109 14.705  17.587  1.00 88.60  ? 383  LYS A CB  1 
ATOM 2271  C CG  . LYS A 1 316  ? 232.218 15.642  16.384  1.00 88.91  ? 383  LYS A CG  1 
ATOM 2272  C CD  . LYS A 1 316  ? 230.974 16.504  16.268  1.00 88.71  ? 383  LYS A CD  1 
ATOM 2273  C CE  . LYS A 1 316  ? 231.042 17.446  15.084  1.00 88.59  ? 383  LYS A CE  1 
ATOM 2274  N NZ  . LYS A 1 316  ? 229.836 18.329  15.098  1.00 88.48  ? 383  LYS A NZ  1 
ATOM 2275  N N   . ASP A 1 317  ? 232.666 13.056  20.096  1.00 88.96  ? 384  ASP A N   1 
ATOM 2276  C CA  . ASP A 1 317  ? 232.319 12.568  21.423  1.00 89.14  ? 384  ASP A CA  1 
ATOM 2277  C C   . ASP A 1 317  ? 233.598 12.279  22.174  1.00 88.63  ? 384  ASP A C   1 
ATOM 2278  O O   . ASP A 1 317  ? 233.698 12.495  23.383  1.00 88.43  ? 384  ASP A O   1 
ATOM 2279  C CB  . ASP A 1 317  ? 231.504 11.272  21.299  1.00 89.18  ? 384  ASP A CB  1 
ATOM 2280  C CG  . ASP A 1 317  ? 231.217 10.892  19.844  1.00 89.10  ? 384  ASP A CG  1 
ATOM 2281  O OD1 . ASP A 1 317  ? 232.181 10.641  19.091  1.00 89.03  ? 384  ASP A OD1 1 
ATOM 2282  O OD2 . ASP A 1 317  ? 230.030 10.845  19.452  1.00 88.85  ? 384  ASP A OD2 1 
ATOM 2283  N N   . ILE A 1 318  ? 234.576 11.797  21.422  1.00 91.12  ? 385  ILE A N   1 
ATOM 2284  C CA  . ILE A 1 318  ? 235.849 11.423  21.980  1.00 91.19  ? 385  ILE A CA  1 
ATOM 2285  C C   . ILE A 1 318  ? 236.341 12.266  23.152  1.00 91.95  ? 385  ILE A C   1 
ATOM 2286  O O   . ILE A 1 318  ? 236.661 11.714  24.195  1.00 91.49  ? 385  ILE A O   1 
ATOM 2287  C CB  . ILE A 1 318  ? 236.937 11.381  20.900  1.00 90.84  ? 385  ILE A CB  1 
ATOM 2288  C CG1 . ILE A 1 318  ? 238.073 10.463  21.365  1.00 90.87  ? 385  ILE A CG1 1 
ATOM 2289  C CG2 . ILE A 1 318  ? 237.511 12.762  20.683  1.00 91.31  ? 385  ILE A CG2 1 
ATOM 2290  C CD1 . ILE A 1 318  ? 239.059 10.064  20.261  1.00 91.71  ? 385  ILE A CD1 1 
ATOM 2291  N N   . ARG A 1 319  ? 236.400 13.585  23.005  1.00 91.65  ? 386  ARG A N   1 
ATOM 2292  C CA  . ARG A 1 319  ? 236.903 14.405  24.096  1.00 92.80  ? 386  ARG A CA  1 
ATOM 2293  C C   . ARG A 1 319  ? 236.203 14.185  25.412  1.00 95.74  ? 386  ARG A C   1 
ATOM 2294  O O   . ARG A 1 319  ? 236.845 14.057  26.448  1.00 96.28  ? 386  ARG A O   1 
ATOM 2295  C CB  . ARG A 1 319  ? 236.831 15.883  23.755  1.00 98.71  ? 386  ARG A CB  1 
ATOM 2296  C CG  . ARG A 1 319  ? 235.605 16.565  24.232  1.00 96.95  ? 386  ARG A CG  1 
ATOM 2297  C CD  . ARG A 1 319  ? 234.446 16.208  23.373  1.00 95.72  ? 386  ARG A CD  1 
ATOM 2298  N NE  . ARG A 1 319  ? 233.298 17.039  23.710  1.00 95.29  ? 386  ARG A NE  1 
ATOM 2299  C CZ  . ARG A 1 319  ? 232.053 16.778  23.334  1.00 94.49  ? 386  ARG A CZ  1 
ATOM 2300  N NH1 . ARG A 1 319  ? 231.796 15.698  22.605  1.00 95.07  ? 386  ARG A NH1 1 
ATOM 2301  N NH2 . ARG A 1 319  ? 231.062 17.585  23.699  1.00 94.69  ? 386  ARG A NH2 1 
ATOM 2302  N N   . GLU A 1 320  ? 234.881 14.186  25.372  1.00 89.90  ? 387  GLU A N   1 
ATOM 2303  C CA  . GLU A 1 320  ? 234.107 13.984  26.577  1.00 89.85  ? 387  GLU A CA  1 
ATOM 2304  C C   . GLU A 1 320  ? 234.725 12.794  27.287  1.00 89.98  ? 387  GLU A C   1 
ATOM 2305  O O   . GLU A 1 320  ? 235.395 12.922  28.321  1.00 89.90  ? 387  GLU A O   1 
ATOM 2306  C CB  . GLU A 1 320  ? 232.671 13.646  26.218  1.00 90.14  ? 387  GLU A CB  1 
ATOM 2307  C CG  . GLU A 1 320  ? 232.162 14.400  25.049  1.00 89.54  ? 387  GLU A CG  1 
ATOM 2308  C CD  . GLU A 1 320  ? 230.688 14.240  24.886  1.00 90.09  ? 387  GLU A CD  1 
ATOM 2309  O OE1 . GLU A 1 320  ? 230.264 13.254  24.256  1.00 89.42  ? 387  GLU A OE1 1 
ATOM 2310  O OE2 . GLU A 1 320  ? 229.950 15.095  25.410  1.00 90.29  ? 387  GLU A OE2 1 
ATOM 2311  N N   . ASN A 1 321  ? 234.490 11.632  26.690  1.00 80.23  ? 388  ASN A N   1 
ATOM 2312  C CA  . ASN A 1 321  ? 234.996 10.365  27.183  1.00 80.28  ? 388  ASN A CA  1 
ATOM 2313  C C   . ASN A 1 321  ? 236.473 10.528  27.504  1.00 76.79  ? 388  ASN A C   1 
ATOM 2314  O O   . ASN A 1 321  ? 236.960 10.022  28.511  1.00 77.24  ? 388  ASN A O   1 
ATOM 2315  C CB  . ASN A 1 321  ? 234.812 9.306   26.104  1.00 79.96  ? 388  ASN A CB  1 
ATOM 2316  C CG  . ASN A 1 321  ? 233.817 9.737   25.050  1.00 78.25  ? 388  ASN A CG  1 
ATOM 2317  O OD1 . ASN A 1 321  ? 232.637 9.960   25.336  1.00 76.77  ? 388  ASN A OD1 1 
ATOM 2318  N ND2 . ASN A 1 321  ? 234.291 9.873   23.821  1.00 77.36  ? 388  ASN A ND2 1 
ATOM 2319  N N   . PHE A 1 322  ? 237.177 11.252  26.641  1.00 66.76  ? 389  PHE A N   1 
ATOM 2320  C CA  . PHE A 1 322  ? 238.601 11.502  26.814  1.00 66.44  ? 389  PHE A CA  1 
ATOM 2321  C C   . PHE A 1 322  ? 238.945 12.150  28.135  1.00 67.05  ? 389  PHE A C   1 
ATOM 2322  O O   . PHE A 1 322  ? 239.650 11.564  28.968  1.00 66.87  ? 389  PHE A O   1 
ATOM 2323  C CB  . PHE A 1 322  ? 239.144 12.368  25.651  1.00 66.99  ? 389  PHE A CB  1 
ATOM 2324  C CG  . PHE A 1 322  ? 240.153 13.456  26.073  1.00 66.40  ? 389  PHE A CG  1 
ATOM 2325  C CD1 . PHE A 1 322  ? 239.726 14.713  26.516  1.00 66.99  ? 389  PHE A CD1 1 
ATOM 2326  C CD2 . PHE A 1 322  ? 241.519 13.219  26.037  1.00 66.74  ? 389  PHE A CD2 1 
ATOM 2327  C CE1 . PHE A 1 322  ? 240.632 15.698  26.911  1.00 66.82  ? 389  PHE A CE1 1 
ATOM 2328  C CE2 . PHE A 1 322  ? 242.426 14.211  26.434  1.00 67.04  ? 389  PHE A CE2 1 
ATOM 2329  C CZ  . PHE A 1 322  ? 241.972 15.445  26.870  1.00 66.67  ? 389  PHE A CZ  1 
ATOM 2330  N N   . GLN A 1 323  ? 238.439 13.368  28.309  1.00 56.56  ? 390  GLN A N   1 
ATOM 2331  C CA  . GLN A 1 323  ? 238.714 14.136  29.500  1.00 57.01  ? 390  GLN A CA  1 
ATOM 2332  C C   . GLN A 1 323  ? 238.726 13.146  30.630  1.00 56.26  ? 390  GLN A C   1 
ATOM 2333  O O   . GLN A 1 323  ? 239.789 12.861  31.184  1.00 57.49  ? 390  GLN A O   1 
ATOM 2334  C CB  . GLN A 1 323  ? 237.667 15.241  29.699  1.00 56.76  ? 390  GLN A CB  1 
ATOM 2335  C CG  . GLN A 1 323  ? 237.972 16.507  28.888  1.00 59.56  ? 390  GLN A CG  1 
ATOM 2336  C CD  . GLN A 1 323  ? 237.125 16.614  27.643  1.00 58.26  ? 390  GLN A CD  1 
ATOM 2337  O OE1 . GLN A 1 323  ? 235.904 16.708  27.732  1.00 58.07  ? 390  GLN A OE1 1 
ATOM 2338  N NE2 . GLN A 1 323  ? 237.763 16.601  26.477  1.00 56.51  ? 390  GLN A NE2 1 
ATOM 2339  N N   . ASP A 1 324  ? 237.569 12.562  30.914  1.00 48.67  ? 391  ASP A N   1 
ATOM 2340  C CA  . ASP A 1 324  ? 237.477 11.580  31.977  1.00 48.67  ? 391  ASP A CA  1 
ATOM 2341  C C   . ASP A 1 324  ? 238.636 10.578  31.935  1.00 48.67  ? 391  ASP A C   1 
ATOM 2342  O O   . ASP A 1 324  ? 239.529 10.600  32.793  1.00 48.67  ? 391  ASP A O   1 
ATOM 2343  C CB  . ASP A 1 324  ? 236.133 10.821  31.902  1.00 48.67  ? 391  ASP A CB  1 
ATOM 2344  C CG  . ASP A 1 324  ? 235.922 9.846   33.081  1.00 48.67  ? 391  ASP A CG  1 
ATOM 2345  O OD1 . ASP A 1 324  ? 236.722 8.895   33.267  1.00 48.67  ? 391  ASP A OD1 1 
ATOM 2346  O OD2 . ASP A 1 324  ? 234.936 10.038  33.826  1.00 48.67  ? 391  ASP A OD2 1 
ATOM 2347  N N   . LEU A 1 325  ? 238.650 9.757   30.888  1.00 41.67  ? 392  LEU A N   1 
ATOM 2348  C CA  . LEU A 1 325  ? 239.608 8.660   30.778  1.00 41.67  ? 392  LEU A CA  1 
ATOM 2349  C C   . LEU A 1 325  ? 240.963 8.683   30.091  1.00 41.67  ? 392  LEU A C   1 
ATOM 2350  O O   . LEU A 1 325  ? 241.876 7.982   30.521  1.00 41.67  ? 392  LEU A O   1 
ATOM 2351  C CB  . LEU A 1 325  ? 238.867 7.432   30.235  1.00 41.67  ? 392  LEU A CB  1 
ATOM 2352  C CG  . LEU A 1 325  ? 239.705 6.150   30.223  1.00 41.67  ? 392  LEU A CG  1 
ATOM 2353  C CD1 . LEU A 1 325  ? 238.778 4.989   30.349  1.00 41.67  ? 392  LEU A CD1 1 
ATOM 2354  C CD2 . LEU A 1 325  ? 240.624 6.036   28.996  1.00 41.67  ? 392  LEU A CD2 1 
ATOM 2355  N N   . MET A 1 326  ? 241.121 9.440   29.030  1.00 41.67  ? 393  MET A N   1 
ATOM 2356  C CA  . MET A 1 326  ? 242.384 9.364   28.322  1.00 41.67  ? 393  MET A CA  1 
ATOM 2357  C C   . MET A 1 326  ? 243.654 9.314   29.133  1.00 41.67  ? 393  MET A C   1 
ATOM 2358  O O   . MET A 1 326  ? 244.693 8.888   28.645  1.00 41.67  ? 393  MET A O   1 
ATOM 2359  C CB  . MET A 1 326  ? 242.409 10.435  27.267  1.00 41.67  ? 393  MET A CB  1 
ATOM 2360  C CG  . MET A 1 326  ? 241.406 10.074  26.178  1.00 41.67  ? 393  MET A CG  1 
ATOM 2361  S SD  . MET A 1 326  ? 239.961 9.100   26.819  1.00 41.67  ? 393  MET A SD  1 
ATOM 2362  C CE  . MET A 1 326  ? 240.384 7.427   26.199  1.00 41.67  ? 393  MET A CE  1 
ATOM 2363  N N   . GLN A 1 327  ? 243.574 9.745   30.378  1.00 41.67  ? 394  GLN A N   1 
ATOM 2364  C CA  . GLN A 1 327  ? 244.731 9.633   31.244  1.00 41.67  ? 394  GLN A CA  1 
ATOM 2365  C C   . GLN A 1 327  ? 244.939 8.115   31.393  1.00 41.67  ? 394  GLN A C   1 
ATOM 2366  O O   . GLN A 1 327  ? 246.081 7.646   31.469  1.00 41.67  ? 394  GLN A O   1 
ATOM 2367  C CB  . GLN A 1 327  ? 244.446 10.267  32.623  1.00 41.67  ? 394  GLN A CB  1 
ATOM 2368  C CG  . GLN A 1 327  ? 245.225 9.652   33.848  1.00 41.67  ? 394  GLN A CG  1 
ATOM 2369  C CD  . GLN A 1 327  ? 244.515 8.435   34.508  1.00 41.67  ? 394  GLN A CD  1 
ATOM 2370  O OE1 . GLN A 1 327  ? 244.412 7.362   33.924  1.00 41.67  ? 394  GLN A OE1 1 
ATOM 2371  N NE2 . GLN A 1 327  ? 244.028 8.622   35.729  1.00 41.67  ? 394  GLN A NE2 1 
ATOM 2372  N N   . TYR A 1 328  ? 243.828 7.364   31.440  1.00 41.67  ? 395  TYR A N   1 
ATOM 2373  C CA  . TYR A 1 328  ? 243.847 5.900   31.592  1.00 41.67  ? 395  TYR A CA  1 
ATOM 2374  C C   . TYR A 1 328  ? 244.741 5.297   30.538  1.00 41.67  ? 395  TYR A C   1 
ATOM 2375  O O   . TYR A 1 328  ? 245.705 4.581   30.828  1.00 41.67  ? 395  TYR A O   1 
ATOM 2376  C CB  . TYR A 1 328  ? 242.464 5.291   31.374  1.00 41.67  ? 395  TYR A CB  1 
ATOM 2377  C CG  . TYR A 1 328  ? 241.411 5.442   32.463  1.00 41.67  ? 395  TYR A CG  1 
ATOM 2378  C CD1 . TYR A 1 328  ? 241.046 6.703   32.964  1.00 41.67  ? 395  TYR A CD1 1 
ATOM 2379  C CD2 . TYR A 1 328  ? 240.645 4.323   32.859  1.00 41.67  ? 395  TYR A CD2 1 
ATOM 2380  C CE1 . TYR A 1 328  ? 239.931 6.853   33.815  1.00 41.67  ? 395  TYR A CE1 1 
ATOM 2381  C CE2 . TYR A 1 328  ? 239.532 4.459   33.709  1.00 41.67  ? 395  TYR A CE2 1 
ATOM 2382  C CZ  . TYR A 1 328  ? 239.173 5.735   34.181  1.00 41.67  ? 395  TYR A CZ  1 
ATOM 2383  O OH  . TYR A 1 328  ? 238.048 5.918   34.984  1.00 41.67  ? 395  TYR A OH  1 
ATOM 2384  N N   . CYS A 1 329  ? 244.357 5.575   29.302  1.00 41.67  ? 396  CYS A N   1 
ATOM 2385  C CA  . CYS A 1 329  ? 245.075 5.106   28.141  1.00 41.67  ? 396  CYS A CA  1 
ATOM 2386  C C   . CYS A 1 329  ? 246.547 5.275   28.408  1.00 41.67  ? 396  CYS A C   1 
ATOM 2387  O O   . CYS A 1 329  ? 247.335 4.330   28.400  1.00 41.67  ? 396  CYS A O   1 
ATOM 2388  C CB  . CYS A 1 329  ? 244.666 5.946   26.937  1.00 41.67  ? 396  CYS A CB  1 
ATOM 2389  S SG  . CYS A 1 329  ? 242.914 5.817   26.540  1.00 41.67  ? 396  CYS A SG  1 
ATOM 2390  N N   . ALA A 1 330  ? 246.898 6.524   28.631  1.00 41.67  ? 397  ALA A N   1 
ATOM 2391  C CA  . ALA A 1 330  ? 248.254 6.904   28.940  1.00 41.67  ? 397  ALA A CA  1 
ATOM 2392  C C   . ALA A 1 330  ? 248.880 5.853   29.856  1.00 41.67  ? 397  ALA A C   1 
ATOM 2393  O O   . ALA A 1 330  ? 249.695 5.018   29.446  1.00 41.67  ? 397  ALA A O   1 
ATOM 2394  C CB  . ALA A 1 330  ? 248.235 8.257   29.646  1.00 41.67  ? 397  ALA A CB  1 
ATOM 2395  N N   . GLN A 1 331  ? 248.461 5.909   31.110  1.00 41.67  ? 398  GLN A N   1 
ATOM 2396  C CA  . GLN A 1 331  ? 248.965 5.021   32.119  1.00 41.67  ? 398  GLN A CA  1 
ATOM 2397  C C   . GLN A 1 331  ? 249.071 3.572   31.662  1.00 41.67  ? 398  GLN A C   1 
ATOM 2398  O O   . GLN A 1 331  ? 250.148 2.990   31.749  1.00 41.67  ? 398  GLN A O   1 
ATOM 2399  C CB  . GLN A 1 331  ? 248.114 5.169   33.388  1.00 41.67  ? 398  GLN A CB  1 
ATOM 2400  C CG  . GLN A 1 331  ? 248.966 5.595   34.603  1.00 41.67  ? 398  GLN A CG  1 
ATOM 2401  C CD  . GLN A 1 331  ? 248.249 6.503   35.605  1.00 41.67  ? 398  GLN A CD  1 
ATOM 2402  O OE1 . GLN A 1 331  ? 247.783 7.604   35.269  1.00 41.67  ? 398  GLN A OE1 1 
ATOM 2403  N NE2 . GLN A 1 331  ? 248.182 6.049   36.850  1.00 41.67  ? 398  GLN A NE2 1 
ATOM 2404  N N   . ASP A 1 332  ? 247.984 2.985   31.167  1.00 41.67  ? 399  ASP A N   1 
ATOM 2405  C CA  . ASP A 1 332  ? 248.056 1.596   30.712  1.00 41.67  ? 399  ASP A CA  1 
ATOM 2406  C C   . ASP A 1 332  ? 249.291 1.476   29.867  1.00 41.67  ? 399  ASP A C   1 
ATOM 2407  O O   . ASP A 1 332  ? 250.119 0.601   30.061  1.00 41.67  ? 399  ASP A O   1 
ATOM 2408  C CB  . ASP A 1 332  ? 246.847 1.221   29.847  1.00 41.67  ? 399  ASP A CB  1 
ATOM 2409  C CG  . ASP A 1 332  ? 246.968 -0.196  29.237  1.00 41.67  ? 399  ASP A CG  1 
ATOM 2410  O OD1 . ASP A 1 332  ? 247.909 -0.939  29.618  1.00 41.67  ? 399  ASP A OD1 1 
ATOM 2411  O OD2 . ASP A 1 332  ? 246.120 -0.573  28.388  1.00 41.67  ? 399  ASP A OD2 1 
ATOM 2412  N N   . VAL A 1 333  ? 249.384 2.390   28.919  1.00 41.67  ? 400  VAL A N   1 
ATOM 2413  C CA  . VAL A 1 333  ? 250.493 2.460   28.007  1.00 41.67  ? 400  VAL A CA  1 
ATOM 2414  C C   . VAL A 1 333  ? 251.796 2.405   28.770  1.00 41.67  ? 400  VAL A C   1 
ATOM 2415  O O   . VAL A 1 333  ? 252.680 1.601   28.457  1.00 41.67  ? 400  VAL A O   1 
ATOM 2416  C CB  . VAL A 1 333  ? 250.421 3.765   27.221  1.00 41.67  ? 400  VAL A CB  1 
ATOM 2417  C CG1 . VAL A 1 333  ? 251.737 4.082   26.612  1.00 41.67  ? 400  VAL A CG1 1 
ATOM 2418  C CG2 . VAL A 1 333  ? 249.366 3.649   26.148  1.00 41.67  ? 400  VAL A CG2 1 
ATOM 2419  N N   . TRP A 1 334  ? 251.896 3.265   29.781  1.00 41.67  ? 401  TRP A N   1 
ATOM 2420  C CA  . TRP A 1 334  ? 253.096 3.371   30.620  1.00 41.67  ? 401  TRP A CA  1 
ATOM 2421  C C   . TRP A 1 334  ? 253.584 2.100   31.271  1.00 41.67  ? 401  TRP A C   1 
ATOM 2422  O O   . TRP A 1 334  ? 254.755 1.708   31.107  1.00 41.67  ? 401  TRP A O   1 
ATOM 2423  C CB  . TRP A 1 334  ? 252.897 4.448   31.685  1.00 41.67  ? 401  TRP A CB  1 
ATOM 2424  C CG  . TRP A 1 334  ? 252.975 5.745   31.031  1.00 41.67  ? 401  TRP A CG  1 
ATOM 2425  C CD1 . TRP A 1 334  ? 251.979 6.679   30.934  1.00 41.67  ? 401  TRP A CD1 1 
ATOM 2426  C CD2 . TRP A 1 334  ? 254.047 6.207   30.179  1.00 41.67  ? 401  TRP A CD2 1 
ATOM 2427  N NE1 . TRP A 1 334  ? 252.371 7.695   30.081  1.00 41.67  ? 401  TRP A NE1 1 
ATOM 2428  C CE2 . TRP A 1 334  ? 253.641 7.441   29.628  1.00 41.67  ? 401  TRP A CE2 1 
ATOM 2429  C CE3 . TRP A 1 334  ? 255.337 5.725   29.883  1.00 41.67  ? 401  TRP A CE3 1 
ATOM 2430  C CZ2 . TRP A 1 334  ? 254.437 8.149   28.736  1.00 41.67  ? 401  TRP A CZ2 1 
ATOM 2431  C CZ3 . TRP A 1 334  ? 256.117 6.452   29.005  1.00 41.67  ? 401  TRP A CZ3 1 
ATOM 2432  C CH2 . TRP A 1 334  ? 255.675 7.664   28.468  1.00 41.67  ? 401  TRP A CH2 1 
ATOM 2433  N N   . ALA A 1 335  ? 252.690 1.483   32.037  1.00 41.67  ? 402  ALA A N   1 
ATOM 2434  C CA  . ALA A 1 335  ? 252.999 0.233   32.705  1.00 41.67  ? 402  ALA A CA  1 
ATOM 2435  C C   . ALA A 1 335  ? 253.740 -0.579  31.640  1.00 41.67  ? 402  ALA A C   1 
ATOM 2436  O O   . ALA A 1 335  ? 254.940 -0.807  31.781  1.00 41.67  ? 402  ALA A O   1 
ATOM 2437  C CB  . ALA A 1 335  ? 251.697 -0.474  33.147  1.00 41.67  ? 402  ALA A CB  1 
ATOM 2438  N N   . THR A 1 336  ? 253.036 -0.959  30.564  1.00 41.67  ? 403  THR A N   1 
ATOM 2439  C CA  . THR A 1 336  ? 253.626 -1.741  29.467  1.00 41.67  ? 403  THR A CA  1 
ATOM 2440  C C   . THR A 1 336  ? 255.060 -1.296  29.276  1.00 41.67  ? 403  THR A C   1 
ATOM 2441  O O   . THR A 1 336  ? 256.000 -2.053  29.549  1.00 41.67  ? 403  THR A O   1 
ATOM 2442  C CB  . THR A 1 336  ? 252.875 -1.554  28.098  1.00 41.67  ? 403  THR A CB  1 
ATOM 2443  O OG1 . THR A 1 336  ? 253.697 -0.831  27.173  1.00 41.67  ? 403  THR A OG1 1 
ATOM 2444  C CG2 . THR A 1 336  ? 251.600 -0.795  28.284  1.00 41.67  ? 403  THR A CG2 1 
ATOM 2445  N N   . HIS A 1 337  ? 255.220 -0.059  28.815  1.00 41.67  ? 404  HIS A N   1 
ATOM 2446  C CA  . HIS A 1 337  ? 256.544 0.494   28.606  1.00 41.67  ? 404  HIS A CA  1 
ATOM 2447  C C   . HIS A 1 337  ? 257.383 0.055   29.775  1.00 41.67  ? 404  HIS A C   1 
ATOM 2448  O O   . HIS A 1 337  ? 258.333 -0.732  29.629  1.00 41.67  ? 404  HIS A O   1 
ATOM 2449  C CB  . HIS A 1 337  ? 256.469 2.010   28.543  1.00 41.67  ? 404  HIS A CB  1 
ATOM 2450  C CG  . HIS A 1 337  ? 255.652 2.498   27.394  1.00 41.67  ? 404  HIS A CG  1 
ATOM 2451  N ND1 . HIS A 1 337  ? 255.862 2.069   26.099  1.00 41.67  ? 404  HIS A ND1 1 
ATOM 2452  C CD2 . HIS A 1 337  ? 254.615 3.364   27.340  1.00 41.67  ? 404  HIS A CD2 1 
ATOM 2453  C CE1 . HIS A 1 337  ? 254.986 2.649   25.296  1.00 41.67  ? 404  HIS A CE1 1 
ATOM 2454  N NE2 . HIS A 1 337  ? 254.218 3.440   26.025  1.00 41.67  ? 404  HIS A NE2 1 
ATOM 2455  N N   . GLU A 1 338  ? 256.986 0.539   30.946  1.00 41.67  ? 405  GLU A N   1 
ATOM 2456  C CA  . GLU A 1 338  ? 257.674 0.214   32.180  1.00 41.67  ? 405  GLU A CA  1 
ATOM 2457  C C   . GLU A 1 338  ? 257.803 -1.264  32.479  1.00 41.67  ? 405  GLU A C   1 
ATOM 2458  O O   . GLU A 1 338  ? 258.902 -1.727  32.799  1.00 41.67  ? 405  GLU A O   1 
ATOM 2459  C CB  . GLU A 1 338  ? 256.992 0.893   33.354  1.00 41.67  ? 405  GLU A CB  1 
ATOM 2460  C CG  . GLU A 1 338  ? 257.419 2.350   33.489  1.00 41.67  ? 405  GLU A CG  1 
ATOM 2461  C CD  . GLU A 1 338  ? 258.920 2.525   33.797  1.00 41.67  ? 405  GLU A CD  1 
ATOM 2462  O OE1 . GLU A 1 338  ? 259.483 3.562   33.394  1.00 41.67  ? 405  GLU A OE1 1 
ATOM 2463  O OE2 . GLU A 1 338  ? 259.531 1.646   34.446  1.00 41.67  ? 405  GLU A OE2 1 
ATOM 2464  N N   . VAL A 1 339  ? 256.705 -2.009  32.377  1.00 41.67  ? 406  VAL A N   1 
ATOM 2465  C CA  . VAL A 1 339  ? 256.776 -3.435  32.687  1.00 41.67  ? 406  VAL A CA  1 
ATOM 2466  C C   . VAL A 1 339  ? 257.670 -4.244  31.739  1.00 41.67  ? 406  VAL A C   1 
ATOM 2467  O O   . VAL A 1 339  ? 258.527 -5.020  32.217  1.00 41.67  ? 406  VAL A O   1 
ATOM 2468  C CB  . VAL A 1 339  ? 255.322 -4.126  32.864  1.00 41.67  ? 406  VAL A CB  1 
ATOM 2469  C CG1 . VAL A 1 339  ? 254.271 -3.088  33.231  1.00 41.67  ? 406  VAL A CG1 1 
ATOM 2470  C CG2 . VAL A 1 339  ? 254.907 -4.928  31.644  1.00 41.67  ? 406  VAL A CG2 1 
ATOM 2471  N N   . PHE A 1 340  ? 257.511 -4.059  30.423  1.00 41.67  ? 407  PHE A N   1 
ATOM 2472  C CA  . PHE A 1 340  ? 258.342 -4.816  29.489  1.00 41.67  ? 407  PHE A CA  1 
ATOM 2473  C C   . PHE A 1 340  ? 259.769 -4.374  29.678  1.00 41.67  ? 407  PHE A C   1 
ATOM 2474  O O   . PHE A 1 340  ? 260.669 -5.200  29.851  1.00 41.67  ? 407  PHE A O   1 
ATOM 2475  C CB  . PHE A 1 340  ? 257.955 -4.581  28.018  1.00 41.67  ? 407  PHE A CB  1 
ATOM 2476  C CG  . PHE A 1 340  ? 256.553 -4.999  27.671  1.00 41.67  ? 407  PHE A CG  1 
ATOM 2477  C CD1 . PHE A 1 340  ? 256.149 -5.093  26.334  1.00 41.67  ? 407  PHE A CD1 1 
ATOM 2478  C CD2 . PHE A 1 340  ? 255.612 -5.231  28.678  1.00 41.67  ? 407  PHE A CD2 1 
ATOM 2479  C CE1 . PHE A 1 340  ? 254.826 -5.403  26.019  1.00 41.67  ? 407  PHE A CE1 1 
ATOM 2480  C CE2 . PHE A 1 340  ? 254.285 -5.541  28.374  1.00 41.67  ? 407  PHE A CE2 1 
ATOM 2481  C CZ  . PHE A 1 340  ? 253.890 -5.625  27.049  1.00 41.67  ? 407  PHE A CZ  1 
ATOM 2482  N N   . GLN A 1 341  ? 259.949 -3.057  29.699  1.00 41.67  ? 408  GLN A N   1 
ATOM 2483  C CA  . GLN A 1 341  ? 261.266 -2.457  29.814  1.00 41.67  ? 408  GLN A CA  1 
ATOM 2484  C C   . GLN A 1 341  ? 262.228 -2.737  30.950  1.00 41.67  ? 408  GLN A C   1 
ATOM 2485  O O   . GLN A 1 341  ? 263.329 -3.209  30.700  1.00 41.67  ? 408  GLN A O   1 
ATOM 2486  C CB  . GLN A 1 341  ? 261.169 -0.963  29.643  1.00 41.67  ? 408  GLN A CB  1 
ATOM 2487  C CG  . GLN A 1 341  ? 262.381 -0.480  28.937  1.00 41.67  ? 408  GLN A CG  1 
ATOM 2488  C CD  . GLN A 1 341  ? 262.086 0.702   28.067  1.00 41.67  ? 408  GLN A CD  1 
ATOM 2489  O OE1 . GLN A 1 341  ? 261.242 0.641   27.159  1.00 41.67  ? 408  GLN A OE1 1 
ATOM 2490  N NE2 . GLN A 1 341  ? 262.778 1.801   28.334  1.00 41.67  ? 408  GLN A NE2 1 
ATOM 2491  N N   . GLN A 1 342  ? 261.857 -2.419  32.185  1.00 41.67  ? 409  GLN A N   1 
ATOM 2492  C CA  . GLN A 1 342  ? 262.758 -2.676  33.305  1.00 41.67  ? 409  GLN A CA  1 
ATOM 2493  C C   . GLN A 1 342  ? 263.192 -4.157  33.355  1.00 41.67  ? 409  GLN A C   1 
ATOM 2494  O O   . GLN A 1 342  ? 264.209 -4.481  33.978  1.00 41.67  ? 409  GLN A O   1 
ATOM 2495  C CB  . GLN A 1 342  ? 262.098 -2.252  34.633  1.00 41.67  ? 409  GLN A CB  1 
ATOM 2496  C CG  . GLN A 1 342  ? 261.856 -0.726  34.804  1.00 41.67  ? 409  GLN A CG  1 
ATOM 2497  C CD  . GLN A 1 342  ? 261.803 -0.278  36.282  1.00 41.67  ? 409  GLN A CD  1 
ATOM 2498  O OE1 . GLN A 1 342  ? 260.944 -0.711  37.046  1.00 41.67  ? 409  GLN A OE1 1 
ATOM 2499  N NE2 . GLN A 1 342  ? 262.731 0.582   36.678  1.00 41.67  ? 409  GLN A NE2 1 
ATOM 2500  N N   . GLN A 1 343  ? 262.418 -5.026  32.678  1.00 41.67  ? 410  GLN A N   1 
ATOM 2501  C CA  . GLN A 1 343  ? 262.654 -6.484  32.582  1.00 41.67  ? 410  GLN A CA  1 
ATOM 2502  C C   . GLN A 1 343  ? 263.085 -6.922  31.167  1.00 41.67  ? 410  GLN A C   1 
ATOM 2503  O O   . GLN A 1 343  ? 263.619 -8.000  30.994  1.00 41.67  ? 410  GLN A O   1 
ATOM 2504  C CB  . GLN A 1 343  ? 261.387 -7.283  32.954  1.00 41.67  ? 410  GLN A CB  1 
ATOM 2505  C CG  . GLN A 1 343  ? 260.861 -7.093  34.368  1.00 41.67  ? 410  GLN A CG  1 
ATOM 2506  C CD  . GLN A 1 343  ? 261.294 -8.198  35.324  1.00 41.67  ? 410  GLN A CD  1 
ATOM 2507  O OE1 . GLN A 1 343  ? 262.468 -8.304  35.708  1.00 41.67  ? 410  GLN A OE1 1 
ATOM 2508  N NE2 . GLN A 1 343  ? 260.336 -9.036  35.711  1.00 41.67  ? 410  GLN A NE2 1 
ATOM 2509  N N   . LEU A 1 344  ? 262.852 -6.092  30.155  1.00 41.67  ? 411  LEU A N   1 
ATOM 2510  C CA  . LEU A 1 344  ? 263.219 -6.417  28.759  1.00 41.67  ? 411  LEU A CA  1 
ATOM 2511  C C   . LEU A 1 344  ? 264.698 -6.333  28.359  1.00 41.67  ? 411  LEU A C   1 
ATOM 2512  O O   . LEU A 1 344  ? 265.129 -6.984  27.418  1.00 41.67  ? 411  LEU A O   1 
ATOM 2513  C CB  . LEU A 1 344  ? 262.464 -5.505  27.798  1.00 41.67  ? 411  LEU A CB  1 
ATOM 2514  C CG  . LEU A 1 344  ? 262.749 -3.998  27.929  1.00 41.67  ? 411  LEU A CG  1 
ATOM 2515  C CD1 . LEU A 1 344  ? 264.169 -3.603  27.573  1.00 41.67  ? 411  LEU A CD1 1 
ATOM 2516  C CD2 . LEU A 1 344  ? 261.768 -3.275  27.043  1.00 41.67  ? 411  LEU A CD2 1 
ATOM 2517  N N   . PRO A 1 345  ? 265.487 -5.513  29.056  1.00 41.67  ? 412  PRO A N   1 
ATOM 2518  C CA  . PRO A 1 345  ? 266.904 -5.365  28.731  1.00 41.67  ? 412  PRO A CA  1 
ATOM 2519  C C   . PRO A 1 345  ? 267.727 -6.581  29.124  1.00 41.67  ? 412  PRO A C   1 
ATOM 2520  O O   . PRO A 1 345  ? 268.264 -7.292  28.282  1.00 41.67  ? 412  PRO A O   1 
ATOM 2521  C CB  . PRO A 1 345  ? 267.291 -4.146  29.549  1.00 41.67  ? 412  PRO A CB  1 
ATOM 2522  C CG  . PRO A 1 345  ? 266.536 -4.405  30.844  1.00 41.67  ? 412  PRO A CG  1 
ATOM 2523  C CD  . PRO A 1 345  ? 265.178 -4.853  30.340  1.00 41.67  ? 412  PRO A CD  1 
ATOM 2524  N N   . LEU A 1 346  ? 267.807 -6.775  30.434  1.00 41.67  ? 413  LEU A N   1 
ATOM 2525  C CA  . LEU A 1 346  ? 268.546 -7.828  31.103  1.00 41.67  ? 413  LEU A CA  1 
ATOM 2526  C C   . LEU A 1 346  ? 268.547 -9.192  30.433  1.00 41.67  ? 413  LEU A C   1 
ATOM 2527  O O   . LEU A 1 346  ? 269.594 -9.822  30.265  1.00 41.67  ? 413  LEU A O   1 
ATOM 2528  C CB  . LEU A 1 346  ? 267.988 -7.958  32.514  1.00 41.67  ? 413  LEU A CB  1 
ATOM 2529  C CG  . LEU A 1 346  ? 267.476 -6.646  33.132  1.00 41.67  ? 413  LEU A CG  1 
ATOM 2530  C CD1 . LEU A 1 346  ? 266.630 -6.972  34.345  1.00 41.67  ? 413  LEU A CD1 1 
ATOM 2531  C CD2 . LEU A 1 346  ? 268.636 -5.725  33.513  1.00 41.67  ? 413  LEU A CD2 1 
ATOM 2532  N N   . PHE A 1 347  ? 267.361 -9.667  30.086  1.00 41.67  ? 414  PHE A N   1 
ATOM 2533  C CA  . PHE A 1 347  ? 267.242 -10.963 29.445  1.00 41.67  ? 414  PHE A CA  1 
ATOM 2534  C C   . PHE A 1 347  ? 267.819 -10.794 28.014  1.00 41.67  ? 414  PHE A C   1 
ATOM 2535  O O   . PHE A 1 347  ? 268.402 -11.729 27.455  1.00 41.67  ? 414  PHE A O   1 
ATOM 2536  C CB  . PHE A 1 347  ? 265.756 -11.419 29.417  1.00 41.67  ? 414  PHE A CB  1 
ATOM 2537  C CG  . PHE A 1 347  ? 265.043 -11.392 30.780  1.00 41.67  ? 414  PHE A CG  1 
ATOM 2538  C CD1 . PHE A 1 347  ? 264.761 -12.569 31.488  1.00 41.67  ? 414  PHE A CD1 1 
ATOM 2539  C CD2 . PHE A 1 347  ? 264.608 -10.190 31.327  1.00 41.67  ? 414  PHE A CD2 1 
ATOM 2540  C CE1 . PHE A 1 347  ? 264.047 -12.521 32.726  1.00 41.67  ? 414  PHE A CE1 1 
ATOM 2541  C CE2 . PHE A 1 347  ? 263.897 -10.135 32.559  1.00 41.67  ? 414  PHE A CE2 1 
ATOM 2542  C CZ  . PHE A 1 347  ? 263.618 -11.292 33.251  1.00 41.67  ? 414  PHE A CZ  1 
ATOM 2543  N N   . LEU A 1 348  ? 267.664 -9.600  27.433  1.00 41.67  ? 415  LEU A N   1 
ATOM 2544  C CA  . LEU A 1 348  ? 268.167 -9.323  26.088  1.00 41.67  ? 415  LEU A CA  1 
ATOM 2545  C C   . LEU A 1 348  ? 269.653 -9.484  26.099  1.00 41.67  ? 415  LEU A C   1 
ATOM 2546  O O   . LEU A 1 348  ? 270.234 -10.205 25.295  1.00 41.67  ? 415  LEU A O   1 
ATOM 2547  C CB  . LEU A 1 348  ? 267.851 -7.895  25.678  1.00 41.67  ? 415  LEU A CB  1 
ATOM 2548  C CG  . LEU A 1 348  ? 266.591 -7.641  24.872  1.00 41.67  ? 415  LEU A CG  1 
ATOM 2549  C CD1 . LEU A 1 348  ? 265.487 -8.652  25.202  1.00 41.67  ? 415  LEU A CD1 1 
ATOM 2550  C CD2 . LEU A 1 348  ? 266.183 -6.199  25.144  1.00 41.67  ? 415  LEU A CD2 1 
ATOM 2551  N N   . GLU A 1 349  ? 270.278 -8.776  27.018  1.00 41.67  ? 416  GLU A N   1 
ATOM 2552  C CA  . GLU A 1 349  ? 271.709 -8.856  27.136  1.00 41.67  ? 416  GLU A CA  1 
ATOM 2553  C C   . GLU A 1 349  ? 271.985 -10.199 27.766  1.00 41.67  ? 416  GLU A C   1 
ATOM 2554  O O   . GLU A 1 349  ? 273.131 -10.494 28.098  1.00 41.67  ? 416  GLU A O   1 
ATOM 2555  C CB  . GLU A 1 349  ? 272.235 -7.765  28.044  1.00 41.67  ? 416  GLU A CB  1 
ATOM 2556  C CG  . GLU A 1 349  ? 271.316 -6.585  28.164  1.00 41.67  ? 416  GLU A CG  1 
ATOM 2557  C CD  . GLU A 1 349  ? 271.626 -5.751  29.396  1.00 41.67  ? 416  GLU A CD  1 
ATOM 2558  O OE1 . GLU A 1 349  ? 271.592 -6.318  30.533  1.00 41.67  ? 416  GLU A OE1 1 
ATOM 2559  O OE2 . GLU A 1 349  ? 271.902 -4.533  29.216  1.00 41.67  ? 416  GLU A OE2 1 
ATOM 2560  N N   . ARG A 1 350  ? 270.936 -10.999 27.979  1.00 41.67  ? 417  ARG A N   1 
ATOM 2561  C CA  . ARG A 1 350  ? 271.145 -12.331 28.539  1.00 41.67  ? 417  ARG A CA  1 
ATOM 2562  C C   . ARG A 1 350  ? 271.574 -13.114 27.300  1.00 41.67  ? 417  ARG A C   1 
ATOM 2563  O O   . ARG A 1 350  ? 271.986 -14.272 27.384  1.00 41.67  ? 417  ARG A O   1 
ATOM 2564  C CB  . ARG A 1 350  ? 269.868 -12.917 29.156  1.00 41.67  ? 417  ARG A CB  1 
ATOM 2565  C CG  . ARG A 1 350  ? 270.116 -13.962 30.231  1.00 41.67  ? 417  ARG A CG  1 
ATOM 2566  C CD  . ARG A 1 350  ? 270.824 -13.347 31.406  1.00 41.67  ? 417  ARG A CD  1 
ATOM 2567  N NE  . ARG A 1 350  ? 270.136 -13.536 32.682  1.00 41.67  ? 417  ARG A NE  1 
ATOM 2568  C CZ  . ARG A 1 350  ? 268.817 -13.500 32.854  1.00 41.67  ? 417  ARG A CZ  1 
ATOM 2569  N NH1 . ARG A 1 350  ? 268.009 -13.299 31.821  1.00 41.67  ? 417  ARG A NH1 1 
ATOM 2570  N NH2 . ARG A 1 350  ? 268.303 -13.628 34.073  1.00 41.67  ? 417  ARG A NH2 1 
ATOM 2571  N N   . CYS A 1 351  ? 271.496 -12.432 26.150  1.00 41.67  ? 418  CYS A N   1 
ATOM 2572  C CA  . CYS A 1 351  ? 271.915 -12.966 24.844  1.00 41.67  ? 418  CYS A CA  1 
ATOM 2573  C C   . CYS A 1 351  ? 272.878 -11.919 24.183  1.00 41.67  ? 418  CYS A C   1 
ATOM 2574  O O   . CYS A 1 351  ? 272.787 -11.618 22.987  1.00 41.67  ? 418  CYS A O   1 
ATOM 2575  C CB  . CYS A 1 351  ? 270.667 -13.227 23.994  1.00 41.67  ? 418  CYS A CB  1 
ATOM 2576  S SG  . CYS A 1 351  ? 269.414 -14.332 24.825  1.00 41.67  ? 418  CYS A SG  1 
ATOM 2577  N N   . PRO A 1 352  ? 273.841 -11.401 24.989  1.00 41.67  ? 419  PRO A N   1 
ATOM 2578  C CA  . PRO A 1 352  ? 274.958 -10.437 24.980  1.00 41.67  ? 419  PRO A CA  1 
ATOM 2579  C C   . PRO A 1 352  ? 275.800 -9.948  23.802  1.00 41.67  ? 419  PRO A C   1 
ATOM 2580  O O   . PRO A 1 352  ? 276.917 -10.418 23.614  1.00 41.67  ? 419  PRO A O   1 
ATOM 2581  C CB  . PRO A 1 352  ? 275.885 -10.976 26.089  1.00 41.67  ? 419  PRO A CB  1 
ATOM 2582  C CG  . PRO A 1 352  ? 275.580 -12.433 26.142  1.00 41.67  ? 419  PRO A CG  1 
ATOM 2583  C CD  . PRO A 1 352  ? 274.094 -12.372 26.078  1.00 41.67  ? 419  PRO A CD  1 
ATOM 2584  N N   . HIS A 1 353  ? 275.322 -8.988  23.025  1.00 59.70  ? 420  HIS A N   1 
ATOM 2585  C CA  . HIS A 1 353  ? 276.206 -8.481  21.987  1.00 57.96  ? 420  HIS A CA  1 
ATOM 2586  C C   . HIS A 1 353  ? 276.197 -6.972  21.957  1.00 56.49  ? 420  HIS A C   1 
ATOM 2587  O O   . HIS A 1 353  ? 275.251 -6.371  22.410  1.00 55.79  ? 420  HIS A O   1 
ATOM 2588  C CB  . HIS A 1 353  ? 275.875 -9.039  20.611  1.00 57.76  ? 420  HIS A CB  1 
ATOM 2589  C CG  . HIS A 1 353  ? 277.104 -9.359  19.828  1.00 57.07  ? 420  HIS A CG  1 
ATOM 2590  N ND1 . HIS A 1 353  ? 277.649 -8.502  18.897  1.00 55.12  ? 420  HIS A ND1 1 
ATOM 2591  C CD2 . HIS A 1 353  ? 277.978 -10.382 19.950  1.00 56.43  ? 420  HIS A CD2 1 
ATOM 2592  C CE1 . HIS A 1 353  ? 278.806 -8.987  18.480  1.00 56.17  ? 420  HIS A CE1 1 
ATOM 2593  N NE2 . HIS A 1 353  ? 279.028 -10.128 19.104  1.00 56.48  ? 420  HIS A NE2 1 
ATOM 2594  N N   . PRO A 1 354  ? 277.273 -6.333  21.471  1.00 54.76  ? 421  PRO A N   1 
ATOM 2595  C CA  . PRO A 1 354  ? 277.243 -4.872  21.446  1.00 53.15  ? 421  PRO A CA  1 
ATOM 2596  C C   . PRO A 1 354  ? 276.674 -4.468  20.115  1.00 51.71  ? 421  PRO A C   1 
ATOM 2597  O O   . PRO A 1 354  ? 275.852 -3.559  19.998  1.00 50.94  ? 421  PRO A O   1 
ATOM 2598  C CB  . PRO A 1 354  ? 278.712 -4.509  21.545  1.00 51.62  ? 421  PRO A CB  1 
ATOM 2599  C CG  . PRO A 1 354  ? 279.344 -5.557  20.694  1.00 52.11  ? 421  PRO A CG  1 
ATOM 2600  C CD  . PRO A 1 354  ? 278.623 -6.826  21.145  1.00 53.76  ? 421  PRO A CD  1 
ATOM 2601  N N   . VAL A 1 355  ? 277.124 -5.203  19.115  1.00 49.55  ? 422  VAL A N   1 
ATOM 2602  C CA  . VAL A 1 355  ? 276.756 -4.961  17.751  1.00 47.56  ? 422  VAL A CA  1 
ATOM 2603  C C   . VAL A 1 355  ? 275.308 -5.192  17.465  1.00 46.06  ? 422  VAL A C   1 
ATOM 2604  O O   . VAL A 1 355  ? 274.648 -4.298  16.949  1.00 43.70  ? 422  VAL A O   1 
ATOM 2605  C CB  . VAL A 1 355  ? 277.584 -5.824  16.816  1.00 47.41  ? 422  VAL A CB  1 
ATOM 2606  C CG1 . VAL A 1 355  ? 277.757 -5.120  15.476  1.00 46.68  ? 422  VAL A CG1 1 
ATOM 2607  C CG2 . VAL A 1 355  ? 278.930 -6.104  17.447  1.00 46.28  ? 422  VAL A CG2 1 
ATOM 2608  N N   . THR A 1 356  ? 274.803 -6.381  17.772  1.00 46.02  ? 423  THR A N   1 
ATOM 2609  C CA  . THR A 1 356  ? 273.394 -6.626  17.487  1.00 47.18  ? 423  THR A CA  1 
ATOM 2610  C C   . THR A 1 356  ? 272.614 -5.377  17.900  1.00 46.82  ? 423  THR A C   1 
ATOM 2611  O O   . THR A 1 356  ? 271.870 -4.798  17.104  1.00 46.24  ? 423  THR A O   1 
ATOM 2612  C CB  . THR A 1 356  ? 272.792 -7.856  18.276  1.00 47.64  ? 423  THR A CB  1 
ATOM 2613  O OG1 . THR A 1 356  ? 273.168 -9.096  17.659  1.00 48.25  ? 423  THR A OG1 1 
ATOM 2614  C CG2 . THR A 1 356  ? 271.269 -7.776  18.282  1.00 46.84  ? 423  THR A CG2 1 
ATOM 2615  N N   . LEU A 1 357  ? 272.849 -4.943  19.134  1.00 47.38  ? 424  LEU A N   1 
ATOM 2616  C CA  . LEU A 1 357  ? 272.154 -3.806  19.741  1.00 46.96  ? 424  LEU A CA  1 
ATOM 2617  C C   . LEU A 1 357  ? 272.319 -2.426  19.107  1.00 45.25  ? 424  LEU A C   1 
ATOM 2618  O O   . LEU A 1 357  ? 271.337 -1.694  18.924  1.00 45.41  ? 424  LEU A O   1 
ATOM 2619  C CB  . LEU A 1 357  ? 272.538 -3.751  21.214  1.00 49.15  ? 424  LEU A CB  1 
ATOM 2620  C CG  . LEU A 1 357  ? 273.156 -5.060  21.746  1.00 51.65  ? 424  LEU A CG  1 
ATOM 2621  C CD1 . LEU A 1 357  ? 273.214 -4.958  23.270  1.00 52.25  ? 424  LEU A CD1 1 
ATOM 2622  C CD2 . LEU A 1 357  ? 272.362 -6.321  21.328  1.00 50.84  ? 424  LEU A CD2 1 
ATOM 2623  N N   . ALA A 1 358  ? 273.560 -2.068  18.796  1.00 42.50  ? 425  ALA A N   1 
ATOM 2624  C CA  . ALA A 1 358  ? 273.836 -0.784  18.170  1.00 40.91  ? 425  ALA A CA  1 
ATOM 2625  C C   . ALA A 1 358  ? 273.278 -0.769  16.729  1.00 39.08  ? 425  ALA A C   1 
ATOM 2626  O O   . ALA A 1 358  ? 272.683 0.230   16.289  1.00 39.04  ? 425  ALA A O   1 
ATOM 2627  C CB  . ALA A 1 358  ? 275.336 -0.528  18.172  1.00 39.89  ? 425  ALA A CB  1 
ATOM 2628  N N   . GLY A 1 359  ? 273.468 -1.877  16.004  1.00 36.67  ? 426  GLY A N   1 
ATOM 2629  C CA  . GLY A 1 359  ? 272.976 -1.977  14.640  1.00 32.89  ? 426  GLY A CA  1 
ATOM 2630  C C   . GLY A 1 359  ? 271.481 -1.749  14.581  1.00 30.06  ? 426  GLY A C   1 
ATOM 2631  O O   . GLY A 1 359  ? 271.007 -1.138  13.627  1.00 28.95  ? 426  GLY A O   1 
ATOM 2632  N N   . MET A 1 360  ? 270.741 -2.228  15.592  1.00 25.46  ? 427  MET A N   1 
ATOM 2633  C CA  . MET A 1 360  ? 269.288 -2.053  15.608  1.00 27.73  ? 427  MET A CA  1 
ATOM 2634  C C   . MET A 1 360  ? 268.890 -0.676  16.045  1.00 25.30  ? 427  MET A C   1 
ATOM 2635  O O   . MET A 1 360  ? 267.784 -0.220  15.761  1.00 25.33  ? 427  MET A O   1 
ATOM 2636  C CB  . MET A 1 360  ? 268.568 -3.087  16.484  1.00 28.03  ? 427  MET A CB  1 
ATOM 2637  C CG  . MET A 1 360  ? 269.224 -3.496  17.745  1.00 28.11  ? 427  MET A CG  1 
ATOM 2638  S SD  . MET A 1 360  ? 268.399 -5.034  18.084  1.00 31.77  ? 427  MET A SD  1 
ATOM 2639  C CE  . MET A 1 360  ? 266.967 -4.515  18.784  1.00 27.28  ? 427  MET A CE  1 
ATOM 2640  N N   . LEU A 1 361  ? 269.795 -0.006  16.737  1.00 33.06  ? 428  LEU A N   1 
ATOM 2641  C CA  . LEU A 1 361  ? 269.525 1.343   17.187  1.00 40.59  ? 428  LEU A CA  1 
ATOM 2642  C C   . LEU A 1 361  ? 269.311 2.249   15.992  1.00 44.67  ? 428  LEU A C   1 
ATOM 2643  O O   . LEU A 1 361  ? 268.401 3.076   16.005  1.00 44.15  ? 428  LEU A O   1 
ATOM 2644  C CB  . LEU A 1 361  ? 270.686 1.847   18.037  1.00 40.10  ? 428  LEU A CB  1 
ATOM 2645  C CG  . LEU A 1 361  ? 270.602 1.537   19.528  1.00 38.69  ? 428  LEU A CG  1 
ATOM 2646  C CD1 . LEU A 1 361  ? 271.963 1.254   20.098  1.00 38.87  ? 428  LEU A CD1 1 
ATOM 2647  C CD2 . LEU A 1 361  ? 269.983 2.711   20.204  1.00 36.97  ? 428  LEU A CD2 1 
ATOM 2648  N N   . GLU A 1 362  ? 270.144 2.086   14.966  1.00 50.30  ? 429  GLU A N   1 
ATOM 2649  C CA  . GLU A 1 362  ? 270.021 2.903   13.768  1.00 56.19  ? 429  GLU A CA  1 
ATOM 2650  C C   . GLU A 1 362  ? 268.973 2.359   12.808  1.00 57.71  ? 429  GLU A C   1 
ATOM 2651  O O   . GLU A 1 362  ? 268.369 3.112   12.052  1.00 56.55  ? 429  GLU A O   1 
ATOM 2652  C CB  . GLU A 1 362  ? 271.367 3.042   13.047  1.00 59.25  ? 429  GLU A CB  1 
ATOM 2653  C CG  . GLU A 1 362  ? 271.880 4.481   13.029  1.00 66.25  ? 429  GLU A CG  1 
ATOM 2654  C CD  . GLU A 1 362  ? 272.996 4.710   14.020  1.00 70.06  ? 429  GLU A CD  1 
ATOM 2655  O OE1 . GLU A 1 362  ? 273.128 3.927   14.978  1.00 74.95  ? 429  GLU A OE1 1 
ATOM 2656  O OE2 . GLU A 1 362  ? 273.747 5.680   13.847  1.00 71.37  ? 429  GLU A OE2 1 
ATOM 2657  N N   . MET A 1 363  ? 268.750 1.051   12.833  1.00 59.80  ? 430  MET A N   1 
ATOM 2658  C CA  . MET A 1 363  ? 267.744 0.464   11.955  1.00 62.20  ? 430  MET A CA  1 
ATOM 2659  C C   . MET A 1 363  ? 266.450 1.233   12.179  1.00 62.35  ? 430  MET A C   1 
ATOM 2660  O O   . MET A 1 363  ? 265.828 1.703   11.234  1.00 64.02  ? 430  MET A O   1 
ATOM 2661  C CB  . MET A 1 363  ? 267.535 -1.026  12.268  1.00 65.92  ? 430  MET A CB  1 
ATOM 2662  C CG  . MET A 1 363  ? 266.510 -1.717  11.374  1.00 70.57  ? 430  MET A CG  1 
ATOM 2663  S SD  . MET A 1 363  ? 267.074 -3.302  10.685  1.00 74.07  ? 430  MET A SD  1 
ATOM 2664  C CE  . MET A 1 363  ? 265.866 -4.455  11.345  1.00 76.03  ? 430  MET A CE  1 
ATOM 2665  N N   . GLY A 1 364  ? 266.071 1.381   13.444  1.00 62.25  ? 431  GLY A N   1 
ATOM 2666  C CA  . GLY A 1 364  ? 264.852 2.095   13.793  1.00 60.40  ? 431  GLY A CA  1 
ATOM 2667  C C   . GLY A 1 364  ? 264.741 3.517   13.259  1.00 59.96  ? 431  GLY A C   1 
ATOM 2668  O O   . GLY A 1 364  ? 263.674 3.931   12.800  1.00 61.06  ? 431  GLY A O   1 
ATOM 2669  N N   . VAL A 1 365  ? 265.839 4.270   13.321  1.00 57.99  ? 432  VAL A N   1 
ATOM 2670  C CA  . VAL A 1 365  ? 265.880 5.664   12.851  1.00 55.01  ? 432  VAL A CA  1 
ATOM 2671  C C   . VAL A 1 365  ? 266.077 5.725   11.352  1.00 55.27  ? 432  VAL A C   1 
ATOM 2672  O O   . VAL A 1 365  ? 266.977 6.416   10.865  1.00 55.19  ? 432  VAL A O   1 
ATOM 2673  C CB  . VAL A 1 365  ? 267.064 6.459   13.469  1.00 52.73  ? 432  VAL A CB  1 
ATOM 2674  C CG1 . VAL A 1 365  ? 266.994 7.916   13.018  1.00 50.78  ? 432  VAL A CG1 1 
ATOM 2675  C CG2 . VAL A 1 365  ? 267.070 6.333   15.004  1.00 53.80  ? 432  VAL A CG2 1 
ATOM 2676  N N   . SER A 1 366  ? 265.239 5.012   10.617  1.00 55.87  ? 433  SER A N   1 
ATOM 2677  C CA  . SER A 1 366  ? 265.387 4.996   9.180   1.00 56.68  ? 433  SER A CA  1 
ATOM 2678  C C   . SER A 1 366  ? 264.738 6.206   8.547   1.00 57.98  ? 433  SER A C   1 
ATOM 2679  O O   . SER A 1 366  ? 264.106 7.017   9.219   1.00 57.74  ? 433  SER A O   1 
ATOM 2680  C CB  . SER A 1 366  ? 264.792 3.720   8.603   1.00 56.58  ? 433  SER A CB  1 
ATOM 2681  O OG  . SER A 1 366  ? 263.392 3.739   8.704   1.00 55.36  ? 433  SER A OG  1 
ATOM 2682  N N   . TYR A 1 367  ? 264.897 6.314   7.238   1.00 59.20  ? 434  TYR A N   1 
ATOM 2683  C CA  . TYR A 1 367  ? 264.349 7.429   6.504   1.00 60.47  ? 434  TYR A CA  1 
ATOM 2684  C C   . TYR A 1 367  ? 263.884 7.063   5.102   1.00 60.24  ? 434  TYR A C   1 
ATOM 2685  O O   . TYR A 1 367  ? 264.275 6.039   4.539   1.00 58.76  ? 434  TYR A O   1 
ATOM 2686  C CB  . TYR A 1 367  ? 265.394 8.520   6.405   1.00 63.33  ? 434  TYR A CB  1 
ATOM 2687  C CG  . TYR A 1 367  ? 265.485 9.396   7.611   1.00 67.91  ? 434  TYR A CG  1 
ATOM 2688  C CD1 . TYR A 1 367  ? 264.693 10.529  7.722   1.00 70.96  ? 434  TYR A CD1 1 
ATOM 2689  C CD2 . TYR A 1 367  ? 266.401 9.121   8.619   1.00 70.25  ? 434  TYR A CD2 1 
ATOM 2690  C CE1 . TYR A 1 367  ? 264.819 11.376  8.805   1.00 73.57  ? 434  TYR A CE1 1 
ATOM 2691  C CE2 . TYR A 1 367  ? 266.537 9.957   9.711   1.00 74.29  ? 434  TYR A CE2 1 
ATOM 2692  C CZ  . TYR A 1 367  ? 265.751 11.086  9.805   1.00 74.92  ? 434  TYR A CZ  1 
ATOM 2693  O OH  . TYR A 1 367  ? 265.922 11.918  10.898  1.00 76.15  ? 434  TYR A OH  1 
ATOM 2694  N N   . LEU A 1 368  ? 263.048 7.935   4.543   1.00 60.88  ? 435  LEU A N   1 
ATOM 2695  C CA  . LEU A 1 368  ? 262.493 7.772   3.202   1.00 60.24  ? 435  LEU A CA  1 
ATOM 2696  C C   . LEU A 1 368  ? 262.009 9.135   2.681   1.00 59.82  ? 435  LEU A C   1 
ATOM 2697  O O   . LEU A 1 368  ? 260.996 9.663   3.151   1.00 58.42  ? 435  LEU A O   1 
ATOM 2698  C CB  . LEU A 1 368  ? 261.359 6.741   3.243   1.00 59.49  ? 435  LEU A CB  1 
ATOM 2699  C CG  . LEU A 1 368  ? 261.941 5.352   3.564   1.00 58.18  ? 435  LEU A CG  1 
ATOM 2700  C CD1 . LEU A 1 368  ? 261.030 4.556   4.423   1.00 57.68  ? 435  LEU A CD1 1 
ATOM 2701  C CD2 . LEU A 1 368  ? 262.239 4.621   2.290   1.00 58.71  ? 435  LEU A CD2 1 
ATOM 2702  N N   . PRO A 1 369  ? 262.768 9.725   1.723   1.00 59.97  ? 436  PRO A N   1 
ATOM 2703  C CA  . PRO A 1 369  ? 262.693 10.983  0.964   1.00 59.50  ? 436  PRO A CA  1 
ATOM 2704  C C   . PRO A 1 369  ? 261.356 11.572  0.536   1.00 58.46  ? 436  PRO A C   1 
ATOM 2705  O O   . PRO A 1 369  ? 260.798 12.435  1.221   1.00 56.77  ? 436  PRO A O   1 
ATOM 2706  C CB  . PRO A 1 369  ? 263.564 10.686  -0.233  1.00 60.01  ? 436  PRO A CB  1 
ATOM 2707  C CG  . PRO A 1 369  ? 264.678 10.005  0.387   1.00 60.57  ? 436  PRO A CG  1 
ATOM 2708  C CD  . PRO A 1 369  ? 264.006 9.018   1.339   1.00 60.10  ? 436  PRO A CD  1 
ATOM 2709  N N   . VAL A 1 370  ? 260.886 11.141  -0.631  1.00 58.70  ? 437  VAL A N   1 
ATOM 2710  C CA  . VAL A 1 370  ? 259.617 11.592  -1.194  1.00 58.99  ? 437  VAL A CA  1 
ATOM 2711  C C   . VAL A 1 370  ? 259.621 13.037  -1.659  1.00 57.81  ? 437  VAL A C   1 
ATOM 2712  O O   . VAL A 1 370  ? 260.417 13.852  -1.190  1.00 58.33  ? 437  VAL A O   1 
ATOM 2713  C CB  . VAL A 1 370  ? 258.459 11.422  -0.194  1.00 59.78  ? 437  VAL A CB  1 
ATOM 2714  C CG1 . VAL A 1 370  ? 257.183 12.022  -0.761  1.00 61.62  ? 437  VAL A CG1 1 
ATOM 2715  C CG2 . VAL A 1 370  ? 258.249 9.953   0.105   1.00 60.70  ? 437  VAL A CG2 1 
ATOM 2716  N N   . ASN A 1 371  ? 258.717 13.328  -2.593  1.00 56.35  ? 438  ASN A N   1 
ATOM 2717  C CA  . ASN A 1 371  ? 258.550 14.651  -3.161  1.00 53.61  ? 438  ASN A CA  1 
ATOM 2718  C C   . ASN A 1 371  ? 257.103 14.904  -3.503  1.00 50.15  ? 438  ASN A C   1 
ATOM 2719  O O   . ASN A 1 371  ? 256.213 14.098  -3.239  1.00 49.04  ? 438  ASN A O   1 
ATOM 2720  C CB  . ASN A 1 371  ? 259.393 14.803  -4.424  1.00 56.58  ? 438  ASN A CB  1 
ATOM 2721  C CG  . ASN A 1 371  ? 260.684 15.546  -4.166  1.00 59.81  ? 438  ASN A CG  1 
ATOM 2722  O OD1 . ASN A 1 371  ? 261.350 15.324  -3.157  1.00 62.28  ? 438  ASN A OD1 1 
ATOM 2723  N ND2 . ASN A 1 371  ? 261.049 16.429  -5.083  1.00 60.58  ? 438  ASN A ND2 1 
ATOM 2724  N N   . GLN A 1 372  ? 256.883 16.058  -4.094  1.00 46.15  ? 439  GLN A N   1 
ATOM 2725  C CA  . GLN A 1 372  ? 255.566 16.460  -4.510  1.00 42.11  ? 439  GLN A CA  1 
ATOM 2726  C C   . GLN A 1 372  ? 254.910 15.251  -5.101  1.00 41.82  ? 439  GLN A C   1 
ATOM 2727  O O   . GLN A 1 372  ? 253.716 15.036  -4.994  1.00 41.24  ? 439  GLN A O   1 
ATOM 2728  C CB  . GLN A 1 372  ? 255.710 17.502  -5.592  1.00 39.72  ? 439  GLN A CB  1 
ATOM 2729  C CG  . GLN A 1 372  ? 256.764 18.498  -5.249  1.00 35.96  ? 439  GLN A CG  1 
ATOM 2730  C CD  . GLN A 1 372  ? 257.954 18.468  -6.150  1.00 31.81  ? 439  GLN A CD  1 
ATOM 2731  O OE1 . GLN A 1 372  ? 258.010 17.686  -7.100  1.00 29.54  ? 439  GLN A OE1 1 
ATOM 2732  N NE2 . GLN A 1 372  ? 258.929 19.327  -5.866  1.00 30.76  ? 439  GLN A NE2 1 
ATOM 2733  N N   . ASN A 1 373  ? 255.742 14.439  -5.711  1.00 41.50  ? 440  ASN A N   1 
ATOM 2734  C CA  . ASN A 1 373  ? 255.274 13.281  -6.412  1.00 41.50  ? 440  ASN A CA  1 
ATOM 2735  C C   . ASN A 1 373  ? 254.594 12.115  -5.738  1.00 43.35  ? 440  ASN A C   1 
ATOM 2736  O O   . ASN A 1 373  ? 253.743 11.489  -6.361  1.00 41.19  ? 440  ASN A O   1 
ATOM 2737  C CB  . ASN A 1 373  ? 256.411 12.745  -7.262  1.00 40.11  ? 440  ASN A CB  1 
ATOM 2738  C CG  . ASN A 1 373  ? 256.895 13.747  -8.262  1.00 39.70  ? 440  ASN A CG  1 
ATOM 2739  O OD1 . ASN A 1 373  ? 256.111 14.319  -9.014  1.00 37.83  ? 440  ASN A OD1 1 
ATOM 2740  N ND2 . ASN A 1 373  ? 258.193 13.970  -8.282  1.00 41.56  ? 440  ASN A ND2 1 
ATOM 2741  N N   . TRP A 1 374  ? 254.902 11.785  -4.495  1.00 46.51  ? 441  TRP A N   1 
ATOM 2742  C CA  . TRP A 1 374  ? 254.227 10.597  -4.035  1.00 51.60  ? 441  TRP A CA  1 
ATOM 2743  C C   . TRP A 1 374  ? 252.755 10.597  -4.280  1.00 54.11  ? 441  TRP A C   1 
ATOM 2744  O O   . TRP A 1 374  ? 252.266 9.739   -5.000  1.00 55.87  ? 441  TRP A O   1 
ATOM 2745  C CB  . TRP A 1 374  ? 254.555 10.235  -2.594  1.00 53.01  ? 441  TRP A CB  1 
ATOM 2746  C CG  . TRP A 1 374  ? 255.327 8.985   -2.685  1.00 57.33  ? 441  TRP A CG  1 
ATOM 2747  C CD1 . TRP A 1 374  ? 256.542 8.838   -3.305  1.00 58.53  ? 441  TRP A CD1 1 
ATOM 2748  C CD2 . TRP A 1 374  ? 254.858 7.662   -2.426  1.00 59.55  ? 441  TRP A CD2 1 
ATOM 2749  N NE1 . TRP A 1 374  ? 256.843 7.513   -3.471  1.00 57.89  ? 441  TRP A NE1 1 
ATOM 2750  C CE2 . TRP A 1 374  ? 255.828 6.766   -2.939  1.00 59.67  ? 441  TRP A CE2 1 
ATOM 2751  C CE3 . TRP A 1 374  ? 253.715 7.144   -1.824  1.00 62.58  ? 441  TRP A CE3 1 
ATOM 2752  C CZ2 . TRP A 1 374  ? 255.684 5.392   -2.865  1.00 60.91  ? 441  TRP A CZ2 1 
ATOM 2753  C CZ3 . TRP A 1 374  ? 253.575 5.779   -1.754  1.00 64.80  ? 441  TRP A CZ3 1 
ATOM 2754  C CH2 . TRP A 1 374  ? 254.552 4.915   -2.274  1.00 63.15  ? 441  TRP A CH2 1 
ATOM 2755  N N   . GLU A 1 375  ? 252.047 11.578  -3.741  1.00 56.82  ? 442  GLU A N   1 
ATOM 2756  C CA  . GLU A 1 375  ? 250.597 11.647  -3.933  1.00 57.85  ? 442  GLU A CA  1 
ATOM 2757  C C   . GLU A 1 375  ? 250.193 11.587  -5.383  1.00 59.00  ? 442  GLU A C   1 
ATOM 2758  O O   . GLU A 1 375  ? 249.155 11.014  -5.704  1.00 57.64  ? 442  GLU A O   1 
ATOM 2759  C CB  . GLU A 1 375  ? 249.997 12.926  -3.333  1.00 57.46  ? 442  GLU A CB  1 
ATOM 2760  C CG  . GLU A 1 375  ? 249.645 12.835  -1.854  1.00 59.77  ? 442  GLU A CG  1 
ATOM 2761  C CD  . GLU A 1 375  ? 250.856 12.975  -0.950  1.00 61.75  ? 442  GLU A CD  1 
ATOM 2762  O OE1 . GLU A 1 375  ? 251.003 14.045  -0.327  1.00 62.71  ? 442  GLU A OE1 1 
ATOM 2763  O OE2 . GLU A 1 375  ? 251.661 12.021  -0.865  1.00 62.56  ? 442  GLU A OE2 1 
ATOM 2764  N N   . ARG A 1 376  ? 250.993 12.203  -6.249  1.00 61.36  ? 443  ARG A N   1 
ATOM 2765  C CA  . ARG A 1 376  ? 250.677 12.195  -7.666  1.00 65.01  ? 443  ARG A CA  1 
ATOM 2766  C C   . ARG A 1 376  ? 251.082 10.878  -8.297  1.00 64.93  ? 443  ARG A C   1 
ATOM 2767  O O   . ARG A 1 376  ? 250.332 10.298  -9.079  1.00 64.75  ? 443  ARG A O   1 
ATOM 2768  C CB  . ARG A 1 376  ? 251.361 13.340  -8.417  1.00 69.02  ? 443  ARG A CB  1 
ATOM 2769  C CG  . ARG A 1 376  ? 250.955 13.356  -9.899  1.00 72.66  ? 443  ARG A CG  1 
ATOM 2770  C CD  . ARG A 1 376  ? 249.442 13.612  -10.081 1.00 77.59  ? 443  ARG A CD  1 
ATOM 2771  N NE  . ARG A 1 376  ? 249.184 15.026  -10.338 1.00 81.49  ? 443  ARG A NE  1 
ATOM 2772  C CZ  . ARG A 1 376  ? 249.528 15.647  -11.466 1.00 84.85  ? 443  ARG A CZ  1 
ATOM 2773  N NH1 . ARG A 1 376  ? 250.127 14.966  -12.437 1.00 86.76  ? 443  ARG A NH1 1 
ATOM 2774  N NH2 . ARG A 1 376  ? 249.321 16.956  -11.612 1.00 85.51  ? 443  ARG A NH2 1 
ATOM 2775  N N   . TYR A 1 377  ? 252.273 10.404  -7.972  1.00 65.19  ? 444  TYR A N   1 
ATOM 2776  C CA  . TYR A 1 377  ? 252.706 9.146   -8.519  1.00 63.79  ? 444  TYR A CA  1 
ATOM 2777  C C   . TYR A 1 377  ? 251.671 8.119   -8.064  1.00 60.86  ? 444  TYR A C   1 
ATOM 2778  O O   . TYR A 1 377  ? 251.330 7.183   -8.781  1.00 60.29  ? 444  TYR A O   1 
ATOM 2779  C CB  . TYR A 1 377  ? 254.080 8.800   -7.975  1.00 68.51  ? 444  TYR A CB  1 
ATOM 2780  C CG  . TYR A 1 377  ? 254.610 7.551   -8.581  1.00 73.47  ? 444  TYR A CG  1 
ATOM 2781  C CD1 . TYR A 1 377  ? 255.112 7.545   -9.873  1.00 75.45  ? 444  TYR A CD1 1 
ATOM 2782  C CD2 . TYR A 1 377  ? 254.495 6.346   -7.914  1.00 74.75  ? 444  TYR A CD2 1 
ATOM 2783  C CE1 . TYR A 1 377  ? 255.473 6.356   -10.484 1.00 76.63  ? 444  TYR A CE1 1 
ATOM 2784  C CE2 . TYR A 1 377  ? 254.849 5.152   -8.511  1.00 76.04  ? 444  TYR A CE2 1 
ATOM 2785  C CZ  . TYR A 1 377  ? 255.337 5.151   -9.796  1.00 76.50  ? 444  TYR A CZ  1 
ATOM 2786  O OH  . TYR A 1 377  ? 255.678 3.942   -10.373 1.00 76.73  ? 444  TYR A OH  1 
ATOM 2787  N N   . LEU A 1 378  ? 251.150 8.344   -6.863  1.00 58.12  ? 445  LEU A N   1 
ATOM 2788  C CA  . LEU A 1 378  ? 250.147 7.482   -6.238  1.00 55.09  ? 445  LEU A CA  1 
ATOM 2789  C C   . LEU A 1 378  ? 248.728 7.683   -6.772  1.00 54.47  ? 445  LEU A C   1 
ATOM 2790  O O   . LEU A 1 378  ? 247.951 6.735   -6.823  1.00 52.41  ? 445  LEU A O   1 
ATOM 2791  C CB  . LEU A 1 378  ? 250.137 7.730   -4.734  1.00 54.45  ? 445  LEU A CB  1 
ATOM 2792  C CG  . LEU A 1 378  ? 249.884 6.550   -3.796  1.00 54.14  ? 445  LEU A CG  1 
ATOM 2793  C CD1 . LEU A 1 378  ? 250.975 6.530   -2.768  1.00 52.51  ? 445  LEU A CD1 1 
ATOM 2794  C CD2 . LEU A 1 378  ? 248.541 6.662   -3.114  1.00 53.76  ? 445  LEU A CD2 1 
ATOM 2795  N N   . ALA A 1 379  ? 248.395 8.925   -7.137  1.00 56.24  ? 446  ALA A N   1 
ATOM 2796  C CA  . ALA A 1 379  ? 247.075 9.292   -7.674  1.00 58.33  ? 446  ALA A CA  1 
ATOM 2797  C C   . ALA A 1 379  ? 246.900 8.881   -9.143  1.00 59.74  ? 446  ALA A C   1 
ATOM 2798  O O   . ALA A 1 379  ? 245.812 8.491   -9.550  1.00 59.05  ? 446  ALA A O   1 
ATOM 2799  C CB  . ALA A 1 379  ? 246.845 10.795  -7.513  1.00 58.52  ? 446  ALA A CB  1 
ATOM 2800  N N   . GLU A 1 380  ? 247.957 8.993   -9.940  1.00 63.48  ? 447  GLU A N   1 
ATOM 2801  C CA  . GLU A 1 380  ? 247.899 8.564   -11.330 1.00 68.22  ? 447  GLU A CA  1 
ATOM 2802  C C   . GLU A 1 380  ? 247.742 7.056   -11.155 1.00 68.43  ? 447  GLU A C   1 
ATOM 2803  O O   . GLU A 1 380  ? 247.037 6.369   -11.897 1.00 70.14  ? 447  GLU A O   1 
ATOM 2804  C CB  . GLU A 1 380  ? 249.228 8.865   -12.028 1.00 73.25  ? 447  GLU A CB  1 
ATOM 2805  C CG  . GLU A 1 380  ? 249.699 10.312  -11.906 1.00 79.80  ? 447  GLU A CG  1 
ATOM 2806  C CD  . GLU A 1 380  ? 251.109 10.553  -12.461 1.00 82.95  ? 447  GLU A CD  1 
ATOM 2807  O OE1 . GLU A 1 380  ? 251.622 11.687  -12.309 1.00 86.09  ? 447  GLU A OE1 1 
ATOM 2808  O OE2 . GLU A 1 380  ? 251.704 9.619   -13.049 1.00 82.54  ? 447  GLU A OE2 1 
ATOM 2809  N N   . ALA A 1 381  ? 248.428 6.573   -10.128 1.00 67.27  ? 448  ALA A N   1 
ATOM 2810  C CA  . ALA A 1 381  ? 248.442 5.179   -9.736  1.00 65.04  ? 448  ALA A CA  1 
ATOM 2811  C C   . ALA A 1 381  ? 247.017 4.655   -9.492  1.00 64.40  ? 448  ALA A C   1 
ATOM 2812  O O   . ALA A 1 381  ? 246.653 3.557   -9.930  1.00 65.04  ? 448  ALA A O   1 
ATOM 2813  C CB  . ALA A 1 381  ? 249.292 5.037   -8.465  1.00 64.70  ? 448  ALA A CB  1 
ATOM 2814  N N   . GLN A 1 382  ? 246.223 5.469   -8.795  1.00 62.51  ? 449  GLN A N   1 
ATOM 2815  C CA  . GLN A 1 382  ? 244.830 5.168   -8.442  1.00 61.26  ? 449  GLN A CA  1 
ATOM 2816  C C   . GLN A 1 382  ? 243.868 5.207   -9.631  1.00 60.48  ? 449  GLN A C   1 
ATOM 2817  O O   . GLN A 1 382  ? 242.904 4.440   -9.697  1.00 60.84  ? 449  GLN A O   1 
ATOM 2818  C CB  . GLN A 1 382  ? 244.332 6.157   -7.366  1.00 62.84  ? 449  GLN A CB  1 
ATOM 2819  C CG  . GLN A 1 382  ? 245.119 6.130   -6.041  1.00 63.02  ? 449  GLN A CG  1 
ATOM 2820  C CD  . GLN A 1 382  ? 244.572 7.094   -4.969  1.00 63.22  ? 449  GLN A CD  1 
ATOM 2821  O OE1 . GLN A 1 382  ? 243.408 7.011   -4.564  1.00 64.26  ? 449  GLN A OE1 1 
ATOM 2822  N NE2 . GLN A 1 382  ? 245.427 8.001   -4.499  1.00 61.88  ? 449  GLN A NE2 1 
ATOM 2823  N N   . GLY A 1 383  ? 244.136 6.106   -10.569 1.00 60.07  ? 450  GLY A N   1 
ATOM 2824  C CA  . GLY A 1 383  ? 243.270 6.247   -11.726 1.00 62.07  ? 450  GLY A CA  1 
ATOM 2825  C C   . GLY A 1 383  ? 243.119 5.012   -12.592 1.00 63.20  ? 450  GLY A C   1 
ATOM 2826  O O   . GLY A 1 383  ? 242.048 4.757   -13.158 1.00 63.50  ? 450  GLY A O   1 
ATOM 2827  N N   . THR A 1 384  ? 244.188 4.230   -12.668 1.00 63.76  ? 451  THR A N   1 
ATOM 2828  C CA  . THR A 1 384  ? 244.223 3.031   -13.494 1.00 63.55  ? 451  THR A CA  1 
ATOM 2829  C C   . THR A 1 384  ? 243.482 1.811   -13.009 1.00 64.73  ? 451  THR A C   1 
ATOM 2830  O O   . THR A 1 384  ? 242.780 1.165   -13.788 1.00 61.88  ? 451  THR A O   1 
ATOM 2831  C CB  . THR A 1 384  ? 245.634 2.648   -13.723 1.00 61.99  ? 451  THR A CB  1 
ATOM 2832  O OG1 . THR A 1 384  ? 246.403 3.829   -13.568 1.00 60.11  ? 451  THR A OG1 1 
ATOM 2833  C CG2 . THR A 1 384  ? 245.827 2.102   -15.117 1.00 61.26  ? 451  THR A CG2 1 
ATOM 2834  N N   . TYR A 1 385  ? 243.649 1.461   -11.740 1.00 69.03  ? 452  TYR A N   1 
ATOM 2835  C CA  . TYR A 1 385  ? 242.959 0.284   -11.252 1.00 73.83  ? 452  TYR A CA  1 
ATOM 2836  C C   . TYR A 1 385  ? 241.502 0.403   -11.628 1.00 73.92  ? 452  TYR A C   1 
ATOM 2837  O O   . TYR A 1 385  ? 240.858 -0.569  -12.015 1.00 73.61  ? 452  TYR A O   1 
ATOM 2838  C CB  . TYR A 1 385  ? 243.123 0.127   -9.737  1.00 79.06  ? 452  TYR A CB  1 
ATOM 2839  C CG  . TYR A 1 385  ? 242.656 1.290   -8.869  1.00 87.10  ? 452  TYR A CG  1 
ATOM 2840  C CD1 . TYR A 1 385  ? 243.579 2.060   -8.140  1.00 91.05  ? 452  TYR A CD1 1 
ATOM 2841  C CD2 . TYR A 1 385  ? 241.293 1.562   -8.689  1.00 89.81  ? 452  TYR A CD2 1 
ATOM 2842  C CE1 . TYR A 1 385  ? 243.156 3.054   -7.248  1.00 94.38  ? 452  TYR A CE1 1 
ATOM 2843  C CE2 . TYR A 1 385  ? 240.865 2.565   -7.799  1.00 94.74  ? 452  TYR A CE2 1 
ATOM 2844  C CZ  . TYR A 1 385  ? 241.807 3.300   -7.083  1.00 96.11  ? 452  TYR A CZ  1 
ATOM 2845  O OH  . TYR A 1 385  ? 241.409 4.266   -6.191  1.00 98.87  ? 452  TYR A OH  1 
ATOM 2846  N N   . GLU A 1 386  ? 240.993 1.620   -11.547 1.00 73.60  ? 453  GLU A N   1 
ATOM 2847  C CA  . GLU A 1 386  ? 239.616 1.854   -11.886 1.00 73.51  ? 453  GLU A CA  1 
ATOM 2848  C C   . GLU A 1 386  ? 239.445 1.530   -13.344 1.00 73.54  ? 453  GLU A C   1 
ATOM 2849  O O   . GLU A 1 386  ? 238.823 0.529   -13.688 1.00 74.02  ? 453  GLU A O   1 
ATOM 2850  C CB  . GLU A 1 386  ? 239.266 3.300   -11.654 1.00 73.15  ? 453  GLU A CB  1 
ATOM 2851  C CG  . GLU A 1 386  ? 240.134 3.946   -10.651 1.00 72.96  ? 453  GLU A CG  1 
ATOM 2852  C CD  . GLU A 1 386  ? 239.338 4.781   -9.714  1.00 72.72  ? 453  GLU A CD  1 
ATOM 2853  O OE1 . GLU A 1 386  ? 239.911 5.720   -9.138  1.00 72.58  ? 453  GLU A OE1 1 
ATOM 2854  O OE2 . GLU A 1 386  ? 238.135 4.494   -9.546  1.00 71.80  ? 453  GLU A OE2 1 
ATOM 2855  N N   . GLU A 1 387  ? 240.001 2.374   -14.202 1.00 73.35  ? 454  GLU A N   1 
ATOM 2856  C CA  . GLU A 1 387  ? 239.874 2.139   -15.622 1.00 72.52  ? 454  GLU A CA  1 
ATOM 2857  C C   . GLU A 1 387  ? 239.761 0.660   -15.800 1.00 70.67  ? 454  GLU A C   1 
ATOM 2858  O O   . GLU A 1 387  ? 238.728 0.146   -16.178 1.00 69.99  ? 454  GLU A O   1 
ATOM 2859  C CB  . GLU A 1 387  ? 241.097 2.597   -16.345 1.00 75.00  ? 454  GLU A CB  1 
ATOM 2860  C CG  . GLU A 1 387  ? 241.452 3.979   -16.031 1.00 77.29  ? 454  GLU A CG  1 
ATOM 2861  C CD  . GLU A 1 387  ? 242.650 4.372   -16.807 1.00 78.76  ? 454  GLU A CD  1 
ATOM 2862  O OE1 . GLU A 1 387  ? 242.819 3.770   -17.886 1.00 77.89  ? 454  GLU A OE1 1 
ATOM 2863  O OE2 . GLU A 1 387  ? 243.407 5.265   -16.357 1.00 80.62  ? 454  GLU A OE2 1 
ATOM 2864  N N   . LEU A 1 388  ? 240.826 -0.041  -15.468 1.00 68.19  ? 455  LEU A N   1 
ATOM 2865  C CA  . LEU A 1 388  ? 240.813 -1.474  -15.617 1.00 65.99  ? 455  LEU A CA  1 
ATOM 2866  C C   . LEU A 1 388  ? 239.492 -2.123  -15.239 1.00 64.21  ? 455  LEU A C   1 
ATOM 2867  O O   . LEU A 1 388  ? 238.790 -2.618  -16.109 1.00 63.82  ? 455  LEU A O   1 
ATOM 2868  C CB  . LEU A 1 388  ? 241.957 -2.093  -14.819 1.00 67.84  ? 455  LEU A CB  1 
ATOM 2869  C CG  . LEU A 1 388  ? 243.353 -1.685  -15.306 1.00 70.69  ? 455  LEU A CG  1 
ATOM 2870  C CD1 . LEU A 1 388  ? 244.354 -2.738  -14.858 1.00 71.88  ? 455  LEU A CD1 1 
ATOM 2871  C CD2 . LEU A 1 388  ? 243.384 -1.565  -16.829 1.00 70.33  ? 455  LEU A CD2 1 
ATOM 2872  N N   . GLN A 1 389  ? 239.147 -2.122  -13.957 1.00 63.13  ? 456  GLN A N   1 
ATOM 2873  C CA  . GLN A 1 389  ? 237.902 -2.743  -13.534 1.00 63.06  ? 456  GLN A CA  1 
ATOM 2874  C C   . GLN A 1 389  ? 236.780 -2.164  -14.349 1.00 63.66  ? 456  GLN A C   1 
ATOM 2875  O O   . GLN A 1 389  ? 236.106 -2.891  -15.062 1.00 64.18  ? 456  GLN A O   1 
ATOM 2876  C CB  . GLN A 1 389  ? 237.617 -2.489  -12.056 1.00 62.98  ? 456  GLN A CB  1 
ATOM 2877  C CG  . GLN A 1 389  ? 238.587 -3.134  -11.108 1.00 64.68  ? 456  GLN A CG  1 
ATOM 2878  C CD  . GLN A 1 389  ? 238.795 -2.298  -9.860  1.00 65.52  ? 456  GLN A CD  1 
ATOM 2879  O OE1 . GLN A 1 389  ? 238.314 -1.170  -9.773  1.00 66.39  ? 456  GLN A OE1 1 
ATOM 2880  N NE2 . GLN A 1 389  ? 239.526 -2.839  -8.892  1.00 65.40  ? 456  GLN A NE2 1 
ATOM 2881  N N   . ARG A 1 390  ? 236.593 -0.850  -14.252 1.00 63.06  ? 457  ARG A N   1 
ATOM 2882  C CA  . ARG A 1 390  ? 235.523 -0.161  -14.972 1.00 63.61  ? 457  ARG A CA  1 
ATOM 2883  C C   . ARG A 1 390  ? 235.361 -0.774  -16.343 1.00 63.28  ? 457  ARG A C   1 
ATOM 2884  O O   . ARG A 1 390  ? 234.242 -0.968  -16.844 1.00 62.88  ? 457  ARG A O   1 
ATOM 2885  C CB  . ARG A 1 390  ? 235.840 1.328   -15.140 1.00 65.10  ? 457  ARG A CB  1 
ATOM 2886  C CG  . ARG A 1 390  ? 236.243 2.039   -13.862 1.00 68.85  ? 457  ARG A CG  1 
ATOM 2887  C CD  . ARG A 1 390  ? 235.480 3.347   -13.674 1.00 70.95  ? 457  ARG A CD  1 
ATOM 2888  N NE  . ARG A 1 390  ? 236.337 4.538   -13.621 1.00 73.26  ? 457  ARG A NE  1 
ATOM 2889  C CZ  . ARG A 1 390  ? 236.844 5.166   -14.683 1.00 75.16  ? 457  ARG A CZ  1 
ATOM 2890  N NH1 . ARG A 1 390  ? 236.594 4.730   -15.910 1.00 77.34  ? 457  ARG A NH1 1 
ATOM 2891  N NH2 . ARG A 1 390  ? 237.596 6.244   -14.518 1.00 76.70  ? 457  ARG A NH2 1 
ATOM 2892  N N   . GLU A 1 391  ? 236.501 -1.102  -16.932 1.00 63.23  ? 458  GLU A N   1 
ATOM 2893  C CA  . GLU A 1 391  ? 236.527 -1.666  -18.262 1.00 61.92  ? 458  GLU A CA  1 
ATOM 2894  C C   . GLU A 1 391  ? 236.149 -3.149  -18.313 1.00 59.64  ? 458  GLU A C   1 
ATOM 2895  O O   . GLU A 1 391  ? 235.211 -3.505  -19.025 1.00 56.87  ? 458  GLU A O   1 
ATOM 2896  C CB  . GLU A 1 391  ? 237.889 -1.326  -18.892 1.00 63.66  ? 458  GLU A CB  1 
ATOM 2897  C CG  . GLU A 1 391  ? 238.173 0.195   -18.659 1.00 66.50  ? 458  GLU A CG  1 
ATOM 2898  C CD  . GLU A 1 391  ? 238.912 0.931   -19.772 1.00 68.16  ? 458  GLU A CD  1 
ATOM 2899  O OE1 . GLU A 1 391  ? 240.164 0.852   -19.825 1.00 68.35  ? 458  GLU A OE1 1 
ATOM 2900  O OE2 . GLU A 1 391  ? 238.227 1.602   -20.582 1.00 70.10  ? 458  GLU A OE2 1 
ATOM 2901  N N   . MET A 1 392  ? 236.808 -4.022  -17.556 1.00 57.96  ? 459  MET A N   1 
ATOM 2902  C CA  . MET A 1 392  ? 236.391 -5.416  -17.627 1.00 57.51  ? 459  MET A CA  1 
ATOM 2903  C C   . MET A 1 392  ? 234.902 -5.498  -17.393 1.00 58.25  ? 459  MET A C   1 
ATOM 2904  O O   . MET A 1 392  ? 234.225 -6.346  -17.949 1.00 58.18  ? 459  MET A O   1 
ATOM 2905  C CB  . MET A 1 392  ? 237.066 -6.284  -16.593 1.00 55.48  ? 459  MET A CB  1 
ATOM 2906  C CG  . MET A 1 392  ? 236.490 -7.667  -16.660 1.00 53.84  ? 459  MET A CG  1 
ATOM 2907  S SD  . MET A 1 392  ? 237.488 -8.879  -15.862 1.00 47.09  ? 459  MET A SD  1 
ATOM 2908  C CE  . MET A 1 392  ? 236.330 -9.480  -14.601 1.00 52.14  ? 459  MET A CE  1 
ATOM 2909  N N   . LYS A 1 393  ? 234.406 -4.602  -16.552 1.00 58.39  ? 460  LYS A N   1 
ATOM 2910  C CA  . LYS A 1 393  ? 232.992 -4.539  -16.235 1.00 59.15  ? 460  LYS A CA  1 
ATOM 2911  C C   . LYS A 1 393  ? 232.214 -4.431  -17.514 1.00 59.69  ? 460  LYS A C   1 
ATOM 2912  O O   . LYS A 1 393  ? 231.421 -5.304  -17.835 1.00 58.76  ? 460  LYS A O   1 
ATOM 2913  C CB  . LYS A 1 393  ? 232.703 -3.342  -15.328 1.00 59.39  ? 460  LYS A CB  1 
ATOM 2914  C CG  . LYS A 1 393  ? 233.066 -3.620  -13.868 1.00 60.01  ? 460  LYS A CG  1 
ATOM 2915  C CD  . LYS A 1 393  ? 234.300 -4.542  -13.774 1.00 61.54  ? 460  LYS A CD  1 
ATOM 2916  C CE  . LYS A 1 393  ? 234.184 -5.560  -12.645 1.00 60.64  ? 460  LYS A CE  1 
ATOM 2917  N NZ  . LYS A 1 393  ? 234.893 -6.840  -12.970 1.00 57.15  ? 460  LYS A NZ  1 
ATOM 2918  N N   . LYS A 1 394  ? 232.444 -3.372  -18.268 1.00 60.30  ? 461  LYS A N   1 
ATOM 2919  C CA  . LYS A 1 394  ? 231.712 -3.247  -19.507 1.00 60.32  ? 461  LYS A CA  1 
ATOM 2920  C C   . LYS A 1 394  ? 231.911 -4.493  -20.346 1.00 58.14  ? 461  LYS A C   1 
ATOM 2921  O O   . LYS A 1 394  ? 230.932 -5.065  -20.827 1.00 57.98  ? 461  LYS A O   1 
ATOM 2922  C CB  . LYS A 1 394  ? 232.153 -2.007  -20.267 1.00 62.78  ? 461  LYS A CB  1 
ATOM 2923  C CG  . LYS A 1 394  ? 233.641 -1.891  -20.512 1.00 65.96  ? 461  LYS A CG  1 
ATOM 2924  C CD  . LYS A 1 394  ? 233.983 -0.482  -20.981 1.00 70.00  ? 461  LYS A CD  1 
ATOM 2925  C CE  . LYS A 1 394  ? 233.477 0.559   -19.981 1.00 71.36  ? 461  LYS A CE  1 
ATOM 2926  N NZ  . LYS A 1 394  ? 233.767 1.950   -20.408 1.00 72.48  ? 461  LYS A NZ  1 
ATOM 2927  N N   . SER A 1 395  ? 233.165 -4.921  -20.505 1.00 55.59  ? 462  SER A N   1 
ATOM 2928  C CA  . SER A 1 395  ? 233.455 -6.121  -21.290 1.00 54.99  ? 462  SER A CA  1 
ATOM 2929  C C   . SER A 1 395  ? 232.440 -7.078  -20.750 1.00 52.62  ? 462  SER A C   1 
ATOM 2930  O O   . SER A 1 395  ? 231.442 -7.404  -21.391 1.00 52.58  ? 462  SER A O   1 
ATOM 2931  C CB  . SER A 1 395  ? 234.865 -6.678  -21.004 1.00 56.99  ? 462  SER A CB  1 
ATOM 2932  O OG  . SER A 1 395  ? 234.922 -7.465  -19.819 1.00 59.60  ? 462  SER A OG  1 
ATOM 2933  N N   . LEU A 1 396  ? 232.729 -7.504  -19.535 1.00 50.56  ? 463  LEU A N   1 
ATOM 2934  C CA  . LEU A 1 396  ? 231.892 -8.392  -18.786 1.00 49.24  ? 463  LEU A CA  1 
ATOM 2935  C C   . LEU A 1 396  ? 230.464 -8.033  -19.159 1.00 48.26  ? 463  LEU A C   1 
ATOM 2936  O O   . LEU A 1 396  ? 229.876 -8.640  -20.060 1.00 48.85  ? 463  LEU A O   1 
ATOM 2937  C CB  . LEU A 1 396  ? 232.141 -8.125  -17.304 1.00 48.83  ? 463  LEU A CB  1 
ATOM 2938  C CG  . LEU A 1 396  ? 231.459 -8.874  -16.164 1.00 46.58  ? 463  LEU A CG  1 
ATOM 2939  C CD1 . LEU A 1 396  ? 231.463 -7.971  -14.942 1.00 45.00  ? 463  LEU A CD1 1 
ATOM 2940  C CD2 . LEU A 1 396  ? 230.029 -9.239  -16.521 1.00 48.61  ? 463  LEU A CD2 1 
ATOM 2941  N N   . MET A 1 397  ? 229.935 -7.024  -18.468 1.00 45.76  ? 464  MET A N   1 
ATOM 2942  C CA  . MET A 1 397  ? 228.579 -6.558  -18.669 1.00 44.24  ? 464  MET A CA  1 
ATOM 2943  C C   . MET A 1 397  ? 228.109 -6.910  -20.059 1.00 44.29  ? 464  MET A C   1 
ATOM 2944  O O   . MET A 1 397  ? 227.103 -7.592  -20.240 1.00 43.29  ? 464  MET A O   1 
ATOM 2945  C CB  . MET A 1 397  ? 228.512 -5.056  -18.444 1.00 44.84  ? 464  MET A CB  1 
ATOM 2946  C CG  . MET A 1 397  ? 228.989 -4.645  -17.062 1.00 46.24  ? 464  MET A CG  1 
ATOM 2947  S SD  . MET A 1 397  ? 228.175 -3.160  -16.440 1.00 48.11  ? 464  MET A SD  1 
ATOM 2948  C CE  . MET A 1 397  ? 228.983 -1.831  -17.401 1.00 43.87  ? 464  MET A CE  1 
ATOM 2949  N N   . ASP A 1 398  ? 228.862 -6.484  -21.055 1.00 45.02  ? 465  ASP A N   1 
ATOM 2950  C CA  . ASP A 1 398  ? 228.454 -6.792  -22.398 1.00 45.83  ? 465  ASP A CA  1 
ATOM 2951  C C   . ASP A 1 398  ? 228.477 -8.286  -22.717 1.00 44.72  ? 465  ASP A C   1 
ATOM 2952  O O   . ASP A 1 398  ? 227.440 -8.836  -23.055 1.00 45.44  ? 465  ASP A O   1 
ATOM 2953  C CB  . ASP A 1 398  ? 229.306 -6.016  -23.398 1.00 48.87  ? 465  ASP A CB  1 
ATOM 2954  C CG  . ASP A 1 398  ? 230.217 -6.913  -24.219 1.00 53.73  ? 465  ASP A CG  1 
ATOM 2955  O OD1 . ASP A 1 398  ? 229.723 -7.851  -24.882 1.00 56.16  ? 465  ASP A OD1 1 
ATOM 2956  O OD2 . ASP A 1 398  ? 231.440 -6.677  -24.214 1.00 55.56  ? 465  ASP A OD2 1 
ATOM 2957  N N   . LEU A 1 399  ? 229.628 -8.954  -22.600 1.00 42.98  ? 466  LEU A N   1 
ATOM 2958  C CA  . LEU A 1 399  ? 229.690 -10.372 -22.962 1.00 42.26  ? 466  LEU A CA  1 
ATOM 2959  C C   . LEU A 1 399  ? 228.568 -11.178 -22.382 1.00 41.35  ? 466  LEU A C   1 
ATOM 2960  O O   . LEU A 1 399  ? 227.993 -12.008 -23.077 1.00 40.18  ? 466  LEU A O   1 
ATOM 2961  C CB  . LEU A 1 399  ? 231.035 -11.036 -22.593 1.00 43.69  ? 466  LEU A CB  1 
ATOM 2962  C CG  . LEU A 1 399  ? 231.842 -10.937 -21.295 1.00 44.55  ? 466  LEU A CG  1 
ATOM 2963  C CD1 . LEU A 1 399  ? 232.649 -12.187 -21.093 1.00 45.32  ? 466  LEU A CD1 1 
ATOM 2964  C CD2 . LEU A 1 399  ? 232.779 -9.793  -21.393 1.00 45.42  ? 466  LEU A CD2 1 
ATOM 2965  N N   . ALA A 1 400  ? 228.260 -10.924 -21.114 1.00 40.48  ? 467  ALA A N   1 
ATOM 2966  C CA  . ALA A 1 400  ? 227.196 -11.628 -20.407 1.00 38.39  ? 467  ALA A CA  1 
ATOM 2967  C C   . ALA A 1 400  ? 225.886 -11.263 -21.054 1.00 38.83  ? 467  ALA A C   1 
ATOM 2968  O O   . ALA A 1 400  ? 224.980 -12.083 -21.210 1.00 37.94  ? 467  ALA A O   1 
ATOM 2969  C CB  . ALA A 1 400  ? 227.181 -11.215 -18.967 1.00 37.71  ? 467  ALA A CB  1 
ATOM 2970  N N   . ASN A 1 401  ? 225.794 -10.001 -21.422 1.00 41.74  ? 468  ASN A N   1 
ATOM 2971  C CA  . ASN A 1 401  ? 224.613 -9.513  -22.082 1.00 44.15  ? 468  ASN A CA  1 
ATOM 2972  C C   . ASN A 1 401  ? 224.428 -10.236 -23.417 1.00 45.68  ? 468  ASN A C   1 
ATOM 2973  O O   . ASN A 1 401  ? 223.459 -10.966 -23.621 1.00 44.78  ? 468  ASN A O   1 
ATOM 2974  C CB  . ASN A 1 401  ? 224.769 -8.026  -22.274 1.00 43.50  ? 468  ASN A CB  1 
ATOM 2975  C CG  . ASN A 1 401  ? 223.838 -7.261  -21.411 1.00 41.82  ? 468  ASN A CG  1 
ATOM 2976  O OD1 . ASN A 1 401  ? 223.297 -7.780  -20.427 1.00 41.83  ? 468  ASN A OD1 1 
ATOM 2977  N ND2 . ASN A 1 401  ? 223.624 -6.019  -21.769 1.00 40.36  ? 468  ASN A ND2 1 
ATOM 2978  N N   . ASP A 1 402  ? 225.372 -10.029 -24.323 1.00 47.65  ? 469  ASP A N   1 
ATOM 2979  C CA  . ASP A 1 402  ? 225.331 -10.692 -25.611 1.00 50.01  ? 469  ASP A CA  1 
ATOM 2980  C C   . ASP A 1 402  ? 224.848 -12.127 -25.368 1.00 50.93  ? 469  ASP A C   1 
ATOM 2981  O O   . ASP A 1 402  ? 223.724 -12.490 -25.687 1.00 50.93  ? 469  ASP A O   1 
ATOM 2982  C CB  . ASP A 1 402  ? 226.743 -10.709 -26.235 1.00 49.83  ? 469  ASP A CB  1 
ATOM 2983  C CG  . ASP A 1 402  ? 227.151 -9.360  -26.844 1.00 50.36  ? 469  ASP A CG  1 
ATOM 2984  O OD1 . ASP A 1 402  ? 226.319 -8.731  -27.517 1.00 51.34  ? 469  ASP A OD1 1 
ATOM 2985  O OD2 . ASP A 1 402  ? 228.311 -8.936  -26.677 1.00 48.02  ? 469  ASP A OD2 1 
ATOM 2986  N N   . ALA A 1 403  ? 225.713 -12.920 -24.756 1.00 52.76  ? 470  ALA A N   1 
ATOM 2987  C CA  . ALA A 1 403  ? 225.436 -14.315 -24.460 1.00 52.03  ? 470  ALA A CA  1 
ATOM 2988  C C   . ALA A 1 403  ? 223.995 -14.669 -24.119 1.00 50.88  ? 470  ALA A C   1 
ATOM 2989  O O   . ALA A 1 403  ? 223.243 -15.171 -24.951 1.00 50.55  ? 470  ALA A O   1 
ATOM 2990  C CB  . ALA A 1 403  ? 226.366 -14.788 -23.328 1.00 50.37  ? 470  ALA A CB  1 
ATOM 2991  N N   . CYS A 1 404  ? 223.637 -14.419 -22.873 1.00 51.00  ? 471  CYS A N   1 
ATOM 2992  C CA  . CYS A 1 404  ? 222.323 -14.745 -22.351 1.00 52.71  ? 471  CYS A CA  1 
ATOM 2993  C C   . CYS A 1 404  ? 221.189 -14.636 -23.355 1.00 50.53  ? 471  CYS A C   1 
ATOM 2994  O O   . CYS A 1 404  ? 220.337 -15.517 -23.497 1.00 50.24  ? 471  CYS A O   1 
ATOM 2995  C CB  . CYS A 1 404  ? 221.994 -13.826 -21.158 1.00 56.88  ? 471  CYS A CB  1 
ATOM 2996  S SG  . CYS A 1 404  ? 222.630 -14.193 -19.490 1.00 60.33  ? 471  CYS A SG  1 
ATOM 2997  N N   . GLN A 1 405  ? 221.215 -13.533 -24.064 1.00 47.53  ? 472  GLN A N   1 
ATOM 2998  C CA  . GLN A 1 405  ? 220.159 -13.176 -24.977 1.00 45.24  ? 472  GLN A CA  1 
ATOM 2999  C C   . GLN A 1 405  ? 220.032 -13.913 -26.271 1.00 45.40  ? 472  GLN A C   1 
ATOM 3000  O O   . GLN A 1 405  ? 218.960 -14.433 -26.605 1.00 46.52  ? 472  GLN A O   1 
ATOM 3001  C CB  . GLN A 1 405  ? 220.305 -11.694 -25.206 1.00 43.61  ? 472  GLN A CB  1 
ATOM 3002  C CG  . GLN A 1 405  ? 220.764 -11.057 -23.904 1.00 40.05  ? 472  GLN A CG  1 
ATOM 3003  C CD  . GLN A 1 405  ? 219.961 -11.524 -22.714 1.00 37.16  ? 472  GLN A CD  1 
ATOM 3004  O OE1 . GLN A 1 405  ? 220.300 -12.521 -22.114 1.00 31.04  ? 472  GLN A OE1 1 
ATOM 3005  N NE2 . GLN A 1 405  ? 218.879 -10.819 -22.378 1.00 37.81  ? 472  GLN A NE2 1 
ATOM 3006  N N   . LEU A 1 406  ? 221.140 -13.948 -26.990 1.00 46.31  ? 473  LEU A N   1 
ATOM 3007  C CA  . LEU A 1 406  ? 221.225 -14.582 -28.291 1.00 48.62  ? 473  LEU A CA  1 
ATOM 3008  C C   . LEU A 1 406  ? 220.603 -15.972 -28.297 1.00 50.71  ? 473  LEU A C   1 
ATOM 3009  O O   . LEU A 1 406  ? 220.207 -16.493 -29.343 1.00 51.25  ? 473  LEU A O   1 
ATOM 3010  C CB  . LEU A 1 406  ? 222.693 -14.629 -28.703 1.00 47.93  ? 473  LEU A CB  1 
ATOM 3011  C CG  . LEU A 1 406  ? 223.406 -13.267 -28.782 1.00 44.79  ? 473  LEU A CG  1 
ATOM 3012  C CD1 . LEU A 1 406  ? 223.707 -12.997 -30.239 1.00 43.89  ? 473  LEU A CD1 1 
ATOM 3013  C CD2 . LEU A 1 406  ? 222.575 -12.109 -28.188 1.00 45.52  ? 473  LEU A CD2 1 
ATOM 3014  N N   . LEU A 1 407  ? 220.482 -16.551 -27.114 1.00 52.57  ? 474  LEU A N   1 
ATOM 3015  C CA  . LEU A 1 407  ? 219.923 -17.880 -26.983 1.00 55.52  ? 474  LEU A CA  1 
ATOM 3016  C C   . LEU A 1 407  ? 218.384 -17.874 -26.886 1.00 57.25  ? 474  LEU A C   1 
ATOM 3017  O O   . LEU A 1 407  ? 217.801 -18.040 -25.808 1.00 57.99  ? 474  LEU A O   1 
ATOM 3018  C CB  . LEU A 1 407  ? 220.553 -18.548 -25.763 1.00 55.42  ? 474  LEU A CB  1 
ATOM 3019  C CG  . LEU A 1 407  ? 222.084 -18.600 -25.676 1.00 55.02  ? 474  LEU A CG  1 
ATOM 3020  C CD1 . LEU A 1 407  ? 222.787 -17.598 -26.557 1.00 55.64  ? 474  LEU A CD1 1 
ATOM 3021  C CD2 . LEU A 1 407  ? 222.438 -18.340 -24.255 1.00 56.61  ? 474  LEU A CD2 1 
ATOM 3022  N N   . SER A 1 408  ? 217.734 -17.663 -28.025 1.00 58.38  ? 475  SER A N   1 
ATOM 3023  C CA  . SER A 1 408  ? 216.285 -17.658 -28.078 1.00 59.33  ? 475  SER A CA  1 
ATOM 3024  C C   . SER A 1 408  ? 215.858 -19.026 -27.583 1.00 63.56  ? 475  SER A C   1 
ATOM 3025  O O   . SER A 1 408  ? 216.207 -20.031 -28.195 1.00 63.42  ? 475  SER A O   1 
ATOM 3026  C CB  . SER A 1 408  ? 215.822 -17.508 -29.515 1.00 56.09  ? 475  SER A CB  1 
ATOM 3027  O OG  . SER A 1 408  ? 216.184 -18.662 -30.254 1.00 49.76  ? 475  SER A OG  1 
ATOM 3028  N N   . GLY A 1 409  ? 215.110 -19.076 -26.486 1.00 68.41  ? 476  GLY A N   1 
ATOM 3029  C CA  . GLY A 1 409  ? 214.665 -20.368 -25.983 1.00 74.65  ? 476  GLY A CA  1 
ATOM 3030  C C   . GLY A 1 409  ? 213.647 -20.349 -24.855 1.00 78.79  ? 476  GLY A C   1 
ATOM 3031  O O   . GLY A 1 409  ? 213.471 -19.326 -24.194 1.00 78.96  ? 476  GLY A O   1 
ATOM 3032  N N   . GLU A 1 410  ? 212.967 -21.479 -24.649 1.00 82.71  ? 477  GLU A N   1 
ATOM 3033  C CA  . GLU A 1 410  ? 211.976 -21.621 -23.574 1.00 86.24  ? 477  GLU A CA  1 
ATOM 3034  C C   . GLU A 1 410  ? 210.818 -20.603 -23.634 1.00 87.84  ? 477  GLU A C   1 
ATOM 3035  O O   . GLU A 1 410  ? 210.180 -20.454 -24.679 1.00 86.96  ? 477  GLU A O   1 
ATOM 3036  C CB  . GLU A 1 410  ? 212.732 -21.578 -22.224 1.00 87.92  ? 477  GLU A CB  1 
ATOM 3037  C CG  . GLU A 1 410  ? 212.069 -20.882 -21.038 1.00 89.75  ? 477  GLU A CG  1 
ATOM 3038  C CD  . GLU A 1 410  ? 211.139 -21.765 -20.238 1.00 90.47  ? 477  GLU A CD  1 
ATOM 3039  O OE1 . GLU A 1 410  ? 211.480 -22.074 -19.074 1.00 91.14  ? 477  GLU A OE1 1 
ATOM 3040  O OE2 . GLU A 1 410  ? 210.073 -22.144 -20.770 1.00 90.08  ? 477  GLU A OE2 1 
ATOM 3041  N N   . ARG A 1 411  ? 210.549 -19.936 -22.510 1.00 90.28  ? 478  ARG A N   1 
ATOM 3042  C CA  . ARG A 1 411  ? 209.499 -18.927 -22.346 1.00 92.45  ? 478  ARG A CA  1 
ATOM 3043  C C   . ARG A 1 411  ? 210.060 -17.741 -21.527 1.00 94.15  ? 478  ARG A C   1 
ATOM 3044  O O   . ARG A 1 411  ? 210.852 -17.937 -20.597 1.00 96.11  ? 478  ARG A O   1 
ATOM 3045  C CB  . ARG A 1 411  ? 208.283 -19.544 -21.624 1.00 91.48  ? 478  ARG A CB  1 
ATOM 3046  C CG  . ARG A 1 411  ? 208.512 -19.851 -20.147 1.00 90.18  ? 478  ARG A CG  1 
ATOM 3047  C CD  . ARG A 1 411  ? 207.603 -20.976 -19.616 1.00 89.31  ? 478  ARG A CD  1 
ATOM 3048  N NE  . ARG A 1 411  ? 208.221 -21.636 -18.460 1.00 88.21  ? 478  ARG A NE  1 
ATOM 3049  C CZ  . ARG A 1 411  ? 207.699 -22.656 -17.783 1.00 88.14  ? 478  ARG A CZ  1 
ATOM 3050  N NH1 . ARG A 1 411  ? 206.523 -23.163 -18.133 1.00 87.41  ? 478  ARG A NH1 1 
ATOM 3051  N NH2 . ARG A 1 411  ? 208.365 -23.168 -16.752 1.00 88.45  ? 478  ARG A NH2 1 
ATOM 3052  N N   . TYR A 1 412  ? 209.650 -16.518 -21.870 1.00 94.49  ? 479  TYR A N   1 
ATOM 3053  C CA  . TYR A 1 412  ? 210.133 -15.317 -21.177 1.00 94.19  ? 479  TYR A CA  1 
ATOM 3054  C C   . TYR A 1 412  ? 209.659 -15.237 -19.724 1.00 92.04  ? 479  TYR A C   1 
ATOM 3055  O O   . TYR A 1 412  ? 208.642 -15.829 -19.371 1.00 91.40  ? 479  TYR A O   1 
ATOM 3056  C CB  . TYR A 1 412  ? 209.738 -14.046 -21.966 1.00 97.24  ? 479  TYR A CB  1 
ATOM 3057  C CG  . TYR A 1 412  ? 208.280 -13.593 -21.884 1.00 99.58  ? 479  TYR A CG  1 
ATOM 3058  C CD1 . TYR A 1 412  ? 207.888 -12.606 -20.972 1.00 101.08 ? 479  TYR A CD1 1 
ATOM 3059  C CD2 . TYR A 1 412  ? 207.299 -14.127 -22.735 1.00 100.19 ? 479  TYR A CD2 1 
ATOM 3060  C CE1 . TYR A 1 412  ? 206.562 -12.162 -20.909 1.00 101.91 ? 479  TYR A CE1 1 
ATOM 3061  C CE2 . TYR A 1 412  ? 205.967 -13.688 -22.676 1.00 101.51 ? 479  TYR A CE2 1 
ATOM 3062  C CZ  . TYR A 1 412  ? 205.609 -12.706 -21.761 1.00 101.74 ? 479  TYR A CZ  1 
ATOM 3063  O OH  . TYR A 1 412  ? 204.304 -12.266 -21.691 1.00 101.98 ? 479  TYR A OH  1 
ATOM 3064  N N   . LYS A 1 413  ? 210.428 -14.517 -18.904 1.00 90.34  ? 480  LYS A N   1 
ATOM 3065  C CA  . LYS A 1 413  ? 210.193 -14.305 -17.468 1.00 88.73  ? 480  LYS A CA  1 
ATOM 3066  C C   . LYS A 1 413  ? 210.808 -15.424 -16.636 1.00 88.33  ? 480  LYS A C   1 
ATOM 3067  O O   . LYS A 1 413  ? 210.603 -15.481 -15.431 1.00 88.17  ? 480  LYS A O   1 
ATOM 3068  C CB  . LYS A 1 413  ? 208.695 -14.176 -17.143 1.00 88.05  ? 480  LYS A CB  1 
ATOM 3069  C CG  . LYS A 1 413  ? 207.928 -15.488 -17.100 1.00 87.02  ? 480  LYS A CG  1 
ATOM 3070  C CD  . LYS A 1 413  ? 206.422 -15.277 -17.002 1.00 84.74  ? 480  LYS A CD  1 
ATOM 3071  C CE  . LYS A 1 413  ? 206.014 -14.894 -15.584 1.00 82.93  ? 480  LYS A CE  1 
ATOM 3072  N NZ  . LYS A 1 413  ? 206.478 -15.896 -14.575 1.00 79.70  ? 480  LYS A NZ  1 
ATOM 3073  N N   . GLU A 1 414  ? 211.578 -16.295 -17.290 1.00 87.77  ? 481  GLU A N   1 
ATOM 3074  C CA  . GLU A 1 414  ? 212.230 -17.440 -16.640 1.00 88.36  ? 481  GLU A CA  1 
ATOM 3075  C C   . GLU A 1 414  ? 213.547 -17.780 -17.315 1.00 87.80  ? 481  GLU A C   1 
ATOM 3076  O O   . GLU A 1 414  ? 213.896 -17.175 -18.319 1.00 86.58  ? 481  GLU A O   1 
ATOM 3077  C CB  . GLU A 1 414  ? 211.361 -18.693 -16.751 1.00 89.80  ? 481  GLU A CB  1 
ATOM 3078  C CG  . GLU A 1 414  ? 210.609 -19.120 -15.516 1.00 91.91  ? 481  GLU A CG  1 
ATOM 3079  C CD  . GLU A 1 414  ? 209.150 -18.739 -15.583 1.00 92.12  ? 481  GLU A CD  1 
ATOM 3080  O OE1 . GLU A 1 414  ? 208.631 -18.572 -16.707 1.00 92.88  ? 481  GLU A OE1 1 
ATOM 3081  O OE2 . GLU A 1 414  ? 208.519 -18.620 -14.514 1.00 92.40  ? 481  GLU A OE2 1 
ATOM 3082  N N   . ASP A 1 415  ? 214.238 -18.782 -16.756 1.00 88.73  ? 482  ASP A N   1 
ATOM 3083  C CA  . ASP A 1 415  ? 215.514 -19.353 -17.246 1.00 89.66  ? 482  ASP A CA  1 
ATOM 3084  C C   . ASP A 1 415  ? 216.764 -18.473 -17.495 1.00 90.59  ? 482  ASP A C   1 
ATOM 3085  O O   . ASP A 1 415  ? 217.438 -18.117 -16.528 1.00 90.32  ? 482  ASP A O   1 
ATOM 3086  C CB  . ASP A 1 415  ? 215.199 -20.209 -18.465 1.00 88.97  ? 482  ASP A CB  1 
ATOM 3087  C CG  . ASP A 1 415  ? 213.939 -19.771 -19.144 1.00 88.24  ? 482  ASP A CG  1 
ATOM 3088  O OD1 . ASP A 1 415  ? 212.863 -19.950 -18.546 1.00 85.84  ? 482  ASP A OD1 1 
ATOM 3089  O OD2 . ASP A 1 415  ? 214.015 -19.223 -20.257 1.00 88.04  ? 482  ASP A OD2 1 
ATOM 3090  N N   . PRO A 1 416  ? 217.141 -18.165 -18.771 1.00 91.75  ? 483  PRO A N   1 
ATOM 3091  C CA  . PRO A 1 416  ? 218.339 -17.314 -18.846 1.00 92.24  ? 483  PRO A CA  1 
ATOM 3092  C C   . PRO A 1 416  ? 217.968 -15.893 -18.360 1.00 92.98  ? 483  PRO A C   1 
ATOM 3093  O O   . PRO A 1 416  ? 218.843 -15.101 -17.973 1.00 92.42  ? 483  PRO A O   1 
ATOM 3094  C CB  . PRO A 1 416  ? 218.709 -17.366 -20.335 1.00 92.30  ? 483  PRO A CB  1 
ATOM 3095  C CG  . PRO A 1 416  ? 217.388 -17.406 -20.987 1.00 90.66  ? 483  PRO A CG  1 
ATOM 3096  C CD  . PRO A 1 416  ? 216.647 -18.443 -20.138 1.00 90.87  ? 483  PRO A CD  1 
ATOM 3097  N N   . TRP A 1 417  ? 216.661 -15.596 -18.380 1.00 94.36  ? 484  TRP A N   1 
ATOM 3098  C CA  . TRP A 1 417  ? 216.104 -14.316 -17.921 1.00 94.89  ? 484  TRP A CA  1 
ATOM 3099  C C   . TRP A 1 417  ? 216.526 -14.103 -16.483 1.00 93.79  ? 484  TRP A C   1 
ATOM 3100  O O   . TRP A 1 417  ? 217.012 -13.040 -16.105 1.00 93.31  ? 484  TRP A O   1 
ATOM 3101  C CB  . TRP A 1 417  ? 214.581 -14.352 -17.957 1.00 96.73  ? 484  TRP A CB  1 
ATOM 3102  C CG  . TRP A 1 417  ? 214.010 -13.251 -18.737 1.00 99.60  ? 484  TRP A CG  1 
ATOM 3103  C CD1 . TRP A 1 417  ? 212.816 -12.633 -18.532 1.00 100.21 ? 484  TRP A CD1 1 
ATOM 3104  C CD2 . TRP A 1 417  ? 214.591 -12.639 -19.887 1.00 101.32 ? 484  TRP A CD2 1 
ATOM 3105  N NE1 . TRP A 1 417  ? 212.611 -11.668 -19.487 1.00 100.87 ? 484  TRP A NE1 1 
ATOM 3106  C CE2 . TRP A 1 417  ? 213.688 -11.651 -20.333 1.00 102.28 ? 484  TRP A CE2 1 
ATOM 3107  C CE3 . TRP A 1 417  ? 215.788 -12.830 -20.586 1.00 101.91 ? 484  TRP A CE3 1 
ATOM 3108  C CZ2 . TRP A 1 417  ? 213.943 -10.855 -21.450 1.00 104.01 ? 484  TRP A CZ2 1 
ATOM 3109  C CZ3 . TRP A 1 417  ? 216.041 -12.043 -21.690 1.00 103.20 ? 484  TRP A CZ3 1 
ATOM 3110  C CH2 . TRP A 1 417  ? 215.122 -11.064 -22.114 1.00 104.66 ? 484  TRP A CH2 1 
ATOM 3111  N N   . LEU A 1 418  ? 216.307 -15.146 -15.689 1.00 92.42  ? 485  LEU A N   1 
ATOM 3112  C CA  . LEU A 1 418  ? 216.663 -15.169 -14.282 1.00 90.60  ? 485  LEU A CA  1 
ATOM 3113  C C   . LEU A 1 418  ? 218.051 -14.571 -14.152 1.00 90.24  ? 485  LEU A C   1 
ATOM 3114  O O   . LEU A 1 418  ? 218.248 -13.617 -13.417 1.00 89.93  ? 485  LEU A O   1 
ATOM 3115  C CB  . LEU A 1 418  ? 216.581 -16.630 -13.765 1.00 88.77  ? 485  LEU A CB  1 
ATOM 3116  C CG  . LEU A 1 418  ? 217.525 -17.482 -12.887 1.00 87.47  ? 485  LEU A CG  1 
ATOM 3117  C CD1 . LEU A 1 418  ? 217.945 -16.754 -11.631 1.00 86.77  ? 485  LEU A CD1 1 
ATOM 3118  C CD2 . LEU A 1 418  ? 216.792 -18.786 -12.512 1.00 86.34  ? 485  LEU A CD2 1 
ATOM 3119  N N   . TRP A 1 419  ? 218.998 -15.100 -14.909 1.00 90.58  ? 486  TRP A N   1 
ATOM 3120  C CA  . TRP A 1 419  ? 220.359 -14.605 -14.868 1.00 90.92  ? 486  TRP A CA  1 
ATOM 3121  C C   . TRP A 1 419  ? 220.444 -13.135 -15.218 1.00 88.18  ? 486  TRP A C   1 
ATOM 3122  O O   . TRP A 1 419  ? 220.861 -12.320 -14.394 1.00 88.54  ? 486  TRP A O   1 
ATOM 3123  C CB  . TRP A 1 419  ? 221.234 -15.413 -15.825 1.00 96.38  ? 486  TRP A CB  1 
ATOM 3124  C CG  . TRP A 1 419  ? 221.387 -16.838 -15.404 1.00 102.52 ? 486  TRP A CG  1 
ATOM 3125  C CD1 . TRP A 1 419  ? 221.128 -17.953 -16.157 1.00 103.23 ? 486  TRP A CD1 1 
ATOM 3126  C CD2 . TRP A 1 419  ? 221.824 -17.308 -14.118 1.00 104.94 ? 486  TRP A CD2 1 
ATOM 3127  N NE1 . TRP A 1 419  ? 221.375 -19.086 -15.417 1.00 104.29 ? 486  TRP A NE1 1 
ATOM 3128  C CE2 . TRP A 1 419  ? 221.804 -18.718 -14.164 1.00 105.78 ? 486  TRP A CE2 1 
ATOM 3129  C CE3 . TRP A 1 419  ? 222.230 -16.671 -12.928 1.00 105.39 ? 486  TRP A CE3 1 
ATOM 3130  C CZ2 . TRP A 1 419  ? 222.175 -19.506 -13.063 1.00 107.09 ? 486  TRP A CZ2 1 
ATOM 3131  C CZ3 . TRP A 1 419  ? 222.596 -17.454 -11.835 1.00 105.42 ? 486  TRP A CZ3 1 
ATOM 3132  C CH2 . TRP A 1 419  ? 222.567 -18.856 -11.911 1.00 106.41 ? 486  TRP A CH2 1 
ATOM 3133  N N   . ASP A 1 420  ? 220.048 -12.798 -16.439 1.00 84.64  ? 487  ASP A N   1 
ATOM 3134  C CA  . ASP A 1 420  ? 220.122 -11.420 -16.865 1.00 81.50  ? 487  ASP A CA  1 
ATOM 3135  C C   . ASP A 1 420  ? 219.341 -10.521 -15.941 1.00 80.46  ? 487  ASP A C   1 
ATOM 3136  O O   . ASP A 1 420  ? 219.771 -9.423  -15.643 1.00 81.12  ? 487  ASP A O   1 
ATOM 3137  C CB  . ASP A 1 420  ? 219.620 -11.252 -18.294 1.00 79.55  ? 487  ASP A CB  1 
ATOM 3138  C CG  . ASP A 1 420  ? 220.657 -10.597 -19.193 1.00 77.86  ? 487  ASP A CG  1 
ATOM 3139  O OD1 . ASP A 1 420  ? 221.080 -9.458  -18.919 1.00 75.81  ? 487  ASP A OD1 1 
ATOM 3140  O OD2 . ASP A 1 420  ? 221.070 -11.224 -20.178 1.00 78.24  ? 487  ASP A OD2 1 
ATOM 3141  N N   . LEU A 1 421  ? 218.209 -10.992 -15.448 1.00 79.25  ? 488  LEU A N   1 
ATOM 3142  C CA  . LEU A 1 421  ? 217.400 -10.155 -14.573 1.00 77.70  ? 488  LEU A CA  1 
ATOM 3143  C C   . LEU A 1 421  ? 217.982 -9.779  -13.186 1.00 77.15  ? 488  LEU A C   1 
ATOM 3144  O O   . LEU A 1 421  ? 217.824 -8.638  -12.745 1.00 75.39  ? 488  LEU A O   1 
ATOM 3145  C CB  . LEU A 1 421  ? 216.008 -10.780 -14.430 1.00 76.38  ? 488  LEU A CB  1 
ATOM 3146  C CG  . LEU A 1 421  ? 215.331 -11.128 -15.761 1.00 75.20  ? 488  LEU A CG  1 
ATOM 3147  C CD1 . LEU A 1 421  ? 213.836 -10.962 -15.611 1.00 75.07  ? 488  LEU A CD1 1 
ATOM 3148  C CD2 . LEU A 1 421  ? 215.850 -10.235 -16.879 1.00 74.23  ? 488  LEU A CD2 1 
ATOM 3149  N N   . GLU A 1 422  ? 218.654 -10.710 -12.507 1.00 77.72  ? 489  GLU A N   1 
ATOM 3150  C CA  . GLU A 1 422  ? 219.237 -10.436 -11.182 1.00 78.74  ? 489  GLU A CA  1 
ATOM 3151  C C   . GLU A 1 422  ? 220.333 -9.405  -11.277 1.00 80.48  ? 489  GLU A C   1 
ATOM 3152  O O   . GLU A 1 422  ? 220.255 -8.329  -10.695 1.00 80.26  ? 489  GLU A O   1 
ATOM 3153  C CB  . GLU A 1 422  ? 219.874 -11.683 -10.594 1.00 77.79  ? 489  GLU A CB  1 
ATOM 3154  C CG  . GLU A 1 422  ? 219.039 -12.933 -10.672 1.00 74.86  ? 489  GLU A CG  1 
ATOM 3155  C CD  . GLU A 1 422  ? 219.896 -14.149 -10.970 1.00 73.57  ? 489  GLU A CD  1 
ATOM 3156  O OE1 . GLU A 1 422  ? 220.826 -14.454 -10.182 1.00 73.36  ? 489  GLU A OE1 1 
ATOM 3157  O OE2 . GLU A 1 422  ? 219.643 -14.794 -12.007 1.00 72.67  ? 489  GLU A OE2 1 
ATOM 3158  N N   . TRP A 1 423  ? 221.384 -9.771  -11.994 1.00 83.27  ? 490  TRP A N   1 
ATOM 3159  C CA  . TRP A 1 423  ? 222.495 -8.873  -12.166 1.00 86.40  ? 490  TRP A CA  1 
ATOM 3160  C C   . TRP A 1 423  ? 221.994 -7.502  -12.535 1.00 86.79  ? 490  TRP A C   1 
ATOM 3161  O O   . TRP A 1 423  ? 222.390 -6.511  -11.943 1.00 86.59  ? 490  TRP A O   1 
ATOM 3162  C CB  . TRP A 1 423  ? 223.441 -9.387  -13.239 1.00 90.00  ? 490  TRP A CB  1 
ATOM 3163  C CG  . TRP A 1 423  ? 224.649 -10.073 -12.676 1.00 94.70  ? 490  TRP A CG  1 
ATOM 3164  C CD1 . TRP A 1 423  ? 225.854 -9.494  -12.303 1.00 94.70  ? 490  TRP A CD1 1 
ATOM 3165  C CD2 . TRP A 1 423  ? 224.781 -11.472 -12.413 1.00 97.17  ? 490  TRP A CD2 1 
ATOM 3166  N NE1 . TRP A 1 423  ? 226.718 -10.460 -11.828 1.00 96.32  ? 490  TRP A NE1 1 
ATOM 3167  C CE2 . TRP A 1 423  ? 226.086 -11.680 -11.886 1.00 97.58  ? 490  TRP A CE2 1 
ATOM 3168  C CE3 . TRP A 1 423  ? 223.922 -12.577 -12.568 1.00 98.28  ? 490  TRP A CE3 1 
ATOM 3169  C CZ2 . TRP A 1 423  ? 226.545 -12.951 -11.522 1.00 97.97  ? 490  TRP A CZ2 1 
ATOM 3170  C CZ3 . TRP A 1 423  ? 224.382 -13.835 -12.202 1.00 98.71  ? 490  TRP A CZ3 1 
ATOM 3171  C CH2 . TRP A 1 423  ? 225.682 -14.007 -11.684 1.00 98.65  ? 490  TRP A CH2 1 
ATOM 3172  N N   . ASP A 1 424  ? 221.105 -7.425  -13.509 1.00 87.60  ? 491  ASP A N   1 
ATOM 3173  C CA  . ASP A 1 424  ? 220.623 -6.115  -13.877 1.00 89.20  ? 491  ASP A CA  1 
ATOM 3174  C C   . ASP A 1 424  ? 219.353 -5.784  -13.146 1.00 89.80  ? 491  ASP A C   1 
ATOM 3175  O O   . ASP A 1 424  ? 218.284 -6.294  -13.448 1.00 89.23  ? 491  ASP A O   1 
ATOM 3176  C CB  . ASP A 1 424  ? 220.413 -5.985  -15.393 1.00 90.25  ? 491  ASP A CB  1 
ATOM 3177  C CG  . ASP A 1 424  ? 220.768 -7.247  -16.158 1.00 91.49  ? 491  ASP A CG  1 
ATOM 3178  O OD1 . ASP A 1 424  ? 221.738 -7.930  -15.784 1.00 92.92  ? 491  ASP A OD1 1 
ATOM 3179  O OD2 . ASP A 1 424  ? 220.083 -7.559  -17.152 1.00 90.47  ? 491  ASP A OD2 1 
ATOM 3180  N N   . LEU A 1 425  ? 219.498 -4.950  -12.138 1.00 90.92  ? 492  LEU A N   1 
ATOM 3181  C CA  . LEU A 1 425  ? 218.368 -4.494  -11.374 1.00 91.92  ? 492  LEU A CA  1 
ATOM 3182  C C   . LEU A 1 425  ? 218.598 -3.002  -11.368 1.00 92.92  ? 492  LEU A C   1 
ATOM 3183  O O   . LEU A 1 425  ? 219.736 -2.552  -11.242 1.00 94.14  ? 492  LEU A O   1 
ATOM 3184  C CB  . LEU A 1 425  ? 218.410 -5.052  -9.958  1.00 91.37  ? 492  LEU A CB  1 
ATOM 3185  C CG  . LEU A 1 425  ? 217.920 -6.486  -9.785  1.00 90.99  ? 492  LEU A CG  1 
ATOM 3186  C CD1 . LEU A 1 425  ? 218.379 -7.018  -8.449  1.00 91.10  ? 492  LEU A CD1 1 
ATOM 3187  C CD2 . LEU A 1 425  ? 216.411 -6.526  -9.876  1.00 91.05  ? 492  LEU A CD2 1 
ATOM 3188  N N   . GLN A 1 426  ? 217.526 -2.237  -11.544 1.00 93.77  ? 493  GLN A N   1 
ATOM 3189  C CA  . GLN A 1 426  ? 217.603 -0.776  -11.561 1.00 94.73  ? 493  GLN A CA  1 
ATOM 3190  C C   . GLN A 1 426  ? 216.215 -0.178  -11.728 1.00 93.79  ? 493  GLN A C   1 
ATOM 3191  O O   . GLN A 1 426  ? 215.272 -0.886  -12.063 1.00 94.39  ? 493  GLN A O   1 
ATOM 3192  C CB  . GLN A 1 426  ? 218.506 -0.290  -12.701 1.00 96.96  ? 493  GLN A CB  1 
ATOM 3193  C CG  . GLN A 1 426  ? 218.331 -1.065  -14.008 1.00 98.51  ? 493  GLN A CG  1 
ATOM 3194  C CD  . GLN A 1 426  ? 218.765 -0.278  -15.245 1.00 98.90  ? 493  GLN A CD  1 
ATOM 3195  O OE1 . GLN A 1 426  ? 218.023 0.576   -15.744 1.00 98.50  ? 493  GLN A OE1 1 
ATOM 3196  N NE2 . GLN A 1 426  ? 219.973 -0.561  -15.740 1.00 99.50  ? 493  GLN A NE2 1 
ATOM 3197  N N   . GLU A 1 427  ? 216.102 1.125   -11.501 1.00 92.40  ? 494  GLU A N   1 
ATOM 3198  C CA  . GLU A 1 427  ? 214.832 1.821   -11.618 1.00 91.79  ? 494  GLU A CA  1 
ATOM 3199  C C   . GLU A 1 427  ? 213.843 1.302   -10.592 1.00 92.30  ? 494  GLU A C   1 
ATOM 3200  O O   . GLU A 1 427  ? 212.682 1.035   -10.903 1.00 91.98  ? 494  GLU A O   1 
ATOM 3201  C CB  . GLU A 1 427  ? 214.264 1.683   -13.040 1.00 90.77  ? 494  GLU A CB  1 
ATOM 3202  C CG  . GLU A 1 427  ? 213.690 0.330   -13.437 1.00 88.84  ? 494  GLU A CG  1 
ATOM 3203  C CD  . GLU A 1 427  ? 214.249 -0.167  -14.763 1.00 86.92  ? 494  GLU A CD  1 
ATOM 3204  O OE1 . GLU A 1 427  ? 213.924 -1.299  -15.179 1.00 85.02  ? 494  GLU A OE1 1 
ATOM 3205  O OE2 . GLU A 1 427  ? 215.020 0.576   -15.397 1.00 85.99  ? 494  GLU A OE2 1 
ATOM 3206  N N   . PHE A 1 428  ? 214.327 1.146   -9.364  1.00 92.95  ? 495  PHE A N   1 
ATOM 3207  C CA  . PHE A 1 428  ? 213.499 0.678   -8.263  1.00 93.28  ? 495  PHE A CA  1 
ATOM 3208  C C   . PHE A 1 428  ? 213.400 1.831   -7.286  1.00 95.38  ? 495  PHE A C   1 
ATOM 3209  O O   . PHE A 1 428  ? 214.293 2.678   -7.213  1.00 95.54  ? 495  PHE A O   1 
ATOM 3210  C CB  . PHE A 1 428  ? 214.123 -0.543  -7.569  1.00 90.03  ? 495  PHE A CB  1 
ATOM 3211  C CG  . PHE A 1 428  ? 214.075 -1.808  -8.387  1.00 87.17  ? 495  PHE A CG  1 
ATOM 3212  C CD1 . PHE A 1 428  ? 214.116 -1.755  -9.773  1.00 86.11  ? 495  PHE A CD1 1 
ATOM 3213  C CD2 . PHE A 1 428  ? 214.067 -3.053  -7.770  1.00 87.47  ? 495  PHE A CD2 1 
ATOM 3214  C CE1 . PHE A 1 428  ? 214.155 -2.914  -10.538 1.00 86.47  ? 495  PHE A CE1 1 
ATOM 3215  C CE2 . PHE A 1 428  ? 214.107 -4.220  -8.525  1.00 87.26  ? 495  PHE A CE2 1 
ATOM 3216  C CZ  . PHE A 1 428  ? 214.154 -4.148  -9.914  1.00 86.24  ? 495  PHE A CZ  1 
ATOM 3217  N N   . LYS A 1 429  ? 212.303 1.855   -6.543  1.00 98.06  ? 496  LYS A N   1 
ATOM 3218  C CA  . LYS A 1 429  ? 212.057 2.901   -5.565  1.00 101.26 ? 496  LYS A CA  1 
ATOM 3219  C C   . LYS A 1 429  ? 211.325 2.319   -4.351  1.00 102.19 ? 496  LYS A C   1 
ATOM 3220  O O   . LYS A 1 429  ? 210.846 3.071   -3.495  1.00 102.70 ? 496  LYS A O   1 
ATOM 3221  C CB  . LYS A 1 429  ? 211.190 4.000   -6.199  1.00 102.63 ? 496  LYS A CB  1 
ATOM 3222  C CG  . LYS A 1 429  ? 211.839 5.361   -6.266  1.00 105.21 ? 496  LYS A CG  1 
ATOM 3223  C CD  . LYS A 1 429  ? 212.926 5.422   -7.317  1.00 106.23 ? 496  LYS A CD  1 
ATOM 3224  C CE  . LYS A 1 429  ? 213.771 6.627   -7.033  1.00 106.74 ? 496  LYS A CE  1 
ATOM 3225  N NZ  . LYS A 1 429  ? 212.903 7.720   -6.484  1.00 106.73 ? 496  LYS A NZ  1 
ATOM 3226  N N   . GLN A 1 430  ? 211.261 0.988   -4.258  1.00 103.56 ? 497  GLN A N   1 
ATOM 3227  C CA  . GLN A 1 430  ? 210.516 0.353   -3.171  1.00 104.28 ? 497  GLN A CA  1 
ATOM 3228  C C   . GLN A 1 430  ? 210.756 0.764   -1.730  1.00 104.79 ? 497  GLN A C   1 
ATOM 3229  O O   . GLN A 1 430  ? 209.778 0.964   -1.002  1.00 103.76 ? 497  GLN A O   1 
ATOM 3230  C CB  . GLN A 1 430  ? 210.577 -1.178  -3.250  1.00 103.71 ? 497  GLN A CB  1 
ATOM 3231  C CG  . GLN A 1 430  ? 209.924 -1.872  -2.028  1.00 101.96 ? 497  GLN A CG  1 
ATOM 3232  C CD  . GLN A 1 430  ? 208.451 -1.505  -1.782  1.00 101.20 ? 497  GLN A CD  1 
ATOM 3233  O OE1 . GLN A 1 430  ? 208.051 -0.352  -1.891  1.00 100.29 ? 497  GLN A OE1 1 
ATOM 3234  N NE2 . GLN A 1 430  ? 207.653 -2.496  -1.419  1.00 101.30 ? 497  GLN A NE2 1 
ATOM 3235  N N   . LYS A 1 431  ? 212.006 0.898   -1.284  1.00 105.64 ? 498  LYS A N   1 
ATOM 3236  C CA  . LYS A 1 431  ? 212.151 1.266   0.115   1.00 106.00 ? 498  LYS A CA  1 
ATOM 3237  C C   . LYS A 1 431  ? 213.415 1.763   0.787   1.00 106.90 ? 498  LYS A C   1 
ATOM 3238  O O   . LYS A 1 431  ? 214.514 1.817   0.226   1.00 107.36 ? 498  LYS A O   1 
ATOM 3239  C CB  . LYS A 1 431  ? 211.601 0.136   0.983   1.00 105.29 ? 498  LYS A CB  1 
ATOM 3240  C CG  . LYS A 1 431  ? 210.244 0.416   1.578   1.00 104.54 ? 498  LYS A CG  1 
ATOM 3241  C CD  . LYS A 1 431  ? 210.322 0.485   3.077   1.00 103.61 ? 498  LYS A CD  1 
ATOM 3242  C CE  . LYS A 1 431  ? 210.626 1.875   3.566   1.00 103.31 ? 498  LYS A CE  1 
ATOM 3243  N NZ  . LYS A 1 431  ? 210.398 1.945   5.027   1.00 102.40 ? 498  LYS A NZ  1 
ATOM 3244  N N   . LYS A 1 432  ? 213.158 2.103   2.047   1.00 108.19 ? 499  LYS A N   1 
ATOM 3245  C CA  . LYS A 1 432  ? 214.064 2.635   3.048   1.00 109.52 ? 499  LYS A CA  1 
ATOM 3246  C C   . LYS A 1 432  ? 213.406 3.953   3.460   1.00 111.20 ? 499  LYS A C   1 
ATOM 3247  O O   . LYS A 1 432  ? 213.216 4.855   2.643   1.00 111.93 ? 499  LYS A O   1 
ATOM 3248  C CB  . LYS A 1 432  ? 215.486 2.818   2.502   1.00 108.33 ? 499  LYS A CB  1 
ATOM 3249  C CG  . LYS A 1 432  ? 215.881 4.201   2.060   1.00 106.51 ? 499  LYS A CG  1 
ATOM 3250  C CD  . LYS A 1 432  ? 217.393 4.259   1.897   1.00 106.95 ? 499  LYS A CD  1 
ATOM 3251  C CE  . LYS A 1 432  ? 218.101 4.071   3.239   1.00 106.78 ? 499  LYS A CE  1 
ATOM 3252  N NZ  . LYS A 1 432  ? 219.557 3.811   3.090   1.00 106.31 ? 499  LYS A NZ  1 
ATOM 3253  N N   . ALA A 1 433  ? 213.021 4.011   4.735   1.00 112.41 ? 500  ALA A N   1 
ATOM 3254  C CA  . ALA A 1 433  ? 212.321 5.136   5.372   1.00 113.13 ? 500  ALA A CA  1 
ATOM 3255  C C   . ALA A 1 433  ? 212.784 6.596   5.131   1.00 113.52 ? 500  ALA A C   1 
ATOM 3256  O O   . ALA A 1 433  ? 212.340 7.241   4.179   1.00 113.47 ? 500  ALA A O   1 
ATOM 3257  C CB  . ALA A 1 433  ? 212.232 4.857   6.880   1.00 112.95 ? 500  ALA A CB  1 
ATOM 3258  N N   . LYS A 1 434  ? 213.630 7.122   6.020   1.00 113.14 ? 501  LYS A N   1 
ATOM 3259  C CA  . LYS A 1 434  ? 214.158 8.498   5.931   1.00 112.52 ? 501  LYS A CA  1 
ATOM 3260  C C   . LYS A 1 434  ? 213.209 9.663   6.322   1.00 112.36 ? 501  LYS A C   1 
ATOM 3261  O O   . LYS A 1 434  ? 212.424 9.578   7.271   1.00 113.36 ? 501  LYS A O   1 
ATOM 3262  C CB  . LYS A 1 434  ? 214.712 8.764   4.513   1.00 111.31 ? 501  LYS A CB  1 
ATOM 3263  C CG  . LYS A 1 434  ? 216.088 8.162   4.215   1.00 109.99 ? 501  LYS A CG  1 
ATOM 3264  C CD  . LYS A 1 434  ? 217.165 9.242   4.091   1.00 110.19 ? 501  LYS A CD  1 
ATOM 3265  C CE  . LYS A 1 434  ? 217.721 9.317   2.675   1.00 109.57 ? 501  LYS A CE  1 
ATOM 3266  N NZ  . LYS A 1 434  ? 216.669 9.629   1.670   1.00 110.56 ? 501  LYS A NZ  1 
ATOM 3267  N N   . LYS A 1 435  ? 213.355 10.751  5.566   1.00 110.95 ? 502  LYS A N   1 
ATOM 3268  C CA  . LYS A 1 435  ? 212.631 12.031  5.643   1.00 108.93 ? 502  LYS A CA  1 
ATOM 3269  C C   . LYS A 1 435  ? 211.182 12.069  6.151   1.00 107.73 ? 502  LYS A C   1 
ATOM 3270  O O   . LYS A 1 435  ? 210.872 12.627  7.207   1.00 107.67 ? 502  LYS A O   1 
ATOM 3271  C CB  . LYS A 1 435  ? 212.631 12.651  4.237   1.00 108.96 ? 502  LYS A CB  1 
ATOM 3272  C CG  . LYS A 1 435  ? 211.772 11.814  3.275   1.00 108.73 ? 502  LYS A CG  1 
ATOM 3273  C CD  . LYS A 1 435  ? 211.580 12.387  1.907   1.00 108.38 ? 502  LYS A CD  1 
ATOM 3274  C CE  . LYS A 1 435  ? 210.112 12.515  1.574   1.00 107.68 ? 502  LYS A CE  1 
ATOM 3275  N NZ  . LYS A 1 435  ? 209.666 13.929  1.454   1.00 107.14 ? 502  LYS A NZ  1 
ATOM 3276  N N   . VAL A 1 436  ? 210.315 11.518  5.306   1.00 105.92 ? 503  VAL A N   1 
ATOM 3277  C CA  . VAL A 1 436  ? 208.861 11.415  5.443   1.00 103.88 ? 503  VAL A CA  1 
ATOM 3278  C C   . VAL A 1 436  ? 208.090 12.014  6.587   1.00 103.15 ? 503  VAL A C   1 
ATOM 3279  O O   . VAL A 1 436  ? 208.385 11.759  7.758   1.00 103.74 ? 503  VAL A O   1 
ATOM 3280  C CB  . VAL A 1 436  ? 208.417 10.023  5.461   1.00 103.63 ? 503  VAL A CB  1 
ATOM 3281  C CG1 . VAL A 1 436  ? 209.243 9.281   6.492   1.00 103.11 ? 503  VAL A CG1 1 
ATOM 3282  C CG2 . VAL A 1 436  ? 206.907 9.992   5.801   1.00 102.65 ? 503  VAL A CG2 1 
ATOM 3283  N N   . LYS A 1 437  ? 207.007 12.685  6.205   1.00 101.01 ? 504  LYS A N   1 
ATOM 3284  C CA  . LYS A 1 437  ? 206.104 13.355  7.124   1.00 98.44  ? 504  LYS A CA  1 
ATOM 3285  C C   . LYS A 1 437  ? 206.768 14.651  7.518   1.00 97.26  ? 504  LYS A C   1 
ATOM 3286  O O   . LYS A 1 437  ? 206.208 15.461  8.251   1.00 96.59  ? 504  LYS A O   1 
ATOM 3287  C CB  . LYS A 1 437  ? 205.843 12.510  8.366   1.00 97.24  ? 504  LYS A CB  1 
ATOM 3288  C CG  . LYS A 1 437  ? 204.919 13.199  9.348   1.00 95.23  ? 504  LYS A CG  1 
ATOM 3289  C CD  . LYS A 1 437  ? 203.618 13.608  8.660   1.00 92.55  ? 504  LYS A CD  1 
ATOM 3290  C CE  . LYS A 1 437  ? 202.682 14.317  9.617   1.00 91.10  ? 504  LYS A CE  1 
ATOM 3291  N NZ  . LYS A 1 437  ? 202.455 13.503  10.837  1.00 89.78  ? 504  LYS A NZ  1 
ATOM 3292  N N   . LYS A 1 438  ? 207.981 14.816  7.008   1.00 96.07  ? 505  LYS A N   1 
ATOM 3293  C CA  . LYS A 1 438  ? 208.821 15.982  7.226   1.00 94.59  ? 505  LYS A CA  1 
ATOM 3294  C C   . LYS A 1 438  ? 209.736 15.991  6.004   1.00 93.69  ? 505  LYS A C   1 
ATOM 3295  O O   . LYS A 1 438  ? 210.169 14.939  5.550   1.00 92.08  ? 505  LYS A O   1 
ATOM 3296  C CB  . LYS A 1 438  ? 209.659 15.807  8.490   1.00 94.66  ? 505  LYS A CB  1 
ATOM 3297  C CG  . LYS A 1 438  ? 208.860 15.572  9.755   1.00 94.55  ? 505  LYS A CG  1 
ATOM 3298  C CD  . LYS A 1 438  ? 209.534 14.504  10.600  1.00 93.85  ? 505  LYS A CD  1 
ATOM 3299  C CE  . LYS A 1 438  ? 209.020 14.520  12.020  1.00 92.94  ? 505  LYS A CE  1 
ATOM 3300  N NZ  . LYS A 1 438  ? 209.620 15.630  12.788  1.00 92.19  ? 505  LYS A NZ  1 
ATOM 3301  N N   . GLU A 1 439  ? 210.013 17.177  5.474   1.00 93.73  ? 506  GLU A N   1 
ATOM 3302  C CA  . GLU A 1 439  ? 210.864 17.367  4.288   1.00 93.72  ? 506  GLU A CA  1 
ATOM 3303  C C   . GLU A 1 439  ? 210.569 18.760  3.733   1.00 93.80  ? 506  GLU A C   1 
ATOM 3304  O O   . GLU A 1 439  ? 209.513 19.328  4.005   1.00 93.94  ? 506  GLU A O   1 
ATOM 3305  C CB  . GLU A 1 439  ? 210.557 16.313  3.200   1.00 92.55  ? 506  GLU A CB  1 
ATOM 3306  C CG  . GLU A 1 439  ? 211.392 16.450  1.914   1.00 90.80  ? 506  GLU A CG  1 
ATOM 3307  C CD  . GLU A 1 439  ? 212.578 15.513  1.868   1.00 89.66  ? 506  GLU A CD  1 
ATOM 3308  O OE1 . GLU A 1 439  ? 212.494 14.495  1.174   1.00 88.60  ? 506  GLU A OE1 1 
ATOM 3309  O OE2 . GLU A 1 439  ? 213.596 15.788  2.526   1.00 88.29  ? 506  GLU A OE2 1 
ATOM 3310  N N   . PRO A 1 440  ? 211.504 19.342  2.973   1.00 93.69  ? 507  PRO A N   1 
ATOM 3311  C CA  . PRO A 1 440  ? 211.133 20.670  2.484   1.00 94.23  ? 507  PRO A CA  1 
ATOM 3312  C C   . PRO A 1 440  ? 211.131 20.954  0.968   1.00 95.13  ? 507  PRO A C   1 
ATOM 3313  O O   . PRO A 1 440  ? 212.095 20.659  0.247   1.00 96.05  ? 507  PRO A O   1 
ATOM 3314  C CB  . PRO A 1 440  ? 212.095 21.567  3.239   1.00 92.94  ? 507  PRO A CB  1 
ATOM 3315  C CG  . PRO A 1 440  ? 213.364 20.767  3.187   1.00 92.35  ? 507  PRO A CG  1 
ATOM 3316  C CD  . PRO A 1 440  ? 212.934 19.306  3.330   1.00 92.82  ? 507  PRO A CD  1 
ATOM 3317  N N   . ALA A 1 441  ? 210.017 21.545  0.522   1.00 95.08  ? 508  ALA A N   1 
ATOM 3318  C CA  . ALA A 1 441  ? 209.749 21.977  -0.859  1.00 93.59  ? 508  ALA A CA  1 
ATOM 3319  C C   . ALA A 1 441  ? 210.433 21.255  -2.028  1.00 92.25  ? 508  ALA A C   1 
ATOM 3320  O O   . ALA A 1 441  ? 211.461 21.690  -2.533  1.00 92.35  ? 508  ALA A O   1 
ATOM 3321  C CB  . ALA A 1 441  ? 210.014 23.472  -0.952  1.00 94.51  ? 508  ALA A CB  1 
ATOM 3322  N N   . THR A 1 442  ? 209.816 20.182  -2.495  1.00 90.54  ? 509  THR A N   1 
ATOM 3323  C CA  . THR A 1 442  ? 210.382 19.390  -3.579  1.00 89.12  ? 509  THR A CA  1 
ATOM 3324  C C   . THR A 1 442  ? 210.651 20.037  -4.933  1.00 88.54  ? 509  THR A C   1 
ATOM 3325  O O   . THR A 1 442  ? 209.851 20.825  -5.454  1.00 87.77  ? 509  THR A O   1 
ATOM 3326  C CB  . THR A 1 442  ? 209.527 18.159  -3.834  1.00 88.58  ? 509  THR A CB  1 
ATOM 3327  O OG1 . THR A 1 442  ? 208.201 18.560  -4.211  1.00 87.37  ? 509  THR A OG1 1 
ATOM 3328  C CG2 . THR A 1 442  ? 209.479 17.309  -2.579  1.00 88.68  ? 509  THR A CG2 1 
ATOM 3329  N N   . ALA A 1 443  ? 211.789 19.646  -5.501  1.00 87.74  ? 510  ALA A N   1 
ATOM 3330  C CA  . ALA A 1 443  ? 212.247 20.099  -6.811  1.00 87.28  ? 510  ALA A CA  1 
ATOM 3331  C C   . ALA A 1 443  ? 211.939 19.001  -7.849  1.00 87.24  ? 510  ALA A C   1 
ATOM 3332  O O   . ALA A 1 443  ? 212.817 18.599  -8.622  1.00 89.31  ? 510  ALA A O   1 
ATOM 3333  C CB  . ALA A 1 443  ? 213.744 20.369  -6.758  1.00 87.29  ? 510  ALA A CB  1 
ATOM 3334  N N   . SER A 1 444  ? 210.678 18.546  -7.853  1.00 85.63  ? 511  SER A N   1 
ATOM 3335  C CA  . SER A 1 444  ? 210.155 17.479  -8.726  1.00 83.61  ? 511  SER A CA  1 
ATOM 3336  C C   . SER A 1 444  ? 210.836 16.123  -8.497  1.00 83.15  ? 511  SER A C   1 
ATOM 3337  O O   . SER A 1 444  ? 210.858 15.270  -9.387  1.00 82.81  ? 511  SER A O   1 
ATOM 3338  C CB  . SER A 1 444  ? 210.230 17.879  -10.212 1.00 82.88  ? 511  SER A CB  1 
ATOM 3339  O OG  . SER A 1 444  ? 211.500 18.378  -10.601 1.00 81.21  ? 511  SER A OG  1 
ATOM 3340  N N   . LYS A 1 445  ? 211.349 15.950  -7.271  1.00 82.24  ? 512  LYS A N   1 
ATOM 3341  C CA  . LYS A 1 445  ? 212.071 14.764  -6.766  1.00 82.17  ? 512  LYS A CA  1 
ATOM 3342  C C   . LYS A 1 445  ? 211.124 14.037  -5.823  1.00 83.20  ? 512  LYS A C   1 
ATOM 3343  O O   . LYS A 1 445  ? 211.099 14.357  -4.634  1.00 81.93  ? 512  LYS A O   1 
ATOM 3344  C CB  . LYS A 1 445  ? 213.257 15.230  -5.931  1.00 81.45  ? 512  LYS A CB  1 
ATOM 3345  C CG  . LYS A 1 445  ? 214.527 14.495  -6.135  1.00 80.67  ? 512  LYS A CG  1 
ATOM 3346  C CD  . LYS A 1 445  ? 215.338 14.507  -4.864  1.00 80.84  ? 512  LYS A CD  1 
ATOM 3347  C CE  . LYS A 1 445  ? 214.903 13.400  -3.922  1.00 82.44  ? 512  LYS A CE  1 
ATOM 3348  N NZ  . LYS A 1 445  ? 213.619 13.659  -3.234  1.00 82.87  ? 512  LYS A NZ  1 
ATOM 3349  N N   . LEU A 1 446  ? 210.372 13.050  -6.293  1.00 85.98  ? 513  LEU A N   1 
ATOM 3350  C CA  . LEU A 1 446  ? 209.422 12.453  -5.372  1.00 89.19  ? 513  LEU A CA  1 
ATOM 3351  C C   . LEU A 1 446  ? 209.255 10.920  -5.347  1.00 90.91  ? 513  LEU A C   1 
ATOM 3352  O O   . LEU A 1 446  ? 208.223 10.368  -5.730  1.00 90.43  ? 513  LEU A O   1 
ATOM 3353  C CB  . LEU A 1 446  ? 208.102 13.180  -5.595  1.00 89.33  ? 513  LEU A CB  1 
ATOM 3354  C CG  . LEU A 1 446  ? 208.267 14.638  -6.055  1.00 90.78  ? 513  LEU A CG  1 
ATOM 3355  C CD1 . LEU A 1 446  ? 207.009 15.185  -6.701  1.00 91.86  ? 513  LEU A CD1 1 
ATOM 3356  C CD2 . LEU A 1 446  ? 208.646 15.464  -4.863  1.00 90.08  ? 513  LEU A CD2 1 
ATOM 3357  N N   . PRO A 1 447  ? 210.267 10.226  -4.805  1.00 92.50  ? 514  PRO A N   1 
ATOM 3358  C CA  . PRO A 1 447  ? 210.372 8.772   -4.659  1.00 93.03  ? 514  PRO A CA  1 
ATOM 3359  C C   . PRO A 1 447  ? 209.054 8.136   -4.300  1.00 92.95  ? 514  PRO A C   1 
ATOM 3360  O O   . PRO A 1 447  ? 208.410 8.548   -3.335  1.00 91.58  ? 514  PRO A O   1 
ATOM 3361  C CB  . PRO A 1 447  ? 211.372 8.613   -3.519  1.00 94.47  ? 514  PRO A CB  1 
ATOM 3362  C CG  . PRO A 1 447  ? 211.107 9.829   -2.682  1.00 94.22  ? 514  PRO A CG  1 
ATOM 3363  C CD  . PRO A 1 447  ? 211.081 10.881  -3.767  1.00 93.23  ? 514  PRO A CD  1 
ATOM 3364  N N   . ILE A 1 448  ? 208.631 7.136   -5.060  1.00 94.29  ? 515  ILE A N   1 
ATOM 3365  C CA  . ILE A 1 448  ? 207.386 6.494   -4.687  1.00 96.24  ? 515  ILE A CA  1 
ATOM 3366  C C   . ILE A 1 448  ? 207.715 5.268   -3.879  1.00 95.89  ? 515  ILE A C   1 
ATOM 3367  O O   . ILE A 1 448  ? 208.810 5.172   -3.326  1.00 95.92  ? 515  ILE A O   1 
ATOM 3368  C CB  . ILE A 1 448  ? 206.518 6.126   -5.876  1.00 97.83  ? 515  ILE A CB  1 
ATOM 3369  C CG1 . ILE A 1 448  ? 206.422 7.324   -6.798  1.00 98.88  ? 515  ILE A CG1 1 
ATOM 3370  C CG2 . ILE A 1 448  ? 205.106 5.766   -5.409  1.00 98.13  ? 515  ILE A CG2 1 
ATOM 3371  C CD1 . ILE A 1 448  ? 207.622 7.463   -7.668  1.00 91.71  ? 515  ILE A CD1 1 
ATOM 3372  N N   . GLU A 1 449  ? 206.797 4.315   -3.826  1.00 95.05  ? 516  GLU A N   1 
ATOM 3373  C CA  . GLU A 1 449  ? 207.037 3.161   -2.988  1.00 93.12  ? 516  GLU A CA  1 
ATOM 3374  C C   . GLU A 1 449  ? 207.469 3.848   -1.683  1.00 91.53  ? 516  GLU A C   1 
ATOM 3375  O O   . GLU A 1 449  ? 206.739 4.687   -1.192  1.00 90.89  ? 516  GLU A O   1 
ATOM 3376  C CB  . GLU A 1 449  ? 208.147 2.290   -3.568  1.00 92.90  ? 516  GLU A CB  1 
ATOM 3377  C CG  . GLU A 1 449  ? 207.910 1.746   -4.973  1.00 91.71  ? 516  GLU A CG  1 
ATOM 3378  C CD  . GLU A 1 449  ? 206.671 0.870   -5.091  1.00 91.37  ? 516  GLU A CD  1 
ATOM 3379  O OE1 . GLU A 1 449  ? 206.384 0.093   -4.149  1.00 91.53  ? 516  GLU A OE1 1 
ATOM 3380  O OE2 . GLU A 1 449  ? 205.992 0.956   -6.141  1.00 91.00  ? 516  GLU A OE2 1 
ATOM 3381  N N   . GLY A 1 450  ? 208.669 3.590   -1.176  1.00 90.01  ? 517  GLY A N   1 
ATOM 3382  C CA  . GLY A 1 450  ? 209.057 4.209   0.081   1.00 88.41  ? 517  GLY A CA  1 
ATOM 3383  C C   . GLY A 1 450  ? 208.023 3.657   1.049   1.00 87.11  ? 517  GLY A C   1 
ATOM 3384  O O   . GLY A 1 450  ? 206.853 3.998   0.909   1.00 87.61  ? 517  GLY A O   1 
ATOM 3385  N N   . ALA A 1 451  ? 208.398 2.846   2.039   1.00 85.51  ? 518  ALA A N   1 
ATOM 3386  C CA  . ALA A 1 451  ? 207.354 2.276   2.883   1.00 83.66  ? 518  ALA A CA  1 
ATOM 3387  C C   . ALA A 1 451  ? 207.006 2.683   4.319   1.00 82.00  ? 518  ALA A C   1 
ATOM 3388  O O   . ALA A 1 451  ? 205.963 3.237   4.506   1.00 81.12  ? 518  ALA A O   1 
ATOM 3389  C CB  . ALA A 1 451  ? 207.448 0.760   2.810   1.00 84.28  ? 518  ALA A CB  1 
ATOM 3390  N N   . GLY A 1 452  ? 207.816 2.387   5.330   1.00 79.91  ? 519  GLY A N   1 
ATOM 3391  C CA  . GLY A 1 452  ? 207.432 2.711   6.713   1.00 77.60  ? 519  GLY A CA  1 
ATOM 3392  C C   . GLY A 1 452  ? 207.324 4.125   7.255   1.00 75.73  ? 519  GLY A C   1 
ATOM 3393  O O   . GLY A 1 452  ? 206.285 4.585   7.730   1.00 75.04  ? 519  GLY A O   1 
ATOM 3394  N N   . ALA A 1 453  ? 208.442 4.815   7.230   1.00 75.30  ? 520  ALA A N   1 
ATOM 3395  C CA  . ALA A 1 453  ? 208.448 6.173   7.693   1.00 76.17  ? 520  ALA A CA  1 
ATOM 3396  C C   . ALA A 1 453  ? 207.740 7.104   6.689   1.00 77.41  ? 520  ALA A C   1 
ATOM 3397  O O   . ALA A 1 453  ? 206.927 7.919   7.113   1.00 76.25  ? 520  ALA A O   1 
ATOM 3398  C CB  . ALA A 1 453  ? 209.889 6.628   7.940   1.00 75.59  ? 520  ALA A CB  1 
ATOM 3399  N N   . PRO A 1 454  ? 208.021 6.976   5.353   1.00 79.49  ? 521  PRO A N   1 
ATOM 3400  C CA  . PRO A 1 454  ? 207.495 7.749   4.198   1.00 80.13  ? 521  PRO A CA  1 
ATOM 3401  C C   . PRO A 1 454  ? 206.011 7.943   3.844   1.00 80.37  ? 521  PRO A C   1 
ATOM 3402  O O   . PRO A 1 454  ? 205.707 8.672   2.889   1.00 80.17  ? 521  PRO A O   1 
ATOM 3403  C CB  . PRO A 1 454  ? 208.257 7.161   2.996   1.00 80.59  ? 521  PRO A CB  1 
ATOM 3404  C CG  . PRO A 1 454  ? 209.502 6.636   3.584   1.00 80.69  ? 521  PRO A CG  1 
ATOM 3405  C CD  . PRO A 1 454  ? 209.019 6.002   4.867   1.00 80.53  ? 521  PRO A CD  1 
ATOM 3406  N N   . GLY A 1 455  ? 205.093 7.374   4.621   1.00 80.62  ? 522  GLY A N   1 
ATOM 3407  C CA  . GLY A 1 455  ? 203.683 7.442   4.250   1.00 80.85  ? 522  GLY A CA  1 
ATOM 3408  C C   . GLY A 1 455  ? 202.591 8.138   5.025   1.00 81.16  ? 522  GLY A C   1 
ATOM 3409  O O   . GLY A 1 455  ? 201.557 7.556   5.368   1.00 80.18  ? 522  GLY A O   1 
ATOM 3410  N N   . ASP A 1 456  ? 202.843 9.401   5.295   1.00 82.51  ? 523  ASP A N   1 
ATOM 3411  C CA  . ASP A 1 456  ? 201.893 10.286  5.914   1.00 83.67  ? 523  ASP A CA  1 
ATOM 3412  C C   . ASP A 1 456  ? 202.001 11.145  4.676   1.00 83.65  ? 523  ASP A C   1 
ATOM 3413  O O   . ASP A 1 456  ? 202.728 12.136  4.635   1.00 83.02  ? 523  ASP A O   1 
ATOM 3414  C CB  . ASP A 1 456  ? 202.508 10.885  7.166   1.00 84.11  ? 523  ASP A CB  1 
ATOM 3415  C CG  . ASP A 1 456  ? 202.707 9.836   8.236   1.00 84.35  ? 523  ASP A CG  1 
ATOM 3416  O OD1 . ASP A 1 456  ? 202.032 8.790   8.134   1.00 83.46  ? 523  ASP A OD1 1 
ATOM 3417  O OD2 . ASP A 1 456  ? 203.510 10.035  9.167   1.00 85.13  ? 523  ASP A OD2 1 
ATOM 3418  N N   . PRO A 1 457  ? 201.324 10.693  3.604   1.00 83.71  ? 524  PRO A N   1 
ATOM 3419  C CA  . PRO A 1 457  ? 201.274 11.305  2.283   1.00 84.04  ? 524  PRO A CA  1 
ATOM 3420  C C   . PRO A 1 457  ? 200.076 12.188  2.153   1.00 84.05  ? 524  PRO A C   1 
ATOM 3421  O O   . PRO A 1 457  ? 198.959 11.788  2.486   1.00 84.27  ? 524  PRO A O   1 
ATOM 3422  C CB  . PRO A 1 457  ? 201.141 10.102  1.384   1.00 84.72  ? 524  PRO A CB  1 
ATOM 3423  C CG  . PRO A 1 457  ? 200.069 9.299   2.152   1.00 84.18  ? 524  PRO A CG  1 
ATOM 3424  C CD  . PRO A 1 457  ? 200.370 9.563   3.652   1.00 83.54  ? 524  PRO A CD  1 
ATOM 3425  N N   . MET A 1 458  ? 200.279 13.387  1.651   1.00 84.21  ? 525  MET A N   1 
ATOM 3426  C CA  . MET A 1 458  ? 199.135 14.237  1.508   1.00 85.56  ? 525  MET A CA  1 
ATOM 3427  C C   . MET A 1 458  ? 199.064 14.878  0.120   1.00 86.99  ? 525  MET A C   1 
ATOM 3428  O O   . MET A 1 458  ? 200.012 14.807  -0.655  1.00 86.28  ? 525  MET A O   1 
ATOM 3429  C CB  . MET A 1 458  ? 199.110 15.242  2.682   1.00 85.04  ? 525  MET A CB  1 
ATOM 3430  C CG  . MET A 1 458  ? 198.307 14.701  3.927   1.00 84.61  ? 525  MET A CG  1 
ATOM 3431  S SD  . MET A 1 458  ? 198.759 15.192  5.655   1.00 85.56  ? 525  MET A SD  1 
ATOM 3432  C CE  . MET A 1 458  ? 199.814 13.843  6.117   1.00 83.53  ? 525  MET A CE  1 
ATOM 3433  N N   . ASP A 1 459  ? 197.894 15.445  -0.178  1.00 72.67  ? 526  ASP A N   1 
ATOM 3434  C CA  . ASP A 1 459  ? 197.514 16.136  -1.432  1.00 72.67  ? 526  ASP A CA  1 
ATOM 3435  C C   . ASP A 1 459  ? 198.473 17.184  -1.938  1.00 72.67  ? 526  ASP A C   1 
ATOM 3436  O O   . ASP A 1 459  ? 199.265 17.745  -1.195  1.00 72.67  ? 526  ASP A O   1 
ATOM 3437  C CB  . ASP A 1 459  ? 196.144 16.827  -1.233  1.00 72.67  ? 526  ASP A CB  1 
ATOM 3438  C CG  . ASP A 1 459  ? 195.866 18.013  -2.219  1.00 72.67  ? 526  ASP A CG  1 
ATOM 3439  O OD1 . ASP A 1 459  ? 194.747 18.077  -2.773  1.00 72.67  ? 526  ASP A OD1 1 
ATOM 3440  O OD2 . ASP A 1 459  ? 196.703 18.918  -2.408  1.00 72.67  ? 526  ASP A OD2 1 
ATOM 3441  N N   . GLN A 1 460  ? 198.351 17.443  -3.235  1.00 64.67  ? 527  GLN A N   1 
ATOM 3442  C CA  . GLN A 1 460  ? 199.107 18.463  -3.960  1.00 64.67  ? 527  GLN A CA  1 
ATOM 3443  C C   . GLN A 1 460  ? 199.847 18.063  -5.217  1.00 64.67  ? 527  GLN A C   1 
ATOM 3444  O O   . GLN A 1 460  ? 199.939 16.904  -5.598  1.00 64.67  ? 527  GLN A O   1 
ATOM 3445  C CB  . GLN A 1 460  ? 200.126 19.158  -3.054  1.00 64.67  ? 527  GLN A CB  1 
ATOM 3446  C CG  . GLN A 1 460  ? 200.124 20.682  -3.118  1.00 64.67  ? 527  GLN A CG  1 
ATOM 3447  C CD  . GLN A 1 460  ? 200.580 21.284  -1.816  1.00 64.67  ? 527  GLN A CD  1 
ATOM 3448  O OE1 . GLN A 1 460  ? 199.949 21.097  -0.777  1.00 64.67  ? 527  GLN A OE1 1 
ATOM 3449  N NE2 . GLN A 1 460  ? 201.687 22.000  -1.856  1.00 64.67  ? 527  GLN A NE2 1 
ATOM 3450  N N   . GLU A 1 461  ? 200.330 19.127  -5.845  1.00 78.67  ? 528  GLU A N   1 
ATOM 3451  C CA  . GLU A 1 461  ? 201.160 19.161  -7.027  1.00 78.67  ? 528  GLU A CA  1 
ATOM 3452  C C   . GLU A 1 461  ? 200.850 18.421  -8.324  1.00 78.67  ? 528  GLU A C   1 
ATOM 3453  O O   . GLU A 1 461  ? 201.719 17.734  -8.856  1.00 78.67  ? 528  GLU A O   1 
ATOM 3454  C CB  . GLU A 1 461  ? 202.576 18.815  -6.614  1.00 78.67  ? 528  GLU A CB  1 
ATOM 3455  C CG  . GLU A 1 461  ? 203.593 19.831  -7.129  1.00 78.67  ? 528  GLU A CG  1 
ATOM 3456  C CD  . GLU A 1 461  ? 203.205 21.305  -6.876  1.00 78.67  ? 528  GLU A CD  1 
ATOM 3457  O OE1 . GLU A 1 461  ? 204.104 22.072  -6.479  1.00 78.67  ? 528  GLU A OE1 1 
ATOM 3458  O OE2 . GLU A 1 461  ? 202.033 21.708  -7.074  1.00 78.67  ? 528  GLU A OE2 1 
ATOM 3459  N N   . ASP A 1 462  ? 199.655 18.596  -8.876  1.00 82.67  ? 529  ASP A N   1 
ATOM 3460  C CA  . ASP A 1 462  ? 199.313 17.973  -10.151 1.00 82.67  ? 529  ASP A CA  1 
ATOM 3461  C C   . ASP A 1 462  ? 198.210 18.759  -10.838 1.00 82.67  ? 529  ASP A C   1 
ATOM 3462  O O   . ASP A 1 462  ? 197.098 18.920  -10.332 1.00 82.67  ? 529  ASP A O   1 
ATOM 3463  C CB  . ASP A 1 462  ? 198.915 16.503  -9.980  1.00 82.67  ? 529  ASP A CB  1 
ATOM 3464  C CG  . ASP A 1 462  ? 200.062 15.534  -10.306 1.00 82.67  ? 529  ASP A CG  1 
ATOM 3465  O OD1 . ASP A 1 462  ? 199.782 14.428  -10.823 1.00 82.67  ? 529  ASP A OD1 1 
ATOM 3466  O OD2 . ASP A 1 462  ? 201.227 15.856  -10.025 1.00 82.67  ? 529  ASP A OD2 1 
ATOM 3467  N N   . LEU A 1 463  ? 198.549 19.234  -12.024 1.00 91.90  ? 530  LEU A N   1 
ATOM 3468  C CA  . LEU A 1 463  ? 197.642 20.037  -12.802 1.00 93.16  ? 530  LEU A CA  1 
ATOM 3469  C C   . LEU A 1 463  ? 198.284 20.413  -14.144 1.00 100.09 ? 530  LEU A C   1 
ATOM 3470  O O   . LEU A 1 463  ? 199.373 19.927  -14.474 1.00 99.54  ? 530  LEU A O   1 
ATOM 3471  C CB  . LEU A 1 463  ? 197.268 21.282  -11.992 1.00 91.43  ? 530  LEU A CB  1 
ATOM 3472  C CG  . LEU A 1 463  ? 195.955 21.917  -12.422 1.00 91.88  ? 530  LEU A CG  1 
ATOM 3473  C CD1 . LEU A 1 463  ? 195.040 20.828  -12.946 1.00 91.76  ? 530  LEU A CD1 1 
ATOM 3474  C CD2 . LEU A 1 463  ? 195.340 22.659  -11.251 1.00 92.32  ? 530  LEU A CD2 1 
ATOM 3475  N N   . GLY A 1 464  ? 197.617 21.276  -14.912 1.00 98.87  ? 531  GLY A N   1 
ATOM 3476  C CA  . GLY A 1 464  ? 198.148 21.664  -16.209 1.00 96.34  ? 531  GLY A CA  1 
ATOM 3477  C C   . GLY A 1 464  ? 198.113 23.131  -16.615 1.00 94.37  ? 531  GLY A C   1 
ATOM 3478  O O   . GLY A 1 464  ? 197.343 23.936  -16.089 1.00 92.02  ? 531  GLY A O   1 
ATOM 3479  N N   . PRO A 1 465  ? 198.973 23.498  -17.574 1.00 93.88  ? 532  PRO A N   1 
ATOM 3480  C CA  . PRO A 1 465  ? 199.137 24.840  -18.139 1.00 93.74  ? 532  PRO A CA  1 
ATOM 3481  C C   . PRO A 1 465  ? 198.088 25.552  -19.002 1.00 93.62  ? 532  PRO A C   1 
ATOM 3482  O O   . PRO A 1 465  ? 197.237 24.960  -19.685 1.00 92.79  ? 532  PRO A O   1 
ATOM 3483  C CB  . PRO A 1 465  ? 200.453 24.723  -18.916 1.00 93.79  ? 532  PRO A CB  1 
ATOM 3484  C CG  . PRO A 1 465  ? 201.232 23.788  -18.092 1.00 94.27  ? 532  PRO A CG  1 
ATOM 3485  C CD  . PRO A 1 465  ? 200.203 22.711  -17.794 1.00 94.66  ? 532  PRO A CD  1 
ATOM 3486  N N   . CYS A 1 466  ? 198.194 26.870  -18.908 1.00 94.04  ? 533  CYS A N   1 
ATOM 3487  C CA  . CYS A 1 466  ? 197.464 27.812  -19.715 1.00 94.35  ? 533  CYS A CA  1 
ATOM 3488  C C   . CYS A 1 466  ? 198.775 27.884  -20.457 1.00 94.47  ? 533  CYS A C   1 
ATOM 3489  O O   . CYS A 1 466  ? 199.055 27.040  -21.303 1.00 94.16  ? 533  CYS A O   1 
ATOM 3490  C CB  . CYS A 1 466  ? 197.201 29.091  -18.936 1.00 94.12  ? 533  CYS A CB  1 
ATOM 3491  S SG  . CYS A 1 466  ? 195.873 28.878  -17.748 1.00 93.84  ? 533  CYS A SG  1 
ATOM 3492  N N   . SER A 1 467  ? 199.623 28.829  -20.076 1.00 95.63  ? 534  SER A N   1 
ATOM 3493  C CA  . SER A 1 467  ? 200.954 28.900  -20.667 1.00 96.58  ? 534  SER A CA  1 
ATOM 3494  C C   . SER A 1 467  ? 200.996 28.621  -22.175 1.00 96.93  ? 534  SER A C   1 
ATOM 3495  O O   . SER A 1 467  ? 200.253 29.235  -22.940 1.00 95.63  ? 534  SER A O   1 
ATOM 3496  C CB  . SER A 1 467  ? 201.871 27.915  -19.914 1.00 96.49  ? 534  SER A CB  1 
ATOM 3497  O OG  . SER A 1 467  ? 203.093 27.668  -20.591 1.00 98.16  ? 534  SER A OG  1 
ATOM 3498  N N   . GLU A 1 468  ? 201.843 27.688  -22.608 1.00 98.46  ? 535  GLU A N   1 
ATOM 3499  C CA  . GLU A 1 468  ? 201.941 27.436  -24.034 1.00 100.40 ? 535  GLU A CA  1 
ATOM 3500  C C   . GLU A 1 468  ? 202.409 26.093  -24.550 1.00 101.56 ? 535  GLU A C   1 
ATOM 3501  O O   . GLU A 1 468  ? 202.961 25.266  -23.819 1.00 101.24 ? 535  GLU A O   1 
ATOM 3502  C CB  . GLU A 1 468  ? 202.819 28.507  -24.673 1.00 100.69 ? 535  GLU A CB  1 
ATOM 3503  C CG  . GLU A 1 468  ? 202.054 29.467  -25.551 1.00 101.64 ? 535  GLU A CG  1 
ATOM 3504  C CD  . GLU A 1 468  ? 202.247 30.915  -25.152 1.00 102.03 ? 535  GLU A CD  1 
ATOM 3505  O OE1 . GLU A 1 468  ? 203.235 31.530  -25.600 1.00 102.73 ? 535  GLU A OE1 1 
ATOM 3506  O OE2 . GLU A 1 468  ? 201.417 31.438  -24.379 1.00 101.52 ? 535  GLU A OE2 1 
ATOM 3507  N N   . GLU A 1 469  ? 202.177 25.933  -25.855 1.00 103.00 ? 536  GLU A N   1 
ATOM 3508  C CA  . GLU A 1 469  ? 202.538 24.761  -26.648 1.00 104.50 ? 536  GLU A CA  1 
ATOM 3509  C C   . GLU A 1 469  ? 203.535 25.241  -27.729 1.00 104.57 ? 536  GLU A C   1 
ATOM 3510  O O   . GLU A 1 469  ? 203.391 26.338  -28.277 1.00 104.63 ? 536  GLU A O   1 
ATOM 3511  C CB  . GLU A 1 469  ? 201.285 24.133  -27.283 1.00 105.48 ? 536  GLU A CB  1 
ATOM 3512  C CG  . GLU A 1 469  ? 199.940 24.860  -27.032 1.00 106.34 ? 536  GLU A CG  1 
ATOM 3513  C CD  . GLU A 1 469  ? 199.276 24.534  -25.687 1.00 106.18 ? 536  GLU A CD  1 
ATOM 3514  O OE1 . GLU A 1 469  ? 199.601 23.498  -25.078 1.00 106.10 ? 536  GLU A OE1 1 
ATOM 3515  O OE2 . GLU A 1 469  ? 198.404 25.310  -25.242 1.00 106.64 ? 536  GLU A OE2 1 
ATOM 3516  N N   . GLU A 1 470  ? 204.513 24.389  -28.037 1.00 104.39 ? 537  GLU A N   1 
ATOM 3517  C CA  . GLU A 1 470  ? 205.651 24.651  -28.949 1.00 103.54 ? 537  GLU A CA  1 
ATOM 3518  C C   . GLU A 1 470  ? 205.697 24.999  -30.467 1.00 103.11 ? 537  GLU A C   1 
ATOM 3519  O O   . GLU A 1 470  ? 206.423 25.925  -30.874 1.00 102.88 ? 537  GLU A O   1 
ATOM 3520  C CB  . GLU A 1 470  ? 206.636 23.516  -28.726 1.00 103.71 ? 537  GLU A CB  1 
ATOM 3521  C CG  . GLU A 1 470  ? 207.025 23.396  -27.286 1.00 103.30 ? 537  GLU A CG  1 
ATOM 3522  C CD  . GLU A 1 470  ? 208.120 22.397  -27.082 1.00 102.91 ? 537  GLU A CD  1 
ATOM 3523  O OE1 . GLU A 1 470  ? 209.032 22.335  -27.936 1.00 102.21 ? 537  GLU A OE1 1 
ATOM 3524  O OE2 . GLU A 1 470  ? 208.076 21.683  -26.062 1.00 103.03 ? 537  GLU A OE2 1 
ATOM 3525  N N   . GLU A 1 471  ? 204.979 24.241  -31.295 1.00 102.89 ? 538  GLU A N   1 
ATOM 3526  C CA  . GLU A 1 471  ? 204.970 24.421  -32.760 1.00 102.55 ? 538  GLU A CA  1 
ATOM 3527  C C   . GLU A 1 471  ? 203.507 24.706  -33.197 1.00 101.81 ? 538  GLU A C   1 
ATOM 3528  O O   . GLU A 1 471  ? 202.574 24.253  -32.536 1.00 101.72 ? 538  GLU A O   1 
ATOM 3529  C CB  . GLU A 1 471  ? 205.490 23.100  -33.378 1.00 102.88 ? 538  GLU A CB  1 
ATOM 3530  C CG  . GLU A 1 471  ? 206.234 23.132  -34.714 1.00 102.70 ? 538  GLU A CG  1 
ATOM 3531  C CD  . GLU A 1 471  ? 206.811 21.758  -35.062 1.00 101.68 ? 538  GLU A CD  1 
ATOM 3532  O OE1 . GLU A 1 471  ? 206.599 21.265  -36.191 1.00 101.11 ? 538  GLU A OE1 1 
ATOM 3533  O OE2 . GLU A 1 471  ? 207.479 21.166  -34.195 1.00 100.67 ? 538  GLU A OE2 1 
ATOM 3534  N N   . PHE A 1 472  ? 203.288 25.472  -34.266 1.00 100.34 ? 539  PHE A N   1 
ATOM 3535  C CA  . PHE A 1 472  ? 201.913 25.707  -34.722 1.00 98.11  ? 539  PHE A CA  1 
ATOM 3536  C C   . PHE A 1 472  ? 201.786 24.623  -35.775 1.00 97.01  ? 539  PHE A C   1 
ATOM 3537  O O   . PHE A 1 472  ? 202.696 24.486  -36.578 1.00 97.63  ? 539  PHE A O   1 
ATOM 3538  C CB  . PHE A 1 472  ? 201.758 27.068  -35.413 1.00 97.69  ? 539  PHE A CB  1 
ATOM 3539  C CG  . PHE A 1 472  ? 202.362 27.101  -36.780 1.00 97.70  ? 539  PHE A CG  1 
ATOM 3540  C CD1 . PHE A 1 472  ? 203.698 27.446  -36.956 1.00 97.97  ? 539  PHE A CD1 1 
ATOM 3541  C CD2 . PHE A 1 472  ? 201.636 26.647  -37.875 1.00 97.47  ? 539  PHE A CD2 1 
ATOM 3542  C CE1 . PHE A 1 472  ? 204.312 27.319  -38.189 1.00 97.29  ? 539  PHE A CE1 1 
ATOM 3543  C CE2 . PHE A 1 472  ? 202.241 26.513  -39.106 1.00 97.36  ? 539  PHE A CE2 1 
ATOM 3544  C CZ  . PHE A 1 472  ? 203.586 26.852  -39.262 1.00 97.04  ? 539  PHE A CZ  1 
ATOM 3545  N N   . GLN A 1 473  ? 200.696 23.860  -35.764 1.00 95.25  ? 540  GLN A N   1 
ATOM 3546  C CA  . GLN A 1 473  ? 200.461 22.781  -36.735 1.00 93.02  ? 540  GLN A CA  1 
ATOM 3547  C C   . GLN A 1 473  ? 199.970 21.480  -36.116 1.00 91.51  ? 540  GLN A C   1 
ATOM 3548  O O   . GLN A 1 473  ? 199.652 21.401  -34.934 1.00 91.12  ? 540  GLN A O   1 
ATOM 3549  C CB  . GLN A 1 473  ? 201.719 22.453  -37.541 1.00 92.77  ? 540  GLN A CB  1 
ATOM 3550  C CG  . GLN A 1 473  ? 202.088 23.463  -38.607 1.00 91.52  ? 540  GLN A CG  1 
ATOM 3551  C CD  . GLN A 1 473  ? 201.360 23.247  -39.893 1.00 91.16  ? 540  GLN A CD  1 
ATOM 3552  O OE1 . GLN A 1 473  ? 201.468 22.186  -40.490 1.00 90.72  ? 540  GLN A OE1 1 
ATOM 3553  N NE2 . GLN A 1 473  ? 200.617 24.250  -40.340 1.00 90.94  ? 540  GLN A NE2 1 
ATOM 3554  N N   . GLN A 1 474  ? 199.919 20.455  -36.957 1.00 89.99  ? 541  GLN A N   1 
ATOM 3555  C CA  . GLN A 1 474  ? 199.497 19.125  -36.552 1.00 88.27  ? 541  GLN A CA  1 
ATOM 3556  C C   . GLN A 1 474  ? 200.359 18.742  -35.361 1.00 87.25  ? 541  GLN A C   1 
ATOM 3557  O O   . GLN A 1 474  ? 199.947 17.950  -34.516 1.00 86.47  ? 541  GLN A O   1 
ATOM 3558  C CB  . GLN A 1 474  ? 199.770 18.130  -37.678 1.00 88.16  ? 541  GLN A CB  1 
ATOM 3559  C CG  . GLN A 1 474  ? 201.224 17.663  -37.700 1.00 84.70  ? 541  GLN A CG  1 
ATOM 3560  C CD  . GLN A 1 474  ? 201.628 16.968  -38.978 1.00 82.04  ? 541  GLN A CD  1 
ATOM 3561  O OE1 . GLN A 1 474  ? 201.846 17.608  -40.003 1.00 79.28  ? 541  GLN A OE1 1 
ATOM 3562  N NE2 . GLN A 1 474  ? 201.731 15.649  -38.925 1.00 81.81  ? 541  GLN A NE2 1 
ATOM 3563  N N   . ASP A 1 475  ? 201.569 19.301  -35.319 1.00 86.19  ? 542  ASP A N   1 
ATOM 3564  C CA  . ASP A 1 475  ? 202.512 19.010  -34.245 1.00 84.51  ? 542  ASP A CA  1 
ATOM 3565  C C   . ASP A 1 475  ? 201.853 19.251  -32.903 1.00 83.00  ? 542  ASP A C   1 
ATOM 3566  O O   . ASP A 1 475  ? 201.734 18.339  -32.092 1.00 81.45  ? 542  ASP A O   1 
ATOM 3567  C CB  . ASP A 1 475  ? 203.773 19.870  -34.375 1.00 84.58  ? 542  ASP A CB  1 
ATOM 3568  C CG  . ASP A 1 475  ? 204.426 19.745  -35.739 1.00 84.17  ? 542  ASP A CG  1 
ATOM 3569  O OD1 . ASP A 1 475  ? 203.876 20.301  -36.711 1.00 84.08  ? 542  ASP A OD1 1 
ATOM 3570  O OD2 . ASP A 1 475  ? 205.482 19.088  -35.845 1.00 84.71  ? 542  ASP A OD2 1 
ATOM 3571  N N   . VAL A 1 476  ? 201.421 20.479  -32.658 1.00 82.54  ? 543  VAL A N   1 
ATOM 3572  C CA  . VAL A 1 476  ? 200.755 20.745  -31.398 1.00 82.53  ? 543  VAL A CA  1 
ATOM 3573  C C   . VAL A 1 476  ? 199.605 19.740  -31.316 1.00 82.88  ? 543  VAL A C   1 
ATOM 3574  O O   . VAL A 1 476  ? 199.491 18.995  -30.344 1.00 82.16  ? 543  VAL A O   1 
ATOM 3575  C CB  . VAL A 1 476  ? 200.225 22.212  -31.321 1.00 81.83  ? 543  VAL A CB  1 
ATOM 3576  C CG1 . VAL A 1 476  ? 199.385 22.549  -32.545 1.00 80.95  ? 543  VAL A CG1 1 
ATOM 3577  C CG2 . VAL A 1 476  ? 199.414 22.409  -30.042 1.00 81.22  ? 543  VAL A CG2 1 
ATOM 3578  N N   . MET A 1 477  ? 198.780 19.695  -32.357 1.00 83.81  ? 544  MET A N   1 
ATOM 3579  C CA  . MET A 1 477  ? 197.660 18.768  -32.394 1.00 84.58  ? 544  MET A CA  1 
ATOM 3580  C C   . MET A 1 477  ? 198.137 17.431  -31.882 1.00 83.98  ? 544  MET A C   1 
ATOM 3581  O O   . MET A 1 477  ? 197.637 16.888  -30.901 1.00 83.20  ? 544  MET A O   1 
ATOM 3582  C CB  . MET A 1 477  ? 197.195 18.571  -33.818 1.00 87.07  ? 544  MET A CB  1 
ATOM 3583  C CG  . MET A 1 477  ? 195.857 17.947  -33.903 1.00 92.16  ? 544  MET A CG  1 
ATOM 3584  S SD  . MET A 1 477  ? 194.856 19.180  -34.662 1.00 99.92  ? 544  MET A SD  1 
ATOM 3585  C CE  . MET A 1 477  ? 195.369 18.981  -36.371 1.00 100.03 ? 544  MET A CE  1 
ATOM 3586  N N   . ALA A 1 478  ? 199.137 16.912  -32.572 1.00 83.83  ? 545  ALA A N   1 
ATOM 3587  C CA  . ALA A 1 478  ? 199.701 15.631  -32.228 1.00 83.60  ? 545  ALA A CA  1 
ATOM 3588  C C   . ALA A 1 478  ? 200.453 15.667  -30.899 1.00 84.16  ? 545  ALA A C   1 
ATOM 3589  O O   . ALA A 1 478  ? 200.125 14.915  -29.978 1.00 82.88  ? 545  ALA A O   1 
ATOM 3590  C CB  . ALA A 1 478  ? 200.606 15.159  -33.350 1.00 82.58  ? 545  ALA A CB  1 
ATOM 3591  N N   . ARG A 1 479  ? 201.446 16.544  -30.784 1.00 85.64  ? 546  ARG A N   1 
ATOM 3592  C CA  . ARG A 1 479  ? 202.225 16.617  -29.553 1.00 87.00  ? 546  ARG A CA  1 
ATOM 3593  C C   . ARG A 1 479  ? 201.306 16.610  -28.348 1.00 88.43  ? 546  ARG A C   1 
ATOM 3594  O O   . ARG A 1 479  ? 201.448 15.785  -27.446 1.00 89.01  ? 546  ARG A O   1 
ATOM 3595  C CB  . ARG A 1 479  ? 203.115 17.868  -29.522 1.00 85.73  ? 546  ARG A CB  1 
ATOM 3596  C CG  . ARG A 1 479  ? 204.196 17.870  -30.580 1.00 84.46  ? 546  ARG A CG  1 
ATOM 3597  C CD  . ARG A 1 479  ? 205.198 18.974  -30.349 1.00 83.42  ? 546  ARG A CD  1 
ATOM 3598  N NE  . ARG A 1 479  ? 206.116 18.656  -29.260 1.00 82.14  ? 546  ARG A NE  1 
ATOM 3599  C CZ  . ARG A 1 479  ? 207.129 19.437  -28.894 1.00 79.57  ? 546  ARG A CZ  1 
ATOM 3600  N NH1 . ARG A 1 479  ? 207.339 20.581  -29.528 1.00 78.36  ? 546  ARG A NH1 1 
ATOM 3601  N NH2 . ARG A 1 479  ? 207.949 19.069  -27.915 1.00 77.08  ? 546  ARG A NH2 1 
ATOM 3602  N N   . ALA A 1 480  ? 200.342 17.516  -28.339 1.00 90.19  ? 547  ALA A N   1 
ATOM 3603  C CA  . ALA A 1 480  ? 199.437 17.584  -27.211 1.00 91.96  ? 547  ALA A CA  1 
ATOM 3604  C C   . ALA A 1 480  ? 198.554 16.355  -27.122 1.00 92.66  ? 547  ALA A C   1 
ATOM 3605  O O   . ALA A 1 480  ? 198.179 15.959  -26.027 1.00 92.31  ? 547  ALA A O   1 
ATOM 3606  C CB  . ALA A 1 480  ? 198.590 18.844  -27.283 1.00 92.73  ? 547  ALA A CB  1 
ATOM 3607  N N   . CYS A 1 481  ? 198.221 15.741  -28.254 1.00 93.22  ? 548  CYS A N   1 
ATOM 3608  C CA  . CYS A 1 481  ? 197.368 14.558  -28.204 1.00 93.73  ? 548  CYS A CA  1 
ATOM 3609  C C   . CYS A 1 481  ? 198.165 13.403  -27.628 1.00 93.55  ? 548  CYS A C   1 
ATOM 3610  O O   . CYS A 1 481  ? 197.619 12.507  -26.989 1.00 93.68  ? 548  CYS A O   1 
ATOM 3611  C CB  . CYS A 1 481  ? 196.854 14.187  -29.592 1.00 94.44  ? 548  CYS A CB  1 
ATOM 3612  S SG  . CYS A 1 481  ? 198.064 13.380  -30.622 1.00 94.86  ? 548  CYS A SG  1 
ATOM 3613  N N   . LEU A 1 482  ? 199.468 13.431  -27.845 1.00 93.23  ? 549  LEU A N   1 
ATOM 3614  C CA  . LEU A 1 482  ? 200.290 12.369  -27.325 1.00 92.55  ? 549  LEU A CA  1 
ATOM 3615  C C   . LEU A 1 482  ? 200.272 12.290  -25.802 1.00 91.05  ? 549  LEU A C   1 
ATOM 3616  O O   . LEU A 1 482  ? 200.005 11.223  -25.247 1.00 89.98  ? 549  LEU A O   1 
ATOM 3617  C CB  . LEU A 1 482  ? 201.724 12.501  -27.837 1.00 93.43  ? 549  LEU A CB  1 
ATOM 3618  C CG  . LEU A 1 482  ? 202.019 11.543  -28.992 1.00 93.66  ? 549  LEU A CG  1 
ATOM 3619  C CD1 . LEU A 1 482  ? 203.472 11.044  -28.939 1.00 92.55  ? 549  LEU A CD1 1 
ATOM 3620  C CD2 . LEU A 1 482  ? 201.062 10.374  -28.865 1.00 94.39  ? 549  LEU A CD2 1 
ATOM 3621  N N   . GLN A 1 483  ? 200.549 13.407  -25.126 1.00 89.73  ? 550  GLN A N   1 
ATOM 3622  C CA  . GLN A 1 483  ? 200.561 13.421  -23.657 1.00 88.75  ? 550  GLN A CA  1 
ATOM 3623  C C   . GLN A 1 483  ? 199.210 12.952  -23.141 1.00 89.05  ? 550  GLN A C   1 
ATOM 3624  O O   . GLN A 1 483  ? 199.125 12.275  -22.119 1.00 89.51  ? 550  GLN A O   1 
ATOM 3625  C CB  . GLN A 1 483  ? 200.842 14.825  -23.101 1.00 87.08  ? 550  GLN A CB  1 
ATOM 3626  C CG  . GLN A 1 483  ? 202.146 15.460  -23.539 1.00 83.89  ? 550  GLN A CG  1 
ATOM 3627  C CD  . GLN A 1 483  ? 201.910 16.580  -24.512 1.00 80.63  ? 550  GLN A CD  1 
ATOM 3628  O OE1 . GLN A 1 483  ? 200.846 17.199  -24.500 1.00 77.88  ? 550  GLN A OE1 1 
ATOM 3629  N NE2 . GLN A 1 483  ? 202.900 16.864  -25.353 1.00 80.55  ? 550  GLN A NE2 1 
ATOM 3630  N N   . LYS A 1 484  ? 198.156 13.353  -23.846 1.00 89.68  ? 551  LYS A N   1 
ATOM 3631  C CA  . LYS A 1 484  ? 196.798 12.956  -23.504 1.00 90.09  ? 551  LYS A CA  1 
ATOM 3632  C C   . LYS A 1 484  ? 196.891 11.460  -23.491 1.00 90.80  ? 551  LYS A C   1 
ATOM 3633  O O   . LYS A 1 484  ? 196.693 10.821  -22.465 1.00 91.00  ? 551  LYS A O   1 
ATOM 3634  C CB  . LYS A 1 484  ? 195.813 13.379  -24.602 1.00 89.59  ? 551  LYS A CB  1 
ATOM 3635  C CG  . LYS A 1 484  ? 194.590 12.458  -24.762 1.00 87.88  ? 551  LYS A CG  1 
ATOM 3636  C CD  . LYS A 1 484  ? 194.269 12.210  -26.241 1.00 86.46  ? 551  LYS A CD  1 
ATOM 3637  C CE  . LYS A 1 484  ? 193.159 11.186  -26.438 1.00 86.77  ? 551  LYS A CE  1 
ATOM 3638  N NZ  . LYS A 1 484  ? 191.802 11.708  -26.137 1.00 87.25  ? 551  LYS A NZ  1 
ATOM 3639  N N   . LEU A 1 485  ? 197.217 10.920  -24.659 1.00 91.34  ? 552  LEU A N   1 
ATOM 3640  C CA  . LEU A 1 485  ? 197.360 9.488   -24.841 1.00 92.33  ? 552  LEU A CA  1 
ATOM 3641  C C   . LEU A 1 485  ? 198.273 8.922   -23.753 1.00 93.05  ? 552  LEU A C   1 
ATOM 3642  O O   . LEU A 1 485  ? 197.936 7.941   -23.084 1.00 93.29  ? 552  LEU A O   1 
ATOM 3643  C CB  . LEU A 1 485  ? 197.929 9.198   -26.243 1.00 92.00  ? 552  LEU A CB  1 
ATOM 3644  C CG  . LEU A 1 485  ? 197.062 9.615   -27.447 1.00 90.96  ? 552  LEU A CG  1 
ATOM 3645  C CD1 . LEU A 1 485  ? 197.805 9.366   -28.763 1.00 90.09  ? 552  LEU A CD1 1 
ATOM 3646  C CD2 . LEU A 1 485  ? 195.744 8.846   -27.414 1.00 90.24  ? 552  LEU A CD2 1 
ATOM 3647  N N   . LYS A 1 486  ? 199.419 9.559   -23.559 1.00 94.08  ? 553  LYS A N   1 
ATOM 3648  C CA  . LYS A 1 486  ? 200.353 9.101   -22.553 1.00 94.58  ? 553  LYS A CA  1 
ATOM 3649  C C   . LYS A 1 486  ? 199.806 9.324   -21.156 1.00 95.42  ? 553  LYS A C   1 
ATOM 3650  O O   . LYS A 1 486  ? 199.653 8.375   -20.394 1.00 94.76  ? 553  LYS A O   1 
ATOM 3651  C CB  . LYS A 1 486  ? 201.681 9.816   -22.730 1.00 93.79  ? 553  LYS A CB  1 
ATOM 3652  C CG  . LYS A 1 486  ? 202.176 9.705   -24.145 1.00 92.48  ? 553  LYS A CG  1 
ATOM 3653  C CD  . LYS A 1 486  ? 203.692 9.647   -24.240 1.00 91.30  ? 553  LYS A CD  1 
ATOM 3654  C CE  . LYS A 1 486  ? 204.381 10.995  -24.135 1.00 91.23  ? 553  LYS A CE  1 
ATOM 3655  N NZ  . LYS A 1 486  ? 205.803 10.894  -24.617 1.00 91.94  ? 553  LYS A NZ  1 
ATOM 3656  N N   . GLY A 1 487  ? 199.511 10.574  -20.821 1.00 97.12  ? 554  GLY A N   1 
ATOM 3657  C CA  . GLY A 1 487  ? 198.969 10.880  -19.510 1.00 99.09  ? 554  GLY A CA  1 
ATOM 3658  C C   . GLY A 1 487  ? 197.898 9.893   -19.061 1.00 100.68 ? 554  GLY A C   1 
ATOM 3659  O O   . GLY A 1 487  ? 197.968 9.355   -17.959 1.00 100.43 ? 554  GLY A O   1 
ATOM 3660  N N   . THR A 1 488  ? 196.903 9.649   -19.912 1.00 102.43 ? 555  THR A N   1 
ATOM 3661  C CA  . THR A 1 488  ? 195.815 8.719   -19.586 1.00 104.22 ? 555  THR A CA  1 
ATOM 3662  C C   . THR A 1 488  ? 196.351 7.302   -19.450 1.00 104.79 ? 555  THR A C   1 
ATOM 3663  O O   . THR A 1 488  ? 195.858 6.508   -18.654 1.00 105.41 ? 555  THR A O   1 
ATOM 3664  C CB  . THR A 1 488  ? 194.734 8.697   -20.683 1.00 104.55 ? 555  THR A CB  1 
ATOM 3665  O OG1 . THR A 1 488  ? 194.586 10.009  -21.242 1.00 104.41 ? 555  THR A OG1 1 
ATOM 3666  C CG2 . THR A 1 488  ? 193.401 8.237   -20.098 1.00 104.89 ? 555  THR A CG2 1 
ATOM 3667  N N   . THR A 1 489  ? 197.351 6.988   -20.258 1.00 104.79 ? 556  THR A N   1 
ATOM 3668  C CA  . THR A 1 489  ? 197.966 5.683   -20.215 1.00 104.63 ? 556  THR A CA  1 
ATOM 3669  C C   . THR A 1 489  ? 198.343 5.394   -18.769 1.00 104.93 ? 556  THR A C   1 
ATOM 3670  O O   . THR A 1 489  ? 198.449 4.233   -18.367 1.00 105.41 ? 556  THR A O   1 
ATOM 3671  C CB  . THR A 1 489  ? 199.216 5.661   -21.100 1.00 104.40 ? 556  THR A CB  1 
ATOM 3672  O OG1 . THR A 1 489  ? 198.821 5.535   -22.468 1.00 104.05 ? 556  THR A OG1 1 
ATOM 3673  C CG2 . THR A 1 489  ? 200.130 4.532   -20.714 1.00 102.23 ? 556  THR A CG2 1 
ATOM 3674  N N   . GLU A 1 490  ? 198.548 6.457   -17.992 1.00 104.56 ? 557  GLU A N   1 
ATOM 3675  C CA  . GLU A 1 490  ? 198.909 6.308   -16.589 1.00 103.94 ? 557  GLU A CA  1 
ATOM 3676  C C   . GLU A 1 490  ? 197.627 5.981   -15.837 1.00 103.68 ? 557  GLU A C   1 
ATOM 3677  O O   . GLU A 1 490  ? 197.598 5.019   -15.063 1.00 103.34 ? 557  GLU A O   1 
ATOM 3678  C CB  . GLU A 1 490  ? 199.538 7.590   -16.027 1.00 103.34 ? 557  GLU A CB  1 
ATOM 3679  C CG  . GLU A 1 490  ? 200.308 8.439   -17.036 1.00 101.55 ? 557  GLU A CG  1 
ATOM 3680  C CD  . GLU A 1 490  ? 201.817 8.435   -16.840 1.00 101.07 ? 557  GLU A CD  1 
ATOM 3681  O OE1 . GLU A 1 490  ? 202.419 9.529   -16.765 1.00 100.48 ? 557  GLU A OE1 1 
ATOM 3682  O OE2 . GLU A 1 490  ? 202.408 7.345   -16.778 1.00 100.55 ? 557  GLU A OE2 1 
ATOM 3683  N N   . LEU A 1 491  ? 196.567 6.768   -16.048 1.00 103.20 ? 558  LEU A N   1 
ATOM 3684  C CA  . LEU A 1 491  ? 195.301 6.454   -15.382 1.00 102.89 ? 558  LEU A CA  1 
ATOM 3685  C C   . LEU A 1 491  ? 195.024 4.995   -15.768 1.00 102.83 ? 558  LEU A C   1 
ATOM 3686  O O   . LEU A 1 491  ? 194.315 4.255   -15.060 1.00 103.48 ? 558  LEU A O   1 
ATOM 3687  C CB  . LEU A 1 491  ? 194.147 7.355   -15.860 1.00 102.03 ? 558  LEU A CB  1 
ATOM 3688  C CG  . LEU A 1 491  ? 192.770 6.692   -15.665 1.00 101.19 ? 558  LEU A CG  1 
ATOM 3689  C CD1 . LEU A 1 491  ? 191.753 7.629   -15.036 1.00 100.13 ? 558  LEU A CD1 1 
ATOM 3690  C CD2 . LEU A 1 491  ? 192.299 6.187   -17.018 1.00 101.14 ? 558  LEU A CD2 1 
ATOM 3691  N N   . LEU A 1 492  ? 195.609 4.595   -16.901 1.00 102.37 ? 559  LEU A N   1 
ATOM 3692  C CA  . LEU A 1 492  ? 195.498 3.229   -17.414 1.00 102.18 ? 559  LEU A CA  1 
ATOM 3693  C C   . LEU A 1 492  ? 196.371 2.338   -16.443 1.00 102.49 ? 559  LEU A C   1 
ATOM 3694  O O   . LEU A 1 492  ? 196.354 2.590   -15.233 1.00 102.32 ? 559  LEU A O   1 
ATOM 3695  C CB  . LEU A 1 492  ? 195.945 3.223   -18.900 1.00 101.24 ? 559  LEU A CB  1 
ATOM 3696  C CG  . LEU A 1 492  ? 195.180 2.415   -19.977 1.00 100.65 ? 559  LEU A CG  1 
ATOM 3697  C CD1 . LEU A 1 492  ? 194.170 3.255   -20.752 1.00 101.17 ? 559  LEU A CD1 1 
ATOM 3698  C CD2 . LEU A 1 492  ? 196.192 1.899   -20.944 1.00 99.70  ? 559  LEU A CD2 1 
ATOM 3699  N N   . PRO A 1 493  ? 197.118 1.305   -16.924 1.00 102.83 ? 560  PRO A N   1 
ATOM 3700  C CA  . PRO A 1 493  ? 197.956 0.413   -16.095 1.00 103.70 ? 560  PRO A CA  1 
ATOM 3701  C C   . PRO A 1 493  ? 198.753 0.809   -14.843 1.00 104.94 ? 560  PRO A C   1 
ATOM 3702  O O   . PRO A 1 493  ? 199.372 1.874   -14.782 1.00 105.19 ? 560  PRO A O   1 
ATOM 3703  C CB  . PRO A 1 493  ? 198.864 -0.233  -17.126 1.00 102.75 ? 560  PRO A CB  1 
ATOM 3704  C CG  . PRO A 1 493  ? 197.932 -0.500  -18.183 1.00 102.08 ? 560  PRO A CG  1 
ATOM 3705  C CD  . PRO A 1 493  ? 197.143 0.797   -18.306 1.00 102.19 ? 560  PRO A CD  1 
ATOM 3706  N N   . LYS A 1 494  ? 198.755 -0.122  -13.879 1.00 105.91 ? 561  LYS A N   1 
ATOM 3707  C CA  . LYS A 1 494  ? 199.445 -0.012  -12.587 1.00 106.80 ? 561  LYS A CA  1 
ATOM 3708  C C   . LYS A 1 494  ? 198.639 0.756   -11.520 1.00 106.69 ? 561  LYS A C   1 
ATOM 3709  O O   . LYS A 1 494  ? 197.406 0.765   -11.572 1.00 107.50 ? 561  LYS A O   1 
ATOM 3710  C CB  . LYS A 1 494  ? 200.833 0.610   -12.793 1.00 107.37 ? 561  LYS A CB  1 
ATOM 3711  C CG  . LYS A 1 494  ? 201.675 -0.150  -13.821 1.00 107.86 ? 561  LYS A CG  1 
ATOM 3712  C CD  . LYS A 1 494  ? 202.022 0.710   -15.031 1.00 108.12 ? 561  LYS A CD  1 
ATOM 3713  C CE  . LYS A 1 494  ? 203.166 1.672   -14.735 1.00 107.85 ? 561  LYS A CE  1 
ATOM 3714  N NZ  . LYS A 1 494  ? 204.466 0.970   -14.534 1.00 107.55 ? 561  LYS A NZ  1 
ATOM 3715  N N   . ARG A 1 495  ? 199.321 1.366   -10.547 1.00 105.81 ? 562  ARG A N   1 
ATOM 3716  C CA  . ARG A 1 495  ? 198.651 2.132   -9.483  1.00 104.26 ? 562  ARG A CA  1 
ATOM 3717  C C   . ARG A 1 495  ? 198.924 3.631   -9.745  1.00 104.94 ? 562  ARG A C   1 
ATOM 3718  O O   . ARG A 1 495  ? 199.975 3.970   -10.287 1.00 105.59 ? 562  ARG A O   1 
ATOM 3719  C CB  . ARG A 1 495  ? 199.187 1.686   -8.116  1.00 101.74 ? 562  ARG A CB  1 
ATOM 3720  C CG  . ARG A 1 495  ? 198.351 2.111   -6.936  1.00 96.48  ? 562  ARG A CG  1 
ATOM 3721  C CD  . ARG A 1 495  ? 198.829 1.436   -5.690  1.00 92.42  ? 562  ARG A CD  1 
ATOM 3722  N NE  . ARG A 1 495  ? 198.102 1.925   -4.536  1.00 88.97  ? 562  ARG A NE  1 
ATOM 3723  C CZ  . ARG A 1 495  ? 198.330 1.526   -3.291  1.00 87.37  ? 562  ARG A CZ  1 
ATOM 3724  N NH1 . ARG A 1 495  ? 199.268 0.621   -3.041  1.00 86.19  ? 562  ARG A NH1 1 
ATOM 3725  N NH2 . ARG A 1 495  ? 197.631 2.046   -2.289  1.00 85.36  ? 562  ARG A NH2 1 
ATOM 3726  N N   . PRO A 1 496  ? 197.993 4.540   -9.358  1.00 105.65 ? 563  PRO A N   1 
ATOM 3727  C CA  . PRO A 1 496  ? 198.100 6.009   -9.557  1.00 106.27 ? 563  PRO A CA  1 
ATOM 3728  C C   . PRO A 1 496  ? 199.013 6.973   -8.741  1.00 107.11 ? 563  PRO A C   1 
ATOM 3729  O O   . PRO A 1 496  ? 199.318 8.082   -9.217  1.00 107.07 ? 563  PRO A O   1 
ATOM 3730  C CB  . PRO A 1 496  ? 196.634 6.483   -9.471  1.00 105.35 ? 563  PRO A CB  1 
ATOM 3731  C CG  . PRO A 1 496  ? 195.792 5.198   -9.559  1.00 105.23 ? 563  PRO A CG  1 
ATOM 3732  C CD  . PRO A 1 496  ? 196.652 4.195   -8.849  1.00 105.40 ? 563  PRO A CD  1 
ATOM 3733  N N   . GLN A 1 497  ? 199.432 6.596   -7.536  1.00 107.94 ? 564  GLN A N   1 
ATOM 3734  C CA  . GLN A 1 497  ? 200.242 7.509   -6.734  1.00 109.09 ? 564  GLN A CA  1 
ATOM 3735  C C   . GLN A 1 497  ? 201.755 7.345   -6.911  1.00 109.69 ? 564  GLN A C   1 
ATOM 3736  O O   . GLN A 1 497  ? 202.551 8.094   -6.327  1.00 109.50 ? 564  GLN A O   1 
ATOM 3737  C CB  . GLN A 1 497  ? 199.813 7.401   -5.272  1.00 108.91 ? 564  GLN A CB  1 
ATOM 3738  C CG  . GLN A 1 497  ? 198.280 7.178   -5.095  1.00 107.13 ? 564  GLN A CG  1 
ATOM 3739  C CD  . GLN A 1 497  ? 197.368 8.182   -5.843  1.00 105.77 ? 564  GLN A CD  1 
ATOM 3740  O OE1 . GLN A 1 497  ? 196.367 8.643   -5.293  1.00 105.55 ? 564  GLN A OE1 1 
ATOM 3741  N NE2 . GLN A 1 497  ? 197.696 8.494   -7.090  1.00 103.99 ? 564  GLN A NE2 1 
ATOM 3742  N N   . HIS A 1 498  ? 202.134 6.360   -7.727  1.00 110.64 ? 565  HIS A N   1 
ATOM 3743  C CA  . HIS A 1 498  ? 203.531 6.135   -8.065  1.00 110.85 ? 565  HIS A CA  1 
ATOM 3744  C C   . HIS A 1 498  ? 203.816 7.449   -8.855  1.00 109.91 ? 565  HIS A C   1 
ATOM 3745  O O   . HIS A 1 498  ? 204.810 8.145   -8.611  1.00 110.14 ? 565  HIS A O   1 
ATOM 3746  C CB  . HIS A 1 498  ? 203.686 4.919   -9.012  1.00 111.94 ? 565  HIS A CB  1 
ATOM 3747  C CG  . HIS A 1 498  ? 203.373 3.580   -8.403  1.00 113.16 ? 565  HIS A CG  1 
ATOM 3748  N ND1 . HIS A 1 498  ? 202.248 3.348   -7.643  1.00 113.72 ? 565  HIS A ND1 1 
ATOM 3749  C CD2 . HIS A 1 498  ? 203.992 2.380   -8.534  1.00 113.31 ? 565  HIS A CD2 1 
ATOM 3750  C CE1 . HIS A 1 498  ? 202.185 2.064   -7.334  1.00 113.83 ? 565  HIS A CE1 1 
ATOM 3751  N NE2 . HIS A 1 498  ? 203.230 1.455   -7.863  1.00 113.44 ? 565  HIS A NE2 1 
ATOM 3752  N N   . LEU A 1 499  ? 202.895 7.768   -9.780  1.00 108.73 ? 566  LEU A N   1 
ATOM 3753  C CA  . LEU A 1 499  ? 202.944 8.961   -10.618 1.00 108.07 ? 566  LEU A CA  1 
ATOM 3754  C C   . LEU A 1 499  ? 203.314 10.089  -9.651  1.00 107.42 ? 566  LEU A C   1 
ATOM 3755  O O   . LEU A 1 499  ? 204.395 10.685  -9.794  1.00 106.44 ? 566  LEU A O   1 
ATOM 3756  C CB  . LEU A 1 499  ? 201.562 9.189   -11.262 1.00 107.91 ? 566  LEU A CB  1 
ATOM 3757  C CG  . LEU A 1 499  ? 201.307 10.299  -12.273 1.00 107.73 ? 566  LEU A CG  1 
ATOM 3758  C CD1 . LEU A 1 499  ? 199.853 10.234  -12.677 1.00 107.48 ? 566  LEU A CD1 1 
ATOM 3759  C CD2 . LEU A 1 499  ? 201.618 11.642  -11.683 1.00 107.35 ? 566  LEU A CD2 1 
ATOM 3760  N N   . PRO A 1 500  ? 202.421 10.421  -8.680  1.00 107.37 ? 567  PRO A N   1 
ATOM 3761  C CA  . PRO A 1 500  ? 202.798 11.483  -7.745  1.00 107.06 ? 567  PRO A CA  1 
ATOM 3762  C C   . PRO A 1 500  ? 204.165 11.100  -7.243  1.00 105.85 ? 567  PRO A C   1 
ATOM 3763  O O   . PRO A 1 500  ? 204.424 9.957   -6.854  1.00 104.88 ? 567  PRO A O   1 
ATOM 3764  C CB  . PRO A 1 500  ? 201.737 11.374  -6.668  1.00 107.37 ? 567  PRO A CB  1 
ATOM 3765  C CG  . PRO A 1 500  ? 200.550 11.122  -7.485  1.00 107.21 ? 567  PRO A CG  1 
ATOM 3766  C CD  . PRO A 1 500  ? 201.014 10.040  -8.461  1.00 107.38 ? 567  PRO A CD  1 
ATOM 3767  N N   . GLY A 1 501  ? 205.053 12.064  -7.243  1.00 104.99 ? 568  GLY A N   1 
ATOM 3768  C CA  . GLY A 1 501  ? 206.377 11.749  -6.837  1.00 103.45 ? 568  GLY A CA  1 
ATOM 3769  C C   . GLY A 1 501  ? 206.886 10.814  -7.887  1.00 102.73 ? 568  GLY A C   1 
ATOM 3770  O O   . GLY A 1 501  ? 206.636 9.643   -7.785  1.00 101.78 ? 568  GLY A O   1 
ATOM 3771  N N   . HIS A 1 502  ? 207.547 11.316  -8.916  1.00 102.70 ? 569  HIS A N   1 
ATOM 3772  C CA  . HIS A 1 502  ? 208.078 10.411  -9.927  1.00 103.18 ? 569  HIS A CA  1 
ATOM 3773  C C   . HIS A 1 502  ? 209.487 10.075  -9.394  1.00 103.15 ? 569  HIS A C   1 
ATOM 3774  O O   . HIS A 1 502  ? 210.194 10.939  -8.883  1.00 103.21 ? 569  HIS A O   1 
ATOM 3775  C CB  . HIS A 1 502  ? 208.129 11.073  -11.331 1.00 103.69 ? 569  HIS A CB  1 
ATOM 3776  C CG  . HIS A 1 502  ? 207.559 10.221  -12.446 1.00 104.91 ? 569  HIS A CG  1 
ATOM 3777  N ND1 . HIS A 1 502  ? 206.239 10.279  -12.851 1.00 105.59 ? 569  HIS A ND1 1 
ATOM 3778  C CD2 . HIS A 1 502  ? 208.149 9.282   -13.227 1.00 105.15 ? 569  HIS A CD2 1 
ATOM 3779  C CE1 . HIS A 1 502  ? 206.042 9.410   -13.833 1.00 105.03 ? 569  HIS A CE1 1 
ATOM 3780  N NE2 . HIS A 1 502  ? 207.183 8.794   -14.078 1.00 105.15 ? 569  HIS A NE2 1 
ATOM 3781  N N   . PRO A 1 503  ? 209.912 8.819   -9.552  1.00 103.66 ? 570  PRO A N   1 
ATOM 3782  C CA  . PRO A 1 503  ? 211.124 8.083   -9.190  1.00 103.78 ? 570  PRO A CA  1 
ATOM 3783  C C   . PRO A 1 503  ? 212.521 8.690   -9.352  1.00 103.67 ? 570  PRO A C   1 
ATOM 3784  O O   . PRO A 1 503  ? 213.119 9.115   -8.383  1.00 104.23 ? 570  PRO A O   1 
ATOM 3785  C CB  . PRO A 1 503  ? 210.981 6.830   -10.018 1.00 103.70 ? 570  PRO A CB  1 
ATOM 3786  C CG  . PRO A 1 503  ? 210.414 7.419   -11.285 1.00 103.67 ? 570  PRO A CG  1 
ATOM 3787  C CD  . PRO A 1 503  ? 209.290 8.117   -10.682 1.00 103.72 ? 570  PRO A CD  1 
ATOM 3788  N N   . GLY A 1 504  ? 213.077 8.719   -10.566 1.00 102.84 ? 571  GLY A N   1 
ATOM 3789  C CA  . GLY A 1 504  ? 214.429 9.257   -10.740 1.00 102.58 ? 571  GLY A CA  1 
ATOM 3790  C C   . GLY A 1 504  ? 215.439 8.118   -10.830 1.00 101.73 ? 571  GLY A C   1 
ATOM 3791  O O   . GLY A 1 504  ? 216.658 8.313   -10.884 1.00 101.19 ? 571  GLY A O   1 
ATOM 3792  N N   . TRP A 1 505  ? 214.877 6.911   -10.825 1.00 101.76 ? 572  TRP A N   1 
ATOM 3793  C CA  . TRP A 1 505  ? 215.568 5.621   -10.955 1.00 100.83 ? 572  TRP A CA  1 
ATOM 3794  C C   . TRP A 1 505  ? 216.773 5.224   -10.144 1.00 98.96  ? 572  TRP A C   1 
ATOM 3795  O O   . TRP A 1 505  ? 217.781 4.853   -10.736 1.00 99.52  ? 572  TRP A O   1 
ATOM 3796  C CB  . TRP A 1 505  ? 215.972 5.404   -12.403 1.00 101.77 ? 572  TRP A CB  1 
ATOM 3797  C CG  . TRP A 1 505  ? 214.843 4.994   -13.283 1.00 102.83 ? 572  TRP A CG  1 
ATOM 3798  C CD1 . TRP A 1 505  ? 214.884 4.830   -14.630 1.00 102.88 ? 572  TRP A CD1 1 
ATOM 3799  C CD2 . TRP A 1 505  ? 213.469 4.803   -12.898 1.00 103.80 ? 572  TRP A CD2 1 
ATOM 3800  N NE1 . TRP A 1 505  ? 213.626 4.566   -15.119 1.00 103.74 ? 572  TRP A NE1 1 
ATOM 3801  C CE2 . TRP A 1 505  ? 212.737 4.542   -14.078 1.00 104.29 ? 572  TRP A CE2 1 
ATOM 3802  C CE3 . TRP A 1 505  ? 212.786 4.829   -11.676 1.00 104.23 ? 572  TRP A CE3 1 
ATOM 3803  C CZ2 . TRP A 1 505  ? 211.353 4.314   -14.073 1.00 104.35 ? 572  TRP A CZ2 1 
ATOM 3804  C CZ3 . TRP A 1 505  ? 211.413 4.600   -11.675 1.00 104.38 ? 572  TRP A CZ3 1 
ATOM 3805  C CH2 . TRP A 1 505  ? 210.713 4.350   -12.866 1.00 104.36 ? 572  TRP A CH2 1 
ATOM 3806  N N   . TYR A 1 506  ? 216.695 5.222   -8.824  1.00 95.99  ? 573  TYR A N   1 
ATOM 3807  C CA  . TYR A 1 506  ? 217.858 4.834   -8.049  1.00 93.38  ? 573  TYR A CA  1 
ATOM 3808  C C   . TYR A 1 506  ? 219.172 4.988   -8.829  1.00 90.94  ? 573  TYR A C   1 
ATOM 3809  O O   . TYR A 1 506  ? 219.747 6.086   -8.847  1.00 89.60  ? 573  TYR A O   1 
ATOM 3810  C CB  . TYR A 1 506  ? 217.690 3.393   -7.577  1.00 94.12  ? 573  TYR A CB  1 
ATOM 3811  C CG  . TYR A 1 506  ? 216.898 3.291   -6.314  1.00 95.14  ? 573  TYR A CG  1 
ATOM 3812  C CD1 . TYR A 1 506  ? 216.666 2.062   -5.729  1.00 95.92  ? 573  TYR A CD1 1 
ATOM 3813  C CD2 . TYR A 1 506  ? 216.444 4.436   -5.655  1.00 95.64  ? 573  TYR A CD2 1 
ATOM 3814  C CE1 . TYR A 1 506  ? 216.007 1.966   -4.506  1.00 96.58  ? 573  TYR A CE1 1 
ATOM 3815  C CE2 . TYR A 1 506  ? 215.791 4.353   -4.441  1.00 96.07  ? 573  TYR A CE2 1 
ATOM 3816  C CZ  . TYR A 1 506  ? 215.579 3.114   -3.864  1.00 96.49  ? 573  TYR A CZ  1 
ATOM 3817  O OH  . TYR A 1 506  ? 214.990 2.997   -2.623  1.00 96.98  ? 573  TYR A OH  1 
ATOM 3818  N N   . ARG A 1 507  ? 219.620 3.921   -9.511  1.00 88.89  ? 574  ARG A N   1 
ATOM 3819  C CA  . ARG A 1 507  ? 220.908 3.992   -10.213 1.00 86.65  ? 574  ARG A CA  1 
ATOM 3820  C C   . ARG A 1 507  ? 221.265 3.218   -11.498 1.00 85.61  ? 574  ARG A C   1 
ATOM 3821  O O   . ARG A 1 507  ? 220.421 2.608   -12.157 1.00 84.93  ? 574  ARG A O   1 
ATOM 3822  C CB  . ARG A 1 507  ? 221.984 3.736   -9.172  1.00 85.46  ? 574  ARG A CB  1 
ATOM 3823  C CG  . ARG A 1 507  ? 222.110 4.912   -8.231  1.00 83.78  ? 574  ARG A CG  1 
ATOM 3824  C CD  . ARG A 1 507  ? 222.466 4.546   -6.816  1.00 83.25  ? 574  ARG A CD  1 
ATOM 3825  N NE  . ARG A 1 507  ? 223.266 5.631   -6.260  1.00 81.74  ? 574  ARG A NE  1 
ATOM 3826  C CZ  . ARG A 1 507  ? 223.232 6.040   -4.998  1.00 80.75  ? 574  ARG A CZ  1 
ATOM 3827  N NH1 . ARG A 1 507  ? 222.422 5.458   -4.122  1.00 79.53  ? 574  ARG A NH1 1 
ATOM 3828  N NH2 . ARG A 1 507  ? 224.016 7.039   -4.617  1.00 80.64  ? 574  ARG A NH2 1 
ATOM 3829  N N   . LYS A 1 508  ? 222.554 3.312   -11.836 1.00 84.17  ? 575  LYS A N   1 
ATOM 3830  C CA  . LYS A 1 508  ? 223.200 2.705   -13.007 1.00 82.18  ? 575  LYS A CA  1 
ATOM 3831  C C   . LYS A 1 508  ? 222.576 3.121   -14.334 1.00 81.46  ? 575  LYS A C   1 
ATOM 3832  O O   . LYS A 1 508  ? 222.206 4.274   -14.512 1.00 80.95  ? 575  LYS A O   1 
ATOM 3833  C CB  . LYS A 1 508  ? 223.213 1.175   -12.894 1.00 82.55  ? 575  LYS A CB  1 
ATOM 3834  C CG  . LYS A 1 508  ? 223.983 0.482   -14.016 1.00 83.60  ? 575  LYS A CG  1 
ATOM 3835  C CD  . LYS A 1 508  ? 225.367 1.080   -14.197 1.00 85.33  ? 575  LYS A CD  1 
ATOM 3836  C CE  . LYS A 1 508  ? 226.059 0.513   -15.435 1.00 86.55  ? 575  LYS A CE  1 
ATOM 3837  N NZ  . LYS A 1 508  ? 227.496 0.902   -15.531 1.00 87.08  ? 575  LYS A NZ  1 
ATOM 3838  N N   . LEU A 1 509  ? 222.511 2.180   -15.273 1.00 80.95  ? 576  LEU A N   1 
ATOM 3839  C CA  . LEU A 1 509  ? 221.912 2.385   -16.587 1.00 79.47  ? 576  LEU A CA  1 
ATOM 3840  C C   . LEU A 1 509  ? 221.973 1.106   -17.420 1.00 78.61  ? 576  LEU A C   1 
ATOM 3841  O O   . LEU A 1 509  ? 220.963 0.667   -17.954 1.00 77.81  ? 576  LEU A O   1 
ATOM 3842  C CB  . LEU A 1 509  ? 222.555 3.581   -17.357 1.00 78.77  ? 576  LEU A CB  1 
ATOM 3843  C CG  . LEU A 1 509  ? 223.732 3.686   -18.363 1.00 77.91  ? 576  LEU A CG  1 
ATOM 3844  C CD1 . LEU A 1 509  ? 223.974 2.432   -19.142 1.00 78.33  ? 576  LEU A CD1 1 
ATOM 3845  C CD2 . LEU A 1 509  ? 223.399 4.784   -19.364 1.00 77.36  ? 576  LEU A CD2 1 
ATOM 3846  N N   . CYS A 1 510  ? 223.144 0.485   -17.495 1.00 78.35  ? 577  CYS A N   1 
ATOM 3847  C CA  . CYS A 1 510  ? 223.313 -0.718  -18.312 1.00 78.31  ? 577  CYS A CA  1 
ATOM 3848  C C   . CYS A 1 510  ? 223.358 -2.065  -17.523 1.00 78.22  ? 577  CYS A C   1 
ATOM 3849  O O   . CYS A 1 510  ? 222.849 -2.158  -16.397 1.00 76.95  ? 577  CYS A O   1 
ATOM 3850  C CB  . CYS A 1 510  ? 224.560 -0.528  -19.218 1.00 79.34  ? 577  CYS A CB  1 
ATOM 3851  S SG  . CYS A 1 510  ? 224.269 -0.384  -21.037 1.00 77.36  ? 577  CYS A SG  1 
ATOM 3852  N N   . PRO A 1 511  ? 223.966 -3.122  -18.107 1.00 78.90  ? 578  PRO A N   1 
ATOM 3853  C CA  . PRO A 1 511  ? 224.040 -4.429  -17.441 1.00 78.69  ? 578  PRO A CA  1 
ATOM 3854  C C   . PRO A 1 511  ? 225.125 -4.588  -16.390 1.00 77.85  ? 578  PRO A C   1 
ATOM 3855  O O   . PRO A 1 511  ? 226.212 -5.079  -16.681 1.00 77.53  ? 578  PRO A O   1 
ATOM 3856  C CB  . PRO A 1 511  ? 224.261 -5.397  -18.604 1.00 79.22  ? 578  PRO A CB  1 
ATOM 3857  C CG  . PRO A 1 511  ? 224.047 -4.555  -19.848 1.00 78.27  ? 578  PRO A CG  1 
ATOM 3858  C CD  . PRO A 1 511  ? 224.521 -3.234  -19.465 1.00 78.72  ? 578  PRO A CD  1 
ATOM 3859  N N   . ARG A 1 512  ? 224.811 -4.207  -15.162 1.00 77.00  ? 579  ARG A N   1 
ATOM 3860  C CA  . ARG A 1 512  ? 225.761 -4.307  -14.063 1.00 76.04  ? 579  ARG A CA  1 
ATOM 3861  C C   . ARG A 1 512  ? 224.973 -4.697  -12.843 1.00 75.40  ? 579  ARG A C   1 
ATOM 3862  O O   . ARG A 1 512  ? 223.791 -4.367  -12.761 1.00 75.11  ? 579  ARG A O   1 
ATOM 3863  C CB  . ARG A 1 512  ? 226.413 -2.944  -13.809 1.00 75.81  ? 579  ARG A CB  1 
ATOM 3864  C CG  . ARG A 1 512  ? 226.502 -2.528  -12.345 1.00 76.15  ? 579  ARG A CG  1 
ATOM 3865  C CD  . ARG A 1 512  ? 227.876 -2.805  -11.795 1.00 77.10  ? 579  ARG A CD  1 
ATOM 3866  N NE  . ARG A 1 512  ? 228.915 -2.194  -12.618 1.00 79.10  ? 579  ARG A NE  1 
ATOM 3867  C CZ  . ARG A 1 512  ? 228.977 -0.897  -12.900 1.00 79.27  ? 579  ARG A CZ  1 
ATOM 3868  N NH1 . ARG A 1 512  ? 228.053 -0.065  -12.425 1.00 81.43  ? 579  ARG A NH1 1 
ATOM 3869  N NH2 . ARG A 1 512  ? 229.968 -0.430  -13.653 1.00 79.11  ? 579  ARG A NH2 1 
ATOM 3870  N N   . LEU A 1 513  ? 225.592 -5.413  -11.906 1.00 74.88  ? 580  LEU A N   1 
ATOM 3871  C CA  . LEU A 1 513  ? 224.862 -5.732  -10.686 1.00 74.61  ? 580  LEU A CA  1 
ATOM 3872  C C   . LEU A 1 513  ? 225.502 -5.099  -9.488  1.00 74.44  ? 580  LEU A C   1 
ATOM 3873  O O   . LEU A 1 513  ? 226.721 -5.186  -9.281  1.00 73.57  ? 580  LEU A O   1 
ATOM 3874  C CB  . LEU A 1 513  ? 224.685 -7.221  -10.425 1.00 75.36  ? 580  LEU A CB  1 
ATOM 3875  C CG  . LEU A 1 513  ? 223.678 -7.387  -9.259  1.00 76.73  ? 580  LEU A CG  1 
ATOM 3876  C CD1 . LEU A 1 513  ? 222.549 -6.358  -9.350  1.00 78.28  ? 580  LEU A CD1 1 
ATOM 3877  C CD2 . LEU A 1 513  ? 223.088 -8.780  -9.258  1.00 77.13  ? 580  LEU A CD2 1 
ATOM 3878  N N   . ASP A 1 514  ? 224.612 -4.509  -8.690  1.00 75.73  ? 581  ASP A N   1 
ATOM 3879  C CA  . ASP A 1 514  ? 224.907 -3.713  -7.502  1.00 79.34  ? 581  ASP A CA  1 
ATOM 3880  C C   . ASP A 1 514  ? 224.842 -4.214  -6.047  1.00 82.57  ? 581  ASP A C   1 
ATOM 3881  O O   . ASP A 1 514  ? 223.797 -4.080  -5.407  1.00 82.51  ? 581  ASP A O   1 
ATOM 3882  C CB  . ASP A 1 514  ? 224.021 -2.462  -7.572  1.00 78.75  ? 581  ASP A CB  1 
ATOM 3883  C CG  . ASP A 1 514  ? 222.524 -2.807  -7.578  1.00 78.62  ? 581  ASP A CG  1 
ATOM 3884  O OD1 . ASP A 1 514  ? 221.963 -3.174  -6.512  1.00 78.38  ? 581  ASP A OD1 1 
ATOM 3885  O OD2 . ASP A 1 514  ? 221.913 -2.721  -8.665  1.00 77.43  ? 581  ASP A OD2 1 
ATOM 3886  N N   . ASP A 1 515  ? 225.930 -4.765  -5.501  1.00 87.23  ? 582  ASP A N   1 
ATOM 3887  C CA  . ASP A 1 515  ? 225.903 -5.119  -4.065  1.00 91.91  ? 582  ASP A CA  1 
ATOM 3888  C C   . ASP A 1 515  ? 226.269 -3.874  -3.234  1.00 95.38  ? 582  ASP A C   1 
ATOM 3889  O O   . ASP A 1 515  ? 225.738 -3.709  -2.120  1.00 96.04  ? 582  ASP A O   1 
ATOM 3890  C CB  . ASP A 1 515  ? 226.887 -6.264  -3.663  1.00 91.40  ? 582  ASP A CB  1 
ATOM 3891  C CG  . ASP A 1 515  ? 227.159 -6.325  -2.111  1.00 90.45  ? 582  ASP A CG  1 
ATOM 3892  O OD1 . ASP A 1 515  ? 228.079 -5.637  -1.615  1.00 89.95  ? 582  ASP A OD1 1 
ATOM 3893  O OD2 . ASP A 1 515  ? 226.450 -7.050  -1.377  1.00 90.20  ? 582  ASP A OD2 1 
ATOM 3894  N N   . PRO A 1 516  ? 227.116 -2.951  -3.787  1.00 98.62  ? 583  PRO A N   1 
ATOM 3895  C CA  . PRO A 1 516  ? 227.472 -1.785  -2.978  1.00 101.24 ? 583  PRO A CA  1 
ATOM 3896  C C   . PRO A 1 516  ? 227.323 -2.038  -1.475  1.00 103.99 ? 583  PRO A C   1 
ATOM 3897  O O   . PRO A 1 516  ? 227.903 -2.999  -0.962  1.00 105.06 ? 583  PRO A O   1 
ATOM 3898  C CB  . PRO A 1 516  ? 226.571 -0.707  -3.567  1.00 100.32 ? 583  PRO A CB  1 
ATOM 3899  C CG  . PRO A 1 516  ? 226.678 -1.047  -5.118  1.00 99.53  ? 583  PRO A CG  1 
ATOM 3900  C CD  . PRO A 1 516  ? 227.149 -2.530  -5.203  1.00 98.73  ? 583  PRO A CD  1 
ATOM 3901  N N   . ALA A 1 517  ? 226.557 -1.220  -0.766  1.00 106.49 ? 584  ALA A N   1 
ATOM 3902  C CA  . ALA A 1 517  ? 226.407 -1.450  0.660   1.00 108.47 ? 584  ALA A CA  1 
ATOM 3903  C C   . ALA A 1 517  ? 227.760 -1.257  1.331   1.00 109.61 ? 584  ALA A C   1 
ATOM 3904  O O   . ALA A 1 517  ? 227.865 -0.528  2.310   1.00 108.94 ? 584  ALA A O   1 
ATOM 3905  C CB  . ALA A 1 517  ? 225.891 -2.876  0.916   1.00 108.97 ? 584  ALA A CB  1 
ATOM 3906  N N   . TRP A 1 518  ? 228.787 -1.920  0.798   1.00 111.94 ? 585  TRP A N   1 
ATOM 3907  C CA  . TRP A 1 518  ? 230.157 -1.864  1.330   1.00 113.98 ? 585  TRP A CA  1 
ATOM 3908  C C   . TRP A 1 518  ? 231.117 -0.819  0.718   1.00 113.23 ? 585  TRP A C   1 
ATOM 3909  O O   . TRP A 1 518  ? 231.420 -0.861  -0.481  1.00 113.44 ? 585  TRP A O   1 
ATOM 3910  C CB  . TRP A 1 518  ? 230.808 -3.261  1.240   1.00 116.86 ? 585  TRP A CB  1 
ATOM 3911  C CG  . TRP A 1 518  ? 230.487 -4.146  2.401   1.00 119.26 ? 585  TRP A CG  1 
ATOM 3912  C CD1 . TRP A 1 518  ? 231.285 -5.109  2.946   1.00 119.51 ? 585  TRP A CD1 1 
ATOM 3913  C CD2 . TRP A 1 518  ? 229.311 -4.097  3.208   1.00 120.26 ? 585  TRP A CD2 1 
ATOM 3914  N NE1 . TRP A 1 518  ? 230.681 -5.653  4.051   1.00 120.12 ? 585  TRP A NE1 1 
ATOM 3915  C CE2 . TRP A 1 518  ? 229.467 -5.048  4.232   1.00 120.45 ? 585  TRP A CE2 1 
ATOM 3916  C CE3 . TRP A 1 518  ? 228.140 -3.334  3.166   1.00 120.55 ? 585  TRP A CE3 1 
ATOM 3917  C CZ2 . TRP A 1 518  ? 228.497 -5.255  5.205   1.00 120.73 ? 585  TRP A CZ2 1 
ATOM 3918  C CZ3 . TRP A 1 518  ? 227.186 -3.535  4.122   1.00 121.20 ? 585  TRP A CZ3 1 
ATOM 3919  C CH2 . TRP A 1 518  ? 227.369 -4.489  5.133   1.00 121.27 ? 585  TRP A CH2 1 
ATOM 3920  N N   . THR A 1 519  ? 231.606 0.097   1.562   1.00 112.16 ? 586  THR A N   1 
ATOM 3921  C CA  . THR A 1 519  ? 232.541 1.159   1.159   1.00 111.10 ? 586  THR A CA  1 
ATOM 3922  C C   . THR A 1 519  ? 234.002 0.708   1.033   1.00 110.63 ? 586  THR A C   1 
ATOM 3923  O O   . THR A 1 519  ? 234.722 1.164   0.138   1.00 111.37 ? 586  THR A O   1 
ATOM 3924  C CB  . THR A 1 519  ? 232.475 2.368   2.143   1.00 110.68 ? 586  THR A CB  1 
ATOM 3925  O OG1 . THR A 1 519  ? 231.606 3.373   1.601   1.00 110.93 ? 586  THR A OG1 1 
ATOM 3926  C CG2 . THR A 1 519  ? 233.868 2.970   2.387   1.00 110.21 ? 586  THR A CG2 1 
ATOM 3927  N N   . PRO A 1 520  ? 234.460 -0.179  1.939   1.00 109.96 ? 587  PRO A N   1 
ATOM 3928  C CA  . PRO A 1 520  ? 235.838 -0.683  1.913   1.00 109.08 ? 587  PRO A CA  1 
ATOM 3929  C C   . PRO A 1 520  ? 236.508 -0.595  0.537   1.00 108.00 ? 587  PRO A C   1 
ATOM 3930  O O   . PRO A 1 520  ? 236.135 -1.306  -0.396  1.00 108.02 ? 587  PRO A O   1 
ATOM 3931  C CB  . PRO A 1 520  ? 235.670 -2.116  2.408   1.00 109.90 ? 587  PRO A CB  1 
ATOM 3932  C CG  . PRO A 1 520  ? 234.648 -1.928  3.518   1.00 109.56 ? 587  PRO A CG  1 
ATOM 3933  C CD  . PRO A 1 520  ? 233.683 -0.851  3.002   1.00 109.75 ? 587  PRO A CD  1 
ATOM 3934  N N   . GLY A 1 521  ? 237.492 0.294   0.424   1.00 106.35 ? 588  GLY A N   1 
ATOM 3935  C CA  . GLY A 1 521  ? 238.192 0.482   -0.830  1.00 103.81 ? 588  GLY A CA  1 
ATOM 3936  C C   . GLY A 1 521  ? 238.342 -0.757  -1.698  1.00 102.13 ? 588  GLY A C   1 
ATOM 3937  O O   . GLY A 1 521  ? 238.209 -1.893  -1.240  1.00 101.69 ? 588  GLY A O   1 
ATOM 3938  N N   . PRO A 1 522  ? 238.719 -0.549  -2.958  1.00 101.08 ? 589  PRO A N   1 
ATOM 3939  C CA  . PRO A 1 522  ? 238.926 -1.552  -3.997  1.00 100.26 ? 589  PRO A CA  1 
ATOM 3940  C C   . PRO A 1 522  ? 238.049 -2.800  -3.949  1.00 99.45  ? 589  PRO A C   1 
ATOM 3941  O O   . PRO A 1 522  ? 238.500 -3.870  -3.533  1.00 99.36  ? 589  PRO A O   1 
ATOM 3942  C CB  . PRO A 1 522  ? 240.421 -1.862  -3.863  1.00 100.62 ? 589  PRO A CB  1 
ATOM 3943  C CG  . PRO A 1 522  ? 240.988 -0.659  -3.030  1.00 100.66 ? 589  PRO A CG  1 
ATOM 3944  C CD  . PRO A 1 522  ? 239.873 0.351   -2.987  1.00 100.91 ? 589  PRO A CD  1 
ATOM 3945  N N   . SER A 1 523  ? 236.804 -2.660  -4.403  1.00 97.71  ? 590  SER A N   1 
ATOM 3946  C CA  . SER A 1 523  ? 235.862 -3.779  -4.423  1.00 95.35  ? 590  SER A CA  1 
ATOM 3947  C C   . SER A 1 523  ? 235.117 -3.934  -5.760  1.00 94.59  ? 590  SER A C   1 
ATOM 3948  O O   . SER A 1 523  ? 234.734 -2.936  -6.382  1.00 94.79  ? 590  SER A O   1 
ATOM 3949  C CB  . SER A 1 523  ? 234.842 -3.631  -3.284  1.00 95.24  ? 590  SER A CB  1 
ATOM 3950  O OG  . SER A 1 523  ? 234.071 -2.450  -3.426  1.00 93.70  ? 590  SER A OG  1 
ATOM 3951  N N   . LEU A 1 524  ? 234.928 -5.191  -6.186  1.00 93.30  ? 591  LEU A N   1 
ATOM 3952  C CA  . LEU A 1 524  ? 234.211 -5.555  -7.426  1.00 91.44  ? 591  LEU A CA  1 
ATOM 3953  C C   . LEU A 1 524  ? 233.445 -6.886  -7.235  1.00 90.44  ? 591  LEU A C   1 
ATOM 3954  O O   . LEU A 1 524  ? 233.921 -7.970  -7.595  1.00 89.96  ? 591  LEU A O   1 
ATOM 3955  C CB  . LEU A 1 524  ? 235.192 -5.682  -8.585  1.00 90.51  ? 591  LEU A CB  1 
ATOM 3956  C CG  . LEU A 1 524  ? 236.319 -6.679  -8.364  1.00 90.55  ? 591  LEU A CG  1 
ATOM 3957  C CD1 . LEU A 1 524  ? 236.426 -7.501  -9.598  1.00 91.19  ? 591  LEU A CD1 1 
ATOM 3958  C CD2 . LEU A 1 524  ? 237.632 -5.984  -8.056  1.00 88.79  ? 591  LEU A CD2 1 
ATOM 3959  N N   . LEU A 1 525  ? 232.237 -6.765  -6.689  1.00 89.28  ? 592  LEU A N   1 
ATOM 3960  C CA  . LEU A 1 525  ? 231.364 -7.886  -6.350  1.00 85.94  ? 592  LEU A CA  1 
ATOM 3961  C C   . LEU A 1 525  ? 230.664 -8.641  -7.464  1.00 82.54  ? 592  LEU A C   1 
ATOM 3962  O O   . LEU A 1 525  ? 229.931 -9.585  -7.186  1.00 82.17  ? 592  LEU A O   1 
ATOM 3963  C CB  . LEU A 1 525  ? 230.306 -7.405  -5.347  1.00 87.29  ? 592  LEU A CB  1 
ATOM 3964  C CG  . LEU A 1 525  ? 230.572 -5.972  -4.866  1.00 88.14  ? 592  LEU A CG  1 
ATOM 3965  C CD1 . LEU A 1 525  ? 229.837 -4.990  -5.779  1.00 88.81  ? 592  LEU A CD1 1 
ATOM 3966  C CD2 . LEU A 1 525  ? 230.145 -5.800  -3.415  1.00 88.51  ? 592  LEU A CD2 1 
ATOM 3967  N N   . SER A 1 526  ? 230.870 -8.245  -8.715  1.00 78.69  ? 593  SER A N   1 
ATOM 3968  C CA  . SER A 1 526  ? 230.204 -8.934  -9.812  1.00 75.29  ? 593  SER A CA  1 
ATOM 3969  C C   . SER A 1 526  ? 230.884 -10.251 -10.156 1.00 72.14  ? 593  SER A C   1 
ATOM 3970  O O   . SER A 1 526  ? 230.344 -11.033 -10.939 1.00 72.06  ? 593  SER A O   1 
ATOM 3971  C CB  . SER A 1 526  ? 230.151 -8.046  -11.051 1.00 76.41  ? 593  SER A CB  1 
ATOM 3972  O OG  . SER A 1 526  ? 231.460 -7.772  -11.510 1.00 77.55  ? 593  SER A OG  1 
ATOM 3973  N N   . LEU A 1 527  ? 232.059 -10.487 -9.563  1.00 68.70  ? 594  LEU A N   1 
ATOM 3974  C CA  . LEU A 1 527  ? 232.842 -11.711 -9.786  1.00 64.99  ? 594  LEU A CA  1 
ATOM 3975  C C   . LEU A 1 527  ? 232.553 -12.736 -8.701  1.00 62.73  ? 594  LEU A C   1 
ATOM 3976  O O   . LEU A 1 527  ? 232.577 -13.952 -8.931  1.00 62.03  ? 594  LEU A O   1 
ATOM 3977  C CB  . LEU A 1 527  ? 234.328 -11.398 -9.777  1.00 65.29  ? 594  LEU A CB  1 
ATOM 3978  C CG  . LEU A 1 527  ? 234.777 -10.027 -10.274 1.00 63.66  ? 594  LEU A CG  1 
ATOM 3979  C CD1 . LEU A 1 527  ? 236.150 -10.223 -10.871 1.00 62.60  ? 594  LEU A CD1 1 
ATOM 3980  C CD2 . LEU A 1 527  ? 233.845 -9.438  -11.327 1.00 64.98  ? 594  LEU A CD2 1 
ATOM 3981  N N   . GLN A 1 528  ? 232.320 -12.226 -7.500  1.00 61.69  ? 595  GLN A N   1 
ATOM 3982  C CA  . GLN A 1 528  ? 231.951 -13.069 -6.380  1.00 60.74  ? 595  GLN A CA  1 
ATOM 3983  C C   . GLN A 1 528  ? 230.579 -13.572 -6.820  1.00 58.86  ? 595  GLN A C   1 
ATOM 3984  O O   . GLN A 1 528  ? 230.211 -14.695 -6.494  1.00 58.98  ? 595  GLN A O   1 
ATOM 3985  C CB  . GLN A 1 528  ? 231.800 -12.238 -5.113  1.00 62.27  ? 595  GLN A CB  1 
ATOM 3986  C CG  . GLN A 1 528  ? 232.292 -10.809 -5.276  1.00 63.67  ? 595  GLN A CG  1 
ATOM 3987  C CD  . GLN A 1 528  ? 233.703 -10.631 -4.792  1.00 64.18  ? 595  GLN A CD  1 
ATOM 3988  O OE1 . GLN A 1 528  ? 233.989 -10.848 -3.618  1.00 63.68  ? 595  GLN A OE1 1 
ATOM 3989  N NE2 . GLN A 1 528  ? 234.598 -10.236 -5.685  1.00 63.35  ? 595  GLN A NE2 1 
ATOM 3990  N N   . MET A 1 529  ? 229.833 -12.719 -7.549  1.00 54.82  ? 596  MET A N   1 
ATOM 3991  C CA  . MET A 1 529  ? 228.505 -13.065 -8.093  1.00 51.41  ? 596  MET A CA  1 
ATOM 3992  C C   . MET A 1 529  ? 228.786 -14.380 -8.790  1.00 47.87  ? 596  MET A C   1 
ATOM 3993  O O   . MET A 1 529  ? 229.267 -14.411 -9.921  1.00 45.66  ? 596  MET A O   1 
ATOM 3994  C CB  . MET A 1 529  ? 228.021 -12.071 -9.170  1.00 53.77  ? 596  MET A CB  1 
ATOM 3995  C CG  . MET A 1 529  ? 227.928 -10.620 -8.795  1.00 56.54  ? 596  MET A CG  1 
ATOM 3996  S SD  . MET A 1 529  ? 226.309 -9.908  -8.829  1.00 58.19  ? 596  MET A SD  1 
ATOM 3997  C CE  . MET A 1 529  ? 225.193 -11.396 -8.931  1.00 60.77  ? 596  MET A CE  1 
ATOM 3998  N N   . ARG A 1 530  ? 228.518 -15.475 -8.111  1.00 45.40  ? 597  ARG A N   1 
ATOM 3999  C CA  . ARG A 1 530  ? 228.790 -16.747 -8.717  1.00 43.68  ? 597  ARG A CA  1 
ATOM 4000  C C   . ARG A 1 530  ? 228.063 -16.608 -10.052 1.00 42.42  ? 597  ARG A C   1 
ATOM 4001  O O   . ARG A 1 530  ? 227.090 -15.859 -10.136 1.00 40.71  ? 597  ARG A O   1 
ATOM 4002  C CB  . ARG A 1 530  ? 228.207 -17.855 -7.830  1.00 42.68  ? 597  ARG A CB  1 
ATOM 4003  C CG  . ARG A 1 530  ? 228.410 -17.636 -6.328  1.00 43.19  ? 597  ARG A CG  1 
ATOM 4004  C CD  . ARG A 1 530  ? 227.138 -17.960 -5.565  1.00 42.69  ? 597  ARG A CD  1 
ATOM 4005  N NE  . ARG A 1 530  ? 226.028 -18.150 -6.486  1.00 42.05  ? 597  ARG A NE  1 
ATOM 4006  C CZ  . ARG A 1 530  ? 224.789 -18.450 -6.127  1.00 41.59  ? 597  ARG A CZ  1 
ATOM 4007  N NH1 . ARG A 1 530  ? 224.477 -18.591 -4.853  1.00 42.17  ? 597  ARG A NH1 1 
ATOM 4008  N NH2 . ARG A 1 530  ? 223.868 -18.643 -7.053  1.00 41.86  ? 597  ARG A NH2 1 
ATOM 4009  N N   . VAL A 1 531  ? 228.577 -17.273 -11.088 1.00 41.29  ? 598  VAL A N   1 
ATOM 4010  C CA  . VAL A 1 531  ? 228.004 -17.276 -12.444 1.00 39.52  ? 598  VAL A CA  1 
ATOM 4011  C C   . VAL A 1 531  ? 228.913 -16.637 -13.443 1.00 38.32  ? 598  VAL A C   1 
ATOM 4012  O O   . VAL A 1 531  ? 229.028 -17.095 -14.571 1.00 38.65  ? 598  VAL A O   1 
ATOM 4013  C CB  . VAL A 1 531  ? 226.633 -16.559 -12.536 1.00 38.36  ? 598  VAL A CB  1 
ATOM 4014  C CG1 . VAL A 1 531  ? 226.280 -16.274 -13.973 1.00 37.18  ? 598  VAL A CG1 1 
ATOM 4015  C CG2 . VAL A 1 531  ? 225.553 -17.426 -11.920 1.00 36.52  ? 598  VAL A CG2 1 
ATOM 4016  N N   . THR A 1 532  ? 229.559 -15.569 -13.027 1.00 37.48  ? 599  THR A N   1 
ATOM 4017  C CA  . THR A 1 532  ? 230.450 -14.880 -13.926 1.00 34.55  ? 599  THR A CA  1 
ATOM 4018  C C   . THR A 1 532  ? 231.391 -15.842 -14.684 1.00 35.01  ? 599  THR A C   1 
ATOM 4019  O O   . THR A 1 532  ? 231.677 -15.634 -15.866 1.00 32.11  ? 599  THR A O   1 
ATOM 4020  C CB  . THR A 1 532  ? 231.243 -13.788 -13.166 1.00 32.67  ? 599  THR A CB  1 
ATOM 4021  O OG1 . THR A 1 532  ? 230.326 -12.834 -12.616 1.00 30.14  ? 599  THR A OG1 1 
ATOM 4022  C CG2 . THR A 1 532  ? 232.158 -13.046 -14.106 1.00 33.80  ? 599  THR A CG2 1 
ATOM 4023  N N   . PRO A 1 533  ? 231.882 -16.903 -14.017 1.00 36.51  ? 600  PRO A N   1 
ATOM 4024  C CA  . PRO A 1 533  ? 232.780 -17.857 -14.691 1.00 38.42  ? 600  PRO A CA  1 
ATOM 4025  C C   . PRO A 1 533  ? 232.167 -18.696 -15.835 1.00 38.28  ? 600  PRO A C   1 
ATOM 4026  O O   . PRO A 1 533  ? 232.846 -18.996 -16.826 1.00 36.39  ? 600  PRO A O   1 
ATOM 4027  C CB  . PRO A 1 533  ? 233.289 -18.716 -13.535 1.00 38.69  ? 600  PRO A CB  1 
ATOM 4028  C CG  . PRO A 1 533  ? 233.357 -17.719 -12.407 1.00 36.30  ? 600  PRO A CG  1 
ATOM 4029  C CD  . PRO A 1 533  ? 232.029 -17.003 -12.551 1.00 37.19  ? 600  PRO A CD  1 
ATOM 4030  N N   . LYS A 1 534  ? 230.901 -19.088 -15.710 1.00 39.29  ? 601  LYS A N   1 
ATOM 4031  C CA  . LYS A 1 534  ? 230.267 -19.852 -16.785 1.00 40.83  ? 601  LYS A CA  1 
ATOM 4032  C C   . LYS A 1 534  ? 230.272 -18.826 -17.887 1.00 41.02  ? 601  LYS A C   1 
ATOM 4033  O O   . LYS A 1 534  ? 230.514 -19.141 -19.055 1.00 39.27  ? 601  LYS A O   1 
ATOM 4034  C CB  . LYS A 1 534  ? 228.840 -20.238 -16.433 1.00 44.06  ? 601  LYS A CB  1 
ATOM 4035  C CG  . LYS A 1 534  ? 228.742 -20.969 -15.136 1.00 42.94  ? 601  LYS A CG  1 
ATOM 4036  C CD  . LYS A 1 534  ? 227.863 -20.204 -14.187 1.00 42.57  ? 601  LYS A CD  1 
ATOM 4037  C CE  . LYS A 1 534  ? 226.837 -21.109 -13.562 1.00 36.32  ? 601  LYS A CE  1 
ATOM 4038  N NZ  . LYS A 1 534  ? 227.512 -22.199 -12.823 1.00 38.92  ? 601  LYS A NZ  1 
ATOM 4039  N N   . LEU A 1 535  ? 229.984 -17.586 -17.491 1.00 40.51  ? 602  LEU A N   1 
ATOM 4040  C CA  . LEU A 1 535  ? 230.062 -16.468 -18.417 1.00 40.92  ? 602  LEU A CA  1 
ATOM 4041  C C   . LEU A 1 535  ? 231.583 -16.484 -18.360 1.00 40.07  ? 602  LEU A C   1 
ATOM 4042  O O   . LEU A 1 535  ? 232.128 -17.249 -17.585 1.00 38.92  ? 602  LEU A O   1 
ATOM 4043  C CB  . LEU A 1 535  ? 229.513 -15.166 -17.801 1.00 42.39  ? 602  LEU A CB  1 
ATOM 4044  C CG  . LEU A 1 535  ? 228.115 -15.148 -17.181 1.00 43.84  ? 602  LEU A CG  1 
ATOM 4045  C CD1 . LEU A 1 535  ? 227.729 -13.725 -16.900 1.00 43.88  ? 602  LEU A CD1 1 
ATOM 4046  C CD2 . LEU A 1 535  ? 227.110 -15.750 -18.103 1.00 45.03  ? 602  LEU A CD2 1 
ATOM 4047  N N   . MET A 1 536  ? 232.299 -15.677 -19.122 1.00 39.09  ? 603  MET A N   1 
ATOM 4048  C CA  . MET A 1 536  ? 233.748 -15.799 -19.003 1.00 39.60  ? 603  MET A CA  1 
ATOM 4049  C C   . MET A 1 536  ? 234.039 -17.310 -19.060 1.00 40.75  ? 603  MET A C   1 
ATOM 4050  O O   . MET A 1 536  ? 234.665 -17.862 -18.172 1.00 38.78  ? 603  MET A O   1 
ATOM 4051  C CB  . MET A 1 536  ? 234.229 -15.217 -17.656 1.00 39.63  ? 603  MET A CB  1 
ATOM 4052  C CG  . MET A 1 536  ? 234.760 -13.780 -17.715 1.00 40.38  ? 603  MET A CG  1 
ATOM 4053  S SD  . MET A 1 536  ? 235.021 -13.094 -16.078 1.00 37.45  ? 603  MET A SD  1 
ATOM 4054  C CE  . MET A 1 536  ? 236.796 -12.815 -16.060 1.00 40.18  ? 603  MET A CE  1 
ATOM 4055  N N   . ALA A 1 537  ? 233.538 -17.979 -20.088 1.00 42.92  ? 604  ALA A N   1 
ATOM 4056  C CA  . ALA A 1 537  ? 233.762 -19.409 -20.243 1.00 46.52  ? 604  ALA A CA  1 
ATOM 4057  C C   . ALA A 1 537  ? 235.209 -19.751 -19.878 1.00 48.78  ? 604  ALA A C   1 
ATOM 4058  O O   . ALA A 1 537  ? 236.133 -19.335 -20.565 1.00 49.09  ? 604  ALA A O   1 
ATOM 4059  C CB  . ALA A 1 537  ? 233.472 -19.796 -21.649 1.00 47.61  ? 604  ALA A CB  1 
ATOM 4060  N N   . LEU A 1 538  ? 235.417 -20.550 -18.834 1.00 52.24  ? 605  LEU A N   1 
ATOM 4061  C CA  . LEU A 1 538  ? 236.780 -20.808 -18.388 1.00 55.89  ? 605  LEU A CA  1 
ATOM 4062  C C   . LEU A 1 538  ? 237.592 -22.110 -18.292 1.00 60.74  ? 605  LEU A C   1 
ATOM 4063  O O   . LEU A 1 538  ? 238.712 -22.022 -17.820 1.00 61.36  ? 605  LEU A O   1 
ATOM 4064  C CB  . LEU A 1 538  ? 236.943 -20.149 -17.041 1.00 52.45  ? 605  LEU A CB  1 
ATOM 4065  C CG  . LEU A 1 538  ? 236.649 -18.676 -16.923 1.00 50.43  ? 605  LEU A CG  1 
ATOM 4066  C CD1 . LEU A 1 538  ? 236.569 -18.369 -15.464 1.00 49.47  ? 605  LEU A CD1 1 
ATOM 4067  C CD2 . LEU A 1 538  ? 237.694 -17.833 -17.614 1.00 49.98  ? 605  LEU A CD2 1 
ATOM 4068  N N   . THR A 1 539  ? 237.163 -23.298 -18.700 1.00 66.09  ? 606  THR A N   1 
ATOM 4069  C CA  . THR A 1 539  ? 238.126 -24.386 -18.456 1.00 72.93  ? 606  THR A CA  1 
ATOM 4070  C C   . THR A 1 539  ? 239.188 -24.580 -19.455 1.00 79.28  ? 606  THR A C   1 
ATOM 4071  O O   . THR A 1 539  ? 238.965 -24.484 -20.644 1.00 81.76  ? 606  THR A O   1 
ATOM 4072  C CB  . THR A 1 539  ? 237.617 -25.813 -18.424 1.00 71.78  ? 606  THR A CB  1 
ATOM 4073  O OG1 . THR A 1 539  ? 236.924 -26.081 -19.637 1.00 70.71  ? 606  THR A OG1 1 
ATOM 4074  C CG2 . THR A 1 539  ? 236.844 -26.109 -17.194 1.00 70.75  ? 606  THR A CG2 1 
ATOM 4075  N N   . TRP A 1 540  ? 240.340 -24.962 -18.926 1.00 84.91  ? 607  TRP A N   1 
ATOM 4076  C CA  . TRP A 1 540  ? 241.469 -25.281 -19.749 1.00 89.91  ? 607  TRP A CA  1 
ATOM 4077  C C   . TRP A 1 540  ? 242.781 -25.776 -19.082 1.00 94.14  ? 607  TRP A C   1 
ATOM 4078  O O   . TRP A 1 540  ? 243.722 -26.133 -19.783 1.00 94.34  ? 607  TRP A O   1 
ATOM 4079  C CB  . TRP A 1 540  ? 241.660 -24.138 -20.771 1.00 89.46  ? 607  TRP A CB  1 
ATOM 4080  C CG  . TRP A 1 540  ? 241.518 -24.664 -22.167 1.00 89.61  ? 607  TRP A CG  1 
ATOM 4081  C CD1 . TRP A 1 540  ? 240.403 -24.680 -22.975 1.00 89.84  ? 607  TRP A CD1 1 
ATOM 4082  C CD2 . TRP A 1 540  ? 242.525 -25.361 -22.864 1.00 89.37  ? 607  TRP A CD2 1 
ATOM 4083  N NE1 . TRP A 1 540  ? 240.679 -25.354 -24.139 1.00 89.60  ? 607  TRP A NE1 1 
ATOM 4084  C CE2 . TRP A 1 540  ? 241.982 -25.777 -24.094 1.00 88.98  ? 607  TRP A CE2 1 
ATOM 4085  C CE3 . TRP A 1 540  ? 243.856 -25.667 -22.568 1.00 89.07  ? 607  TRP A CE3 1 
ATOM 4086  C CZ2 . TRP A 1 540  ? 242.719 -26.502 -25.013 1.00 87.27  ? 607  TRP A CZ2 1 
ATOM 4087  C CZ3 . TRP A 1 540  ? 244.585 -26.383 -23.475 1.00 87.61  ? 607  TRP A CZ3 1 
ATOM 4088  C CH2 . TRP A 1 540  ? 244.022 -26.790 -24.692 1.00 86.67  ? 607  TRP A CH2 1 
ATOM 4089  N N   . ASP A 1 541  ? 242.818 -25.841 -17.743 1.00 99.69  ? 608  ASP A N   1 
ATOM 4090  C CA  . ASP A 1 541  ? 244.012 -26.305 -16.983 1.00 106.00 ? 608  ASP A CA  1 
ATOM 4091  C C   . ASP A 1 541  ? 243.948 -27.708 -16.396 1.00 109.23 ? 608  ASP A C   1 
ATOM 4092  O O   . ASP A 1 541  ? 243.672 -27.875 -15.219 1.00 110.21 ? 608  ASP A O   1 
ATOM 4093  C CB  . ASP A 1 541  ? 244.318 -25.437 -15.778 1.00 106.78 ? 608  ASP A CB  1 
ATOM 4094  C CG  . ASP A 1 541  ? 243.362 -24.352 -15.594 1.00 107.39 ? 608  ASP A CG  1 
ATOM 4095  O OD1 . ASP A 1 541  ? 243.688 -23.203 -15.935 1.00 108.40 ? 608  ASP A OD1 1 
ATOM 4096  O OD2 . ASP A 1 541  ? 242.276 -24.663 -15.098 1.00 106.71 ? 608  ASP A OD2 1 
ATOM 4097  N N   . GLY A 1 542  ? 244.318 -28.704 -17.166 1.00 112.39 ? 609  GLY A N   1 
ATOM 4098  C CA  . GLY A 1 542  ? 244.157 -30.076 -16.727 1.00 115.32 ? 609  GLY A CA  1 
ATOM 4099  C C   . GLY A 1 542  ? 243.261 -30.256 -17.915 1.00 117.39 ? 609  GLY A C   1 
ATOM 4100  O O   . GLY A 1 542  ? 242.455 -31.179 -18.078 1.00 117.37 ? 609  GLY A O   1 
ATOM 4101  N N   . PHE A 1 543  ? 243.420 -29.206 -18.710 1.00 119.16 ? 610  PHE A N   1 
ATOM 4102  C CA  . PHE A 1 543  ? 242.811 -29.009 -19.971 1.00 120.31 ? 610  PHE A CA  1 
ATOM 4103  C C   . PHE A 1 543  ? 241.284 -28.757 -19.937 1.00 120.72 ? 610  PHE A C   1 
ATOM 4104  O O   . PHE A 1 543  ? 240.898 -27.597 -19.967 1.00 120.71 ? 610  PHE A O   1 
ATOM 4105  C CB  . PHE A 1 543  ? 243.342 -30.143 -20.874 1.00 120.88 ? 610  PHE A CB  1 
ATOM 4106  C CG  . PHE A 1 543  ? 244.892 -30.291 -20.828 1.00 121.51 ? 610  PHE A CG  1 
ATOM 4107  C CD1 . PHE A 1 543  ? 245.585 -30.967 -21.838 1.00 121.54 ? 610  PHE A CD1 1 
ATOM 4108  C CD2 . PHE A 1 543  ? 245.647 -29.748 -19.769 1.00 121.30 ? 610  PHE A CD2 1 
ATOM 4109  C CE1 . PHE A 1 543  ? 246.994 -31.096 -21.795 1.00 121.03 ? 610  PHE A CE1 1 
ATOM 4110  C CE2 . PHE A 1 543  ? 247.048 -29.875 -19.716 1.00 121.65 ? 610  PHE A CE2 1 
ATOM 4111  C CZ  . PHE A 1 543  ? 247.721 -30.548 -20.732 1.00 121.48 ? 610  PHE A CZ  1 
ATOM 4112  N N   . PRO A 1 544  ? 240.395 -29.773 -19.856 1.00 121.44 ? 611  PRO A N   1 
ATOM 4113  C CA  . PRO A 1 544  ? 239.148 -28.987 -19.865 1.00 121.59 ? 611  PRO A CA  1 
ATOM 4114  C C   . PRO A 1 544  ? 237.883 -29.299 -19.034 1.00 121.36 ? 611  PRO A C   1 
ATOM 4115  O O   . PRO A 1 544  ? 237.872 -30.056 -18.069 1.00 120.82 ? 611  PRO A O   1 
ATOM 4116  C CB  . PRO A 1 544  ? 238.813 -28.975 -21.342 1.00 122.32 ? 611  PRO A CB  1 
ATOM 4117  C CG  . PRO A 1 544  ? 239.085 -30.455 -21.702 1.00 122.57 ? 611  PRO A CG  1 
ATOM 4118  C CD  . PRO A 1 544  ? 240.238 -30.923 -20.769 1.00 122.10 ? 611  PRO A CD  1 
ATOM 4119  N N   . LEU A 1 545  ? 236.828 -28.640 -19.501 1.00 121.13 ? 612  LEU A N   1 
ATOM 4120  C CA  . LEU A 1 545  ? 235.432 -28.636 -19.062 1.00 120.69 ? 612  LEU A CA  1 
ATOM 4121  C C   . LEU A 1 545  ? 235.073 -27.260 -19.585 1.00 120.34 ? 612  LEU A C   1 
ATOM 4122  O O   . LEU A 1 545  ? 234.982 -27.051 -20.783 1.00 120.87 ? 612  LEU A O   1 
ATOM 4123  C CB  . LEU A 1 545  ? 235.233 -28.643 -17.539 1.00 120.20 ? 612  LEU A CB  1 
ATOM 4124  C CG  . LEU A 1 545  ? 233.947 -27.845 -17.205 1.00 120.97 ? 612  LEU A CG  1 
ATOM 4125  C CD1 . LEU A 1 545  ? 232.814 -28.375 -18.014 1.00 119.97 ? 612  LEU A CD1 1 
ATOM 4126  C CD2 . LEU A 1 545  ? 233.567 -27.846 -15.779 1.00 121.90 ? 612  LEU A CD2 1 
ATOM 4127  N N   . HIS A 1 546  ? 234.957 -26.321 -18.655 1.00 120.14 ? 613  HIS A N   1 
ATOM 4128  C CA  . HIS A 1 546  ? 234.680 -24.904 -18.857 1.00 119.78 ? 613  HIS A CA  1 
ATOM 4129  C C   . HIS A 1 546  ? 234.821 -24.380 -17.464 1.00 118.17 ? 613  HIS A C   1 
ATOM 4130  O O   . HIS A 1 546  ? 235.316 -23.283 -17.226 1.00 118.40 ? 613  HIS A O   1 
ATOM 4131  C CB  . HIS A 1 546  ? 233.266 -24.670 -19.303 1.00 122.17 ? 613  HIS A CB  1 
ATOM 4132  C CG  . HIS A 1 546  ? 233.026 -25.073 -20.709 1.00 124.26 ? 613  HIS A CG  1 
ATOM 4133  N ND1 . HIS A 1 546  ? 232.731 -26.371 -21.060 1.00 125.76 ? 613  HIS A ND1 1 
ATOM 4134  C CD2 . HIS A 1 546  ? 233.150 -24.383 -21.865 1.00 125.36 ? 613  HIS A CD2 1 
ATOM 4135  C CE1 . HIS A 1 546  ? 232.689 -26.466 -22.376 1.00 126.02 ? 613  HIS A CE1 1 
ATOM 4136  N NE2 . HIS A 1 546  ? 232.940 -25.274 -22.888 1.00 125.93 ? 613  HIS A NE2 1 
ATOM 4137  N N   . TYR A 1 547  ? 234.408 -25.258 -16.559 1.00 115.39 ? 614  TYR A N   1 
ATOM 4138  C CA  . TYR A 1 547  ? 234.386 -25.056 -15.132 1.00 112.96 ? 614  TYR A CA  1 
ATOM 4139  C C   . TYR A 1 547  ? 232.942 -25.153 -14.750 1.00 111.44 ? 614  TYR A C   1 
ATOM 4140  O O   . TYR A 1 547  ? 232.081 -25.508 -15.547 1.00 112.00 ? 614  TYR A O   1 
ATOM 4141  C CB  . TYR A 1 547  ? 234.863 -23.664 -14.750 1.00 112.84 ? 614  TYR A CB  1 
ATOM 4142  C CG  . TYR A 1 547  ? 236.347 -23.541 -14.720 1.00 113.49 ? 614  TYR A CG  1 
ATOM 4143  C CD1 . TYR A 1 547  ? 236.967 -22.302 -14.848 1.00 114.36 ? 614  TYR A CD1 1 
ATOM 4144  C CD2 . TYR A 1 547  ? 237.139 -24.669 -14.586 1.00 113.79 ? 614  TYR A CD2 1 
ATOM 4145  C CE1 . TYR A 1 547  ? 238.348 -22.195 -14.850 1.00 114.09 ? 614  TYR A CE1 1 
ATOM 4146  C CE2 . TYR A 1 547  ? 238.509 -24.577 -14.585 1.00 113.84 ? 614  TYR A CE2 1 
ATOM 4147  C CZ  . TYR A 1 547  ? 239.114 -23.343 -14.720 1.00 113.47 ? 614  TYR A CZ  1 
ATOM 4148  O OH  . TYR A 1 547  ? 240.486 -23.270 -14.751 1.00 111.74 ? 614  TYR A OH  1 
ATOM 4149  N N   . SER A 1 548  ? 232.710 -24.845 -13.493 1.00 109.59 ? 615  SER A N   1 
ATOM 4150  C CA  . SER A 1 548  ? 231.398 -24.768 -12.907 1.00 107.43 ? 615  SER A CA  1 
ATOM 4151  C C   . SER A 1 548  ? 231.755 -23.408 -12.305 1.00 106.59 ? 615  SER A C   1 
ATOM 4152  O O   . SER A 1 548  ? 232.937 -23.102 -12.176 1.00 106.72 ? 615  SER A O   1 
ATOM 4153  C CB  . SER A 1 548  ? 231.238 -25.863 -11.859 1.00 106.20 ? 615  SER A CB  1 
ATOM 4154  O OG  . SER A 1 548  ? 231.646 -27.117 -12.371 1.00 103.69 ? 615  SER A OG  1 
ATOM 4155  N N   . GLU A 1 549  ? 230.798 -22.567 -11.966 1.00 104.38 ? 616  GLU A N   1 
ATOM 4156  C CA  . GLU A 1 549  ? 231.186 -21.267 -11.437 1.00 101.42 ? 616  GLU A CA  1 
ATOM 4157  C C   . GLU A 1 549  ? 231.818 -21.310 -10.047 1.00 99.93  ? 616  GLU A C   1 
ATOM 4158  O O   . GLU A 1 549  ? 231.124 -21.061 -9.068  1.00 99.88  ? 616  GLU A O   1 
ATOM 4159  C CB  . GLU A 1 549  ? 229.970 -20.356 -11.394 1.00 101.01 ? 616  GLU A CB  1 
ATOM 4160  C CG  . GLU A 1 549  ? 228.868 -21.022 -10.651 1.00 100.09 ? 616  GLU A CG  1 
ATOM 4161  C CD  . GLU A 1 549  ? 227.628 -20.197 -10.472 1.00 99.49  ? 616  GLU A CD  1 
ATOM 4162  O OE1 . GLU A 1 549  ? 227.698 -19.192 -9.762  1.00 99.50  ? 616  GLU A OE1 1 
ATOM 4163  O OE2 . GLU A 1 549  ? 226.570 -20.561 -11.024 1.00 97.81  ? 616  GLU A OE2 1 
ATOM 4164  N N   . ARG A 1 550  ? 233.110 -21.642 -9.956  1.00 98.14  ? 617  ARG A N   1 
ATOM 4165  C CA  . ARG A 1 550  ? 233.850 -21.664 -8.677  1.00 95.48  ? 617  ARG A CA  1 
ATOM 4166  C C   . ARG A 1 550  ? 234.151 -22.969 -7.904  1.00 92.98  ? 617  ARG A C   1 
ATOM 4167  O O   . ARG A 1 550  ? 234.542 -22.889 -6.745  1.00 92.72  ? 617  ARG A O   1 
ATOM 4168  C CB  . ARG A 1 550  ? 233.196 -20.709 -7.669  1.00 97.40  ? 617  ARG A CB  1 
ATOM 4169  C CG  . ARG A 1 550  ? 233.025 -19.243 -8.092  1.00 99.00  ? 617  ARG A CG  1 
ATOM 4170  C CD  . ARG A 1 550  ? 232.079 -18.534 -7.103  1.00 101.00 ? 617  ARG A CD  1 
ATOM 4171  N NE  . ARG A 1 550  ? 232.646 -17.309 -6.539  1.00 103.49 ? 617  ARG A NE  1 
ATOM 4172  C CZ  . ARG A 1 550  ? 232.370 -16.845 -5.322  1.00 105.61 ? 617  ARG A CZ  1 
ATOM 4173  N NH1 . ARG A 1 550  ? 231.535 -17.505 -4.530  1.00 107.04 ? 617  ARG A NH1 1 
ATOM 4174  N NH2 . ARG A 1 550  ? 232.929 -15.720 -4.894  1.00 106.00 ? 617  ARG A NH2 1 
ATOM 4175  N N   . HIS A 1 551  ? 233.988 -24.151 -8.495  1.00 90.37  ? 618  HIS A N   1 
ATOM 4176  C CA  . HIS A 1 551  ? 234.268 -25.385 -7.755  1.00 88.51  ? 618  HIS A CA  1 
ATOM 4177  C C   . HIS A 1 551  ? 235.146 -26.339 -8.544  1.00 86.93  ? 618  HIS A C   1 
ATOM 4178  O O   . HIS A 1 551  ? 236.340 -26.442 -8.289  1.00 86.91  ? 618  HIS A O   1 
ATOM 4179  C CB  . HIS A 1 551  ? 232.971 -26.105 -7.370  1.00 89.72  ? 618  HIS A CB  1 
ATOM 4180  C CG  . HIS A 1 551  ? 232.848 -26.433 -5.913  1.00 90.01  ? 618  HIS A CG  1 
ATOM 4181  N ND1 . HIS A 1 551  ? 233.505 -27.493 -5.325  1.00 89.49  ? 618  HIS A ND1 1 
ATOM 4182  C CD2 . HIS A 1 551  ? 232.121 -25.853 -4.929  1.00 90.05  ? 618  HIS A CD2 1 
ATOM 4183  C CE1 . HIS A 1 551  ? 233.186 -27.555 -4.044  1.00 89.02  ? 618  HIS A CE1 1 
ATOM 4184  N NE2 . HIS A 1 551  ? 232.347 -26.571 -3.778  1.00 89.47  ? 618  HIS A NE2 1 
ATOM 4185  N N   . GLY A 1 552  ? 234.551 -27.041 -9.503  1.00 84.25  ? 619  GLY A N   1 
ATOM 4186  C CA  . GLY A 1 552  ? 235.311 -27.993 -10.296 1.00 81.23  ? 619  GLY A CA  1 
ATOM 4187  C C   . GLY A 1 552  ? 234.951 -28.037 -11.765 1.00 78.68  ? 619  GLY A C   1 
ATOM 4188  O O   . GLY A 1 552  ? 234.116 -27.279 -12.249 1.00 78.36  ? 619  GLY A O   1 
ATOM 4189  N N   . TRP A 1 553  ? 235.558 -28.958 -12.489 1.00 75.77  ? 620  TRP A N   1 
ATOM 4190  C CA  . TRP A 1 553  ? 235.267 -28.992 -13.895 1.00 72.61  ? 620  TRP A CA  1 
ATOM 4191  C C   . TRP A 1 553  ? 235.045 -30.278 -14.626 1.00 69.65  ? 620  TRP A C   1 
ATOM 4192  O O   . TRP A 1 553  ? 235.846 -31.206 -14.583 1.00 66.55  ? 620  TRP A O   1 
ATOM 4193  C CB  . TRP A 1 553  ? 236.316 -28.220 -14.646 1.00 74.92  ? 620  TRP A CB  1 
ATOM 4194  C CG  . TRP A 1 553  ? 237.657 -28.657 -14.352 1.00 77.15  ? 620  TRP A CG  1 
ATOM 4195  C CD1 . TRP A 1 553  ? 238.056 -29.508 -13.365 1.00 76.86  ? 620  TRP A CD1 1 
ATOM 4196  C CD2 . TRP A 1 553  ? 238.833 -28.108 -14.910 1.00 79.79  ? 620  TRP A CD2 1 
ATOM 4197  N NE1 . TRP A 1 553  ? 239.418 -29.497 -13.262 1.00 78.28  ? 620  TRP A NE1 1 
ATOM 4198  C CE2 . TRP A 1 553  ? 239.919 -28.636 -14.203 1.00 80.38  ? 620  TRP A CE2 1 
ATOM 4199  C CE3 . TRP A 1 553  ? 239.075 -27.199 -15.940 1.00 81.36  ? 620  TRP A CE3 1 
ATOM 4200  C CZ2 . TRP A 1 553  ? 241.226 -28.277 -14.496 1.00 81.69  ? 620  TRP A CZ2 1 
ATOM 4201  C CZ3 . TRP A 1 553  ? 240.356 -26.845 -16.227 1.00 80.87  ? 620  TRP A CZ3 1 
ATOM 4202  C CH2 . TRP A 1 553  ? 241.412 -27.374 -15.511 1.00 80.86  ? 620  TRP A CH2 1 
ATOM 4203  N N   . GLY A 1 554  ? 233.937 -30.277 -15.348 1.00 68.58  ? 621  GLY A N   1 
ATOM 4204  C CA  . GLY A 1 554  ? 233.518 -31.403 -16.136 1.00 67.59  ? 621  GLY A CA  1 
ATOM 4205  C C   . GLY A 1 554  ? 234.571 -32.010 -17.018 1.00 66.78  ? 621  GLY A C   1 
ATOM 4206  O O   . GLY A 1 554  ? 235.659 -31.477 -17.209 1.00 64.70  ? 621  GLY A O   1 
ATOM 4207  N N   . TYR A 1 555  ? 234.203 -33.164 -17.549 1.00 68.58  ? 622  TYR A N   1 
ATOM 4208  C CA  . TYR A 1 555  ? 235.027 -33.946 -18.449 1.00 70.98  ? 622  TYR A CA  1 
ATOM 4209  C C   . TYR A 1 555  ? 234.137 -34.775 -19.352 1.00 72.70  ? 622  TYR A C   1 
ATOM 4210  O O   . TYR A 1 555  ? 232.914 -34.680 -19.300 1.00 73.97  ? 622  TYR A O   1 
ATOM 4211  C CB  . TYR A 1 555  ? 235.972 -34.861 -17.685 1.00 70.54  ? 622  TYR A CB  1 
ATOM 4212  C CG  . TYR A 1 555  ? 237.252 -34.182 -17.312 1.00 70.90  ? 622  TYR A CG  1 
ATOM 4213  C CD1 . TYR A 1 555  ? 237.450 -33.674 -16.025 1.00 71.01  ? 622  TYR A CD1 1 
ATOM 4214  C CD2 . TYR A 1 555  ? 238.270 -34.040 -18.254 1.00 71.58  ? 622  TYR A CD2 1 
ATOM 4215  C CE1 . TYR A 1 555  ? 238.639 -33.046 -15.682 1.00 72.15  ? 622  TYR A CE1 1 
ATOM 4216  C CE2 . TYR A 1 555  ? 239.457 -33.415 -17.934 1.00 72.99  ? 622  TYR A CE2 1 
ATOM 4217  C CZ  . TYR A 1 555  ? 239.643 -32.921 -16.643 1.00 72.71  ? 622  TYR A CZ  1 
ATOM 4218  O OH  . TYR A 1 555  ? 240.845 -32.333 -16.303 1.00 69.91  ? 622  TYR A OH  1 
ATOM 4219  N N   . LEU A 1 556  ? 234.749 -35.620 -20.160 1.00 73.79  ? 623  LEU A N   1 
ATOM 4220  C CA  . LEU A 1 556  ? 233.980 -36.399 -21.111 1.00 75.06  ? 623  LEU A CA  1 
ATOM 4221  C C   . LEU A 1 556  ? 233.760 -37.872 -20.825 1.00 76.90  ? 623  LEU A C   1 
ATOM 4222  O O   . LEU A 1 556  ? 234.227 -38.690 -21.607 1.00 77.19  ? 623  LEU A O   1 
ATOM 4223  C CB  . LEU A 1 556  ? 234.636 -36.312 -22.492 1.00 73.60  ? 623  LEU A CB  1 
ATOM 4224  C CG  . LEU A 1 556  ? 235.891 -37.202 -22.621 1.00 73.03  ? 623  LEU A CG  1 
ATOM 4225  C CD1 . LEU A 1 556  ? 236.303 -37.343 -24.090 1.00 72.98  ? 623  LEU A CD1 1 
ATOM 4226  C CD2 . LEU A 1 556  ? 237.017 -36.667 -21.724 1.00 72.97  ? 623  LEU A CD2 1 
ATOM 4227  N N   . VAL A 1 557  ? 233.091 -38.284 -19.758 1.00 79.53  ? 624  VAL A N   1 
ATOM 4228  C CA  . VAL A 1 557  ? 232.928 -39.736 -19.691 1.00 81.34  ? 624  VAL A CA  1 
ATOM 4229  C C   . VAL A 1 557  ? 231.509 -40.110 -20.139 1.00 83.12  ? 624  VAL A C   1 
ATOM 4230  O O   . VAL A 1 557  ? 230.599 -40.233 -19.309 1.00 83.23  ? 624  VAL A O   1 
ATOM 4231  C CB  . VAL A 1 557  ? 233.343 -40.365 -18.280 1.00 80.59  ? 624  VAL A CB  1 
ATOM 4232  C CG1 . VAL A 1 557  ? 234.297 -39.423 -17.566 1.00 79.33  ? 624  VAL A CG1 1 
ATOM 4233  C CG2 . VAL A 1 557  ? 232.136 -40.755 -17.435 1.00 79.99  ? 624  VAL A CG2 1 
ATOM 4234  N N   . PRO A 1 558  ? 231.294 -40.215 -21.485 1.00 84.18  ? 625  PRO A N   1 
ATOM 4235  C CA  . PRO A 1 558  ? 230.018 -40.570 -22.113 1.00 84.14  ? 625  PRO A CA  1 
ATOM 4236  C C   . PRO A 1 558  ? 229.676 -41.871 -21.464 1.00 84.08  ? 625  PRO A C   1 
ATOM 4237  O O   . PRO A 1 558  ? 229.452 -42.900 -22.083 1.00 82.55  ? 625  PRO A O   1 
ATOM 4238  C CB  . PRO A 1 558  ? 230.372 -40.699 -23.597 1.00 84.99  ? 625  PRO A CB  1 
ATOM 4239  C CG  . PRO A 1 558  ? 231.819 -40.964 -23.600 1.00 85.70  ? 625  PRO A CG  1 
ATOM 4240  C CD  . PRO A 1 558  ? 232.313 -40.044 -22.530 1.00 84.69  ? 625  PRO A CD  1 
ATOM 4241  N N   . GLY A 1 559  ? 229.703 -41.741 -20.156 1.00 85.61  ? 626  GLY A N   1 
ATOM 4242  C CA  . GLY A 1 559  ? 229.456 -42.758 -19.189 1.00 87.66  ? 626  GLY A CA  1 
ATOM 4243  C C   . GLY A 1 559  ? 229.215 -44.204 -19.470 1.00 88.37  ? 626  GLY A C   1 
ATOM 4244  O O   . GLY A 1 559  ? 230.123 -44.998 -19.272 1.00 88.63  ? 626  GLY A O   1 
ATOM 4245  N N   . ARG A 1 560  ? 228.025 -44.544 -19.965 1.00 88.55  ? 627  ARG A N   1 
ATOM 4246  C CA  . ARG A 1 560  ? 227.636 -45.956 -20.082 1.00 88.76  ? 627  ARG A CA  1 
ATOM 4247  C C   . ARG A 1 560  ? 227.779 -46.041 -18.563 1.00 89.02  ? 627  ARG A C   1 
ATOM 4248  O O   . ARG A 1 560  ? 228.576 -46.802 -18.015 1.00 88.44  ? 627  ARG A O   1 
ATOM 4249  C CB  . ARG A 1 560  ? 228.690 -46.824 -20.813 1.00 88.46  ? 627  ARG A CB  1 
ATOM 4250  C CG  . ARG A 1 560  ? 228.942 -48.253 -20.221 1.00 87.90  ? 627  ARG A CG  1 
ATOM 4251  C CD  . ARG A 1 560  ? 227.693 -49.164 -20.134 1.00 85.67  ? 627  ARG A CD  1 
ATOM 4252  N NE  . ARG A 1 560  ? 227.643 -50.200 -21.177 1.00 82.08  ? 627  ARG A NE  1 
ATOM 4253  C CZ  . ARG A 1 560  ? 228.229 -51.400 -21.106 1.00 80.07  ? 627  ARG A CZ  1 
ATOM 4254  N NH1 . ARG A 1 560  ? 228.929 -51.762 -20.035 1.00 78.49  ? 627  ARG A NH1 1 
ATOM 4255  N NH2 . ARG A 1 560  ? 228.109 -52.247 -22.120 1.00 80.33  ? 627  ARG A NH2 1 
ATOM 4256  N N   . ARG A 1 561  ? 227.018 -45.157 -17.919 1.00 89.90  ? 628  ARG A N   1 
ATOM 4257  C CA  . ARG A 1 561  ? 227.019 -44.930 -16.483 1.00 91.01  ? 628  ARG A CA  1 
ATOM 4258  C C   . ARG A 1 561  ? 226.942 -43.419 -16.578 1.00 90.95  ? 628  ARG A C   1 
ATOM 4259  O O   . ARG A 1 561  ? 227.285 -42.851 -17.615 1.00 90.08  ? 628  ARG A O   1 
ATOM 4260  C CB  . ARG A 1 561  ? 228.358 -45.392 -15.892 1.00 92.04  ? 628  ARG A CB  1 
ATOM 4261  C CG  . ARG A 1 561  ? 229.074 -44.491 -14.913 1.00 94.80  ? 628  ARG A CG  1 
ATOM 4262  C CD  . ARG A 1 561  ? 230.568 -44.838 -14.961 1.00 98.11  ? 628  ARG A CD  1 
ATOM 4263  N NE  . ARG A 1 561  ? 230.870 -46.214 -14.531 1.00 101.12 ? 628  ARG A NE  1 
ATOM 4264  C CZ  . ARG A 1 561  ? 232.000 -46.869 -14.810 1.00 102.14 ? 628  ARG A CZ  1 
ATOM 4265  N NH1 . ARG A 1 561  ? 232.942 -46.279 -15.529 1.00 103.87 ? 628  ARG A NH1 1 
ATOM 4266  N NH2 . ARG A 1 561  ? 232.198 -48.109 -14.362 1.00 101.59 ? 628  ARG A NH2 1 
ATOM 4267  N N   . ASP A 1 562  ? 226.476 -42.759 -15.537 1.00 91.64  ? 629  ASP A N   1 
ATOM 4268  C CA  . ASP A 1 562  ? 226.370 -41.316 -15.610 1.00 91.82  ? 629  ASP A CA  1 
ATOM 4269  C C   . ASP A 1 562  ? 225.155 -40.955 -16.433 1.00 92.67  ? 629  ASP A C   1 
ATOM 4270  O O   . ASP A 1 562  ? 224.214 -40.372 -15.917 1.00 91.69  ? 629  ASP A O   1 
ATOM 4271  C CB  . ASP A 1 562  ? 227.614 -40.712 -16.267 1.00 90.34  ? 629  ASP A CB  1 
ATOM 4272  C CG  . ASP A 1 562  ? 228.754 -40.547 -15.307 1.00 89.00  ? 629  ASP A CG  1 
ATOM 4273  O OD1 . ASP A 1 562  ? 229.914 -40.626 -15.758 1.00 88.92  ? 629  ASP A OD1 1 
ATOM 4274  O OD2 . ASP A 1 562  ? 228.490 -40.326 -14.107 1.00 87.10  ? 629  ASP A OD2 1 
ATOM 4275  N N   . ASN A 1 563  ? 225.163 -41.304 -17.714 1.00 94.85  ? 630  ASN A N   1 
ATOM 4276  C CA  . ASN A 1 563  ? 224.025 -40.954 -18.556 1.00 97.56  ? 630  ASN A CA  1 
ATOM 4277  C C   . ASN A 1 563  ? 223.099 -42.079 -19.029 1.00 99.66  ? 630  ASN A C   1 
ATOM 4278  O O   . ASN A 1 563  ? 223.500 -43.036 -19.700 1.00 100.67 ? 630  ASN A O   1 
ATOM 4279  C CB  . ASN A 1 563  ? 224.486 -40.146 -19.780 1.00 97.57  ? 630  ASN A CB  1 
ATOM 4280  C CG  . ASN A 1 563  ? 223.313 -39.597 -20.605 1.00 97.99  ? 630  ASN A CG  1 
ATOM 4281  O OD1 . ASN A 1 563  ? 223.509 -39.022 -21.675 1.00 97.75  ? 630  ASN A OD1 1 
ATOM 4282  N ND2 . ASN A 1 563  ? 222.097 -39.770 -20.104 1.00 97.42  ? 630  ASN A ND2 1 
ATOM 4283  N N   . LEU A 1 564  ? 221.838 -41.931 -18.651 1.00 85.47  ? 631  LEU A N   1 
ATOM 4284  C CA  . LEU A 1 564  ? 220.796 -42.845 -19.041 1.00 86.36  ? 631  LEU A CA  1 
ATOM 4285  C C   . LEU A 1 564  ? 219.707 -41.902 -19.482 1.00 85.68  ? 631  LEU A C   1 
ATOM 4286  O O   . LEU A 1 564  ? 218.628 -41.875 -18.898 1.00 85.56  ? 631  LEU A O   1 
ATOM 4287  C CB  . LEU A 1 564  ? 220.287 -43.673 -17.868 1.00 86.18  ? 631  LEU A CB  1 
ATOM 4288  C CG  . LEU A 1 564  ? 221.214 -43.970 -16.695 1.00 86.35  ? 631  LEU A CG  1 
ATOM 4289  C CD1 . LEU A 1 564  ? 220.526 -44.964 -15.784 1.00 85.51  ? 631  LEU A CD1 1 
ATOM 4290  C CD2 . LEU A 1 564  ? 222.539 -44.518 -17.179 1.00 85.89  ? 631  LEU A CD2 1 
ATOM 4291  N N   . ALA A 1 565  ? 220.023 -41.060 -20.460 1.00 86.01  ? 632  ALA A N   1 
ATOM 4292  C CA  . ALA A 1 565  ? 219.019 -40.161 -21.007 1.00 85.58  ? 632  ALA A CA  1 
ATOM 4293  C C   . ALA A 1 565  ? 218.276 -41.243 -21.754 1.00 85.78  ? 632  ALA A C   1 
ATOM 4294  O O   . ALA A 1 565  ? 217.043 -41.355 -21.718 1.00 85.70  ? 632  ALA A O   1 
ATOM 4295  C CB  . ALA A 1 565  ? 219.648 -39.194 -21.980 1.00 85.92  ? 632  ALA A CB  1 
ATOM 4296  N N   . LYS A 1 566  ? 219.103 -42.067 -22.392 1.00 77.57  ? 633  LYS A N   1 
ATOM 4297  C CA  . LYS A 1 566  ? 218.697 -43.236 -23.160 1.00 78.12  ? 633  LYS A CA  1 
ATOM 4298  C C   . LYS A 1 566  ? 217.304 -43.180 -23.819 1.00 76.10  ? 633  LYS A C   1 
ATOM 4299  O O   . LYS A 1 566  ? 217.019 -42.257 -24.589 1.00 75.61  ? 633  LYS A O   1 
ATOM 4300  C CB  . LYS A 1 566  ? 218.830 -44.480 -22.261 1.00 77.58  ? 633  LYS A CB  1 
ATOM 4301  C CG  . LYS A 1 566  ? 218.977 -45.795 -23.009 1.00 77.42  ? 633  LYS A CG  1 
ATOM 4302  C CD  . LYS A 1 566  ? 218.619 -45.640 -24.488 1.00 77.48  ? 633  LYS A CD  1 
ATOM 4303  C CE  . LYS A 1 566  ? 217.764 -46.775 -24.990 1.00 80.50  ? 633  LYS A CE  1 
ATOM 4304  N NZ  . LYS A 1 566  ? 217.201 -46.447 -26.321 1.00 78.06  ? 633  LYS A NZ  1 
ATOM 4305  N N   . LEU A 1 567  ? 216.459 -44.176 -23.528 1.00 77.21  ? 634  LEU A N   1 
ATOM 4306  C CA  . LEU A 1 567  ? 215.110 -44.256 -24.107 1.00 76.41  ? 634  LEU A CA  1 
ATOM 4307  C C   . LEU A 1 567  ? 214.232 -45.425 -23.485 1.00 76.70  ? 634  LEU A C   1 
ATOM 4308  O O   . LEU A 1 567  ? 214.433 -45.815 -22.315 1.00 76.79  ? 634  LEU A O   1 
ATOM 4309  C CB  . LEU A 1 567  ? 215.281 -44.354 -25.640 1.00 77.04  ? 634  LEU A CB  1 
ATOM 4310  C CG  . LEU A 1 567  ? 214.622 -43.347 -26.614 1.00 76.98  ? 634  LEU A CG  1 
ATOM 4311  C CD1 . LEU A 1 567  ? 214.930 -41.928 -26.261 1.00 76.48  ? 634  LEU A CD1 1 
ATOM 4312  C CD2 . LEU A 1 567  ? 215.132 -43.617 -28.019 1.00 76.96  ? 634  LEU A CD2 1 
ATOM 4313  N N   . PRO A 1 568  ? 213.266 -46.001 -24.241 1.00 66.65  ? 635  PRO A N   1 
ATOM 4314  C CA  . PRO A 1 568  ? 212.858 -45.724 -25.620 1.00 66.40  ? 635  PRO A CA  1 
ATOM 4315  C C   . PRO A 1 568  ? 211.641 -44.817 -25.803 1.00 66.74  ? 635  PRO A C   1 
ATOM 4316  O O   . PRO A 1 568  ? 211.648 -43.640 -25.411 1.00 67.08  ? 635  PRO A O   1 
ATOM 4317  C CB  . PRO A 1 568  ? 212.625 -47.121 -26.173 1.00 66.86  ? 635  PRO A CB  1 
ATOM 4318  C CG  . PRO A 1 568  ? 211.914 -47.779 -25.014 1.00 67.31  ? 635  PRO A CG  1 
ATOM 4319  C CD  . PRO A 1 568  ? 212.603 -47.233 -23.755 1.00 66.75  ? 635  PRO A CD  1 
ATOM 4320  N N   . THR A 1 569  ? 210.617 -45.388 -26.437 1.00 65.45  ? 636  THR A N   1 
ATOM 4321  C CA  . THR A 1 569  ? 209.363 -44.702 -26.714 1.00 66.11  ? 636  THR A CA  1 
ATOM 4322  C C   . THR A 1 569  ? 208.962 -43.960 -25.467 1.00 66.24  ? 636  THR A C   1 
ATOM 4323  O O   . THR A 1 569  ? 208.271 -42.942 -25.533 1.00 65.57  ? 636  THR A O   1 
ATOM 4324  C CB  . THR A 1 569  ? 208.267 -45.704 -27.093 1.00 66.23  ? 636  THR A CB  1 
ATOM 4325  O OG1 . THR A 1 569  ? 207.933 -45.544 -28.480 1.00 66.24  ? 636  THR A OG1 1 
ATOM 4326  C CG2 . THR A 1 569  ? 207.032 -45.515 -26.213 1.00 66.07  ? 636  THR A CG2 1 
ATOM 4327  N N   . GLY A 1 570  ? 209.391 -44.492 -24.328 1.00 58.65  ? 637  GLY A N   1 
ATOM 4328  C CA  . GLY A 1 570  ? 209.101 -43.825 -23.084 1.00 59.19  ? 637  GLY A CA  1 
ATOM 4329  C C   . GLY A 1 570  ? 209.634 -42.411 -23.240 1.00 58.56  ? 637  GLY A C   1 
ATOM 4330  O O   . GLY A 1 570  ? 208.866 -41.453 -23.379 1.00 59.06  ? 637  GLY A O   1 
ATOM 4331  N N   . THR A 1 571  ? 210.961 -42.293 -23.257 1.00 58.93  ? 638  THR A N   1 
ATOM 4332  C CA  . THR A 1 571  ? 211.645 -41.007 -23.387 1.00 58.95  ? 638  THR A CA  1 
ATOM 4333  C C   . THR A 1 571  ? 210.946 -39.988 -24.264 1.00 63.93  ? 638  THR A C   1 
ATOM 4334  O O   . THR A 1 571  ? 210.833 -38.828 -23.893 1.00 63.79  ? 638  THR A O   1 
ATOM 4335  C CB  . THR A 1 571  ? 213.055 -41.175 -23.928 1.00 59.01  ? 638  THR A CB  1 
ATOM 4336  O OG1 . THR A 1 571  ? 213.916 -41.617 -22.874 1.00 58.58  ? 638  THR A OG1 1 
ATOM 4337  C CG2 . THR A 1 571  ? 213.564 -39.855 -24.479 1.00 59.24  ? 638  THR A CG2 1 
ATOM 4338  N N   . THR A 1 572  ? 210.504 -40.421 -25.437 1.00 64.31  ? 639  THR A N   1 
ATOM 4339  C CA  . THR A 1 572  ? 209.805 -39.541 -26.365 1.00 63.64  ? 639  THR A CA  1 
ATOM 4340  C C   . THR A 1 572  ? 208.868 -38.603 -25.625 1.00 64.05  ? 639  THR A C   1 
ATOM 4341  O O   . THR A 1 572  ? 209.196 -37.445 -25.354 1.00 63.81  ? 639  THR A O   1 
ATOM 4342  C CB  . THR A 1 572  ? 208.926 -40.327 -27.326 1.00 63.86  ? 639  THR A CB  1 
ATOM 4343  O OG1 . THR A 1 572  ? 209.294 -41.709 -27.310 1.00 63.94  ? 639  THR A OG1 1 
ATOM 4344  C CG2 . THR A 1 572  ? 209.085 -39.784 -28.712 1.00 63.88  ? 639  THR A CG2 1 
ATOM 4345  N N   . LEU A 1 573  ? 207.693 -39.134 -25.313 1.00 67.38  ? 640  LEU A N   1 
ATOM 4346  C CA  . LEU A 1 573  ? 206.642 -38.418 -24.613 1.00 67.33  ? 640  LEU A CA  1 
ATOM 4347  C C   . LEU A 1 573  ? 207.072 -37.734 -23.319 1.00 66.53  ? 640  LEU A C   1 
ATOM 4348  O O   . LEU A 1 573  ? 206.923 -36.518 -23.186 1.00 66.98  ? 640  LEU A O   1 
ATOM 4349  C CB  . LEU A 1 573  ? 205.511 -39.393 -24.326 1.00 66.64  ? 640  LEU A CB  1 
ATOM 4350  C CG  . LEU A 1 573  ? 205.872 -40.835 -24.712 1.00 66.58  ? 640  LEU A CG  1 
ATOM 4351  C CD1 . LEU A 1 573  ? 204.798 -41.780 -24.210 1.00 67.02  ? 640  LEU A CD1 1 
ATOM 4352  C CD2 . LEU A 1 573  ? 206.017 -40.958 -26.214 1.00 67.29  ? 640  LEU A CD2 1 
ATOM 4353  N N   . GLU A 1 574  ? 207.614 -38.517 -22.381 1.00 66.66  ? 641  GLU A N   1 
ATOM 4354  C CA  . GLU A 1 574  ? 208.047 -38.020 -21.058 1.00 68.13  ? 641  GLU A CA  1 
ATOM 4355  C C   . GLU A 1 574  ? 209.257 -37.066 -20.921 1.00 68.26  ? 641  GLU A C   1 
ATOM 4356  O O   . GLU A 1 574  ? 209.182 -36.084 -20.163 1.00 67.67  ? 641  GLU A O   1 
ATOM 4357  C CB  . GLU A 1 574  ? 208.233 -39.207 -20.098 1.00 68.04  ? 641  GLU A CB  1 
ATOM 4358  C CG  . GLU A 1 574  ? 209.058 -40.362 -20.651 1.00 68.14  ? 641  GLU A CG  1 
ATOM 4359  C CD  . GLU A 1 574  ? 208.910 -41.622 -19.810 1.00 68.15  ? 641  GLU A CD  1 
ATOM 4360  O OE1 . GLU A 1 574  ? 209.639 -42.614 -20.071 1.00 67.53  ? 641  GLU A OE1 1 
ATOM 4361  O OE2 . GLU A 1 574  ? 208.056 -41.616 -18.887 1.00 68.02  ? 641  GLU A OE2 1 
ATOM 4362  N N   . SER A 1 575  ? 210.363 -37.351 -21.614 1.00 57.86  ? 642  SER A N   1 
ATOM 4363  C CA  . SER A 1 575  ? 211.536 -36.479 -21.543 1.00 57.75  ? 642  SER A CA  1 
ATOM 4364  C C   . SER A 1 575  ? 211.065 -35.042 -21.704 1.00 58.37  ? 642  SER A C   1 
ATOM 4365  O O   . SER A 1 575  ? 211.364 -34.175 -20.875 1.00 54.56  ? 642  SER A O   1 
ATOM 4366  C CB  . SER A 1 575  ? 212.525 -36.810 -22.659 1.00 57.47  ? 642  SER A CB  1 
ATOM 4367  O OG  . SER A 1 575  ? 212.957 -38.147 -22.538 1.00 58.06  ? 642  SER A OG  1 
ATOM 4368  N N   . ALA A 1 576  ? 210.324 -34.804 -22.784 1.00 54.52  ? 643  ALA A N   1 
ATOM 4369  C CA  . ALA A 1 576  ? 209.774 -33.481 -23.084 1.00 54.70  ? 643  ALA A CA  1 
ATOM 4370  C C   . ALA A 1 576  ? 208.979 -32.983 -21.876 1.00 54.84  ? 643  ALA A C   1 
ATOM 4371  O O   . ALA A 1 576  ? 209.259 -31.902 -21.351 1.00 54.46  ? 643  ALA A O   1 
ATOM 4372  C CB  . ALA A 1 576  ? 208.867 -33.547 -24.334 1.00 55.09  ? 643  ALA A CB  1 
ATOM 4373  N N   . GLY A 1 577  ? 208.001 -33.779 -21.440 1.00 53.56  ? 644  GLY A N   1 
ATOM 4374  C CA  . GLY A 1 577  ? 207.189 -33.408 -20.294 1.00 53.62  ? 644  GLY A CA  1 
ATOM 4375  C C   . GLY A 1 577  ? 208.059 -32.771 -19.239 1.00 53.96  ? 644  GLY A C   1 
ATOM 4376  O O   . GLY A 1 577  ? 207.687 -31.797 -18.597 1.00 53.66  ? 644  GLY A O   1 
ATOM 4377  N N   . VAL A 1 578  ? 209.236 -33.345 -19.062 1.00 54.36  ? 645  VAL A N   1 
ATOM 4378  C CA  . VAL A 1 578  ? 210.196 -32.813 -18.128 1.00 53.71  ? 645  VAL A CA  1 
ATOM 4379  C C   . VAL A 1 578  ? 209.927 -33.067 -16.659 1.00 50.68  ? 645  VAL A C   1 
ATOM 4380  O O   . VAL A 1 578  ? 210.515 -33.956 -16.098 1.00 50.80  ? 645  VAL A O   1 
ATOM 4381  C CB  . VAL A 1 578  ? 210.403 -31.283 -18.360 1.00 54.23  ? 645  VAL A CB  1 
ATOM 4382  C CG1 . VAL A 1 578  ? 211.111 -30.667 -17.199 1.00 53.01  ? 645  VAL A CG1 1 
ATOM 4383  C CG2 . VAL A 1 578  ? 211.231 -31.051 -19.622 1.00 52.71  ? 645  VAL A CG2 1 
ATOM 4384  N N   . VAL A 1 579  ? 209.011 -32.328 -16.052 1.00 50.44  ? 646  VAL A N   1 
ATOM 4385  C CA  . VAL A 1 579  ? 208.757 -32.404 -14.601 1.00 51.16  ? 646  VAL A CA  1 
ATOM 4386  C C   . VAL A 1 579  ? 209.991 -31.742 -14.014 1.00 51.10  ? 646  VAL A C   1 
ATOM 4387  O O   . VAL A 1 579  ? 211.096 -32.238 -14.191 1.00 50.79  ? 646  VAL A O   1 
ATOM 4388  C CB  . VAL A 1 579  ? 208.642 -33.852 -13.991 1.00 50.85  ? 646  VAL A CB  1 
ATOM 4389  C CG1 . VAL A 1 579  ? 209.994 -34.552 -13.851 1.00 51.11  ? 646  VAL A CG1 1 
ATOM 4390  C CG2 . VAL A 1 579  ? 208.061 -33.728 -12.592 1.00 51.20  ? 646  VAL A CG2 1 
ATOM 4391  N N   . CYS A 1 580  ? 209.807 -30.598 -13.361 1.00 47.75  ? 647  CYS A N   1 
ATOM 4392  C CA  . CYS A 1 580  ? 210.920 -29.841 -12.765 1.00 48.36  ? 647  CYS A CA  1 
ATOM 4393  C C   . CYS A 1 580  ? 211.872 -29.162 -13.763 1.00 47.64  ? 647  CYS A C   1 
ATOM 4394  O O   . CYS A 1 580  ? 212.036 -29.631 -14.902 1.00 47.43  ? 647  CYS A O   1 
ATOM 4395  C CB  . CYS A 1 580  ? 211.749 -30.736 -11.839 1.00 47.56  ? 647  CYS A CB  1 
ATOM 4396  S SG  . CYS A 1 580  ? 211.060 -30.958 -10.184 1.00 47.48  ? 647  CYS A SG  1 
ATOM 4397  N N   . PRO A 1 581  ? 212.524 -28.046 -13.334 1.00 47.70  ? 648  PRO A N   1 
ATOM 4398  C CA  . PRO A 1 581  ? 213.471 -27.273 -14.153 1.00 46.62  ? 648  PRO A CA  1 
ATOM 4399  C C   . PRO A 1 581  ? 214.614 -28.170 -14.564 1.00 46.70  ? 648  PRO A C   1 
ATOM 4400  O O   . PRO A 1 581  ? 215.291 -27.922 -15.564 1.00 46.74  ? 648  PRO A O   1 
ATOM 4401  C CB  . PRO A 1 581  ? 213.930 -26.156 -13.207 1.00 47.18  ? 648  PRO A CB  1 
ATOM 4402  C CG  . PRO A 1 581  ? 213.844 -26.797 -11.878 1.00 47.25  ? 648  PRO A CG  1 
ATOM 4403  C CD  . PRO A 1 581  ? 212.508 -27.520 -11.956 1.00 47.22  ? 648  PRO A CD  1 
ATOM 4404  N N   . TYR A 1 582  ? 214.801 -29.223 -13.772 1.00 47.89  ? 649  TYR A N   1 
ATOM 4405  C CA  . TYR A 1 582  ? 215.852 -30.191 -14.000 1.00 47.59  ? 649  TYR A CA  1 
ATOM 4406  C C   . TYR A 1 582  ? 215.875 -30.795 -15.395 1.00 52.91  ? 649  TYR A C   1 
ATOM 4407  O O   . TYR A 1 582  ? 216.873 -30.644 -16.080 1.00 55.71  ? 649  TYR A O   1 
ATOM 4408  C CB  . TYR A 1 582  ? 215.766 -31.283 -12.958 1.00 47.51  ? 649  TYR A CB  1 
ATOM 4409  C CG  . TYR A 1 582  ? 216.424 -30.926 -11.657 1.00 48.10  ? 649  TYR A CG  1 
ATOM 4410  C CD1 . TYR A 1 582  ? 216.172 -31.678 -10.520 1.00 48.01  ? 649  TYR A CD1 1 
ATOM 4411  C CD2 . TYR A 1 582  ? 217.355 -29.883 -11.572 1.00 47.90  ? 649  TYR A CD2 1 
ATOM 4412  C CE1 . TYR A 1 582  ? 216.835 -31.415 -9.314  1.00 47.99  ? 649  TYR A CE1 1 
ATOM 4413  C CE2 . TYR A 1 582  ? 218.027 -29.609 -10.372 1.00 52.42  ? 649  TYR A CE2 1 
ATOM 4414  C CZ  . TYR A 1 582  ? 217.761 -30.383 -9.244  1.00 53.01  ? 649  TYR A CZ  1 
ATOM 4415  O OH  . TYR A 1 582  ? 218.415 -30.147 -8.051  1.00 52.41  ? 649  TYR A OH  1 
ATOM 4416  N N   . ARG A 1 583  ? 214.810 -31.468 -15.836 1.00 44.30  ? 650  ARG A N   1 
ATOM 4417  C CA  . ARG A 1 583  ? 214.848 -32.051 -17.182 1.00 44.30  ? 650  ARG A CA  1 
ATOM 4418  C C   . ARG A 1 583  ? 215.144 -30.946 -18.213 1.00 44.30  ? 650  ARG A C   1 
ATOM 4419  O O   . ARG A 1 583  ? 215.677 -31.221 -19.294 1.00 44.30  ? 650  ARG A O   1 
ATOM 4420  C CB  . ARG A 1 583  ? 213.541 -32.825 -17.518 1.00 44.30  ? 650  ARG A CB  1 
ATOM 4421  C CG  . ARG A 1 583  ? 213.494 -34.260 -16.930 1.00 44.30  ? 650  ARG A CG  1 
ATOM 4422  C CD  . ARG A 1 583  ? 212.325 -35.087 -17.452 1.00 44.30  ? 650  ARG A CD  1 
ATOM 4423  N NE  . ARG A 1 583  ? 212.433 -36.505 -17.097 1.00 44.30  ? 650  ARG A NE  1 
ATOM 4424  C CZ  . ARG A 1 583  ? 211.403 -37.343 -16.915 1.00 44.30  ? 650  ARG A CZ  1 
ATOM 4425  N NH1 . ARG A 1 583  ? 210.144 -36.929 -17.040 1.00 44.30  ? 650  ARG A NH1 1 
ATOM 4426  N NH2 . ARG A 1 583  ? 211.632 -38.617 -16.609 1.00 44.30  ? 650  ARG A NH2 1 
ATOM 4427  N N   . ALA A 1 584  ? 214.820 -29.699 -17.859 1.00 44.30  ? 651  ALA A N   1 
ATOM 4428  C CA  . ALA A 1 584  ? 215.078 -28.549 -18.725 1.00 44.30  ? 651  ALA A CA  1 
ATOM 4429  C C   . ALA A 1 584  ? 216.500 -28.087 -18.438 1.00 44.30  ? 651  ALA A C   1 
ATOM 4430  O O   . ALA A 1 584  ? 217.213 -27.667 -19.336 1.00 44.30  ? 651  ALA A O   1 
ATOM 4431  C CB  . ALA A 1 584  ? 214.093 -27.433 -18.426 1.00 44.30  ? 651  ALA A CB  1 
ATOM 4432  N N   . ILE A 1 585  ? 216.889 -28.165 -17.168 1.00 44.30  ? 652  ILE A N   1 
ATOM 4433  C CA  . ILE A 1 585  ? 218.228 -27.799 -16.709 1.00 44.30  ? 652  ILE A CA  1 
ATOM 4434  C C   . ILE A 1 585  ? 219.182 -28.932 -17.054 1.00 44.30  ? 652  ILE A C   1 
ATOM 4435  O O   . ILE A 1 585  ? 220.371 -28.725 -17.233 1.00 44.30  ? 652  ILE A O   1 
ATOM 4436  C CB  . ILE A 1 585  ? 218.295 -27.596 -15.177 1.00 44.30  ? 652  ILE A CB  1 
ATOM 4437  C CG1 . ILE A 1 585  ? 217.543 -26.325 -14.765 1.00 44.30  ? 652  ILE A CG1 1 
ATOM 4438  C CG2 . ILE A 1 585  ? 219.744 -27.539 -14.733 1.00 44.30  ? 652  ILE A CG2 1 
ATOM 4439  C CD1 . ILE A 1 585  ? 217.520 -26.084 -13.266 1.00 91.71  ? 652  ILE A CD1 1 
ATOM 4440  N N   . GLU A 1 586  ? 218.628 -30.135 -17.139 1.00 44.30  ? 653  GLU A N   1 
ATOM 4441  C CA  . GLU A 1 586  ? 219.355 -31.362 -17.455 1.00 44.30  ? 653  GLU A CA  1 
ATOM 4442  C C   . GLU A 1 586  ? 219.606 -31.443 -18.934 1.00 44.30  ? 653  GLU A C   1 
ATOM 4443  O O   . GLU A 1 586  ? 220.703 -31.773 -19.377 1.00 44.30  ? 653  GLU A O   1 
ATOM 4444  C CB  . GLU A 1 586  ? 218.538 -32.577 -17.005 1.00 44.30  ? 653  GLU A CB  1 
ATOM 4445  C CG  . GLU A 1 586  ? 219.173 -33.939 -17.267 1.00 44.30  ? 653  GLU A CG  1 
ATOM 4446  C CD  . GLU A 1 586  ? 218.336 -35.073 -16.695 1.00 44.30  ? 653  GLU A CD  1 
ATOM 4447  O OE1 . GLU A 1 586  ? 217.868 -34.900 -15.545 1.00 44.30  ? 653  GLU A OE1 1 
ATOM 4448  O OE2 . GLU A 1 586  ? 218.154 -36.120 -17.380 1.00 44.30  ? 653  GLU A OE2 1 
ATOM 4449  N N   . SER A 1 587  ? 218.547 -31.155 -19.682 1.00 44.30  ? 654  SER A N   1 
ATOM 4450  C CA  . SER A 1 587  ? 218.595 -31.143 -21.125 1.00 44.30  ? 654  SER A CA  1 
ATOM 4451  C C   . SER A 1 587  ? 219.732 -30.189 -21.472 1.00 44.30  ? 654  SER A C   1 
ATOM 4452  O O   . SER A 1 587  ? 220.516 -30.451 -22.405 1.00 44.30  ? 654  SER A O   1 
ATOM 4453  C CB  . SER A 1 587  ? 217.244 -30.653 -21.704 1.00 44.30  ? 654  SER A CB  1 
ATOM 4454  O OG  . SER A 1 587  ? 216.771 -29.443 -21.112 1.00 44.30  ? 654  SER A OG  1 
ATOM 4455  N N   . LEU A 1 588  ? 219.833 -29.102 -20.691 1.00 44.30  ? 655  LEU A N   1 
ATOM 4456  C CA  . LEU A 1 588  ? 220.872 -28.102 -20.907 1.00 44.30  ? 655  LEU A CA  1 
ATOM 4457  C C   . LEU A 1 588  ? 222.262 -28.600 -20.568 1.00 44.30  ? 655  LEU A C   1 
ATOM 4458  O O   . LEU A 1 588  ? 223.146 -28.443 -21.398 1.00 44.30  ? 655  LEU A O   1 
ATOM 4459  C CB  . LEU A 1 588  ? 220.554 -26.781 -20.201 1.00 44.30  ? 655  LEU A CB  1 
ATOM 4460  C CG  . LEU A 1 588  ? 219.999 -26.702 -18.796 1.00 44.30  ? 655  LEU A CG  1 
ATOM 4461  C CD1 . LEU A 1 588  ? 221.126 -26.466 -17.834 1.00 44.30  ? 655  LEU A CD1 1 
ATOM 4462  C CD2 . LEU A 1 588  ? 218.957 -25.579 -18.723 1.00 44.30  ? 655  LEU A CD2 1 
ATOM 4463  N N   . TYR A 1 589  ? 222.498 -29.201 -19.399 1.00 44.30  ? 656  TYR A N   1 
ATOM 4464  C CA  . TYR A 1 589  ? 223.853 -29.737 -19.183 1.00 44.30  ? 656  TYR A CA  1 
ATOM 4465  C C   . TYR A 1 589  ? 224.150 -30.905 -20.132 1.00 44.30  ? 656  TYR A C   1 
ATOM 4466  O O   . TYR A 1 589  ? 225.270 -31.442 -20.174 1.00 44.30  ? 656  TYR A O   1 
ATOM 4467  C CB  . TYR A 1 589  ? 224.102 -30.208 -17.753 1.00 44.30  ? 656  TYR A CB  1 
ATOM 4468  C CG  . TYR A 1 589  ? 222.970 -30.808 -16.964 1.00 44.30  ? 656  TYR A CG  1 
ATOM 4469  C CD1 . TYR A 1 589  ? 222.630 -32.149 -17.098 1.00 44.30  ? 656  TYR A CD1 1 
ATOM 4470  C CD2 . TYR A 1 589  ? 222.341 -30.064 -15.963 1.00 44.30  ? 656  TYR A CD2 1 
ATOM 4471  C CE1 . TYR A 1 589  ? 221.713 -32.735 -16.241 1.00 44.30  ? 656  TYR A CE1 1 
ATOM 4472  C CE2 . TYR A 1 589  ? 221.414 -30.636 -15.105 1.00 44.30  ? 656  TYR A CE2 1 
ATOM 4473  C CZ  . TYR A 1 589  ? 221.105 -31.967 -15.244 1.00 44.30  ? 656  TYR A CZ  1 
ATOM 4474  O OH  . TYR A 1 589  ? 220.163 -32.502 -14.400 1.00 44.30  ? 656  TYR A OH  1 
ATOM 4475  N N   . ARG A 1 590  ? 223.119 -31.283 -20.883 1.00 44.30  ? 657  ARG A N   1 
ATOM 4476  C CA  . ARG A 1 590  ? 223.194 -32.358 -21.857 1.00 44.30  ? 657  ARG A CA  1 
ATOM 4477  C C   . ARG A 1 590  ? 223.484 -31.790 -23.268 1.00 44.30  ? 657  ARG A C   1 
ATOM 4478  O O   . ARG A 1 590  ? 224.345 -32.325 -23.972 1.00 44.30  ? 657  ARG A O   1 
ATOM 4479  C CB  . ARG A 1 590  ? 221.903 -33.213 -21.810 1.00 44.30  ? 657  ARG A CB  1 
ATOM 4480  C CG  . ARG A 1 590  ? 221.689 -33.945 -20.440 1.00 44.30  ? 657  ARG A CG  1 
ATOM 4481  C CD  . ARG A 1 590  ? 221.074 -35.380 -20.535 1.00 44.30  ? 657  ARG A CD  1 
ATOM 4482  N NE  . ARG A 1 590  ? 219.599 -35.446 -20.511 1.00 44.30  ? 657  ARG A NE  1 
ATOM 4483  C CZ  . ARG A 1 590  ? 218.878 -36.420 -19.934 1.00 44.30  ? 657  ARG A CZ  1 
ATOM 4484  N NH1 . ARG A 1 590  ? 219.480 -37.432 -19.314 1.00 44.30  ? 657  ARG A NH1 1 
ATOM 4485  N NH2 . ARG A 1 590  ? 217.542 -36.387 -19.965 1.00 44.30  ? 657  ARG A NH2 1 
ATOM 4486  N N   . LYS A 1 591  ? 222.780 -30.741 -23.708 1.00 44.30  ? 658  LYS A N   1 
ATOM 4487  C CA  . LYS A 1 591  ? 223.134 -30.152 -25.004 1.00 44.30  ? 658  LYS A CA  1 
ATOM 4488  C C   . LYS A 1 591  ? 224.575 -29.887 -24.609 1.00 44.30  ? 658  LYS A C   1 
ATOM 4489  O O   . LYS A 1 591  ? 225.488 -30.530 -25.111 1.00 44.30  ? 658  LYS A O   1 
ATOM 4490  C CB  . LYS A 1 591  ? 222.394 -28.844 -25.232 1.00 44.30  ? 658  LYS A CB  1 
ATOM 4491  C CG  . LYS A 1 591  ? 220.894 -28.984 -25.364 1.00 44.30  ? 658  LYS A CG  1 
ATOM 4492  C CD  . LYS A 1 591  ? 220.456 -29.362 -26.775 1.00 44.30  ? 658  LYS A CD  1 
ATOM 4493  C CE  . LYS A 1 591  ? 218.940 -29.516 -26.816 1.00 44.30  ? 658  LYS A CE  1 
ATOM 4494  N NZ  . LYS A 1 591  ? 218.399 -30.159 -28.057 1.00 44.30  ? 658  LYS A NZ  1 
ATOM 4495  N N   . HIS A 1 592  ? 224.731 -28.968 -23.658 1.00 44.30  ? 659  HIS A N   1 
ATOM 4496  C CA  . HIS A 1 592  ? 225.990 -28.617 -23.000 1.00 44.30  ? 659  HIS A CA  1 
ATOM 4497  C C   . HIS A 1 592  ? 226.959 -29.789 -23.225 1.00 44.30  ? 659  HIS A C   1 
ATOM 4498  O O   . HIS A 1 592  ? 228.079 -29.597 -23.703 1.00 44.30  ? 659  HIS A O   1 
ATOM 4499  C CB  . HIS A 1 592  ? 225.618 -28.514 -21.520 1.00 44.30  ? 659  HIS A CB  1 
ATOM 4500  C CG  . HIS A 1 592  ? 226.669 -28.001 -20.591 1.00 44.30  ? 659  HIS A CG  1 
ATOM 4501  N ND1 . HIS A 1 592  ? 228.004 -27.896 -20.908 1.00 44.30  ? 659  HIS A ND1 1 
ATOM 4502  C CD2 . HIS A 1 592  ? 226.568 -27.648 -19.289 1.00 44.30  ? 659  HIS A CD2 1 
ATOM 4503  C CE1 . HIS A 1 592  ? 228.680 -27.506 -19.840 1.00 44.30  ? 659  HIS A CE1 1 
ATOM 4504  N NE2 . HIS A 1 592  ? 227.831 -27.349 -18.844 1.00 44.30  ? 659  HIS A NE2 1 
ATOM 4505  N N   . CYS A 1 593  ? 226.470 -30.995 -22.896 1.00 44.30  ? 660  CYS A N   1 
ATOM 4506  C CA  . CYS A 1 593  ? 227.167 -32.304 -22.958 1.00 44.30  ? 660  CYS A CA  1 
ATOM 4507  C C   . CYS A 1 593  ? 228.009 -32.822 -24.120 1.00 44.30  ? 660  CYS A C   1 
ATOM 4508  O O   . CYS A 1 593  ? 229.228 -32.959 -24.008 1.00 44.30  ? 660  CYS A O   1 
ATOM 4509  C CB  . CYS A 1 593  ? 226.181 -33.423 -22.667 1.00 44.30  ? 660  CYS A CB  1 
ATOM 4510  S SG  . CYS A 1 593  ? 226.482 -34.876 -23.722 1.00 44.30  ? 660  CYS A SG  1 
ATOM 4511  N N   . LEU A 1 594  ? 227.346 -33.207 -25.200 1.00 44.30  ? 661  LEU A N   1 
ATOM 4512  C CA  . LEU A 1 594  ? 228.054 -33.748 -26.350 1.00 44.30  ? 661  LEU A CA  1 
ATOM 4513  C C   . LEU A 1 594  ? 229.026 -32.661 -26.780 1.00 44.30  ? 661  LEU A C   1 
ATOM 4514  O O   . LEU A 1 594  ? 230.174 -32.930 -27.139 1.00 44.30  ? 661  LEU A O   1 
ATOM 4515  C CB  . LEU A 1 594  ? 227.043 -34.097 -27.465 1.00 44.30  ? 661  LEU A CB  1 
ATOM 4516  C CG  . LEU A 1 594  ? 227.333 -34.997 -28.696 1.00 44.30  ? 661  LEU A CG  1 
ATOM 4517  C CD1 . LEU A 1 594  ? 228.530 -35.926 -28.475 1.00 44.30  ? 661  LEU A CD1 1 
ATOM 4518  C CD2 . LEU A 1 594  ? 226.067 -35.820 -29.007 1.00 44.30  ? 661  LEU A CD2 1 
ATOM 4519  N N   . GLU A 1 595  ? 228.551 -31.422 -26.693 1.00 44.30  ? 662  GLU A N   1 
ATOM 4520  C CA  . GLU A 1 595  ? 229.341 -30.254 -27.049 1.00 44.30  ? 662  GLU A CA  1 
ATOM 4521  C C   . GLU A 1 595  ? 230.551 -30.055 -26.149 1.00 44.30  ? 662  GLU A C   1 
ATOM 4522  O O   . GLU A 1 595  ? 231.624 -29.741 -26.639 1.00 44.30  ? 662  GLU A O   1 
ATOM 4523  C CB  . GLU A 1 595  ? 228.479 -28.977 -27.059 1.00 44.30  ? 662  GLU A CB  1 
ATOM 4524  C CG  . GLU A 1 595  ? 227.125 -29.036 -26.338 1.00 44.30  ? 662  GLU A CG  1 
ATOM 4525  C CD  . GLU A 1 595  ? 225.922 -29.281 -27.272 1.00 44.30  ? 662  GLU A CD  1 
ATOM 4526  O OE1 . GLU A 1 595  ? 226.015 -30.181 -28.150 1.00 44.30  ? 662  GLU A OE1 1 
ATOM 4527  O OE2 . GLU A 1 595  ? 224.882 -28.583 -27.103 1.00 44.30  ? 662  GLU A OE2 1 
ATOM 4528  N N   . GLN A 1 596  ? 230.395 -30.211 -24.842 1.00 44.30  ? 663  GLN A N   1 
ATOM 4529  C CA  . GLN A 1 596  ? 231.547 -30.079 -23.968 1.00 44.30  ? 663  GLN A CA  1 
ATOM 4530  C C   . GLN A 1 596  ? 232.610 -31.076 -24.473 1.00 44.30  ? 663  GLN A C   1 
ATOM 4531  O O   . GLN A 1 596  ? 233.768 -30.703 -24.691 1.00 44.30  ? 663  GLN A O   1 
ATOM 4532  C CB  . GLN A 1 596  ? 231.183 -30.446 -22.532 1.00 44.30  ? 663  GLN A CB  1 
ATOM 4533  C CG  . GLN A 1 596  ? 230.037 -29.671 -21.894 1.00 44.30  ? 663  GLN A CG  1 
ATOM 4534  C CD  . GLN A 1 596  ? 229.814 -30.029 -20.396 1.00 44.30  ? 663  GLN A CD  1 
ATOM 4535  O OE1 . GLN A 1 596  ? 228.788 -30.620 -20.020 1.00 44.30  ? 663  GLN A OE1 1 
ATOM 4536  N NE2 . GLN A 1 596  ? 230.778 -29.652 -19.542 1.00 44.30  ? 663  GLN A NE2 1 
ATOM 4537  N N   . GLY A 1 597  ? 232.195 -32.336 -24.661 1.00 44.30  ? 664  GLY A N   1 
ATOM 4538  C CA  . GLY A 1 597  ? 233.083 -33.394 -25.125 1.00 44.30  ? 664  GLY A CA  1 
ATOM 4539  C C   . GLY A 1 597  ? 233.737 -33.146 -26.475 1.00 44.30  ? 664  GLY A C   1 
ATOM 4540  O O   . GLY A 1 597  ? 234.920 -33.397 -26.654 1.00 44.30  ? 664  GLY A O   1 
ATOM 4541  N N   . LYS A 1 598  ? 232.955 -32.670 -27.439 1.00 44.30  ? 665  LYS A N   1 
ATOM 4542  C CA  . LYS A 1 598  ? 233.454 -32.364 -28.782 1.00 44.30  ? 665  LYS A CA  1 
ATOM 4543  C C   . LYS A 1 598  ? 234.303 -31.132 -28.636 1.00 44.30  ? 665  LYS A C   1 
ATOM 4544  O O   . LYS A 1 598  ? 235.361 -31.015 -29.240 1.00 44.30  ? 665  LYS A O   1 
ATOM 4545  C CB  . LYS A 1 598  ? 232.323 -31.955 -29.710 1.00 44.30  ? 665  LYS A CB  1 
ATOM 4546  C CG  . LYS A 1 598  ? 232.129 -30.420 -29.730 1.00 44.30  ? 665  LYS A CG  1 
ATOM 4547  C CD  . LYS A 1 598  ? 230.924 -29.970 -30.502 1.00 44.30  ? 665  LYS A CD  1 
ATOM 4548  C CE  . LYS A 1 598  ? 230.992 -30.468 -31.921 1.00 44.30  ? 665  LYS A CE  1 
ATOM 4549  N NZ  . LYS A 1 598  ? 232.387 -30.387 -32.441 1.00 44.30  ? 665  LYS A NZ  1 
ATOM 4550  N N   . GLN A 1 599  ? 233.766 -30.193 -27.860 1.00 44.30  ? 666  GLN A N   1 
ATOM 4551  C CA  . GLN A 1 599  ? 234.406 -28.934 -27.608 1.00 44.30  ? 666  GLN A CA  1 
ATOM 4552  C C   . GLN A 1 599  ? 235.704 -29.159 -26.927 1.00 44.30  ? 666  GLN A C   1 
ATOM 4553  O O   . GLN A 1 599  ? 236.568 -28.368 -27.093 1.00 44.30  ? 666  GLN A O   1 
ATOM 4554  C CB  . GLN A 1 599  ? 233.576 -28.027 -26.713 1.00 44.30  ? 666  GLN A CB  1 
ATOM 4555  C CG  . GLN A 1 599  ? 234.136 -26.603 -26.610 1.00 44.30  ? 666  GLN A CG  1 
ATOM 4556  C CD  . GLN A 1 599  ? 234.701 -26.229 -25.226 1.00 44.30  ? 666  GLN A CD  1 
ATOM 4557  O OE1 . GLN A 1 599  ? 235.058 -25.061 -24.988 1.00 44.30  ? 666  GLN A OE1 1 
ATOM 4558  N NE2 . GLN A 1 599  ? 234.782 -27.207 -24.319 1.00 44.30  ? 666  GLN A NE2 1 
ATOM 4559  N N   . GLN A 1 600  ? 235.852 -30.212 -26.143 1.00 44.30  ? 667  GLN A N   1 
ATOM 4560  C CA  . GLN A 1 600  ? 237.124 -30.408 -25.480 1.00 44.30  ? 667  GLN A CA  1 
ATOM 4561  C C   . GLN A 1 600  ? 238.217 -30.905 -26.409 1.00 44.30  ? 667  GLN A C   1 
ATOM 4562  O O   . GLN A 1 600  ? 239.307 -30.354 -26.406 1.00 44.30  ? 667  GLN A O   1 
ATOM 4563  C CB  . GLN A 1 600  ? 236.989 -31.382 -24.327 1.00 44.30  ? 667  GLN A CB  1 
ATOM 4564  C CG  . GLN A 1 600  ? 236.789 -32.801 -24.782 1.00 44.30  ? 667  GLN A CG  1 
ATOM 4565  C CD  . GLN A 1 600  ? 236.688 -33.753 -23.633 1.00 44.30  ? 667  GLN A CD  1 
ATOM 4566  O OE1 . GLN A 1 600  ? 237.656 -34.429 -23.287 1.00 44.30  ? 667  GLN A OE1 1 
ATOM 4567  N NE2 . GLN A 1 600  ? 235.514 -33.801 -23.010 1.00 44.30  ? 667  GLN A NE2 1 
ATOM 4568  N N   . LEU A 1 601  ? 237.962 -31.943 -27.199 1.00 44.30  ? 668  LEU A N   1 
ATOM 4569  C CA  . LEU A 1 601  ? 239.033 -32.408 -28.057 1.00 44.30  ? 668  LEU A CA  1 
ATOM 4570  C C   . LEU A 1 601  ? 239.389 -31.313 -29.011 1.00 44.30  ? 668  LEU A C   1 
ATOM 4571  O O   . LEU A 1 601  ? 240.573 -31.054 -29.251 1.00 51.71  ? 668  LEU A O   1 
ATOM 4572  C CB  . LEU A 1 601  ? 238.663 -33.660 -28.844 1.00 44.30  ? 668  LEU A CB  1 
ATOM 4573  C CG  . LEU A 1 601  ? 237.198 -33.887 -29.154 1.00 44.30  ? 668  LEU A CG  1 
ATOM 4574  C CD1 . LEU A 1 601  ? 237.046 -34.351 -30.591 1.00 44.30  ? 668  LEU A CD1 1 
ATOM 4575  C CD2 . LEU A 1 601  ? 236.655 -34.906 -28.137 1.00 44.30  ? 668  LEU A CD2 1 
ATOM 4576  N N   . MET A 1 602  ? 238.385 -30.632 -29.548 1.00 53.53  ? 669  MET A N   1 
ATOM 4577  C CA  . MET A 1 602  ? 238.766 -29.614 -30.481 1.00 53.53  ? 669  MET A CA  1 
ATOM 4578  C C   . MET A 1 602  ? 239.741 -28.612 -29.884 1.00 53.53  ? 669  MET A C   1 
ATOM 4579  O O   . MET A 1 602  ? 240.846 -28.611 -30.318 1.00 53.71  ? 669  MET A O   1 
ATOM 4580  C CB  . MET A 1 602  ? 237.579 -28.950 -31.205 1.00 41.67  ? 669  MET A CB  1 
ATOM 4581  C CG  . MET A 1 602  ? 236.432 -28.451 -30.390 1.00 41.67  ? 669  MET A CG  1 
ATOM 4582  S SD  . MET A 1 602  ? 235.265 -27.600 -31.508 1.00 41.67  ? 669  MET A SD  1 
ATOM 4583  C CE  . MET A 1 602  ? 234.028 -26.899 -30.255 1.00 41.67  ? 669  MET A CE  1 
ATOM 4584  N N   . PRO A 1 603  ? 239.418 -27.860 -28.814 1.00 53.53  ? 670  PRO A N   1 
ATOM 4585  C CA  . PRO A 1 603  ? 240.452 -26.926 -28.359 1.00 53.53  ? 670  PRO A CA  1 
ATOM 4586  C C   . PRO A 1 603  ? 241.650 -27.636 -27.717 1.00 53.53  ? 670  PRO A C   1 
ATOM 4587  O O   . PRO A 1 603  ? 242.785 -27.374 -28.103 1.00 53.71  ? 670  PRO A O   1 
ATOM 4588  C CB  . PRO A 1 603  ? 239.701 -26.052 -27.358 1.00 44.30  ? 670  PRO A CB  1 
ATOM 4589  C CG  . PRO A 1 603  ? 238.885 -27.077 -26.619 1.00 44.30  ? 670  PRO A CG  1 
ATOM 4590  C CD  . PRO A 1 603  ? 238.631 -28.251 -27.644 1.00 44.30  ? 670  PRO A CD  1 
ATOM 4591  N N   . GLN A 1 604  ? 241.406 -28.520 -26.746 1.00 53.53  ? 671  GLN A N   1 
ATOM 4592  C CA  . GLN A 1 604  ? 242.497 -29.221 -26.081 1.00 53.53  ? 671  GLN A CA  1 
ATOM 4593  C C   . GLN A 1 604  ? 243.517 -29.645 -27.097 1.00 53.53  ? 671  GLN A C   1 
ATOM 4594  O O   . GLN A 1 604  ? 244.644 -29.143 -27.134 1.00 53.71  ? 671  GLN A O   1 
ATOM 4595  C CB  . GLN A 1 604  ? 242.004 -30.470 -25.361 1.00 44.30  ? 671  GLN A CB  1 
ATOM 4596  C CG  . GLN A 1 604  ? 240.965 -30.208 -24.327 1.00 44.30  ? 671  GLN A CG  1 
ATOM 4597  C CD  . GLN A 1 604  ? 241.101 -28.826 -23.751 1.00 44.30  ? 671  GLN A CD  1 
ATOM 4598  O OE1 . GLN A 1 604  ? 241.999 -28.550 -22.966 1.00 44.30  ? 671  GLN A OE1 1 
ATOM 4599  N NE2 . GLN A 1 604  ? 240.219 -27.938 -24.159 1.00 44.30  ? 671  GLN A NE2 1 
ATOM 4600  N N   . GLU A 1 605  ? 243.084 -30.562 -27.941 1.00 53.53  ? 672  GLU A N   1 
ATOM 4601  C CA  . GLU A 1 605  ? 243.913 -31.132 -28.960 1.00 53.53  ? 672  GLU A CA  1 
ATOM 4602  C C   . GLU A 1 605  ? 243.763 -30.373 -30.253 1.00 53.53  ? 672  GLU A C   1 
ATOM 4603  O O   . GLU A 1 605  ? 244.100 -30.885 -31.304 1.00 53.71  ? 672  GLU A O   1 
ATOM 4604  C CB  . GLU A 1 605  ? 243.509 -32.563 -29.084 1.00 44.30  ? 672  GLU A CB  1 
ATOM 4605  C CG  . GLU A 1 605  ? 242.664 -32.942 -27.878 1.00 44.30  ? 672  GLU A CG  1 
ATOM 4606  C CD  . GLU A 1 605  ? 242.441 -34.398 -27.811 1.00 44.30  ? 672  GLU A CD  1 
ATOM 4607  O OE1 . GLU A 1 605  ? 241.657 -34.906 -26.983 1.00 44.30  ? 672  GLU A OE1 1 
ATOM 4608  O OE2 . GLU A 1 605  ? 243.093 -35.039 -28.623 1.00 44.30  ? 672  GLU A OE2 1 
ATOM 4609  N N   . ALA A 1 606  ? 243.223 -29.154 -30.154 1.00 53.53  ? 673  ALA A N   1 
ATOM 4610  C CA  . ALA A 1 606  ? 243.088 -28.232 -31.297 1.00 43.53  ? 673  ALA A CA  1 
ATOM 4611  C C   . ALA A 1 606  ? 244.389 -27.553 -31.234 1.00 43.53  ? 673  ALA A C   1 
ATOM 4612  O O   . ALA A 1 606  ? 244.427 -26.353 -30.964 1.00 51.71  ? 673  ALA A O   1 
ATOM 4613  C CB  . ALA A 1 606  ? 242.051 -27.128 -31.088 1.00 44.30  ? 673  ALA A CB  1 
ATOM 4614  N N   . ALA A 1 643  ? 220.383 -23.697 -30.922 1.00 54.04  ? 710  ALA A N   1 
ATOM 4615  C CA  . ALA A 1 643  ? 220.401 -23.664 -29.460 1.00 79.38  ? 710  ALA A CA  1 
ATOM 4616  C C   . ALA A 1 643  ? 219.524 -22.559 -28.824 1.00 75.96  ? 710  ALA A C   1 
ATOM 4617  O O   . ALA A 1 643  ? 219.640 -21.363 -29.140 1.00 75.18  ? 710  ALA A O   1 
ATOM 4618  C CB  . ALA A 1 643  ? 221.851 -23.553 -28.965 1.00 79.07  ? 710  ALA A CB  1 
ATOM 4619  N N   . ALA A 1 644  ? 218.645 -22.993 -27.924 1.00 71.66  ? 711  ALA A N   1 
ATOM 4620  C CA  . ALA A 1 644  ? 217.724 -22.116 -27.213 1.00 66.83  ? 711  ALA A CA  1 
ATOM 4621  C C   . ALA A 1 644  ? 218.110 -22.165 -25.731 1.00 63.70  ? 711  ALA A C   1 
ATOM 4622  O O   . ALA A 1 644  ? 217.355 -22.691 -24.922 1.00 62.84  ? 711  ALA A O   1 
ATOM 4623  C CB  . ALA A 1 644  ? 216.300 -22.628 -27.416 1.00 66.94  ? 711  ALA A CB  1 
ATOM 4624  N N   . VAL A 1 645  ? 219.293 -21.619 -25.414 1.00 60.50  ? 712  VAL A N   1 
ATOM 4625  C CA  . VAL A 1 645  ? 219.983 -21.578 -24.089 1.00 58.27  ? 712  VAL A CA  1 
ATOM 4626  C C   . VAL A 1 645  ? 220.755 -22.860 -23.721 1.00 56.23  ? 712  VAL A C   1 
ATOM 4627  O O   . VAL A 1 645  ? 221.479 -22.874 -22.727 1.00 54.40  ? 712  VAL A O   1 
ATOM 4628  C CB  . VAL A 1 645  ? 219.109 -21.171 -22.769 1.00 58.13  ? 712  VAL A CB  1 
ATOM 4629  C CG1 . VAL A 1 645  ? 219.430 -19.740 -22.361 1.00 58.06  ? 712  VAL A CG1 1 
ATOM 4630  C CG2 . VAL A 1 645  ? 217.627 -21.329 -22.943 1.00 58.68  ? 712  VAL A CG2 1 
ATOM 4631  N N   . PRO A 1 646  ? 220.609 -23.952 -24.499 1.00 54.95  ? 713  PRO A N   1 
ATOM 4632  C CA  . PRO A 1 646  ? 221.381 -25.125 -24.088 1.00 52.70  ? 713  PRO A CA  1 
ATOM 4633  C C   . PRO A 1 646  ? 222.627 -25.330 -24.963 1.00 50.51  ? 713  PRO A C   1 
ATOM 4634  O O   . PRO A 1 646  ? 223.205 -26.419 -24.993 1.00 49.75  ? 713  PRO A O   1 
ATOM 4635  C CB  . PRO A 1 646  ? 220.377 -26.280 -24.244 1.00 52.62  ? 713  PRO A CB  1 
ATOM 4636  C CG  . PRO A 1 646  ? 219.048 -25.624 -24.516 1.00 54.56  ? 713  PRO A CG  1 
ATOM 4637  C CD  . PRO A 1 646  ? 219.455 -24.409 -25.284 1.00 55.35  ? 713  PRO A CD  1 
ATOM 4638  N N   . GLY A 1 647  ? 223.042 -24.284 -25.673 1.00 48.80  ? 714  GLY A N   1 
ATOM 4639  C CA  . GLY A 1 647  ? 224.219 -24.395 -26.525 1.00 47.87  ? 714  GLY A CA  1 
ATOM 4640  C C   . GLY A 1 647  ? 225.572 -24.133 -25.861 1.00 46.56  ? 714  GLY A C   1 
ATOM 4641  O O   . GLY A 1 647  ? 226.513 -24.895 -26.084 1.00 45.44  ? 714  GLY A O   1 
ATOM 4642  N N   . GLN A 1 648  ? 225.660 -23.072 -25.048 1.00 46.04  ? 715  GLN A N   1 
ATOM 4643  C CA  . GLN A 1 648  ? 226.879 -22.646 -24.336 1.00 44.39  ? 715  GLN A CA  1 
ATOM 4644  C C   . GLN A 1 648  ? 227.142 -23.442 -23.060 1.00 41.66  ? 715  GLN A C   1 
ATOM 4645  O O   . GLN A 1 648  ? 226.730 -23.030 -21.984 1.00 39.60  ? 715  GLN A O   1 
ATOM 4646  C CB  . GLN A 1 648  ? 226.743 -21.165 -23.981 1.00 47.38  ? 715  GLN A CB  1 
ATOM 4647  C CG  . GLN A 1 648  ? 227.965 -20.537 -23.314 1.00 52.23  ? 715  GLN A CG  1 
ATOM 4648  C CD  . GLN A 1 648  ? 227.878 -18.998 -23.206 1.00 53.77  ? 715  GLN A CD  1 
ATOM 4649  O OE1 . GLN A 1 648  ? 227.429 -18.448 -22.192 1.00 51.98  ? 715  GLN A OE1 1 
ATOM 4650  N NE2 . GLN A 1 648  ? 228.305 -18.307 -24.267 1.00 55.28  ? 715  GLN A NE2 1 
ATOM 4651  N N   . PRO A 1 649  ? 227.892 -24.552 -23.156 1.00 40.14  ? 716  PRO A N   1 
ATOM 4652  C CA  . PRO A 1 649  ? 228.230 -25.440 -22.041 1.00 40.85  ? 716  PRO A CA  1 
ATOM 4653  C C   . PRO A 1 649  ? 228.230 -24.834 -20.635 1.00 42.41  ? 716  PRO A C   1 
ATOM 4654  O O   . PRO A 1 649  ? 227.286 -25.066 -19.883 1.00 43.47  ? 716  PRO A O   1 
ATOM 4655  C CB  . PRO A 1 649  ? 229.579 -26.021 -22.453 1.00 38.60  ? 716  PRO A CB  1 
ATOM 4656  C CG  . PRO A 1 649  ? 230.133 -24.990 -23.309 1.00 36.81  ? 716  PRO A CG  1 
ATOM 4657  C CD  . PRO A 1 649  ? 228.961 -24.615 -24.156 1.00 38.14  ? 716  PRO A CD  1 
ATOM 4658  N N   . LEU A 1 650  ? 229.262 -24.081 -20.263 1.00 42.58  ? 717  LEU A N   1 
ATOM 4659  C CA  . LEU A 1 650  ? 229.300 -23.458 -18.929 1.00 41.75  ? 717  LEU A CA  1 
ATOM 4660  C C   . LEU A 1 650  ? 227.892 -23.046 -18.440 1.00 43.92  ? 717  LEU A C   1 
ATOM 4661  O O   . LEU A 1 650  ? 227.300 -23.690 -17.572 1.00 42.90  ? 717  LEU A O   1 
ATOM 4662  C CB  . LEU A 1 650  ? 230.212 -22.218 -18.935 1.00 35.99  ? 717  LEU A CB  1 
ATOM 4663  C CG  . LEU A 1 650  ? 231.606 -22.331 -19.553 1.00 28.53  ? 717  LEU A CG  1 
ATOM 4664  C CD1 . LEU A 1 650  ? 231.583 -21.742 -20.935 1.00 30.84  ? 717  LEU A CD1 1 
ATOM 4665  C CD2 . LEU A 1 650  ? 232.613 -21.645 -18.696 1.00 28.13  ? 717  LEU A CD2 1 
ATOM 4666  N N   . ALA A 1 651  ? 227.359 -21.985 -19.035 1.00 44.66  ? 718  ALA A N   1 
ATOM 4667  C CA  . ALA A 1 651  ? 226.040 -21.442 -18.710 1.00 42.21  ? 718  ALA A CA  1 
ATOM 4668  C C   . ALA A 1 651  ? 224.877 -22.377 -18.366 1.00 41.59  ? 718  ALA A C   1 
ATOM 4669  O O   . ALA A 1 651  ? 224.202 -22.161 -17.367 1.00 38.04  ? 718  ALA A O   1 
ATOM 4670  C CB  . ALA A 1 651  ? 225.603 -20.531 -19.821 1.00 40.13  ? 718  ALA A CB  1 
ATOM 4671  N N   . LEU A 1 652  ? 224.623 -23.391 -19.188 1.00 44.05  ? 719  LEU A N   1 
ATOM 4672  C CA  . LEU A 1 652  ? 223.497 -24.309 -18.972 1.00 46.06  ? 719  LEU A CA  1 
ATOM 4673  C C   . LEU A 1 652  ? 223.457 -25.080 -17.674 1.00 48.79  ? 719  LEU A C   1 
ATOM 4674  O O   . LEU A 1 652  ? 222.741 -24.721 -16.737 1.00 48.64  ? 719  LEU A O   1 
ATOM 4675  C CB  . LEU A 1 652  ? 223.424 -25.327 -20.093 1.00 43.46  ? 719  LEU A CB  1 
ATOM 4676  C CG  . LEU A 1 652  ? 224.300 -25.051 -21.298 1.00 43.28  ? 719  LEU A CG  1 
ATOM 4677  C CD1 . LEU A 1 652  ? 224.001 -26.070 -22.349 1.00 45.85  ? 719  LEU A CD1 1 
ATOM 4678  C CD2 . LEU A 1 652  ? 224.029 -23.674 -21.836 1.00 41.88  ? 719  LEU A CD2 1 
ATOM 4679  N N   . THR A 1 653  ? 224.177 -26.191 -17.651 1.00 51.19  ? 720  THR A N   1 
ATOM 4680  C CA  . THR A 1 653  ? 224.207 -27.012 -16.463 1.00 56.37  ? 720  THR A CA  1 
ATOM 4681  C C   . THR A 1 653  ? 224.645 -26.174 -15.291 1.00 59.74  ? 720  THR A C   1 
ATOM 4682  O O   . THR A 1 653  ? 224.011 -26.173 -14.225 1.00 60.35  ? 720  THR A O   1 
ATOM 4683  C CB  . THR A 1 653  ? 225.227 -28.156 -16.576 1.00 57.03  ? 720  THR A CB  1 
ATOM 4684  O OG1 . THR A 1 653  ? 224.902 -29.167 -15.619 1.00 58.06  ? 720  THR A OG1 1 
ATOM 4685  C CG2 . THR A 1 653  ? 226.646 -27.681 -16.287 1.00 57.08  ? 720  THR A CG2 1 
ATOM 4686  N N   . ALA A 1 654  ? 225.753 -25.469 -15.519 1.00 63.13  ? 721  ALA A N   1 
ATOM 4687  C CA  . ALA A 1 654  ? 226.386 -24.653 -14.509 1.00 66.47  ? 721  ALA A CA  1 
ATOM 4688  C C   . ALA A 1 654  ? 225.410 -23.840 -13.686 1.00 69.47  ? 721  ALA A C   1 
ATOM 4689  O O   . ALA A 1 654  ? 225.698 -23.547 -12.529 1.00 70.54  ? 721  ALA A O   1 
ATOM 4690  C CB  . ALA A 1 654  ? 227.422 -23.759 -15.138 1.00 65.43  ? 721  ALA A CB  1 
ATOM 4691  N N   . ARG A 1 655  ? 224.265 -23.477 -14.266 1.00 72.01  ? 722  ARG A N   1 
ATOM 4692  C CA  . ARG A 1 655  ? 223.264 -22.709 -13.532 1.00 74.74  ? 722  ARG A CA  1 
ATOM 4693  C C   . ARG A 1 655  ? 223.370 -23.113 -12.045 1.00 76.75  ? 722  ARG A C   1 
ATOM 4694  O O   . ARG A 1 655  ? 222.966 -24.222 -11.665 1.00 76.35  ? 722  ARG A O   1 
ATOM 4695  C CB  . ARG A 1 655  ? 221.861 -23.013 -14.085 1.00 73.72  ? 722  ARG A CB  1 
ATOM 4696  C CG  . ARG A 1 655  ? 221.627 -22.525 -15.497 1.00 74.42  ? 722  ARG A CG  1 
ATOM 4697  C CD  . ARG A 1 655  ? 220.212 -22.786 -15.932 1.00 75.36  ? 722  ARG A CD  1 
ATOM 4698  N NE  . ARG A 1 655  ? 220.044 -22.513 -17.354 1.00 78.45  ? 722  ARG A NE  1 
ATOM 4699  C CZ  . ARG A 1 655  ? 218.902 -22.673 -18.009 1.00 80.91  ? 722  ARG A CZ  1 
ATOM 4700  N NH1 . ARG A 1 655  ? 217.832 -23.100 -17.353 1.00 81.92  ? 722  ARG A NH1 1 
ATOM 4701  N NH2 . ARG A 1 655  ? 218.829 -22.428 -19.316 1.00 81.78  ? 722  ARG A NH2 1 
ATOM 4702  N N   . GLY A 1 656  ? 223.943 -22.220 -11.227 1.00 78.99  ? 723  GLY A N   1 
ATOM 4703  C CA  . GLY A 1 656  ? 224.127 -22.490 -9.806  1.00 82.90  ? 723  GLY A CA  1 
ATOM 4704  C C   . GLY A 1 656  ? 225.403 -23.294 -9.602  1.00 85.23  ? 723  GLY A C   1 
ATOM 4705  O O   . GLY A 1 656  ? 225.369 -24.509 -9.393  1.00 86.56  ? 723  GLY A O   1 
ATOM 4706  N N   . GLY A 1 657  ? 226.547 -22.631 -9.660  1.00 86.25  ? 724  GLY A N   1 
ATOM 4707  C CA  . GLY A 1 657  ? 227.773 -23.380 -9.506  1.00 86.85  ? 724  GLY A CA  1 
ATOM 4708  C C   . GLY A 1 657  ? 228.694 -22.971 -8.376  1.00 87.34  ? 724  GLY A C   1 
ATOM 4709  O O   . GLY A 1 657  ? 228.661 -21.827 -7.899  1.00 86.70  ? 724  GLY A O   1 
ATOM 4710  N N   . PRO A 1 658  ? 229.540 -23.913 -7.938  1.00 87.64  ? 725  PRO A N   1 
ATOM 4711  C CA  . PRO A 1 658  ? 229.447 -25.215 -8.610  1.00 88.26  ? 725  PRO A CA  1 
ATOM 4712  C C   . PRO A 1 658  ? 228.962 -26.309 -7.689  1.00 89.22  ? 725  PRO A C   1 
ATOM 4713  O O   . PRO A 1 658  ? 229.001 -27.487 -8.036  1.00 90.71  ? 725  PRO A O   1 
ATOM 4714  C CB  . PRO A 1 658  ? 230.861 -25.460 -9.091  1.00 87.17  ? 725  PRO A CB  1 
ATOM 4715  C CG  . PRO A 1 658  ? 231.482 -24.098 -9.049  1.00 86.43  ? 725  PRO A CG  1 
ATOM 4716  C CD  . PRO A 1 658  ? 230.953 -23.585 -7.754  1.00 86.48  ? 725  PRO A CD  1 
ATOM 4717  N N   . LYS A 1 659  ? 228.544 -25.905 -6.494  1.00 89.47  ? 726  LYS A N   1 
ATOM 4718  C CA  . LYS A 1 659  ? 227.976 -26.818 -5.510  1.00 90.79  ? 726  LYS A CA  1 
ATOM 4719  C C   . LYS A 1 659  ? 228.817 -27.465 -4.435  1.00 90.62  ? 726  LYS A C   1 
ATOM 4720  O O   . LYS A 1 659  ? 230.042 -27.375 -4.412  1.00 90.20  ? 726  LYS A O   1 
ATOM 4721  C CB  . LYS A 1 659  ? 227.187 -27.920 -6.221  1.00 92.23  ? 726  LYS A CB  1 
ATOM 4722  C CG  . LYS A 1 659  ? 225.747 -27.543 -6.475  1.00 93.87  ? 726  LYS A CG  1 
ATOM 4723  C CD  . LYS A 1 659  ? 224.954 -27.569 -5.174  1.00 95.34  ? 726  LYS A CD  1 
ATOM 4724  C CE  . LYS A 1 659  ? 223.943 -26.443 -5.125  1.00 96.60  ? 726  LYS A CE  1 
ATOM 4725  N NZ  . LYS A 1 659  ? 223.266 -26.278 -6.437  1.00 98.11  ? 726  LYS A NZ  1 
ATOM 4726  N N   . ASP A 1 660  ? 228.098 -28.137 -3.542  1.00 91.36  ? 727  ASP A N   1 
ATOM 4727  C CA  . ASP A 1 660  ? 228.672 -28.851 -2.424  1.00 92.14  ? 727  ASP A CA  1 
ATOM 4728  C C   . ASP A 1 660  ? 229.844 -29.645 -2.924  1.00 92.20  ? 727  ASP A C   1 
ATOM 4729  O O   . ASP A 1 660  ? 230.175 -29.621 -4.108  1.00 92.32  ? 727  ASP A O   1 
ATOM 4730  C CB  . ASP A 1 660  ? 227.672 -29.833 -1.813  1.00 92.39  ? 727  ASP A CB  1 
ATOM 4731  C CG  . ASP A 1 660  ? 226.242 -29.361 -1.912  1.00 91.19  ? 727  ASP A CG  1 
ATOM 4732  O OD1 . ASP A 1 660  ? 225.381 -29.998 -1.271  1.00 90.92  ? 727  ASP A OD1 1 
ATOM 4733  O OD2 . ASP A 1 660  ? 225.969 -28.373 -2.626  1.00 90.18  ? 727  ASP A OD2 1 
ATOM 4734  N N   . THR A 1 661  ? 230.416 -30.396 -1.996  1.00 92.25  ? 728  THR A N   1 
ATOM 4735  C CA  . THR A 1 661  ? 231.589 -31.236 -2.199  1.00 92.78  ? 728  THR A CA  1 
ATOM 4736  C C   . THR A 1 661  ? 232.579 -30.576 -1.254  1.00 95.63  ? 728  THR A C   1 
ATOM 4737  O O   . THR A 1 661  ? 232.177 -29.851 -0.340  1.00 96.02  ? 728  THR A O   1 
ATOM 4738  C CB  . THR A 1 661  ? 232.146 -31.198 -3.657  1.00 90.66  ? 728  THR A CB  1 
ATOM 4739  O OG1 . THR A 1 661  ? 231.146 -31.669 -4.567  1.00 89.01  ? 728  THR A OG1 1 
ATOM 4740  C CG2 . THR A 1 661  ? 233.372 -32.097 -3.792  1.00 90.20  ? 728  THR A CG2 1 
ATOM 4741  N N   . GLN A 1 662  ? 233.862 -30.817 -1.461  1.00 98.83  ? 729  GLN A N   1 
ATOM 4742  C CA  . GLN A 1 662  ? 234.867 -30.236 -0.599  1.00 101.95 ? 729  GLN A CA  1 
ATOM 4743  C C   . GLN A 1 662  ? 236.082 -29.893 -1.437  1.00 103.43 ? 729  GLN A C   1 
ATOM 4744  O O   . GLN A 1 662  ? 236.279 -30.460 -2.514  1.00 103.78 ? 729  GLN A O   1 
ATOM 4745  C CB  . GLN A 1 662  ? 235.288 -31.245 0.472   1.00 102.44 ? 729  GLN A CB  1 
ATOM 4746  C CG  . GLN A 1 662  ? 234.161 -31.891 1.258   1.00 104.48 ? 729  GLN A CG  1 
ATOM 4747  C CD  . GLN A 1 662  ? 233.365 -32.904 0.457   1.00 105.11 ? 729  GLN A CD  1 
ATOM 4748  O OE1 . GLN A 1 662  ? 233.915 -33.874 -0.071  1.00 105.84 ? 729  GLN A OE1 1 
ATOM 4749  N NE2 . GLN A 1 662  ? 232.054 -32.687 0.374   1.00 105.42 ? 729  GLN A NE2 1 
ATOM 4750  N N   . PRO A 1 663  ? 236.902 -28.934 -0.976  1.00 105.02 ? 730  PRO A N   1 
ATOM 4751  C CA  . PRO A 1 663  ? 238.080 -28.640 -1.799  1.00 105.92 ? 730  PRO A CA  1 
ATOM 4752  C C   . PRO A 1 663  ? 238.928 -29.916 -1.678  1.00 107.00 ? 730  PRO A C   1 
ATOM 4753  O O   . PRO A 1 663  ? 239.542 -30.385 -2.645  1.00 108.17 ? 730  PRO A O   1 
ATOM 4754  C CB  . PRO A 1 663  ? 238.710 -27.452 -1.076  1.00 105.02 ? 730  PRO A CB  1 
ATOM 4755  C CG  . PRO A 1 663  ? 238.356 -27.726 0.384   1.00 104.73 ? 730  PRO A CG  1 
ATOM 4756  C CD  . PRO A 1 663  ? 236.906 -28.142 0.271   1.00 105.37 ? 730  PRO A CD  1 
ATOM 4757  N N   . SER A 1 664  ? 238.892 -30.466 -0.459  1.00 107.44 ? 731  SER A N   1 
ATOM 4758  C CA  . SER A 1 664  ? 239.585 -31.684 -0.029  1.00 107.33 ? 731  SER A CA  1 
ATOM 4759  C C   . SER A 1 664  ? 240.892 -32.005 -0.744  1.00 106.32 ? 731  SER A C   1 
ATOM 4760  O O   . SER A 1 664  ? 241.262 -33.177 -0.868  1.00 106.68 ? 731  SER A O   1 
ATOM 4761  C CB  . SER A 1 664  ? 238.639 -32.896 -0.115  1.00 108.77 ? 731  SER A CB  1 
ATOM 4762  O OG  . SER A 1 664  ? 237.492 -32.732 0.706   1.00 110.36 ? 731  SER A OG  1 
ATOM 4763  N N   . TYR A 1 665  ? 241.603 -30.976 -1.202  1.00 104.92 ? 732  TYR A N   1 
ATOM 4764  C CA  . TYR A 1 665  ? 242.869 -31.218 -1.879  1.00 103.48 ? 732  TYR A CA  1 
ATOM 4765  C C   . TYR A 1 665  ? 242.574 -32.353 -2.859  1.00 101.91 ? 732  TYR A C   1 
ATOM 4766  O O   . TYR A 1 665  ? 243.288 -33.356 -2.892  1.00 101.68 ? 732  TYR A O   1 
ATOM 4767  C CB  . TYR A 1 665  ? 243.888 -31.663 -0.829  1.00 104.25 ? 732  TYR A CB  1 
ATOM 4768  C CG  . TYR A 1 665  ? 244.090 -30.647 0.274   1.00 104.34 ? 732  TYR A CG  1 
ATOM 4769  C CD1 . TYR A 1 665  ? 244.908 -29.556 0.069   1.00 104.13 ? 732  TYR A CD1 1 
ATOM 4770  C CD2 . TYR A 1 665  ? 243.450 -30.767 1.515   1.00 104.32 ? 732  TYR A CD2 1 
ATOM 4771  C CE1 . TYR A 1 665  ? 245.096 -28.621 1.042   1.00 104.43 ? 732  TYR A CE1 1 
ATOM 4772  C CE2 . TYR A 1 665  ? 243.638 -29.802 2.517   1.00 104.33 ? 732  TYR A CE2 1 
ATOM 4773  C CZ  . TYR A 1 665  ? 244.473 -28.727 2.259   1.00 104.24 ? 732  TYR A CZ  1 
ATOM 4774  O OH  . TYR A 1 665  ? 244.702 -27.744 3.190   1.00 102.30 ? 732  TYR A OH  1 
ATOM 4775  N N   . HIS A 1 666  ? 241.513 -32.172 -3.648  1.00 100.30 ? 733  HIS A N   1 
ATOM 4776  C CA  . HIS A 1 666  ? 241.025 -33.185 -4.590  1.00 98.41  ? 733  HIS A CA  1 
ATOM 4777  C C   . HIS A 1 666  ? 241.699 -33.483 -5.921  1.00 97.15  ? 733  HIS A C   1 
ATOM 4778  O O   . HIS A 1 666  ? 241.133 -33.212 -6.984  1.00 96.88  ? 733  HIS A O   1 
ATOM 4779  C CB  . HIS A 1 666  ? 239.545 -32.947 -4.886  1.00 98.60  ? 733  HIS A CB  1 
ATOM 4780  C CG  . HIS A 1 666  ? 238.695 -34.144 -4.620  1.00 97.68  ? 733  HIS A CG  1 
ATOM 4781  N ND1 . HIS A 1 666  ? 239.050 -35.411 -5.026  1.00 97.92  ? 733  HIS A ND1 1 
ATOM 4782  C CD2 . HIS A 1 666  ? 237.533 -34.276 -3.939  1.00 96.88  ? 733  HIS A CD2 1 
ATOM 4783  C CE1 . HIS A 1 666  ? 238.147 -36.275 -4.602  1.00 97.15  ? 733  HIS A CE1 1 
ATOM 4784  N NE2 . HIS A 1 666  ? 237.215 -35.612 -3.939  1.00 96.42  ? 733  HIS A NE2 1 
ATOM 4785  N N   . HIS A 1 667  ? 242.880 -34.087 -5.871  1.00 95.54  ? 734  HIS A N   1 
ATOM 4786  C CA  . HIS A 1 667  ? 243.579 -34.455 -7.094  1.00 92.90  ? 734  HIS A CA  1 
ATOM 4787  C C   . HIS A 1 667  ? 242.500 -35.230 -7.835  1.00 91.16  ? 734  HIS A C   1 
ATOM 4788  O O   . HIS A 1 667  ? 242.411 -35.219 -9.057  1.00 89.24  ? 734  HIS A O   1 
ATOM 4789  C CB  . HIS A 1 667  ? 244.740 -35.414 -6.776  1.00 93.35  ? 734  HIS A CB  1 
ATOM 4790  C CG  . HIS A 1 667  ? 245.424 -35.160 -5.458  1.00 93.45  ? 734  HIS A CG  1 
ATOM 4791  N ND1 . HIS A 1 667  ? 244.740 -34.975 -4.272  1.00 93.31  ? 734  HIS A ND1 1 
ATOM 4792  C CD2 . HIS A 1 667  ? 246.739 -35.133 -5.132  1.00 94.03  ? 734  HIS A CD2 1 
ATOM 4793  C CE1 . HIS A 1 667  ? 245.602 -34.846 -3.277  1.00 93.35  ? 734  HIS A CE1 1 
ATOM 4794  N NE2 . HIS A 1 667  ? 246.822 -34.940 -3.772  1.00 93.18  ? 734  HIS A NE2 1 
ATOM 4795  N N   . GLY A 1 668  ? 241.657 -35.843 -7.011  1.00 90.55  ? 735  GLY A N   1 
ATOM 4796  C CA  . GLY A 1 668  ? 240.582 -36.714 -7.426  1.00 89.13  ? 735  GLY A CA  1 
ATOM 4797  C C   . GLY A 1 668  ? 239.337 -36.440 -8.231  1.00 88.24  ? 735  GLY A C   1 
ATOM 4798  O O   . GLY A 1 668  ? 239.383 -35.875 -9.321  1.00 87.61  ? 735  GLY A O   1 
ATOM 4799  N N   . ASN A 1 669  ? 238.219 -36.903 -7.662  1.00 87.52  ? 736  ASN A N   1 
ATOM 4800  C CA  . ASN A 1 669  ? 236.901 -36.883 -8.299  1.00 87.49  ? 736  ASN A CA  1 
ATOM 4801  C C   . ASN A 1 669  ? 235.753 -36.949 -7.251  1.00 86.95  ? 736  ASN A C   1 
ATOM 4802  O O   . ASN A 1 669  ? 236.016 -37.239 -6.087  1.00 87.07  ? 736  ASN A O   1 
ATOM 4803  C CB  . ASN A 1 669  ? 236.911 -38.086 -9.226  1.00 88.92  ? 736  ASN A CB  1 
ATOM 4804  C CG  . ASN A 1 669  ? 238.341 -38.497 -9.585  1.00 90.37  ? 736  ASN A CG  1 
ATOM 4805  O OD1 . ASN A 1 669  ? 238.867 -38.137 -10.639 1.00 91.29  ? 736  ASN A OD1 1 
ATOM 4806  N ND2 . ASN A 1 669  ? 238.996 -39.200 -8.668  1.00 91.56  ? 736  ASN A ND2 1 
ATOM 4807  N N   . GLY A 1 670  ? 234.496 -36.721 -7.657  1.00 85.66  ? 737  GLY A N   1 
ATOM 4808  C CA  . GLY A 1 670  ? 233.392 -36.690 -6.693  1.00 83.65  ? 737  GLY A CA  1 
ATOM 4809  C C   . GLY A 1 670  ? 232.354 -37.780 -6.450  1.00 82.24  ? 737  GLY A C   1 
ATOM 4810  O O   . GLY A 1 670  ? 231.228 -37.452 -6.105  1.00 82.21  ? 737  GLY A O   1 
ATOM 4811  N N   . PRO A 1 671  ? 232.699 -39.068 -6.537  1.00 81.08  ? 738  PRO A N   1 
ATOM 4812  C CA  . PRO A 1 671  ? 231.714 -40.116 -6.308  1.00 80.33  ? 738  PRO A CA  1 
ATOM 4813  C C   . PRO A 1 671  ? 230.251 -39.735 -6.279  1.00 79.61  ? 738  PRO A C   1 
ATOM 4814  O O   . PRO A 1 671  ? 229.625 -39.674 -5.222  1.00 78.04  ? 738  PRO A O   1 
ATOM 4815  C CB  . PRO A 1 671  ? 232.190 -40.718 -5.000  1.00 81.04  ? 738  PRO A CB  1 
ATOM 4816  C CG  . PRO A 1 671  ? 233.651 -40.815 -5.254  1.00 81.44  ? 738  PRO A CG  1 
ATOM 4817  C CD  . PRO A 1 671  ? 234.014 -39.565 -6.109  1.00 81.36  ? 738  PRO A CD  1 
ATOM 4818  N N   . TYR A 1 672  ? 229.715 -39.446 -7.450  1.00 80.79  ? 739  TYR A N   1 
ATOM 4819  C CA  . TYR A 1 672  ? 228.304 -39.163 -7.543  1.00 83.48  ? 739  TYR A CA  1 
ATOM 4820  C C   . TYR A 1 672  ? 227.712 -38.084 -6.720  1.00 84.49  ? 739  TYR A C   1 
ATOM 4821  O O   . TYR A 1 672  ? 228.399 -37.236 -6.143  1.00 83.99  ? 739  TYR A O   1 
ATOM 4822  C CB  . TYR A 1 672  ? 227.506 -40.413 -7.224  1.00 85.49  ? 739  TYR A CB  1 
ATOM 4823  C CG  . TYR A 1 672  ? 227.509 -41.399 -8.345  1.00 87.99  ? 739  TYR A CG  1 
ATOM 4824  C CD1 . TYR A 1 672  ? 228.409 -41.262 -9.408  1.00 88.19  ? 739  TYR A CD1 1 
ATOM 4825  C CD2 . TYR A 1 672  ? 226.611 -42.466 -8.362  1.00 88.85  ? 739  TYR A CD2 1 
ATOM 4826  C CE1 . TYR A 1 672  ? 228.414 -42.161 -10.462 1.00 88.23  ? 739  TYR A CE1 1 
ATOM 4827  C CE2 . TYR A 1 672  ? 226.605 -43.374 -9.414  1.00 89.12  ? 739  TYR A CE2 1 
ATOM 4828  C CZ  . TYR A 1 672  ? 227.507 -43.210 -10.460 1.00 88.64  ? 739  TYR A CZ  1 
ATOM 4829  O OH  . TYR A 1 672  ? 227.476 -44.066 -11.524 1.00 87.50  ? 739  TYR A OH  1 
ATOM 4830  N N   . ASN A 1 673  ? 226.383 -38.173 -6.685  1.00 86.39  ? 740  ASN A N   1 
ATOM 4831  C CA  . ASN A 1 673  ? 225.544 -37.234 -5.989  1.00 88.82  ? 740  ASN A CA  1 
ATOM 4832  C C   . ASN A 1 673  ? 225.707 -36.081 -6.933  1.00 90.53  ? 740  ASN A C   1 
ATOM 4833  O O   . ASN A 1 673  ? 224.759 -35.516 -7.478  1.00 91.95  ? 740  ASN A O   1 
ATOM 4834  C CB  . ASN A 1 673  ? 226.172 -36.941 -4.648  1.00 88.33  ? 740  ASN A CB  1 
ATOM 4835  C CG  . ASN A 1 673  ? 225.376 -35.995 -3.871  1.00 88.59  ? 740  ASN A CG  1 
ATOM 4836  O OD1 . ASN A 1 673  ? 224.252 -35.653 -4.272  1.00 88.73  ? 740  ASN A OD1 1 
ATOM 4837  N ND2 . ASN A 1 673  ? 225.925 -35.550 -2.738  1.00 88.18  ? 740  ASN A ND2 1 
ATOM 4838  N N   . ASP A 1 674  ? 226.981 -35.780 -7.098  1.00 92.04  ? 741  ASP A N   1 
ATOM 4839  C CA  . ASP A 1 674  ? 227.489 -34.804 -8.010  1.00 92.92  ? 741  ASP A CA  1 
ATOM 4840  C C   . ASP A 1 674  ? 227.607 -35.847 -9.089  1.00 93.22  ? 741  ASP A C   1 
ATOM 4841  O O   . ASP A 1 674  ? 227.382 -37.007 -8.825  1.00 93.61  ? 741  ASP A O   1 
ATOM 4842  C CB  . ASP A 1 674  ? 228.907 -34.466 -7.650  1.00 93.32  ? 741  ASP A CB  1 
ATOM 4843  C CG  . ASP A 1 674  ? 229.878 -35.414 -8.317  1.00 95.05  ? 741  ASP A CG  1 
ATOM 4844  O OD1 . ASP A 1 674  ? 230.113 -35.233 -9.524  1.00 95.95  ? 741  ASP A OD1 1 
ATOM 4845  O OD2 . ASP A 1 674  ? 230.372 -36.357 -7.678  1.00 96.39  ? 741  ASP A OD2 1 
ATOM 4846  N N   . VAL A 1 675  ? 228.006 -35.473 -10.283 1.00 92.78  ? 742  VAL A N   1 
ATOM 4847  C CA  . VAL A 1 675  ? 228.171 -36.477 -11.314 1.00 91.85  ? 742  VAL A CA  1 
ATOM 4848  C C   . VAL A 1 675  ? 226.881 -36.822 -11.999 1.00 91.65  ? 742  VAL A C   1 
ATOM 4849  O O   . VAL A 1 675  ? 226.091 -37.641 -11.524 1.00 92.12  ? 742  VAL A O   1 
ATOM 4850  C CB  . VAL A 1 675  ? 228.739 -37.801 -10.766 1.00 91.72  ? 742  VAL A CB  1 
ATOM 4851  C CG1 . VAL A 1 675  ? 228.576 -38.884 -11.799 1.00 91.54  ? 742  VAL A CG1 1 
ATOM 4852  C CG2 . VAL A 1 675  ? 230.180 -37.649 -10.409 1.00 90.27  ? 742  VAL A CG2 1 
ATOM 4853  N N   . ASP A 1 676  ? 226.677 -36.200 -13.140 1.00 91.98  ? 743  ASP A N   1 
ATOM 4854  C CA  . ASP A 1 676  ? 225.495 -36.476 -13.893 1.00 92.13  ? 743  ASP A CA  1 
ATOM 4855  C C   . ASP A 1 676  ? 225.830 -36.463 -15.373 1.00 92.01  ? 743  ASP A C   1 
ATOM 4856  O O   . ASP A 1 676  ? 226.856 -35.925 -15.809 1.00 91.75  ? 743  ASP A O   1 
ATOM 4857  C CB  . ASP A 1 676  ? 224.406 -35.451 -13.563 1.00 91.73  ? 743  ASP A CB  1 
ATOM 4858  C CG  . ASP A 1 676  ? 224.042 -35.441 -12.091 1.00 91.73  ? 743  ASP A CG  1 
ATOM 4859  O OD1 . ASP A 1 676  ? 223.791 -36.532 -11.538 1.00 90.45  ? 743  ASP A OD1 1 
ATOM 4860  O OD2 . ASP A 1 676  ? 224.000 -34.342 -11.495 1.00 92.40  ? 743  ASP A OD2 1 
ATOM 4861  N N   . ILE A 1 677  ? 224.938 -37.087 -16.124 1.00 92.04  ? 744  ILE A N   1 
ATOM 4862  C CA  . ILE A 1 677  ? 224.996 -37.202 -17.562 1.00 91.21  ? 744  ILE A CA  1 
ATOM 4863  C C   . ILE A 1 677  ? 226.255 -37.758 -18.300 1.00 91.19  ? 744  ILE A C   1 
ATOM 4864  O O   . ILE A 1 677  ? 226.770 -38.818 -17.928 1.00 91.84  ? 744  ILE A O   1 
ATOM 4865  C CB  . ILE A 1 677  ? 224.424 -35.878 -18.215 1.00 89.88  ? 744  ILE A CB  1 
ATOM 4866  C CG1 . ILE A 1 677  ? 225.134 -34.608 -17.712 1.00 89.28  ? 744  ILE A CG1 1 
ATOM 4867  C CG2 . ILE A 1 677  ? 222.953 -35.771 -17.897 1.00 89.12  ? 744  ILE A CG2 1 
ATOM 4868  C CD1 . ILE A 1 677  ? 224.697 -34.093 -16.393 1.00 91.71  ? 744  ILE A CD1 1 
ATOM 4869  N N   . PRO A 1 678  ? 226.797 -37.045 -19.304 1.00 90.26  ? 745  PRO A N   1 
ATOM 4870  C CA  . PRO A 1 678  ? 227.938 -37.605 -20.008 1.00 89.62  ? 745  PRO A CA  1 
ATOM 4871  C C   . PRO A 1 678  ? 229.329 -37.389 -19.504 1.00 89.47  ? 745  PRO A C   1 
ATOM 4872  O O   . PRO A 1 678  ? 230.197 -38.180 -19.791 1.00 88.94  ? 745  PRO A O   1 
ATOM 4873  C CB  . PRO A 1 678  ? 227.782 -36.996 -21.384 1.00 89.25  ? 745  PRO A CB  1 
ATOM 4874  C CG  . PRO A 1 678  ? 227.139 -35.643 -21.074 1.00 90.48  ? 745  PRO A CG  1 
ATOM 4875  C CD  . PRO A 1 678  ? 226.746 -35.622 -19.644 1.00 90.38  ? 745  PRO A CD  1 
ATOM 4876  N N   . GLY A 1 679  ? 229.581 -36.312 -18.793 1.00 90.03  ? 746  GLY A N   1 
ATOM 4877  C CA  . GLY A 1 679  ? 230.947 -36.131 -18.370 1.00 92.85  ? 746  GLY A CA  1 
ATOM 4878  C C   . GLY A 1 679  ? 231.182 -36.065 -16.885 1.00 94.36  ? 746  GLY A C   1 
ATOM 4879  O O   . GLY A 1 679  ? 230.313 -35.608 -16.149 1.00 94.15  ? 746  GLY A O   1 
ATOM 4880  N N   . CYS A 1 680  ? 232.359 -36.528 -16.455 1.00 95.66  ? 747  CYS A N   1 
ATOM 4881  C CA  . CYS A 1 680  ? 232.775 -36.509 -15.040 1.00 96.46  ? 747  CYS A CA  1 
ATOM 4882  C C   . CYS A 1 680  ? 233.562 -35.216 -14.789 1.00 99.24  ? 747  CYS A C   1 
ATOM 4883  O O   . CYS A 1 680  ? 234.157 -34.671 -15.720 1.00 99.34  ? 747  CYS A O   1 
ATOM 4884  C CB  . CYS A 1 680  ? 233.751 -37.661 -14.717 1.00 93.40  ? 747  CYS A CB  1 
ATOM 4885  S SG  . CYS A 1 680  ? 233.225 -39.388 -14.920 1.00 88.11  ? 747  CYS A SG  1 
ATOM 4886  N N   . TRP A 1 681  ? 233.565 -34.705 -13.557 1.00 102.65 ? 748  TRP A N   1 
ATOM 4887  C CA  . TRP A 1 681  ? 234.398 -33.531 -13.281 1.00 105.55 ? 748  TRP A CA  1 
ATOM 4888  C C   . TRP A 1 681  ? 235.248 -33.626 -12.048 1.00 106.42 ? 748  TRP A C   1 
ATOM 4889  O O   . TRP A 1 681  ? 234.871 -34.220 -11.042 1.00 105.78 ? 748  TRP A O   1 
ATOM 4890  C CB  . TRP A 1 681  ? 233.651 -32.181 -13.257 1.00 107.11 ? 748  TRP A CB  1 
ATOM 4891  C CG  . TRP A 1 681  ? 232.310 -32.024 -12.623 1.00 108.81 ? 748  TRP A CG  1 
ATOM 4892  C CD1 . TRP A 1 681  ? 231.154 -32.674 -12.972 1.00 109.35 ? 748  TRP A CD1 1 
ATOM 4893  C CD2 . TRP A 1 681  ? 231.922 -30.987 -11.700 1.00 109.75 ? 748  TRP A CD2 1 
ATOM 4894  N NE1 . TRP A 1 681  ? 230.073 -32.097 -12.341 1.00 110.31 ? 748  TRP A NE1 1 
ATOM 4895  C CE2 . TRP A 1 681  ? 230.515 -31.062 -11.554 1.00 110.20 ? 748  TRP A CE2 1 
ATOM 4896  C CE3 . TRP A 1 681  ? 232.625 -30.000 -10.987 1.00 110.65 ? 748  TRP A CE3 1 
ATOM 4897  C CZ2 . TRP A 1 681  ? 229.795 -30.176 -10.725 1.00 110.84 ? 748  TRP A CZ2 1 
ATOM 4898  C CZ3 . TRP A 1 681  ? 231.905 -29.118 -10.160 1.00 110.68 ? 748  TRP A CZ3 1 
ATOM 4899  C CH2 . TRP A 1 681  ? 230.507 -29.217 -10.039 1.00 110.43 ? 748  TRP A CH2 1 
ATOM 4900  N N   . PHE A 1 682  ? 236.427 -33.041 -12.161 1.00 107.82 ? 749  PHE A N   1 
ATOM 4901  C CA  . PHE A 1 682  ? 237.379 -33.040 -11.080 1.00 109.23 ? 749  PHE A CA  1 
ATOM 4902  C C   . PHE A 1 682  ? 237.193 -31.722 -10.349 1.00 108.64 ? 749  PHE A C   1 
ATOM 4903  O O   . PHE A 1 682  ? 237.368 -30.641 -10.910 1.00 107.40 ? 749  PHE A O   1 
ATOM 4904  C CB  . PHE A 1 682  ? 238.802 -33.186 -11.643 1.00 111.26 ? 749  PHE A CB  1 
ATOM 4905  C CG  . PHE A 1 682  ? 239.011 -34.437 -12.471 1.00 112.94 ? 749  PHE A CG  1 
ATOM 4906  C CD1 . PHE A 1 682  ? 237.944 -35.270 -12.789 1.00 113.42 ? 749  PHE A CD1 1 
ATOM 4907  C CD2 . PHE A 1 682  ? 240.272 -34.776 -12.934 1.00 113.39 ? 749  PHE A CD2 1 
ATOM 4908  C CE1 . PHE A 1 682  ? 238.134 -36.413 -13.551 1.00 113.64 ? 749  PHE A CE1 1 
ATOM 4909  C CE2 . PHE A 1 682  ? 240.465 -35.920 -13.697 1.00 113.66 ? 749  PHE A CE2 1 
ATOM 4910  C CZ  . PHE A 1 682  ? 239.397 -36.737 -14.004 1.00 113.74 ? 749  PHE A CZ  1 
ATOM 4911  N N   . PHE A 1 683  ? 236.794 -31.829 -9.096  1.00 108.65 ? 750  PHE A N   1 
ATOM 4912  C CA  . PHE A 1 683  ? 236.566 -30.670 -8.271  1.00 108.19 ? 750  PHE A CA  1 
ATOM 4913  C C   . PHE A 1 683  ? 237.922 -30.083 -8.037  1.00 107.52 ? 750  PHE A C   1 
ATOM 4914  O O   . PHE A 1 683  ? 238.670 -30.439 -7.132  1.00 107.08 ? 750  PHE A O   1 
ATOM 4915  C CB  . PHE A 1 683  ? 235.824 -31.130 -7.035  1.00 109.50 ? 750  PHE A CB  1 
ATOM 4916  C CG  . PHE A 1 683  ? 234.664 -31.991 -7.396  1.00 110.89 ? 750  PHE A CG  1 
ATOM 4917  C CD1 . PHE A 1 683  ? 234.886 -33.295 -7.849  1.00 110.91 ? 750  PHE A CD1 1 
ATOM 4918  C CD2 . PHE A 1 683  ? 233.385 -31.448 -7.512  1.00 111.90 ? 750  PHE A CD2 1 
ATOM 4919  C CE1 . PHE A 1 683  ? 233.870 -34.039 -8.425  1.00 111.49 ? 750  PHE A CE1 1 
ATOM 4920  C CE2 . PHE A 1 683  ? 232.355 -32.188 -8.090  1.00 111.99 ? 750  PHE A CE2 1 
ATOM 4921  C CZ  . PHE A 1 683  ? 232.604 -33.491 -8.553  1.00 111.31 ? 750  PHE A CZ  1 
ATOM 4922  N N   . LYS A 1 684  ? 238.213 -29.197 -8.967  1.00 107.35 ? 751  LYS A N   1 
ATOM 4923  C CA  . LYS A 1 684  ? 239.443 -28.472 -9.093  1.00 106.98 ? 751  LYS A CA  1 
ATOM 4924  C C   . LYS A 1 684  ? 240.205 -28.008 -7.874  1.00 106.69 ? 751  LYS A C   1 
ATOM 4925  O O   . LYS A 1 684  ? 239.680 -27.390 -6.946  1.00 106.63 ? 751  LYS A O   1 
ATOM 4926  C CB  . LYS A 1 684  ? 239.184 -27.306 -10.017 1.00 107.62 ? 751  LYS A CB  1 
ATOM 4927  C CG  . LYS A 1 684  ? 240.314 -26.338 -10.159 1.00 108.50 ? 751  LYS A CG  1 
ATOM 4928  C CD  . LYS A 1 684  ? 239.808 -25.169 -10.956 1.00 110.24 ? 751  LYS A CD  1 
ATOM 4929  C CE  . LYS A 1 684  ? 238.456 -24.705 -10.401 1.00 111.93 ? 751  LYS A CE  1 
ATOM 4930  N NZ  . LYS A 1 684  ? 237.786 -23.710 -11.274 1.00 112.86 ? 751  LYS A NZ  1 
ATOM 4931  N N   . LEU A 1 685  ? 241.487 -28.315 -7.933  1.00 106.20 ? 752  LEU A N   1 
ATOM 4932  C CA  . LEU A 1 685  ? 242.432 -27.969 -6.909  1.00 105.70 ? 752  LEU A CA  1 
ATOM 4933  C C   . LEU A 1 685  ? 243.056 -26.650 -7.265  1.00 105.01 ? 752  LEU A C   1 
ATOM 4934  O O   . LEU A 1 685  ? 242.856 -26.125 -8.357  1.00 104.43 ? 752  LEU A O   1 
ATOM 4935  C CB  . LEU A 1 685  ? 243.548 -28.984 -6.889  1.00 106.03 ? 752  LEU A CB  1 
ATOM 4936  C CG  . LEU A 1 685  ? 243.397 -30.284 -6.146  1.00 106.04 ? 752  LEU A CG  1 
ATOM 4937  C CD1 . LEU A 1 685  ? 243.885 -31.367 -7.068  1.00 106.54 ? 752  LEU A CD1 1 
ATOM 4938  C CD2 . LEU A 1 685  ? 244.198 -30.251 -4.852  1.00 106.06 ? 752  LEU A CD2 1 
ATOM 4939  N N   . PRO A 1 686  ? 243.844 -26.103 -6.341  1.00 104.46 ? 753  PRO A N   1 
ATOM 4940  C CA  . PRO A 1 686  ? 244.062 -26.763 -5.044  1.00 103.60 ? 753  PRO A CA  1 
ATOM 4941  C C   . PRO A 1 686  ? 243.529 -25.860 -3.939  1.00 103.02 ? 753  PRO A C   1 
ATOM 4942  O O   . PRO A 1 686  ? 242.840 -24.879 -4.221  1.00 102.96 ? 753  PRO A O   1 
ATOM 4943  C CB  . PRO A 1 686  ? 245.587 -26.924 -4.986  1.00 102.87 ? 753  PRO A CB  1 
ATOM 4944  C CG  . PRO A 1 686  ? 246.073 -26.602 -6.420  1.00 103.42 ? 753  PRO A CG  1 
ATOM 4945  C CD  . PRO A 1 686  ? 245.110 -25.536 -6.828  1.00 104.38 ? 753  PRO A CD  1 
ATOM 4946  N N   . HIS A 1 687  ? 243.823 -26.163 -2.682  1.00 102.22 ? 754  HIS A N   1 
ATOM 4947  C CA  . HIS A 1 687  ? 243.343 -25.257 -1.655  1.00 100.89 ? 754  HIS A CA  1 
ATOM 4948  C C   . HIS A 1 687  ? 244.078 -25.210 -0.319  1.00 98.85  ? 754  HIS A C   1 
ATOM 4949  O O   . HIS A 1 687  ? 243.614 -24.565 0.619   1.00 98.13  ? 754  HIS A O   1 
ATOM 4950  C CB  . HIS A 1 687  ? 241.848 -25.462 -1.439  1.00 102.76 ? 754  HIS A CB  1 
ATOM 4951  C CG  . HIS A 1 687  ? 241.103 -24.175 -1.353  1.00 104.16 ? 754  HIS A CG  1 
ATOM 4952  N ND1 . HIS A 1 687  ? 239.773 -24.052 -1.689  1.00 105.15 ? 754  HIS A ND1 1 
ATOM 4953  C CD2 . HIS A 1 687  ? 241.518 -22.940 -0.986  1.00 104.42 ? 754  HIS A CD2 1 
ATOM 4954  C CE1 . HIS A 1 687  ? 239.402 -22.794 -1.531  1.00 106.30 ? 754  HIS A CE1 1 
ATOM 4955  N NE2 . HIS A 1 687  ? 240.442 -22.099 -1.107  1.00 105.79 ? 754  HIS A NE2 1 
ATOM 4956  N N   . LYS A 1 688  ? 245.236 -25.864 -0.253  1.00 97.04  ? 755  LYS A N   1 
ATOM 4957  C CA  . LYS A 1 688  ? 246.060 -25.909 0.959   1.00 96.34  ? 755  LYS A CA  1 
ATOM 4958  C C   . LYS A 1 688  ? 246.529 -24.519 1.346   1.00 96.49  ? 755  LYS A C   1 
ATOM 4959  O O   . LYS A 1 688  ? 246.427 -24.088 2.499   1.00 96.17  ? 755  LYS A O   1 
ATOM 4960  C CB  . LYS A 1 688  ? 247.296 -26.800 0.725   1.00 95.66  ? 755  LYS A CB  1 
ATOM 4961  C CG  . LYS A 1 688  ? 247.298 -27.551 -0.610  1.00 94.44  ? 755  LYS A CG  1 
ATOM 4962  C CD  . LYS A 1 688  ? 248.260 -28.715 -0.578  1.00 93.77  ? 755  LYS A CD  1 
ATOM 4963  C CE  . LYS A 1 688  ? 247.914 -29.788 -1.594  1.00 93.05  ? 755  LYS A CE  1 
ATOM 4964  N NZ  . LYS A 1 688  ? 246.920 -30.772 -1.080  1.00 90.54  ? 755  LYS A NZ  1 
ATOM 4965  N N   . ASP A 1 689  ? 247.068 -23.838 0.347   1.00 97.32  ? 756  ASP A N   1 
ATOM 4966  C CA  . ASP A 1 689  ? 247.597 -22.500 0.488   1.00 98.79  ? 756  ASP A CA  1 
ATOM 4967  C C   . ASP A 1 689  ? 246.429 -21.610 0.854   1.00 99.22  ? 756  ASP A C   1 
ATOM 4968  O O   . ASP A 1 689  ? 246.590 -20.592 1.520   1.00 99.95  ? 756  ASP A O   1 
ATOM 4969  C CB  . ASP A 1 689  ? 248.242 -22.127 -0.835  1.00 98.75  ? 756  ASP A CB  1 
ATOM 4970  C CG  . ASP A 1 689  ? 249.146 -23.244 -1.356  1.00 98.95  ? 756  ASP A CG  1 
ATOM 4971  O OD1 . ASP A 1 689  ? 248.658 -24.385 -1.467  1.00 99.11  ? 756  ASP A OD1 1 
ATOM 4972  O OD2 . ASP A 1 689  ? 250.338 -23.007 -1.643  1.00 99.77  ? 756  ASP A OD2 1 
ATOM 4973  N N   . GLY A 1 690  ? 245.244 -22.012 0.409   1.00 99.00  ? 757  GLY A N   1 
ATOM 4974  C CA  . GLY A 1 690  ? 244.049 -21.277 0.762   1.00 97.72  ? 757  GLY A CA  1 
ATOM 4975  C C   . GLY A 1 690  ? 243.843 -21.768 2.177   1.00 96.73  ? 757  GLY A C   1 
ATOM 4976  O O   . GLY A 1 690  ? 243.528 -20.999 3.082   1.00 95.77  ? 757  GLY A O   1 
ATOM 4977  N N   . ASN A 1 691  ? 244.046 -23.075 2.341   1.00 96.96  ? 758  ASN A N   1 
ATOM 4978  C CA  . ASN A 1 691  ? 243.950 -23.779 3.618   1.00 97.27  ? 758  ASN A CA  1 
ATOM 4979  C C   . ASN A 1 691  ? 242.643 -24.490 3.985   1.00 96.97  ? 758  ASN A C   1 
ATOM 4980  O O   . ASN A 1 691  ? 242.618 -25.720 4.061   1.00 96.42  ? 758  ASN A O   1 
ATOM 4981  C CB  . ASN A 1 691  ? 244.330 -22.836 4.776   1.00 97.85  ? 758  ASN A CB  1 
ATOM 4982  C CG  . ASN A 1 691  ? 244.731 -23.576 6.063   1.00 98.82  ? 758  ASN A CG  1 
ATOM 4983  O OD1 . ASN A 1 691  ? 245.877 -23.480 6.517   1.00 99.47  ? 758  ASN A OD1 1 
ATOM 4984  N ND2 . ASN A 1 691  ? 243.784 -24.300 6.658   1.00 99.09  ? 758  ASN A ND2 1 
ATOM 4985  N N   . SER A 1 692  ? 241.552 -23.744 4.174   1.00 96.51  ? 759  SER A N   1 
ATOM 4986  C CA  . SER A 1 692  ? 240.323 -24.365 4.671   1.00 95.49  ? 759  SER A CA  1 
ATOM 4987  C C   . SER A 1 692  ? 239.039 -24.727 3.918   1.00 95.63  ? 759  SER A C   1 
ATOM 4988  O O   . SER A 1 692  ? 238.307 -25.584 4.407   1.00 95.92  ? 759  SER A O   1 
ATOM 4989  C CB  . SER A 1 692  ? 239.900 -23.609 5.932   1.00 94.51  ? 759  SER A CB  1 
ATOM 4990  O OG  . SER A 1 692  ? 238.896 -24.324 6.629   1.00 94.35  ? 759  SER A OG  1 
ATOM 4991  N N   . CYS A 1 693  ? 238.717 -24.133 2.773   1.00 95.47  ? 760  CYS A N   1 
ATOM 4992  C CA  . CYS A 1 693  ? 237.445 -24.518 2.150   1.00 95.05  ? 760  CYS A CA  1 
ATOM 4993  C C   . CYS A 1 693  ? 237.442 -24.860 0.663   1.00 94.10  ? 760  CYS A C   1 
ATOM 4994  O O   . CYS A 1 693  ? 238.492 -25.056 0.057   1.00 93.19  ? 760  CYS A O   1 
ATOM 4995  C CB  . CYS A 1 693  ? 236.383 -23.439 2.421   1.00 96.18  ? 760  CYS A CB  1 
ATOM 4996  S SG  . CYS A 1 693  ? 236.257 -22.063 1.222   1.00 97.41  ? 760  CYS A SG  1 
ATOM 4997  N N   . ASN A 1 694  ? 236.241 -24.949 0.093   1.00 93.33  ? 761  ASN A N   1 
ATOM 4998  C CA  . ASN A 1 694  ? 236.048 -25.262 -1.324  1.00 92.92  ? 761  ASN A CA  1 
ATOM 4999  C C   . ASN A 1 694  ? 236.515 -24.098 -2.168  1.00 92.39  ? 761  ASN A C   1 
ATOM 5000  O O   . ASN A 1 694  ? 236.244 -22.943 -1.834  1.00 93.76  ? 761  ASN A O   1 
ATOM 5001  C CB  . ASN A 1 694  ? 234.576 -25.510 -1.597  1.00 93.20  ? 761  ASN A CB  1 
ATOM 5002  C CG  . ASN A 1 694  ? 234.003 -26.551 -0.686  1.00 93.70  ? 761  ASN A CG  1 
ATOM 5003  O OD1 . ASN A 1 694  ? 234.390 -26.642 0.482   1.00 94.47  ? 761  ASN A OD1 1 
ATOM 5004  N ND2 . ASN A 1 694  ? 233.068 -27.342 -1.198  1.00 92.70  ? 761  ASN A ND2 1 
ATOM 5005  N N   . VAL A 1 695  ? 237.207 -24.408 -3.260  1.00 89.93  ? 762  VAL A N   1 
ATOM 5006  C CA  . VAL A 1 695  ? 237.735 -23.392 -4.164  1.00 87.67  ? 762  VAL A CA  1 
ATOM 5007  C C   . VAL A 1 695  ? 236.979 -22.069 -4.118  1.00 85.40  ? 762  VAL A C   1 
ATOM 5008  O O   . VAL A 1 695  ? 237.587 -21.006 -4.022  1.00 84.51  ? 762  VAL A O   1 
ATOM 5009  C CB  . VAL A 1 695  ? 237.749 -23.911 -5.575  1.00 88.48  ? 762  VAL A CB  1 
ATOM 5010  C CG1 . VAL A 1 695  ? 238.781 -24.988 -5.693  1.00 89.06  ? 762  VAL A CG1 1 
ATOM 5011  C CG2 . VAL A 1 695  ? 236.419 -24.475 -5.907  1.00 89.32  ? 762  VAL A CG2 1 
ATOM 5012  N N   . GLY A 1 696  ? 235.658 -22.131 -4.193  1.00 83.49  ? 763  GLY A N   1 
ATOM 5013  C CA  . GLY A 1 696  ? 234.867 -20.922 -4.111  1.00 80.21  ? 763  GLY A CA  1 
ATOM 5014  C C   . GLY A 1 696  ? 235.130 -19.827 -5.120  1.00 78.14  ? 763  GLY A C   1 
ATOM 5015  O O   . GLY A 1 696  ? 234.190 -19.213 -5.581  1.00 77.60  ? 763  GLY A O   1 
ATOM 5016  N N   . SER A 1 697  ? 236.378 -19.536 -5.449  1.00 75.90  ? 764  SER A N   1 
ATOM 5017  C CA  . SER A 1 697  ? 236.626 -18.489 -6.426  1.00 72.58  ? 764  SER A CA  1 
ATOM 5018  C C   . SER A 1 697  ? 237.549 -18.974 -7.514  1.00 70.62  ? 764  SER A C   1 
ATOM 5019  O O   . SER A 1 697  ? 238.558 -19.620 -7.256  1.00 69.86  ? 764  SER A O   1 
ATOM 5020  C CB  . SER A 1 697  ? 237.201 -17.233 -5.763  1.00 71.83  ? 764  SER A CB  1 
ATOM 5021  O OG  . SER A 1 697  ? 238.190 -17.562 -4.810  1.00 70.36  ? 764  SER A OG  1 
ATOM 5022  N N   . PRO A 1 698  ? 237.196 -18.680 -8.762  1.00 68.38  ? 765  PRO A N   1 
ATOM 5023  C CA  . PRO A 1 698  ? 237.984 -19.078 -9.922  1.00 66.21  ? 765  PRO A CA  1 
ATOM 5024  C C   . PRO A 1 698  ? 239.192 -18.175 -9.996  1.00 64.55  ? 765  PRO A C   1 
ATOM 5025  O O   . PRO A 1 698  ? 240.304 -18.603 -10.280 1.00 63.07  ? 765  PRO A O   1 
ATOM 5026  C CB  . PRO A 1 698  ? 237.023 -18.848 -11.071 1.00 66.52  ? 765  PRO A CB  1 
ATOM 5027  C CG  . PRO A 1 698  ? 236.302 -17.629 -10.622 1.00 68.59  ? 765  PRO A CG  1 
ATOM 5028  C CD  . PRO A 1 698  ? 236.018 -17.899 -9.167  1.00 68.53  ? 765  PRO A CD  1 
ATOM 5029  N N   . PHE A 1 699  ? 238.969 -16.905 -9.725  1.00 64.17  ? 766  PHE A N   1 
ATOM 5030  C CA  . PHE A 1 699  ? 240.062 -15.971 -9.760  1.00 63.97  ? 766  PHE A CA  1 
ATOM 5031  C C   . PHE A 1 699  ? 240.664 -15.940 -8.389  1.00 65.60  ? 766  PHE A C   1 
ATOM 5032  O O   . PHE A 1 699  ? 241.503 -15.095 -8.081  1.00 66.63  ? 766  PHE A O   1 
ATOM 5033  C CB  . PHE A 1 699  ? 239.549 -14.608 -10.160 1.00 60.39  ? 766  PHE A CB  1 
ATOM 5034  C CG  . PHE A 1 699  ? 238.649 -14.659 -11.344 1.00 57.04  ? 766  PHE A CG  1 
ATOM 5035  C CD1 . PHE A 1 699  ? 237.274 -14.694 -11.181 1.00 53.90  ? 766  PHE A CD1 1 
ATOM 5036  C CD2 . PHE A 1 699  ? 239.174 -14.732 -12.629 1.00 56.59  ? 766  PHE A CD2 1 
ATOM 5037  C CE1 . PHE A 1 699  ? 236.432 -14.805 -12.277 1.00 51.32  ? 766  PHE A CE1 1 
ATOM 5038  C CE2 . PHE A 1 699  ? 238.338 -14.846 -13.735 1.00 52.97  ? 766  PHE A CE2 1 
ATOM 5039  C CZ  . PHE A 1 699  ? 236.965 -14.881 -13.554 1.00 50.53  ? 766  PHE A CZ  1 
ATOM 5040  N N   . ALA A 1 700  ? 240.216 -16.879 -7.561  1.00 67.01  ? 767  ALA A N   1 
ATOM 5041  C CA  . ALA A 1 700  ? 240.722 -16.988 -6.207  1.00 67.62  ? 767  ALA A CA  1 
ATOM 5042  C C   . ALA A 1 700  ? 242.159 -16.580 -6.311  1.00 68.26  ? 767  ALA A C   1 
ATOM 5043  O O   . ALA A 1 700  ? 242.872 -16.998 -7.223  1.00 67.62  ? 767  ALA A O   1 
ATOM 5044  C CB  . ALA A 1 700  ? 240.636 -18.432 -5.699  1.00 67.97  ? 767  ALA A CB  1 
ATOM 5045  N N   . LYS A 1 701  ? 242.571 -15.720 -5.403  1.00 69.77  ? 768  LYS A N   1 
ATOM 5046  C CA  . LYS A 1 701  ? 243.951 -15.283 -5.372  1.00 72.22  ? 768  LYS A CA  1 
ATOM 5047  C C   . LYS A 1 701  ? 244.741 -16.610 -5.286  1.00 73.78  ? 768  LYS A C   1 
ATOM 5048  O O   . LYS A 1 701  ? 244.233 -17.675 -5.662  1.00 75.05  ? 768  LYS A O   1 
ATOM 5049  C CB  . LYS A 1 701  ? 244.143 -14.413 -4.110  1.00 72.13  ? 768  LYS A CB  1 
ATOM 5050  C CG  . LYS A 1 701  ? 245.494 -13.717 -3.931  1.00 71.57  ? 768  LYS A CG  1 
ATOM 5051  C CD  . LYS A 1 701  ? 245.572 -12.991 -2.572  1.00 71.15  ? 768  LYS A CD  1 
ATOM 5052  C CE  . LYS A 1 701  ? 244.491 -11.897 -2.415  1.00 70.90  ? 768  LYS A CE  1 
ATOM 5053  N NZ  . LYS A 1 701  ? 244.646 -11.060 -1.175  1.00 68.55  ? 768  LYS A NZ  1 
ATOM 5054  N N   . ASP A 1 702  ? 245.988 -16.550 -4.833  1.00 74.19  ? 769  ASP A N   1 
ATOM 5055  C CA  . ASP A 1 702  ? 246.778 -17.766 -4.641  1.00 73.71  ? 769  ASP A CA  1 
ATOM 5056  C C   . ASP A 1 702  ? 247.109 -18.653 -5.858  1.00 71.60  ? 769  ASP A C   1 
ATOM 5057  O O   . ASP A 1 702  ? 247.837 -18.241 -6.764  1.00 70.43  ? 769  ASP A O   1 
ATOM 5058  C CB  . ASP A 1 702  ? 246.081 -18.596 -3.559  1.00 76.81  ? 769  ASP A CB  1 
ATOM 5059  C CG  . ASP A 1 702  ? 246.729 -19.929 -3.338  1.00 79.20  ? 769  ASP A CG  1 
ATOM 5060  O OD1 . ASP A 1 702  ? 247.939 -19.966 -3.031  1.00 78.99  ? 769  ASP A OD1 1 
ATOM 5061  O OD2 . ASP A 1 702  ? 246.011 -20.937 -3.472  1.00 80.01  ? 769  ASP A OD2 1 
ATOM 5062  N N   . PHE A 1 703  ? 246.591 -19.879 -5.851  1.00 69.69  ? 770  PHE A N   1 
ATOM 5063  C CA  . PHE A 1 703  ? 246.835 -20.842 -6.919  1.00 67.91  ? 770  PHE A CA  1 
ATOM 5064  C C   . PHE A 1 703  ? 246.463 -20.272 -8.272  1.00 67.09  ? 770  PHE A C   1 
ATOM 5065  O O   . PHE A 1 703  ? 247.285 -20.146 -9.184  1.00 65.56  ? 770  PHE A O   1 
ATOM 5066  C CB  . PHE A 1 703  ? 245.979 -22.092 -6.708  1.00 66.24  ? 770  PHE A CB  1 
ATOM 5067  C CG  . PHE A 1 703  ? 246.374 -22.926 -5.530  1.00 64.72  ? 770  PHE A CG  1 
ATOM 5068  C CD1 . PHE A 1 703  ? 247.606 -23.565 -5.492  1.00 63.88  ? 770  PHE A CD1 1 
ATOM 5069  C CD2 . PHE A 1 703  ? 245.486 -23.128 -4.482  1.00 64.45  ? 770  PHE A CD2 1 
ATOM 5070  C CE1 . PHE A 1 703  ? 247.940 -24.393 -4.430  1.00 63.65  ? 770  PHE A CE1 1 
ATOM 5071  C CE2 . PHE A 1 703  ? 245.816 -23.950 -3.416  1.00 65.04  ? 770  PHE A CE2 1 
ATOM 5072  C CZ  . PHE A 1 703  ? 247.035 -24.583 -3.392  1.00 65.21  ? 770  PHE A CZ  1 
ATOM 5073  N N   . LEU A 1 704  ? 245.180 -19.942 -8.354  1.00 67.10  ? 771  LEU A N   1 
ATOM 5074  C CA  . LEU A 1 704  ? 244.507 -19.431 -9.539  1.00 67.23  ? 771  LEU A CA  1 
ATOM 5075  C C   . LEU A 1 704  ? 245.140 -18.280 -10.300 1.00 66.94  ? 771  LEU A C   1 
ATOM 5076  O O   . LEU A 1 704  ? 245.128 -18.269 -11.532 1.00 67.16  ? 771  LEU A O   1 
ATOM 5077  C CB  . LEU A 1 704  ? 243.060 -19.098 -9.168  1.00 68.22  ? 771  LEU A CB  1 
ATOM 5078  C CG  . LEU A 1 704  ? 242.292 -20.223 -8.442  1.00 68.35  ? 771  LEU A CG  1 
ATOM 5079  C CD1 . LEU A 1 704  ? 242.492 -21.540 -9.183  1.00 69.05  ? 771  LEU A CD1 1 
ATOM 5080  C CD2 . LEU A 1 704  ? 242.780 -20.371 -7.004  1.00 69.74  ? 771  LEU A CD2 1 
ATOM 5081  N N   . PRO A 1 705  ? 245.683 -17.281 -9.595  1.00 66.99  ? 772  PRO A N   1 
ATOM 5082  C CA  . PRO A 1 705  ? 246.283 -16.211 -10.381 1.00 67.00  ? 772  PRO A CA  1 
ATOM 5083  C C   . PRO A 1 705  ? 247.473 -16.834 -11.072 1.00 67.05  ? 772  PRO A C   1 
ATOM 5084  O O   . PRO A 1 705  ? 247.699 -16.638 -12.269 1.00 67.46  ? 772  PRO A O   1 
ATOM 5085  C CB  . PRO A 1 705  ? 246.692 -15.196 -9.324  1.00 67.05  ? 772  PRO A CB  1 
ATOM 5086  C CG  . PRO A 1 705  ? 247.042 -16.050 -8.179  1.00 67.48  ? 772  PRO A CG  1 
ATOM 5087  C CD  . PRO A 1 705  ? 245.910 -17.059 -8.163  1.00 67.25  ? 772  PRO A CD  1 
ATOM 5088  N N   . LYS A 1 706  ? 248.212 -17.625 -10.307 1.00 67.43  ? 773  LYS A N   1 
ATOM 5089  C CA  . LYS A 1 706  ? 249.386 -18.285 -10.834 1.00 69.21  ? 773  LYS A CA  1 
ATOM 5090  C C   . LYS A 1 706  ? 249.067 -18.980 -12.152 1.00 69.78  ? 773  LYS A C   1 
ATOM 5091  O O   . LYS A 1 706  ? 249.868 -18.969 -13.080 1.00 69.01  ? 773  LYS A O   1 
ATOM 5092  C CB  . LYS A 1 706  ? 249.913 -19.274 -9.801  1.00 69.79  ? 773  LYS A CB  1 
ATOM 5093  C CG  . LYS A 1 706  ? 250.080 -18.621 -8.441  1.00 70.81  ? 773  LYS A CG  1 
ATOM 5094  C CD  . LYS A 1 706  ? 250.791 -19.512 -7.442  1.00 71.89  ? 773  LYS A CD  1 
ATOM 5095  C CE  . LYS A 1 706  ? 250.979 -18.801 -6.112  1.00 73.00  ? 773  LYS A CE  1 
ATOM 5096  N NZ  . LYS A 1 706  ? 251.928 -19.544 -5.251  1.00 74.28  ? 773  LYS A NZ  1 
ATOM 5097  N N   . MET A 1 707  ? 247.877 -19.549 -12.261 1.00 71.56  ? 774  MET A N   1 
ATOM 5098  C CA  . MET A 1 707  ? 247.525 -20.245 -13.484 1.00 74.26  ? 774  MET A CA  1 
ATOM 5099  C C   . MET A 1 707  ? 246.926 -19.374 -14.557 1.00 76.47  ? 774  MET A C   1 
ATOM 5100  O O   . MET A 1 707  ? 246.775 -19.808 -15.691 1.00 75.89  ? 774  MET A O   1 
ATOM 5101  C CB  . MET A 1 707  ? 246.593 -21.402 -13.175 1.00 74.30  ? 774  MET A CB  1 
ATOM 5102  C CG  . MET A 1 707  ? 247.114 -22.291 -12.054 1.00 74.61  ? 774  MET A CG  1 
ATOM 5103  S SD  . MET A 1 707  ? 246.276 -23.892 -11.988 1.00 76.27  ? 774  MET A SD  1 
ATOM 5104  C CE  . MET A 1 707  ? 244.638 -23.400 -11.501 1.00 74.64  ? 774  MET A CE  1 
ATOM 5105  N N   . GLU A 1 708  ? 246.571 -18.149 -14.214 1.00 79.06  ? 775  GLU A N   1 
ATOM 5106  C CA  . GLU A 1 708  ? 246.035 -17.285 -15.234 1.00 81.83  ? 775  GLU A CA  1 
ATOM 5107  C C   . GLU A 1 708  ? 247.241 -16.987 -16.106 1.00 83.82  ? 775  GLU A C   1 
ATOM 5108  O O   . GLU A 1 708  ? 247.181 -17.116 -17.326 1.00 84.32  ? 775  GLU A O   1 
ATOM 5109  C CB  . GLU A 1 708  ? 245.429 -16.033 -14.611 1.00 82.12  ? 775  GLU A CB  1 
ATOM 5110  C CG  . GLU A 1 708  ? 244.215 -16.355 -13.759 1.00 85.11  ? 775  GLU A CG  1 
ATOM 5111  C CD  . GLU A 1 708  ? 243.552 -15.133 -13.209 1.00 87.19  ? 775  GLU A CD  1 
ATOM 5112  O OE1 . GLU A 1 708  ? 244.257 -14.294 -12.626 1.00 88.69  ? 775  GLU A OE1 1 
ATOM 5113  O OE2 . GLU A 1 708  ? 242.326 -15.016 -13.353 1.00 88.14  ? 775  GLU A OE2 1 
ATOM 5114  N N   . ASP A 1 709  ? 248.350 -16.616 -15.482 1.00 86.72  ? 776  ASP A N   1 
ATOM 5115  C CA  . ASP A 1 709  ? 249.559 -16.369 -16.247 1.00 89.59  ? 776  ASP A CA  1 
ATOM 5116  C C   . ASP A 1 709  ? 249.930 -17.809 -16.545 1.00 90.29  ? 776  ASP A C   1 
ATOM 5117  O O   . ASP A 1 709  ? 250.611 -18.127 -17.519 1.00 89.31  ? 776  ASP A O   1 
ATOM 5118  C CB  . ASP A 1 709  ? 250.606 -15.682 -15.364 1.00 91.76  ? 776  ASP A CB  1 
ATOM 5119  C CG  . ASP A 1 709  ? 251.752 -16.592 -14.996 1.00 93.81  ? 776  ASP A CG  1 
ATOM 5120  O OD1 . ASP A 1 709  ? 251.504 -17.787 -14.721 1.00 93.97  ? 776  ASP A OD1 1 
ATOM 5121  O OD2 . ASP A 1 709  ? 252.905 -16.104 -14.970 1.00 95.23  ? 776  ASP A OD2 1 
ATOM 5122  N N   . GLY A 1 710  ? 249.424 -18.677 -15.676 1.00 90.78  ? 777  GLY A N   1 
ATOM 5123  C CA  . GLY A 1 710  ? 249.668 -20.094 -15.786 1.00 90.43  ? 777  GLY A CA  1 
ATOM 5124  C C   . GLY A 1 710  ? 249.531 -20.613 -17.190 1.00 90.16  ? 777  GLY A C   1 
ATOM 5125  O O   . GLY A 1 710  ? 249.031 -19.942 -18.090 1.00 90.88  ? 777  GLY A O   1 
ATOM 5126  N N   . THR A 1 711  ? 249.986 -21.844 -17.356 1.00 89.42  ? 778  THR A N   1 
ATOM 5127  C CA  . THR A 1 711  ? 249.969 -22.528 -18.635 1.00 87.37  ? 778  THR A CA  1 
ATOM 5128  C C   . THR A 1 711  ? 248.550 -22.780 -19.123 1.00 87.71  ? 778  THR A C   1 
ATOM 5129  O O   . THR A 1 711  ? 248.288 -22.826 -20.327 1.00 86.76  ? 778  THR A O   1 
ATOM 5130  C CB  . THR A 1 711  ? 250.677 -23.894 -18.511 1.00 85.32  ? 778  THR A CB  1 
ATOM 5131  O OG1 . THR A 1 711  ? 251.655 -23.841 -17.465 1.00 81.85  ? 778  THR A OG1 1 
ATOM 5132  C CG2 . THR A 1 711  ? 251.371 -24.241 -19.800 1.00 84.01  ? 778  THR A CG2 1 
ATOM 5133  N N   . LEU A 1 712  ? 247.637 -22.918 -18.172 1.00 88.19  ? 779  LEU A N   1 
ATOM 5134  C CA  . LEU A 1 712  ? 246.256 -23.242 -18.470 1.00 88.94  ? 779  LEU A CA  1 
ATOM 5135  C C   . LEU A 1 712  ? 245.237 -22.293 -17.838 1.00 88.33  ? 779  LEU A C   1 
ATOM 5136  O O   . LEU A 1 712  ? 245.351 -21.927 -16.665 1.00 86.99  ? 779  LEU A O   1 
ATOM 5137  C CB  . LEU A 1 712  ? 246.048 -24.678 -18.023 1.00 90.20  ? 779  LEU A CB  1 
ATOM 5138  C CG  . LEU A 1 712  ? 247.108 -25.146 -17.001 1.00 90.99  ? 779  LEU A CG  1 
ATOM 5139  C CD1 . LEU A 1 712  ? 246.878 -24.517 -15.634 1.00 91.41  ? 779  LEU A CD1 1 
ATOM 5140  C CD2 . LEU A 1 712  ? 247.086 -26.653 -16.890 1.00 90.96  ? 779  LEU A CD2 1 
ATOM 5141  N N   . GLN A 1 713  ? 244.247 -21.905 -18.642 1.00 88.33  ? 780  GLN A N   1 
ATOM 5142  C CA  . GLN A 1 713  ? 243.176 -20.978 -18.249 1.00 88.26  ? 780  GLN A CA  1 
ATOM 5143  C C   . GLN A 1 713  ? 242.254 -20.780 -19.461 1.00 88.80  ? 780  GLN A C   1 
ATOM 5144  O O   . GLN A 1 713  ? 242.556 -21.291 -20.541 1.00 90.83  ? 780  GLN A O   1 
ATOM 5145  C CB  . GLN A 1 713  ? 243.770 -19.629 -17.822 1.00 87.33  ? 780  GLN A CB  1 
ATOM 5146  C CG  . GLN A 1 713  ? 244.165 -19.525 -16.353 1.00 86.27  ? 780  GLN A CG  1 
ATOM 5147  C CD  . GLN A 1 713  ? 242.978 -19.344 -15.425 1.00 85.85  ? 780  GLN A CD  1 
ATOM 5148  O OE1 . GLN A 1 713  ? 242.081 -18.544 -15.691 1.00 85.44  ? 780  GLN A OE1 1 
ATOM 5149  N NE2 . GLN A 1 713  ? 242.978 -20.071 -14.322 1.00 85.12  ? 780  GLN A NE2 1 
ATOM 5150  N N   . ALA A 1 714  ? 241.158 -20.028 -19.307 1.00 88.39  ? 781  ALA A N   1 
ATOM 5151  C CA  . ALA A 1 714  ? 240.230 -19.843 -20.429 1.00 88.17  ? 781  ALA A CA  1 
ATOM 5152  C C   . ALA A 1 714  ? 239.683 -18.472 -20.884 1.00 88.34  ? 781  ALA A C   1 
ATOM 5153  O O   . ALA A 1 714  ? 239.879 -17.423 -20.265 1.00 88.38  ? 781  ALA A O   1 
ATOM 5154  C CB  . ALA A 1 714  ? 239.080 -20.802 -20.278 1.00 87.55  ? 781  ALA A CB  1 
ATOM 5155  N N   . GLY A 1 715  ? 238.957 -18.559 -21.995 1.00 88.16  ? 782  GLY A N   1 
ATOM 5156  C CA  . GLY A 1 715  ? 238.387 -17.434 -22.706 1.00 87.62  ? 782  GLY A CA  1 
ATOM 5157  C C   . GLY A 1 715  ? 238.950 -17.863 -24.053 1.00 88.40  ? 782  GLY A C   1 
ATOM 5158  O O   . GLY A 1 715  ? 239.925 -17.282 -24.527 1.00 88.65  ? 782  GLY A O   1 
ATOM 5159  N N   . PRO A 1 716  ? 238.367 -18.907 -24.678 1.00 88.20  ? 783  PRO A N   1 
ATOM 5160  C CA  . PRO A 1 716  ? 238.717 -19.540 -25.963 1.00 87.58  ? 783  PRO A CA  1 
ATOM 5161  C C   . PRO A 1 716  ? 238.806 -18.788 -27.289 1.00 87.47  ? 783  PRO A C   1 
ATOM 5162  O O   . PRO A 1 716  ? 239.791 -18.925 -28.018 1.00 88.17  ? 783  PRO A O   1 
ATOM 5163  C CB  . PRO A 1 716  ? 237.733 -20.710 -26.053 1.00 87.38  ? 783  PRO A CB  1 
ATOM 5164  C CG  . PRO A 1 716  ? 236.583 -20.248 -25.301 1.00 86.41  ? 783  PRO A CG  1 
ATOM 5165  C CD  . PRO A 1 716  ? 237.130 -19.491 -24.132 1.00 86.28  ? 783  PRO A CD  1 
ATOM 5166  N N   . GLY A 1 717  ? 237.801 -17.978 -27.578 1.00 86.67  ? 784  GLY A N   1 
ATOM 5167  C CA  . GLY A 1 717  ? 237.743 -17.293 -28.847 1.00 87.03  ? 784  GLY A CA  1 
ATOM 5168  C C   . GLY A 1 717  ? 237.971 -15.837 -29.102 1.00 89.09  ? 784  GLY A C   1 
ATOM 5169  O O   . GLY A 1 717  ? 237.096 -15.151 -29.620 1.00 87.72  ? 784  GLY A O   1 
ATOM 5170  N N   . GLY A 1 718  ? 239.170 -15.376 -28.790 1.00 86.47  ? 785  GLY A N   1 
ATOM 5171  C CA  . GLY A 1 718  ? 239.507 -13.994 -29.046 1.00 84.43  ? 785  GLY A CA  1 
ATOM 5172  C C   . GLY A 1 718  ? 240.214 -13.249 -27.927 1.00 81.73  ? 785  GLY A C   1 
ATOM 5173  O O   . GLY A 1 718  ? 241.094 -13.765 -27.232 1.00 82.10  ? 785  GLY A O   1 
ATOM 5174  N N   . ALA A 1 719  ? 239.812 -11.993 -27.792 1.00 85.74  ? 786  ALA A N   1 
ATOM 5175  C CA  . ALA A 1 719  ? 240.323 -11.072 -26.794 1.00 84.38  ? 786  ALA A CA  1 
ATOM 5176  C C   . ALA A 1 719  ? 239.673 -11.459 -25.473 1.00 84.79  ? 786  ALA A C   1 
ATOM 5177  O O   . ALA A 1 719  ? 240.352 -11.860 -24.528 1.00 81.08  ? 786  ALA A O   1 
ATOM 5178  C CB  . ALA A 1 719  ? 239.913 -9.662  -27.177 1.00 83.42  ? 786  ALA A CB  1 
ATOM 5179  N N   . SER A 1 720  ? 238.343 -11.316 -25.457 1.00 79.80  ? 787  SER A N   1 
ATOM 5180  C CA  . SER A 1 720  ? 237.423 -11.611 -24.347 1.00 79.67  ? 787  SER A CA  1 
ATOM 5181  C C   . SER A 1 720  ? 237.946 -11.601 -22.912 1.00 77.73  ? 787  SER A C   1 
ATOM 5182  O O   . SER A 1 720  ? 238.369 -10.566 -22.389 1.00 76.94  ? 787  SER A O   1 
ATOM 5183  C CB  . SER A 1 720  ? 236.726 -12.956 -24.601 1.00 78.94  ? 787  SER A CB  1 
ATOM 5184  O OG  . SER A 1 720  ? 235.880 -12.911 -25.736 1.00 78.32  ? 787  SER A OG  1 
ATOM 5185  N N   . GLY A 1 721  ? 237.860 -12.776 -22.287 1.00 75.75  ? 788  GLY A N   1 
ATOM 5186  C CA  . GLY A 1 721  ? 238.299 -12.978 -20.919 1.00 72.66  ? 788  GLY A CA  1 
ATOM 5187  C C   . GLY A 1 721  ? 239.807 -12.988 -20.769 1.00 70.12  ? 788  GLY A C   1 
ATOM 5188  O O   . GLY A 1 721  ? 240.303 -12.612 -19.711 1.00 70.47  ? 788  GLY A O   1 
ATOM 5189  N N   . PRO A 1 722  ? 240.570 -13.459 -21.775 1.00 68.63  ? 789  PRO A N   1 
ATOM 5190  C CA  . PRO A 1 722  ? 242.019 -13.430 -21.586 1.00 67.05  ? 789  PRO A CA  1 
ATOM 5191  C C   . PRO A 1 722  ? 242.275 -12.012 -21.139 1.00 65.09  ? 789  PRO A C   1 
ATOM 5192  O O   . PRO A 1 722  ? 242.931 -11.762 -20.144 1.00 64.99  ? 789  PRO A O   1 
ATOM 5193  C CB  . PRO A 1 722  ? 242.540 -13.698 -22.985 1.00 67.95  ? 789  PRO A CB  1 
ATOM 5194  C CG  . PRO A 1 722  ? 241.560 -14.684 -23.498 1.00 67.42  ? 789  PRO A CG  1 
ATOM 5195  C CD  . PRO A 1 722  ? 240.226 -14.120 -23.046 1.00 68.63  ? 789  PRO A CD  1 
ATOM 5196  N N   . ARG A 1 723  ? 241.698 -11.085 -21.884 1.00 62.37  ? 790  ARG A N   1 
ATOM 5197  C CA  . ARG A 1 723  ? 241.810 -9.690  -21.549 1.00 58.92  ? 790  ARG A CA  1 
ATOM 5198  C C   . ARG A 1 723  ? 241.423 -9.600  -20.082 1.00 55.12  ? 790  ARG A C   1 
ATOM 5199  O O   . ARG A 1 723  ? 242.162 -9.059  -19.264 1.00 52.22  ? 790  ARG A O   1 
ATOM 5200  C CB  . ARG A 1 723  ? 240.833 -8.878  -22.395 1.00 61.63  ? 790  ARG A CB  1 
ATOM 5201  C CG  . ARG A 1 723  ? 241.097 -8.981  -23.877 1.00 66.56  ? 790  ARG A CG  1 
ATOM 5202  C CD  . ARG A 1 723  ? 242.433 -8.352  -24.226 1.00 72.90  ? 790  ARG A CD  1 
ATOM 5203  N NE  . ARG A 1 723  ? 242.920 -8.743  -25.549 1.00 79.94  ? 790  ARG A NE  1 
ATOM 5204  C CZ  . ARG A 1 723  ? 242.411 -8.321  -26.703 1.00 83.70  ? 790  ARG A CZ  1 
ATOM 5205  N NH1 . ARG A 1 723  ? 241.382 -7.479  -26.711 1.00 84.39  ? 790  ARG A NH1 1 
ATOM 5206  N NH2 . ARG A 1 723  ? 242.929 -8.754  -27.851 1.00 85.89  ? 790  ARG A NH2 1 
ATOM 5207  N N   . ALA A 1 724  ? 240.265 -10.170 -19.765 1.00 51.84  ? 791  ALA A N   1 
ATOM 5208  C CA  . ALA A 1 724  ? 239.722 -10.173 -18.411 1.00 49.03  ? 791  ALA A CA  1 
ATOM 5209  C C   . ALA A 1 724  ? 240.687 -10.727 -17.364 1.00 47.54  ? 791  ALA A C   1 
ATOM 5210  O O   . ALA A 1 724  ? 241.214 -9.964  -16.551 1.00 46.50  ? 791  ALA A O   1 
ATOM 5211  C CB  . ALA A 1 724  ? 238.407 -10.954 -18.381 1.00 49.56  ? 791  ALA A CB  1 
ATOM 5212  N N   . LEU A 1 725  ? 240.917 -12.044 -17.366 1.00 45.88  ? 792  LEU A N   1 
ATOM 5213  C CA  . LEU A 1 725  ? 241.827 -12.635 -16.386 1.00 42.67  ? 792  LEU A CA  1 
ATOM 5214  C C   . LEU A 1 725  ? 243.100 -11.823 -16.391 1.00 40.84  ? 792  LEU A C   1 
ATOM 5215  O O   . LEU A 1 725  ? 243.523 -11.307 -15.359 1.00 39.75  ? 792  LEU A O   1 
ATOM 5216  C CB  . LEU A 1 725  ? 242.104 -14.102 -16.698 1.00 40.63  ? 792  LEU A CB  1 
ATOM 5217  C CG  . LEU A 1 725  ? 242.073 -14.487 -18.156 1.00 43.89  ? 792  LEU A CG  1 
ATOM 5218  C CD1 . LEU A 1 725  ? 243.379 -14.135 -18.775 1.00 44.93  ? 792  LEU A CD1 1 
ATOM 5219  C CD2 . LEU A 1 725  ? 241.810 -15.956 -18.273 1.00 42.24  ? 792  LEU A CD2 1 
ATOM 5220  N N   . GLU A 1 726  ? 243.685 -11.677 -17.569 1.00 40.89  ? 793  GLU A N   1 
ATOM 5221  C CA  . GLU A 1 726  ? 244.893 -10.888 -17.731 1.00 41.88  ? 793  GLU A CA  1 
ATOM 5222  C C   . GLU A 1 726  ? 244.789 -9.535  -17.051 1.00 41.94  ? 793  GLU A C   1 
ATOM 5223  O O   . GLU A 1 726  ? 245.667 -9.175  -16.290 1.00 42.33  ? 793  GLU A O   1 
ATOM 5224  C CB  . GLU A 1 726  ? 245.162 -10.690 -19.202 1.00 42.24  ? 793  GLU A CB  1 
ATOM 5225  C CG  . GLU A 1 726  ? 245.524 -11.976 -19.904 1.00 43.77  ? 793  GLU A CG  1 
ATOM 5226  C CD  . GLU A 1 726  ? 246.995 -12.298 -19.769 1.00 43.90  ? 793  GLU A CD  1 
ATOM 5227  O OE1 . GLU A 1 726  ? 247.818 -11.346 -19.844 1.00 47.24  ? 793  GLU A OE1 1 
ATOM 5228  O OE2 . GLU A 1 726  ? 247.327 -13.496 -19.608 1.00 40.75  ? 793  GLU A OE2 1 
ATOM 5229  N N   . ILE A 1 727  ? 243.725 -8.788  -17.331 1.00 40.85  ? 794  ILE A N   1 
ATOM 5230  C CA  . ILE A 1 727  ? 243.524 -7.475  -16.710 1.00 39.06  ? 794  ILE A CA  1 
ATOM 5231  C C   . ILE A 1 727  ? 243.575 -7.559  -15.187 1.00 40.25  ? 794  ILE A C   1 
ATOM 5232  O O   . ILE A 1 727  ? 244.446 -6.985  -14.539 1.00 37.92  ? 794  ILE A O   1 
ATOM 5233  C CB  . ILE A 1 727  ? 242.148 -6.850  -17.086 1.00 36.12  ? 794  ILE A CB  1 
ATOM 5234  C CG1 . ILE A 1 727  ? 242.165 -6.322  -18.520 1.00 35.47  ? 794  ILE A CG1 1 
ATOM 5235  C CG2 . ILE A 1 727  ? 241.819 -5.721  -16.138 1.00 33.41  ? 794  ILE A CG2 1 
ATOM 5236  C CD1 . ILE A 1 727  ? 240.796 -6.109  -19.106 1.00 91.71  ? 794  ILE A CD1 1 
ATOM 5237  N N   . ASN A 1 728  ? 242.621 -8.281  -14.620 1.00 42.40  ? 795  ASN A N   1 
ATOM 5238  C CA  . ASN A 1 728  ? 242.533 -8.414  -13.178 1.00 44.45  ? 795  ASN A CA  1 
ATOM 5239  C C   . ASN A 1 728  ? 243.865 -8.781  -12.594 1.00 46.38  ? 795  ASN A C   1 
ATOM 5240  O O   . ASN A 1 728  ? 244.268 -8.253  -11.563 1.00 44.95  ? 795  ASN A O   1 
ATOM 5241  C CB  . ASN A 1 728  ? 241.510 -9.484  -12.792 1.00 46.12  ? 795  ASN A CB  1 
ATOM 5242  C CG  . ASN A 1 728  ? 241.967 -10.887 -13.129 1.00 49.87  ? 795  ASN A CG  1 
ATOM 5243  O OD1 . ASN A 1 728  ? 241.329 -11.581 -13.899 1.00 52.54  ? 795  ASN A OD1 1 
ATOM 5244  N ND2 . ASN A 1 728  ? 243.066 -11.310 -12.541 1.00 51.71  ? 795  ASN A ND2 1 
ATOM 5245  N N   . LYS A 1 729  ? 244.541 -9.697  -13.267 1.00 50.14  ? 796  LYS A N   1 
ATOM 5246  C CA  . LYS A 1 729  ? 245.833 -10.175 -12.820 1.00 53.43  ? 796  LYS A CA  1 
ATOM 5247  C C   . LYS A 1 729  ? 246.738 -8.982  -12.568 1.00 55.65  ? 796  LYS A C   1 
ATOM 5248  O O   . LYS A 1 729  ? 247.510 -8.924  -11.607 1.00 56.83  ? 796  LYS A O   1 
ATOM 5249  C CB  . LYS A 1 729  ? 246.426 -11.087 -13.898 1.00 54.30  ? 796  LYS A CB  1 
ATOM 5250  C CG  . LYS A 1 729  ? 245.623 -12.344 -14.105 1.00 56.57  ? 796  LYS A CG  1 
ATOM 5251  C CD  . LYS A 1 729  ? 245.695 -12.859 -15.519 1.00 55.36  ? 796  LYS A CD  1 
ATOM 5252  C CE  . LYS A 1 729  ? 247.069 -13.306 -15.887 1.00 54.73  ? 796  LYS A CE  1 
ATOM 5253  N NZ  . LYS A 1 729  ? 246.927 -14.321 -16.957 1.00 52.73  ? 796  LYS A NZ  1 
ATOM 5254  N N   . MET A 1 730  ? 246.607 -8.006  -13.439 1.00 56.32  ? 797  MET A N   1 
ATOM 5255  C CA  . MET A 1 730  ? 247.426 -6.826  -13.360 1.00 58.76  ? 797  MET A CA  1 
ATOM 5256  C C   . MET A 1 730  ? 247.183 -6.063  -12.086 1.00 62.33  ? 797  MET A C   1 
ATOM 5257  O O   . MET A 1 730  ? 248.116 -5.648  -11.404 1.00 60.54  ? 797  MET A O   1 
ATOM 5258  C CB  . MET A 1 730  ? 247.127 -5.959  -14.580 1.00 56.41  ? 797  MET A CB  1 
ATOM 5259  C CG  . MET A 1 730  ? 247.282 -6.754  -15.882 1.00 56.64  ? 797  MET A CG  1 
ATOM 5260  S SD  . MET A 1 730  ? 246.322 -6.232  -17.316 1.00 58.26  ? 797  MET A SD  1 
ATOM 5261  C CE  . MET A 1 730  ? 247.093 -4.702  -17.679 1.00 62.24  ? 797  MET A CE  1 
ATOM 5262  N N   . ILE A 1 731  ? 245.911 -5.938  -11.744 1.00 66.99  ? 798  ILE A N   1 
ATOM 5263  C CA  . ILE A 1 731  ? 245.491 -5.153  -10.594 1.00 72.28  ? 798  ILE A CA  1 
ATOM 5264  C C   . ILE A 1 731  ? 245.455 -5.819  -9.223  1.00 75.92  ? 798  ILE A C   1 
ATOM 5265  O O   . ILE A 1 731  ? 245.514 -5.158  -8.184  1.00 78.02  ? 798  ILE A O   1 
ATOM 5266  C CB  . ILE A 1 731  ? 244.099 -4.518  -10.897 1.00 72.61  ? 798  ILE A CB  1 
ATOM 5267  C CG1 . ILE A 1 731  ? 242.989 -5.268  -10.170 1.00 73.37  ? 798  ILE A CG1 1 
ATOM 5268  C CG2 . ILE A 1 731  ? 243.809 -4.588  -12.401 1.00 71.30  ? 798  ILE A CG2 1 
ATOM 5269  C CD1 . ILE A 1 731  ? 241.889 -4.351  -9.676  1.00 91.71  ? 798  ILE A CD1 1 
ATOM 5270  N N   . SER A 1 732  ? 245.362 -7.129  -9.213  1.00 78.35  ? 799  SER A N   1 
ATOM 5271  C CA  . SER A 1 732  ? 245.280 -7.809  -7.954  1.00 79.62  ? 799  SER A CA  1 
ATOM 5272  C C   . SER A 1 732  ? 246.302 -7.278  -6.974  1.00 80.60  ? 799  SER A C   1 
ATOM 5273  O O   . SER A 1 732  ? 245.951 -6.731  -5.933  1.00 80.04  ? 799  SER A O   1 
ATOM 5274  C CB  . SER A 1 732  ? 245.452 -9.293  -8.196  1.00 79.39  ? 799  SER A CB  1 
ATOM 5275  O OG  . SER A 1 732  ? 244.446 -9.729  -9.094  1.00 79.04  ? 799  SER A OG  1 
ATOM 5276  N N   . PHE A 1 733  ? 247.568 -7.407  -7.325  1.00 82.06  ? 800  PHE A N   1 
ATOM 5277  C CA  . PHE A 1 733  ? 248.627 -6.952  -6.449  1.00 84.46  ? 800  PHE A CA  1 
ATOM 5278  C C   . PHE A 1 733  ? 248.328 -5.603  -5.856  1.00 85.52  ? 800  PHE A C   1 
ATOM 5279  O O   . PHE A 1 733  ? 248.547 -5.376  -4.676  1.00 84.89  ? 800  PHE A O   1 
ATOM 5280  C CB  . PHE A 1 733  ? 249.935 -6.863  -7.216  1.00 85.64  ? 800  PHE A CB  1 
ATOM 5281  C CG  . PHE A 1 733  ? 250.284 -8.117  -7.932  1.00 87.81  ? 800  PHE A CG  1 
ATOM 5282  C CD1 . PHE A 1 733  ? 250.992 -9.131  -7.291  1.00 88.64  ? 800  PHE A CD1 1 
ATOM 5283  C CD2 . PHE A 1 733  ? 249.856 -8.314  -9.235  1.00 89.00  ? 800  PHE A CD2 1 
ATOM 5284  C CE1 . PHE A 1 733  ? 251.267 -10.328 -7.944  1.00 89.37  ? 800  PHE A CE1 1 
ATOM 5285  C CE2 . PHE A 1 733  ? 250.121 -9.500  -9.892  1.00 89.17  ? 800  PHE A CE2 1 
ATOM 5286  C CZ  . PHE A 1 733  ? 250.829 -10.512 -9.248  1.00 89.34  ? 800  PHE A CZ  1 
ATOM 5287  N N   . TRP A 1 734  ? 247.818 -4.704  -6.681  1.00 87.28  ? 801  TRP A N   1 
ATOM 5288  C CA  . TRP A 1 734  ? 247.554 -3.362  -6.207  1.00 89.35  ? 801  TRP A CA  1 
ATOM 5289  C C   . TRP A 1 734  ? 246.374 -3.207  -5.288  1.00 87.93  ? 801  TRP A C   1 
ATOM 5290  O O   . TRP A 1 734  ? 246.419 -2.404  -4.377  1.00 88.49  ? 801  TRP A O   1 
ATOM 5291  C CB  . TRP A 1 734  ? 247.405 -2.385  -7.379  1.00 94.28  ? 801  TRP A CB  1 
ATOM 5292  C CG  . TRP A 1 734  ? 246.903 -1.000  -6.956  1.00 99.75  ? 801  TRP A CG  1 
ATOM 5293  C CD1 . TRP A 1 734  ? 245.644 -0.497  -7.132  1.00 102.07 ? 801  TRP A CD1 1 
ATOM 5294  C CD2 . TRP A 1 734  ? 247.633 0.013   -6.236  1.00 101.30 ? 801  TRP A CD2 1 
ATOM 5295  N NE1 . TRP A 1 734  ? 245.543 0.756   -6.570  1.00 103.37 ? 801  TRP A NE1 1 
ATOM 5296  C CE2 . TRP A 1 734  ? 246.747 1.094   -6.015  1.00 102.42 ? 801  TRP A CE2 1 
ATOM 5297  C CE3 . TRP A 1 734  ? 248.945 0.110   -5.756  1.00 101.23 ? 801  TRP A CE3 1 
ATOM 5298  C CZ2 . TRP A 1 734  ? 247.131 2.254   -5.334  1.00 101.95 ? 801  TRP A CZ2 1 
ATOM 5299  C CZ3 . TRP A 1 734  ? 249.324 1.270   -5.077  1.00 101.70 ? 801  TRP A CZ3 1 
ATOM 5300  C CH2 . TRP A 1 734  ? 248.418 2.322   -4.875  1.00 102.21 ? 801  TRP A CH2 1 
ATOM 5301  N N   . ARG A 1 735  ? 245.312 -3.957  -5.512  1.00 86.15  ? 802  ARG A N   1 
ATOM 5302  C CA  . ARG A 1 735  ? 244.145 -3.810  -4.657  1.00 83.68  ? 802  ARG A CA  1 
ATOM 5303  C C   . ARG A 1 735  ? 244.555 -3.606  -3.227  1.00 82.36  ? 802  ARG A C   1 
ATOM 5304  O O   . ARG A 1 735  ? 244.503 -2.503  -2.689  1.00 82.96  ? 802  ARG A O   1 
ATOM 5305  C CB  . ARG A 1 735  ? 243.276 -5.051  -4.728  1.00 83.23  ? 802  ARG A CB  1 
ATOM 5306  C CG  . ARG A 1 735  ? 242.961 -5.419  -6.122  1.00 82.74  ? 802  ARG A CG  1 
ATOM 5307  C CD  . ARG A 1 735  ? 241.810 -6.341  -6.188  1.00 81.54  ? 802  ARG A CD  1 
ATOM 5308  N NE  . ARG A 1 735  ? 241.425 -6.474  -7.578  1.00 81.83  ? 802  ARG A NE  1 
ATOM 5309  C CZ  . ARG A 1 735  ? 240.615 -7.412  -8.032  1.00 82.43  ? 802  ARG A CZ  1 
ATOM 5310  N NH1 . ARG A 1 735  ? 240.109 -8.296  -7.194  1.00 83.17  ? 802  ARG A NH1 1 
ATOM 5311  N NH2 . ARG A 1 735  ? 240.320 -7.471  -9.319  1.00 81.28  ? 802  ARG A NH2 1 
ATOM 5312  N N   . ASN A 1 736  ? 244.958 -4.716  -2.634  1.00 79.84  ? 803  ASN A N   1 
ATOM 5313  C CA  . ASN A 1 736  ? 245.399 -4.800  -1.260  1.00 78.25  ? 803  ASN A CA  1 
ATOM 5314  C C   . ASN A 1 736  ? 246.572 -3.852  -0.972  1.00 76.71  ? 803  ASN A C   1 
ATOM 5315  O O   . ASN A 1 736  ? 246.531 -3.075  -0.007  1.00 76.26  ? 803  ASN A O   1 
ATOM 5316  C CB  . ASN A 1 736  ? 245.778 -6.248  -1.008  1.00 79.62  ? 803  ASN A CB  1 
ATOM 5317  C CG  . ASN A 1 736  ? 245.307 -7.160  -2.130  1.00 81.11  ? 803  ASN A CG  1 
ATOM 5318  O OD1 . ASN A 1 736  ? 244.136 -7.135  -2.514  1.00 80.55  ? 803  ASN A OD1 1 
ATOM 5319  N ND2 . ASN A 1 736  ? 246.219 -7.962  -2.664  1.00 81.45  ? 803  ASN A ND2 1 
ATOM 5320  N N   . ALA A 1 737  ? 247.614 -3.921  -1.802  1.00 75.25  ? 804  ALA A N   1 
ATOM 5321  C CA  . ALA A 1 737  ? 248.785 -3.055  -1.641  1.00 72.18  ? 804  ALA A CA  1 
ATOM 5322  C C   . ALA A 1 737  ? 248.230 -1.645  -1.504  1.00 70.29  ? 804  ALA A C   1 
ATOM 5323  O O   . ALA A 1 737  ? 248.544 -0.911  -0.564  1.00 69.46  ? 804  ALA A O   1 
ATOM 5324  C CB  . ALA A 1 737  ? 249.687 -3.159  -2.874  1.00 73.17  ? 804  ALA A CB  1 
ATOM 5325  N N   . HIS A 1 738  ? 247.366 -1.312  -2.454  1.00 69.70  ? 805  HIS A N   1 
ATOM 5326  C CA  . HIS A 1 738  ? 246.688 -0.028  -2.535  1.00 68.94  ? 805  HIS A CA  1 
ATOM 5327  C C   . HIS A 1 738  ? 246.462 0.609   -1.170  1.00 68.36  ? 805  HIS A C   1 
ATOM 5328  O O   . HIS A 1 738  ? 247.187 1.521   -0.769  1.00 68.03  ? 805  HIS A O   1 
ATOM 5329  C CB  . HIS A 1 738  ? 245.364 -0.238  -3.288  1.00 68.88  ? 805  HIS A CB  1 
ATOM 5330  C CG  . HIS A 1 738  ? 244.317 0.783   -3.005  1.00 68.46  ? 805  HIS A CG  1 
ATOM 5331  N ND1 . HIS A 1 738  ? 244.312 1.555   -1.866  1.00 68.66  ? 805  HIS A ND1 1 
ATOM 5332  C CD2 . HIS A 1 738  ? 243.192 1.099   -3.680  1.00 67.52  ? 805  HIS A CD2 1 
ATOM 5333  C CE1 . HIS A 1 738  ? 243.224 2.299   -1.846  1.00 68.05  ? 805  HIS A CE1 1 
ATOM 5334  N NE2 . HIS A 1 738  ? 242.525 2.040   -2.936  1.00 68.52  ? 805  HIS A NE2 1 
ATOM 5335  N N   . LYS A 1 739  ? 245.465 0.122   -0.453  1.00 67.53  ? 806  LYS A N   1 
ATOM 5336  C CA  . LYS A 1 739  ? 245.162 0.688   0.837   1.00 66.91  ? 806  LYS A CA  1 
ATOM 5337  C C   . LYS A 1 739  ? 246.402 1.008   1.659   1.00 65.61  ? 806  LYS A C   1 
ATOM 5338  O O   . LYS A 1 739  ? 246.691 2.172   1.948   1.00 65.58  ? 806  LYS A O   1 
ATOM 5339  C CB  . LYS A 1 739  ? 244.262 -0.260  1.617   1.00 68.51  ? 806  LYS A CB  1 
ATOM 5340  C CG  . LYS A 1 739  ? 242.875 -0.470  1.010   1.00 71.62  ? 806  LYS A CG  1 
ATOM 5341  C CD  . LYS A 1 739  ? 241.936 -1.110  2.042   1.00 75.75  ? 806  LYS A CD  1 
ATOM 5342  C CE  . LYS A 1 739  ? 240.694 -1.713  1.412   1.00 78.80  ? 806  LYS A CE  1 
ATOM 5343  N NZ  . LYS A 1 739  ? 240.015 -0.717  0.571   1.00 83.04  ? 806  LYS A NZ  1 
ATOM 5344  N N   . ARG A 1 740  ? 247.136 -0.034  2.024   1.00 64.88  ? 807  ARG A N   1 
ATOM 5345  C CA  . ARG A 1 740  ? 248.324 0.118   2.849   1.00 62.83  ? 807  ARG A CA  1 
ATOM 5346  C C   . ARG A 1 740  ? 249.260 1.203   2.349   1.00 59.10  ? 807  ARG A C   1 
ATOM 5347  O O   . ARG A 1 740  ? 249.858 1.934   3.139   1.00 56.91  ? 807  ARG A O   1 
ATOM 5348  C CB  . ARG A 1 740  ? 249.042 -1.220  2.930   1.00 67.84  ? 807  ARG A CB  1 
ATOM 5349  C CG  . ARG A 1 740  ? 248.053 -2.362  3.048   1.00 74.94  ? 807  ARG A CG  1 
ATOM 5350  C CD  . ARG A 1 740  ? 248.689 -3.677  3.463   1.00 79.22  ? 807  ARG A CD  1 
ATOM 5351  N NE  . ARG A 1 740  ? 247.668 -4.722  3.612   1.00 83.95  ? 807  ARG A NE  1 
ATOM 5352  C CZ  . ARG A 1 740  ? 247.814 -5.841  4.323   1.00 85.39  ? 807  ARG A CZ  1 
ATOM 5353  N NH1 . ARG A 1 740  ? 248.952 -6.081  4.969   1.00 85.44  ? 807  ARG A NH1 1 
ATOM 5354  N NH2 . ARG A 1 740  ? 246.816 -6.719  4.399   1.00 85.07  ? 807  ARG A NH2 1 
ATOM 5355  N N   . ILE A 1 741  ? 249.366 1.320   1.034   1.00 56.29  ? 808  ILE A N   1 
ATOM 5356  C CA  . ILE A 1 741  ? 250.240 2.314   0.439   1.00 52.75  ? 808  ILE A CA  1 
ATOM 5357  C C   . ILE A 1 741  ? 249.700 3.709   0.654   1.00 49.12  ? 808  ILE A C   1 
ATOM 5358  O O   . ILE A 1 741  ? 250.265 4.501   1.396   1.00 47.78  ? 808  ILE A O   1 
ATOM 5359  C CB  . ILE A 1 741  ? 250.405 2.100   -1.067  1.00 54.16  ? 808  ILE A CB  1 
ATOM 5360  C CG1 . ILE A 1 741  ? 250.755 0.641   -1.341  1.00 54.19  ? 808  ILE A CG1 1 
ATOM 5361  C CG2 . ILE A 1 741  ? 251.511 2.988   -1.585  1.00 55.78  ? 808  ILE A CG2 1 
ATOM 5362  C CD1 . ILE A 1 741  ? 251.107 0.331   -2.783  1.00 91.71  ? 808  ILE A CD1 1 
ATOM 5363  N N   . SER A 1 742  ? 248.597 4.012   -0.007  1.00 46.65  ? 809  SER A N   1 
ATOM 5364  C CA  . SER A 1 742  ? 247.985 5.326   0.108   1.00 46.54  ? 809  SER A CA  1 
ATOM 5365  C C   . SER A 1 742  ? 248.017 5.834   1.540   1.00 44.86  ? 809  SER A C   1 
ATOM 5366  O O   . SER A 1 742  ? 248.183 7.028   1.778   1.00 42.89  ? 809  SER A O   1 
ATOM 5367  C CB  . SER A 1 742  ? 246.537 5.243   -0.358  1.00 47.85  ? 809  SER A CB  1 
ATOM 5368  O OG  . SER A 1 742  ? 246.429 4.464   -1.539  1.00 51.17  ? 809  SER A OG  1 
ATOM 5369  N N   . SER A 1 743  ? 247.877 4.895   2.476   1.00 44.05  ? 810  SER A N   1 
ATOM 5370  C CA  . SER A 1 743  ? 247.825 5.157   3.912   1.00 44.51  ? 810  SER A CA  1 
ATOM 5371  C C   . SER A 1 743  ? 248.932 5.895   4.661   1.00 45.29  ? 810  SER A C   1 
ATOM 5372  O O   . SER A 1 743  ? 248.638 6.708   5.533   1.00 46.32  ? 810  SER A O   1 
ATOM 5373  C CB  . SER A 1 743  ? 247.541 3.852   4.642   1.00 45.17  ? 810  SER A CB  1 
ATOM 5374  O OG  . SER A 1 743  ? 248.027 2.760   3.909   1.00 44.30  ? 810  SER A OG  1 
ATOM 5375  N N   . GLN A 1 744  ? 250.193 5.626   4.368   1.00 52.30  ? 811  GLN A N   1 
ATOM 5376  C CA  . GLN A 1 744  ? 251.238 6.327   5.099   1.00 56.74  ? 811  GLN A CA  1 
ATOM 5377  C C   . GLN A 1 744  ? 251.050 7.830   5.192   1.00 60.48  ? 811  GLN A C   1 
ATOM 5378  O O   . GLN A 1 744  ? 251.631 8.454   6.073   1.00 60.76  ? 811  GLN A O   1 
ATOM 5379  C CB  . GLN A 1 744  ? 252.604 6.077   4.483   1.00 56.55  ? 811  GLN A CB  1 
ATOM 5380  C CG  . GLN A 1 744  ? 252.603 6.129   2.994   1.00 57.65  ? 811  GLN A CG  1 
ATOM 5381  C CD  . GLN A 1 744  ? 252.437 4.763   2.432   1.00 59.46  ? 811  GLN A CD  1 
ATOM 5382  O OE1 . GLN A 1 744  ? 252.020 3.845   3.136   1.00 59.54  ? 811  GLN A OE1 1 
ATOM 5383  N NE2 . GLN A 1 744  ? 252.745 4.606   1.155   1.00 58.43  ? 811  GLN A NE2 1 
ATOM 5384  N N   . MET A 1 745  ? 250.253 8.415   4.301   1.00 65.35  ? 812  MET A N   1 
ATOM 5385  C CA  . MET A 1 745  ? 250.078 9.865   4.308   1.00 67.58  ? 812  MET A CA  1 
ATOM 5386  C C   . MET A 1 745  ? 251.516 10.387  4.354   1.00 68.33  ? 812  MET A C   1 
ATOM 5387  O O   . MET A 1 745  ? 252.382 9.783   3.730   1.00 69.91  ? 812  MET A O   1 
ATOM 5388  C CB  . MET A 1 745  ? 249.275 10.311  5.532   1.00 69.81  ? 812  MET A CB  1 
ATOM 5389  C CG  . MET A 1 745  ? 249.037 11.804  5.622   1.00 74.20  ? 812  MET A CG  1 
ATOM 5390  S SD  . MET A 1 745  ? 248.975 12.646  4.033   1.00 77.73  ? 812  MET A SD  1 
ATOM 5391  C CE  . MET A 1 745  ? 250.102 14.038  4.375   1.00 79.73  ? 812  MET A CE  1 
ATOM 5392  N N   . VAL A 1 746  ? 251.807 11.457  5.088   1.00 72.53  ? 813  VAL A N   1 
ATOM 5393  C CA  . VAL A 1 746  ? 253.177 11.972  5.106   1.00 72.75  ? 813  VAL A CA  1 
ATOM 5394  C C   . VAL A 1 746  ? 253.256 13.310  5.816   1.00 74.67  ? 813  VAL A C   1 
ATOM 5395  O O   . VAL A 1 746  ? 252.249 13.826  6.294   1.00 74.55  ? 813  VAL A O   1 
ATOM 5396  C CB  . VAL A 1 746  ? 253.694 12.132  3.654   1.00 73.08  ? 813  VAL A CB  1 
ATOM 5397  C CG1 . VAL A 1 746  ? 252.566 12.555  2.786   1.00 74.67  ? 813  VAL A CG1 1 
ATOM 5398  C CG2 . VAL A 1 746  ? 254.789 13.154  3.546   1.00 73.78  ? 813  VAL A CG2 1 
ATOM 5399  N N   . VAL A 1 747  ? 254.471 13.845  5.898   1.00 76.46  ? 814  VAL A N   1 
ATOM 5400  C CA  . VAL A 1 747  ? 254.752 15.140  6.510   1.00 79.26  ? 814  VAL A CA  1 
ATOM 5401  C C   . VAL A 1 747  ? 255.699 15.840  5.520   1.00 81.47  ? 814  VAL A C   1 
ATOM 5402  O O   . VAL A 1 747  ? 256.316 15.170  4.694   1.00 82.36  ? 814  VAL A O   1 
ATOM 5403  C CB  . VAL A 1 747  ? 255.444 14.976  7.895   1.00 80.02  ? 814  VAL A CB  1 
ATOM 5404  C CG1 . VAL A 1 747  ? 254.746 13.893  8.713   1.00 80.07  ? 814  VAL A CG1 1 
ATOM 5405  C CG2 . VAL A 1 747  ? 256.903 14.636  7.713   1.00 79.44  ? 814  VAL A CG2 1 
ATOM 5406  N N   . TRP A 1 748  ? 255.821 17.166  5.578   1.00 82.67  ? 815  TRP A N   1 
ATOM 5407  C CA  . TRP A 1 748  ? 256.702 17.839  4.628   1.00 84.42  ? 815  TRP A CA  1 
ATOM 5408  C C   . TRP A 1 748  ? 257.561 19.004  5.111   1.00 85.34  ? 815  TRP A C   1 
ATOM 5409  O O   . TRP A 1 748  ? 257.249 19.679  6.086   1.00 86.13  ? 815  TRP A O   1 
ATOM 5410  C CB  . TRP A 1 748  ? 255.904 18.296  3.407   1.00 83.98  ? 815  TRP A CB  1 
ATOM 5411  C CG  . TRP A 1 748  ? 254.714 17.421  3.056   1.00 83.83  ? 815  TRP A CG  1 
ATOM 5412  C CD1 . TRP A 1 748  ? 253.446 17.536  3.552   1.00 84.25  ? 815  TRP A CD1 1 
ATOM 5413  C CD2 . TRP A 1 748  ? 254.665 16.363  2.084   1.00 83.10  ? 815  TRP A CD2 1 
ATOM 5414  N NE1 . TRP A 1 748  ? 252.613 16.627  2.944   1.00 83.49  ? 815  TRP A NE1 1 
ATOM 5415  C CE2 . TRP A 1 748  ? 253.338 15.897  2.041   1.00 83.01  ? 815  TRP A CE2 1 
ATOM 5416  C CE3 . TRP A 1 748  ? 255.611 15.768  1.246   1.00 82.46  ? 815  TRP A CE3 1 
ATOM 5417  C CZ2 . TRP A 1 748  ? 252.937 14.877  1.193   1.00 82.85  ? 815  TRP A CZ2 1 
ATOM 5418  C CZ3 . TRP A 1 748  ? 255.207 14.750  0.405   1.00 82.29  ? 815  TRP A CZ3 1 
ATOM 5419  C CH2 . TRP A 1 748  ? 253.883 14.315  0.386   1.00 82.24  ? 815  TRP A CH2 1 
ATOM 5420  N N   . LEU A 1 749  ? 258.660 19.221  4.399   1.00 86.88  ? 816  LEU A N   1 
ATOM 5421  C CA  . LEU A 1 749  ? 259.591 20.292  4.709   1.00 88.16  ? 816  LEU A CA  1 
ATOM 5422  C C   . LEU A 1 749  ? 259.026 21.492  3.948   1.00 88.13  ? 816  LEU A C   1 
ATOM 5423  O O   . LEU A 1 749  ? 258.903 21.462  2.725   1.00 86.44  ? 816  LEU A O   1 
ATOM 5424  C CB  . LEU A 1 749  ? 261.003 19.891  4.233   1.00 89.32  ? 816  LEU A CB  1 
ATOM 5425  C CG  . LEU A 1 749  ? 261.630 18.631  4.884   1.00 89.97  ? 816  LEU A CG  1 
ATOM 5426  C CD1 . LEU A 1 749  ? 262.477 17.878  3.861   1.00 89.78  ? 816  LEU A CD1 1 
ATOM 5427  C CD2 . LEU A 1 749  ? 262.470 19.008  6.118   1.00 91.52  ? 816  LEU A CD2 1 
ATOM 5428  N N   . PRO A 1 750  ? 258.674 22.567  4.674   1.00 89.11  ? 817  PRO A N   1 
ATOM 5429  C CA  . PRO A 1 750  ? 258.094 23.819  4.191   1.00 89.53  ? 817  PRO A CA  1 
ATOM 5430  C C   . PRO A 1 750  ? 259.058 24.929  3.732   1.00 89.57  ? 817  PRO A C   1 
ATOM 5431  O O   . PRO A 1 750  ? 258.926 25.468  2.629   1.00 89.22  ? 817  PRO A O   1 
ATOM 5432  C CB  . PRO A 1 750  ? 257.288 24.261  5.397   1.00 89.86  ? 817  PRO A CB  1 
ATOM 5433  C CG  . PRO A 1 750  ? 258.294 24.029  6.482   1.00 91.18  ? 817  PRO A CG  1 
ATOM 5434  C CD  . PRO A 1 750  ? 259.034 22.727  6.090   1.00 89.98  ? 817  PRO A CD  1 
ATOM 5435  N N   . ARG A 1 751  ? 260.009 25.279  4.594   1.00 89.87  ? 818  ARG A N   1 
ATOM 5436  C CA  . ARG A 1 751  ? 260.957 26.353  4.313   1.00 89.97  ? 818  ARG A CA  1 
ATOM 5437  C C   . ARG A 1 751  ? 262.245 26.157  5.102   1.00 89.65  ? 818  ARG A C   1 
ATOM 5438  O O   . ARG A 1 751  ? 263.337 26.485  4.639   1.00 89.30  ? 818  ARG A O   1 
ATOM 5439  C CB  . ARG A 1 751  ? 260.333 27.673  4.725   1.00 90.56  ? 818  ARG A CB  1 
ATOM 5440  C CG  . ARG A 1 751  ? 261.229 28.842  4.529   1.00 91.58  ? 818  ARG A CG  1 
ATOM 5441  C CD  . ARG A 1 751  ? 261.133 29.296  3.110   1.00 93.60  ? 818  ARG A CD  1 
ATOM 5442  N NE  . ARG A 1 751  ? 259.746 29.580  2.772   1.00 95.63  ? 818  ARG A NE  1 
ATOM 5443  C CZ  . ARG A 1 751  ? 259.368 30.310  1.728   1.00 96.11  ? 818  ARG A CZ  1 
ATOM 5444  N NH1 . ARG A 1 751  ? 260.278 30.828  0.920   1.00 96.34  ? 818  ARG A NH1 1 
ATOM 5445  N NH2 . ARG A 1 751  ? 258.080 30.530  1.498   1.00 95.67  ? 818  ARG A NH2 1 
ATOM 5446  N N   . SER A 1 752  ? 262.086 25.642  6.315   1.00 90.06  ? 819  SER A N   1 
ATOM 5447  C CA  . SER A 1 752  ? 263.195 25.367  7.219   1.00 91.13  ? 819  SER A CA  1 
ATOM 5448  C C   . SER A 1 752  ? 263.742 24.005  6.835   1.00 90.95  ? 819  SER A C   1 
ATOM 5449  O O   . SER A 1 752  ? 263.801 23.085  7.654   1.00 91.38  ? 819  SER A O   1 
ATOM 5450  C CB  . SER A 1 752  ? 262.688 25.323  8.657   1.00 91.96  ? 819  SER A CB  1 
ATOM 5451  O OG  . SER A 1 752  ? 261.705 26.322  8.873   1.00 93.55  ? 819  SER A OG  1 
ATOM 5452  N N   . ALA A 1 753  ? 264.122 23.878  5.573   1.00 90.31  ? 820  ALA A N   1 
ATOM 5453  C CA  . ALA A 1 753  ? 264.638 22.623  5.079   1.00 90.62  ? 820  ALA A CA  1 
ATOM 5454  C C   . ALA A 1 753  ? 266.122 22.713  5.014   1.00 91.16  ? 820  ALA A C   1 
ATOM 5455  O O   . ALA A 1 753  ? 266.748 23.556  5.644   1.00 93.22  ? 820  ALA A O   1 
ATOM 5456  C CB  . ALA A 1 753  ? 264.086 22.332  3.690   1.00 89.42  ? 820  ALA A CB  1 
ATOM 5457  N N   . LEU A 1 754  ? 266.665 21.814  4.223   1.00 90.30  ? 821  LEU A N   1 
ATOM 5458  C CA  . LEU A 1 754  ? 268.073 21.738  3.987   1.00 89.29  ? 821  LEU A CA  1 
ATOM 5459  C C   . LEU A 1 754  ? 268.518 23.140  3.533   1.00 88.78  ? 821  LEU A C   1 
ATOM 5460  O O   . LEU A 1 754  ? 268.161 23.600  2.457   1.00 89.46  ? 821  LEU A O   1 
ATOM 5461  C CB  . LEU A 1 754  ? 268.296 20.696  2.893   1.00 88.44  ? 821  LEU A CB  1 
ATOM 5462  C CG  . LEU A 1 754  ? 267.968 21.213  1.494   1.00 87.75  ? 821  LEU A CG  1 
ATOM 5463  C CD1 . LEU A 1 754  ? 269.261 21.580  0.917   1.00 87.93  ? 821  LEU A CD1 1 
ATOM 5464  C CD2 . LEU A 1 754  ? 267.296 20.228  0.591   1.00 86.34  ? 821  LEU A CD2 1 
ATOM 5465  N N   . PRO A 1 755  ? 269.281 23.850  4.371   1.00 41.67  ? 822  PRO A N   1 
ATOM 5466  C CA  . PRO A 1 755  ? 269.768 25.201  4.046   1.00 41.67  ? 822  PRO A CA  1 
ATOM 5467  C C   . PRO A 1 755  ? 270.998 25.162  3.136   1.00 41.67  ? 822  PRO A C   1 
ATOM 5468  O O   . PRO A 1 755  ? 271.261 24.163  2.488   1.00 41.67  ? 822  PRO A O   1 
ATOM 5469  C CB  . PRO A 1 755  ? 270.111 25.791  5.415   1.00 41.67  ? 822  PRO A CB  1 
ATOM 5470  C CG  . PRO A 1 755  ? 269.385 24.891  6.409   1.00 41.67  ? 822  PRO A CG  1 
ATOM 5471  C CD  . PRO A 1 755  ? 269.501 23.539  5.793   1.00 41.67  ? 822  PRO A CD  1 
ATOM 5472  N N   . ARG A 1 756  ? 271.744 26.265  3.113   1.00 41.67  ? 823  ARG A N   1 
ATOM 5473  C CA  . ARG A 1 756  ? 272.989 26.432  2.320   1.00 41.67  ? 823  ARG A CA  1 
ATOM 5474  C C   . ARG A 1 756  ? 272.841 26.746  0.816   1.00 41.67  ? 823  ARG A C   1 
ATOM 5475  O O   . ARG A 1 756  ? 273.837 26.736  0.061   1.00 41.67  ? 823  ARG A O   1 
ATOM 5476  C CB  . ARG A 1 756  ? 273.904 25.200  2.488   1.00 41.67  ? 823  ARG A CB  1 
ATOM 5477  C CG  . ARG A 1 756  ? 275.151 25.183  1.573   1.00 41.67  ? 823  ARG A CG  1 
ATOM 5478  C CD  . ARG A 1 756  ? 276.414 24.945  2.364   1.00 41.67  ? 823  ARG A CD  1 
ATOM 5479  N NE  . ARG A 1 756  ? 276.450 25.836  3.520   1.00 41.67  ? 823  ARG A NE  1 
ATOM 5480  C CZ  . ARG A 1 756  ? 276.661 27.151  3.459   1.00 41.67  ? 823  ARG A CZ  1 
ATOM 5481  N NH1 . ARG A 1 756  ? 276.876 27.736  2.285   1.00 41.67  ? 823  ARG A NH1 1 
ATOM 5482  N NH2 . ARG A 1 756  ? 276.606 27.892  4.570   1.00 41.67  ? 823  ARG A NH2 1 
ATOM 5483  N N   . ALA A 1 757  ? 271.621 27.078  0.387   1.00 41.67  ? 824  ALA A N   1 
ATOM 5484  C CA  . ALA A 1 757  ? 271.384 27.297  -1.027  1.00 41.67  ? 824  ALA A CA  1 
ATOM 5485  C C   . ALA A 1 757  ? 271.620 25.853  -1.508  1.00 41.67  ? 824  ALA A C   1 
ATOM 5486  O O   . ALA A 1 757  ? 271.657 25.569  -2.710  1.00 41.67  ? 824  ALA A O   1 
ATOM 5487  C CB  . ALA A 1 757  ? 272.438 28.277  -1.620  1.00 41.67  ? 824  ALA A CB  1 
ATOM 5488  N N   . VAL A 1 758  ? 271.808 24.939  -0.543  1.00 41.67  ? 825  VAL A N   1 
ATOM 5489  C CA  . VAL A 1 758  ? 272.010 23.546  -0.897  1.00 41.67  ? 825  VAL A CA  1 
ATOM 5490  C C   . VAL A 1 758  ? 270.727 23.426  -1.618  1.00 41.67  ? 825  VAL A C   1 
ATOM 5491  O O   . VAL A 1 758  ? 270.710 22.954  -2.717  1.00 41.67  ? 825  VAL A O   1 
ATOM 5492  C CB  . VAL A 1 758  ? 271.936 22.543  0.251   1.00 41.67  ? 825  VAL A CB  1 
ATOM 5493  C CG1 . VAL A 1 758  ? 271.855 21.137  -0.347  1.00 41.67  ? 825  VAL A CG1 1 
ATOM 5494  C CG2 . VAL A 1 758  ? 273.150 22.637  1.136   1.00 41.67  ? 825  VAL A CG2 1 
ATOM 5495  N N   . ILE A 1 759  ? 269.656 23.896  -0.979  1.00 41.67  ? 826  ILE A N   1 
ATOM 5496  C CA  . ILE A 1 759  ? 268.323 23.900  -1.567  1.00 41.67  ? 826  ILE A CA  1 
ATOM 5497  C C   . ILE A 1 759  ? 268.383 24.462  -2.997  1.00 41.67  ? 826  ILE A C   1 
ATOM 5498  O O   . ILE A 1 759  ? 267.752 23.931  -3.916  1.00 41.67  ? 826  ILE A O   1 
ATOM 5499  C CB  . ILE A 1 759  ? 267.388 24.769  -0.712  1.00 41.67  ? 826  ILE A CB  1 
ATOM 5500  C CG1 . ILE A 1 759  ? 268.203 25.869  -0.022  1.00 41.67  ? 826  ILE A CG1 1 
ATOM 5501  C CG2 . ILE A 1 759  ? 266.669 23.908  0.293   1.00 41.67  ? 826  ILE A CG2 1 
ATOM 5502  C CD1 . ILE A 1 759  ? 267.430 26.678  0.971   1.00 41.67  ? 826  ILE A CD1 1 
ATOM 5503  N N   . ARG A 1 760  ? 269.184 25.517  -3.164  1.00 41.67  ? 827  ARG A N   1 
ATOM 5504  C CA  . ARG A 1 760  ? 269.365 26.223  -4.437  1.00 41.67  ? 827  ARG A CA  1 
ATOM 5505  C C   . ARG A 1 760  ? 269.975 25.465  -5.637  1.00 41.67  ? 827  ARG A C   1 
ATOM 5506  O O   . ARG A 1 760  ? 269.324 25.306  -6.681  1.00 41.67  ? 827  ARG A O   1 
ATOM 5507  C CB  . ARG A 1 760  ? 270.141 27.529  -4.167  1.00 41.67  ? 827  ARG A CB  1 
ATOM 5508  C CG  . ARG A 1 760  ? 271.438 27.710  -4.931  1.00 41.67  ? 827  ARG A CG  1 
ATOM 5509  C CD  . ARG A 1 760  ? 271.199 28.171  -6.355  1.00 41.67  ? 827  ARG A CD  1 
ATOM 5510  N NE  . ARG A 1 760  ? 270.498 29.452  -6.422  1.00 41.67  ? 827  ARG A NE  1 
ATOM 5511  C CZ  . ARG A 1 760  ? 270.844 30.534  -5.731  1.00 41.67  ? 827  ARG A CZ  1 
ATOM 5512  N NH1 . ARG A 1 760  ? 271.871 30.503  -4.911  1.00 41.67  ? 827  ARG A NH1 1 
ATOM 5513  N NH2 . ARG A 1 760  ? 270.175 31.661  -5.880  1.00 41.67  ? 827  ARG A NH2 1 
ATOM 5514  N N   . HIS A 1 761  ? 271.214 25.003  -5.499  1.00 41.67  ? 828  HIS A N   1 
ATOM 5515  C CA  . HIS A 1 761  ? 271.898 24.296  -6.588  1.00 41.67  ? 828  HIS A CA  1 
ATOM 5516  C C   . HIS A 1 761  ? 271.131 23.086  -7.186  1.00 41.67  ? 828  HIS A C   1 
ATOM 5517  O O   . HIS A 1 761  ? 271.028 22.961  -8.410  1.00 41.67  ? 828  HIS A O   1 
ATOM 5518  C CB  . HIS A 1 761  ? 273.306 23.862  -6.112  1.00 41.67  ? 828  HIS A CB  1 
ATOM 5519  C CG  . HIS A 1 761  ? 274.268 23.539  -7.226  1.00 41.67  ? 828  HIS A CG  1 
ATOM 5520  N ND1 . HIS A 1 761  ? 275.389 22.756  -7.035  1.00 41.67  ? 828  HIS A ND1 1 
ATOM 5521  C CD2 . HIS A 1 761  ? 274.278 23.894  -8.535  1.00 41.67  ? 828  HIS A CD2 1 
ATOM 5522  C CE1 . HIS A 1 761  ? 276.043 22.637  -8.178  1.00 41.67  ? 828  HIS A CE1 1 
ATOM 5523  N NE2 . HIS A 1 761  ? 275.390 23.319  -9.103  1.00 41.67  ? 828  HIS A NE2 1 
ATOM 5524  N N   . PRO A 1 762  ? 270.567 22.205  -6.331  1.00 41.67  ? 829  PRO A N   1 
ATOM 5525  C CA  . PRO A 1 762  ? 269.810 20.994  -6.671  1.00 41.67  ? 829  PRO A CA  1 
ATOM 5526  C C   . PRO A 1 762  ? 268.779 21.154  -7.765  1.00 41.67  ? 829  PRO A C   1 
ATOM 5527  O O   . PRO A 1 762  ? 268.486 20.185  -8.477  1.00 41.67  ? 829  PRO A O   1 
ATOM 5528  C CB  . PRO A 1 762  ? 269.123 20.620  -5.352  1.00 41.67  ? 829  PRO A CB  1 
ATOM 5529  C CG  . PRO A 1 762  ? 270.028 21.120  -4.352  1.00 41.67  ? 829  PRO A CG  1 
ATOM 5530  C CD  . PRO A 1 762  ? 270.384 22.484  -4.905  1.00 41.67  ? 829  PRO A CD  1 
ATOM 5531  N N   . ASP A 1 763  ? 268.239 22.369  -7.883  1.00 48.28  ? 830  ASP A N   1 
ATOM 5532  C CA  . ASP A 1 763  ? 267.186 22.684  -8.846  1.00 47.89  ? 830  ASP A CA  1 
ATOM 5533  C C   . ASP A 1 763  ? 265.961 22.326  -8.003  1.00 47.89  ? 830  ASP A C   1 
ATOM 5534  O O   . ASP A 1 763  ? 266.011 21.348  -7.244  1.00 47.60  ? 830  ASP A O   1 
ATOM 5535  C CB  . ASP A 1 763  ? 267.272 21.772  -10.081 1.00 48.13  ? 830  ASP A CB  1 
ATOM 5536  C CG  . ASP A 1 763  ? 268.689 21.688  -10.666 1.00 47.86  ? 830  ASP A CG  1 
ATOM 5537  O OD1 . ASP A 1 763  ? 268.913 20.881  -11.601 1.00 48.08  ? 830  ASP A OD1 1 
ATOM 5538  O OD2 . ASP A 1 763  ? 269.579 22.426  -10.188 1.00 47.56  ? 830  ASP A OD2 1 
ATOM 5539  N N   . TYR A 1 764  ? 264.878 23.100  -8.109  1.00 60.89  ? 831  TYR A N   1 
ATOM 5540  C CA  . TYR A 1 764  ? 263.676 22.845  -7.285  1.00 63.04  ? 831  TYR A CA  1 
ATOM 5541  C C   . TYR A 1 764  ? 262.496 23.787  -7.582  1.00 63.96  ? 831  TYR A C   1 
ATOM 5542  O O   . TYR A 1 764  ? 262.626 25.015  -7.463  1.00 63.70  ? 831  TYR A O   1 
ATOM 5543  C CB  . TYR A 1 764  ? 264.049 22.963  -5.800  1.00 62.48  ? 831  TYR A CB  1 
ATOM 5544  C CG  . TYR A 1 764  ? 264.859 24.205  -5.481  1.00 63.17  ? 831  TYR A CG  1 
ATOM 5545  C CD1 . TYR A 1 764  ? 265.959 24.567  -6.268  1.00 62.77  ? 831  TYR A CD1 1 
ATOM 5546  C CD2 . TYR A 1 764  ? 264.518 25.030  -4.411  1.00 62.75  ? 831  TYR A CD2 1 
ATOM 5547  C CE1 . TYR A 1 764  ? 266.681 25.701  -6.013  1.00 63.15  ? 831  TYR A CE1 1 
ATOM 5548  C CE2 . TYR A 1 764  ? 265.249 26.183  -4.140  1.00 62.95  ? 831  TYR A CE2 1 
ATOM 5549  C CZ  . TYR A 1 764  ? 266.326 26.510  -4.950  1.00 62.52  ? 831  TYR A CZ  1 
ATOM 5550  O OH  . TYR A 1 764  ? 267.046 27.655  -4.715  1.00 59.85  ? 831  TYR A OH  1 
ATOM 5551  N N   . ASP A 1 765  ? 261.347 23.209  -7.948  1.00 74.45  ? 832  ASP A N   1 
ATOM 5552  C CA  . ASP A 1 765  ? 260.146 23.994  -8.280  1.00 75.33  ? 832  ASP A CA  1 
ATOM 5553  C C   . ASP A 1 765  ? 259.842 25.081  -7.260  1.00 76.88  ? 832  ASP A C   1 
ATOM 5554  O O   . ASP A 1 765  ? 259.752 26.268  -7.601  1.00 76.51  ? 832  ASP A O   1 
ATOM 5555  C CB  . ASP A 1 765  ? 258.891 23.100  -8.393  1.00 74.47  ? 832  ASP A CB  1 
ATOM 5556  C CG  . ASP A 1 765  ? 258.882 22.228  -9.642  1.00 78.74  ? 832  ASP A CG  1 
ATOM 5557  O OD1 . ASP A 1 765  ? 259.536 22.588  -10.642 1.00 79.39  ? 832  ASP A OD1 1 
ATOM 5558  O OD2 . ASP A 1 765  ? 258.195 21.184  -9.629  1.00 78.60  ? 832  ASP A OD2 1 
ATOM 5559  N N   . GLU A 1 766  ? 259.690 24.650  -6.011  1.00 88.20  ? 833  GLU A N   1 
ATOM 5560  C CA  . GLU A 1 766  ? 259.348 25.530  -4.904  1.00 89.25  ? 833  GLU A CA  1 
ATOM 5561  C C   . GLU A 1 766  ? 257.831 25.573  -4.855  1.00 89.10  ? 833  GLU A C   1 
ATOM 5562  O O   . GLU A 1 766  ? 257.234 26.231  -4.001  1.00 89.08  ? 833  GLU A O   1 
ATOM 5563  C CB  . GLU A 1 766  ? 259.913 26.932  -5.118  1.00 88.51  ? 833  GLU A CB  1 
ATOM 5564  C CG  . GLU A 1 766  ? 261.301 27.093  -4.598  1.00 88.90  ? 833  GLU A CG  1 
ATOM 5565  C CD  . GLU A 1 766  ? 261.355 28.172  -3.569  1.00 88.97  ? 833  GLU A CD  1 
ATOM 5566  O OE1 . GLU A 1 766  ? 260.503 28.146  -2.655  1.00 89.25  ? 833  GLU A OE1 1 
ATOM 5567  O OE2 . GLU A 1 766  ? 262.240 29.042  -3.677  1.00 88.54  ? 833  GLU A OE2 1 
ATOM 5568  N N   . GLU A 1 767  ? 257.221 24.864  -5.798  1.00 93.24  ? 834  GLU A N   1 
ATOM 5569  C CA  . GLU A 1 767  ? 255.774 24.766  -5.886  1.00 93.38  ? 834  GLU A CA  1 
ATOM 5570  C C   . GLU A 1 767  ? 255.429 23.325  -5.633  1.00 92.55  ? 834  GLU A C   1 
ATOM 5571  O O   . GLU A 1 767  ? 254.282 22.896  -5.785  1.00 92.53  ? 834  GLU A O   1 
ATOM 5572  C CB  . GLU A 1 767  ? 255.288 25.161  -7.264  1.00 93.10  ? 834  GLU A CB  1 
ATOM 5573  C CG  . GLU A 1 767  ? 255.288 26.634  -7.480  1.00 92.77  ? 834  GLU A CG  1 
ATOM 5574  C CD  . GLU A 1 767  ? 254.285 27.026  -8.529  1.00 93.34  ? 834  GLU A CD  1 
ATOM 5575  O OE1 . GLU A 1 767  ? 253.124 26.560  -8.430  1.00 92.68  ? 834  GLU A OE1 1 
ATOM 5576  O OE2 . GLU A 1 767  ? 254.653 27.796  -9.443  1.00 92.51  ? 834  GLU A OE2 1 
ATOM 5577  N N   . GLY A 1 768  ? 256.454 22.577  -5.258  1.00 92.56  ? 835  GLY A N   1 
ATOM 5578  C CA  . GLY A 1 768  ? 256.263 21.183  -4.960  1.00 93.37  ? 835  GLY A CA  1 
ATOM 5579  C C   . GLY A 1 768  ? 256.443 20.889  -3.481  1.00 101.28 ? 835  GLY A C   1 
ATOM 5580  O O   . GLY A 1 768  ? 256.857 21.749  -2.706  1.00 100.18 ? 835  GLY A O   1 
ATOM 5581  N N   . LEU A 1 769  ? 256.129 19.664  -3.088  1.00 99.79  ? 836  LEU A N   1 
ATOM 5582  C CA  . LEU A 1 769  ? 256.258 19.256  -1.710  1.00 98.39  ? 836  LEU A CA  1 
ATOM 5583  C C   . LEU A 1 769  ? 257.560 18.472  -1.552  1.00 97.10  ? 836  LEU A C   1 
ATOM 5584  O O   . LEU A 1 769  ? 257.926 17.690  -2.423  1.00 96.42  ? 836  LEU A O   1 
ATOM 5585  C CB  . LEU A 1 769  ? 255.060 18.386  -1.332  1.00 99.05  ? 836  LEU A CB  1 
ATOM 5586  C CG  . LEU A 1 769  ? 253.662 18.861  -1.754  1.00 98.88  ? 836  LEU A CG  1 
ATOM 5587  C CD1 . LEU A 1 769  ? 252.677 17.748  -1.474  1.00 99.25  ? 836  LEU A CD1 1 
ATOM 5588  C CD2 . LEU A 1 769  ? 253.254 20.132  -1.021  1.00 99.18  ? 836  LEU A CD2 1 
ATOM 5589  N N   . TYR A 1 770  ? 258.262 18.701  -0.447  1.00 96.16  ? 837  TYR A N   1 
ATOM 5590  C CA  . TYR A 1 770  ? 259.514 18.002  -0.162  1.00 95.24  ? 837  TYR A CA  1 
ATOM 5591  C C   . TYR A 1 770  ? 259.513 17.267  1.166   1.00 95.02  ? 837  TYR A C   1 
ATOM 5592  O O   . TYR A 1 770  ? 260.571 17.053  1.747   1.00 95.27  ? 837  TYR A O   1 
ATOM 5593  C CB  . TYR A 1 770  ? 260.683 18.962  -0.121  1.00 94.35  ? 837  TYR A CB  1 
ATOM 5594  C CG  . TYR A 1 770  ? 261.064 19.534  -1.439  1.00 94.88  ? 837  TYR A CG  1 
ATOM 5595  C CD1 . TYR A 1 770  ? 262.050 20.506  -1.516  1.00 96.00  ? 837  TYR A CD1 1 
ATOM 5596  C CD2 . TYR A 1 770  ? 260.438 19.127  -2.607  1.00 95.78  ? 837  TYR A CD2 1 
ATOM 5597  C CE1 . TYR A 1 770  ? 262.404 21.066  -2.718  1.00 97.02  ? 837  TYR A CE1 1 
ATOM 5598  C CE2 . TYR A 1 770  ? 260.785 19.677  -3.817  1.00 96.28  ? 837  TYR A CE2 1 
ATOM 5599  C CZ  . TYR A 1 770  ? 261.770 20.650  -3.867  1.00 96.46  ? 837  TYR A CZ  1 
ATOM 5600  O OH  . TYR A 1 770  ? 262.117 21.219  -5.065  1.00 96.27  ? 837  TYR A OH  1 
ATOM 5601  N N   . GLY A 1 771  ? 258.340 16.891  1.658   1.00 94.37  ? 838  GLY A N   1 
ATOM 5602  C CA  . GLY A 1 771  ? 258.281 16.174  2.919   1.00 93.78  ? 838  GLY A CA  1 
ATOM 5603  C C   . GLY A 1 771  ? 258.609 14.701  2.792   1.00 93.34  ? 838  GLY A C   1 
ATOM 5604  O O   . GLY A 1 771  ? 258.902 14.219  1.702   1.00 93.19  ? 838  GLY A O   1 
ATOM 5605  N N   . ALA A 1 772  ? 258.560 13.975  3.904   1.00 93.21  ? 839  ALA A N   1 
ATOM 5606  C CA  . ALA A 1 772  ? 258.876 12.551  3.872   1.00 92.38  ? 839  ALA A CA  1 
ATOM 5607  C C   . ALA A 1 772  ? 258.039 11.696  4.817   1.00 92.46  ? 839  ALA A C   1 
ATOM 5608  O O   . ALA A 1 772  ? 257.561 12.171  5.847   1.00 92.41  ? 839  ALA A O   1 
ATOM 5609  C CB  . ALA A 1 772  ? 260.344 12.352  4.170   1.00 91.59  ? 839  ALA A CB  1 
ATOM 5610  N N   . ILE A 1 773  ? 257.864 10.429  4.448   1.00 92.63  ? 840  ILE A N   1 
ATOM 5611  C CA  . ILE A 1 773  ? 257.096 9.491   5.258   1.00 92.70  ? 840  ILE A CA  1 
ATOM 5612  C C   . ILE A 1 773  ? 258.074 8.516   5.842   1.00 92.36  ? 840  ILE A C   1 
ATOM 5613  O O   . ILE A 1 773  ? 259.079 8.165   5.215   1.00 91.37  ? 840  ILE A O   1 
ATOM 5614  C CB  . ILE A 1 773  ? 256.132 8.616   4.457   1.00 92.42  ? 840  ILE A CB  1 
ATOM 5615  C CG1 . ILE A 1 773  ? 255.575 9.379   3.280   1.00 91.72  ? 840  ILE A CG1 1 
ATOM 5616  C CG2 . ILE A 1 773  ? 255.002 8.160   5.341   1.00 93.27  ? 840  ILE A CG2 1 
ATOM 5617  C CD1 . ILE A 1 773  ? 255.509 8.527   2.051   1.00 91.71  ? 840  ILE A CD1 1 
ATOM 5618  N N   . LEU A 1 774  ? 257.756 8.062   7.041   1.00 92.61  ? 841  LEU A N   1 
ATOM 5619  C CA  . LEU A 1 774  ? 258.584 7.098   7.725   1.00 92.57  ? 841  LEU A CA  1 
ATOM 5620  C C   . LEU A 1 774  ? 257.699 5.938   8.156   1.00 91.16  ? 841  LEU A C   1 
ATOM 5621  O O   . LEU A 1 774  ? 256.646 6.138   8.764   1.00 90.37  ? 841  LEU A O   1 
ATOM 5622  C CB  . LEU A 1 774  ? 259.268 7.750   8.927   1.00 95.08  ? 841  LEU A CB  1 
ATOM 5623  C CG  . LEU A 1 774  ? 260.284 8.815   8.513   1.00 97.16  ? 841  LEU A CG  1 
ATOM 5624  C CD1 . LEU A 1 774  ? 261.035 9.312   9.732   1.00 97.32  ? 841  LEU A CD1 1 
ATOM 5625  C CD2 . LEU A 1 774  ? 261.257 8.219   7.495   1.00 97.11  ? 841  LEU A CD2 1 
ATOM 5626  N N   . PRO A 1 775  ? 258.105 4.707   7.810   1.00 90.84  ? 842  PRO A N   1 
ATOM 5627  C CA  . PRO A 1 775  ? 257.414 3.449   8.115   1.00 90.85  ? 842  PRO A CA  1 
ATOM 5628  C C   . PRO A 1 775  ? 257.999 2.706   9.325   1.00 90.36  ? 842  PRO A C   1 
ATOM 5629  O O   . PRO A 1 775  ? 259.206 2.649   9.505   1.00 90.81  ? 842  PRO A O   1 
ATOM 5630  C CB  . PRO A 1 775  ? 257.555 2.654   6.810   1.00 91.85  ? 842  PRO A CB  1 
ATOM 5631  C CG  . PRO A 1 775  ? 258.623 3.429   5.965   1.00 91.62  ? 842  PRO A CG  1 
ATOM 5632  C CD  . PRO A 1 775  ? 259.214 4.468   6.875   1.00 90.93  ? 842  PRO A CD  1 
ATOM 5633  N N   . GLN A 1 776  ? 257.148 2.131   10.162  1.00 89.45  ? 843  GLN A N   1 
ATOM 5634  C CA  . GLN A 1 776  ? 257.654 1.426   11.328  1.00 90.11  ? 843  GLN A CA  1 
ATOM 5635  C C   . GLN A 1 776  ? 258.408 0.179   10.948  1.00 90.74  ? 843  GLN A C   1 
ATOM 5636  O O   . GLN A 1 776  ? 257.831 -0.833  10.551  1.00 91.80  ? 843  GLN A O   1 
ATOM 5637  C CB  . GLN A 1 776  ? 256.532 1.024   12.268  1.00 89.27  ? 843  GLN A CB  1 
ATOM 5638  C CG  . GLN A 1 776  ? 255.700 -0.127  11.762  1.00 88.39  ? 843  GLN A CG  1 
ATOM 5639  C CD  . GLN A 1 776  ? 254.807 0.279   10.627  1.00 87.80  ? 843  GLN A CD  1 
ATOM 5640  O OE1 . GLN A 1 776  ? 254.761 1.454   10.249  1.00 86.80  ? 843  GLN A OE1 1 
ATOM 5641  N NE2 . GLN A 1 776  ? 254.075 -0.687  10.077  1.00 86.02  ? 843  GLN A NE2 1 
ATOM 5642  N N   . VAL A 1 777  ? 259.718 0.257   11.061  1.00 90.52  ? 844  VAL A N   1 
ATOM 5643  C CA  . VAL A 1 777  ? 260.524 -0.893  10.761  1.00 89.81  ? 844  VAL A CA  1 
ATOM 5644  C C   . VAL A 1 777  ? 260.710 -1.494  12.107  1.00 88.50  ? 844  VAL A C   1 
ATOM 5645  O O   . VAL A 1 777  ? 261.511 -1.017  12.901  1.00 88.96  ? 844  VAL A O   1 
ATOM 5646  C CB  . VAL A 1 777  ? 261.892 -0.515  10.184  1.00 91.29  ? 844  VAL A CB  1 
ATOM 5647  C CG1 . VAL A 1 777  ? 262.512 0.616   10.980  1.00 92.10  ? 844  VAL A CG1 1 
ATOM 5648  C CG2 . VAL A 1 777  ? 262.793 -1.735  10.191  1.00 90.89  ? 844  VAL A CG2 1 
ATOM 5649  N N   . VAL A 1 778  ? 259.947 -2.529  12.394  1.00 87.00  ? 845  VAL A N   1 
ATOM 5650  C CA  . VAL A 1 778  ? 260.088 -3.115  13.693  1.00 85.44  ? 845  VAL A CA  1 
ATOM 5651  C C   . VAL A 1 778  ? 261.504 -3.551  13.986  1.00 84.26  ? 845  VAL A C   1 
ATOM 5652  O O   . VAL A 1 778  ? 262.055 -4.449  13.324  1.00 84.10  ? 845  VAL A O   1 
ATOM 5653  C CB  . VAL A 1 778  ? 259.118 -4.273  13.900  1.00 85.39  ? 845  VAL A CB  1 
ATOM 5654  C CG1 . VAL A 1 778  ? 259.599 -5.170  14.994  1.00 85.06  ? 845  VAL A CG1 1 
ATOM 5655  C CG2 . VAL A 1 778  ? 257.765 -3.737  14.291  1.00 87.18  ? 845  VAL A CG2 1 
ATOM 5656  N N   . THR A 1 779  ? 262.107 -2.863  14.954  1.00 82.43  ? 846  THR A N   1 
ATOM 5657  C CA  . THR A 1 779  ? 263.435 -3.222  15.409  1.00 80.48  ? 846  THR A CA  1 
ATOM 5658  C C   . THR A 1 779  ? 263.064 -4.659  15.760  1.00 79.43  ? 846  THR A C   1 
ATOM 5659  O O   . THR A 1 779  ? 261.991 -4.881  16.307  1.00 80.29  ? 846  THR A O   1 
ATOM 5660  C CB  . THR A 1 779  ? 263.813 -2.440  16.692  1.00 80.06  ? 846  THR A CB  1 
ATOM 5661  O OG1 . THR A 1 779  ? 262.964 -2.843  17.773  1.00 79.58  ? 846  THR A OG1 1 
ATOM 5662  C CG2 . THR A 1 779  ? 263.628 -0.953  16.480  1.00 80.82  ? 846  THR A CG2 1 
ATOM 5663  N N   . ALA A 1 780  ? 263.897 -5.636  15.418  1.00 76.63  ? 847  ALA A N   1 
ATOM 5664  C CA  . ALA A 1 780  ? 263.556 -7.030  15.702  1.00 73.70  ? 847  ALA A CA  1 
ATOM 5665  C C   . ALA A 1 780  ? 262.271 -7.386  14.960  1.00 72.34  ? 847  ALA A C   1 
ATOM 5666  O O   . ALA A 1 780  ? 262.219 -7.292  13.726  1.00 73.36  ? 847  ALA A O   1 
ATOM 5667  C CB  . ALA A 1 780  ? 263.376 -7.257  17.210  1.00 72.33  ? 847  ALA A CB  1 
ATOM 5668  N N   . GLY A 1 781  ? 261.231 -7.766  15.708  1.00 69.97  ? 848  GLY A N   1 
ATOM 5669  C CA  . GLY A 1 781  ? 259.979 -8.163  15.082  1.00 66.88  ? 848  GLY A CA  1 
ATOM 5670  C C   . GLY A 1 781  ? 260.343 -9.439  14.361  1.00 64.16  ? 848  GLY A C   1 
ATOM 5671  O O   . GLY A 1 781  ? 261.531 -9.728  14.271  1.00 63.44  ? 848  GLY A O   1 
ATOM 5672  N N   . THR A 1 782  ? 259.397 -10.217 13.844  1.00 61.50  ? 849  THR A N   1 
ATOM 5673  C CA  . THR A 1 782  ? 259.833 -11.449 13.196  1.00 59.87  ? 849  THR A CA  1 
ATOM 5674  C C   . THR A 1 782  ? 260.445 -12.237 14.357  1.00 58.43  ? 849  THR A C   1 
ATOM 5675  O O   . THR A 1 782  ? 260.747 -11.667 15.408  1.00 58.20  ? 849  THR A O   1 
ATOM 5676  C CB  . THR A 1 782  ? 261.003 -11.178 12.188  1.00 60.45  ? 849  THR A CB  1 
ATOM 5677  O OG1 . THR A 1 782  ? 260.607 -10.173 11.246  1.00 60.94  ? 849  THR A OG1 1 
ATOM 5678  C CG2 . THR A 1 782  ? 261.417 -12.458 11.471  1.00 60.51  ? 849  THR A CG2 1 
ATOM 5679  N N   . ILE A 1 783  ? 260.619 -13.540 14.211  1.00 57.13  ? 850  ILE A N   1 
ATOM 5680  C CA  . ILE A 1 783  ? 261.294 -14.244 15.288  1.00 54.96  ? 850  ILE A CA  1 
ATOM 5681  C C   . ILE A 1 783  ? 262.760 -14.190 14.859  1.00 54.01  ? 850  ILE A C   1 
ATOM 5682  O O   . ILE A 1 783  ? 263.688 -14.335 15.659  1.00 53.43  ? 850  ILE A O   1 
ATOM 5683  C CB  . ILE A 1 783  ? 260.807 -15.699 15.460  1.00 53.49  ? 850  ILE A CB  1 
ATOM 5684  C CG1 . ILE A 1 783  ? 260.906 -16.465 14.147  1.00 54.05  ? 850  ILE A CG1 1 
ATOM 5685  C CG2 . ILE A 1 783  ? 259.411 -15.687 16.022  1.00 53.44  ? 850  ILE A CG2 1 
ATOM 5686  C CD1 . ILE A 1 783  ? 259.601 -16.620 13.390  1.00 91.71  ? 850  ILE A CD1 1 
ATOM 5687  N N   . THR A 1 784  ? 262.951 -13.938 13.571  1.00 52.72  ? 851  THR A N   1 
ATOM 5688  C CA  . THR A 1 784  ? 264.279 -13.818 13.008  1.00 52.10  ? 851  THR A CA  1 
ATOM 5689  C C   . THR A 1 784  ? 264.785 -12.415 13.306  1.00 52.80  ? 851  THR A C   1 
ATOM 5690  O O   . THR A 1 784  ? 265.987 -12.158 13.295  1.00 52.81  ? 851  THR A O   1 
ATOM 5691  C CB  . THR A 1 784  ? 264.236 -14.033 11.508  1.00 51.35  ? 851  THR A CB  1 
ATOM 5692  O OG1 . THR A 1 784  ? 264.951 -15.229 11.191  1.00 50.83  ? 851  THR A OG1 1 
ATOM 5693  C CG2 . THR A 1 784  ? 264.853 -12.864 10.782  1.00 51.57  ? 851  THR A CG2 1 
ATOM 5694  N N   . ARG A 1 785  ? 263.836 -11.519 13.568  1.00 52.58  ? 852  ARG A N   1 
ATOM 5695  C CA  . ARG A 1 785  ? 264.100 -10.123 13.906  1.00 51.97  ? 852  ARG A CA  1 
ATOM 5696  C C   . ARG A 1 785  ? 264.298 -9.320  12.654  1.00 50.61  ? 852  ARG A C   1 
ATOM 5697  O O   . ARG A 1 785  ? 264.515 -8.108  12.698  1.00 49.73  ? 852  ARG A O   1 
ATOM 5698  C CB  . ARG A 1 785  ? 265.367 -9.980  14.750  1.00 54.38  ? 852  ARG A CB  1 
ATOM 5699  C CG  . ARG A 1 785  ? 265.615 -11.063 15.799  1.00 56.07  ? 852  ARG A CG  1 
ATOM 5700  C CD  . ARG A 1 785  ? 267.014 -10.874 16.400  1.00 57.04  ? 852  ARG A CD  1 
ATOM 5701  N NE  . ARG A 1 785  ? 267.714 -12.123 16.718  1.00 57.25  ? 852  ARG A NE  1 
ATOM 5702  C CZ  . ARG A 1 785  ? 268.922 -12.462 16.252  1.00 57.79  ? 852  ARG A CZ  1 
ATOM 5703  N NH1 . ARG A 1 785  ? 269.602 -11.660 15.431  1.00 56.53  ? 852  ARG A NH1 1 
ATOM 5704  N NH2 . ARG A 1 785  ? 269.466 -13.616 16.616  1.00 58.49  ? 852  ARG A NH2 1 
ATOM 5705  N N   . ARG A 1 786  ? 264.210 -10.000 11.527  1.00 50.46  ? 853  ARG A N   1 
ATOM 5706  C CA  . ARG A 1 786  ? 264.467 -9.343  10.268  1.00 52.60  ? 853  ARG A CA  1 
ATOM 5707  C C   . ARG A 1 786  ? 263.834 -7.967  10.031  1.00 53.27  ? 853  ARG A C   1 
ATOM 5708  O O   . ARG A 1 786  ? 264.559 -7.008  9.759   1.00 53.21  ? 853  ARG A O   1 
ATOM 5709  C CB  . ARG A 1 786  ? 264.135 -10.286 9.105   1.00 52.83  ? 853  ARG A CB  1 
ATOM 5710  C CG  . ARG A 1 786  ? 265.141 -10.219 7.926   1.00 52.88  ? 853  ARG A CG  1 
ATOM 5711  C CD  . ARG A 1 786  ? 266.477 -10.940 8.221   1.00 53.36  ? 853  ARG A CD  1 
ATOM 5712  N NE  . ARG A 1 786  ? 267.218 -11.239 6.988   1.00 52.94  ? 853  ARG A NE  1 
ATOM 5713  C CZ  . ARG A 1 786  ? 268.094 -12.233 6.850   1.00 53.03  ? 853  ARG A CZ  1 
ATOM 5714  N NH1 . ARG A 1 786  ? 268.354 -13.037 7.876   1.00 53.09  ? 853  ARG A NH1 1 
ATOM 5715  N NH2 . ARG A 1 786  ? 268.688 -12.441 5.675   1.00 51.61  ? 853  ARG A NH2 1 
ATOM 5716  N N   . ALA A 1 787  ? 262.515 -7.836  10.145  1.00 53.66  ? 854  ALA A N   1 
ATOM 5717  C CA  . ALA A 1 787  ? 261.927 -6.542  9.855   1.00 53.87  ? 854  ALA A CA  1 
ATOM 5718  C C   . ALA A 1 787  ? 260.440 -6.617  9.937   1.00 54.48  ? 854  ALA A C   1 
ATOM 5719  O O   . ALA A 1 787  ? 259.863 -7.692  9.843   1.00 54.00  ? 854  ALA A O   1 
ATOM 5720  C CB  . ALA A 1 787  ? 262.320 -6.118  8.460   1.00 55.88  ? 854  ALA A CB  1 
ATOM 5721  N N   . VAL A 1 788  ? 259.810 -5.462  10.080  1.00 55.47  ? 855  VAL A N   1 
ATOM 5722  C CA  . VAL A 1 788  ? 258.361 -5.433  10.168  1.00 56.28  ? 855  VAL A CA  1 
ATOM 5723  C C   . VAL A 1 788  ? 257.669 -4.199  9.585   1.00 56.26  ? 855  VAL A C   1 
ATOM 5724  O O   . VAL A 1 788  ? 257.155 -3.332  10.302  1.00 53.81  ? 855  VAL A O   1 
ATOM 5725  C CB  . VAL A 1 788  ? 257.909 -5.611  11.614  1.00 56.75  ? 855  VAL A CB  1 
ATOM 5726  C CG1 . VAL A 1 788  ? 256.411 -5.859  11.665  1.00 57.84  ? 855  VAL A CG1 1 
ATOM 5727  C CG2 . VAL A 1 788  ? 258.666 -6.760  12.253  1.00 56.14  ? 855  VAL A CG2 1 
ATOM 5728  N N   . GLU A 1 789  ? 257.677 -4.141  8.262   1.00 57.67  ? 856  GLU A N   1 
ATOM 5729  C CA  . GLU A 1 789  ? 257.017 -3.091  7.498   1.00 59.88  ? 856  GLU A CA  1 
ATOM 5730  C C   . GLU A 1 789  ? 256.460 -3.883  6.325   1.00 60.93  ? 856  GLU A C   1 
ATOM 5731  O O   . GLU A 1 789  ? 257.177 -4.157  5.352   1.00 61.61  ? 856  GLU A O   1 
ATOM 5732  C CB  . GLU A 1 789  ? 257.998 -2.069  6.939   1.00 60.20  ? 856  GLU A CB  1 
ATOM 5733  C CG  . GLU A 1 789  ? 258.705 -1.167  7.920   1.00 60.24  ? 856  GLU A CG  1 
ATOM 5734  C CD  . GLU A 1 789  ? 259.536 -0.130  7.173   1.00 59.76  ? 856  GLU A CD  1 
ATOM 5735  O OE1 . GLU A 1 789  ? 258.948 0.551   6.295   1.00 58.03  ? 856  GLU A OE1 1 
ATOM 5736  O OE2 . GLU A 1 789  ? 260.762 -0.006  7.441   1.00 61.10  ? 856  GLU A OE2 1 
ATOM 5737  N N   . PRO A 1 790  ? 255.189 -4.290  6.407   1.00 61.77  ? 857  PRO A N   1 
ATOM 5738  C CA  . PRO A 1 790  ? 254.655 -5.051  5.285   1.00 63.07  ? 857  PRO A CA  1 
ATOM 5739  C C   . PRO A 1 790  ? 255.002 -4.304  4.005   1.00 64.62  ? 857  PRO A C   1 
ATOM 5740  O O   . PRO A 1 790  ? 255.870 -4.688  3.225   1.00 64.97  ? 857  PRO A O   1 
ATOM 5741  C CB  . PRO A 1 790  ? 253.155 -5.050  5.568   1.00 62.66  ? 857  PRO A CB  1 
ATOM 5742  C CG  . PRO A 1 790  ? 253.089 -5.001  7.037   1.00 62.53  ? 857  PRO A CG  1 
ATOM 5743  C CD  . PRO A 1 790  ? 254.117 -3.947  7.350   1.00 61.19  ? 857  PRO A CD  1 
ATOM 5744  N N   . THR A 1 791  ? 254.325 -3.193  3.833   1.00 66.13  ? 858  THR A N   1 
ATOM 5745  C CA  . THR A 1 791  ? 254.512 -2.376  2.675   1.00 68.48  ? 858  THR A CA  1 
ATOM 5746  C C   . THR A 1 791  ? 255.945 -2.090  2.238   1.00 69.66  ? 858  THR A C   1 
ATOM 5747  O O   . THR A 1 791  ? 256.381 -2.544  1.187   1.00 69.93  ? 858  THR A O   1 
ATOM 5748  C CB  . THR A 1 791  ? 253.790 -1.059  2.887   1.00 69.57  ? 858  THR A CB  1 
ATOM 5749  O OG1 . THR A 1 791  ? 253.258 -1.029  4.219   1.00 71.73  ? 858  THR A OG1 1 
ATOM 5750  C CG2 . THR A 1 791  ? 252.666 -0.910  1.890   1.00 69.68  ? 858  THR A CG2 1 
ATOM 5751  N N   . TRP A 1 792  ? 256.703 -1.383  3.057   1.00 71.92  ? 859  TRP A N   1 
ATOM 5752  C CA  . TRP A 1 792  ? 258.017 -0.970  2.616   1.00 73.23  ? 859  TRP A CA  1 
ATOM 5753  C C   . TRP A 1 792  ? 259.180 -1.920  2.625   1.00 73.56  ? 859  TRP A C   1 
ATOM 5754  O O   . TRP A 1 792  ? 260.104 -1.752  1.847   1.00 72.76  ? 859  TRP A O   1 
ATOM 5755  C CB  . TRP A 1 792  ? 258.354 0.341   3.318   1.00 74.64  ? 859  TRP A CB  1 
ATOM 5756  C CG  . TRP A 1 792  ? 257.218 1.317   3.142   1.00 76.53  ? 859  TRP A CG  1 
ATOM 5757  C CD1 . TRP A 1 792  ? 255.947 1.175   3.620   1.00 78.04  ? 859  TRP A CD1 1 
ATOM 5758  C CD2 . TRP A 1 792  ? 257.208 2.511   2.340   1.00 77.66  ? 859  TRP A CD2 1 
ATOM 5759  N NE1 . TRP A 1 792  ? 255.145 2.192   3.159   1.00 79.31  ? 859  TRP A NE1 1 
ATOM 5760  C CE2 . TRP A 1 792  ? 255.893 3.027   2.374   1.00 78.73  ? 859  TRP A CE2 1 
ATOM 5761  C CE3 . TRP A 1 792  ? 258.180 3.192   1.595   1.00 78.07  ? 859  TRP A CE3 1 
ATOM 5762  C CZ2 . TRP A 1 792  ? 255.524 4.190   1.693   1.00 79.62  ? 859  TRP A CZ2 1 
ATOM 5763  C CZ3 . TRP A 1 792  ? 257.809 4.352   0.916   1.00 79.01  ? 859  TRP A CZ3 1 
ATOM 5764  C CH2 . TRP A 1 792  ? 256.493 4.836   0.971   1.00 79.16  ? 859  TRP A CH2 1 
ATOM 5765  N N   . LEU A 1 793  ? 259.152 -2.924  3.481   1.00 74.56  ? 860  LEU A N   1 
ATOM 5766  C CA  . LEU A 1 793  ? 260.247 -3.878  3.501   1.00 75.22  ? 860  LEU A CA  1 
ATOM 5767  C C   . LEU A 1 793  ? 259.840 -5.061  2.654   1.00 75.43  ? 860  LEU A C   1 
ATOM 5768  O O   . LEU A 1 793  ? 260.384 -6.163  2.756   1.00 76.65  ? 860  LEU A O   1 
ATOM 5769  C CB  . LEU A 1 793  ? 260.563 -4.306  4.929   1.00 75.92  ? 860  LEU A CB  1 
ATOM 5770  C CG  . LEU A 1 793  ? 261.587 -3.355  5.551   1.00 76.89  ? 860  LEU A CG  1 
ATOM 5771  C CD1 . LEU A 1 793  ? 261.723 -3.588  7.041   1.00 77.50  ? 860  LEU A CD1 1 
ATOM 5772  C CD2 . LEU A 1 793  ? 262.915 -3.559  4.856   1.00 78.55  ? 860  LEU A CD2 1 
ATOM 5773  N N   . THR A 1 794  ? 258.864 -4.795  1.799   1.00 74.47  ? 861  THR A N   1 
ATOM 5774  C CA  . THR A 1 794  ? 258.341 -5.790  0.890   1.00 73.20  ? 861  THR A CA  1 
ATOM 5775  C C   . THR A 1 794  ? 258.495 -5.242  -0.527  1.00 72.70  ? 861  THR A C   1 
ATOM 5776  O O   . THR A 1 794  ? 257.722 -5.576  -1.428  1.00 71.60  ? 861  THR A O   1 
ATOM 5777  C CB  . THR A 1 794  ? 256.866 -6.069  1.208   1.00 73.44  ? 861  THR A CB  1 
ATOM 5778  O OG1 . THR A 1 794  ? 256.770 -6.581  2.542   1.00 72.09  ? 861  THR A OG1 1 
ATOM 5779  C CG2 . THR A 1 794  ? 256.281 -7.082  0.246   1.00 73.62  ? 861  THR A CG2 1 
ATOM 5780  N N   . ALA A 1 795  ? 259.517 -4.403  -0.707  1.00 74.07  ? 862  ALA A N   1 
ATOM 5781  C CA  . ALA A 1 795  ? 259.826 -3.767  -1.996  1.00 76.69  ? 862  ALA A CA  1 
ATOM 5782  C C   . ALA A 1 795  ? 260.019 -4.750  -3.139  1.00 78.49  ? 862  ALA A C   1 
ATOM 5783  O O   . ALA A 1 795  ? 260.542 -5.850  -2.961  1.00 77.86  ? 862  ALA A O   1 
ATOM 5784  C CB  . ALA A 1 795  ? 261.073 -2.892  -1.876  1.00 76.81  ? 862  ALA A CB  1 
ATOM 5785  N N   . SER A 1 796  ? 259.611 -4.335  -4.329  1.00 80.57  ? 863  SER A N   1 
ATOM 5786  C CA  . SER A 1 796  ? 259.746 -5.193  -5.479  1.00 81.78  ? 863  SER A CA  1 
ATOM 5787  C C   . SER A 1 796  ? 259.879 -4.377  -6.744  1.00 83.91  ? 863  SER A C   1 
ATOM 5788  O O   . SER A 1 796  ? 259.510 -3.210  -6.802  1.00 83.57  ? 863  SER A O   1 
ATOM 5789  C CB  . SER A 1 796  ? 258.530 -6.110  -5.579  1.00 80.73  ? 863  SER A CB  1 
ATOM 5790  O OG  . SER A 1 796  ? 258.242 -6.685  -4.320  1.00 77.15  ? 863  SER A OG  1 
ATOM 5791  N N   . ASN A 1 797  ? 260.455 -5.005  -7.755  1.00 86.71  ? 864  ASN A N   1 
ATOM 5792  C CA  . ASN A 1 797  ? 260.603 -4.379  -9.050  1.00 89.83  ? 864  ASN A CA  1 
ATOM 5793  C C   . ASN A 1 797  ? 259.169 -4.386  -9.535  1.00 91.78  ? 864  ASN A C   1 
ATOM 5794  O O   . ASN A 1 797  ? 258.260 -4.044  -8.781  1.00 92.72  ? 864  ASN A O   1 
ATOM 5795  C CB  . ASN A 1 797  ? 261.451 -5.251  -9.981  1.00 90.44  ? 864  ASN A CB  1 
ATOM 5796  C CG  . ASN A 1 797  ? 262.265 -6.308  -9.231  1.00 92.38  ? 864  ASN A CG  1 
ATOM 5797  O OD1 . ASN A 1 797  ? 261.741 -7.332  -8.791  1.00 92.79  ? 864  ASN A OD1 1 
ATOM 5798  N ND2 . ASN A 1 797  ? 263.552 -6.056  -9.086  1.00 93.66  ? 864  ASN A ND2 1 
ATOM 5799  N N   . ALA A 1 798  ? 258.959 -4.822  -10.772 1.00 93.22  ? 865  ALA A N   1 
ATOM 5800  C CA  . ALA A 1 798  ? 257.612 -4.873  -11.312 1.00 94.30  ? 865  ALA A CA  1 
ATOM 5801  C C   . ALA A 1 798  ? 257.345 -6.002  -12.304 1.00 95.99  ? 865  ALA A C   1 
ATOM 5802  O O   . ALA A 1 798  ? 257.084 -5.718  -13.465 1.00 96.23  ? 865  ALA A O   1 
ATOM 5803  C CB  . ALA A 1 798  ? 257.273 -3.532  -11.967 1.00 92.98  ? 865  ALA A CB  1 
ATOM 5804  N N   . ARG A 1 799  ? 257.390 -7.272  -11.891 1.00 97.77  ? 866  ARG A N   1 
ATOM 5805  C CA  . ARG A 1 799  ? 257.098 -8.343  -12.869 1.00 98.75  ? 866  ARG A CA  1 
ATOM 5806  C C   . ARG A 1 799  ? 255.623 -8.295  -13.294 1.00 97.70  ? 866  ARG A C   1 
ATOM 5807  O O   . ARG A 1 799  ? 255.314 -8.313  -14.493 1.00 97.59  ? 866  ARG A O   1 
ATOM 5808  C CB  . ARG A 1 799  ? 257.395 -9.738  -12.332 1.00 100.84 ? 866  ARG A CB  1 
ATOM 5809  C CG  . ARG A 1 799  ? 257.715 -10.752 -13.446 1.00 104.17 ? 866  ARG A CG  1 
ATOM 5810  C CD  . ARG A 1 799  ? 256.936 -10.606 -14.760 1.00 106.92 ? 866  ARG A CD  1 
ATOM 5811  N NE  . ARG A 1 799  ? 257.826 -10.801 -15.910 1.00 109.98 ? 866  ARG A NE  1 
ATOM 5812  C CZ  . ARG A 1 799  ? 257.828 -11.862 -16.715 1.00 110.78 ? 866  ARG A CZ  1 
ATOM 5813  N NH1 . ARG A 1 799  ? 256.974 -12.854 -16.529 1.00 112.06 ? 866  ARG A NH1 1 
ATOM 5814  N NH2 . ARG A 1 799  ? 258.717 -11.947 -17.697 1.00 110.89 ? 866  ARG A NH2 1 
ATOM 5815  N N   . PRO A 1 800  ? 254.693 -8.318  -12.317 1.00 97.27  ? 867  PRO A N   1 
ATOM 5816  C CA  . PRO A 1 800  ? 253.276 -8.245  -12.674 1.00 96.76  ? 867  PRO A CA  1 
ATOM 5817  C C   . PRO A 1 800  ? 253.042 -6.734  -12.680 1.00 96.49  ? 867  PRO A C   1 
ATOM 5818  O O   . PRO A 1 800  ? 252.504 -6.161  -11.723 1.00 95.32  ? 867  PRO A O   1 
ATOM 5819  C CB  . PRO A 1 800  ? 252.582 -8.922  -11.501 1.00 96.83  ? 867  PRO A CB  1 
ATOM 5820  C CG  . PRO A 1 800  ? 253.654 -9.728  -10.856 1.00 96.13  ? 867  PRO A CG  1 
ATOM 5821  C CD  . PRO A 1 800  ? 254.830 -8.822  -10.943 1.00 97.37  ? 867  PRO A CD  1 
ATOM 5822  N N   . ASP A 1 801  ? 253.515 -6.111  -13.758 1.00 96.84  ? 868  ASP A N   1 
ATOM 5823  C CA  . ASP A 1 801  ? 253.467 -4.663  -14.009 1.00 96.78  ? 868  ASP A CA  1 
ATOM 5824  C C   . ASP A 1 801  ? 252.190 -3.921  -13.597 1.00 96.35  ? 868  ASP A C   1 
ATOM 5825  O O   . ASP A 1 801  ? 251.129 -4.526  -13.568 1.00 97.51  ? 868  ASP A O   1 
ATOM 5826  C CB  . ASP A 1 801  ? 253.752 -4.447  -15.495 1.00 97.38  ? 868  ASP A CB  1 
ATOM 5827  C CG  . ASP A 1 801  ? 255.195 -4.753  -15.855 1.00 97.97  ? 868  ASP A CG  1 
ATOM 5828  O OD1 . ASP A 1 801  ? 255.485 -5.083  -17.017 1.00 98.18  ? 868  ASP A OD1 1 
ATOM 5829  O OD2 . ASP A 1 801  ? 256.055 -4.640  -14.973 1.00 97.27  ? 868  ASP A OD2 1 
ATOM 5830  N N   . ARG A 1 802  ? 252.313 -2.625  -13.278 1.00 95.62  ? 869  ARG A N   1 
ATOM 5831  C CA  . ARG A 1 802  ? 251.187 -1.768  -12.877 1.00 94.23  ? 869  ARG A CA  1 
ATOM 5832  C C   . ARG A 1 802  ? 251.342 -0.790  -11.706 1.00 93.10  ? 869  ARG A C   1 
ATOM 5833  O O   . ARG A 1 802  ? 252.389 -0.692  -11.080 1.00 93.41  ? 869  ARG A O   1 
ATOM 5834  C CB  . ARG A 1 802  ? 249.945 -2.599  -12.612 1.00 94.60  ? 869  ARG A CB  1 
ATOM 5835  C CG  . ARG A 1 802  ? 248.772 -1.745  -12.440 1.00 95.00  ? 869  ARG A CG  1 
ATOM 5836  C CD  . ARG A 1 802  ? 247.570 -2.515  -12.116 1.00 94.54  ? 869  ARG A CD  1 
ATOM 5837  N NE  . ARG A 1 802  ? 246.423 -1.618  -12.097 1.00 93.16  ? 869  ARG A NE  1 
ATOM 5838  C CZ  . ARG A 1 802  ? 246.111 -0.770  -13.075 1.00 92.56  ? 869  ARG A CZ  1 
ATOM 5839  N NH1 . ARG A 1 802  ? 246.861 -0.681  -14.168 1.00 91.95  ? 869  ARG A NH1 1 
ATOM 5840  N NH2 . ARG A 1 802  ? 245.029 -0.026  -12.974 1.00 91.82  ? 869  ARG A NH2 1 
ATOM 5841  N N   . VAL A 1 803  ? 250.266 -0.060  -11.430 1.00 92.46  ? 870  VAL A N   1 
ATOM 5842  C CA  . VAL A 1 803  ? 250.249 0.909   -10.343 1.00 92.18  ? 870  VAL A CA  1 
ATOM 5843  C C   . VAL A 1 803  ? 250.957 0.237   -9.181  1.00 92.36  ? 870  VAL A C   1 
ATOM 5844  O O   . VAL A 1 803  ? 250.704 -0.943  -8.884  1.00 92.97  ? 870  VAL A O   1 
ATOM 5845  C CB  . VAL A 1 803  ? 248.877 1.139   -9.785  1.00 91.73  ? 870  VAL A CB  1 
ATOM 5846  C CG1 . VAL A 1 803  ? 248.818 2.441   -9.311  1.00 91.33  ? 870  VAL A CG1 1 
ATOM 5847  C CG2 . VAL A 1 803  ? 247.835 0.779   -10.799 1.00 91.90  ? 870  VAL A CG2 1 
ATOM 5848  N N   . GLY A 1 804  ? 251.795 0.981   -8.472  1.00 91.83  ? 871  GLY A N   1 
ATOM 5849  C CA  . GLY A 1 804  ? 252.446 0.385   -7.326  1.00 90.14  ? 871  GLY A CA  1 
ATOM 5850  C C   . GLY A 1 804  ? 253.070 -0.938  -7.687  1.00 88.06  ? 871  GLY A C   1 
ATOM 5851  O O   . GLY A 1 804  ? 253.535 -1.657  -6.803  1.00 88.48  ? 871  GLY A O   1 
ATOM 5852  N N   . SER A 1 805  ? 253.057 -1.309  -8.964  1.00 83.86  ? 872  SER A N   1 
ATOM 5853  C CA  . SER A 1 805  ? 253.750 -2.520  -9.347  1.00 78.06  ? 872  SER A CA  1 
ATOM 5854  C C   . SER A 1 805  ? 255.105 -1.824  -9.218  1.00 74.54  ? 872  SER A C   1 
ATOM 5855  O O   . SER A 1 805  ? 255.961 -1.784  -10.100 1.00 74.04  ? 872  SER A O   1 
ATOM 5856  C CB  . SER A 1 805  ? 253.363 -2.954  -10.758 1.00 78.74  ? 872  SER A CB  1 
ATOM 5857  O OG  . SER A 1 805  ? 251.981 -3.308  -10.774 1.00 76.02  ? 872  SER A OG  1 
ATOM 5858  N N   . GLU A 1 806  ? 255.127 -1.197  -8.043  1.00 71.12  ? 873  GLU A N   1 
ATOM 5859  C CA  . GLU A 1 806  ? 256.091 -0.401  -7.310  1.00 67.07  ? 873  GLU A CA  1 
ATOM 5860  C C   . GLU A 1 806  ? 256.355 1.087   -7.530  1.00 63.85  ? 873  GLU A C   1 
ATOM 5861  O O   . GLU A 1 806  ? 256.778 1.554   -8.589  1.00 61.94  ? 873  GLU A O   1 
ATOM 5862  C CB  . GLU A 1 806  ? 257.374 -1.209  -7.160  1.00 68.47  ? 873  GLU A CB  1 
ATOM 5863  C CG  . GLU A 1 806  ? 257.138 -2.416  -6.220  1.00 71.63  ? 873  GLU A CG  1 
ATOM 5864  C CD  . GLU A 1 806  ? 257.359 -2.094  -4.747  1.00 72.52  ? 873  GLU A CD  1 
ATOM 5865  O OE1 . GLU A 1 806  ? 258.392 -1.490  -4.435  1.00 73.63  ? 873  GLU A OE1 1 
ATOM 5866  O OE2 . GLU A 1 806  ? 256.526 -2.456  -3.893  1.00 73.21  ? 873  GLU A OE2 1 
ATOM 5867  N N   . LEU A 1 807  ? 256.046 1.819   -6.461  1.00 61.10  ? 874  LEU A N   1 
ATOM 5868  C CA  . LEU A 1 807  ? 256.215 3.257   -6.380  1.00 57.20  ? 874  LEU A CA  1 
ATOM 5869  C C   . LEU A 1 807  ? 257.610 3.485   -5.809  1.00 56.62  ? 874  LEU A C   1 
ATOM 5870  O O   . LEU A 1 807  ? 257.956 4.599   -5.427  1.00 56.29  ? 874  LEU A O   1 
ATOM 5871  C CB  . LEU A 1 807  ? 255.157 3.868   -5.442  1.00 54.30  ? 874  LEU A CB  1 
ATOM 5872  C CG  . LEU A 1 807  ? 253.655 3.896   -5.777  1.00 51.50  ? 874  LEU A CG  1 
ATOM 5873  C CD1 . LEU A 1 807  ? 252.846 3.003   -4.853  1.00 49.22  ? 874  LEU A CD1 1 
ATOM 5874  C CD2 . LEU A 1 807  ? 253.161 5.311   -5.623  1.00 51.53  ? 874  LEU A CD2 1 
ATOM 5875  N N   . LYS A 1 808  ? 258.404 2.417   -5.766  1.00 55.67  ? 875  LYS A N   1 
ATOM 5876  C CA  . LYS A 1 808  ? 259.752 2.471   -5.220  1.00 53.91  ? 875  LYS A CA  1 
ATOM 5877  C C   . LYS A 1 808  ? 260.481 3.702   -5.650  1.00 53.25  ? 875  LYS A C   1 
ATOM 5878  O O   . LYS A 1 808  ? 261.091 4.388   -4.851  1.00 51.80  ? 875  LYS A O   1 
ATOM 5879  C CB  . LYS A 1 808  ? 260.589 1.279   -5.664  1.00 53.51  ? 875  LYS A CB  1 
ATOM 5880  C CG  . LYS A 1 808  ? 260.076 -0.022  -5.197  1.00 52.90  ? 875  LYS A CG  1 
ATOM 5881  C CD  . LYS A 1 808  ? 261.026 -1.167  -5.482  1.00 54.09  ? 875  LYS A CD  1 
ATOM 5882  C CE  . LYS A 1 808  ? 262.234 -1.144  -4.558  1.00 55.00  ? 875  LYS A CE  1 
ATOM 5883  N NZ  . LYS A 1 808  ? 263.098 -2.350  -4.733  1.00 53.93  ? 875  LYS A NZ  1 
ATOM 5884  N N   . ALA A 1 809  ? 260.435 3.989   -6.932  1.00 52.46  ? 876  ALA A N   1 
ATOM 5885  C CA  . ALA A 1 809  ? 261.173 5.136   -7.391  1.00 51.34  ? 876  ALA A CA  1 
ATOM 5886  C C   . ALA A 1 809  ? 260.745 6.361   -6.640  1.00 50.91  ? 876  ALA A C   1 
ATOM 5887  O O   . ALA A 1 809  ? 261.495 6.934   -5.840  1.00 51.54  ? 876  ALA A O   1 
ATOM 5888  C CB  . ALA A 1 809  ? 260.958 5.334   -8.859  1.00 50.45  ? 876  ALA A CB  1 
ATOM 5889  N N   . MET A 1 810  ? 259.512 6.750   -6.891  1.00 50.06  ? 877  MET A N   1 
ATOM 5890  C CA  . MET A 1 810  ? 259.027 7.931   -6.267  1.00 50.52  ? 877  MET A CA  1 
ATOM 5891  C C   . MET A 1 810  ? 259.566 8.022   -4.848  1.00 50.58  ? 877  MET A C   1 
ATOM 5892  O O   . MET A 1 810  ? 260.003 9.085   -4.426  1.00 51.02  ? 877  MET A O   1 
ATOM 5893  C CB  . MET A 1 810  ? 257.501 7.973   -6.301  1.00 52.60  ? 877  MET A CB  1 
ATOM 5894  C CG  . MET A 1 810  ? 257.008 9.365   -6.650  1.00 54.98  ? 877  MET A CG  1 
ATOM 5895  S SD  . MET A 1 810  ? 257.722 10.721  -5.609  1.00 55.31  ? 877  MET A SD  1 
ATOM 5896  C CE  . MET A 1 810  ? 259.415 11.021  -6.333  1.00 55.25  ? 877  MET A CE  1 
ATOM 5897  N N   . VAL A 1 811  ? 259.640 6.903   -4.138  1.00 51.50  ? 878  VAL A N   1 
ATOM 5898  C CA  . VAL A 1 811  ? 260.083 6.975   -2.747  1.00 53.13  ? 878  VAL A CA  1 
ATOM 5899  C C   . VAL A 1 811  ? 261.122 8.046   -2.439  1.00 54.50  ? 878  VAL A C   1 
ATOM 5900  O O   . VAL A 1 811  ? 260.877 8.946   -1.644  1.00 53.69  ? 878  VAL A O   1 
ATOM 5901  C CB  . VAL A 1 811  ? 260.621 5.611   -2.184  1.00 53.01  ? 878  VAL A CB  1 
ATOM 5902  C CG1 . VAL A 1 811  ? 260.428 5.579   -0.659  1.00 51.71  ? 878  VAL A CG1 1 
ATOM 5903  C CG2 . VAL A 1 811  ? 259.887 4.433   -2.790  1.00 55.30  ? 878  VAL A CG2 1 
ATOM 5904  N N   . GLN A 1 812  ? 262.277 7.985   -3.065  1.00 57.00  ? 879  GLN A N   1 
ATOM 5905  C CA  . GLN A 1 812  ? 263.251 8.973   -2.698  1.00 60.32  ? 879  GLN A CA  1 
ATOM 5906  C C   . GLN A 1 812  ? 263.640 9.949   -3.753  1.00 62.05  ? 879  GLN A C   1 
ATOM 5907  O O   . GLN A 1 812  ? 263.801 9.593   -4.915  1.00 62.14  ? 879  GLN A O   1 
ATOM 5908  C CB  . GLN A 1 812  ? 264.492 8.296   -2.185  1.00 61.40  ? 879  GLN A CB  1 
ATOM 5909  C CG  . GLN A 1 812  ? 264.301 6.879   -1.722  1.00 61.03  ? 879  GLN A CG  1 
ATOM 5910  C CD  . GLN A 1 812  ? 263.335 6.704   -0.596  1.00 60.99  ? 879  GLN A CD  1 
ATOM 5911  O OE1 . GLN A 1 812  ? 263.315 5.652   0.042   1.00 62.00  ? 879  GLN A OE1 1 
ATOM 5912  N NE2 . GLN A 1 812  ? 262.518 7.715   -0.341  1.00 60.85  ? 879  GLN A NE2 1 
ATOM 5913  N N   . ALA A 1 813  ? 263.842 11.187  -3.325  1.00 64.03  ? 880  ALA A N   1 
ATOM 5914  C CA  . ALA A 1 813  ? 264.201 12.210  -4.268  1.00 65.95  ? 880  ALA A CA  1 
ATOM 5915  C C   . ALA A 1 813  ? 264.659 13.595  -3.766  1.00 68.31  ? 880  ALA A C   1 
ATOM 5916  O O   . ALA A 1 813  ? 264.630 14.542  -4.537  1.00 69.25  ? 880  ALA A O   1 
ATOM 5917  C CB  . ALA A 1 813  ? 263.036 12.378  -5.233  1.00 65.63  ? 880  ALA A CB  1 
ATOM 5918  N N   . PRO A 1 814  ? 265.097 13.751  -2.497  1.00 70.70  ? 881  PRO A N   1 
ATOM 5919  C CA  . PRO A 1 814  ? 265.511 15.115  -2.122  1.00 69.40  ? 881  PRO A CA  1 
ATOM 5920  C C   . PRO A 1 814  ? 266.558 15.684  -3.093  1.00 71.58  ? 881  PRO A C   1 
ATOM 5921  O O   . PRO A 1 814  ? 267.598 15.064  -3.323  1.00 72.92  ? 881  PRO A O   1 
ATOM 5922  C CB  . PRO A 1 814  ? 266.052 14.935  -0.706  1.00 69.21  ? 881  PRO A CB  1 
ATOM 5923  C CG  . PRO A 1 814  ? 265.181 13.874  -0.174  1.00 68.72  ? 881  PRO A CG  1 
ATOM 5924  C CD  . PRO A 1 814  ? 265.190 12.865  -1.330  1.00 69.56  ? 881  PRO A CD  1 
ATOM 5925  N N   . PRO A 1 815  ? 266.284 16.879  -3.669  1.00 73.53  ? 882  PRO A N   1 
ATOM 5926  C CA  . PRO A 1 815  ? 267.084 17.654  -4.634  1.00 70.95  ? 882  PRO A CA  1 
ATOM 5927  C C   . PRO A 1 815  ? 268.598 17.685  -4.467  1.00 70.21  ? 882  PRO A C   1 
ATOM 5928  O O   . PRO A 1 815  ? 269.340 17.204  -5.324  1.00 69.75  ? 882  PRO A O   1 
ATOM 5929  C CB  . PRO A 1 815  ? 266.468 19.040  -4.544  1.00 72.50  ? 882  PRO A CB  1 
ATOM 5930  C CG  . PRO A 1 815  ? 265.023 18.716  -4.347  1.00 72.23  ? 882  PRO A CG  1 
ATOM 5931  C CD  . PRO A 1 815  ? 265.074 17.637  -3.290  1.00 72.28  ? 882  PRO A CD  1 
ATOM 5932  N N   . GLY A 1 816  ? 269.065 18.267  -3.377  1.00 68.98  ? 883  GLY A N   1 
ATOM 5933  C CA  . GLY A 1 816  ? 270.495 18.322  -3.184  1.00 67.57  ? 883  GLY A CA  1 
ATOM 5934  C C   . GLY A 1 816  ? 271.097 16.984  -2.823  1.00 67.60  ? 883  GLY A C   1 
ATOM 5935  O O   . GLY A 1 816  ? 272.296 16.910  -2.558  1.00 67.98  ? 883  GLY A O   1 
ATOM 5936  N N   . TYR A 1 817  ? 270.290 15.922  -2.798  1.00 67.47  ? 884  TYR A N   1 
ATOM 5937  C CA  . TYR A 1 817  ? 270.811 14.606  -2.404  1.00 64.97  ? 884  TYR A CA  1 
ATOM 5938  C C   . TYR A 1 817  ? 270.673 13.456  -3.404  1.00 62.31  ? 884  TYR A C   1 
ATOM 5939  O O   . TYR A 1 817  ? 270.179 13.627  -4.522  1.00 61.51  ? 884  TYR A O   1 
ATOM 5940  C CB  . TYR A 1 817  ? 270.217 14.203  -1.036  1.00 65.43  ? 884  TYR A CB  1 
ATOM 5941  C CG  . TYR A 1 817  ? 270.601 15.181  0.045   1.00 65.86  ? 884  TYR A CG  1 
ATOM 5942  C CD1 . TYR A 1 817  ? 270.682 16.533  -0.254  1.00 66.62  ? 884  TYR A CD1 1 
ATOM 5943  C CD2 . TYR A 1 817  ? 270.907 14.772  1.339   1.00 66.25  ? 884  TYR A CD2 1 
ATOM 5944  C CE1 . TYR A 1 817  ? 271.056 17.457  0.657   1.00 67.19  ? 884  TYR A CE1 1 
ATOM 5945  C CE2 . TYR A 1 817  ? 271.288 15.708  2.297   1.00 67.50  ? 884  TYR A CE2 1 
ATOM 5946  C CZ  . TYR A 1 817  ? 271.359 17.061  1.936   1.00 67.20  ? 884  TYR A CZ  1 
ATOM 5947  O OH  . TYR A 1 817  ? 271.713 18.055  2.823   1.00 65.55  ? 884  TYR A OH  1 
ATOM 5948  N N   . THR A 1 818  ? 271.125 12.283  -2.972  1.00 59.37  ? 885  THR A N   1 
ATOM 5949  C CA  . THR A 1 818  ? 271.127 11.084  -3.781  1.00 56.37  ? 885  THR A CA  1 
ATOM 5950  C C   . THR A 1 818  ? 271.329 9.962   -2.792  1.00 54.01  ? 885  THR A C   1 
ATOM 5951  O O   . THR A 1 818  ? 271.856 10.195  -1.715  1.00 53.38  ? 885  THR A O   1 
ATOM 5952  C CB  . THR A 1 818  ? 272.307 11.126  -4.705  1.00 56.19  ? 885  THR A CB  1 
ATOM 5953  O OG1 . THR A 1 818  ? 273.364 11.836  -4.041  1.00 56.16  ? 885  THR A OG1 1 
ATOM 5954  C CG2 . THR A 1 818  ? 271.950 11.795  -6.013  1.00 55.77  ? 885  THR A CG2 1 
ATOM 5955  N N   . LEU A 1 819  ? 270.972 8.739   -3.170  1.00 51.91  ? 886  LEU A N   1 
ATOM 5956  C CA  . LEU A 1 819  ? 271.072 7.590   -2.263  1.00 50.24  ? 886  LEU A CA  1 
ATOM 5957  C C   . LEU A 1 819  ? 272.015 6.420   -2.623  1.00 48.81  ? 886  LEU A C   1 
ATOM 5958  O O   . LEU A 1 819  ? 271.776 5.693   -3.593  1.00 46.93  ? 886  LEU A O   1 
ATOM 5959  C CB  . LEU A 1 819  ? 269.660 7.067   -2.059  1.00 51.40  ? 886  LEU A CB  1 
ATOM 5960  C CG  . LEU A 1 819  ? 268.598 8.029   -2.624  1.00 52.53  ? 886  LEU A CG  1 
ATOM 5961  C CD1 . LEU A 1 819  ? 267.267 7.412   -2.363  1.00 51.58  ? 886  LEU A CD1 1 
ATOM 5962  C CD2 . LEU A 1 819  ? 268.662 9.439   -1.996  1.00 54.40  ? 886  LEU A CD2 1 
ATOM 5963  N N   . VAL A 1 820  ? 273.083 6.257   -1.831  1.00 47.90  ? 887  VAL A N   1 
ATOM 5964  C CA  . VAL A 1 820  ? 274.069 5.174   -2.020  1.00 48.28  ? 887  VAL A CA  1 
ATOM 5965  C C   . VAL A 1 820  ? 273.566 3.917   -1.327  1.00 49.53  ? 887  VAL A C   1 
ATOM 5966  O O   . VAL A 1 820  ? 273.143 3.959   -0.172  1.00 50.66  ? 887  VAL A O   1 
ATOM 5967  C CB  . VAL A 1 820  ? 275.492 5.459   -1.369  1.00 47.44  ? 887  VAL A CB  1 
ATOM 5968  C CG1 . VAL A 1 820  ? 276.419 4.261   -1.616  1.00 46.55  ? 887  VAL A CG1 1 
ATOM 5969  C CG2 . VAL A 1 820  ? 276.143 6.713   -1.927  1.00 48.00  ? 887  VAL A CG2 1 
ATOM 5970  N N   . GLY A 1 821  ? 273.635 2.795   -2.025  1.00 50.43  ? 888  GLY A N   1 
ATOM 5971  C CA  . GLY A 1 821  ? 273.195 1.555   -1.431  1.00 50.14  ? 888  GLY A CA  1 
ATOM 5972  C C   . GLY A 1 821  ? 273.575 0.466   -2.388  1.00 50.23  ? 888  GLY A C   1 
ATOM 5973  O O   . GLY A 1 821  ? 274.214 0.747   -3.402  1.00 48.44  ? 888  GLY A O   1 
ATOM 5974  N N   . ALA A 1 822  ? 273.193 -0.768  -2.067  1.00 52.14  ? 889  ALA A N   1 
ATOM 5975  C CA  . ALA A 1 822  ? 273.488 -1.901  -2.931  1.00 54.30  ? 889  ALA A CA  1 
ATOM 5976  C C   . ALA A 1 822  ? 272.848 -3.216  -2.522  1.00 56.02  ? 889  ALA A C   1 
ATOM 5977  O O   . ALA A 1 822  ? 272.098 -3.314  -1.541  1.00 54.45  ? 889  ALA A O   1 
ATOM 5978  C CB  . ALA A 1 822  ? 274.994 -2.088  -3.068  1.00 52.76  ? 889  ALA A CB  1 
ATOM 5979  N N   . ASP A 1 823  ? 273.182 -4.231  -3.306  1.00 59.85  ? 890  ASP A N   1 
ATOM 5980  C CA  . ASP A 1 823  ? 272.658 -5.559  -3.106  1.00 63.01  ? 890  ASP A CA  1 
ATOM 5981  C C   . ASP A 1 823  ? 273.773 -6.601  -3.099  1.00 63.06  ? 890  ASP A C   1 
ATOM 5982  O O   . ASP A 1 823  ? 274.660 -6.642  -3.969  1.00 61.40  ? 890  ASP A O   1 
ATOM 5983  C CB  . ASP A 1 823  ? 271.640 -5.838  -4.206  1.00 66.17  ? 890  ASP A CB  1 
ATOM 5984  C CG  . ASP A 1 823  ? 270.833 -4.597  -4.558  1.00 69.17  ? 890  ASP A CG  1 
ATOM 5985  O OD1 . ASP A 1 823  ? 269.893 -4.258  -3.811  1.00 71.23  ? 890  ASP A OD1 1 
ATOM 5986  O OD2 . ASP A 1 823  ? 271.148 -3.947  -5.579  1.00 69.12  ? 890  ASP A OD2 1 
ATOM 5987  N N   . VAL A 1 824  ? 273.725 -7.415  -2.058  1.00 64.42  ? 891  VAL A N   1 
ATOM 5988  C CA  . VAL A 1 824  ? 274.659 -8.490  -1.863  1.00 66.34  ? 891  VAL A CA  1 
ATOM 5989  C C   . VAL A 1 824  ? 273.839 -9.702  -2.214  1.00 67.48  ? 891  VAL A C   1 
ATOM 5990  O O   . VAL A 1 824  ? 272.723 -9.869  -1.726  1.00 69.95  ? 891  VAL A O   1 
ATOM 5991  C CB  . VAL A 1 824  ? 275.141 -8.523  -0.411  1.00 66.04  ? 891  VAL A CB  1 
ATOM 5992  C CG1 . VAL A 1 824  ? 274.160 -7.798  0.485   1.00 65.34  ? 891  VAL A CG1 1 
ATOM 5993  C CG2 . VAL A 1 824  ? 275.319 -9.929  0.023   1.00 64.66  ? 891  VAL A CG2 1 
ATOM 5994  N N   . ASP A 1 825  ? 274.397 -10.534 -3.080  1.00 66.71  ? 892  ASP A N   1 
ATOM 5995  C CA  . ASP A 1 825  ? 273.721 -11.730 -3.600  1.00 65.99  ? 892  ASP A CA  1 
ATOM 5996  C C   . ASP A 1 825  ? 273.753 -12.985 -2.767  1.00 64.98  ? 892  ASP A C   1 
ATOM 5997  O O   . ASP A 1 825  ? 274.817 -13.579 -2.600  1.00 64.31  ? 892  ASP A O   1 
ATOM 5998  C CB  . ASP A 1 825  ? 274.320 -12.068 -4.945  1.00 66.50  ? 892  ASP A CB  1 
ATOM 5999  C CG  . ASP A 1 825  ? 275.727 -11.541 -5.075  1.00 66.68  ? 892  ASP A CG  1 
ATOM 6000  O OD1 . ASP A 1 825  ? 276.432 -11.424 -4.046  1.00 67.57  ? 892  ASP A OD1 1 
ATOM 6001  O OD2 . ASP A 1 825  ? 276.133 -11.238 -6.205  1.00 66.55  ? 892  ASP A OD2 1 
ATOM 6002  N N   . SER A 1 826  ? 272.592 -13.420 -2.294  1.00 62.95  ? 893  SER A N   1 
ATOM 6003  C CA  . SER A 1 826  ? 272.575 -14.612 -1.504  1.00 60.44  ? 893  SER A CA  1 
ATOM 6004  C C   . SER A 1 826  ? 273.435 -14.242 -0.317  1.00 59.59  ? 893  SER A C   1 
ATOM 6005  O O   . SER A 1 826  ? 274.300 -15.026 0.091   1.00 58.88  ? 893  SER A O   1 
ATOM 6006  C CB  . SER A 1 826  ? 273.224 -15.735 -2.306  1.00 58.91  ? 893  SER A CB  1 
ATOM 6007  O OG  . SER A 1 826  ? 274.629 -15.787 -2.121  1.00 56.91  ? 893  SER A OG  1 
ATOM 6008  N N   . GLN A 1 827  ? 273.222 -13.031 0.214   1.00 58.64  ? 894  GLN A N   1 
ATOM 6009  C CA  . GLN A 1 827  ? 273.994 -12.586 1.368   1.00 55.64  ? 894  GLN A CA  1 
ATOM 6010  C C   . GLN A 1 827  ? 273.774 -13.778 2.251   1.00 52.73  ? 894  GLN A C   1 
ATOM 6011  O O   . GLN A 1 827  ? 274.616 -14.173 3.040   1.00 49.50  ? 894  GLN A O   1 
ATOM 6012  C CB  . GLN A 1 827  ? 273.405 -11.314 2.000   1.00 56.55  ? 894  GLN A CB  1 
ATOM 6013  C CG  . GLN A 1 827  ? 272.468 -11.526 3.159   1.00 58.58  ? 894  GLN A CG  1 
ATOM 6014  C CD  . GLN A 1 827  ? 271.958 -10.226 3.724   1.00 60.73  ? 894  GLN A CD  1 
ATOM 6015  O OE1 . GLN A 1 827  ? 271.291 -10.207 4.745   1.00 61.99  ? 894  GLN A OE1 1 
ATOM 6016  N NE2 . GLN A 1 827  ? 272.266 -9.131  3.059   1.00 63.35  ? 894  GLN A NE2 1 
ATOM 6017  N N   . GLU A 1 828  ? 272.621 -14.385 2.021   1.00 52.03  ? 895  GLU A N   1 
ATOM 6018  C CA  . GLU A 1 828  ? 272.182 -15.561 2.728   1.00 51.32  ? 895  GLU A CA  1 
ATOM 6019  C C   . GLU A 1 828  ? 272.823 -16.862 2.222   1.00 49.28  ? 895  GLU A C   1 
ATOM 6020  O O   . GLU A 1 828  ? 273.319 -17.665 3.014   1.00 47.72  ? 895  GLU A O   1 
ATOM 6021  C CB  . GLU A 1 828  ? 270.655 -15.641 2.626   1.00 53.43  ? 895  GLU A CB  1 
ATOM 6022  C CG  . GLU A 1 828  ? 269.921 -14.501 3.349   1.00 54.68  ? 895  GLU A CG  1 
ATOM 6023  C CD  . GLU A 1 828  ? 268.537 -14.909 3.824   1.00 54.09  ? 895  GLU A CD  1 
ATOM 6024  O OE1 . GLU A 1 828  ? 268.346 -16.099 4.153   1.00 52.88  ? 895  GLU A OE1 1 
ATOM 6025  O OE2 . GLU A 1 828  ? 267.645 -14.045 3.889   1.00 53.94  ? 895  GLU A OE2 1 
ATOM 6026  N N   . LEU A 1 829  ? 272.813 -17.069 0.907   1.00 49.20  ? 896  LEU A N   1 
ATOM 6027  C CA  . LEU A 1 829  ? 273.374 -18.291 0.338   1.00 49.97  ? 896  LEU A CA  1 
ATOM 6028  C C   . LEU A 1 829  ? 274.833 -18.452 0.714   1.00 50.22  ? 896  LEU A C   1 
ATOM 6029  O O   . LEU A 1 829  ? 275.267 -19.555 1.058   1.00 49.61  ? 896  LEU A O   1 
ATOM 6030  C CB  . LEU A 1 829  ? 273.206 -18.322 -1.190  1.00 50.26  ? 896  LEU A CB  1 
ATOM 6031  C CG  . LEU A 1 829  ? 271.793 -18.431 -1.810  1.00 51.24  ? 896  LEU A CG  1 
ATOM 6032  C CD1 . LEU A 1 829  ? 271.215 -19.802 -1.525  1.00 53.85  ? 896  LEU A CD1 1 
ATOM 6033  C CD2 . LEU A 1 829  ? 270.859 -17.345 -1.273  1.00 50.25  ? 896  LEU A CD2 1 
ATOM 6034  N N   . TRP A 1 830  ? 275.589 -17.359 0.665   1.00 50.74  ? 897  TRP A N   1 
ATOM 6035  C CA  . TRP A 1 830  ? 276.995 -17.421 1.035   1.00 52.34  ? 897  TRP A CA  1 
ATOM 6036  C C   . TRP A 1 830  ? 277.246 -17.776 2.510   1.00 51.44  ? 897  TRP A C   1 
ATOM 6037  O O   . TRP A 1 830  ? 278.192 -18.482 2.851   1.00 51.08  ? 897  TRP A O   1 
ATOM 6038  C CB  . TRP A 1 830  ? 277.690 -16.109 0.768   1.00 56.19  ? 897  TRP A CB  1 
ATOM 6039  C CG  . TRP A 1 830  ? 278.887 -16.081 1.595   1.00 60.72  ? 897  TRP A CG  1 
ATOM 6040  C CD1 . TRP A 1 830  ? 279.892 -16.993 1.580   1.00 61.69  ? 897  TRP A CD1 1 
ATOM 6041  C CD2 . TRP A 1 830  ? 279.174 -15.184 2.665   1.00 63.01  ? 897  TRP A CD2 1 
ATOM 6042  N NE1 . TRP A 1 830  ? 280.783 -16.730 2.578   1.00 62.91  ? 897  TRP A NE1 1 
ATOM 6043  C CE2 . TRP A 1 830  ? 280.372 -15.619 3.260   1.00 63.85  ? 897  TRP A CE2 1 
ATOM 6044  C CE3 . TRP A 1 830  ? 278.540 -14.052 3.179   1.00 63.65  ? 897  TRP A CE3 1 
ATOM 6045  C CZ2 . TRP A 1 830  ? 280.954 -14.961 4.351   1.00 64.76  ? 897  TRP A CZ2 1 
ATOM 6046  C CZ3 . TRP A 1 830  ? 279.121 -13.398 4.265   1.00 63.72  ? 897  TRP A CZ3 1 
ATOM 6047  C CH2 . TRP A 1 830  ? 280.315 -13.854 4.836   1.00 64.49  ? 897  TRP A CH2 1 
ATOM 6048  N N   . ILE A 1 831  ? 276.427 -17.244 3.400   1.00 50.54  ? 898  ILE A N   1 
ATOM 6049  C CA  . ILE A 1 831  ? 276.611 -17.550 4.809   1.00 50.44  ? 898  ILE A CA  1 
ATOM 6050  C C   . ILE A 1 831  ? 276.513 -19.054 4.965   1.00 48.98  ? 898  ILE A C   1 
ATOM 6051  O O   . ILE A 1 831  ? 277.393 -19.687 5.529   1.00 48.92  ? 898  ILE A O   1 
ATOM 6052  C CB  . ILE A 1 831  ? 275.531 -16.868 5.700   1.00 53.31  ? 898  ILE A CB  1 
ATOM 6053  C CG1 . ILE A 1 831  ? 274.322 -17.779 5.908   1.00 56.13  ? 898  ILE A CG1 1 
ATOM 6054  C CG2 . ILE A 1 831  ? 275.045 -15.604 5.045   1.00 53.06  ? 898  ILE A CG2 1 
ATOM 6055  C CD1 . ILE A 1 831  ? 273.169 -17.093 6.593   1.00 91.71  ? 898  ILE A CD1 1 
ATOM 6056  N N   . ALA A 1 832  ? 275.425 -19.614 4.447   1.00 47.58  ? 899  ALA A N   1 
ATOM 6057  C CA  . ALA A 1 832  ? 275.192 -21.045 4.501   1.00 47.89  ? 899  ALA A CA  1 
ATOM 6058  C C   . ALA A 1 832  ? 276.463 -21.630 3.974   1.00 48.29  ? 899  ALA A C   1 
ATOM 6059  O O   . ALA A 1 832  ? 277.002 -22.586 4.512   1.00 48.44  ? 899  ALA A O   1 
ATOM 6060  C CB  . ALA A 1 832  ? 274.041 -21.421 3.594   1.00 47.42  ? 899  ALA A CB  1 
ATOM 6061  N N   . ALA A 1 833  ? 276.949 -20.998 2.918   1.00 48.26  ? 900  ALA A N   1 
ATOM 6062  C CA  . ALA A 1 833  ? 278.164 -21.426 2.267   1.00 48.37  ? 900  ALA A CA  1 
ATOM 6063  C C   . ALA A 1 833  ? 279.314 -21.751 3.213   1.00 48.12  ? 900  ALA A C   1 
ATOM 6064  O O   . ALA A 1 833  ? 279.461 -22.894 3.633   1.00 47.90  ? 900  ALA A O   1 
ATOM 6065  C CB  . ALA A 1 833  ? 278.608 -20.390 1.235   1.00 47.61  ? 900  ALA A CB  1 
ATOM 6066  N N   . VAL A 1 834  ? 280.122 -20.756 3.561   1.00 48.44  ? 901  VAL A N   1 
ATOM 6067  C CA  . VAL A 1 834  ? 281.275 -21.000 4.423   1.00 48.75  ? 901  VAL A CA  1 
ATOM 6068  C C   . VAL A 1 834  ? 280.998 -21.837 5.654   1.00 50.05  ? 901  VAL A C   1 
ATOM 6069  O O   . VAL A 1 834  ? 281.870 -22.576 6.105   1.00 50.41  ? 901  VAL A O   1 
ATOM 6070  C CB  . VAL A 1 834  ? 281.924 -19.696 4.916   1.00 48.11  ? 901  VAL A CB  1 
ATOM 6071  C CG1 . VAL A 1 834  ? 282.029 -18.714 3.798   1.00 45.54  ? 901  VAL A CG1 1 
ATOM 6072  C CG2 . VAL A 1 834  ? 281.141 -19.126 6.059   1.00 50.14  ? 901  VAL A CG2 1 
ATOM 6073  N N   . LEU A 1 835  ? 279.797 -21.707 6.208   1.00 51.08  ? 902  LEU A N   1 
ATOM 6074  C CA  . LEU A 1 835  ? 279.446 -22.448 7.406   1.00 52.17  ? 902  LEU A CA  1 
ATOM 6075  C C   . LEU A 1 835  ? 279.808 -23.880 7.215   1.00 52.69  ? 902  LEU A C   1 
ATOM 6076  O O   . LEU A 1 835  ? 280.656 -24.413 7.921   1.00 51.83  ? 902  LEU A O   1 
ATOM 6077  C CB  . LEU A 1 835  ? 277.956 -22.342 7.702   1.00 51.57  ? 902  LEU A CB  1 
ATOM 6078  C CG  . LEU A 1 835  ? 277.676 -21.491 8.940   1.00 51.51  ? 902  LEU A CG  1 
ATOM 6079  C CD1 . LEU A 1 835  ? 278.351 -20.145 8.770   1.00 52.67  ? 902  LEU A CD1 1 
ATOM 6080  C CD2 . LEU A 1 835  ? 276.187 -21.301 9.142   1.00 49.72  ? 902  LEU A CD2 1 
ATOM 6081  N N   . GLY A 1 836  ? 279.172 -24.507 6.241   1.00 54.09  ? 903  GLY A N   1 
ATOM 6082  C CA  . GLY A 1 836  ? 279.471 -25.899 5.997   1.00 55.94  ? 903  GLY A CA  1 
ATOM 6083  C C   . GLY A 1 836  ? 280.926 -26.158 5.686   1.00 58.28  ? 903  GLY A C   1 
ATOM 6084  O O   . GLY A 1 836  ? 281.623 -26.892 6.398   1.00 59.99  ? 903  GLY A O   1 
ATOM 6085  N N   . ASP A 1 837  ? 281.380 -25.545 4.607   1.00 59.68  ? 904  ASP A N   1 
ATOM 6086  C CA  . ASP A 1 837  ? 282.737 -25.709 4.158   1.00 59.36  ? 904  ASP A CA  1 
ATOM 6087  C C   . ASP A 1 837  ? 283.679 -25.611 5.332   1.00 59.67  ? 904  ASP A C   1 
ATOM 6088  O O   . ASP A 1 837  ? 284.507 -26.492 5.554   1.00 58.70  ? 904  ASP A O   1 
ATOM 6089  C CB  . ASP A 1 837  ? 283.030 -24.633 3.146   1.00 58.00  ? 904  ASP A CB  1 
ATOM 6090  C CG  . ASP A 1 837  ? 281.782 -24.140 2.471   1.00 56.72  ? 904  ASP A CG  1 
ATOM 6091  O OD1 . ASP A 1 837  ? 280.905 -24.990 2.204   1.00 56.13  ? 904  ASP A OD1 1 
ATOM 6092  O OD2 . ASP A 1 837  ? 281.673 -22.921 2.202   1.00 55.08  ? 904  ASP A OD2 1 
ATOM 6093  N N   . ALA A 1 838  ? 283.529 -24.536 6.092   1.00 60.58  ? 905  ALA A N   1 
ATOM 6094  C CA  . ALA A 1 838  ? 284.361 -24.306 7.248   1.00 62.74  ? 905  ALA A CA  1 
ATOM 6095  C C   . ALA A 1 838  ? 284.330 -25.488 8.180   1.00 64.24  ? 905  ALA A C   1 
ATOM 6096  O O   . ALA A 1 838  ? 285.308 -25.754 8.855   1.00 64.19  ? 905  ALA A O   1 
ATOM 6097  C CB  . ALA A 1 838  ? 283.915 -23.070 7.962   1.00 62.67  ? 905  ALA A CB  1 
ATOM 6098  N N   . HIS A 1 839  ? 283.217 -26.203 8.245   1.00 66.02  ? 906  HIS A N   1 
ATOM 6099  C CA  . HIS A 1 839  ? 283.204 -27.348 9.128   1.00 67.94  ? 906  HIS A CA  1 
ATOM 6100  C C   . HIS A 1 839  ? 283.367 -28.674 8.462   1.00 70.54  ? 906  HIS A C   1 
ATOM 6101  O O   . HIS A 1 839  ? 283.329 -29.708 9.125   1.00 70.04  ? 906  HIS A O   1 
ATOM 6102  C CB  . HIS A 1 839  ? 281.998 -27.356 10.028  1.00 64.79  ? 906  HIS A CB  1 
ATOM 6103  C CG  . HIS A 1 839  ? 282.375 -27.182 11.457  1.00 61.98  ? 906  HIS A CG  1 
ATOM 6104  N ND1 . HIS A 1 839  ? 283.410 -26.358 11.839  1.00 60.65  ? 906  HIS A ND1 1 
ATOM 6105  C CD2 . HIS A 1 839  ? 281.886 -27.727 12.594  1.00 61.17  ? 906  HIS A CD2 1 
ATOM 6106  C CE1 . HIS A 1 839  ? 283.544 -26.402 13.152  1.00 59.63  ? 906  HIS A CE1 1 
ATOM 6107  N NE2 . HIS A 1 839  ? 282.631 -27.225 13.634  1.00 60.44  ? 906  HIS A NE2 1 
ATOM 6108  N N   . PHE A 1 840  ? 283.540 -28.627 7.143   1.00 74.38  ? 907  PHE A N   1 
ATOM 6109  C CA  . PHE A 1 840  ? 283.824 -29.805 6.326   1.00 78.43  ? 907  PHE A CA  1 
ATOM 6110  C C   . PHE A 1 840  ? 285.329 -29.606 6.265   1.00 81.23  ? 907  PHE A C   1 
ATOM 6111  O O   . PHE A 1 840  ? 285.928 -29.682 5.196   1.00 82.31  ? 907  PHE A O   1 
ATOM 6112  C CB  . PHE A 1 840  ? 283.323 -29.657 4.886   1.00 41.67  ? 907  PHE A CB  1 
ATOM 6113  C CG  . PHE A 1 840  ? 281.854 -29.985 4.667   1.00 41.67  ? 907  PHE A CG  1 
ATOM 6114  C CD1 . PHE A 1 840  ? 281.374 -31.295 4.721   1.00 41.67  ? 907  PHE A CD1 1 
ATOM 6115  C CD2 . PHE A 1 840  ? 280.979 -28.989 4.250   1.00 41.67  ? 907  PHE A CD2 1 
ATOM 6116  C CE1 . PHE A 1 840  ? 280.044 -31.593 4.338   1.00 41.67  ? 907  PHE A CE1 1 
ATOM 6117  C CE2 . PHE A 1 840  ? 279.657 -29.282 3.872   1.00 41.67  ? 907  PHE A CE2 1 
ATOM 6118  C CZ  . PHE A 1 840  ? 279.197 -30.578 3.912   1.00 41.67  ? 907  PHE A CZ  1 
ATOM 6119  N N   . ALA A 1 841  ? 285.918 -29.307 7.419   1.00 83.89  ? 908  ALA A N   1 
ATOM 6120  C CA  . ALA A 1 841  ? 287.343 -29.020 7.524   1.00 85.66  ? 908  ALA A CA  1 
ATOM 6121  C C   . ALA A 1 841  ? 287.544 -27.645 6.883   1.00 86.88  ? 908  ALA A C   1 
ATOM 6122  O O   . ALA A 1 841  ? 286.811 -26.701 7.193   1.00 87.30  ? 908  ALA A O   1 
ATOM 6123  C CB  . ALA A 1 841  ? 288.161 -30.078 6.802   1.00 85.19  ? 908  ALA A CB  1 
ATOM 6124  N N   . GLY A 1 842  ? 288.518 -27.526 5.987   1.00 88.37  ? 909  GLY A N   1 
ATOM 6125  C CA  . GLY A 1 842  ? 288.758 -26.247 5.334   1.00 91.67  ? 909  GLY A CA  1 
ATOM 6126  C C   . GLY A 1 842  ? 287.496 -25.632 4.747   1.00 94.07  ? 909  GLY A C   1 
ATOM 6127  O O   . GLY A 1 842  ? 286.825 -26.253 3.920   1.00 94.02  ? 909  GLY A O   1 
ATOM 6128  N N   . MET A 1 843  ? 287.181 -24.404 5.153   1.00 96.33  ? 910  MET A N   1 
ATOM 6129  C CA  . MET A 1 843  ? 285.981 -23.728 4.683   1.00 97.77  ? 910  MET A CA  1 
ATOM 6130  C C   . MET A 1 843  ? 285.783 -23.557 3.183   1.00 98.21  ? 910  MET A C   1 
ATOM 6131  O O   . MET A 1 843  ? 284.772 -22.997 2.773   1.00 98.42  ? 910  MET A O   1 
ATOM 6132  C CB  . MET A 1 843  ? 285.843 -22.365 5.362   1.00 99.07  ? 910  MET A CB  1 
ATOM 6133  C CG  . MET A 1 843  ? 286.978 -21.394 5.104   1.00 100.79 ? 910  MET A CG  1 
ATOM 6134  S SD  . MET A 1 843  ? 286.655 -20.165 3.813   1.00 105.43 ? 910  MET A SD  1 
ATOM 6135  C CE  . MET A 1 843  ? 287.995 -20.518 2.699   1.00 105.14 ? 910  MET A CE  1 
ATOM 6136  N N   . HIS A 1 844  ? 286.720 -24.017 2.358   1.00 98.84  ? 911  HIS A N   1 
ATOM 6137  C CA  . HIS A 1 844  ? 286.561 -23.895 0.898   1.00 99.35  ? 911  HIS A CA  1 
ATOM 6138  C C   . HIS A 1 844  ? 285.270 -24.517 0.453   1.00 99.38  ? 911  HIS A C   1 
ATOM 6139  O O   . HIS A 1 844  ? 284.438 -23.877 -0.192  1.00 99.33  ? 911  HIS A O   1 
ATOM 6140  C CB  . HIS A 1 844  ? 287.706 -24.571 0.184   1.00 100.37 ? 911  HIS A CB  1 
ATOM 6141  C CG  . HIS A 1 844  ? 288.800 -23.619 -0.147  1.00 101.49 ? 911  HIS A CG  1 
ATOM 6142  N ND1 . HIS A 1 844  ? 289.162 -22.622 0.722   1.00 101.92 ? 911  HIS A ND1 1 
ATOM 6143  C CD2 . HIS A 1 844  ? 289.552 -23.461 -1.260  1.00 102.27 ? 911  HIS A CD2 1 
ATOM 6144  C CE1 . HIS A 1 844  ? 290.095 -21.875 0.162   1.00 102.13 ? 911  HIS A CE1 1 
ATOM 6145  N NE2 . HIS A 1 844  ? 290.349 -22.364 -1.037  1.00 102.19 ? 911  HIS A NE2 1 
ATOM 6146  N N   . GLY A 1 845  ? 285.149 -25.797 0.776   1.00 99.27  ? 912  GLY A N   1 
ATOM 6147  C CA  . GLY A 1 845  ? 283.925 -26.515 0.534   1.00 99.19  ? 912  GLY A CA  1 
ATOM 6148  C C   . GLY A 1 845  ? 283.440 -27.295 -0.657  1.00 99.02  ? 912  GLY A C   1 
ATOM 6149  O O   . GLY A 1 845  ? 284.152 -27.819 -1.518  1.00 99.54  ? 912  GLY A O   1 
ATOM 6150  N N   . CYS A 1 846  ? 282.119 -27.330 -0.624  1.00 98.47  ? 913  CYS A N   1 
ATOM 6151  C CA  . CYS A 1 846  ? 281.228 -28.011 -1.529  1.00 97.81  ? 913  CYS A CA  1 
ATOM 6152  C C   . CYS A 1 846  ? 280.078 -27.008 -1.664  1.00 97.71  ? 913  CYS A C   1 
ATOM 6153  O O   . CYS A 1 846  ? 280.352 -25.809 -1.715  1.00 97.59  ? 913  CYS A O   1 
ATOM 6154  C CB  . CYS A 1 846  ? 280.788 -29.269 -0.810  1.00 97.03  ? 913  CYS A CB  1 
ATOM 6155  S SG  . CYS A 1 846  ? 280.957 -29.050 0.993   1.00 96.75  ? 913  CYS A SG  1 
ATOM 6156  N N   . THR A 1 847  ? 278.809 -27.452 -1.704  1.00 97.85  ? 914  THR A N   1 
ATOM 6157  C CA  . THR A 1 847  ? 277.705 -26.472 -1.821  1.00 97.66  ? 914  THR A CA  1 
ATOM 6158  C C   . THR A 1 847  ? 278.190 -25.404 -0.901  1.00 97.35  ? 914  THR A C   1 
ATOM 6159  O O   . THR A 1 847  ? 278.698 -25.689 0.175   1.00 97.42  ? 914  THR A O   1 
ATOM 6160  C CB  . THR A 1 847  ? 276.313 -26.951 -1.335  1.00 97.77  ? 914  THR A CB  1 
ATOM 6161  O OG1 . THR A 1 847  ? 275.824 -27.991 -2.191  1.00 97.37  ? 914  THR A OG1 1 
ATOM 6162  C CG2 . THR A 1 847  ? 275.320 -25.793 -1.394  1.00 98.27  ? 914  THR A CG2 1 
ATOM 6163  N N   . ALA A 1 848  ? 278.021 -24.174 -1.329  1.00 96.90  ? 915  ALA A N   1 
ATOM 6164  C CA  . ALA A 1 848  ? 278.572 -23.045 -0.625  1.00 96.23  ? 915  ALA A CA  1 
ATOM 6165  C C   . ALA A 1 848  ? 279.625 -22.888 -1.700  1.00 95.77  ? 915  ALA A C   1 
ATOM 6166  O O   . ALA A 1 848  ? 279.566 -23.605 -2.698  1.00 95.08  ? 915  ALA A O   1 
ATOM 6167  C CB  . ALA A 1 848  ? 279.210 -23.461 0.654   1.00 41.67  ? 915  ALA A CB  1 
ATOM 6168  N N   . PHE A 1 849  ? 280.617 -22.029 -1.538  1.00 95.70  ? 916  PHE A N   1 
ATOM 6169  C CA  . PHE A 1 849  ? 281.518 -21.918 -2.661  1.00 95.93  ? 916  PHE A CA  1 
ATOM 6170  C C   . PHE A 1 849  ? 282.273 -23.159 -3.073  1.00 95.61  ? 916  PHE A C   1 
ATOM 6171  O O   . PHE A 1 849  ? 282.882 -23.172 -4.125  1.00 95.46  ? 916  PHE A O   1 
ATOM 6172  C CB  . PHE A 1 849  ? 282.453 -20.714 -2.531  1.00 96.97  ? 916  PHE A CB  1 
ATOM 6173  C CG  . PHE A 1 849  ? 282.327 -19.762 -3.694  1.00 99.00  ? 916  PHE A CG  1 
ATOM 6174  C CD1 . PHE A 1 849  ? 281.134 -19.091 -3.920  1.00 100.37 ? 916  PHE A CD1 1 
ATOM 6175  C CD2 . PHE A 1 849  ? 283.343 -19.638 -4.631  1.00 99.59  ? 916  PHE A CD2 1 
ATOM 6176  C CE1 . PHE A 1 849  ? 280.952 -18.333 -5.053  1.00 101.02 ? 916  PHE A CE1 1 
ATOM 6177  C CE2 . PHE A 1 849  ? 283.162 -18.872 -5.772  1.00 100.99 ? 916  PHE A CE2 1 
ATOM 6178  C CZ  . PHE A 1 849  ? 281.966 -18.224 -5.981  1.00 101.15 ? 916  PHE A CZ  1 
ATOM 6179  N N   . GLY A 1 850  ? 282.242 -24.212 -2.273  1.00 95.55  ? 917  GLY A N   1 
ATOM 6180  C CA  . GLY A 1 850  ? 282.921 -25.405 -2.721  1.00 96.10  ? 917  GLY A CA  1 
ATOM 6181  C C   . GLY A 1 850  ? 282.171 -25.734 -3.994  1.00 96.16  ? 917  GLY A C   1 
ATOM 6182  O O   . GLY A 1 850  ? 282.752 -25.802 -5.077  1.00 96.24  ? 917  GLY A O   1 
ATOM 6183  N N   . TRP A 1 851  ? 280.858 -25.893 -3.852  1.00 96.39  ? 918  TRP A N   1 
ATOM 6184  C CA  . TRP A 1 851  ? 279.992 -26.195 -4.977  1.00 96.99  ? 918  TRP A CA  1 
ATOM 6185  C C   . TRP A 1 851  ? 279.556 -24.902 -5.673  1.00 97.29  ? 918  TRP A C   1 
ATOM 6186  O O   . TRP A 1 851  ? 279.257 -24.925 -6.868  1.00 97.61  ? 918  TRP A O   1 
ATOM 6187  C CB  . TRP A 1 851  ? 278.765 -27.003 -4.532  1.00 97.15  ? 918  TRP A CB  1 
ATOM 6188  C CG  . TRP A 1 851  ? 277.955 -27.571 -5.684  1.00 97.42  ? 918  TRP A CG  1 
ATOM 6189  C CD1 . TRP A 1 851  ? 277.404 -26.873 -6.731  1.00 97.38  ? 918  TRP A CD1 1 
ATOM 6190  C CD2 . TRP A 1 851  ? 277.643 -28.951 -5.920  1.00 96.79  ? 918  TRP A CD2 1 
ATOM 6191  N NE1 . TRP A 1 851  ? 276.779 -27.731 -7.601  1.00 96.86  ? 918  TRP A NE1 1 
ATOM 6192  C CE2 . TRP A 1 851  ? 276.908 -29.012 -7.129  1.00 96.52  ? 918  TRP A CE2 1 
ATOM 6193  C CE3 . TRP A 1 851  ? 277.912 -30.143 -5.231  1.00 96.45  ? 918  TRP A CE3 1 
ATOM 6194  C CZ2 . TRP A 1 851  ? 276.442 -30.221 -7.664  1.00 96.22  ? 918  TRP A CZ2 1 
ATOM 6195  C CZ3 . TRP A 1 851  ? 277.447 -31.345 -5.765  1.00 96.32  ? 918  TRP A CZ3 1 
ATOM 6196  C CH2 . TRP A 1 851  ? 276.720 -31.372 -6.970  1.00 95.98  ? 918  TRP A CH2 1 
ATOM 6197  N N   . MET A 1 852  ? 279.505 -23.779 -4.949  1.00 97.70  ? 919  MET A N   1 
ATOM 6198  C CA  . MET A 1 852  ? 279.153 -22.513 -5.599  1.00 98.62  ? 919  MET A CA  1 
ATOM 6199  C C   . MET A 1 852  ? 280.302 -22.472 -6.529  1.00 98.45  ? 919  MET A C   1 
ATOM 6200  O O   . MET A 1 852  ? 280.263 -21.846 -7.590  1.00 97.55  ? 919  MET A O   1 
ATOM 6201  C CB  . MET A 1 852  ? 279.338 -21.314 -4.695  1.00 100.34 ? 919  MET A CB  1 
ATOM 6202  C CG  . MET A 1 852  ? 278.129 -20.486 -4.522  1.00 101.12 ? 919  MET A CG  1 
ATOM 6203  S SD  . MET A 1 852  ? 277.058 -21.378 -3.420  1.00 102.69 ? 919  MET A SD  1 
ATOM 6204  C CE  . MET A 1 852  ? 276.798 -20.155 -2.092  1.00 102.06 ? 919  MET A CE  1 
ATOM 6205  N N   . THR A 1 853  ? 281.338 -23.169 -6.065  1.00 98.76  ? 920  THR A N   1 
ATOM 6206  C CA  . THR A 1 853  ? 282.615 -23.289 -6.727  1.00 99.55  ? 920  THR A CA  1 
ATOM 6207  C C   . THR A 1 853  ? 282.968 -21.920 -7.288  1.00 100.20 ? 920  THR A C   1 
ATOM 6208  O O   . THR A 1 853  ? 282.186 -20.960 -7.207  1.00 99.55  ? 920  THR A O   1 
ATOM 6209  C CB  . THR A 1 853  ? 282.620 -24.443 -7.808  1.00 99.73  ? 920  THR A CB  1 
ATOM 6210  O OG1 . THR A 1 853  ? 283.806 -24.355 -8.607  1.00 99.65  ? 920  THR A OG1 1 
ATOM 6211  C CG2 . THR A 1 853  ? 281.386 -24.393 -8.699  1.00 99.30  ? 920  THR A CG2 1 
ATOM 6212  N N   . LEU A 1 854  ? 284.173 -21.802 -7.801  1.00 101.22 ? 921  LEU A N   1 
ATOM 6213  C CA  . LEU A 1 854  ? 284.591 -20.536 -8.339  1.00 101.84 ? 921  LEU A CA  1 
ATOM 6214  C C   . LEU A 1 854  ? 283.470 -19.984 -9.221  1.00 102.02 ? 921  LEU A C   1 
ATOM 6215  O O   . LEU A 1 854  ? 283.147 -18.797 -9.175  1.00 101.75 ? 921  LEU A O   1 
ATOM 6216  C CB  . LEU A 1 854  ? 285.878 -20.743 -9.138  1.00 102.58 ? 921  LEU A CB  1 
ATOM 6217  C CG  . LEU A 1 854  ? 286.859 -21.695 -8.440  1.00 104.15 ? 921  LEU A CG  1 
ATOM 6218  C CD1 . LEU A 1 854  ? 286.508 -23.121 -8.802  1.00 105.27 ? 921  LEU A CD1 1 
ATOM 6219  C CD2 . LEU A 1 854  ? 288.278 -21.400 -8.862  1.00 104.75 ? 921  LEU A CD2 1 
ATOM 6220  N N   . GLN A 1 855  ? 282.841 -20.881 -9.971  1.00 102.85 ? 922  GLN A N   1 
ATOM 6221  C CA  . GLN A 1 855  ? 281.794 -20.522 -10.913 1.00 104.08 ? 922  GLN A CA  1 
ATOM 6222  C C   . GLN A 1 855  ? 280.912 -19.308 -10.735 1.00 105.56 ? 922  GLN A C   1 
ATOM 6223  O O   . GLN A 1 855  ? 280.406 -18.986 -9.664  1.00 104.44 ? 922  GLN A O   1 
ATOM 6224  C CB  . GLN A 1 855  ? 280.864 -21.707 -11.205 1.00 104.00 ? 922  GLN A CB  1 
ATOM 6225  C CG  . GLN A 1 855  ? 279.519 -21.250 -11.803 1.00 105.36 ? 922  GLN A CG  1 
ATOM 6226  C CD  . GLN A 1 855  ? 279.104 -21.996 -13.058 1.00 105.88 ? 922  GLN A CD  1 
ATOM 6227  O OE1 . GLN A 1 855  ? 278.103 -21.651 -13.691 1.00 106.50 ? 922  GLN A OE1 1 
ATOM 6228  N NE2 . GLN A 1 855  ? 279.862 -23.023 -13.421 1.00 105.69 ? 922  GLN A NE2 1 
ATOM 6229  N N   . GLY A 1 856  ? 280.753 -18.678 -11.886 1.00 108.21 ? 923  GLY A N   1 
ATOM 6230  C CA  . GLY A 1 856  ? 279.922 -17.528 -12.122 1.00 112.22 ? 923  GLY A CA  1 
ATOM 6231  C C   . GLY A 1 856  ? 279.666 -17.947 -13.557 1.00 115.08 ? 923  GLY A C   1 
ATOM 6232  O O   . GLY A 1 856  ? 278.571 -18.365 -13.932 1.00 115.64 ? 923  GLY A O   1 
ATOM 6233  N N   . ARG A 1 857  ? 280.747 -17.894 -14.332 1.00 117.38 ? 924  ARG A N   1 
ATOM 6234  C CA  . ARG A 1 857  ? 280.805 -18.279 -15.744 1.00 118.72 ? 924  ARG A CA  1 
ATOM 6235  C C   . ARG A 1 857  ? 279.867 -17.600 -16.760 1.00 119.72 ? 924  ARG A C   1 
ATOM 6236  O O   . ARG A 1 857  ? 278.872 -18.183 -17.188 1.00 120.08 ? 924  ARG A O   1 
ATOM 6237  C CB  . ARG A 1 857  ? 280.711 -19.820 -15.856 1.00 118.84 ? 924  ARG A CB  1 
ATOM 6238  C CG  . ARG A 1 857  ? 281.951 -20.468 -16.520 1.00 119.31 ? 924  ARG A CG  1 
ATOM 6239  C CD  . ARG A 1 857  ? 282.431 -21.770 -15.858 1.00 119.91 ? 924  ARG A CD  1 
ATOM 6240  N NE  . ARG A 1 857  ? 281.597 -22.930 -16.171 1.00 121.01 ? 924  ARG A NE  1 
ATOM 6241  C CZ  . ARG A 1 857  ? 281.886 -24.183 -15.824 1.00 121.31 ? 924  ARG A CZ  1 
ATOM 6242  N NH1 . ARG A 1 857  ? 282.996 -24.446 -15.148 1.00 120.65 ? 924  ARG A NH1 1 
ATOM 6243  N NH2 . ARG A 1 857  ? 281.064 -25.174 -16.152 1.00 121.81 ? 924  ARG A NH2 1 
ATOM 6244  N N   . LYS A 1 858  ? 280.232 -16.365 -17.137 1.00 120.34 ? 925  LYS A N   1 
ATOM 6245  C CA  . LYS A 1 858  ? 279.546 -15.502 -18.126 1.00 121.51 ? 925  LYS A CA  1 
ATOM 6246  C C   . LYS A 1 858  ? 278.225 -14.851 -17.714 1.00 122.19 ? 925  LYS A C   1 
ATOM 6247  O O   . LYS A 1 858  ? 278.154 -13.642 -17.488 1.00 122.54 ? 925  LYS A O   1 
ATOM 6248  C CB  . LYS A 1 858  ? 279.308 -16.264 -19.436 1.00 120.91 ? 925  LYS A CB  1 
ATOM 6249  C CG  . LYS A 1 858  ? 278.010 -17.073 -19.452 1.00 120.66 ? 925  LYS A CG  1 
ATOM 6250  C CD  . LYS A 1 858  ? 277.674 -17.704 -20.784 1.00 120.12 ? 925  LYS A CD  1 
ATOM 6251  C CE  . LYS A 1 858  ? 278.339 -19.055 -20.931 1.00 119.79 ? 925  LYS A CE  1 
ATOM 6252  N NZ  . LYS A 1 858  ? 278.025 -19.680 -22.231 1.00 119.72 ? 925  LYS A NZ  1 
ATOM 6253  N N   . SER A 1 859  ? 277.177 -15.668 -17.675 1.00 122.73 ? 926  SER A N   1 
ATOM 6254  C CA  . SER A 1 859  ? 275.845 -15.245 -17.305 1.00 123.26 ? 926  SER A CA  1 
ATOM 6255  C C   . SER A 1 859  ? 275.992 -15.077 -15.818 1.00 123.50 ? 926  SER A C   1 
ATOM 6256  O O   . SER A 1 859  ? 275.872 -13.961 -15.321 1.00 124.52 ? 926  SER A O   1 
ATOM 6257  C CB  . SER A 1 859  ? 274.828 -16.341 -17.631 1.00 123.64 ? 926  SER A CB  1 
ATOM 6258  O OG  . SER A 1 859  ? 273.502 -15.869 -17.506 1.00 123.76 ? 926  SER A OG  1 
ATOM 6259  N N   . ARG A 1 860  ? 276.287 -16.184 -15.127 1.00 122.89 ? 927  ARG A N   1 
ATOM 6260  C CA  . ARG A 1 860  ? 276.498 -16.170 -13.675 1.00 121.93 ? 927  ARG A CA  1 
ATOM 6261  C C   . ARG A 1 860  ? 276.002 -17.377 -12.860 1.00 121.65 ? 927  ARG A C   1 
ATOM 6262  O O   . ARG A 1 860  ? 275.575 -18.384 -13.407 1.00 121.15 ? 927  ARG A O   1 
ATOM 6263  C CB  . ARG A 1 860  ? 275.897 -14.891 -13.096 1.00 121.25 ? 927  ARG A CB  1 
ATOM 6264  C CG  . ARG A 1 860  ? 276.015 -14.710 -11.605 1.00 120.07 ? 927  ARG A CG  1 
ATOM 6265  C CD  . ARG A 1 860  ? 274.639 -14.488 -11.015 1.00 118.76 ? 927  ARG A CD  1 
ATOM 6266  N NE  . ARG A 1 860  ? 274.653 -14.384 -9.561  1.00 117.67 ? 927  ARG A NE  1 
ATOM 6267  C CZ  . ARG A 1 860  ? 274.198 -13.335 -8.891  1.00 116.99 ? 927  ARG A CZ  1 
ATOM 6268  N NH1 . ARG A 1 860  ? 273.698 -12.303 -9.551  1.00 115.36 ? 927  ARG A NH1 1 
ATOM 6269  N NH2 . ARG A 1 860  ? 274.238 -13.320 -7.568  1.00 117.56 ? 927  ARG A NH2 1 
ATOM 6270  N N   . GLY A 1 861  ? 276.082 -17.241 -11.537 1.00 121.40 ? 928  GLY A N   1 
ATOM 6271  C CA  . GLY A 1 861  ? 275.671 -18.275 -10.605 1.00 121.29 ? 928  GLY A CA  1 
ATOM 6272  C C   . GLY A 1 861  ? 274.246 -18.745 -10.775 1.00 121.39 ? 928  GLY A C   1 
ATOM 6273  O O   . GLY A 1 861  ? 273.944 -19.912 -10.533 1.00 122.22 ? 928  GLY A O   1 
ATOM 6274  N N   . THR A 1 862  ? 273.350 -17.851 -11.170 1.00 120.87 ? 929  THR A N   1 
ATOM 6275  C CA  . THR A 1 862  ? 271.983 -18.283 -11.378 1.00 119.62 ? 929  THR A CA  1 
ATOM 6276  C C   . THR A 1 862  ? 272.109 -19.445 -12.380 1.00 119.60 ? 929  THR A C   1 
ATOM 6277  O O   . THR A 1 862  ? 271.301 -20.373 -12.385 1.00 120.40 ? 929  THR A O   1 
ATOM 6278  C CB  . THR A 1 862  ? 271.109 -17.124 -11.934 1.00 118.66 ? 929  THR A CB  1 
ATOM 6279  O OG1 . THR A 1 862  ? 271.096 -16.035 -10.997 1.00 118.03 ? 929  THR A OG1 1 
ATOM 6280  C CG2 . THR A 1 862  ? 269.685 -17.587 -12.144 1.00 117.40 ? 929  THR A CG2 1 
ATOM 6281  N N   . ASP A 1 863  ? 273.158 -19.398 -13.201 1.00 118.45 ? 930  ASP A N   1 
ATOM 6282  C CA  . ASP A 1 863  ? 273.425 -20.453 -14.179 1.00 116.56 ? 930  ASP A CA  1 
ATOM 6283  C C   . ASP A 1 863  ? 273.736 -21.750 -13.416 1.00 114.62 ? 930  ASP A C   1 
ATOM 6284  O O   . ASP A 1 863  ? 273.614 -22.849 -13.964 1.00 114.06 ? 930  ASP A O   1 
ATOM 6285  C CB  . ASP A 1 863  ? 274.568 -19.999 -15.121 1.00 117.83 ? 930  ASP A CB  1 
ATOM 6286  C CG  . ASP A 1 863  ? 275.420 -21.148 -15.678 1.00 117.92 ? 930  ASP A CG  1 
ATOM 6287  O OD1 . ASP A 1 863  ? 275.987 -20.966 -16.779 1.00 117.98 ? 930  ASP A OD1 1 
ATOM 6288  O OD2 . ASP A 1 863  ? 275.566 -22.203 -15.030 1.00 118.37 ? 930  ASP A OD2 1 
ATOM 6289  N N   . LEU A 1 864  ? 274.120 -21.610 -12.146 1.00 112.95 ? 931  LEU A N   1 
ATOM 6290  C CA  . LEU A 1 864  ? 274.399 -22.758 -11.277 1.00 111.31 ? 931  LEU A CA  1 
ATOM 6291  C C   . LEU A 1 864  ? 273.059 -23.243 -10.780 1.00 110.35 ? 931  LEU A C   1 
ATOM 6292  O O   . LEU A 1 864  ? 272.745 -24.431 -10.822 1.00 110.10 ? 931  LEU A O   1 
ATOM 6293  C CB  . LEU A 1 864  ? 275.234 -22.357 -10.062 1.00 110.66 ? 931  LEU A CB  1 
ATOM 6294  C CG  . LEU A 1 864  ? 275.080 -23.273 -8.836  1.00 109.81 ? 931  LEU A CG  1 
ATOM 6295  C CD1 . LEU A 1 864  ? 276.304 -23.136 -7.963  1.00 110.05 ? 931  LEU A CD1 1 
ATOM 6296  C CD2 . LEU A 1 864  ? 273.821 -22.937 -8.038  1.00 108.50 ? 931  LEU A CD2 1 
ATOM 6297  N N   . HIS A 1 865  ? 272.283 -22.309 -10.252 1.00 109.29 ? 932  HIS A N   1 
ATOM 6298  C CA  . HIS A 1 865  ? 270.966 -22.658 -9.786  1.00 107.86 ? 932  HIS A CA  1 
ATOM 6299  C C   . HIS A 1 865  ? 270.423 -23.362 -11.020 1.00 105.48 ? 932  HIS A C   1 
ATOM 6300  O O   . HIS A 1 865  ? 269.833 -24.438 -10.941 1.00 105.30 ? 932  HIS A O   1 
ATOM 6301  C CB  . HIS A 1 865  ? 270.162 -21.392 -9.479  1.00 110.35 ? 932  HIS A CB  1 
ATOM 6302  C CG  . HIS A 1 865  ? 270.673 -20.616 -8.304  1.00 112.65 ? 932  HIS A CG  1 
ATOM 6303  N ND1 . HIS A 1 865  ? 271.901 -19.988 -8.300  1.00 113.38 ? 932  HIS A ND1 1 
ATOM 6304  C CD2 . HIS A 1 865  ? 270.122 -20.368 -7.093  1.00 113.43 ? 932  HIS A CD2 1 
ATOM 6305  C CE1 . HIS A 1 865  ? 272.083 -19.388 -7.138  1.00 113.72 ? 932  HIS A CE1 1 
ATOM 6306  N NE2 . HIS A 1 865  ? 271.018 -19.603 -6.387  1.00 114.07 ? 932  HIS A NE2 1 
ATOM 6307  N N   . SER A 1 866  ? 270.695 -22.744 -12.166 1.00 102.61 ? 933  SER A N   1 
ATOM 6308  C CA  . SER A 1 866  ? 270.290 -23.238 -13.476 1.00 99.62  ? 933  SER A CA  1 
ATOM 6309  C C   . SER A 1 866  ? 270.731 -24.672 -13.669 1.00 98.45  ? 933  SER A C   1 
ATOM 6310  O O   . SER A 1 866  ? 270.066 -25.458 -14.343 1.00 98.54  ? 933  SER A O   1 
ATOM 6311  C CB  . SER A 1 866  ? 270.929 -22.385 -14.560 1.00 98.23  ? 933  SER A CB  1 
ATOM 6312  O OG  . SER A 1 866  ? 271.735 -23.171 -15.418 1.00 97.33  ? 933  SER A OG  1 
ATOM 6313  N N   . LYS A 1 867  ? 271.876 -24.990 -13.082 1.00 97.22  ? 934  LYS A N   1 
ATOM 6314  C CA  . LYS A 1 867  ? 272.455 -26.322 -13.157 1.00 96.44  ? 934  LYS A CA  1 
ATOM 6315  C C   . LYS A 1 867  ? 271.528 -27.252 -12.396 1.00 96.08  ? 934  LYS A C   1 
ATOM 6316  O O   . LYS A 1 867  ? 271.286 -28.380 -12.813 1.00 96.21  ? 934  LYS A O   1 
ATOM 6317  C CB  . LYS A 1 867  ? 273.835 -26.316 -12.500 1.00 96.30  ? 934  LYS A CB  1 
ATOM 6318  C CG  . LYS A 1 867  ? 274.880 -27.226 -13.130 1.00 97.95  ? 934  LYS A CG  1 
ATOM 6319  C CD  . LYS A 1 867  ? 276.251 -26.943 -12.523 1.00 98.81  ? 934  LYS A CD  1 
ATOM 6320  C CE  . LYS A 1 867  ? 276.600 -25.466 -12.659 1.00 99.53  ? 934  LYS A CE  1 
ATOM 6321  N NZ  . LYS A 1 867  ? 277.851 -25.108 -11.949 1.00 100.49 ? 934  LYS A NZ  1 
ATOM 6322  N N   . THR A 1 868  ? 271.012 -26.765 -11.275 1.00 95.60  ? 935  THR A N   1 
ATOM 6323  C CA  . THR A 1 868  ? 270.106 -27.544 -10.457 1.00 94.42  ? 935  THR A CA  1 
ATOM 6324  C C   . THR A 1 868  ? 268.870 -27.976 -11.222 1.00 93.69  ? 935  THR A C   1 
ATOM 6325  O O   . THR A 1 868  ? 268.417 -29.114 -11.083 1.00 93.84  ? 935  THR A O   1 
ATOM 6326  C CB  . THR A 1 868  ? 269.663 -26.749 -9.255  1.00 94.71  ? 935  THR A CB  1 
ATOM 6327  O OG1 . THR A 1 868  ? 270.579 -26.977 -8.186  1.00 95.01  ? 935  THR A OG1 1 
ATOM 6328  C CG2 . THR A 1 868  ? 268.271 -27.150 -8.841  1.00 94.13  ? 935  THR A CG2 1 
ATOM 6329  N N   . ALA A 1 869  ? 268.325 -27.057 -12.017 1.00 92.84  ? 936  ALA A N   1 
ATOM 6330  C CA  . ALA A 1 869  ? 267.127 -27.327 -12.810 1.00 93.04  ? 936  ALA A CA  1 
ATOM 6331  C C   . ALA A 1 869  ? 267.400 -28.030 -14.142 1.00 93.01  ? 936  ALA A C   1 
ATOM 6332  O O   . ALA A 1 869  ? 266.613 -28.877 -14.550 1.00 93.03  ? 936  ALA A O   1 
ATOM 6333  C CB  . ALA A 1 869  ? 266.363 -26.038 -13.054 1.00 93.06  ? 936  ALA A CB  1 
ATOM 6334  N N   . THR A 1 870  ? 268.492 -27.682 -14.825 1.00 92.99  ? 937  THR A N   1 
ATOM 6335  C CA  . THR A 1 870  ? 268.818 -28.336 -16.095 1.00 93.07  ? 937  THR A CA  1 
ATOM 6336  C C   . THR A 1 870  ? 269.014 -29.847 -15.866 1.00 92.80  ? 937  THR A C   1 
ATOM 6337  O O   . THR A 1 870  ? 268.488 -30.664 -16.634 1.00 91.43  ? 937  THR A O   1 
ATOM 6338  C CB  . THR A 1 870  ? 270.059 -27.715 -16.728 1.00 93.71  ? 937  THR A CB  1 
ATOM 6339  O OG1 . THR A 1 870  ? 269.862 -26.301 -16.831 1.00 94.23  ? 937  THR A OG1 1 
ATOM 6340  C CG2 . THR A 1 870  ? 270.289 -28.289 -18.124 1.00 93.97  ? 937  THR A CG2 1 
ATOM 6341  N N   . THR A 1 871  ? 269.804 -30.234 -14.859 1.00 93.47  ? 938  THR A N   1 
ATOM 6342  C CA  . THR A 1 871  ? 269.883 -31.657 -14.535 1.00 93.44  ? 938  THR A CA  1 
ATOM 6343  C C   . THR A 1 871  ? 268.473 -31.570 -13.982 1.00 94.51  ? 938  THR A C   1 
ATOM 6344  O O   . THR A 1 871  ? 268.235 -30.795 -13.055 1.00 94.83  ? 938  THR A O   1 
ATOM 6345  C CB  . THR A 1 871  ? 270.848 -31.983 -13.370 1.00 92.40  ? 938  THR A CB  1 
ATOM 6346  O OG1 . THR A 1 871  ? 270.660 -31.039 -12.309 1.00 91.14  ? 938  THR A OG1 1 
ATOM 6347  C CG2 . THR A 1 871  ? 272.289 -31.975 -13.837 1.00 92.08  ? 938  THR A CG2 1 
ATOM 6348  N N   . VAL A 1 872  ? 267.540 -32.311 -14.567 1.00 95.11  ? 939  VAL A N   1 
ATOM 6349  C CA  . VAL A 1 872  ? 266.133 -32.231 -14.173 1.00 95.03  ? 939  VAL A CA  1 
ATOM 6350  C C   . VAL A 1 872  ? 265.584 -31.102 -15.059 1.00 95.70  ? 939  VAL A C   1 
ATOM 6351  O O   . VAL A 1 872  ? 264.616 -30.429 -14.704 1.00 95.26  ? 939  VAL A O   1 
ATOM 6352  C CB  . VAL A 1 872  ? 265.944 -31.821 -12.682 1.00 93.90  ? 939  VAL A CB  1 
ATOM 6353  C CG1 . VAL A 1 872  ? 264.493 -31.988 -12.282 1.00 93.80  ? 939  VAL A CG1 1 
ATOM 6354  C CG2 . VAL A 1 872  ? 266.845 -32.651 -11.778 1.00 92.22  ? 939  VAL A CG2 1 
ATOM 6355  N N   . GLY A 1 873  ? 266.244 -30.909 -16.206 1.00 96.29  ? 940  GLY A N   1 
ATOM 6356  C CA  . GLY A 1 873  ? 265.908 -29.877 -17.183 1.00 97.60  ? 940  GLY A CA  1 
ATOM 6357  C C   . GLY A 1 873  ? 264.604 -29.147 -16.965 1.00 98.72  ? 940  GLY A C   1 
ATOM 6358  O O   . GLY A 1 873  ? 263.564 -29.633 -17.387 1.00 98.63  ? 940  GLY A O   1 
ATOM 6359  N N   . ILE A 1 874  ? 264.658 -27.976 -16.331 1.00 100.16 ? 941  ILE A N   1 
ATOM 6360  C CA  . ILE A 1 874  ? 263.446 -27.204 -16.042 1.00 100.92 ? 941  ILE A CA  1 
ATOM 6361  C C   . ILE A 1 874  ? 263.723 -25.701 -15.846 1.00 100.75 ? 941  ILE A C   1 
ATOM 6362  O O   . ILE A 1 874  ? 264.879 -25.270 -15.841 1.00 100.08 ? 941  ILE A O   1 
ATOM 6363  C CB  . ILE A 1 874  ? 262.740 -27.787 -14.761 1.00 100.99 ? 941  ILE A CB  1 
ATOM 6364  C CG1 . ILE A 1 874  ? 261.355 -28.335 -15.118 1.00 101.30 ? 941  ILE A CG1 1 
ATOM 6365  C CG2 . ILE A 1 874  ? 262.640 -26.736 -13.659 1.00 99.85  ? 941  ILE A CG2 1 
ATOM 6366  C CD1 . ILE A 1 874  ? 261.375 -29.694 -15.773 1.00 91.71  ? 941  ILE A CD1 1 
ATOM 6367  N N   . SER A 1 875  ? 262.657 -24.912 -15.704 1.00 100.88 ? 942  SER A N   1 
ATOM 6368  C CA  . SER A 1 875  ? 262.796 -23.479 -15.475 1.00 101.08 ? 942  SER A CA  1 
ATOM 6369  C C   . SER A 1 875  ? 263.686 -23.357 -14.250 1.00 100.98 ? 942  SER A C   1 
ATOM 6370  O O   . SER A 1 875  ? 263.717 -24.249 -13.405 1.00 100.72 ? 942  SER A O   1 
ATOM 6371  C CB  . SER A 1 875  ? 261.448 -22.836 -15.164 1.00 101.65 ? 942  SER A CB  1 
ATOM 6372  O OG  . SER A 1 875  ? 261.142 -22.973 -13.786 1.00 101.32 ? 942  SER A OG  1 
ATOM 6373  N N   . ARG A 1 876  ? 264.394 -22.244 -14.140 1.00 101.13 ? 943  ARG A N   1 
ATOM 6374  C CA  . ARG A 1 876  ? 265.298 -22.052 -13.019 1.00 101.10 ? 943  ARG A CA  1 
ATOM 6375  C C   . ARG A 1 876  ? 264.725 -21.150 -11.939 1.00 100.61 ? 943  ARG A C   1 
ATOM 6376  O O   . ARG A 1 876  ? 264.812 -21.474 -10.757 1.00 101.07 ? 943  ARG A O   1 
ATOM 6377  C CB  . ARG A 1 876  ? 266.625 -21.489 -13.527 1.00 101.37 ? 943  ARG A CB  1 
ATOM 6378  C CG  . ARG A 1 876  ? 267.261 -22.336 -14.621 1.00 101.09 ? 943  ARG A CG  1 
ATOM 6379  C CD  . ARG A 1 876  ? 268.170 -21.486 -15.474 1.00 101.09 ? 943  ARG A CD  1 
ATOM 6380  N NE  . ARG A 1 876  ? 268.841 -22.247 -16.523 1.00 100.86 ? 943  ARG A NE  1 
ATOM 6381  C CZ  . ARG A 1 876  ? 269.883 -21.789 -17.214 1.00 101.53 ? 943  ARG A CZ  1 
ATOM 6382  N NH1 . ARG A 1 876  ? 270.370 -20.577 -16.959 1.00 101.66 ? 943  ARG A NH1 1 
ATOM 6383  N NH2 . ARG A 1 876  ? 270.447 -22.536 -18.155 1.00 101.89 ? 943  ARG A NH2 1 
ATOM 6384  N N   . GLU A 1 877  ? 264.138 -20.023 -12.330 1.00 99.75  ? 944  GLU A N   1 
ATOM 6385  C CA  . GLU A 1 877  ? 263.579 -19.115 -11.339 1.00 98.31  ? 944  GLU A CA  1 
ATOM 6386  C C   . GLU A 1 877  ? 262.638 -19.860 -10.416 1.00 96.64  ? 944  GLU A C   1 
ATOM 6387  O O   . GLU A 1 877  ? 262.447 -19.471 -9.268  1.00 94.77  ? 944  GLU A O   1 
ATOM 6388  C CB  . GLU A 1 877  ? 262.886 -17.940 -12.025 1.00 99.76  ? 944  GLU A CB  1 
ATOM 6389  C CG  . GLU A 1 877  ? 263.907 -16.946 -12.582 1.00 101.71 ? 944  GLU A CG  1 
ATOM 6390  C CD  . GLU A 1 877  ? 263.332 -15.944 -13.574 1.00 102.41 ? 944  GLU A CD  1 
ATOM 6391  O OE1 . GLU A 1 877  ? 262.215 -16.173 -14.084 1.00 102.55 ? 944  GLU A OE1 1 
ATOM 6392  O OE2 . GLU A 1 877  ? 264.011 -14.931 -13.863 1.00 102.58 ? 944  GLU A OE2 1 
ATOM 6393  N N   . HIS A 1 878  ? 262.079 -20.955 -10.919 1.00 95.96  ? 945  HIS A N   1 
ATOM 6394  C CA  . HIS A 1 878  ? 261.186 -21.781 -10.127 1.00 95.28  ? 945  HIS A CA  1 
ATOM 6395  C C   . HIS A 1 878  ? 262.044 -22.802 -9.360  1.00 94.86  ? 945  HIS A C   1 
ATOM 6396  O O   . HIS A 1 878  ? 261.694 -23.235 -8.264  1.00 94.91  ? 945  HIS A O   1 
ATOM 6397  C CB  . HIS A 1 878  ? 260.178 -22.481 -11.042 1.00 94.50  ? 945  HIS A CB  1 
ATOM 6398  C CG  . HIS A 1 878  ? 258.913 -22.876 -10.348 1.00 94.47  ? 945  HIS A CG  1 
ATOM 6399  N ND1 . HIS A 1 878  ? 258.645 -24.174 -9.975  1.00 94.30  ? 945  HIS A ND1 1 
ATOM 6400  C CD2 . HIS A 1 878  ? 257.865 -22.136 -9.915  1.00 93.97  ? 945  HIS A CD2 1 
ATOM 6401  C CE1 . HIS A 1 878  ? 257.489 -24.216 -9.340  1.00 93.65  ? 945  HIS A CE1 1 
ATOM 6402  N NE2 . HIS A 1 878  ? 256.994 -22.992 -9.290  1.00 93.31  ? 945  HIS A NE2 1 
ATOM 6403  N N   . ALA A 1 879  ? 263.185 -23.166 -9.933  1.00 94.27  ? 946  ALA A N   1 
ATOM 6404  C CA  . ALA A 1 879  ? 264.080 -24.112 -9.284  1.00 93.40  ? 946  ALA A CA  1 
ATOM 6405  C C   . ALA A 1 879  ? 264.916 -23.456 -8.174  1.00 93.14  ? 946  ALA A C   1 
ATOM 6406  O O   . ALA A 1 879  ? 265.054 -24.025 -7.094  1.00 93.03  ? 946  ALA A O   1 
ATOM 6407  C CB  . ALA A 1 879  ? 264.995 -24.761 -10.328 1.00 93.43  ? 946  ALA A CB  1 
ATOM 6408  N N   . LYS A 1 880  ? 265.452 -22.258 -8.433  1.00 92.97  ? 947  LYS A N   1 
ATOM 6409  C CA  . LYS A 1 880  ? 266.304 -21.531 -7.473  1.00 92.34  ? 947  LYS A CA  1 
ATOM 6410  C C   . LYS A 1 880  ? 265.635 -21.299 -6.135  1.00 90.07  ? 947  LYS A C   1 
ATOM 6411  O O   . LYS A 1 880  ? 266.203 -21.590 -5.087  1.00 90.73  ? 947  LYS A O   1 
ATOM 6412  C CB  . LYS A 1 880  ? 266.717 -20.154 -8.009  1.00 94.33  ? 947  LYS A CB  1 
ATOM 6413  C CG  . LYS A 1 880  ? 267.132 -20.100 -9.468  1.00 97.58  ? 947  LYS A CG  1 
ATOM 6414  C CD  . LYS A 1 880  ? 267.280 -18.642 -9.928  1.00 101.34 ? 947  LYS A CD  1 
ATOM 6415  C CE  . LYS A 1 880  ? 266.738 -18.423 -11.354 1.00 103.35 ? 947  LYS A CE  1 
ATOM 6416  N NZ  . LYS A 1 880  ? 266.764 -16.983 -11.797 1.00 103.50 ? 947  LYS A NZ  1 
ATOM 6417  N N   . ILE A 1 881  ? 264.433 -20.742 -6.180  1.00 86.66  ? 948  ILE A N   1 
ATOM 6418  C CA  . ILE A 1 881  ? 263.689 -20.456 -4.972  1.00 83.90  ? 948  ILE A CA  1 
ATOM 6419  C C   . ILE A 1 881  ? 263.541 -21.638 -4.034  1.00 80.01  ? 948  ILE A C   1 
ATOM 6420  O O   . ILE A 1 881  ? 263.718 -21.475 -2.836  1.00 79.89  ? 948  ILE A O   1 
ATOM 6421  C CB  . ILE A 1 881  ? 262.289 -19.917 -5.286  1.00 86.70  ? 948  ILE A CB  1 
ATOM 6422  C CG1 . ILE A 1 881  ? 261.807 -20.504 -6.610  1.00 87.47  ? 948  ILE A CG1 1 
ATOM 6423  C CG2 . ILE A 1 881  ? 262.307 -18.396 -5.275  1.00 87.44  ? 948  ILE A CG2 1 
ATOM 6424  C CD1 . ILE A 1 881  ? 260.550 -19.878 -7.144  1.00 91.71  ? 948  ILE A CD1 1 
ATOM 6425  N N   . PHE A 1 882  ? 263.240 -22.825 -4.552  1.00 75.76  ? 949  PHE A N   1 
ATOM 6426  C CA  . PHE A 1 882  ? 263.060 -23.982 -3.675  1.00 72.10  ? 949  PHE A CA  1 
ATOM 6427  C C   . PHE A 1 882  ? 264.306 -24.496 -2.942  1.00 68.63  ? 949  PHE A C   1 
ATOM 6428  O O   . PHE A 1 882  ? 264.196 -25.158 -1.913  1.00 65.65  ? 949  PHE A O   1 
ATOM 6429  C CB  . PHE A 1 882  ? 262.386 -25.108 -4.450  1.00 74.87  ? 949  PHE A CB  1 
ATOM 6430  C CG  . PHE A 1 882  ? 261.030 -24.734 -4.991  1.00 79.05  ? 949  PHE A CG  1 
ATOM 6431  C CD1 . PHE A 1 882  ? 259.940 -25.593 -4.842  1.00 81.06  ? 949  PHE A CD1 1 
ATOM 6432  C CD2 . PHE A 1 882  ? 260.843 -23.525 -5.657  1.00 80.38  ? 949  PHE A CD2 1 
ATOM 6433  C CE1 . PHE A 1 882  ? 258.680 -25.253 -5.350  1.00 82.00  ? 949  PHE A CE1 1 
ATOM 6434  C CE2 . PHE A 1 882  ? 259.591 -23.176 -6.168  1.00 81.39  ? 949  PHE A CE2 1 
ATOM 6435  C CZ  . PHE A 1 882  ? 258.505 -24.045 -6.014  1.00 81.29  ? 949  PHE A CZ  1 
ATOM 6436  N N   . ASN A 1 883  ? 265.484 -24.199 -3.476  1.00 66.91  ? 950  ASN A N   1 
ATOM 6437  C CA  . ASN A 1 883  ? 266.730 -24.590 -2.834  1.00 64.78  ? 950  ASN A CA  1 
ATOM 6438  C C   . ASN A 1 883  ? 266.843 -23.679 -1.672  1.00 65.18  ? 950  ASN A C   1 
ATOM 6439  O O   . ASN A 1 883  ? 267.098 -24.123 -0.551  1.00 64.18  ? 950  ASN A O   1 
ATOM 6440  C CB  . ASN A 1 883  ? 267.914 -24.325 -3.727  1.00 60.80  ? 950  ASN A CB  1 
ATOM 6441  C CG  . ASN A 1 883  ? 268.171 -25.443 -4.651  1.00 58.31  ? 950  ASN A CG  1 
ATOM 6442  O OD1 . ASN A 1 883  ? 268.405 -26.573 -4.216  1.00 55.83  ? 950  ASN A OD1 1 
ATOM 6443  N ND2 . ASN A 1 883  ? 268.125 -25.161 -5.947  1.00 57.52  ? 950  ASN A ND2 1 
ATOM 6444  N N   . TYR A 1 884  ? 266.700 -22.385 -1.977  1.00 66.85  ? 951  TYR A N   1 
ATOM 6445  C CA  . TYR A 1 884  ? 266.729 -21.361 -0.950  1.00 68.39  ? 951  TYR A CA  1 
ATOM 6446  C C   . TYR A 1 884  ? 265.875 -22.158 0.043   1.00 67.92  ? 951  TYR A C   1 
ATOM 6447  O O   . TYR A 1 884  ? 266.353 -22.596 1.077   1.00 66.88  ? 951  TYR A O   1 
ATOM 6448  C CB  . TYR A 1 884  ? 266.041 -20.038 -1.437  1.00 71.68  ? 951  TYR A CB  1 
ATOM 6449  C CG  . TYR A 1 884  ? 266.880 -19.118 -2.370  1.00 74.22  ? 951  TYR A CG  1 
ATOM 6450  C CD1 . TYR A 1 884  ? 267.393 -19.596 -3.584  1.00 75.10  ? 951  TYR A CD1 1 
ATOM 6451  C CD2 . TYR A 1 884  ? 267.178 -17.779 -2.018  1.00 75.31  ? 951  TYR A CD2 1 
ATOM 6452  C CE1 . TYR A 1 884  ? 268.190 -18.781 -4.432  1.00 76.90  ? 951  TYR A CE1 1 
ATOM 6453  C CE2 . TYR A 1 884  ? 267.980 -16.948 -2.864  1.00 77.37  ? 951  TYR A CE2 1 
ATOM 6454  C CZ  . TYR A 1 884  ? 268.486 -17.461 -4.071  1.00 78.04  ? 951  TYR A CZ  1 
ATOM 6455  O OH  . TYR A 1 884  ? 269.295 -16.689 -4.907  1.00 79.72  ? 951  TYR A OH  1 
ATOM 6456  N N   . GLY A 1 885  ? 264.644 -22.454 -0.352  1.00 68.94  ? 952  GLY A N   1 
ATOM 6457  C CA  . GLY A 1 885  ? 263.737 -23.215 0.493   1.00 71.86  ? 952  GLY A CA  1 
ATOM 6458  C C   . GLY A 1 885  ? 264.322 -24.469 1.100   1.00 73.58  ? 952  GLY A C   1 
ATOM 6459  O O   . GLY A 1 885  ? 264.048 -24.794 2.252   1.00 74.82  ? 952  GLY A O   1 
ATOM 6460  N N   . ARG A 1 886  ? 265.120 -25.189 0.327   1.00 74.40  ? 953  ARG A N   1 
ATOM 6461  C CA  . ARG A 1 886  ? 265.735 -26.398 0.835   1.00 74.23  ? 953  ARG A CA  1 
ATOM 6462  C C   . ARG A 1 886  ? 266.673 -25.948 1.920   1.00 74.39  ? 953  ARG A C   1 
ATOM 6463  O O   . ARG A 1 886  ? 266.707 -26.513 3.011   1.00 74.19  ? 953  ARG A O   1 
ATOM 6464  C CB  . ARG A 1 886  ? 266.505 -27.083 -0.270  1.00 73.97  ? 953  ARG A CB  1 
ATOM 6465  C CG  . ARG A 1 886  ? 265.614 -27.492 -1.423  1.00 74.55  ? 953  ARG A CG  1 
ATOM 6466  C CD  . ARG A 1 886  ? 265.880 -28.930 -1.813  1.00 74.72  ? 953  ARG A CD  1 
ATOM 6467  N NE  . ARG A 1 886  ? 265.102 -29.352 -2.970  1.00 76.51  ? 953  ARG A NE  1 
ATOM 6468  C CZ  . ARG A 1 886  ? 265.348 -28.940 -4.204  1.00 76.40  ? 953  ARG A CZ  1 
ATOM 6469  N NH1 . ARG A 1 886  ? 266.350 -28.100 -4.421  1.00 77.05  ? 953  ARG A NH1 1 
ATOM 6470  N NH2 . ARG A 1 886  ? 264.599 -29.367 -5.210  1.00 74.90  ? 953  ARG A NH2 1 
ATOM 6471  N N   . ILE A 1 887  ? 267.436 -24.919 1.595   1.00 74.80  ? 954  ILE A N   1 
ATOM 6472  C CA  . ILE A 1 887  ? 268.357 -24.331 2.527   1.00 75.28  ? 954  ILE A CA  1 
ATOM 6473  C C   . ILE A 1 887  ? 267.681 -24.038 3.844   1.00 74.34  ? 954  ILE A C   1 
ATOM 6474  O O   . ILE A 1 887  ? 268.257 -24.220 4.901   1.00 74.01  ? 954  ILE A O   1 
ATOM 6475  C CB  . ILE A 1 887  ? 268.861 -22.992 2.015   1.00 76.76  ? 954  ILE A CB  1 
ATOM 6476  C CG1 . ILE A 1 887  ? 270.242 -23.152 1.393   1.00 78.82  ? 954  ILE A CG1 1 
ATOM 6477  C CG2 . ILE A 1 887  ? 268.866 -21.979 3.147   1.00 76.43  ? 954  ILE A CG2 1 
ATOM 6478  C CD1 . ILE A 1 887  ? 270.893 -21.817 1.098   1.00 91.71  ? 954  ILE A CD1 1 
ATOM 6479  N N   . TYR A 1 888  ? 266.452 -23.553 3.767   1.00 73.31  ? 955  TYR A N   1 
ATOM 6480  C CA  . TYR A 1 888  ? 265.708 -23.142 4.953   1.00 72.56  ? 955  TYR A CA  1 
ATOM 6481  C C   . TYR A 1 888  ? 265.176 -24.177 5.960   1.00 72.96  ? 955  TYR A C   1 
ATOM 6482  O O   . TYR A 1 888  ? 265.778 -24.370 7.015   1.00 72.28  ? 955  TYR A O   1 
ATOM 6483  C CB  . TYR A 1 888  ? 264.569 -22.191 4.531   1.00 70.96  ? 955  TYR A CB  1 
ATOM 6484  C CG  . TYR A 1 888  ? 265.044 -20.911 3.832   1.00 67.98  ? 955  TYR A CG  1 
ATOM 6485  C CD1 . TYR A 1 888  ? 264.970 -20.774 2.462   1.00 66.60  ? 955  TYR A CD1 1 
ATOM 6486  C CD2 . TYR A 1 888  ? 265.640 -19.879 4.527   1.00 66.24  ? 955  TYR A CD2 1 
ATOM 6487  C CE1 . TYR A 1 888  ? 265.480 -19.662 1.807   1.00 64.32  ? 955  TYR A CE1 1 
ATOM 6488  C CE2 . TYR A 1 888  ? 266.159 -18.754 3.855   1.00 64.33  ? 955  TYR A CE2 1 
ATOM 6489  C CZ  . TYR A 1 888  ? 266.076 -18.665 2.499   1.00 64.20  ? 955  TYR A CZ  1 
ATOM 6490  O OH  . TYR A 1 888  ? 266.649 -17.610 1.819   1.00 64.03  ? 955  TYR A OH  1 
ATOM 6491  N N   . GLY A 1 889  ? 264.082 -24.869 5.660   1.00 74.51  ? 956  GLY A N   1 
ATOM 6492  C CA  . GLY A 1 889  ? 263.551 -25.761 6.681   1.00 76.02  ? 956  GLY A CA  1 
ATOM 6493  C C   . GLY A 1 889  ? 263.387 -27.266 6.632   1.00 77.37  ? 956  GLY A C   1 
ATOM 6494  O O   . GLY A 1 889  ? 263.685 -27.934 7.617   1.00 77.56  ? 956  GLY A O   1 
ATOM 6495  N N   . ALA A 1 890  ? 262.933 -27.831 5.524   1.00 78.02  ? 957  ALA A N   1 
ATOM 6496  C CA  . ALA A 1 890  ? 262.722 -29.269 5.552   1.00 79.53  ? 957  ALA A CA  1 
ATOM 6497  C C   . ALA A 1 890  ? 263.080 -30.107 4.348   1.00 80.09  ? 957  ALA A C   1 
ATOM 6498  O O   . ALA A 1 890  ? 263.972 -30.941 4.432   1.00 79.15  ? 957  ALA A O   1 
ATOM 6499  C CB  . ALA A 1 890  ? 261.291 -29.560 5.943   1.00 79.23  ? 957  ALA A CB  1 
ATOM 6500  N N   . GLY A 1 891  ? 262.391 -29.911 3.233   1.00 80.95  ? 958  GLY A N   1 
ATOM 6501  C CA  . GLY A 1 891  ? 262.681 -30.733 2.077   1.00 81.07  ? 958  GLY A CA  1 
ATOM 6502  C C   . GLY A 1 891  ? 261.613 -31.793 1.840   1.00 81.59  ? 958  GLY A C   1 
ATOM 6503  O O   . GLY A 1 891  ? 260.435 -31.515 1.974   1.00 80.24  ? 958  GLY A O   1 
ATOM 6504  N N   . GLN A 1 892  ? 262.015 -33.010 1.493   1.00 83.45  ? 959  GLN A N   1 
ATOM 6505  C CA  . GLN A 1 892  ? 261.071 -34.101 1.223   1.00 85.76  ? 959  GLN A CA  1 
ATOM 6506  C C   . GLN A 1 892  ? 259.651 -33.658 0.723   1.00 87.96  ? 959  GLN A C   1 
ATOM 6507  O O   . GLN A 1 892  ? 259.531 -33.109 -0.381  1.00 87.83  ? 959  GLN A O   1 
ATOM 6508  C CB  . GLN A 1 892  ? 260.939 -35.040 2.449   1.00 84.55  ? 959  GLN A CB  1 
ATOM 6509  C CG  . GLN A 1 892  ? 262.173 -35.353 3.268   1.00 82.60  ? 959  GLN A CG  1 
ATOM 6510  C CD  . GLN A 1 892  ? 261.795 -35.979 4.597   1.00 82.08  ? 959  GLN A CD  1 
ATOM 6511  O OE1 . GLN A 1 892  ? 260.648 -35.887 5.028   1.00 82.98  ? 959  GLN A OE1 1 
ATOM 6512  N NE2 . GLN A 1 892  ? 262.757 -36.604 5.257   1.00 81.30  ? 959  GLN A NE2 1 
ATOM 6513  N N   . PRO A 1 893  ? 258.579 -33.833 1.545   1.00 90.50  ? 960  PRO A N   1 
ATOM 6514  C CA  . PRO A 1 893  ? 257.204 -33.471 1.155   1.00 92.56  ? 960  PRO A CA  1 
ATOM 6515  C C   . PRO A 1 893  ? 256.977 -32.098 0.551   1.00 93.59  ? 960  PRO A C   1 
ATOM 6516  O O   . PRO A 1 893  ? 256.187 -31.917 -0.371  1.00 93.92  ? 960  PRO A O   1 
ATOM 6517  C CB  . PRO A 1 893  ? 256.416 -33.632 2.463   1.00 92.83  ? 960  PRO A CB  1 
ATOM 6518  C CG  . PRO A 1 893  ? 257.261 -34.550 3.292   1.00 92.58  ? 960  PRO A CG  1 
ATOM 6519  C CD  . PRO A 1 893  ? 258.618 -34.006 3.010   1.00 91.33  ? 960  PRO A CD  1 
ATOM 6520  N N   . PHE A 1 894  ? 257.665 -31.127 1.105   1.00 94.11  ? 961  PHE A N   1 
ATOM 6521  C CA  . PHE A 1 894  ? 257.538 -29.768 0.670   1.00 94.15  ? 961  PHE A CA  1 
ATOM 6522  C C   . PHE A 1 894  ? 257.882 -29.650 -0.811  1.00 94.35  ? 961  PHE A C   1 
ATOM 6523  O O   . PHE A 1 894  ? 257.131 -29.032 -1.561  1.00 94.45  ? 961  PHE A O   1 
ATOM 6524  C CB  . PHE A 1 894  ? 258.418 -28.920 1.576   1.00 93.95  ? 961  PHE A CB  1 
ATOM 6525  C CG  . PHE A 1 894  ? 258.376 -29.370 3.021   1.00 94.49  ? 961  PHE A CG  1 
ATOM 6526  C CD1 . PHE A 1 894  ? 258.674 -30.689 3.356   1.00 93.95  ? 961  PHE A CD1 1 
ATOM 6527  C CD2 . PHE A 1 894  ? 258.019 -28.505 4.040   1.00 94.21  ? 961  PHE A CD2 1 
ATOM 6528  C CE1 . PHE A 1 894  ? 258.623 -31.151 4.665   1.00 92.96  ? 961  PHE A CE1 1 
ATOM 6529  C CE2 . PHE A 1 894  ? 257.962 -28.960 5.372   1.00 93.96  ? 961  PHE A CE2 1 
ATOM 6530  C CZ  . PHE A 1 894  ? 258.266 -30.291 5.677   1.00 92.99  ? 961  PHE A CZ  1 
ATOM 6531  N N   . ALA A 1 895  ? 258.976 -30.256 -1.262  1.00 94.91  ? 962  ALA A N   1 
ATOM 6532  C CA  . ALA A 1 895  ? 259.282 -30.156 -2.685  1.00 95.66  ? 962  ALA A CA  1 
ATOM 6533  C C   . ALA A 1 895  ? 258.127 -30.718 -3.460  1.00 96.01  ? 962  ALA A C   1 
ATOM 6534  O O   . ALA A 1 895  ? 257.540 -30.019 -4.273  1.00 95.80  ? 962  ALA A O   1 
ATOM 6535  C CB  . ALA A 1 895  ? 260.512 -30.919 -3.060  1.00 96.29  ? 962  ALA A CB  1 
ATOM 6536  N N   . GLU A 1 896  ? 257.799 -31.985 -3.218  1.00 95.90  ? 963  GLU A N   1 
ATOM 6537  C CA  . GLU A 1 896  ? 256.697 -32.596 -3.951  1.00 95.82  ? 963  GLU A CA  1 
ATOM 6538  C C   . GLU A 1 896  ? 255.471 -31.698 -3.963  1.00 95.63  ? 963  GLU A C   1 
ATOM 6539  O O   . GLU A 1 896  ? 254.989 -31.363 -5.033  1.00 95.67  ? 963  GLU A O   1 
ATOM 6540  C CB  . GLU A 1 896  ? 256.340 -33.988 -3.414  1.00 96.13  ? 963  GLU A CB  1 
ATOM 6541  C CG  . GLU A 1 896  ? 256.728 -34.260 -1.988  1.00 97.20  ? 963  GLU A CG  1 
ATOM 6542  C CD  . GLU A 1 896  ? 256.638 -35.733 -1.659  1.00 98.19  ? 963  GLU A CD  1 
ATOM 6543  O OE1 . GLU A 1 896  ? 255.546 -36.309 -1.862  1.00 99.17  ? 963  GLU A OE1 1 
ATOM 6544  O OE2 . GLU A 1 896  ? 257.653 -36.312 -1.205  1.00 98.49  ? 963  GLU A OE2 1 
ATOM 6545  N N   . ARG A 1 897  ? 254.980 -31.272 -2.800  1.00 95.16  ? 964  ARG A N   1 
ATOM 6546  C CA  . ARG A 1 897  ? 253.797 -30.401 -2.770  1.00 94.84  ? 964  ARG A CA  1 
ATOM 6547  C C   . ARG A 1 897  ? 253.903 -29.211 -3.710  1.00 94.18  ? 964  ARG A C   1 
ATOM 6548  O O   . ARG A 1 897  ? 253.199 -29.130 -4.711  1.00 93.50  ? 964  ARG A O   1 
ATOM 6549  C CB  . ARG A 1 897  ? 253.520 -29.884 -1.352  1.00 95.94  ? 964  ARG A CB  1 
ATOM 6550  C CG  . ARG A 1 897  ? 252.743 -30.854 -0.473  1.00 98.58  ? 964  ARG A CG  1 
ATOM 6551  C CD  . ARG A 1 897  ? 251.566 -30.163 0.225   1.00 100.95 ? 964  ARG A CD  1 
ATOM 6552  N NE  . ARG A 1 897  ? 250.891 -31.060 1.169   1.00 102.12 ? 964  ARG A NE  1 
ATOM 6553  C CZ  . ARG A 1 897  ? 249.798 -30.759 1.876   1.00 102.56 ? 964  ARG A CZ  1 
ATOM 6554  N NH1 . ARG A 1 897  ? 249.217 -29.574 1.763   1.00 101.67 ? 964  ARG A NH1 1 
ATOM 6555  N NH2 . ARG A 1 897  ? 249.286 -31.652 2.716   1.00 103.61 ? 964  ARG A NH2 1 
ATOM 6556  N N   . LEU A 1 898  ? 254.792 -28.290 -3.378  1.00 94.09  ? 965  LEU A N   1 
ATOM 6557  C CA  . LEU A 1 898  ? 254.982 -27.096 -4.179  1.00 93.47  ? 965  LEU A CA  1 
ATOM 6558  C C   . LEU A 1 898  ? 255.308 -27.419 -5.624  1.00 93.23  ? 965  LEU A C   1 
ATOM 6559  O O   . LEU A 1 898  ? 254.624 -26.961 -6.539  1.00 91.46  ? 965  LEU A O   1 
ATOM 6560  C CB  . LEU A 1 898  ? 256.104 -26.261 -3.590  1.00 92.62  ? 965  LEU A CB  1 
ATOM 6561  C CG  . LEU A 1 898  ? 256.064 -26.108 -2.070  1.00 91.82  ? 965  LEU A CG  1 
ATOM 6562  C CD1 . LEU A 1 898  ? 257.344 -25.417 -1.626  1.00 91.44  ? 965  LEU A CD1 1 
ATOM 6563  C CD2 . LEU A 1 898  ? 254.819 -25.328 -1.633  1.00 91.68  ? 965  LEU A CD2 1 
ATOM 6564  N N   . LEU A 1 899  ? 256.362 -28.200 -5.836  1.00 94.32  ? 966  LEU A N   1 
ATOM 6565  C CA  . LEU A 1 899  ? 256.736 -28.544 -7.198  1.00 96.06  ? 966  LEU A CA  1 
ATOM 6566  C C   . LEU A 1 899  ? 255.491 -29.068 -7.913  1.00 97.67  ? 966  LEU A C   1 
ATOM 6567  O O   . LEU A 1 899  ? 255.121 -28.554 -8.966  1.00 97.78  ? 966  LEU A O   1 
ATOM 6568  C CB  . LEU A 1 899  ? 257.897 -29.576 -7.229  1.00 95.76  ? 966  LEU A CB  1 
ATOM 6569  C CG  . LEU A 1 899  ? 257.834 -31.105 -7.044  1.00 95.31  ? 966  LEU A CG  1 
ATOM 6570  C CD1 . LEU A 1 899  ? 257.084 -31.731 -8.193  1.00 94.78  ? 966  LEU A CD1 1 
ATOM 6571  C CD2 . LEU A 1 899  ? 259.242 -31.690 -7.011  1.00 96.19  ? 966  LEU A CD2 1 
ATOM 6572  N N   . MET A 1 900  ? 254.816 -30.045 -7.307  1.00 99.92  ? 967  MET A N   1 
ATOM 6573  C CA  . MET A 1 900  ? 253.610 -30.654 -7.889  1.00 102.48 ? 967  MET A CA  1 
ATOM 6574  C C   . MET A 1 900  ? 252.586 -29.664 -8.407  1.00 103.44 ? 967  MET A C   1 
ATOM 6575  O O   . MET A 1 900  ? 252.181 -29.716 -9.561  1.00 102.89 ? 967  MET A O   1 
ATOM 6576  C CB  . MET A 1 900  ? 252.912 -31.581 -6.881  1.00 103.18 ? 967  MET A CB  1 
ATOM 6577  C CG  . MET A 1 900  ? 253.591 -32.931 -6.707  1.00 104.35 ? 967  MET A CG  1 
ATOM 6578  S SD  . MET A 1 900  ? 252.460 -34.274 -6.331  1.00 105.16 ? 967  MET A SD  1 
ATOM 6579  C CE  . MET A 1 900  ? 251.419 -34.181 -7.795  1.00 105.92 ? 967  MET A CE  1 
ATOM 6580  N N   . GLN A 1 901  ? 252.148 -28.779 -7.530  1.00 105.15 ? 968  GLN A N   1 
ATOM 6581  C CA  . GLN A 1 901  ? 251.168 -27.773 -7.887  1.00 106.93 ? 968  GLN A CA  1 
ATOM 6582  C C   . GLN A 1 901  ? 251.682 -27.016 -9.091  1.00 106.87 ? 968  GLN A C   1 
ATOM 6583  O O   . GLN A 1 901  ? 251.124 -27.108 -10.177 1.00 107.57 ? 968  GLN A O   1 
ATOM 6584  C CB  . GLN A 1 901  ? 250.987 -26.840 -6.706  1.00 108.03 ? 968  GLN A CB  1 
ATOM 6585  C CG  . GLN A 1 901  ? 251.306 -27.556 -5.420  1.00 110.98 ? 968  GLN A CG  1 
ATOM 6586  C CD  . GLN A 1 901  ? 250.273 -27.354 -4.365  1.00 112.39 ? 968  GLN A CD  1 
ATOM 6587  O OE1 . GLN A 1 901  ? 249.088 -27.278 -4.658  1.00 113.23 ? 968  GLN A OE1 1 
ATOM 6588  N NE2 . GLN A 1 901  ? 250.710 -27.283 -3.118  1.00 112.91 ? 968  GLN A NE2 1 
ATOM 6589  N N   . PHE A 1 902  ? 252.759 -26.272 -8.892  1.00 106.55 ? 969  PHE A N   1 
ATOM 6590  C CA  . PHE A 1 902  ? 253.345 -25.518 -9.975  1.00 105.95 ? 969  PHE A CA  1 
ATOM 6591  C C   . PHE A 1 902  ? 253.618 -26.448 -11.135 1.00 105.89 ? 969  PHE A C   1 
ATOM 6592  O O   . PHE A 1 902  ? 253.724 -26.010 -12.274 1.00 105.35 ? 969  PHE A O   1 
ATOM 6593  C CB  . PHE A 1 902  ? 254.629 -24.871 -9.511  1.00 105.62 ? 969  PHE A CB  1 
ATOM 6594  C CG  . PHE A 1 902  ? 254.434 -23.890 -8.401  1.00 105.47 ? 969  PHE A CG  1 
ATOM 6595  C CD1 . PHE A 1 902  ? 254.852 -24.182 -7.106  1.00 105.87 ? 969  PHE A CD1 1 
ATOM 6596  C CD2 . PHE A 1 902  ? 253.827 -22.669 -8.649  1.00 106.00 ? 969  PHE A CD2 1 
ATOM 6597  C CE1 . PHE A 1 902  ? 254.666 -23.265 -6.073  1.00 106.57 ? 969  PHE A CE1 1 
ATOM 6598  C CE2 . PHE A 1 902  ? 253.636 -21.747 -7.627  1.00 106.16 ? 969  PHE A CE2 1 
ATOM 6599  C CZ  . PHE A 1 902  ? 254.056 -22.044 -6.335  1.00 106.33 ? 969  PHE A CZ  1 
ATOM 6600  N N   . ASN A 1 903  ? 253.750 -27.734 -10.833 1.00 106.78 ? 970  ASN A N   1 
ATOM 6601  C CA  . ASN A 1 903  ? 253.965 -28.738 -11.865 1.00 108.01 ? 970  ASN A CA  1 
ATOM 6602  C C   . ASN A 1 903  ? 252.620 -29.375 -12.147 1.00 109.43 ? 970  ASN A C   1 
ATOM 6603  O O   . ASN A 1 903  ? 251.595 -28.890 -11.662 1.00 109.44 ? 970  ASN A O   1 
ATOM 6604  C CB  . ASN A 1 903  ? 254.964 -29.795 -11.420 1.00 106.63 ? 970  ASN A CB  1 
ATOM 6605  C CG  . ASN A 1 903  ? 256.382 -29.357 -11.621 1.00 105.47 ? 970  ASN A CG  1 
ATOM 6606  O OD1 . ASN A 1 903  ? 256.823 -29.141 -12.746 1.00 104.96 ? 970  ASN A OD1 1 
ATOM 6607  N ND2 . ASN A 1 903  ? 257.110 -29.212 -10.529 1.00 104.34 ? 970  ASN A ND2 1 
ATOM 6608  N N   . HIS A 1 904  ? 252.600 -30.476 -12.892 1.00 110.26 ? 971  HIS A N   1 
ATOM 6609  C CA  . HIS A 1 904  ? 251.310 -31.057 -13.230 1.00 111.20 ? 971  HIS A CA  1 
ATOM 6610  C C   . HIS A 1 904  ? 250.893 -32.482 -12.866 1.00 112.30 ? 971  HIS A C   1 
ATOM 6611  O O   . HIS A 1 904  ? 250.614 -32.781 -11.699 1.00 112.48 ? 971  HIS A O   1 
ATOM 6612  C CB  . HIS A 1 904  ? 251.046 -30.829 -14.722 1.00 110.03 ? 971  HIS A CB  1 
ATOM 6613  C CG  . HIS A 1 904  ? 251.047 -29.384 -15.106 1.00 109.68 ? 971  HIS A CG  1 
ATOM 6614  N ND1 . HIS A 1 904  ? 250.949 -28.373 -14.174 1.00 109.51 ? 971  HIS A ND1 1 
ATOM 6615  C CD2 . HIS A 1 904  ? 251.144 -28.776 -16.311 1.00 109.70 ? 971  HIS A CD2 1 
ATOM 6616  C CE1 . HIS A 1 904  ? 250.990 -27.204 -14.787 1.00 109.07 ? 971  HIS A CE1 1 
ATOM 6617  N NE2 . HIS A 1 904  ? 251.108 -27.420 -16.084 1.00 108.49 ? 971  HIS A NE2 1 
ATOM 6618  N N   . ARG A 1 905  ? 250.840 -33.346 -13.881 1.00 113.27 ? 972  ARG A N   1 
ATOM 6619  C CA  . ARG A 1 905  ? 250.358 -34.724 -13.741 1.00 114.25 ? 972  ARG A CA  1 
ATOM 6620  C C   . ARG A 1 905  ? 251.226 -35.848 -13.211 1.00 114.36 ? 972  ARG A C   1 
ATOM 6621  O O   . ARG A 1 905  ? 250.690 -36.906 -12.880 1.00 115.36 ? 972  ARG A O   1 
ATOM 6622  C CB  . ARG A 1 905  ? 249.807 -35.197 -15.076 1.00 114.92 ? 972  ARG A CB  1 
ATOM 6623  C CG  . ARG A 1 905  ? 249.039 -34.157 -15.821 1.00 115.98 ? 972  ARG A CG  1 
ATOM 6624  C CD  . ARG A 1 905  ? 248.703 -34.710 -17.157 1.00 116.15 ? 972  ARG A CD  1 
ATOM 6625  N NE  . ARG A 1 905  ? 248.032 -33.740 -17.996 1.00 115.96 ? 972  ARG A NE  1 
ATOM 6626  C CZ  . ARG A 1 905  ? 247.586 -34.026 -19.208 1.00 115.56 ? 972  ARG A CZ  1 
ATOM 6627  N NH1 . ARG A 1 905  ? 247.748 -35.246 -19.705 1.00 114.64 ? 972  ARG A NH1 1 
ATOM 6628  N NH2 . ARG A 1 905  ? 246.973 -33.102 -19.916 1.00 116.00 ? 972  ARG A NH2 1 
ATOM 6629  N N   . LEU A 1 906  ? 252.540 -35.654 -13.145 1.00 113.34 ? 973  LEU A N   1 
ATOM 6630  C CA  . LEU A 1 906  ? 253.423 -36.719 -12.667 1.00 110.95 ? 973  LEU A CA  1 
ATOM 6631  C C   . LEU A 1 906  ? 252.846 -37.357 -11.385 1.00 110.03 ? 973  LEU A C   1 
ATOM 6632  O O   . LEU A 1 906  ? 253.231 -38.469 -10.994 1.00 108.84 ? 973  LEU A O   1 
ATOM 6633  C CB  . LEU A 1 906  ? 254.854 -36.167 -12.454 1.00 110.12 ? 973  LEU A CB  1 
ATOM 6634  C CG  . LEU A 1 906  ? 255.502 -35.334 -13.583 1.00 109.43 ? 973  LEU A CG  1 
ATOM 6635  C CD1 . LEU A 1 906  ? 256.996 -35.602 -13.640 1.00 109.35 ? 973  LEU A CD1 1 
ATOM 6636  C CD2 . LEU A 1 906  ? 254.884 -35.685 -14.927 1.00 109.24 ? 973  LEU A CD2 1 
ATOM 6637  N N   . THR A 1 907  ? 251.894 -36.652 -10.765 1.00 109.65 ? 974  THR A N   1 
ATOM 6638  C CA  . THR A 1 907  ? 251.215 -37.101 -9.550  1.00 108.87 ? 974  THR A CA  1 
ATOM 6639  C C   . THR A 1 907  ? 252.154 -37.230 -8.345  1.00 108.57 ? 974  THR A C   1 
ATOM 6640  O O   . THR A 1 907  ? 253.362 -37.020 -8.454  1.00 107.90 ? 974  THR A O   1 
ATOM 6641  C CB  . THR A 1 907  ? 250.456 -38.440 -9.818  1.00 108.96 ? 974  THR A CB  1 
ATOM 6642  O OG1 . THR A 1 907  ? 249.225 -38.150 -10.496 1.00 108.07 ? 974  THR A OG1 1 
ATOM 6643  C CG2 . THR A 1 907  ? 250.145 -39.188 -8.527  1.00 109.14 ? 974  THR A CG2 1 
ATOM 6644  N N   . GLN A 1 908  ? 251.583 -37.547 -7.190  1.00 108.27 ? 975  GLN A N   1 
ATOM 6645  C CA  . GLN A 1 908  ? 252.334 -37.701 -5.955  1.00 108.52 ? 975  GLN A CA  1 
ATOM 6646  C C   . GLN A 1 908  ? 253.567 -38.577 -6.089  1.00 109.54 ? 975  GLN A C   1 
ATOM 6647  O O   . GLN A 1 908  ? 254.649 -38.190 -5.669  1.00 109.16 ? 975  GLN A O   1 
ATOM 6648  C CB  . GLN A 1 908  ? 251.418 -38.278 -4.895  1.00 108.23 ? 975  GLN A CB  1 
ATOM 6649  C CG  . GLN A 1 908  ? 252.044 -38.410 -3.545  1.00 108.33 ? 975  GLN A CG  1 
ATOM 6650  C CD  . GLN A 1 908  ? 251.010 -38.717 -2.493  1.00 109.00 ? 975  GLN A CD  1 
ATOM 6651  O OE1 . GLN A 1 908  ? 249.991 -38.034 -2.400  1.00 109.23 ? 975  GLN A OE1 1 
ATOM 6652  N NE2 . GLN A 1 908  ? 251.260 -39.743 -1.692  1.00 109.16 ? 975  GLN A NE2 1 
ATOM 6653  N N   . GLN A 1 909  ? 253.392 -39.762 -6.665  1.00 111.30 ? 976  GLN A N   1 
ATOM 6654  C CA  . GLN A 1 909  ? 254.488 -40.709 -6.857  1.00 112.95 ? 976  GLN A CA  1 
ATOM 6655  C C   . GLN A 1 909  ? 255.683 -40.107 -7.587  1.00 112.93 ? 976  GLN A C   1 
ATOM 6656  O O   . GLN A 1 909  ? 256.808 -40.169 -7.099  1.00 113.58 ? 976  GLN A O   1 
ATOM 6657  C CB  . GLN A 1 909  ? 253.997 -41.939 -7.627  1.00 114.32 ? 976  GLN A CB  1 
ATOM 6658  C CG  . GLN A 1 909  ? 255.112 -42.764 -8.280  1.00 117.86 ? 976  GLN A CG  1 
ATOM 6659  C CD  . GLN A 1 909  ? 254.580 -43.865 -9.193  1.00 119.72 ? 976  GLN A CD  1 
ATOM 6660  O OE1 . GLN A 1 909  ? 255.322 -44.427 -10.007 1.00 121.11 ? 976  GLN A OE1 1 
ATOM 6661  N NE2 . GLN A 1 909  ? 253.293 -44.184 -9.055  1.00 120.36 ? 976  GLN A NE2 1 
ATOM 6662  N N   . GLU A 1 910  ? 255.456 -39.541 -8.764  1.00 112.60 ? 977  GLU A N   1 
ATOM 6663  C CA  . GLU A 1 910  ? 256.563 -38.955 -9.489  1.00 111.86 ? 977  GLU A CA  1 
ATOM 6664  C C   . GLU A 1 910  ? 257.087 -37.764 -8.720  1.00 110.32 ? 977  GLU A C   1 
ATOM 6665  O O   . GLU A 1 910  ? 258.285 -37.526 -8.688  1.00 109.75 ? 977  GLU A O   1 
ATOM 6666  C CB  . GLU A 1 910  ? 256.132 -38.534 -10.881 1.00 113.37 ? 977  GLU A CB  1 
ATOM 6667  C CG  . GLU A 1 910  ? 255.701 -39.696 -11.735 1.00 115.80 ? 977  GLU A CG  1 
ATOM 6668  C CD  . GLU A 1 910  ? 256.276 -39.620 -13.128 1.00 116.65 ? 977  GLU A CD  1 
ATOM 6669  O OE1 . GLU A 1 910  ? 257.058 -38.679 -13.395 1.00 117.14 ? 977  GLU A OE1 1 
ATOM 6670  O OE2 . GLU A 1 910  ? 255.951 -40.507 -13.949 1.00 116.78 ? 977  GLU A OE2 1 
ATOM 6671  N N   . ALA A 1 911  ? 256.188 -37.016 -8.094  1.00 108.76 ? 978  ALA A N   1 
ATOM 6672  C CA  . ALA A 1 911  ? 256.603 -35.863 -7.309  1.00 107.18 ? 978  ALA A CA  1 
ATOM 6673  C C   . ALA A 1 911  ? 257.592 -36.405 -6.306  1.00 105.42 ? 978  ALA A C   1 
ATOM 6674  O O   . ALA A 1 911  ? 258.666 -35.844 -6.089  1.00 105.04 ? 978  ALA A O   1 
ATOM 6675  C CB  . ALA A 1 911  ? 255.427 -35.274 -6.587  1.00 107.65 ? 978  ALA A CB  1 
ATOM 6676  N N   . ALA A 1 912  ? 257.202 -37.520 -5.701  1.00 103.65 ? 979  ALA A N   1 
ATOM 6677  C CA  . ALA A 1 912  ? 258.021 -38.186 -4.708  1.00 101.58 ? 979  ALA A CA  1 
ATOM 6678  C C   . ALA A 1 912  ? 259.403 -38.353 -5.294  1.00 99.87  ? 979  ALA A C   1 
ATOM 6679  O O   . ALA A 1 912  ? 260.385 -37.811 -4.787  1.00 99.19  ? 979  ALA A O   1 
ATOM 6680  C CB  . ALA A 1 912  ? 257.426 -39.543 -4.368  1.00 102.75 ? 979  ALA A CB  1 
ATOM 6681  N N   . GLU A 1 913  ? 259.461 -39.104 -6.380  1.00 98.16  ? 980  GLU A N   1 
ATOM 6682  C CA  . GLU A 1 913  ? 260.711 -39.351 -7.058  1.00 96.07  ? 980  GLU A CA  1 
ATOM 6683  C C   . GLU A 1 913  ? 261.583 -38.087 -7.026  1.00 94.60  ? 980  GLU A C   1 
ATOM 6684  O O   . GLU A 1 913  ? 262.681 -38.094 -6.469  1.00 93.99  ? 980  GLU A O   1 
ATOM 6685  C CB  . GLU A 1 913  ? 260.425 -39.788 -8.510  1.00 95.59  ? 980  GLU A CB  1 
ATOM 6686  C CG  . GLU A 1 913  ? 259.685 -41.144 -8.652  1.00 93.34  ? 980  GLU A CG  1 
ATOM 6687  C CD  . GLU A 1 913  ? 258.980 -41.345 -10.007 1.00 91.95  ? 980  GLU A CD  1 
ATOM 6688  O OE1 . GLU A 1 913  ? 259.641 -41.271 -11.064 1.00 90.55  ? 980  GLU A OE1 1 
ATOM 6689  O OE2 . GLU A 1 913  ? 257.753 -41.588 -10.010 1.00 91.14  ? 980  GLU A OE2 1 
ATOM 6690  N N   . LYS A 1 914  ? 261.071 -36.991 -7.583  1.00 93.11  ? 981  LYS A N   1 
ATOM 6691  C CA  . LYS A 1 914  ? 261.821 -35.736 -7.655  1.00 91.67  ? 981  LYS A CA  1 
ATOM 6692  C C   . LYS A 1 914  ? 262.163 -35.096 -6.326  1.00 89.37  ? 981  LYS A C   1 
ATOM 6693  O O   . LYS A 1 914  ? 263.304 -34.717 -6.095  1.00 88.56  ? 981  LYS A O   1 
ATOM 6694  C CB  . LYS A 1 914  ? 261.087 -34.719 -8.545  1.00 93.86  ? 981  LYS A CB  1 
ATOM 6695  C CG  . LYS A 1 914  ? 261.140 -35.073 -10.035 1.00 96.34  ? 981  LYS A CG  1 
ATOM 6696  C CD  . LYS A 1 914  ? 260.616 -33.961 -10.935 1.00 98.69  ? 981  LYS A CD  1 
ATOM 6697  C CE  . LYS A 1 914  ? 260.741 -34.334 -12.410 1.00 99.93  ? 981  LYS A CE  1 
ATOM 6698  N NZ  . LYS A 1 914  ? 262.156 -34.567 -12.816 1.00 99.76  ? 981  LYS A NZ  1 
ATOM 6699  N N   . ALA A 1 915  ? 261.180 -34.963 -5.452  1.00 87.04  ? 982  ALA A N   1 
ATOM 6700  C CA  . ALA A 1 915  ? 261.441 -34.365 -4.160  1.00 86.21  ? 982  ALA A CA  1 
ATOM 6701  C C   . ALA A 1 915  ? 262.573 -35.142 -3.539  1.00 86.33  ? 982  ALA A C   1 
ATOM 6702  O O   . ALA A 1 915  ? 263.684 -34.653 -3.422  1.00 87.24  ? 982  ALA A O   1 
ATOM 6703  C CB  . ALA A 1 915  ? 260.216 -34.457 -3.286  1.00 85.52  ? 982  ALA A CB  1 
ATOM 6704  N N   . GLN A 1 916  ? 262.279 -36.373 -3.158  1.00 86.16  ? 983  GLN A N   1 
ATOM 6705  C CA  . GLN A 1 916  ? 263.259 -37.241 -2.534  1.00 85.57  ? 983  GLN A CA  1 
ATOM 6706  C C   . GLN A 1 916  ? 264.625 -37.089 -3.177  1.00 85.89  ? 983  GLN A C   1 
ATOM 6707  O O   . GLN A 1 916  ? 265.620 -36.920 -2.485  1.00 85.06  ? 983  GLN A O   1 
ATOM 6708  C CB  . GLN A 1 916  ? 262.792 -38.692 -2.638  1.00 85.23  ? 983  GLN A CB  1 
ATOM 6709  C CG  . GLN A 1 916  ? 261.355 -38.917 -2.133  1.00 83.91  ? 983  GLN A CG  1 
ATOM 6710  C CD  . GLN A 1 916  ? 261.272 -39.318 -0.664  1.00 82.02  ? 983  GLN A CD  1 
ATOM 6711  O OE1 . GLN A 1 916  ? 261.258 -40.508 -0.337  1.00 81.75  ? 983  GLN A OE1 1 
ATOM 6712  N NE2 . GLN A 1 916  ? 261.218 -38.327 0.226   1.00 80.45  ? 983  GLN A NE2 1 
ATOM 6713  N N   . GLN A 1 917  ? 264.662 -37.135 -4.504  1.00 87.58  ? 984  GLN A N   1 
ATOM 6714  C CA  . GLN A 1 917  ? 265.906 -37.011 -5.259  1.00 89.23  ? 984  GLN A CA  1 
ATOM 6715  C C   . GLN A 1 917  ? 266.698 -35.747 -5.013  1.00 90.19  ? 984  GLN A C   1 
ATOM 6716  O O   . GLN A 1 917  ? 267.875 -35.806 -4.671  1.00 89.55  ? 984  GLN A O   1 
ATOM 6717  C CB  . GLN A 1 917  ? 265.619 -37.083 -6.740  1.00 90.02  ? 984  GLN A CB  1 
ATOM 6718  C CG  . GLN A 1 917  ? 265.387 -38.469 -7.235  1.00 91.08  ? 984  GLN A CG  1 
ATOM 6719  C CD  . GLN A 1 917  ? 264.981 -38.479 -8.693  1.00 91.77  ? 984  GLN A CD  1 
ATOM 6720  O OE1 . GLN A 1 917  ? 263.898 -38.007 -9.049  1.00 90.03  ? 984  GLN A OE1 1 
ATOM 6721  N NE2 . GLN A 1 917  ? 265.854 -39.008 -9.553  1.00 93.17  ? 984  GLN A NE2 1 
ATOM 6722  N N   . MET A 1 918  ? 266.046 -34.609 -5.236  1.00 92.13  ? 985  MET A N   1 
ATOM 6723  C CA  . MET A 1 918  ? 266.648 -33.287 -5.055  1.00 93.62  ? 985  MET A CA  1 
ATOM 6724  C C   . MET A 1 918  ? 267.252 -33.200 -3.681  1.00 93.75  ? 985  MET A C   1 
ATOM 6725  O O   . MET A 1 918  ? 268.345 -32.685 -3.483  1.00 93.34  ? 985  MET A O   1 
ATOM 6726  C CB  . MET A 1 918  ? 265.573 -32.222 -5.196  1.00 95.05  ? 985  MET A CB  1 
ATOM 6727  C CG  . MET A 1 918  ? 264.767 -32.432 -6.437  1.00 96.42  ? 985  MET A CG  1 
ATOM 6728  S SD  . MET A 1 918  ? 263.095 -31.857 -6.311  1.00 97.52  ? 985  MET A SD  1 
ATOM 6729  C CE  . MET A 1 918  ? 263.024 -30.997 -7.849  1.00 98.72  ? 985  MET A CE  1 
ATOM 6730  N N   . TYR A 1 919  ? 266.507 -33.710 -2.726  1.00 94.08  ? 986  TYR A N   1 
ATOM 6731  C CA  . TYR A 1 919  ? 266.955 -33.715 -1.366  1.00 94.13  ? 986  TYR A CA  1 
ATOM 6732  C C   . TYR A 1 919  ? 268.092 -34.725 -1.239  1.00 95.60  ? 986  TYR A C   1 
ATOM 6733  O O   . TYR A 1 919  ? 269.068 -34.514 -0.521  1.00 95.83  ? 986  TYR A O   1 
ATOM 6734  C CB  . TYR A 1 919  ? 265.764 -34.072 -0.498  1.00 92.55  ? 986  TYR A CB  1 
ATOM 6735  C CG  . TYR A 1 919  ? 264.647 -33.073 -0.667  1.00 90.93  ? 986  TYR A CG  1 
ATOM 6736  C CD1 . TYR A 1 919  ? 263.395 -33.463 -1.117  1.00 90.09  ? 986  TYR A CD1 1 
ATOM 6737  C CD2 . TYR A 1 919  ? 264.854 -31.730 -0.378  1.00 90.76  ? 986  TYR A CD2 1 
ATOM 6738  C CE1 . TYR A 1 919  ? 262.380 -32.540 -1.271  1.00 89.74  ? 986  TYR A CE1 1 
ATOM 6739  C CE2 . TYR A 1 919  ? 263.853 -30.806 -0.528  1.00 90.67  ? 986  TYR A CE2 1 
ATOM 6740  C CZ  . TYR A 1 919  ? 262.618 -31.211 -0.966  1.00 90.30  ? 986  TYR A CZ  1 
ATOM 6741  O OH  . TYR A 1 919  ? 261.609 -30.281 -1.031  1.00 91.02  ? 986  TYR A OH  1 
ATOM 6742  N N   . ALA A 1 920  ? 267.972 -35.818 -1.971  1.00 96.55  ? 987  ALA A N   1 
ATOM 6743  C CA  . ALA A 1 920  ? 268.991 -36.848 -1.936  1.00 97.42  ? 987  ALA A CA  1 
ATOM 6744  C C   . ALA A 1 920  ? 270.324 -36.289 -2.392  1.00 98.13  ? 987  ALA A C   1 
ATOM 6745  O O   . ALA A 1 920  ? 271.345 -36.467 -1.740  1.00 98.71  ? 987  ALA A O   1 
ATOM 6746  C CB  . ALA A 1 920  ? 268.584 -37.992 -2.834  1.00 98.17  ? 987  ALA A CB  1 
ATOM 6747  N N   . ALA A 1 921  ? 270.293 -35.601 -3.521  1.00 98.65  ? 988  ALA A N   1 
ATOM 6748  C CA  . ALA A 1 921  ? 271.485 -35.027 -4.121  1.00 99.66  ? 988  ALA A CA  1 
ATOM 6749  C C   . ALA A 1 921  ? 272.317 -34.060 -3.276  1.00 100.13 ? 988  ALA A C   1 
ATOM 6750  O O   . ALA A 1 921  ? 273.529 -34.030 -3.440  1.00 100.35 ? 988  ALA A O   1 
ATOM 6751  C CB  . ALA A 1 921  ? 271.114 -34.372 -5.436  1.00 99.77  ? 988  ALA A CB  1 
ATOM 6752  N N   . THR A 1 922  ? 271.683 -33.260 -2.412  1.00 100.47 ? 989  THR A N   1 
ATOM 6753  C CA  . THR A 1 922  ? 272.404 -32.304 -1.558  1.00 100.41 ? 989  THR A CA  1 
ATOM 6754  C C   . THR A 1 922  ? 272.428 -32.759 -0.108  1.00 100.09 ? 989  THR A C   1 
ATOM 6755  O O   . THR A 1 922  ? 272.998 -32.092 0.750   1.00 99.31  ? 989  THR A O   1 
ATOM 6756  C CB  . THR A 1 922  ? 271.791 -30.874 -1.587  1.00 100.66 ? 989  THR A CB  1 
ATOM 6757  O OG1 . THR A 1 922  ? 270.476 -30.914 -2.156  1.00 100.42 ? 989  THR A OG1 1 
ATOM 6758  C CG2 . THR A 1 922  ? 272.675 -29.923 -2.387  1.00 100.93 ? 989  THR A CG2 1 
ATOM 6759  N N   . LYS A 1 923  ? 271.805 -33.902 0.154   1.00 100.14 ? 990  LYS A N   1 
ATOM 6760  C CA  . LYS A 1 923  ? 271.727 -34.463 1.502   1.00 100.38 ? 990  LYS A CA  1 
ATOM 6761  C C   . LYS A 1 923  ? 271.037 -35.830 1.491   1.00 102.23 ? 990  LYS A C   1 
ATOM 6762  O O   . LYS A 1 923  ? 270.010 -36.004 2.134   1.00 103.21 ? 990  LYS A O   1 
ATOM 6763  C CB  . LYS A 1 923  ? 270.948 -33.507 2.430   1.00 97.70  ? 990  LYS A CB  1 
ATOM 6764  C CG  . LYS A 1 923  ? 269.980 -32.547 1.710   1.00 95.48  ? 990  LYS A CG  1 
ATOM 6765  C CD  . LYS A 1 923  ? 268.961 -31.852 2.648   1.00 92.56  ? 990  LYS A CD  1 
ATOM 6766  C CE  . LYS A 1 923  ? 268.076 -30.837 1.879   1.00 91.20  ? 990  LYS A CE  1 
ATOM 6767  N NZ  . LYS A 1 923  ? 266.845 -30.373 2.614   1.00 90.19  ? 990  LYS A NZ  1 
ATOM 6768  N N   . GLY A 1 924  ? 271.599 -36.811 0.793   1.00 103.33 ? 991  GLY A N   1 
ATOM 6769  C CA  . GLY A 1 924  ? 270.928 -38.097 0.754   1.00 104.51 ? 991  GLY A CA  1 
ATOM 6770  C C   . GLY A 1 924  ? 271.653 -39.404 1.027   1.00 105.83 ? 991  GLY A C   1 
ATOM 6771  O O   . GLY A 1 924  ? 271.313 -40.400 0.401   1.00 106.07 ? 991  GLY A O   1 
ATOM 6772  N N   . LEU A 1 925  ? 272.617 -39.432 1.947   1.00 107.18 ? 992  LEU A N   1 
ATOM 6773  C CA  . LEU A 1 925  ? 273.344 -40.678 2.267   1.00 108.19 ? 992  LEU A CA  1 
ATOM 6774  C C   . LEU A 1 925  ? 272.713 -41.300 3.542   1.00 108.76 ? 992  LEU A C   1 
ATOM 6775  O O   . LEU A 1 925  ? 271.708 -40.765 4.014   1.00 108.04 ? 992  LEU A O   1 
ATOM 6776  C CB  . LEU A 1 925  ? 274.835 -40.365 2.471   1.00 108.98 ? 992  LEU A CB  1 
ATOM 6777  C CG  . LEU A 1 925  ? 275.912 -41.412 2.125   1.00 109.78 ? 992  LEU A CG  1 
ATOM 6778  C CD1 . LEU A 1 925  ? 275.541 -42.681 2.773   1.00 109.65 ? 992  LEU A CD1 1 
ATOM 6779  C CD2 . LEU A 1 925  ? 276.032 -41.670 0.637   1.00 110.86 ? 992  LEU A CD2 1 
ATOM 6780  N N   . ARG A 1 926  ? 273.254 -42.395 4.108   1.00 109.81 ? 993  ARG A N   1 
ATOM 6781  C CA  . ARG A 1 926  ? 272.617 -42.986 5.311   1.00 111.69 ? 993  ARG A CA  1 
ATOM 6782  C C   . ARG A 1 926  ? 272.754 -42.213 6.640   1.00 112.85 ? 993  ARG A C   1 
ATOM 6783  O O   . ARG A 1 926  ? 273.452 -41.204 6.690   1.00 113.36 ? 993  ARG A O   1 
ATOM 6784  C CB  . ARG A 1 926  ? 272.960 -44.483 5.476   1.00 111.70 ? 993  ARG A CB  1 
ATOM 6785  C CG  . ARG A 1 926  ? 274.308 -44.894 5.995   1.00 111.88 ? 993  ARG A CG  1 
ATOM 6786  C CD  . ARG A 1 926  ? 274.314 -46.392 6.048   1.00 112.91 ? 993  ARG A CD  1 
ATOM 6787  N NE  . ARG A 1 926  ? 275.614 -47.038 6.033   1.00 112.61 ? 993  ARG A NE  1 
ATOM 6788  C CZ  . ARG A 1 926  ? 275.855 -48.230 6.577   1.00 112.77 ? 993  ARG A CZ  1 
ATOM 6789  N NH1 . ARG A 1 926  ? 274.893 -48.911 7.183   1.00 113.35 ? 993  ARG A NH1 1 
ATOM 6790  N NH2 . ARG A 1 926  ? 277.072 -48.741 6.548   1.00 113.35 ? 993  ARG A NH2 1 
ATOM 6791  N N   . TRP A 1 927  ? 272.112 -42.694 7.711   1.00 114.40 ? 994  TRP A N   1 
ATOM 6792  C CA  . TRP A 1 927  ? 272.027 -41.952 8.981   1.00 115.92 ? 994  TRP A CA  1 
ATOM 6793  C C   . TRP A 1 927  ? 271.699 -40.539 8.468   1.00 115.86 ? 994  TRP A C   1 
ATOM 6794  O O   . TRP A 1 927  ? 270.671 -40.364 7.828   1.00 116.95 ? 994  TRP A O   1 
ATOM 6795  C CB  . TRP A 1 927  ? 273.306 -41.920 9.837   1.00 117.83 ? 994  TRP A CB  1 
ATOM 6796  C CG  . TRP A 1 927  ? 274.053 -43.202 10.123  1.00 120.41 ? 994  TRP A CG  1 
ATOM 6797  C CD1 . TRP A 1 927  ? 274.862 -43.839 9.274   1.00 120.92 ? 994  TRP A CD1 1 
ATOM 6798  C CD2 . TRP A 1 927  ? 274.204 -43.878 11.392  1.00 121.66 ? 994  TRP A CD2 1 
ATOM 6799  N NE1 . TRP A 1 927  ? 275.530 -44.846 9.903   1.00 121.71 ? 994  TRP A NE1 1 
ATOM 6800  C CE2 . TRP A 1 927  ? 275.149 -44.900 11.207  1.00 122.18 ? 994  TRP A CE2 1 
ATOM 6801  C CE3 . TRP A 1 927  ? 273.644 -43.711 12.656  1.00 122.07 ? 994  TRP A CE3 1 
ATOM 6802  C CZ2 . TRP A 1 927  ? 275.550 -45.764 12.225  1.00 122.41 ? 994  TRP A CZ2 1 
ATOM 6803  C CZ3 . TRP A 1 927  ? 274.044 -44.573 13.672  1.00 122.53 ? 994  TRP A CZ3 1 
ATOM 6804  C CH2 . TRP A 1 927  ? 274.992 -45.583 13.449  1.00 122.73 ? 994  TRP A CH2 1 
ATOM 6805  N N   . TYR A 1 928  ? 272.547 -39.535 8.672   1.00 114.92 ? 995  TYR A N   1 
ATOM 6806  C CA  . TYR A 1 928  ? 272.154 -38.232 8.144   1.00 113.57 ? 995  TYR A CA  1 
ATOM 6807  C C   . TYR A 1 928  ? 272.774 -37.643 6.856   1.00 111.91 ? 995  TYR A C   1 
ATOM 6808  O O   . TYR A 1 928  ? 272.006 -37.258 5.976   1.00 112.26 ? 995  TYR A O   1 
ATOM 6809  C CB  . TYR A 1 928  ? 272.167 -37.192 9.270   1.00 115.29 ? 995  TYR A CB  1 
ATOM 6810  C CG  . TYR A 1 928  ? 271.075 -37.408 10.301  1.00 118.04 ? 995  TYR A CG  1 
ATOM 6811  C CD1 . TYR A 1 928  ? 269.794 -36.878 10.126  1.00 119.62 ? 995  TYR A CD1 1 
ATOM 6812  C CD2 . TYR A 1 928  ? 271.327 -38.155 11.452  1.00 118.93 ? 995  TYR A CD2 1 
ATOM 6813  C CE1 . TYR A 1 928  ? 268.795 -37.090 11.083  1.00 121.38 ? 995  TYR A CE1 1 
ATOM 6814  C CE2 . TYR A 1 928  ? 270.345 -38.373 12.406  1.00 120.51 ? 995  TYR A CE2 1 
ATOM 6815  C CZ  . TYR A 1 928  ? 269.085 -37.841 12.222  1.00 121.62 ? 995  TYR A CZ  1 
ATOM 6816  O OH  . TYR A 1 928  ? 268.129 -38.065 13.188  1.00 121.97 ? 995  TYR A OH  1 
ATOM 6817  N N   . ARG A 1 929  ? 274.100 -37.584 6.676   1.00 109.31 ? 996  ARG A N   1 
ATOM 6818  C CA  . ARG A 1 929  ? 274.579 -36.955 5.436   1.00 106.38 ? 996  ARG A CA  1 
ATOM 6819  C C   . ARG A 1 929  ? 275.820 -37.214 4.628   1.00 103.66 ? 996  ARG A C   1 
ATOM 6820  O O   . ARG A 1 929  ? 276.803 -37.787 5.063   1.00 103.66 ? 996  ARG A O   1 
ATOM 6821  C CB  . ARG A 1 929  ? 274.581 -35.463 5.614   1.00 106.68 ? 996  ARG A CB  1 
ATOM 6822  C CG  . ARG A 1 929  ? 273.232 -34.923 5.645   1.00 107.18 ? 996  ARG A CG  1 
ATOM 6823  C CD  . ARG A 1 929  ? 273.340 -33.499 5.833   1.00 108.43 ? 996  ARG A CD  1 
ATOM 6824  N NE  . ARG A 1 929  ? 272.077 -32.929 6.240   1.00 108.83 ? 996  ARG A NE  1 
ATOM 6825  C CZ  . ARG A 1 929  ? 271.992 -31.683 6.659   1.00 108.38 ? 996  ARG A CZ  1 
ATOM 6826  N NH1 . ARG A 1 929  ? 273.107 -30.973 6.696   1.00 108.52 ? 996  ARG A NH1 1 
ATOM 6827  N NH2 . ARG A 1 929  ? 270.831 -31.151 7.028   1.00 107.52 ? 996  ARG A NH2 1 
ATOM 6828  N N   . LEU A 1 930  ? 275.726 -36.682 3.420   1.00 100.51 ? 997  LEU A N   1 
ATOM 6829  C CA  . LEU A 1 930  ? 276.762 -36.675 2.404   1.00 96.66  ? 997  LEU A CA  1 
ATOM 6830  C C   . LEU A 1 930  ? 276.199 -35.578 1.530   1.00 92.64  ? 997  LEU A C   1 
ATOM 6831  O O   . LEU A 1 930  ? 275.297 -34.837 1.947   1.00 92.06  ? 997  LEU A O   1 
ATOM 6832  C CB  . LEU A 1 930  ? 276.824 -37.972 1.592   1.00 98.91  ? 997  LEU A CB  1 
ATOM 6833  C CG  . LEU A 1 930  ? 278.005 -38.278 0.631   1.00 100.15 ? 997  LEU A CG  1 
ATOM 6834  C CD1 . LEU A 1 930  ? 277.449 -39.132 -0.505  1.00 100.79 ? 997  LEU A CD1 1 
ATOM 6835  C CD2 . LEU A 1 930  ? 278.674 -37.039 0.029   1.00 100.61 ? 997  LEU A CD2 1 
ATOM 6836  N N   . SER A 1 931  ? 276.686 -35.525 0.300   1.00 87.53  ? 998  SER A N   1 
ATOM 6837  C CA  . SER A 1 931  ? 276.279 -34.514 -0.634  1.00 82.77  ? 998  SER A CA  1 
ATOM 6838  C C   . SER A 1 931  ? 276.510 -33.174 0.030   1.00 79.83  ? 998  SER A C   1 
ATOM 6839  O O   . SER A 1 931  ? 277.576 -32.943 0.607   1.00 79.29  ? 998  SER A O   1 
ATOM 6840  C CB  . SER A 1 931  ? 274.820 -34.641 -1.010  1.00 82.29  ? 998  SER A CB  1 
ATOM 6841  O OG  . SER A 1 931  ? 274.505 -33.528 -1.806  1.00 81.42  ? 998  SER A OG  1 
ATOM 6842  N N   . ASP A 1 932  ? 275.510 -32.304 0.028   1.00 76.57  ? 999  ASP A N   1 
ATOM 6843  C CA  . ASP A 1 932  ? 275.777 -30.999 0.581   1.00 73.22  ? 999  ASP A CA  1 
ATOM 6844  C C   . ASP A 1 932  ? 275.062 -30.444 1.765   1.00 72.63  ? 999  ASP A C   1 
ATOM 6845  O O   . ASP A 1 932  ? 274.192 -29.581 1.640   1.00 71.05  ? 999  ASP A O   1 
ATOM 6846  C CB  . ASP A 1 932  ? 275.729 -30.012 -0.551  1.00 70.16  ? 999  ASP A CB  1 
ATOM 6847  C CG  . ASP A 1 932  ? 276.788 -30.301 -1.566  1.00 67.95  ? 999  ASP A CG  1 
ATOM 6848  O OD1 . ASP A 1 932  ? 277.965 -30.020 -1.262  1.00 68.04  ? 999  ASP A OD1 1 
ATOM 6849  O OD2 . ASP A 1 932  ? 276.451 -30.832 -2.647  1.00 63.95  ? 999  ASP A OD2 1 
ATOM 6850  N N   . GLU A 1 933  ? 275.479 -30.923 2.924   1.00 73.23  ? 1000 GLU A N   1 
ATOM 6851  C CA  . GLU A 1 933  ? 274.930 -30.452 4.155   1.00 74.20  ? 1000 GLU A CA  1 
ATOM 6852  C C   . GLU A 1 933  ? 275.671 -31.068 5.304   1.00 76.30  ? 1000 GLU A C   1 
ATOM 6853  O O   . GLU A 1 933  ? 275.132 -31.765 6.132   1.00 77.74  ? 1000 GLU A O   1 
ATOM 6854  C CB  . GLU A 1 933  ? 273.419 -30.697 4.207   1.00 70.78  ? 1000 GLU A CB  1 
ATOM 6855  C CG  . GLU A 1 933  ? 272.620 -29.474 3.675   1.00 65.37  ? 1000 GLU A CG  1 
ATOM 6856  C CD  . GLU A 1 933  ? 271.115 -29.444 4.017   1.00 62.32  ? 1000 GLU A CD  1 
ATOM 6857  O OE1 . GLU A 1 933  ? 270.466 -28.438 3.648   1.00 61.00  ? 1000 GLU A OE1 1 
ATOM 6858  O OE2 . GLU A 1 933  ? 270.578 -30.390 4.643   1.00 59.77  ? 1000 GLU A OE2 1 
ATOM 6859  N N   . GLY A 1 934  ? 276.965 -30.829 5.317   1.00 77.25  ? 1001 GLY A N   1 
ATOM 6860  C CA  . GLY A 1 934  ? 277.746 -31.304 6.429   1.00 77.36  ? 1001 GLY A CA  1 
ATOM 6861  C C   . GLY A 1 934  ? 277.549 -30.159 7.398   1.00 77.92  ? 1001 GLY A C   1 
ATOM 6862  O O   . GLY A 1 934  ? 277.739 -30.300 8.598   1.00 77.51  ? 1001 GLY A O   1 
ATOM 6863  N N   . GLU A 1 935  ? 277.158 -29.011 6.840   1.00 78.31  ? 1002 GLU A N   1 
ATOM 6864  C CA  . GLU A 1 935  ? 276.881 -27.784 7.598   1.00 78.83  ? 1002 GLU A CA  1 
ATOM 6865  C C   . GLU A 1 935  ? 275.543 -27.933 8.284   1.00 77.91  ? 1002 GLU A C   1 
ATOM 6866  O O   . GLU A 1 935  ? 275.403 -27.668 9.466   1.00 77.58  ? 1002 GLU A O   1 
ATOM 6867  C CB  . GLU A 1 935  ? 276.814 -26.573 6.667   1.00 81.34  ? 1002 GLU A CB  1 
ATOM 6868  C CG  . GLU A 1 935  ? 276.042 -26.801 5.378   1.00 86.16  ? 1002 GLU A CG  1 
ATOM 6869  C CD  . GLU A 1 935  ? 276.665 -26.074 4.204   1.00 90.13  ? 1002 GLU A CD  1 
ATOM 6870  O OE1 . GLU A 1 935  ? 276.776 -24.826 4.260   1.00 92.26  ? 1002 GLU A OE1 1 
ATOM 6871  O OE2 . GLU A 1 935  ? 277.049 -26.763 3.231   1.00 92.80  ? 1002 GLU A OE2 1 
ATOM 6872  N N   . TRP A 1 936  ? 274.539 -28.327 7.515   1.00 77.54  ? 1003 TRP A N   1 
ATOM 6873  C CA  . TRP A 1 936  ? 273.226 -28.545 8.091   1.00 77.56  ? 1003 TRP A CA  1 
ATOM 6874  C C   . TRP A 1 936  ? 273.374 -29.755 8.982   1.00 76.81  ? 1003 TRP A C   1 
ATOM 6875  O O   . TRP A 1 936  ? 272.639 -29.921 9.957   1.00 76.38  ? 1003 TRP A O   1 
ATOM 6876  C CB  . TRP A 1 936  ? 272.203 -28.847 7.013   1.00 79.36  ? 1003 TRP A CB  1 
ATOM 6877  C CG  . TRP A 1 936  ? 271.433 -27.717 6.625   1.00 81.33  ? 1003 TRP A CG  1 
ATOM 6878  C CD1 . TRP A 1 936  ? 270.088 -27.675 6.440   1.00 82.23  ? 1003 TRP A CD1 1 
ATOM 6879  C CD2 . TRP A 1 936  ? 271.925 -26.408 6.386   1.00 82.10  ? 1003 TRP A CD2 1 
ATOM 6880  N NE1 . TRP A 1 936  ? 269.703 -26.405 6.102   1.00 82.31  ? 1003 TRP A NE1 1 
ATOM 6881  C CE2 . TRP A 1 936  ? 270.816 -25.605 6.063   1.00 82.16  ? 1003 TRP A CE2 1 
ATOM 6882  C CE3 . TRP A 1 936  ? 273.203 -25.829 6.418   1.00 84.10  ? 1003 TRP A CE3 1 
ATOM 6883  C CZ2 . TRP A 1 936  ? 270.943 -24.251 5.769   1.00 82.93  ? 1003 TRP A CZ2 1 
ATOM 6884  C CZ3 . TRP A 1 936  ? 273.332 -24.490 6.127   1.00 85.16  ? 1003 TRP A CZ3 1 
ATOM 6885  C CH2 . TRP A 1 936  ? 272.208 -23.710 5.808   1.00 84.65  ? 1003 TRP A CH2 1 
ATOM 6886  N N   . LEU A 1 937  ? 274.325 -30.613 8.621   1.00 76.39  ? 1004 LEU A N   1 
ATOM 6887  C CA  . LEU A 1 937  ? 274.575 -31.785 9.420   1.00 77.21  ? 1004 LEU A CA  1 
ATOM 6888  C C   . LEU A 1 937  ? 275.001 -31.122 10.725  1.00 78.09  ? 1004 LEU A C   1 
ATOM 6889  O O   . LEU A 1 937  ? 274.670 -31.603 11.806  1.00 77.66  ? 1004 LEU A O   1 
ATOM 6890  C CB  . LEU A 1 937  ? 275.687 -32.658 8.798   1.00 76.37  ? 1004 LEU A CB  1 
ATOM 6891  C CG  . LEU A 1 937  ? 275.607 -34.166 9.116   1.00 75.32  ? 1004 LEU A CG  1 
ATOM 6892  C CD1 . LEU A 1 937  ? 274.157 -34.616 9.041   1.00 74.25  ? 1004 LEU A CD1 1 
ATOM 6893  C CD2 . LEU A 1 937  ? 276.472 -34.985 8.162   1.00 74.03  ? 1004 LEU A CD2 1 
ATOM 6894  N N   . VAL A 1 938  ? 275.689 -29.979 10.620  1.00 80.13  ? 1005 VAL A N   1 
ATOM 6895  C CA  . VAL A 1 938  ? 276.109 -29.265 11.820  1.00 81.77  ? 1005 VAL A CA  1 
ATOM 6896  C C   . VAL A 1 938  ? 275.037 -28.336 12.345  1.00 81.24  ? 1005 VAL A C   1 
ATOM 6897  O O   . VAL A 1 938  ? 274.840 -28.233 13.547  1.00 81.28  ? 1005 VAL A O   1 
ATOM 6898  C CB  . VAL A 1 938  ? 277.452 -28.474 11.654  1.00 82.26  ? 1005 VAL A CB  1 
ATOM 6899  C CG1 . VAL A 1 938  ? 278.464 -29.312 10.912  1.00 82.55  ? 1005 VAL A CG1 1 
ATOM 6900  C CG2 . VAL A 1 938  ? 277.235 -27.149 10.996  1.00 80.82  ? 1005 VAL A CG2 1 
ATOM 6901  N N   . ARG A 1 939  ? 274.340 -27.645 11.462  1.00 80.53  ? 1006 ARG A N   1 
ATOM 6902  C CA  . ARG A 1 939  ? 273.292 -26.798 11.956  1.00 79.97  ? 1006 ARG A CA  1 
ATOM 6903  C C   . ARG A 1 939  ? 272.476 -27.759 12.750  1.00 79.13  ? 1006 ARG A C   1 
ATOM 6904  O O   . ARG A 1 939  ? 272.173 -27.530 13.905  1.00 78.02  ? 1006 ARG A O   1 
ATOM 6905  C CB  . ARG A 1 939  ? 272.486 -26.205 10.815  1.00 81.56  ? 1006 ARG A CB  1 
ATOM 6906  C CG  . ARG A 1 939  ? 273.097 -24.936 10.247  1.00 85.59  ? 1006 ARG A CG  1 
ATOM 6907  C CD  . ARG A 1 939  ? 274.475 -24.640 10.849  1.00 89.71  ? 1006 ARG A CD  1 
ATOM 6908  N NE  . ARG A 1 939  ? 274.442 -23.946 12.145  1.00 93.90  ? 1006 ARG A NE  1 
ATOM 6909  C CZ  . ARG A 1 939  ? 274.769 -24.488 13.321  1.00 95.64  ? 1006 ARG A CZ  1 
ATOM 6910  N NH1 . ARG A 1 939  ? 275.154 -25.758 13.410  1.00 96.68  ? 1006 ARG A NH1 1 
ATOM 6911  N NH2 . ARG A 1 939  ? 274.746 -23.736 14.418  1.00 96.96  ? 1006 ARG A NH2 1 
ATOM 6912  N N   . GLU A 1 940  ? 272.181 -28.888 12.134  1.00 79.14  ? 1007 GLU A N   1 
ATOM 6913  C CA  . GLU A 1 940  ? 271.399 -29.886 12.818  1.00 79.12  ? 1007 GLU A CA  1 
ATOM 6914  C C   . GLU A 1 940  ? 272.073 -30.530 14.011  1.00 78.80  ? 1007 GLU A C   1 
ATOM 6915  O O   . GLU A 1 940  ? 271.418 -30.714 15.028  1.00 78.04  ? 1007 GLU A O   1 
ATOM 6916  C CB  . GLU A 1 940  ? 270.959 -31.015 11.888  1.00 79.10  ? 1007 GLU A CB  1 
ATOM 6917  C CG  . GLU A 1 940  ? 270.232 -32.121 12.667  1.00 78.89  ? 1007 GLU A CG  1 
ATOM 6918  C CD  . GLU A 1 940  ? 269.659 -33.203 11.793  1.00 78.69  ? 1007 GLU A CD  1 
ATOM 6919  O OE1 . GLU A 1 940  ? 269.290 -32.906 10.641  1.00 78.76  ? 1007 GLU A OE1 1 
ATOM 6920  O OE2 . GLU A 1 940  ? 269.549 -34.350 12.265  1.00 77.92  ? 1007 GLU A OE2 1 
ATOM 6921  N N   . LEU A 1 941  ? 273.351 -30.905 13.902  1.00 78.28  ? 1008 LEU A N   1 
ATOM 6922  C CA  . LEU A 1 941  ? 274.024 -31.574 15.032  1.00 78.40  ? 1008 LEU A CA  1 
ATOM 6923  C C   . LEU A 1 941  ? 274.380 -30.642 16.166  1.00 78.37  ? 1008 LEU A C   1 
ATOM 6924  O O   . LEU A 1 941  ? 274.463 -31.059 17.331  1.00 79.77  ? 1008 LEU A O   1 
ATOM 6925  C CB  . LEU A 1 941  ? 275.290 -32.328 14.589  1.00 78.30  ? 1008 LEU A CB  1 
ATOM 6926  C CG  . LEU A 1 941  ? 276.746 -31.858 14.771  1.00 79.25  ? 1008 LEU A CG  1 
ATOM 6927  C CD1 . LEU A 1 941  ? 277.038 -30.896 13.715  1.00 78.76  ? 1008 LEU A CD1 1 
ATOM 6928  C CD2 . LEU A 1 941  ? 277.050 -31.270 16.139  1.00 80.02  ? 1008 LEU A CD2 1 
ATOM 6929  N N   . ASN A 1 942  ? 274.623 -29.385 15.816  1.00 78.15  ? 1009 ASN A N   1 
ATOM 6930  C CA  . ASN A 1 942  ? 274.945 -28.391 16.815  1.00 79.08  ? 1009 ASN A CA  1 
ATOM 6931  C C   . ASN A 1 942  ? 273.640 -27.865 17.387  1.00 80.10  ? 1009 ASN A C   1 
ATOM 6932  O O   . ASN A 1 942  ? 273.566 -27.444 18.544  1.00 79.46  ? 1009 ASN A O   1 
ATOM 6933  C CB  . ASN A 1 942  ? 275.759 -27.250 16.196  1.00 78.76  ? 1009 ASN A CB  1 
ATOM 6934  C CG  . ASN A 1 942  ? 277.216 -27.645 15.935  1.00 77.81  ? 1009 ASN A CG  1 
ATOM 6935  O OD1 . ASN A 1 942  ? 277.773 -28.519 16.615  1.00 77.59  ? 1009 ASN A OD1 1 
ATOM 6936  N ND2 . ASN A 1 942  ? 277.843 -26.986 14.962  1.00 77.01  ? 1009 ASN A ND2 1 
ATOM 6937  N N   . LEU A 1 943  ? 272.585 -27.927 16.591  1.00 82.28  ? 1010 LEU A N   1 
ATOM 6938  C CA  . LEU A 1 943  ? 271.335 -27.412 17.086  1.00 84.77  ? 1010 LEU A CA  1 
ATOM 6939  C C   . LEU A 1 943  ? 270.228 -28.356 17.432  1.00 85.33  ? 1010 LEU A C   1 
ATOM 6940  O O   . LEU A 1 943  ? 269.101 -27.941 17.608  1.00 85.87  ? 1010 LEU A O   1 
ATOM 6941  C CB  . LEU A 1 943  ? 270.853 -26.326 16.156  1.00 85.29  ? 1010 LEU A CB  1 
ATOM 6942  C CG  . LEU A 1 943  ? 272.050 -25.418 16.406  1.00 84.92  ? 1010 LEU A CG  1 
ATOM 6943  C CD1 . LEU A 1 943  ? 272.705 -25.128 15.122  1.00 83.56  ? 1010 LEU A CD1 1 
ATOM 6944  C CD2 . LEU A 1 943  ? 271.638 -24.181 17.152  1.00 85.61  ? 1010 LEU A CD2 1 
ATOM 6945  N N   . PRO A 1 944  ? 270.513 -29.654 17.496  1.00 85.32  ? 1011 PRO A N   1 
ATOM 6946  C CA  . PRO A 1 944  ? 269.345 -30.422 17.871  1.00 84.72  ? 1011 PRO A CA  1 
ATOM 6947  C C   . PRO A 1 944  ? 269.602 -30.389 19.366  1.00 84.04  ? 1011 PRO A C   1 
ATOM 6948  O O   . PRO A 1 944  ? 268.865 -30.967 20.147  1.00 83.13  ? 1011 PRO A O   1 
ATOM 6949  C CB  . PRO A 1 944  ? 269.662 -31.786 17.306  1.00 85.54  ? 1011 PRO A CB  1 
ATOM 6950  C CG  . PRO A 1 944  ? 271.107 -31.929 17.708  1.00 85.19  ? 1011 PRO A CG  1 
ATOM 6951  C CD  . PRO A 1 944  ? 271.700 -30.526 17.445  1.00 85.67  ? 1011 PRO A CD  1 
ATOM 6952  N N   . VAL A 1 945  ? 270.677 -29.690 19.745  1.00 83.85  ? 1012 VAL A N   1 
ATOM 6953  C CA  . VAL A 1 945  ? 271.108 -29.638 21.139  1.00 85.07  ? 1012 VAL A CA  1 
ATOM 6954  C C   . VAL A 1 945  ? 271.486 -28.315 21.816  1.00 86.89  ? 1012 VAL A C   1 
ATOM 6955  O O   . VAL A 1 945  ? 272.156 -27.443 21.242  1.00 87.77  ? 1012 VAL A O   1 
ATOM 6956  C CB  . VAL A 1 945  ? 272.274 -30.645 21.362  1.00 83.99  ? 1012 VAL A CB  1 
ATOM 6957  C CG1 . VAL A 1 945  ? 271.758 -32.086 21.198  1.00 83.62  ? 1012 VAL A CG1 1 
ATOM 6958  C CG2 . VAL A 1 945  ? 273.414 -30.368 20.368  1.00 83.58  ? 1012 VAL A CG2 1 
ATOM 6959  N N   . ASP A 1 946  ? 271.075 -28.237 23.082  1.00 88.19  ? 1013 ASP A N   1 
ATOM 6960  C CA  . ASP A 1 946  ? 271.276 -27.080 23.934  1.00 88.26  ? 1013 ASP A CA  1 
ATOM 6961  C C   . ASP A 1 946  ? 270.645 -25.937 23.185  1.00 87.63  ? 1013 ASP A C   1 
ATOM 6962  O O   . ASP A 1 946  ? 269.898 -26.147 22.228  1.00 87.38  ? 1013 ASP A O   1 
ATOM 6963  C CB  . ASP A 1 946  ? 272.765 -26.786 24.149  1.00 89.27  ? 1013 ASP A CB  1 
ATOM 6964  C CG  . ASP A 1 946  ? 272.998 -25.668 25.157  1.00 89.37  ? 1013 ASP A CG  1 
ATOM 6965  O OD1 . ASP A 1 946  ? 272.010 -25.125 25.686  1.00 90.01  ? 1013 ASP A OD1 1 
ATOM 6966  O OD2 . ASP A 1 946  ? 274.168 -25.334 25.424  1.00 88.03  ? 1013 ASP A OD2 1 
ATOM 6967  N N   . ARG A 1 947  ? 270.935 -24.726 23.629  1.00 86.67  ? 1014 ARG A N   1 
ATOM 6968  C CA  . ARG A 1 947  ? 270.421 -23.555 22.968  1.00 85.27  ? 1014 ARG A CA  1 
ATOM 6969  C C   . ARG A 1 947  ? 271.650 -22.905 22.446  1.00 84.95  ? 1014 ARG A C   1 
ATOM 6970  O O   . ARG A 1 947  ? 272.728 -23.083 23.006  1.00 85.40  ? 1014 ARG A O   1 
ATOM 6971  C CB  . ARG A 1 947  ? 269.765 -22.625 23.954  1.00 84.43  ? 1014 ARG A CB  1 
ATOM 6972  C CG  . ARG A 1 947  ? 270.746 -21.733 24.673  1.00 83.12  ? 1014 ARG A CG  1 
ATOM 6973  C CD  . ARG A 1 947  ? 270.324 -21.674 26.100  1.00 83.07  ? 1014 ARG A CD  1 
ATOM 6974  N NE  . ARG A 1 947  ? 269.600 -22.901 26.397  1.00 83.41  ? 1014 ARG A NE  1 
ATOM 6975  C CZ  . ARG A 1 947  ? 268.961 -23.156 27.525  1.00 84.17  ? 1014 ARG A CZ  1 
ATOM 6976  N NH1 . ARG A 1 947  ? 268.947 -22.269 28.506  1.00 84.59  ? 1014 ARG A NH1 1 
ATOM 6977  N NH2 . ARG A 1 947  ? 268.321 -24.305 27.656  1.00 84.48  ? 1014 ARG A NH2 1 
ATOM 6978  N N   . THR A 1 948  ? 271.510 -22.145 21.379  1.00 83.90  ? 1015 THR A N   1 
ATOM 6979  C CA  . THR A 1 948  ? 272.691 -21.512 20.886  1.00 83.46  ? 1015 THR A CA  1 
ATOM 6980  C C   . THR A 1 948  ? 272.558 -20.181 20.187  1.00 83.52  ? 1015 THR A C   1 
ATOM 6981  O O   . THR A 1 948  ? 271.540 -19.501 20.270  1.00 82.60  ? 1015 THR A O   1 
ATOM 6982  C CB  . THR A 1 948  ? 273.542 -22.508 20.077  1.00 82.70  ? 1015 THR A CB  1 
ATOM 6983  O OG1 . THR A 1 948  ? 272.700 -23.558 19.603  1.00 80.63  ? 1015 THR A OG1 1 
ATOM 6984  C CG2 . THR A 1 948  ? 274.629 -23.112 20.973  1.00 82.80  ? 1015 THR A CG2 1 
ATOM 6985  N N   . GLU A 1 949  ? 273.637 -19.827 19.513  1.00 83.97  ? 1016 GLU A N   1 
ATOM 6986  C CA  . GLU A 1 949  ? 273.815 -18.536 18.885  1.00 84.74  ? 1016 GLU A CA  1 
ATOM 6987  C C   . GLU A 1 949  ? 273.886 -18.403 17.360  1.00 84.04  ? 1016 GLU A C   1 
ATOM 6988  O O   . GLU A 1 949  ? 273.273 -17.523 16.758  1.00 83.39  ? 1016 GLU A O   1 
ATOM 6989  C CB  . GLU A 1 949  ? 275.077 -17.947 19.524  1.00 86.93  ? 1016 GLU A CB  1 
ATOM 6990  C CG  . GLU A 1 949  ? 275.918 -18.967 20.395  1.00 90.01  ? 1016 GLU A CG  1 
ATOM 6991  C CD  . GLU A 1 949  ? 275.336 -19.343 21.787  1.00 91.17  ? 1016 GLU A CD  1 
ATOM 6992  O OE1 . GLU A 1 949  ? 276.071 -19.302 22.786  1.00 90.67  ? 1016 GLU A OE1 1 
ATOM 6993  O OE2 . GLU A 1 949  ? 274.168 -19.704 21.915  1.00 92.55  ? 1016 GLU A OE2 1 
ATOM 6994  N N   . GLY A 1 950  ? 274.664 -19.274 16.749  1.00 83.09  ? 1017 GLY A N   1 
ATOM 6995  C CA  . GLY A 1 950  ? 274.834 -19.224 15.321  1.00 80.67  ? 1017 GLY A CA  1 
ATOM 6996  C C   . GLY A 1 950  ? 276.304 -18.966 15.124  1.00 79.07  ? 1017 GLY A C   1 
ATOM 6997  O O   . GLY A 1 950  ? 276.707 -18.255 14.220  1.00 79.01  ? 1017 GLY A O   1 
ATOM 6998  N N   . GLY A 1 951  ? 277.115 -19.530 16.006  1.00 77.57  ? 1018 GLY A N   1 
ATOM 6999  C CA  . GLY A 1 951  ? 278.551 -19.349 15.899  1.00 77.04  ? 1018 GLY A CA  1 
ATOM 7000  C C   . GLY A 1 951  ? 278.988 -17.899 15.833  1.00 77.04  ? 1018 GLY A C   1 
ATOM 7001  O O   . GLY A 1 951  ? 280.174 -17.578 15.857  1.00 76.04  ? 1018 GLY A O   1 
ATOM 7002  N N   . TRP A 1 952  ? 278.031 -17.001 15.739  1.00 78.97  ? 1019 TRP A N   1 
ATOM 7003  C CA  . TRP A 1 952  ? 278.401 -15.626 15.695  1.00 81.43  ? 1019 TRP A CA  1 
ATOM 7004  C C   . TRP A 1 952  ? 277.954 -15.033 17.002  1.00 81.43  ? 1019 TRP A C   1 
ATOM 7005  O O   . TRP A 1 952  ? 278.679 -14.241 17.594  1.00 81.10  ? 1019 TRP A O   1 
ATOM 7006  C CB  . TRP A 1 952  ? 277.731 -14.954 14.535  1.00 84.25  ? 1019 TRP A CB  1 
ATOM 7007  C CG  . TRP A 1 952  ? 278.064 -13.544 14.486  1.00 87.15  ? 1019 TRP A CG  1 
ATOM 7008  C CD1 . TRP A 1 952  ? 277.688 -12.589 15.376  1.00 87.72  ? 1019 TRP A CD1 1 
ATOM 7009  C CD2 . TRP A 1 952  ? 278.814 -12.876 13.467  1.00 88.67  ? 1019 TRP A CD2 1 
ATOM 7010  N NE1 . TRP A 1 952  ? 278.148 -11.360 14.976  1.00 88.50  ? 1019 TRP A NE1 1 
ATOM 7011  C CE2 . TRP A 1 952  ? 278.843 -11.509 13.804  1.00 89.48  ? 1019 TRP A CE2 1 
ATOM 7012  C CE3 . TRP A 1 952  ? 279.465 -13.300 12.299  1.00 89.23  ? 1019 TRP A CE3 1 
ATOM 7013  C CZ2 . TRP A 1 952  ? 279.489 -10.559 13.012  1.00 89.51  ? 1019 TRP A CZ2 1 
ATOM 7014  C CZ3 . TRP A 1 952  ? 280.110 -12.351 11.513  1.00 89.32  ? 1019 TRP A CZ3 1 
ATOM 7015  C CH2 . TRP A 1 952  ? 280.116 -10.999 11.874  1.00 89.36  ? 1019 TRP A CH2 1 
ATOM 7016  N N   . ILE A 1 953  ? 276.758 -15.442 17.430  1.00 81.91  ? 1020 ILE A N   1 
ATOM 7017  C CA  . ILE A 1 953  ? 276.130 -15.034 18.693  1.00 82.75  ? 1020 ILE A CA  1 
ATOM 7018  C C   . ILE A 1 953  ? 274.687 -14.549 18.589  1.00 83.57  ? 1020 ILE A C   1 
ATOM 7019  O O   . ILE A 1 953  ? 274.240 -14.122 17.525  1.00 82.86  ? 1020 ILE A O   1 
ATOM 7020  C CB  . ILE A 1 953  ? 276.902 -13.933 19.408  1.00 83.28  ? 1020 ILE A CB  1 
ATOM 7021  C CG1 . ILE A 1 953  ? 276.246 -13.609 20.769  1.00 83.84  ? 1020 ILE A CG1 1 
ATOM 7022  C CG2 . ILE A 1 953  ? 276.881 -12.688 18.540  1.00 82.95  ? 1020 ILE A CG2 1 
ATOM 7023  C CD1 . ILE A 1 953  ? 275.978 -14.808 21.697  1.00 91.71  ? 1020 ILE A CD1 1 
ATOM 7024  N N   . SER A 1 954  ? 274.005 -14.602 19.738  1.00 84.99  ? 1021 SER A N   1 
ATOM 7025  C CA  . SER A 1 954  ? 272.601 -14.223 19.955  1.00 85.86  ? 1021 SER A CA  1 
ATOM 7026  C C   . SER A 1 954  ? 271.821 -15.543 20.051  1.00 86.18  ? 1021 SER A C   1 
ATOM 7027  O O   . SER A 1 954  ? 272.111 -16.476 19.306  1.00 86.59  ? 1021 SER A O   1 
ATOM 7028  C CB  . SER A 1 954  ? 272.080 -13.331 18.819  1.00 85.15  ? 1021 SER A CB  1 
ATOM 7029  O OG  . SER A 1 954  ? 272.719 -12.059 18.831  1.00 83.72  ? 1021 SER A OG  1 
ATOM 7030  N N   . LEU A 1 955  ? 270.844 -15.626 20.958  1.00 86.42  ? 1022 LEU A N   1 
ATOM 7031  C CA  . LEU A 1 955  ? 270.087 -16.869 21.176  1.00 86.48  ? 1022 LEU A CA  1 
ATOM 7032  C C   . LEU A 1 955  ? 268.614 -16.914 20.796  1.00 87.68  ? 1022 LEU A C   1 
ATOM 7033  O O   . LEU A 1 955  ? 267.845 -16.011 21.114  1.00 88.37  ? 1022 LEU A O   1 
ATOM 7034  C CB  . LEU A 1 955  ? 270.212 -17.262 22.637  1.00 85.14  ? 1022 LEU A CB  1 
ATOM 7035  C CG  . LEU A 1 955  ? 271.645 -17.038 23.107  1.00 84.28  ? 1022 LEU A CG  1 
ATOM 7036  C CD1 . LEU A 1 955  ? 271.774 -17.316 24.590  1.00 82.20  ? 1022 LEU A CD1 1 
ATOM 7037  C CD2 . LEU A 1 955  ? 272.557 -17.937 22.313  1.00 84.11  ? 1022 LEU A CD2 1 
ATOM 7038  N N   . GLN A 1 956  ? 268.224 -18.015 20.159  1.00 87.91  ? 1023 GLN A N   1 
ATOM 7039  C CA  . GLN A 1 956  ? 266.854 -18.226 19.704  1.00 86.12  ? 1023 GLN A CA  1 
ATOM 7040  C C   . GLN A 1 956  ? 266.131 -19.300 20.541  1.00 86.00  ? 1023 GLN A C   1 
ATOM 7041  O O   . GLN A 1 956  ? 265.927 -20.436 20.110  1.00 84.63  ? 1023 GLN A O   1 
ATOM 7042  C CB  . GLN A 1 956  ? 266.887 -18.586 18.214  1.00 84.94  ? 1023 GLN A CB  1 
ATOM 7043  C CG  . GLN A 1 956  ? 267.771 -17.632 17.398  1.00 81.22  ? 1023 GLN A CG  1 
ATOM 7044  C CD  . GLN A 1 956  ? 267.828 -17.985 15.933  1.00 78.96  ? 1023 GLN A CD  1 
ATOM 7045  O OE1 . GLN A 1 956  ? 268.588 -18.849 15.512  1.00 77.38  ? 1023 GLN A OE1 1 
ATOM 7046  N NE2 . GLN A 1 956  ? 267.002 -17.325 15.149  1.00 77.85  ? 1023 GLN A NE2 1 
ATOM 7047  N N   . ASP A 1 957  ? 265.756 -18.861 21.744  1.00 86.12  ? 1024 ASP A N   1 
ATOM 7048  C CA  . ASP A 1 957  ? 265.061 -19.562 22.845  1.00 86.86  ? 1024 ASP A CA  1 
ATOM 7049  C C   . ASP A 1 957  ? 264.126 -20.771 22.749  1.00 88.50  ? 1024 ASP A C   1 
ATOM 7050  O O   . ASP A 1 957  ? 264.330 -21.773 23.438  1.00 89.29  ? 1024 ASP A O   1 
ATOM 7051  C CB  . ASP A 1 957  ? 264.302 -18.511 23.655  1.00 84.20  ? 1024 ASP A CB  1 
ATOM 7052  C CG  . ASP A 1 957  ? 263.159 -17.887 22.863  1.00 81.80  ? 1024 ASP A CG  1 
ATOM 7053  O OD1 . ASP A 1 957  ? 263.227 -17.928 21.618  1.00 80.65  ? 1024 ASP A OD1 1 
ATOM 7054  O OD2 . ASP A 1 957  ? 262.200 -17.351 23.468  1.00 80.23  ? 1024 ASP A OD2 1 
ATOM 7055  N N   . LEU A 1 958  ? 263.055 -20.658 21.975  1.00 89.82  ? 1025 LEU A N   1 
ATOM 7056  C CA  . LEU A 1 958  ? 262.119 -21.766 21.900  1.00 90.37  ? 1025 LEU A CA  1 
ATOM 7057  C C   . LEU A 1 958  ? 262.787 -22.927 21.264  1.00 91.28  ? 1025 LEU A C   1 
ATOM 7058  O O   . LEU A 1 958  ? 263.481 -22.795 20.253  1.00 91.57  ? 1025 LEU A O   1 
ATOM 7059  C CB  . LEU A 1 958  ? 260.854 -21.321 21.217  1.00 89.46  ? 1025 LEU A CB  1 
ATOM 7060  C CG  . LEU A 1 958  ? 260.486 -20.483 22.444  1.00 89.25  ? 1025 LEU A CG  1 
ATOM 7061  C CD1 . LEU A 1 958  ? 259.868 -19.199 22.057  1.00 88.36  ? 1025 LEU A CD1 1 
ATOM 7062  C CD2 . LEU A 1 958  ? 259.619 -21.305 23.383  1.00 89.48  ? 1025 LEU A CD2 1 
ATOM 7063  N N   . ARG A 1 959  ? 262.552 -24.088 21.851  1.00 41.67  ? 1026 ARG A N   1 
ATOM 7064  C CA  . ARG A 1 959  ? 263.322 -25.206 21.423  1.00 41.67  ? 1026 ARG A CA  1 
ATOM 7065  C C   . ARG A 1 959  ? 262.729 -26.651 21.526  1.00 41.67  ? 1026 ARG A C   1 
ATOM 7066  O O   . ARG A 1 959  ? 262.257 -27.051 22.560  1.00 41.67  ? 1026 ARG A O   1 
ATOM 7067  C CB  . ARG A 1 959  ? 264.586 -24.975 22.236  1.00 41.67  ? 1026 ARG A CB  1 
ATOM 7068  C CG  . ARG A 1 959  ? 265.389 -23.700 21.818  1.00 41.67  ? 1026 ARG A CG  1 
ATOM 7069  C CD  . ARG A 1 959  ? 266.475 -23.114 22.788  1.00 41.67  ? 1026 ARG A CD  1 
ATOM 7070  N NE  . ARG A 1 959  ? 267.371 -22.200 22.043  1.00 41.67  ? 1026 ARG A NE  1 
ATOM 7071  C CZ  . ARG A 1 959  ? 267.926 -21.069 22.495  1.00 41.67  ? 1026 ARG A CZ  1 
ATOM 7072  N NH1 . ARG A 1 959  ? 267.697 -20.642 23.730  1.00 41.67  ? 1026 ARG A NH1 1 
ATOM 7073  N NH2 . ARG A 1 959  ? 268.741 -20.368 21.705  1.00 41.67  ? 1026 ARG A NH2 1 
ATOM 7074  N N   . LYS A 1 960  ? 262.741 -27.442 20.452  1.00 41.67  ? 1027 LYS A N   1 
ATOM 7075  C CA  . LYS A 1 960  ? 262.184 -28.812 20.531  1.00 41.67  ? 1027 LYS A CA  1 
ATOM 7076  C C   . LYS A 1 960  ? 262.754 -29.632 21.716  1.00 41.67  ? 1027 LYS A C   1 
ATOM 7077  O O   . LYS A 1 960  ? 262.008 -30.044 22.631  1.00 41.67  ? 1027 LYS A O   1 
ATOM 7078  C CB  . LYS A 1 960  ? 262.448 -29.538 19.205  1.00 41.67  ? 1027 LYS A CB  1 
ATOM 7079  C CG  . LYS A 1 960  ? 262.787 -31.025 19.309  1.00 41.67  ? 1027 LYS A CG  1 
ATOM 7080  C CD  . LYS A 1 960  ? 261.680 -31.847 19.922  1.00 41.67  ? 1027 LYS A CD  1 
ATOM 7081  C CE  . LYS A 1 960  ? 261.369 -32.994 19.013  1.00 41.67  ? 1027 LYS A CE  1 
ATOM 7082  N NZ  . LYS A 1 960  ? 260.302 -33.836 19.583  1.00 41.67  ? 1027 LYS A NZ  1 
ATOM 7083  N N   . VAL A 1 961  ? 264.076 -29.855 21.647  1.00 41.67  ? 1028 VAL A N   1 
ATOM 7084  C CA  . VAL A 1 961  ? 264.902 -30.583 22.621  1.00 41.67  ? 1028 VAL A CA  1 
ATOM 7085  C C   . VAL A 1 961  ? 264.999 -29.715 23.835  1.00 41.67  ? 1028 VAL A C   1 
ATOM 7086  O O   . VAL A 1 961  ? 265.034 -30.164 24.965  1.00 41.67  ? 1028 VAL A O   1 
ATOM 7087  C CB  . VAL A 1 961  ? 266.354 -30.657 22.166  1.00 41.67  ? 1028 VAL A CB  1 
ATOM 7088  C CG1 . VAL A 1 961  ? 266.881 -32.051 22.288  1.00 41.67  ? 1028 VAL A CG1 1 
ATOM 7089  C CG2 . VAL A 1 961  ? 266.475 -30.109 20.770  1.00 41.67  ? 1028 VAL A CG2 1 
ATOM 7090  N N   . GLN A 1 962  ? 265.095 -28.441 23.518  1.00 41.67  ? 1029 GLN A N   1 
ATOM 7091  C CA  . GLN A 1 962  ? 265.278 -27.338 24.425  1.00 41.67  ? 1029 GLN A CA  1 
ATOM 7092  C C   . GLN A 1 962  ? 263.964 -26.745 25.058  1.00 41.67  ? 1029 GLN A C   1 
ATOM 7093  O O   . GLN A 1 962  ? 264.027 -26.131 26.124  1.00 41.67  ? 1029 GLN A O   1 
ATOM 7094  C CB  . GLN A 1 962  ? 266.135 -26.362 23.614  1.00 41.67  ? 1029 GLN A CB  1 
ATOM 7095  C CG  . GLN A 1 962  ? 266.484 -27.023 22.206  1.00 41.67  ? 1029 GLN A CG  1 
ATOM 7096  C CD  . GLN A 1 962  ? 266.699 -26.053 21.022  1.00 41.67  ? 1029 GLN A CD  1 
ATOM 7097  O OE1 . GLN A 1 962  ? 267.743 -25.424 20.915  1.00 41.67  ? 1029 GLN A OE1 1 
ATOM 7098  N NE2 . GLN A 1 962  ? 265.699 -25.940 20.132  1.00 41.67  ? 1029 GLN A NE2 1 
ATOM 7099  N N   . ARG A 1 963  ? 262.792 -26.985 24.439  1.00 41.67  ? 1030 ARG A N   1 
ATOM 7100  C CA  . ARG A 1 963  ? 261.452 -26.566 24.954  1.00 41.67  ? 1030 ARG A CA  1 
ATOM 7101  C C   . ARG A 1 963  ? 261.365 -27.648 25.992  1.00 41.67  ? 1030 ARG A C   1 
ATOM 7102  O O   . ARG A 1 963  ? 260.931 -27.448 27.126  1.00 41.67  ? 1030 ARG A O   1 
ATOM 7103  C CB  . ARG A 1 963  ? 260.330 -26.783 23.915  1.00 41.67  ? 1030 ARG A CB  1 
ATOM 7104  C CG  . ARG A 1 963  ? 258.969 -26.183 24.265  1.00 41.67  ? 1030 ARG A CG  1 
ATOM 7105  C CD  . ARG A 1 963  ? 257.916 -26.537 23.199  1.00 41.67  ? 1030 ARG A CD  1 
ATOM 7106  N NE  . ARG A 1 963  ? 257.965 -27.944 22.771  1.00 41.67  ? 1030 ARG A NE  1 
ATOM 7107  C CZ  . ARG A 1 963  ? 257.208 -28.474 21.804  1.00 41.67  ? 1030 ARG A CZ  1 
ATOM 7108  N NH1 . ARG A 1 963  ? 256.327 -27.728 21.153  1.00 41.67  ? 1030 ARG A NH1 1 
ATOM 7109  N NH2 . ARG A 1 963  ? 257.339 -29.753 21.465  1.00 41.67  ? 1030 ARG A NH2 1 
ATOM 7110  N N   . GLU A 1 964  ? 261.774 -28.821 25.533  1.00 41.67  ? 1031 GLU A N   1 
ATOM 7111  C CA  . GLU A 1 964  ? 261.930 -29.992 26.366  1.00 41.67  ? 1031 GLU A CA  1 
ATOM 7112  C C   . GLU A 1 964  ? 263.363 -29.556 26.835  1.00 41.67  ? 1031 GLU A C   1 
ATOM 7113  O O   . GLU A 1 964  ? 263.952 -28.710 26.180  1.00 41.67  ? 1031 GLU A O   1 
ATOM 7114  C CB  . GLU A 1 964  ? 262.012 -31.242 25.462  1.00 41.67  ? 1031 GLU A CB  1 
ATOM 7115  C CG  . GLU A 1 964  ? 260.812 -32.200 25.435  1.00 41.67  ? 1031 GLU A CG  1 
ATOM 7116  C CD  . GLU A 1 964  ? 261.255 -33.675 25.315  1.00 41.67  ? 1031 GLU A CD  1 
ATOM 7117  O OE1 . GLU A 1 964  ? 262.379 -33.992 25.771  1.00 41.67  ? 1031 GLU A OE1 1 
ATOM 7118  O OE2 . GLU A 1 964  ? 260.492 -34.524 24.792  1.00 41.67  ? 1031 GLU A OE2 1 
ATOM 7119  N N   . THR A 1 965  ? 263.919 -30.050 27.949  1.00 41.67  ? 1032 THR A N   1 
ATOM 7120  C CA  . THR A 1 965  ? 265.309 -29.666 28.348  1.00 41.67  ? 1032 THR A CA  1 
ATOM 7121  C C   . THR A 1 965  ? 265.830 -30.009 29.771  1.00 41.67  ? 1032 THR A C   1 
ATOM 7122  O O   . THR A 1 965  ? 267.049 -30.073 29.989  1.00 41.67  ? 1032 THR A O   1 
ATOM 7123  C CB  . THR A 1 965  ? 265.607 -28.153 28.058  1.00 41.67  ? 1032 THR A CB  1 
ATOM 7124  O OG1 . THR A 1 965  ? 266.981 -27.860 28.362  1.00 41.67  ? 1032 THR A OG1 1 
ATOM 7125  C CG2 . THR A 1 965  ? 264.675 -27.259 28.868  1.00 41.67  ? 1032 THR A CG2 1 
ATOM 7126  N N   . ALA A 1 966  ? 264.929 -30.197 30.735  1.00 41.67  ? 1033 ALA A N   1 
ATOM 7127  C CA  . ALA A 1 966  ? 265.332 -30.598 32.079  1.00 41.67  ? 1033 ALA A CA  1 
ATOM 7128  C C   . ALA A 1 966  ? 265.099 -32.105 32.035  1.00 41.67  ? 1033 ALA A C   1 
ATOM 7129  O O   . ALA A 1 966  ? 264.741 -32.727 33.040  1.00 41.67  ? 1033 ALA A O   1 
ATOM 7130  C CB  . ALA A 1 966  ? 264.445 -29.952 33.130  1.00 41.67  ? 1033 ALA A CB  1 
ATOM 7131  N N   . ARG A 1 967  ? 265.281 -32.654 30.826  1.00 41.67  ? 1034 ARG A N   1 
ATOM 7132  C CA  . ARG A 1 967  ? 265.125 -34.071 30.499  1.00 41.67  ? 1034 ARG A CA  1 
ATOM 7133  C C   . ARG A 1 967  ? 263.842 -34.421 29.740  1.00 41.67  ? 1034 ARG A C   1 
ATOM 7134  O O   . ARG A 1 967  ? 263.232 -33.538 29.157  1.00 41.67  ? 1034 ARG A O   1 
ATOM 7135  C CB  . ARG A 1 967  ? 265.286 -34.899 31.761  1.00 41.67  ? 1034 ARG A CB  1 
ATOM 7136  C CG  . ARG A 1 967  ? 266.690 -34.737 32.227  1.00 41.67  ? 1034 ARG A CG  1 
ATOM 7137  C CD  . ARG A 1 967  ? 266.955 -35.348 33.517  1.00 41.67  ? 1034 ARG A CD  1 
ATOM 7138  N NE  . ARG A 1 967  ? 268.364 -35.170 33.831  1.00 41.67  ? 1034 ARG A NE  1 
ATOM 7139  C CZ  . ARG A 1 967  ? 269.385 -35.831 33.275  1.00 41.67  ? 1034 ARG A CZ  1 
ATOM 7140  N NH1 . ARG A 1 967  ? 269.166 -36.761 32.344  1.00 41.67  ? 1034 ARG A NH1 1 
ATOM 7141  N NH2 . ARG A 1 967  ? 270.642 -35.545 33.646  1.00 41.67  ? 1034 ARG A NH2 1 
ATOM 7142  N N   . LYS A 1 968  ? 263.445 -35.697 29.719  1.00 41.67  ? 1035 LYS A N   1 
ATOM 7143  C CA  . LYS A 1 968  ? 262.233 -36.150 28.993  1.00 41.67  ? 1035 LYS A CA  1 
ATOM 7144  C C   . LYS A 1 968  ? 260.933 -35.959 29.774  1.00 41.67  ? 1035 LYS A C   1 
ATOM 7145  O O   . LYS A 1 968  ? 260.631 -36.746 30.673  1.00 41.67  ? 1035 LYS A O   1 
ATOM 7146  C CB  . LYS A 1 968  ? 262.351 -37.633 28.644  1.00 41.67  ? 1035 LYS A CB  1 
ATOM 7147  C CG  . LYS A 1 968  ? 261.082 -38.244 28.034  1.00 41.67  ? 1035 LYS A CG  1 
ATOM 7148  C CD  . LYS A 1 968  ? 261.109 -39.789 28.072  1.00 41.67  ? 1035 LYS A CD  1 
ATOM 7149  C CE  . LYS A 1 968  ? 259.863 -40.416 27.435  1.00 41.67  ? 1035 LYS A CE  1 
ATOM 7150  N NZ  . LYS A 1 968  ? 259.795 -41.909 27.555  1.00 41.67  ? 1035 LYS A NZ  1 
ATOM 7151  N N   . SER A 1 969  ? 260.123 -34.968 29.428  1.00 41.67  ? 1036 SER A N   1 
ATOM 7152  C CA  . SER A 1 969  ? 258.950 -34.809 30.246  1.00 41.67  ? 1036 SER A CA  1 
ATOM 7153  C C   . SER A 1 969  ? 257.579 -34.596 29.699  1.00 41.67  ? 1036 SER A C   1 
ATOM 7154  O O   . SER A 1 969  ? 257.350 -33.955 28.672  1.00 41.67  ? 1036 SER A O   1 
ATOM 7155  C CB  . SER A 1 969  ? 259.201 -33.738 31.303  1.00 41.67  ? 1036 SER A CB  1 
ATOM 7156  O OG  . SER A 1 969  ? 259.393 -32.470 30.714  1.00 41.67  ? 1036 SER A OG  1 
ATOM 7157  N N   . GLN A 1 970  ? 256.674 -35.149 30.498  1.00 41.67  ? 1037 GLN A N   1 
ATOM 7158  C CA  . GLN A 1 970  ? 255.233 -35.147 30.333  1.00 41.67  ? 1037 GLN A CA  1 
ATOM 7159  C C   . GLN A 1 970  ? 254.677 -35.516 28.964  1.00 41.67  ? 1037 GLN A C   1 
ATOM 7160  O O   . GLN A 1 970  ? 254.388 -34.654 28.118  1.00 41.67  ? 1037 GLN A O   1 
ATOM 7161  C CB  . GLN A 1 970  ? 254.675 -33.818 30.838  1.00 41.67  ? 1037 GLN A CB  1 
ATOM 7162  C CG  . GLN A 1 970  ? 254.433 -33.839 32.348  1.00 41.67  ? 1037 GLN A CG  1 
ATOM 7163  C CD  . GLN A 1 970  ? 253.152 -34.582 32.738  1.00 41.67  ? 1037 GLN A CD  1 
ATOM 7164  O OE1 . GLN A 1 970  ? 252.929 -34.871 33.908  1.00 41.67  ? 1037 GLN A OE1 1 
ATOM 7165  N NE2 . GLN A 1 970  ? 252.301 -34.873 31.758  1.00 41.67  ? 1037 GLN A NE2 1 
ATOM 7166  N N   . TRP A 1 971  ? 254.505 -36.830 28.795  1.00 41.67  ? 1038 TRP A N   1 
ATOM 7167  C CA  . TRP A 1 971  ? 254.027 -37.444 27.560  1.00 41.67  ? 1038 TRP A CA  1 
ATOM 7168  C C   . TRP A 1 971  ? 254.993 -36.876 26.481  1.00 41.67  ? 1038 TRP A C   1 
ATOM 7169  O O   . TRP A 1 971  ? 254.906 -37.211 25.305  1.00 41.67  ? 1038 TRP A O   1 
ATOM 7170  C CB  . TRP A 1 971  ? 252.515 -37.098 27.337  1.00 41.67  ? 1038 TRP A CB  1 
ATOM 7171  C CG  . TRP A 1 971  ? 251.621 -38.122 26.479  1.00 41.67  ? 1038 TRP A CG  1 
ATOM 7172  C CD1 . TRP A 1 971  ? 251.816 -39.491 26.314  1.00 41.67  ? 1038 TRP A CD1 1 
ATOM 7173  C CD2 . TRP A 1 971  ? 250.432 -37.808 25.699  1.00 41.67  ? 1038 TRP A CD2 1 
ATOM 7174  N NE1 . TRP A 1 971  ? 250.836 -40.024 25.481  1.00 41.67  ? 1038 TRP A NE1 1 
ATOM 7175  C CE2 . TRP A 1 971  ? 249.982 -39.023 25.093  1.00 41.67  ? 1038 TRP A CE2 1 
ATOM 7176  C CE3 . TRP A 1 971  ? 249.710 -36.625 25.456  1.00 41.67  ? 1038 TRP A CE3 1 
ATOM 7177  C CZ2 . TRP A 1 971  ? 248.848 -39.077 24.264  1.00 41.67  ? 1038 TRP A CZ2 1 
ATOM 7178  C CZ3 . TRP A 1 971  ? 248.585 -36.684 24.636  1.00 41.67  ? 1038 TRP A CZ3 1 
ATOM 7179  C CH2 . TRP A 1 971  ? 248.168 -37.903 24.047  1.00 41.67  ? 1038 TRP A CH2 1 
ATOM 7180  N N   . LYS A 1 972  ? 255.962 -36.071 26.941  1.00 41.67  ? 1039 LYS A N   1 
ATOM 7181  C CA  . LYS A 1 972  ? 256.996 -35.413 26.122  1.00 41.67  ? 1039 LYS A CA  1 
ATOM 7182  C C   . LYS A 1 972  ? 256.376 -34.419 25.144  1.00 41.67  ? 1039 LYS A C   1 
ATOM 7183  O O   . LYS A 1 972  ? 256.570 -34.547 23.926  1.00 41.67  ? 1039 LYS A O   1 
ATOM 7184  C CB  . LYS A 1 972  ? 257.819 -36.454 25.361  1.00 20.00  ? 1039 LYS A CB  1 
ATOM 7185  C CG  . LYS A 1 972  ? 258.674 -37.342 26.252  1.00 20.00  ? 1039 LYS A CG  1 
ATOM 7186  C CD  . LYS A 1 972  ? 259.444 -38.366 25.436  1.00 20.00  ? 1039 LYS A CD  1 
ATOM 7187  C CE  . LYS A 1 972  ? 260.317 -39.238 26.323  1.00 20.00  ? 1039 LYS A CE  1 
ATOM 7188  N NZ  . LYS A 1 972  ? 261.058 -40.263 25.538  1.00 20.00  ? 1039 LYS A NZ  1 
ATOM 7189  N N   . LYS A 1 973  ? 255.654 -33.427 25.696  1.00 41.67  ? 1040 LYS A N   1 
ATOM 7190  C CA  . LYS A 1 973  ? 254.939 -32.388 24.922  1.00 41.67  ? 1040 LYS A CA  1 
ATOM 7191  C C   . LYS A 1 973  ? 253.873 -33.138 24.134  1.00 41.67  ? 1040 LYS A C   1 
ATOM 7192  O O   . LYS A 1 973  ? 253.825 -33.055 22.910  1.00 41.67  ? 1040 LYS A O   1 
ATOM 7193  C CB  . LYS A 1 973  ? 255.889 -31.694 23.952  1.00 41.67  ? 1040 LYS A CB  1 
ATOM 7194  C CG  . LYS A 1 973  ? 256.287 -30.280 24.326  1.00 41.67  ? 1040 LYS A CG  1 
ATOM 7195  C CD  . LYS A 1 973  ? 257.242 -30.263 25.480  1.00 41.67  ? 1040 LYS A CD  1 
ATOM 7196  C CE  . LYS A 1 973  ? 258.084 -29.011 25.441  1.00 41.67  ? 1040 LYS A CE  1 
ATOM 7197  N NZ  . LYS A 1 973  ? 257.219 -27.817 25.322  1.00 41.67  ? 1040 LYS A NZ  1 
ATOM 7198  N N   . TRP A 1 974  ? 253.042 -33.880 24.871  1.00 41.67  ? 1041 TRP A N   1 
ATOM 7199  C CA  . TRP A 1 974  ? 251.988 -34.759 24.344  1.00 41.67  ? 1041 TRP A CA  1 
ATOM 7200  C C   . TRP A 1 974  ? 252.549 -35.860 23.439  1.00 41.67  ? 1041 TRP A C   1 
ATOM 7201  O O   . TRP A 1 974  ? 252.091 -36.996 23.489  1.00 41.67  ? 1041 TRP A O   1 
ATOM 7202  C CB  . TRP A 1 974  ? 250.908 -33.992 23.568  1.00 41.67  ? 1041 TRP A CB  1 
ATOM 7203  C CG  . TRP A 1 974  ? 250.069 -34.910 22.662  1.00 41.67  ? 1041 TRP A CG  1 
ATOM 7204  C CD1 . TRP A 1 974  ? 250.500 -36.041 22.017  1.00 41.67  ? 1041 TRP A CD1 1 
ATOM 7205  C CD2 . TRP A 1 974  ? 248.701 -34.730 22.248  1.00 41.67  ? 1041 TRP A CD2 1 
ATOM 7206  N NE1 . TRP A 1 974  ? 249.513 -36.570 21.245  1.00 41.67  ? 1041 TRP A NE1 1 
ATOM 7207  C CE2 . TRP A 1 974  ? 248.393 -35.790 21.361  1.00 41.67  ? 1041 TRP A CE2 1 
ATOM 7208  C CE3 . TRP A 1 974  ? 247.704 -33.781 22.538  1.00 41.67  ? 1041 TRP A CE3 1 
ATOM 7209  C CZ2 . TRP A 1 974  ? 247.135 -35.925 20.753  1.00 41.67  ? 1041 TRP A CZ2 1 
ATOM 7210  C CZ3 . TRP A 1 974  ? 246.443 -33.920 21.928  1.00 41.67  ? 1041 TRP A CZ3 1 
ATOM 7211  C CH2 . TRP A 1 974  ? 246.178 -34.986 21.049  1.00 41.67  ? 1041 TRP A CH2 1 
ATOM 7212  N N   . GLU A 1 975  ? 253.528 -35.509 22.610  1.00 41.67  ? 1042 GLU A N   1 
ATOM 7213  C CA  . GLU A 1 975  ? 254.146 -36.409 21.636  1.00 41.67  ? 1042 GLU A CA  1 
ATOM 7214  C C   . GLU A 1 975  ? 253.399 -36.101 20.363  1.00 41.67  ? 1042 GLU A C   1 
ATOM 7215  O O   . GLU A 1 975  ? 253.458 -36.850 19.391  1.00 41.67  ? 1042 GLU A O   1 
ATOM 7216  C CB  . GLU A 1 975  ? 253.955 -37.882 21.988  1.00 41.67  ? 1042 GLU A CB  1 
ATOM 7217  C CG  . GLU A 1 975  ? 254.948 -38.411 22.980  1.00 41.67  ? 1042 GLU A CG  1 
ATOM 7218  C CD  . GLU A 1 975  ? 256.362 -38.369 22.465  1.00 41.67  ? 1042 GLU A CD  1 
ATOM 7219  O OE1 . GLU A 1 975  ? 256.917 -37.264 22.257  1.00 41.67  ? 1042 GLU A OE1 1 
ATOM 7220  O OE2 . GLU A 1 975  ? 256.912 -39.463 22.268  1.00 41.67  ? 1042 GLU A OE2 1 
ATOM 7221  N N   . VAL A 1 976  ? 252.671 -34.987 20.415  1.00 41.67  ? 1043 VAL A N   1 
ATOM 7222  C CA  . VAL A 1 976  ? 251.873 -34.456 19.305  1.00 41.67  ? 1043 VAL A CA  1 
ATOM 7223  C C   . VAL A 1 976  ? 251.707 -32.917 19.487  1.00 41.67  ? 1043 VAL A C   1 
ATOM 7224  O O   . VAL A 1 976  ? 250.988 -32.232 18.735  1.00 41.67  ? 1043 VAL A O   1 
ATOM 7225  C CB  . VAL A 1 976  ? 250.488 -35.195 19.167  1.00 41.67  ? 1043 VAL A CB  1 
ATOM 7226  C CG1 . VAL A 1 976  ? 249.558 -34.451 18.211  1.00 41.67  ? 1043 VAL A CG1 1 
ATOM 7227  C CG2 . VAL A 1 976  ? 250.698 -36.635 18.677  1.00 41.67  ? 1043 VAL A CG2 1 
ATOM 7228  N N   . VAL A 1 977  ? 252.371 -32.380 20.514  1.00 79.96  ? 1044 VAL A N   1 
ATOM 7229  C CA  . VAL A 1 977  ? 252.410 -30.931 20.712  1.00 44.30  ? 1044 VAL A CA  1 
ATOM 7230  C C   . VAL A 1 977  ? 253.404 -30.845 19.535  1.00 44.30  ? 1044 VAL A C   1 
ATOM 7231  O O   . VAL A 1 977  ? 253.590 -29.828 18.875  1.00 44.30  ? 1044 VAL A O   1 
ATOM 7232  C CB  . VAL A 1 977  ? 253.135 -30.557 22.046  1.00 41.67  ? 1044 VAL A CB  1 
ATOM 7233  C CG1 . VAL A 1 977  ? 254.602 -30.312 21.746  1.00 41.67  ? 1044 VAL A CG1 1 
ATOM 7234  C CG2 . VAL A 1 977  ? 252.471 -29.342 22.734  1.00 41.67  ? 1044 VAL A CG2 1 
ATOM 7235  N N   . ALA A 1 978  ? 254.007 -32.012 19.316  1.00 44.30  ? 1045 ALA A N   1 
ATOM 7236  C CA  . ALA A 1 978  ? 254.964 -32.320 18.277  1.00 44.30  ? 1045 ALA A CA  1 
ATOM 7237  C C   . ALA A 1 978  ? 254.270 -32.831 16.996  1.00 44.30  ? 1045 ALA A C   1 
ATOM 7238  O O   . ALA A 1 978  ? 254.801 -32.636 15.910  1.00 44.30  ? 1045 ALA A O   1 
ATOM 7239  C CB  . ALA A 1 978  ? 255.927 -33.365 18.791  1.00 41.67  ? 1045 ALA A CB  1 
ATOM 7240  N N   . GLU A 1 979  ? 253.125 -33.518 17.107  1.00 44.30  ? 1046 GLU A N   1 
ATOM 7241  C CA  . GLU A 1 979  ? 252.412 -33.974 15.903  1.00 44.30  ? 1046 GLU A CA  1 
ATOM 7242  C C   . GLU A 1 979  ? 251.578 -32.817 15.382  1.00 44.30  ? 1046 GLU A C   1 
ATOM 7243  O O   . GLU A 1 979  ? 251.369 -32.712 14.180  1.00 44.30  ? 1046 GLU A O   1 
ATOM 7244  C CB  . GLU A 1 979  ? 251.501 -35.194 16.139  1.00 41.67  ? 1046 GLU A CB  1 
ATOM 7245  C CG  . GLU A 1 979  ? 250.808 -35.710 14.866  1.00 41.67  ? 1046 GLU A CG  1 
ATOM 7246  C CD  . GLU A 1 979  ? 251.802 -36.127 13.799  1.00 41.67  ? 1046 GLU A CD  1 
ATOM 7247  O OE1 . GLU A 1 979  ? 252.803 -35.419 13.614  1.00 41.67  ? 1046 GLU A OE1 1 
ATOM 7248  O OE2 . GLU A 1 979  ? 251.582 -37.152 13.134  1.00 41.67  ? 1046 GLU A OE2 1 
ATOM 7249  N N   . ARG A 1 980  ? 251.092 -31.945 16.273  1.00 44.30  ? 1047 ARG A N   1 
ATOM 7250  C CA  . ARG A 1 980  ? 250.345 -30.785 15.799  1.00 44.30  ? 1047 ARG A CA  1 
ATOM 7251  C C   . ARG A 1 980  ? 251.424 -29.949 15.095  1.00 44.30  ? 1047 ARG A C   1 
ATOM 7252  O O   . ARG A 1 980  ? 251.152 -29.181 14.171  1.00 44.30  ? 1047 ARG A O   1 
ATOM 7253  C CB  . ARG A 1 980  ? 249.692 -30.009 16.944  1.00 41.67  ? 1047 ARG A CB  1 
ATOM 7254  C CG  . ARG A 1 980  ? 248.687 -28.985 16.456  1.00 41.67  ? 1047 ARG A CG  1 
ATOM 7255  C CD  . ARG A 1 980  ? 248.555 -28.947 14.921  1.00 41.67  ? 1047 ARG A CD  1 
ATOM 7256  N NE  . ARG A 1 980  ? 247.509 -29.831 14.401  1.00 41.67  ? 1047 ARG A NE  1 
ATOM 7257  C CZ  . ARG A 1 980  ? 247.698 -31.036 13.864  1.00 41.67  ? 1047 ARG A CZ  1 
ATOM 7258  N NH1 . ARG A 1 980  ? 248.907 -31.561 13.747  1.00 41.67  ? 1047 ARG A NH1 1 
ATOM 7259  N NH2 . ARG A 1 980  ? 246.657 -31.725 13.432  1.00 41.67  ? 1047 ARG A NH2 1 
ATOM 7260  N N   . ALA A 1 981  ? 252.667 -30.146 15.526  1.00 44.30  ? 1048 ALA A N   1 
ATOM 7261  C CA  . ALA A 1 981  ? 253.803 -29.468 14.928  1.00 44.30  ? 1048 ALA A CA  1 
ATOM 7262  C C   . ALA A 1 981  ? 254.135 -30.139 13.590  1.00 44.30  ? 1048 ALA A C   1 
ATOM 7263  O O   . ALA A 1 981  ? 254.703 -29.503 12.707  1.00 44.30  ? 1048 ALA A O   1 
ATOM 7264  C CB  . ALA A 1 981  ? 255.003 -29.526 15.866  1.00 41.67  ? 1048 ALA A CB  1 
ATOM 7265  N N   . TRP A 1 982  ? 253.783 -31.418 13.433  1.00 44.30  ? 1049 TRP A N   1 
ATOM 7266  C CA  . TRP A 1 982  ? 254.053 -32.119 12.177  1.00 44.30  ? 1049 TRP A CA  1 
ATOM 7267  C C   . TRP A 1 982  ? 253.270 -31.433 11.064  1.00 44.30  ? 1049 TRP A C   1 
ATOM 7268  O O   . TRP A 1 982  ? 253.767 -31.297 9.944   1.00 44.30  ? 1049 TRP A O   1 
ATOM 7269  C CB  . TRP A 1 982  ? 253.618 -33.592 12.230  1.00 41.67  ? 1049 TRP A CB  1 
ATOM 7270  C CG  . TRP A 1 982  ? 252.283 -33.851 11.600  1.00 41.67  ? 1049 TRP A CG  1 
ATOM 7271  C CD1 . TRP A 1 982  ? 251.076 -33.805 12.203  1.00 41.67  ? 1049 TRP A CD1 1 
ATOM 7272  C CD2 . TRP A 1 982  ? 252.024 -34.020 10.217  1.00 41.67  ? 1049 TRP A CD2 1 
ATOM 7273  N NE1 . TRP A 1 982  ? 250.073 -33.915 11.297  1.00 41.67  ? 1049 TRP A NE1 1 
ATOM 7274  C CE2 . TRP A 1 982  ? 250.624 -34.047 10.056  1.00 41.67  ? 1049 TRP A CE2 1 
ATOM 7275  C CE3 . TRP A 1 982  ? 252.839 -34.140 9.090   1.00 41.67  ? 1049 TRP A CE3 1 
ATOM 7276  C CZ2 . TRP A 1 982  ? 250.011 -34.187 8.809   1.00 41.67  ? 1049 TRP A CZ2 1 
ATOM 7277  C CZ3 . TRP A 1 982  ? 252.234 -34.279 7.844   1.00 41.67  ? 1049 TRP A CZ3 1 
ATOM 7278  C CH2 . TRP A 1 982  ? 250.826 -34.300 7.716   1.00 41.67  ? 1049 TRP A CH2 1 
ATOM 7279  N N   . LYS A 1 983  ? 252.050 -30.996 11.399  1.00 44.30  ? 1050 LYS A N   1 
ATOM 7280  C CA  . LYS A 1 983  ? 251.102 -30.345 10.473  1.00 44.30  ? 1050 LYS A CA  1 
ATOM 7281  C C   . LYS A 1 983  ? 251.343 -28.906 9.942   1.00 44.30  ? 1050 LYS A C   1 
ATOM 7282  O O   . LYS A 1 983  ? 250.823 -28.574 8.885   1.00 44.30  ? 1050 LYS A O   1 
ATOM 7283  C CB  . LYS A 1 983  ? 249.686 -30.398 11.088  1.00 41.67  ? 1050 LYS A CB  1 
ATOM 7284  C CG  . LYS A 1 983  ? 248.597 -31.102 10.254  1.00 41.67  ? 1050 LYS A CG  1 
ATOM 7285  C CD  . LYS A 1 983  ? 247.195 -30.724 10.764  1.00 41.67  ? 1050 LYS A CD  1 
ATOM 7286  C CE  . LYS A 1 983  ? 246.035 -31.366 9.977   1.00 41.67  ? 1050 LYS A CE  1 
ATOM 7287  N NZ  . LYS A 1 983  ? 244.664 -30.854 10.392  1.00 41.67  ? 1050 LYS A NZ  1 
ATOM 7288  N N   . GLY A 1 984  ? 252.110 -28.060 10.637  1.00 44.30  ? 1051 GLY A N   1 
ATOM 7289  C CA  . GLY A 1 984  ? 252.331 -26.679 10.183  1.00 44.30  ? 1051 GLY A CA  1 
ATOM 7290  C C   . GLY A 1 984  ? 253.159 -26.294 8.940   1.00 44.30  ? 1051 GLY A C   1 
ATOM 7291  O O   . GLY A 1 984  ? 252.799 -25.353 8.223   1.00 44.30  ? 1051 GLY A O   1 
ATOM 7292  N N   . GLY A 1 985  ? 254.268 -26.998 8.701   1.00 44.30  ? 1052 GLY A N   1 
ATOM 7293  C CA  . GLY A 1 985  ? 255.163 -26.744 7.573   1.00 44.30  ? 1052 GLY A CA  1 
ATOM 7294  C C   . GLY A 1 985  ? 254.746 -26.087 6.260   1.00 44.30  ? 1052 GLY A C   1 
ATOM 7295  O O   . GLY A 1 985  ? 254.808 -24.861 6.158   1.00 44.30  ? 1052 GLY A O   1 
ATOM 7296  N N   . THR A 1 986  ? 254.365 -26.895 5.255   1.00 44.30  ? 1053 THR A N   1 
ATOM 7297  C CA  . THR A 1 986  ? 253.973 -26.396 3.914   1.00 44.30  ? 1053 THR A CA  1 
ATOM 7298  C C   . THR A 1 986  ? 252.996 -25.213 4.038   1.00 44.30  ? 1053 THR A C   1 
ATOM 7299  O O   . THR A 1 986  ? 253.260 -24.109 3.527   1.00 44.30  ? 1053 THR A O   1 
ATOM 7300  C CB  . THR A 1 986  ? 253.325 -27.555 2.974   1.00 41.67  ? 1053 THR A CB  1 
ATOM 7301  O OG1 . THR A 1 986  ? 254.318 -28.535 2.613   1.00 41.67  ? 1053 THR A OG1 1 
ATOM 7302  C CG2 . THR A 1 986  ? 252.742 -26.955 1.652   1.00 41.67  ? 1053 THR A CG2 1 
ATOM 7303  N N   . GLU A 1 987  ? 251.881 -25.452 4.728   1.00 44.30  ? 1054 GLU A N   1 
ATOM 7304  C CA  . GLU A 1 987  ? 250.862 -24.423 4.936   1.00 44.30  ? 1054 GLU A CA  1 
ATOM 7305  C C   . GLU A 1 987  ? 251.589 -23.140 5.372   1.00 44.30  ? 1054 GLU A C   1 
ATOM 7306  O O   . GLU A 1 987  ? 251.491 -22.104 4.708   1.00 44.30  ? 1054 GLU A O   1 
ATOM 7307  C CB  . GLU A 1 987  ? 249.838 -24.888 6.008   1.00 41.67  ? 1054 GLU A CB  1 
ATOM 7308  C CG  . GLU A 1 987  ? 249.451 -26.398 5.912   1.00 41.67  ? 1054 GLU A CG  1 
ATOM 7309  C CD  . GLU A 1 987  ? 248.078 -26.742 6.525   1.00 41.67  ? 1054 GLU A CD  1 
ATOM 7310  O OE1 . GLU A 1 987  ? 247.072 -26.114 6.112   1.00 41.67  ? 1054 GLU A OE1 1 
ATOM 7311  O OE2 . GLU A 1 987  ? 247.995 -27.645 7.400   1.00 41.67  ? 1054 GLU A OE2 1 
ATOM 7312  N N   . SER A 1 988  ? 252.353 -23.230 6.458   1.00 44.30  ? 1055 SER A N   1 
ATOM 7313  C CA  . SER A 1 988  ? 253.078 -22.077 6.960   1.00 44.30  ? 1055 SER A CA  1 
ATOM 7314  C C   . SER A 1 988  ? 253.866 -21.306 5.915   1.00 44.30  ? 1055 SER A C   1 
ATOM 7315  O O   . SER A 1 988  ? 253.910 -20.089 5.961   1.00 44.30  ? 1055 SER A O   1 
ATOM 7316  C CB  . SER A 1 988  ? 253.992 -22.491 8.098   1.00 41.67  ? 1055 SER A CB  1 
ATOM 7317  O OG  . SER A 1 988  ? 253.207 -22.663 9.256   1.00 41.67  ? 1055 SER A OG  1 
ATOM 7318  N N   . GLU A 1 989  ? 254.472 -21.999 4.960   1.00 44.30  ? 1056 GLU A N   1 
ATOM 7319  C CA  . GLU A 1 989  ? 255.233 -21.302 3.927   1.00 44.30  ? 1056 GLU A CA  1 
ATOM 7320  C C   . GLU A 1 989  ? 254.397 -20.528 2.897   1.00 44.30  ? 1056 GLU A C   1 
ATOM 7321  O O   . GLU A 1 989  ? 254.797 -19.459 2.422   1.00 44.30  ? 1056 GLU A O   1 
ATOM 7322  C CB  . GLU A 1 989  ? 256.188 -22.272 3.236   1.00 41.67  ? 1056 GLU A CB  1 
ATOM 7323  C CG  . GLU A 1 989  ? 257.606 -22.156 3.806   1.00 41.67  ? 1056 GLU A CG  1 
ATOM 7324  C CD  . GLU A 1 989  ? 257.835 -22.921 5.114   1.00 41.67  ? 1056 GLU A CD  1 
ATOM 7325  O OE1 . GLU A 1 989  ? 256.946 -22.937 6.003   1.00 41.67  ? 1056 GLU A OE1 1 
ATOM 7326  O OE2 . GLU A 1 989  ? 258.940 -23.497 5.245   1.00 41.67  ? 1056 GLU A OE2 1 
ATOM 7327  N N   . MET A 1 990  ? 253.234 -21.057 2.547   1.00 44.30  ? 1057 MET A N   1 
ATOM 7328  C CA  . MET A 1 990  ? 252.373 -20.349 1.613   1.00 44.30  ? 1057 MET A CA  1 
ATOM 7329  C C   . MET A 1 990  ? 251.555 -19.371 2.444   1.00 44.30  ? 1057 MET A C   1 
ATOM 7330  O O   . MET A 1 990  ? 250.744 -18.614 1.930   1.00 44.30  ? 1057 MET A O   1 
ATOM 7331  C CB  . MET A 1 990  ? 251.427 -21.301 0.890   1.00 41.67  ? 1057 MET A CB  1 
ATOM 7332  C CG  . MET A 1 990  ? 250.726 -20.651 -0.291  1.00 41.67  ? 1057 MET A CG  1 
ATOM 7333  S SD  . MET A 1 990  ? 251.727 -20.488 -1.812  1.00 41.67  ? 1057 MET A SD  1 
ATOM 7334  C CE  . MET A 1 990  ? 250.646 -19.523 -2.813  1.00 41.67  ? 1057 MET A CE  1 
ATOM 7335  N N   . PHE A 1 991  ? 251.772 -19.395 3.746   1.00 44.30  ? 1058 PHE A N   1 
ATOM 7336  C CA  . PHE A 1 991  ? 251.048 -18.501 4.621   1.00 44.30  ? 1058 PHE A CA  1 
ATOM 7337  C C   . PHE A 1 991  ? 251.961 -17.390 5.147   1.00 44.30  ? 1058 PHE A C   1 
ATOM 7338  O O   . PHE A 1 991  ? 251.557 -16.224 5.202   1.00 44.30  ? 1058 PHE A O   1 
ATOM 7339  C CB  . PHE A 1 991  ? 250.457 -19.290 5.790   1.00 41.67  ? 1058 PHE A CB  1 
ATOM 7340  C CG  . PHE A 1 991  ? 249.128 -19.937 5.490   1.00 41.67  ? 1058 PHE A CG  1 
ATOM 7341  C CD1 . PHE A 1 991  ? 247.953 -19.435 6.068   1.00 41.67  ? 1058 PHE A CD1 1 
ATOM 7342  C CD2 . PHE A 1 991  ? 249.050 -21.074 4.668   1.00 41.67  ? 1058 PHE A CD2 1 
ATOM 7343  C CE1 . PHE A 1 991  ? 246.728 -20.059 5.839   1.00 41.67  ? 1058 PHE A CE1 1 
ATOM 7344  C CE2 . PHE A 1 991  ? 247.834 -21.711 4.430   1.00 41.67  ? 1058 PHE A CE2 1 
ATOM 7345  C CZ  . PHE A 1 991  ? 246.673 -21.201 5.017   1.00 41.67  ? 1058 PHE A CZ  1 
ATOM 7346  N N   . ASN A 1 992  ? 253.186 -17.771 5.515   1.00 44.30  ? 1059 ASN A N   1 
ATOM 7347  C CA  . ASN A 1 992  ? 254.193 -16.874 6.075   1.00 44.30  ? 1059 ASN A CA  1 
ATOM 7348  C C   . ASN A 1 992  ? 253.943 -15.392 5.860   1.00 44.30  ? 1059 ASN A C   1 
ATOM 7349  O O   . ASN A 1 992  ? 254.136 -14.579 6.776   1.00 44.30  ? 1059 ASN A O   1 
ATOM 7350  C CB  . ASN A 1 992  ? 255.569 -17.240 5.538   1.00 41.67  ? 1059 ASN A CB  1 
ATOM 7351  C CG  . ASN A 1 992  ? 255.977 -18.685 5.876   1.00 41.67  ? 1059 ASN A CG  1 
ATOM 7352  O OD1 . ASN A 1 992  ? 255.662 -19.230 6.951   1.00 41.67  ? 1059 ASN A OD1 1 
ATOM 7353  N ND2 . ASN A 1 992  ? 256.708 -19.301 4.957   1.00 41.67  ? 1059 ASN A ND2 1 
ATOM 7354  N N   . LYS A 1 993  ? 253.519 -15.046 4.648   1.00 44.30  ? 1060 LYS A N   1 
ATOM 7355  C CA  . LYS A 1 993  ? 253.213 -13.661 4.297   1.00 44.30  ? 1060 LYS A CA  1 
ATOM 7356  C C   . LYS A 1 993  ? 251.687 -13.350 4.354   1.00 44.30  ? 1060 LYS A C   1 
ATOM 7357  O O   . LYS A 1 993  ? 250.871 -14.059 3.740   1.00 44.30  ? 1060 LYS A O   1 
ATOM 7358  C CB  . LYS A 1 993  ? 253.776 -13.372 2.899   1.00 41.67  ? 1060 LYS A CB  1 
ATOM 7359  C CG  . LYS A 1 993  ? 255.283 -13.490 2.797   1.00 41.67  ? 1060 LYS A CG  1 
ATOM 7360  C CD  . LYS A 1 993  ? 255.675 -13.835 1.407   1.00 41.67  ? 1060 LYS A CD  1 
ATOM 7361  C CE  . LYS A 1 993  ? 255.457 -15.301 1.192   1.00 41.67  ? 1060 LYS A CE  1 
ATOM 7362  N NZ  . LYS A 1 993  ? 256.254 -16.086 2.138   1.00 41.67  ? 1060 LYS A NZ  1 
ATOM 7363  N N   . LEU A 1 994  ? 251.314 -12.303 5.107   1.00 44.30  ? 1061 LEU A N   1 
ATOM 7364  C CA  . LEU A 1 994  ? 249.910 -11.874 5.236   1.00 44.30  ? 1061 LEU A CA  1 
ATOM 7365  C C   . LEU A 1 994  ? 249.432 -11.147 3.936   1.00 44.30  ? 1061 LEU A C   1 
ATOM 7366  O O   . LEU A 1 994  ? 248.326 -11.423 3.415   1.00 44.30  ? 1061 LEU A O   1 
ATOM 7367  C CB  . LEU A 1 994  ? 249.759 -10.959 6.469   1.00 41.67  ? 1061 LEU A CB  1 
ATOM 7368  C CG  . LEU A 1 994  ? 248.353 -10.605 6.957   1.00 41.67  ? 1061 LEU A CG  1 
ATOM 7369  C CD1 . LEU A 1 994  ? 247.627 -9.689  5.955   1.00 41.67  ? 1061 LEU A CD1 1 
ATOM 7370  C CD2 . LEU A 1 994  ? 247.597 -11.890 7.181   1.00 41.67  ? 1061 LEU A CD2 1 
ATOM 7371  N N   . GLU A 1 995  ? 250.283 -10.247 3.414   1.00 44.30  ? 1062 GLU A N   1 
ATOM 7372  C CA  . GLU A 1 995  ? 250.028 -9.461  2.182   1.00 44.30  ? 1062 GLU A CA  1 
ATOM 7373  C C   . GLU A 1 995  ? 249.783 -10.324 0.890   1.00 44.30  ? 1062 GLU A C   1 
ATOM 7374  O O   . GLU A 1 995  ? 248.631 -10.458 0.427   1.00 44.30  ? 1062 GLU A O   1 
ATOM 7375  C CB  . GLU A 1 995  ? 251.208 -8.480  1.974   1.00 41.67  ? 1062 GLU A CB  1 
ATOM 7376  C CG  . GLU A 1 995  ? 251.476 -7.545  3.155   1.00 41.67  ? 1062 GLU A CG  1 
ATOM 7377  C CD  . GLU A 1 995  ? 252.896 -7.008  3.163   1.00 41.67  ? 1062 GLU A CD  1 
ATOM 7378  O OE1 . GLU A 1 995  ? 253.842 -7.790  3.446   1.00 41.67  ? 1062 GLU A OE1 1 
ATOM 7379  O OE2 . GLU A 1 995  ? 253.064 -5.799  2.879   1.00 41.67  ? 1062 GLU A OE2 1 
ATOM 7380  N N   . SER A 1 996  ? 250.871 -10.876 0.324   1.00 44.30  ? 1063 SER A N   1 
ATOM 7381  C CA  . SER A 1 996  ? 250.874 -11.743 -0.880  1.00 44.30  ? 1063 SER A CA  1 
ATOM 7382  C C   . SER A 1 996  ? 251.715 -12.939 -0.449  1.00 44.30  ? 1063 SER A C   1 
ATOM 7383  O O   . SER A 1 996  ? 252.512 -12.800 0.486   1.00 44.30  ? 1063 SER A O   1 
ATOM 7384  C CB  . SER A 1 996  ? 251.584 -11.062 -2.059  1.00 41.67  ? 1063 SER A CB  1 
ATOM 7385  O OG  . SER A 1 996  ? 253.002 -11.145 -1.936  1.00 41.67  ? 1063 SER A OG  1 
ATOM 7386  N N   . ILE A 1 997  ? 251.585 -14.101 -1.094  1.00 44.30  ? 1064 ILE A N   1 
ATOM 7387  C CA  . ILE A 1 997  ? 252.411 -15.235 -0.632  1.00 44.30  ? 1064 ILE A CA  1 
ATOM 7388  C C   . ILE A 1 997  ? 253.316 -16.014 -1.617  1.00 44.30  ? 1064 ILE A C   1 
ATOM 7389  O O   . ILE A 1 997  ? 252.885 -16.438 -2.711  1.00 44.30  ? 1064 ILE A O   1 
ATOM 7390  C CB  . ILE A 1 997  ? 251.583 -16.301 0.174   1.00 41.67  ? 1064 ILE A CB  1 
ATOM 7391  C CG1 . ILE A 1 997  ? 250.710 -15.650 1.277   1.00 41.67  ? 1064 ILE A CG1 1 
ATOM 7392  C CG2 . ILE A 1 997  ? 252.578 -17.261 0.839   1.00 41.67  ? 1064 ILE A CG2 1 
ATOM 7393  C CD1 . ILE A 1 997  ? 249.448 -14.882 0.791   1.00 41.67  ? 1064 ILE A CD1 1 
ATOM 7394  N N   . ALA A 1 998  ? 254.565 -16.213 -1.161  1.00 44.30  ? 1065 ALA A N   1 
ATOM 7395  C CA  . ALA A 1 998  ? 255.647 -16.897 -1.881  1.00 44.30  ? 1065 ALA A CA  1 
ATOM 7396  C C   . ALA A 1 998  ? 256.177 -15.944 -2.955  1.00 44.30  ? 1065 ALA A C   1 
ATOM 7397  O O   . ALA A 1 998  ? 257.200 -16.205 -3.588  1.00 44.30  ? 1065 ALA A O   1 
ATOM 7398  C CB  . ALA A 1 998  ? 255.135 -18.218 -2.522  1.00 41.67  ? 1065 ALA A CB  1 
ATOM 7399  N N   . THR A 1 999  ? 255.455 -14.832 -3.110  1.00 44.30  ? 1066 THR A N   1 
ATOM 7400  C CA  . THR A 1 999  ? 255.703 -13.754 -4.072  1.00 44.30  ? 1066 THR A CA  1 
ATOM 7401  C C   . THR A 1 999  ? 255.235 -14.085 -5.528  1.00 44.30  ? 1066 THR A C   1 
ATOM 7402  O O   . THR A 1 999  ? 254.602 -15.126 -5.758  1.00 44.30  ? 1066 THR A O   1 
ATOM 7403  C CB  . THR A 1 999  ? 257.201 -13.200 -3.972  1.00 41.67  ? 1066 THR A CB  1 
ATOM 7404  O OG1 . THR A 1 999  ? 258.060 -14.167 -3.355  1.00 41.67  ? 1066 THR A OG1 1 
ATOM 7405  C CG2 . THR A 1 999  ? 257.252 -11.916 -3.114  1.00 41.67  ? 1066 THR A CG2 1 
ATOM 7406  N N   . SER A 1 1000 ? 255.535 -13.201 -6.488  1.00 44.30  ? 1067 SER A N   1 
ATOM 7407  C CA  . SER A 1 1000 ? 255.056 -13.332 -7.882  1.00 44.30  ? 1067 SER A CA  1 
ATOM 7408  C C   . SER A 1 1000 ? 255.729 -14.182 -9.012  1.00 44.30  ? 1067 SER A C   1 
ATOM 7409  O O   . SER A 1 1000 ? 255.092 -14.414 -10.051 1.00 44.30  ? 1067 SER A O   1 
ATOM 7410  C CB  . SER A 1 1000 ? 254.801 -11.908 -8.424  1.00 41.67  ? 1067 SER A CB  1 
ATOM 7411  O OG  . SER A 1 1000 ? 254.204 -11.917 -9.706  1.00 41.67  ? 1067 SER A OG  1 
ATOM 7412  N N   . ASP A 1 1001 ? 256.969 -14.643 -8.830  1.00 44.30  ? 1068 ASP A N   1 
ATOM 7413  C CA  . ASP A 1 1001 ? 257.715 -15.433 -9.840  1.00 44.30  ? 1068 ASP A CA  1 
ATOM 7414  C C   . ASP A 1 1001 ? 258.490 -14.456 -10.749 1.00 44.30  ? 1068 ASP A C   1 
ATOM 7415  O O   . ASP A 1 1001 ? 257.956 -13.429 -11.178 1.00 44.30  ? 1068 ASP A O   1 
ATOM 7416  C CB  . ASP A 1 1001 ? 256.776 -16.331 -10.665 1.00 41.67  ? 1068 ASP A CB  1 
ATOM 7417  C CG  . ASP A 1 1001 ? 257.404 -17.672 -11.021 1.00 41.67  ? 1068 ASP A CG  1 
ATOM 7418  O OD1 . ASP A 1 1001 ? 256.905 -18.707 -10.520 1.00 41.67  ? 1068 ASP A OD1 1 
ATOM 7419  O OD2 . ASP A 1 1001 ? 258.387 -17.692 -11.795 1.00 41.67  ? 1068 ASP A OD2 1 
ATOM 7420  N N   . ILE A 1 1002 ? 259.758 -14.789 -10.995 1.00 44.30  ? 1069 ILE A N   1 
ATOM 7421  C CA  . ILE A 1 1002 ? 260.733 -14.001 -11.773 1.00 44.30  ? 1069 ILE A CA  1 
ATOM 7422  C C   . ILE A 1 1002 ? 261.784 -13.403 -10.760 1.00 44.30  ? 1069 ILE A C   1 
ATOM 7423  O O   . ILE A 1 1002 ? 262.855 -12.913 -11.177 1.00 44.30  ? 1069 ILE A O   1 
ATOM 7424  C CB  . ILE A 1 1002 ? 260.052 -12.910 -12.680 1.00 41.67  ? 1069 ILE A CB  1 
ATOM 7425  C CG1 . ILE A 1 1002 ? 260.971 -12.518 -13.844 1.00 41.67  ? 1069 ILE A CG1 1 
ATOM 7426  C CG2 . ILE A 1 1002 ? 259.786 -11.667 -11.888 1.00 41.67  ? 1069 ILE A CG2 1 
ATOM 7427  C CD1 . ILE A 1 1002 ? 261.882 -11.308 -13.534 1.00 41.67  ? 1069 ILE A CD1 1 
ATOM 7428  N N   . PRO A 1 1003 ? 261.445 -13.377 -9.429  1.00 44.30  ? 1070 PRO A N   1 
ATOM 7429  C CA  . PRO A 1 1003 ? 262.190 -12.937 -8.240  1.00 44.30  ? 1070 PRO A CA  1 
ATOM 7430  C C   . PRO A 1 1003 ? 261.610 -13.744 -7.056  1.00 44.30  ? 1070 PRO A C   1 
ATOM 7431  O O   . PRO A 1 1003 ? 262.016 -14.879 -6.813  1.00 44.30  ? 1070 PRO A O   1 
ATOM 7432  C CB  . PRO A 1 1003 ? 261.843 -11.451 -8.133  1.00 41.67  ? 1070 PRO A CB  1 
ATOM 7433  C CG  . PRO A 1 1003 ? 260.490 -11.329 -8.868  1.00 41.67  ? 1070 PRO A CG  1 
ATOM 7434  C CD  . PRO A 1 1003 ? 260.114 -12.767 -9.260  1.00 41.67  ? 1070 PRO A CD  1 
ATOM 7435  N N   . ARG A 1 1004 ? 260.637 -13.156 -6.359  1.00 44.30  ? 1071 ARG A N   1 
ATOM 7436  C CA  . ARG A 1 1004 ? 259.973 -13.784 -5.222  1.00 44.30  ? 1071 ARG A CA  1 
ATOM 7437  C C   . ARG A 1 1004 ? 260.915 -14.298 -4.179  1.00 44.30  ? 1071 ARG A C   1 
ATOM 7438  O O   . ARG A 1 1004 ? 261.322 -15.456 -4.253  1.00 44.30  ? 1071 ARG A O   1 
ATOM 7439  C CB  . ARG A 1 1004 ? 259.185 -14.999 -5.618  1.00 41.67  ? 1071 ARG A CB  1 
ATOM 7440  C CG  . ARG A 1 1004 ? 258.569 -15.067 -6.952  1.00 41.67  ? 1071 ARG A CG  1 
ATOM 7441  C CD  . ARG A 1 1004 ? 257.847 -16.421 -6.948  1.00 41.67  ? 1071 ARG A CD  1 
ATOM 7442  N NE  . ARG A 1 1004 ? 258.609 -17.319 -6.074  1.00 41.67  ? 1071 ARG A NE  1 
ATOM 7443  C CZ  . ARG A 1 1004 ? 258.095 -18.266 -5.294  1.00 41.67  ? 1071 ARG A CZ  1 
ATOM 7444  N NH1 . ARG A 1 1004 ? 256.778 -18.474 -5.264  1.00 41.67  ? 1071 ARG A NH1 1 
ATOM 7445  N NH2 . ARG A 1 1004 ? 258.908 -18.986 -4.519  1.00 41.67  ? 1071 ARG A NH2 1 
ATOM 7446  N N   . THR A 1 1005 ? 261.187 -13.488 -3.165  1.00 44.30  ? 1072 THR A N   1 
ATOM 7447  C CA  . THR A 1 1005 ? 262.148 -13.849 -2.105  1.00 44.30  ? 1072 THR A CA  1 
ATOM 7448  C C   . THR A 1 1005 ? 261.652 -14.368 -0.709  1.00 44.30  ? 1072 THR A C   1 
ATOM 7449  O O   . THR A 1 1005 ? 262.438 -14.982 0.033   1.00 44.30  ? 1072 THR A O   1 
ATOM 7450  C CB  . THR A 1 1005 ? 263.152 -12.622 -1.894  1.00 41.67  ? 1072 THR A CB  1 
ATOM 7451  O OG1 . THR A 1 1005 ? 263.851 -12.345 -3.120  1.00 41.67  ? 1072 THR A OG1 1 
ATOM 7452  C CG2 . THR A 1 1005 ? 264.176 -12.903 -0.812  1.00 41.67  ? 1072 THR A CG2 1 
ATOM 7453  N N   . PRO A 1 1006 ? 260.352 -14.182 -0.364  1.00 44.30  ? 1073 PRO A N   1 
ATOM 7454  C CA  . PRO A 1 1006 ? 259.762 -14.599 0.910   1.00 44.30  ? 1073 PRO A CA  1 
ATOM 7455  C C   . PRO A 1 1006 ? 259.900 -16.044 1.343   1.00 44.30  ? 1073 PRO A C   1 
ATOM 7456  O O   . PRO A 1 1006 ? 259.591 -16.955 0.574   1.00 44.30  ? 1073 PRO A O   1 
ATOM 7457  C CB  . PRO A 1 1006 ? 258.314 -14.248 0.721   1.00 41.67  ? 1073 PRO A CB  1 
ATOM 7458  C CG  . PRO A 1 1006 ? 258.103 -14.641 -0.637  1.00 41.67  ? 1073 PRO A CG  1 
ATOM 7459  C CD  . PRO A 1 1006 ? 259.252 -13.911 -1.297  1.00 41.67  ? 1073 PRO A CD  1 
ATOM 7460  N N   . VAL A 1 1007 ? 260.322 -16.224 2.601   1.00 44.30  ? 1074 VAL A N   1 
ATOM 7461  C CA  . VAL A 1 1007 ? 260.497 -17.546 3.230   1.00 44.30  ? 1074 VAL A CA  1 
ATOM 7462  C C   . VAL A 1 1007 ? 259.325 -17.882 4.157   1.00 44.30  ? 1074 VAL A C   1 
ATOM 7463  O O   . VAL A 1 1007 ? 258.790 -17.006 4.844   1.00 44.30  ? 1074 VAL A O   1 
ATOM 7464  C CB  . VAL A 1 1007 ? 261.799 -17.632 4.083   1.00 41.67  ? 1074 VAL A CB  1 
ATOM 7465  C CG1 . VAL A 1 1007 ? 261.812 -16.534 5.130   1.00 41.67  ? 1074 VAL A CG1 1 
ATOM 7466  C CG2 . VAL A 1 1007 ? 261.882 -18.994 4.771   1.00 41.67  ? 1074 VAL A CG2 1 
ATOM 7467  N N   . GLU A 1 1023 ? 256.213 -26.453 15.213  1.00 83.54  ? 1090 GLU A N   1 
ATOM 7468  C CA  . GLU A 1 1023 ? 256.336 -25.839 16.529  1.00 84.35  ? 1090 GLU A CA  1 
ATOM 7469  C C   . GLU A 1 1023 ? 257.602 -26.355 17.170  1.00 83.46  ? 1090 GLU A C   1 
ATOM 7470  O O   . GLU A 1 1023 ? 257.621 -27.439 17.748  1.00 84.24  ? 1090 GLU A O   1 
ATOM 7471  C CB  . GLU A 1 1023 ? 255.132 -26.186 17.411  1.00 83.95  ? 1090 GLU A CB  1 
ATOM 7472  C CG  . GLU A 1 1023 ? 255.222 -25.602 18.822  1.00 84.22  ? 1090 GLU A CG  1 
ATOM 7473  C CD  . GLU A 1 1023 ? 253.963 -25.833 19.656  1.00 83.46  ? 1090 GLU A CD  1 
ATOM 7474  O OE1 . GLU A 1 1023 ? 253.003 -26.475 19.146  1.00 84.20  ? 1090 GLU A OE1 1 
ATOM 7475  O OE2 . GLU A 1 1023 ? 253.945 -25.363 20.825  1.00 83.74  ? 1090 GLU A OE2 1 
ATOM 7476  N N   . GLU A 1 1024 ? 258.661 -25.564 17.073  1.00 97.00  ? 1091 GLU A N   1 
ATOM 7477  C CA  . GLU A 1 1024 ? 259.957 -25.944 17.604  1.00 96.74  ? 1091 GLU A CA  1 
ATOM 7478  C C   . GLU A 1 1024 ? 260.343 -26.986 16.566  1.00 96.87  ? 1091 GLU A C   1 
ATOM 7479  O O   . GLU A 1 1024 ? 259.580 -27.222 15.621  1.00 96.88  ? 1091 GLU A O   1 
ATOM 7480  C CB  . GLU A 1 1024 ? 259.820 -26.564 19.007  1.00 96.41  ? 1091 GLU A CB  1 
ATOM 7481  C CG  . GLU A 1 1024 ? 258.792 -25.857 19.919  1.00 97.32  ? 1091 GLU A CG  1 
ATOM 7482  C CD  . GLU A 1 1024 ? 259.405 -24.903 20.947  1.00 97.27  ? 1091 GLU A CD  1 
ATOM 7483  O OE1 . GLU A 1 1024 ? 258.645 -24.286 21.731  1.00 96.76  ? 1091 GLU A OE1 1 
ATOM 7484  O OE2 . GLU A 1 1024 ? 260.640 -24.771 20.980  1.00 97.11  ? 1091 GLU A OE2 1 
ATOM 7485  N N   . PHE A 1 1025 ? 261.507 -27.600 16.726  1.00 95.13  ? 1092 PHE A N   1 
ATOM 7486  C CA  . PHE A 1 1025 ? 261.990 -28.606 15.780  1.00 94.92  ? 1092 PHE A CA  1 
ATOM 7487  C C   . PHE A 1 1025 ? 262.844 -27.945 14.688  1.00 94.75  ? 1092 PHE A C   1 
ATOM 7488  O O   . PHE A 1 1025 ? 262.761 -26.739 14.448  1.00 94.71  ? 1092 PHE A O   1 
ATOM 7489  C CB  . PHE A 1 1025 ? 260.828 -29.376 15.125  1.00 94.59  ? 1092 PHE A CB  1 
ATOM 7490  C CG  . PHE A 1 1025 ? 259.838 -29.950 16.101  1.00 94.61  ? 1092 PHE A CG  1 
ATOM 7491  C CD1 . PHE A 1 1025 ? 258.561 -30.275 15.681  1.00 94.60  ? 1092 PHE A CD1 1 
ATOM 7492  C CD2 . PHE A 1 1025 ? 260.173 -30.152 17.431  1.00 94.87  ? 1092 PHE A CD2 1 
ATOM 7493  C CE1 . PHE A 1 1025 ? 257.633 -30.789 16.575  1.00 94.54  ? 1092 PHE A CE1 1 
ATOM 7494  C CE2 . PHE A 1 1025 ? 259.252 -30.664 18.329  1.00 94.45  ? 1092 PHE A CE2 1 
ATOM 7495  C CZ  . PHE A 1 1025 ? 257.978 -30.984 17.901  1.00 95.28  ? 1092 PHE A CZ  1 
ATOM 7496  N N   . MET A 1 1026 ? 263.656 -28.772 14.036  1.00 101.35 ? 1093 MET A N   1 
ATOM 7497  C CA  . MET A 1 1026 ? 264.591 -28.380 12.982  1.00 97.32  ? 1093 MET A CA  1 
ATOM 7498  C C   . MET A 1 1026 ? 264.114 -27.304 12.036  1.00 92.72  ? 1093 MET A C   1 
ATOM 7499  O O   . MET A 1 1026 ? 264.582 -26.172 12.078  1.00 92.12  ? 1093 MET A O   1 
ATOM 7500  C CB  . MET A 1 1026 ? 264.974 -29.608 12.150  1.00 99.22  ? 1093 MET A CB  1 
ATOM 7501  C CG  . MET A 1 1026 ? 265.258 -30.854 12.974  1.00 100.61 ? 1093 MET A CG  1 
ATOM 7502  S SD  . MET A 1 1026 ? 265.155 -32.371 11.982  1.00 95.04  ? 1093 MET A SD  1 
ATOM 7503  C CE  . MET A 1 1026 ? 266.759 -33.168 12.384  1.00 99.42  ? 1093 MET A CE  1 
ATOM 7504  N N   . THR A 1 1027 ? 263.192 -27.690 11.165  1.00 87.91  ? 1094 THR A N   1 
ATOM 7505  C CA  . THR A 1 1027 ? 262.650 -26.797 10.162  1.00 83.20  ? 1094 THR A CA  1 
ATOM 7506  C C   . THR A 1 1027 ? 262.804 -25.373 10.605  1.00 78.32  ? 1094 THR A C   1 
ATOM 7507  O O   . THR A 1 1027 ? 263.715 -24.669 10.190  1.00 76.35  ? 1094 THR A O   1 
ATOM 7508  C CB  . THR A 1 1027 ? 261.163 -27.057 9.925   1.00 84.30  ? 1094 THR A CB  1 
ATOM 7509  O OG1 . THR A 1 1027 ? 260.939 -28.459 9.729   1.00 84.72  ? 1094 THR A OG1 1 
ATOM 7510  C CG2 . THR A 1 1027 ? 260.701 -26.304 8.688   1.00 83.95  ? 1094 THR A CG2 1 
ATOM 7511  N N   . SER A 1 1028 ? 261.897 -24.958 11.465  1.00 73.73  ? 1095 SER A N   1 
ATOM 7512  C CA  . SER A 1 1028 ? 261.946 -23.617 11.964  1.00 69.31  ? 1095 SER A CA  1 
ATOM 7513  C C   . SER A 1 1028 ? 263.394 -23.310 12.302  1.00 66.42  ? 1095 SER A C   1 
ATOM 7514  O O   . SER A 1 1028 ? 264.093 -22.664 11.533  1.00 65.79  ? 1095 SER A O   1 
ATOM 7515  C CB  . SER A 1 1028 ? 261.052 -23.501 13.193  1.00 69.95  ? 1095 SER A CB  1 
ATOM 7516  O OG  . SER A 1 1028 ? 261.248 -24.605 14.053  1.00 71.03  ? 1095 SER A OG  1 
ATOM 7517  N N   . ARG A 1 1029 ? 263.851 -23.816 13.436  1.00 62.96  ? 1096 ARG A N   1 
ATOM 7518  C CA  . ARG A 1 1029 ? 265.210 -23.583 13.896  1.00 60.20  ? 1096 ARG A CA  1 
ATOM 7519  C C   . ARG A 1 1029 ? 266.247 -23.472 12.795  1.00 57.04  ? 1096 ARG A C   1 
ATOM 7520  O O   . ARG A 1 1029 ? 266.940 -22.464 12.686  1.00 56.16  ? 1096 ARG A O   1 
ATOM 7521  C CB  . ARG A 1 1029 ? 265.620 -24.697 14.840  1.00 62.51  ? 1096 ARG A CB  1 
ATOM 7522  C CG  . ARG A 1 1029 ? 264.567 -25.011 15.874  1.00 65.90  ? 1096 ARG A CG  1 
ATOM 7523  C CD  . ARG A 1 1029 ? 264.924 -26.274 16.627  1.00 69.77  ? 1096 ARG A CD  1 
ATOM 7524  N NE  . ARG A 1 1029 ? 266.190 -26.151 17.347  1.00 73.65  ? 1096 ARG A NE  1 
ATOM 7525  C CZ  . ARG A 1 1029 ? 266.715 -27.102 18.115  1.00 75.32  ? 1096 ARG A CZ  1 
ATOM 7526  N NH1 . ARG A 1 1029 ? 266.096 -28.266 18.269  1.00 76.72  ? 1096 ARG A NH1 1 
ATOM 7527  N NH2 . ARG A 1 1029 ? 267.842 -26.868 18.771  1.00 75.76  ? 1096 ARG A NH2 1 
ATOM 7528  N N   . VAL A 1 1030 ? 266.357 -24.514 11.983  1.00 54.66  ? 1097 VAL A N   1 
ATOM 7529  C CA  . VAL A 1 1030 ? 267.339 -24.522 10.913  1.00 53.64  ? 1097 VAL A CA  1 
ATOM 7530  C C   . VAL A 1 1030 ? 267.126 -23.326 9.985   1.00 54.34  ? 1097 VAL A C   1 
ATOM 7531  O O   . VAL A 1 1030 ? 268.053 -22.582 9.667   1.00 54.20  ? 1097 VAL A O   1 
ATOM 7532  C CB  . VAL A 1 1030 ? 267.269 -25.839 10.091  1.00 52.32  ? 1097 VAL A CB  1 
ATOM 7533  C CG1 . VAL A 1 1030 ? 268.498 -25.962 9.210   1.00 48.36  ? 1097 VAL A CG1 1 
ATOM 7534  C CG2 . VAL A 1 1030 ? 267.160 -27.033 11.013  1.00 50.94  ? 1097 VAL A CG2 1 
ATOM 7535  N N   . ASN A 1 1031 ? 265.890 -23.123 9.569   1.00 55.74  ? 1098 ASN A N   1 
ATOM 7536  C CA  . ASN A 1 1031 ? 265.600 -22.026 8.673   1.00 56.10  ? 1098 ASN A CA  1 
ATOM 7537  C C   . ASN A 1 1031 ? 266.076 -20.708 9.290   1.00 56.15  ? 1098 ASN A C   1 
ATOM 7538  O O   . ASN A 1 1031 ? 266.722 -19.888 8.643   1.00 55.96  ? 1098 ASN A O   1 
ATOM 7539  C CB  . ASN A 1 1031 ? 264.092 -21.991 8.414   1.00 56.94  ? 1098 ASN A CB  1 
ATOM 7540  C CG  . ASN A 1 1031 ? 263.737 -21.219 7.164   1.00 58.80  ? 1098 ASN A CG  1 
ATOM 7541  O OD1 . ASN A 1 1031 ? 264.579 -20.535 6.606   1.00 58.54  ? 1098 ASN A OD1 1 
ATOM 7542  N ND2 . ASN A 1 1031 ? 262.486 -21.322 6.724   1.00 60.68  ? 1098 ASN A ND2 1 
ATOM 7543  N N   . TRP A 1 1032 ? 265.775 -20.542 10.567  1.00 56.88  ? 1099 TRP A N   1 
ATOM 7544  C CA  . TRP A 1 1032 ? 266.101 -19.330 11.285  1.00 57.42  ? 1099 TRP A CA  1 
ATOM 7545  C C   . TRP A 1 1032 ? 267.567 -19.062 11.569  1.00 53.98  ? 1099 TRP A C   1 
ATOM 7546  O O   . TRP A 1 1032 ? 267.969 -17.914 11.707  1.00 52.83  ? 1099 TRP A O   1 
ATOM 7547  C CB  . TRP A 1 1032 ? 265.244 -19.292 12.551  1.00 63.37  ? 1099 TRP A CB  1 
ATOM 7548  C CG  . TRP A 1 1032 ? 263.928 -18.602 12.276  1.00 69.79  ? 1099 TRP A CG  1 
ATOM 7549  C CD1 . TRP A 1 1032 ? 263.682 -17.269 12.407  1.00 71.71  ? 1099 TRP A CD1 1 
ATOM 7550  C CD2 . TRP A 1 1032 ? 262.722 -19.172 11.704  1.00 73.04  ? 1099 TRP A CD2 1 
ATOM 7551  N NE1 . TRP A 1 1032 ? 262.417 -16.963 11.952  1.00 73.23  ? 1099 TRP A NE1 1 
ATOM 7552  C CE2 . TRP A 1 1032 ? 261.804 -18.108 11.516  1.00 74.07  ? 1099 TRP A CE2 1 
ATOM 7553  C CE3 . TRP A 1 1032 ? 262.332 -20.470 11.331  1.00 76.19  ? 1099 TRP A CE3 1 
ATOM 7554  C CZ2 . TRP A 1 1032 ? 260.512 -18.299 10.975  1.00 76.29  ? 1099 TRP A CZ2 1 
ATOM 7555  C CZ3 . TRP A 1 1032 ? 261.037 -20.660 10.788  1.00 77.96  ? 1099 TRP A CZ3 1 
ATOM 7556  C CH2 . TRP A 1 1032 ? 260.150 -19.574 10.619  1.00 78.26  ? 1099 TRP A CH2 1 
ATOM 7557  N N   . VAL A 1 1033 ? 268.371 -20.114 11.646  1.00 51.96  ? 1100 VAL A N   1 
ATOM 7558  C CA  . VAL A 1 1033 ? 269.796 -19.933 11.880  1.00 50.20  ? 1100 VAL A CA  1 
ATOM 7559  C C   . VAL A 1 1033 ? 270.274 -19.012 10.782  1.00 49.39  ? 1100 VAL A C   1 
ATOM 7560  O O   . VAL A 1 1033 ? 270.734 -17.900 11.036  1.00 49.13  ? 1100 VAL A O   1 
ATOM 7561  C CB  . VAL A 1 1033 ? 270.575 -21.264 11.772  1.00 49.54  ? 1100 VAL A CB  1 
ATOM 7562  C CG1 . VAL A 1 1033 ? 271.971 -21.010 11.253  1.00 48.73  ? 1100 VAL A CG1 1 
ATOM 7563  C CG2 . VAL A 1 1033 ? 270.660 -21.929 13.130  1.00 49.13  ? 1100 VAL A CG2 1 
ATOM 7564  N N   . VAL A 1 1034 ? 270.148 -19.502 9.555   1.00 48.75  ? 1101 VAL A N   1 
ATOM 7565  C CA  . VAL A 1 1034 ? 270.545 -18.754 8.379   1.00 48.14  ? 1101 VAL A CA  1 
ATOM 7566  C C   . VAL A 1 1034 ? 269.978 -17.357 8.518   1.00 48.03  ? 1101 VAL A C   1 
ATOM 7567  O O   . VAL A 1 1034 ? 270.709 -16.373 8.472   1.00 50.70  ? 1101 VAL A O   1 
ATOM 7568  C CB  . VAL A 1 1034 ? 269.972 -19.374 7.092   1.00 47.30  ? 1101 VAL A CB  1 
ATOM 7569  C CG1 . VAL A 1 1034 ? 270.552 -18.702 5.884   1.00 48.16  ? 1101 VAL A CG1 1 
ATOM 7570  C CG2 . VAL A 1 1034 ? 270.269 -20.829 7.048   1.00 49.28  ? 1101 VAL A CG2 1 
ATOM 7571  N N   . GLN A 1 1035 ? 268.669 -17.274 8.706   1.00 45.15  ? 1102 GLN A N   1 
ATOM 7572  C CA  . GLN A 1 1035 ? 268.038 -15.982 8.826   1.00 42.54  ? 1102 GLN A CA  1 
ATOM 7573  C C   . GLN A 1 1035 ? 268.615 -15.178 9.981   1.00 40.67  ? 1102 GLN A C   1 
ATOM 7574  O O   . GLN A 1 1035 ? 269.235 -14.146 9.759   1.00 41.39  ? 1102 GLN A O   1 
ATOM 7575  C CB  . GLN A 1 1035 ? 266.511 -16.148 8.943   1.00 44.06  ? 1102 GLN A CB  1 
ATOM 7576  C CG  . GLN A 1 1035 ? 265.737 -15.913 7.597   1.00 46.88  ? 1102 GLN A CG  1 
ATOM 7577  C CD  . GLN A 1 1035 ? 264.937 -17.118 7.082   1.00 47.31  ? 1102 GLN A CD  1 
ATOM 7578  O OE1 . GLN A 1 1035 ? 263.787 -17.355 7.466   1.00 46.63  ? 1102 GLN A OE1 1 
ATOM 7579  N NE2 . GLN A 1 1035 ? 265.555 -17.877 6.209   1.00 47.02  ? 1102 GLN A NE2 1 
ATOM 7580  N N   . SER A 1 1036 ? 268.446 -15.643 11.209  1.00 38.14  ? 1103 SER A N   1 
ATOM 7581  C CA  . SER A 1 1036 ? 268.968 -14.904 12.340  1.00 36.18  ? 1103 SER A CA  1 
ATOM 7582  C C   . SER A 1 1036 ? 270.348 -14.382 12.019  1.00 35.69  ? 1103 SER A C   1 
ATOM 7583  O O   . SER A 1 1036 ? 270.652 -13.224 12.294  1.00 35.24  ? 1103 SER A O   1 
ATOM 7584  C CB  . SER A 1 1036 ? 269.021 -15.814 13.525  1.00 36.07  ? 1103 SER A CB  1 
ATOM 7585  O OG  . SER A 1 1036 ? 267.854 -16.583 13.482  1.00 37.57  ? 1103 SER A OG  1 
ATOM 7586  N N   . SER A 1 1037 ? 271.163 -15.237 11.399  1.00 36.18  ? 1104 SER A N   1 
ATOM 7587  C CA  . SER A 1 1037 ? 272.541 -14.908 11.017  1.00 37.31  ? 1104 SER A CA  1 
ATOM 7588  C C   . SER A 1 1037 ? 272.687 -13.889 9.883   1.00 38.93  ? 1104 SER A C   1 
ATOM 7589  O O   . SER A 1 1037 ? 273.748 -13.284 9.719   1.00 38.11  ? 1104 SER A O   1 
ATOM 7590  C CB  . SER A 1 1037 ? 273.273 -16.185 10.637  1.00 36.68  ? 1104 SER A CB  1 
ATOM 7591  O OG  . SER A 1 1037 ? 273.017 -17.174 11.613  1.00 36.10  ? 1104 SER A OG  1 
ATOM 7592  N N   . ALA A 1 1038 ? 271.641 -13.705 9.087   1.00 41.03  ? 1105 ALA A N   1 
ATOM 7593  C CA  . ALA A 1 1038 ? 271.725 -12.729 8.014   1.00 42.39  ? 1105 ALA A CA  1 
ATOM 7594  C C   . ALA A 1 1038 ? 271.294 -11.410 8.602   1.00 42.31  ? 1105 ALA A C   1 
ATOM 7595  O O   . ALA A 1 1038 ? 271.448 -10.369 7.980   1.00 43.05  ? 1105 ALA A O   1 
ATOM 7596  C CB  . ALA A 1 1038 ? 270.846 -13.115 6.865   1.00 42.27  ? 1105 ALA A CB  1 
ATOM 7597  N N   . VAL A 1 1039 ? 270.759 -11.470 9.815   1.00 42.12  ? 1106 VAL A N   1 
ATOM 7598  C CA  . VAL A 1 1039 ? 270.345 -10.273 10.515  1.00 42.19  ? 1106 VAL A CA  1 
ATOM 7599  C C   . VAL A 1 1039 ? 271.655 -9.672  10.975  1.00 42.21  ? 1106 VAL A C   1 
ATOM 7600  O O   . VAL A 1 1039 ? 271.943 -8.493  10.738  1.00 41.81  ? 1106 VAL A O   1 
ATOM 7601  C CB  . VAL A 1 1039 ? 269.499 -10.609 11.745  1.00 42.04  ? 1106 VAL A CB  1 
ATOM 7602  C CG1 . VAL A 1 1039 ? 268.834 -9.355  12.275  1.00 42.22  ? 1106 VAL A CG1 1 
ATOM 7603  C CG2 . VAL A 1 1039 ? 268.456 -11.622 11.386  1.00 43.31  ? 1106 VAL A CG2 1 
ATOM 7604  N N   . ASP A 1 1040 ? 272.443 -10.517 11.635  1.00 41.79  ? 1107 ASP A N   1 
ATOM 7605  C CA  . ASP A 1 1040 ? 273.760 -10.147 12.135  1.00 41.00  ? 1107 ASP A CA  1 
ATOM 7606  C C   . ASP A 1 1040 ? 274.437 -9.439  10.976  1.00 40.03  ? 1107 ASP A C   1 
ATOM 7607  O O   . ASP A 1 1040 ? 274.955 -8.325  11.105  1.00 38.82  ? 1107 ASP A O   1 
ATOM 7608  C CB  . ASP A 1 1040 ? 274.592 -11.400 12.482  1.00 41.15  ? 1107 ASP A CB  1 
ATOM 7609  C CG  . ASP A 1 1040 ? 273.873 -12.365 13.446  1.00 42.44  ? 1107 ASP A CG  1 
ATOM 7610  O OD1 . ASP A 1 1040 ? 272.709 -12.055 13.825  1.00 44.73  ? 1107 ASP A OD1 1 
ATOM 7611  O OD2 . ASP A 1 1040 ? 274.475 -13.425 13.817  1.00 33.94  ? 1107 ASP A OD2 1 
ATOM 7612  N N   . TYR A 1 1041 ? 274.426 -10.119 9.835   1.00 38.96  ? 1108 TYR A N   1 
ATOM 7613  C CA  . TYR A 1 1041 ? 275.021 -9.584  8.627   1.00 39.07  ? 1108 TYR A CA  1 
ATOM 7614  C C   . TYR A 1 1041 ? 274.627 -8.117  8.495   1.00 39.19  ? 1108 TYR A C   1 
ATOM 7615  O O   . TYR A 1 1041 ? 275.464 -7.215  8.551   1.00 38.44  ? 1108 TYR A O   1 
ATOM 7616  C CB  . TYR A 1 1041 ? 274.521 -10.359 7.413   1.00 39.47  ? 1108 TYR A CB  1 
ATOM 7617  C CG  . TYR A 1 1041 ? 275.481 -10.310 6.267   1.00 40.99  ? 1108 TYR A CG  1 
ATOM 7618  C CD1 . TYR A 1 1041 ? 276.143 -11.449 5.860   1.00 41.80  ? 1108 TYR A CD1 1 
ATOM 7619  C CD2 . TYR A 1 1041 ? 275.769 -9.112  5.619   1.00 42.58  ? 1108 TYR A CD2 1 
ATOM 7620  C CE1 . TYR A 1 1041 ? 277.069 -11.404 4.846   1.00 42.58  ? 1108 TYR A CE1 1 
ATOM 7621  C CE2 . TYR A 1 1041 ? 276.701 -9.058  4.599   1.00 44.03  ? 1108 TYR A CE2 1 
ATOM 7622  C CZ  . TYR A 1 1041 ? 277.351 -10.207 4.218   1.00 43.69  ? 1108 TYR A CZ  1 
ATOM 7623  O OH  . TYR A 1 1041 ? 278.313 -10.148 3.235   1.00 40.93  ? 1108 TYR A OH  1 
ATOM 7624  N N   . LEU A 1 1042 ? 273.335 -7.880  8.354   1.00 40.01  ? 1109 LEU A N   1 
ATOM 7625  C CA  . LEU A 1 1042 ? 272.868 -6.528  8.200   1.00 40.14  ? 1109 LEU A CA  1 
ATOM 7626  C C   . LEU A 1 1042 ? 273.536 -5.547  9.153   1.00 39.67  ? 1109 LEU A C   1 
ATOM 7627  O O   . LEU A 1 1042 ? 274.117 -4.561  8.710   1.00 38.78  ? 1109 LEU A O   1 
ATOM 7628  C CB  . LEU A 1 1042 ? 271.349 -6.462  8.374   1.00 42.21  ? 1109 LEU A CB  1 
ATOM 7629  C CG  . LEU A 1 1042 ? 270.673 -5.615  7.290   1.00 43.60  ? 1109 LEU A CG  1 
ATOM 7630  C CD1 . LEU A 1 1042 ? 271.741 -4.761  6.599   1.00 44.55  ? 1109 LEU A CD1 1 
ATOM 7631  C CD2 . LEU A 1 1042 ? 269.981 -6.513  6.254   1.00 45.84  ? 1109 LEU A CD2 1 
ATOM 7632  N N   . HIS A 1 1043 ? 273.477 -5.835  10.453  1.00 39.11  ? 1110 HIS A N   1 
ATOM 7633  C CA  . HIS A 1 1043 ? 274.028 -4.943  11.491  1.00 38.75  ? 1110 HIS A CA  1 
ATOM 7634  C C   . HIS A 1 1043 ? 275.455 -4.468  11.360  1.00 36.43  ? 1110 HIS A C   1 
ATOM 7635  O O   . HIS A 1 1043 ? 275.823 -3.429  11.892  1.00 35.76  ? 1110 HIS A O   1 
ATOM 7636  C CB  . HIS A 1 1043 ? 273.877 -5.567  12.879  1.00 41.97  ? 1110 HIS A CB  1 
ATOM 7637  C CG  . HIS A 1 1043 ? 272.461 -5.802  13.271  1.00 43.37  ? 1110 HIS A CG  1 
ATOM 7638  N ND1 . HIS A 1 1043 ? 271.439 -4.970  12.871  1.00 44.43  ? 1110 HIS A ND1 1 
ATOM 7639  C CD2 . HIS A 1 1043 ? 271.889 -6.774  14.018  1.00 44.07  ? 1110 HIS A CD2 1 
ATOM 7640  C CE1 . HIS A 1 1043 ? 270.295 -5.421  13.351  1.00 45.00  ? 1110 HIS A CE1 1 
ATOM 7641  N NE2 . HIS A 1 1043 ? 270.540 -6.515  14.050  1.00 43.96  ? 1110 HIS A NE2 1 
ATOM 7642  N N   . LEU A 1 1044 ? 276.277 -5.224  10.673  1.00 34.98  ? 1111 LEU A N   1 
ATOM 7643  C CA  . LEU A 1 1044 ? 277.631 -4.785  10.563  1.00 37.35  ? 1111 LEU A CA  1 
ATOM 7644  C C   . LEU A 1 1044 ? 277.742 -3.801  9.458   1.00 39.10  ? 1111 LEU A C   1 
ATOM 7645  O O   . LEU A 1 1044 ? 278.304 -2.727  9.620   1.00 37.08  ? 1111 LEU A O   1 
ATOM 7646  C CB  . LEU A 1 1044 ? 278.529 -5.972  10.323  1.00 39.37  ? 1111 LEU A CB  1 
ATOM 7647  C CG  . LEU A 1 1044 ? 278.910 -6.582  11.668  1.00 39.37  ? 1111 LEU A CG  1 
ATOM 7648  C CD1 . LEU A 1 1044 ? 277.694 -6.673  12.586  1.00 40.76  ? 1111 LEU A CD1 1 
ATOM 7649  C CD2 . LEU A 1 1044 ? 279.548 -7.934  11.419  1.00 40.48  ? 1111 LEU A CD2 1 
ATOM 7650  N N   . MET A 1 1045 ? 277.188 -4.174  8.321   1.00 41.73  ? 1112 MET A N   1 
ATOM 7651  C CA  . MET A 1 1045 ? 277.217 -3.303  7.169   1.00 43.85  ? 1112 MET A CA  1 
ATOM 7652  C C   . MET A 1 1045 ? 276.924 -1.945  7.742   1.00 44.21  ? 1112 MET A C   1 
ATOM 7653  O O   . MET A 1 1045 ? 277.625 -0.966  7.504   1.00 44.48  ? 1112 MET A O   1 
ATOM 7654  C CB  . MET A 1 1045 ? 276.108 -3.689  6.178   1.00 45.89  ? 1112 MET A CB  1 
ATOM 7655  C CG  . MET A 1 1045 ? 275.561 -5.112  6.358   1.00 49.54  ? 1112 MET A CG  1 
ATOM 7656  S SD  . MET A 1 1045 ? 274.699 -5.756  4.925   1.00 50.46  ? 1112 MET A SD  1 
ATOM 7657  C CE  . MET A 1 1045 ? 276.105 -6.221  3.864   1.00 50.51  ? 1112 MET A CE  1 
ATOM 7658  N N   . LEU A 1 1046 ? 275.884 -1.950  8.559   1.00 46.12  ? 1113 LEU A N   1 
ATOM 7659  C CA  . LEU A 1 1046 ? 275.362 -0.775  9.213   1.00 49.21  ? 1113 LEU A CA  1 
ATOM 7660  C C   . LEU A 1 1046 ? 276.315 -0.185  10.219  1.00 49.25  ? 1113 LEU A C   1 
ATOM 7661  O O   . LEU A 1 1046 ? 276.745 0.949   10.074  1.00 47.47  ? 1113 LEU A O   1 
ATOM 7662  C CB  . LEU A 1 1046 ? 274.061 -1.137  9.906   1.00 51.61  ? 1113 LEU A CB  1 
ATOM 7663  C CG  . LEU A 1 1046 ? 273.059 -2.018  9.170   1.00 53.68  ? 1113 LEU A CG  1 
ATOM 7664  C CD1 . LEU A 1 1046 ? 271.705 -1.424  9.447   1.00 52.51  ? 1113 LEU A CD1 1 
ATOM 7665  C CD2 . LEU A 1 1046 ? 273.317 -2.084  7.661   1.00 55.47  ? 1113 LEU A CD2 1 
ATOM 7666  N N   . VAL A 1 1047 ? 276.626 -0.952  11.253  1.00 50.26  ? 1114 VAL A N   1 
ATOM 7667  C CA  . VAL A 1 1047 ? 277.523 -0.484  12.292  1.00 51.83  ? 1114 VAL A CA  1 
ATOM 7668  C C   . VAL A 1 1047 ? 278.801 0.167   11.760  1.00 52.48  ? 1114 VAL A C   1 
ATOM 7669  O O   . VAL A 1 1047 ? 279.204 1.244   12.220  1.00 51.96  ? 1114 VAL A O   1 
ATOM 7670  C CB  . VAL A 1 1047 ? 277.896 -1.625  13.222  1.00 52.16  ? 1114 VAL A CB  1 
ATOM 7671  C CG1 . VAL A 1 1047 ? 278.956 -1.182  14.165  1.00 53.70  ? 1114 VAL A CG1 1 
ATOM 7672  C CG2 . VAL A 1 1047 ? 276.687 -2.066  13.983  1.00 53.19  ? 1114 VAL A CG2 1 
ATOM 7673  N N   . ALA A 1 1048 ? 279.438 -0.477  10.791  1.00 54.43  ? 1115 ALA A N   1 
ATOM 7674  C CA  . ALA A 1 1048 ? 280.668 0.055   10.225  1.00 56.29  ? 1115 ALA A CA  1 
ATOM 7675  C C   . ALA A 1 1048 ? 280.415 1.374   9.522   1.00 57.27  ? 1115 ALA A C   1 
ATOM 7676  O O   . ALA A 1 1048 ? 281.127 2.361   9.744   1.00 57.70  ? 1115 ALA A O   1 
ATOM 7677  C CB  . ALA A 1 1048 ? 281.251 -0.932  9.252   1.00 56.81  ? 1115 ALA A CB  1 
ATOM 7678  N N   . MET A 1 1049 ? 279.395 1.374   8.669   1.00 59.55  ? 1116 MET A N   1 
ATOM 7679  C CA  . MET A 1 1049 ? 279.004 2.554   7.899   1.00 61.87  ? 1116 MET A CA  1 
ATOM 7680  C C   . MET A 1 1049 ? 278.659 3.744   8.784   1.00 62.28  ? 1116 MET A C   1 
ATOM 7681  O O   . MET A 1 1049 ? 279.202 4.838   8.600   1.00 61.97  ? 1116 MET A O   1 
ATOM 7682  C CB  . MET A 1 1049 ? 277.825 2.211   6.990   1.00 64.10  ? 1116 MET A CB  1 
ATOM 7683  C CG  . MET A 1 1049 ? 278.196 1.268   5.838   1.00 69.61  ? 1116 MET A CG  1 
ATOM 7684  S SD  . MET A 1 1049 ? 278.225 2.025   4.163   1.00 74.46  ? 1116 MET A SD  1 
ATOM 7685  C CE  . MET A 1 1049 ? 278.394 3.767   4.555   1.00 73.00  ? 1116 MET A CE  1 
ATOM 7686  N N   . LYS A 1 1050 ? 277.750 3.534   9.732   1.00 63.25  ? 1117 LYS A N   1 
ATOM 7687  C CA  . LYS A 1 1050 ? 277.380 4.590   10.669  1.00 64.87  ? 1117 LYS A CA  1 
ATOM 7688  C C   . LYS A 1 1050 ? 278.704 5.085   11.221  1.00 65.17  ? 1117 LYS A C   1 
ATOM 7689  O O   . LYS A 1 1050 ? 279.020 6.278   11.239  1.00 64.49  ? 1117 LYS A O   1 
ATOM 7690  C CB  . LYS A 1 1050 ? 276.568 4.016   11.820  1.00 66.31  ? 1117 LYS A CB  1 
ATOM 7691  C CG  . LYS A 1 1050 ? 275.452 3.139   11.366  1.00 69.10  ? 1117 LYS A CG  1 
ATOM 7692  C CD  . LYS A 1 1050 ? 275.319 1.975   12.303  1.00 71.71  ? 1117 LYS A CD  1 
ATOM 7693  C CE  . LYS A 1 1050 ? 274.199 1.055   11.881  1.00 73.39  ? 1117 LYS A CE  1 
ATOM 7694  N NZ  . LYS A 1 1050 ? 274.345 -0.294  12.501  1.00 74.68  ? 1117 LYS A NZ  1 
ATOM 7695  N N   . TRP A 1 1051 ? 279.488 4.128   11.667  1.00 67.42  ? 1118 TRP A N   1 
ATOM 7696  C CA  . TRP A 1 1051 ? 280.756 4.454   12.202  1.00 69.95  ? 1118 TRP A CA  1 
ATOM 7697  C C   . TRP A 1 1051 ? 281.520 5.369   11.278  1.00 70.21  ? 1118 TRP A C   1 
ATOM 7698  O O   . TRP A 1 1051 ? 281.838 6.500   11.619  1.00 70.14  ? 1118 TRP A O   1 
ATOM 7699  C CB  . TRP A 1 1051 ? 281.551 3.195   12.417  1.00 73.06  ? 1118 TRP A CB  1 
ATOM 7700  C CG  . TRP A 1 1051 ? 282.572 3.486   13.379  1.00 76.95  ? 1118 TRP A CG  1 
ATOM 7701  C CD1 . TRP A 1 1051 ? 283.917 3.294   13.251  1.00 77.80  ? 1118 TRP A CD1 1 
ATOM 7702  C CD2 . TRP A 1 1051 ? 282.367 4.151   14.623  1.00 78.61  ? 1118 TRP A CD2 1 
ATOM 7703  N NE1 . TRP A 1 1051 ? 284.569 3.811   14.350  1.00 79.22  ? 1118 TRP A NE1 1 
ATOM 7704  C CE2 . TRP A 1 1051 ? 283.638 4.344   15.207  1.00 79.42  ? 1118 TRP A CE2 1 
ATOM 7705  C CE3 . TRP A 1 1051 ? 281.230 4.609   15.302  1.00 78.93  ? 1118 TRP A CE3 1 
ATOM 7706  C CZ2 . TRP A 1 1051 ? 283.802 4.979   16.443  1.00 80.31  ? 1118 TRP A CZ2 1 
ATOM 7707  C CZ3 . TRP A 1 1051 ? 281.394 5.236   16.518  1.00 79.38  ? 1118 TRP A CZ3 1 
ATOM 7708  C CH2 . TRP A 1 1051 ? 282.671 5.417   17.077  1.00 80.17  ? 1118 TRP A CH2 1 
ATOM 7709  N N   . LEU A 1 1052 ? 281.796 4.875   10.088  1.00 69.68  ? 1119 LEU A N   1 
ATOM 7710  C CA  . LEU A 1 1052 ? 282.564 5.639   9.143   1.00 70.24  ? 1119 LEU A CA  1 
ATOM 7711  C C   . LEU A 1 1052 ? 281.972 6.959   8.706   1.00 71.26  ? 1119 LEU A C   1 
ATOM 7712  O O   . LEU A 1 1052 ? 282.709 7.881   8.410   1.00 71.66  ? 1119 LEU A O   1 
ATOM 7713  C CB  . LEU A 1 1052 ? 282.901 4.766   7.951   1.00 69.82  ? 1119 LEU A CB  1 
ATOM 7714  C CG  . LEU A 1 1052 ? 283.583 3.481   8.421   1.00 71.54  ? 1119 LEU A CG  1 
ATOM 7715  C CD1 . LEU A 1 1052 ? 284.162 2.788   7.213   1.00 72.44  ? 1119 LEU A CD1 1 
ATOM 7716  C CD2 . LEU A 1 1052 ? 284.680 3.770   9.443   1.00 71.46  ? 1119 LEU A CD2 1 
ATOM 7717  N N   . PHE A 1 1053 ? 280.658 7.082   8.647   1.00 72.81  ? 1120 PHE A N   1 
ATOM 7718  C CA  . PHE A 1 1053 ? 280.111 8.374   8.272   1.00 75.33  ? 1120 PHE A CA  1 
ATOM 7719  C C   . PHE A 1 1053 ? 280.629 9.341   9.316   1.00 77.50  ? 1120 PHE A C   1 
ATOM 7720  O O   . PHE A 1 1053 ? 281.174 10.396  9.002   1.00 78.12  ? 1120 PHE A O   1 
ATOM 7721  C CB  . PHE A 1 1053 ? 278.590 8.345   8.297   1.00 75.96  ? 1120 PHE A CB  1 
ATOM 7722  C CG  . PHE A 1 1053 ? 277.970 8.024   6.969   1.00 76.33  ? 1120 PHE A CG  1 
ATOM 7723  C CD1 . PHE A 1 1053 ? 278.587 7.140   6.091   1.00 76.77  ? 1120 PHE A CD1 1 
ATOM 7724  C CD2 . PHE A 1 1053 ? 276.762 8.601   6.595   1.00 75.62  ? 1120 PHE A CD2 1 
ATOM 7725  C CE1 . PHE A 1 1053 ? 278.008 6.839   4.854   1.00 76.64  ? 1120 PHE A CE1 1 
ATOM 7726  C CE2 . PHE A 1 1053 ? 276.176 8.303   5.361   1.00 75.28  ? 1120 PHE A CE2 1 
ATOM 7727  C CZ  . PHE A 1 1053 ? 276.803 7.420   4.490   1.00 75.77  ? 1120 PHE A CZ  1 
ATOM 7728  N N   . GLU A 1 1054 ? 280.464 8.966   10.574  1.00 79.61  ? 1121 GLU A N   1 
ATOM 7729  C CA  . GLU A 1 1054 ? 280.954 9.795   11.651  1.00 81.41  ? 1121 GLU A CA  1 
ATOM 7730  C C   . GLU A 1 1054 ? 282.391 10.090  11.279  1.00 83.26  ? 1121 GLU A C   1 
ATOM 7731  O O   . GLU A 1 1054 ? 282.857 11.229  11.316  1.00 83.27  ? 1121 GLU A O   1 
ATOM 7732  C CB  . GLU A 1 1054 ? 280.946 9.021   12.958  1.00 80.76  ? 1121 GLU A CB  1 
ATOM 7733  C CG  . GLU A 1 1054 ? 279.665 8.271   13.255  1.00 80.31  ? 1121 GLU A CG  1 
ATOM 7734  C CD  . GLU A 1 1054 ? 279.688 7.647   14.642  1.00 80.87  ? 1121 GLU A CD  1 
ATOM 7735  O OE1 . GLU A 1 1054 ? 280.782 7.556   15.246  1.00 80.67  ? 1121 GLU A OE1 1 
ATOM 7736  O OE2 . GLU A 1 1054 ? 278.612 7.244   15.127  1.00 80.79  ? 1121 GLU A OE2 1 
ATOM 7737  N N   . GLU A 1 1055 ? 283.086 9.029   10.897  1.00 85.74  ? 1122 GLU A N   1 
ATOM 7738  C CA  . GLU A 1 1055 ? 284.481 9.141   10.521  1.00 88.15  ? 1122 GLU A CA  1 
ATOM 7739  C C   . GLU A 1 1055 ? 284.715 10.052  9.297   1.00 88.95  ? 1122 GLU A C   1 
ATOM 7740  O O   . GLU A 1 1055 ? 285.321 9.631   8.304   1.00 87.91  ? 1122 GLU A O   1 
ATOM 7741  C CB  . GLU A 1 1055 ? 285.082 7.745   10.260  1.00 89.07  ? 1122 GLU A CB  1 
ATOM 7742  C CG  . GLU A 1 1055 ? 284.636 6.612   11.204  1.00 90.95  ? 1122 GLU A CG  1 
ATOM 7743  C CD  . GLU A 1 1055 ? 285.042 6.813   12.649  1.00 92.88  ? 1122 GLU A CD  1 
ATOM 7744  O OE1 . GLU A 1 1055 ? 284.213 7.314   13.442  1.00 93.58  ? 1122 GLU A OE1 1 
ATOM 7745  O OE2 . GLU A 1 1055 ? 286.193 6.468   12.992  1.00 94.03  ? 1122 GLU A OE2 1 
ATOM 7746  N N   . PHE A 1 1056 ? 284.243 11.295  9.367   1.00 90.24  ? 1123 PHE A N   1 
ATOM 7747  C CA  . PHE A 1 1056 ? 284.478 12.264  8.297   1.00 91.97  ? 1123 PHE A CA  1 
ATOM 7748  C C   . PHE A 1 1056 ? 283.864 12.010  6.943   1.00 91.98  ? 1123 PHE A C   1 
ATOM 7749  O O   . PHE A 1 1056 ? 283.158 11.027  6.744   1.00 91.70  ? 1123 PHE A O   1 
ATOM 7750  C CB  . PHE A 1 1056 ? 285.976 12.434  8.094   1.00 95.34  ? 1123 PHE A CB  1 
ATOM 7751  C CG  . PHE A 1 1056 ? 286.732 12.439  9.367   1.00 98.80  ? 1123 PHE A CG  1 
ATOM 7752  C CD1 . PHE A 1 1056 ? 287.030 11.244  10.011  1.00 99.87  ? 1123 PHE A CD1 1 
ATOM 7753  C CD2 . PHE A 1 1056 ? 287.009 13.634  10.008  1.00 99.83  ? 1123 PHE A CD2 1 
ATOM 7754  C CE1 . PHE A 1 1056 ? 287.572 11.233  11.277  1.00 101.21 ? 1123 PHE A CE1 1 
ATOM 7755  C CE2 . PHE A 1 1056 ? 287.557 13.640  11.277  1.00 101.52 ? 1123 PHE A CE2 1 
ATOM 7756  C CZ  . PHE A 1 1056 ? 287.834 12.437  11.918  1.00 101.71 ? 1123 PHE A CZ  1 
ATOM 7757  N N   . ALA A 1 1057 ? 284.167 12.914  6.007   1.00 92.62  ? 1124 ALA A N   1 
ATOM 7758  C CA  . ALA A 1 1057 ? 283.656 12.834  4.649   1.00 93.02  ? 1124 ALA A CA  1 
ATOM 7759  C C   . ALA A 1 1057 ? 282.167 12.673  4.848   1.00 92.01  ? 1124 ALA A C   1 
ATOM 7760  O O   . ALA A 1 1057 ? 281.457 12.200  3.978   1.00 91.10  ? 1124 ALA A O   1 
ATOM 7761  C CB  . ALA A 1 1057 ? 284.238 11.614  3.958   1.00 94.21  ? 1124 ALA A CB  1 
ATOM 7762  N N   . ILE A 1 1058 ? 281.738 13.103  6.032   1.00 90.57  ? 1125 ILE A N   1 
ATOM 7763  C CA  . ILE A 1 1058 ? 280.377 13.028  6.575   1.00 89.95  ? 1125 ILE A CA  1 
ATOM 7764  C C   . ILE A 1 1058 ? 279.126 12.481  5.856   1.00 89.99  ? 1125 ILE A C   1 
ATOM 7765  O O   . ILE A 1 1058 ? 278.381 11.710  6.464   1.00 89.97  ? 1125 ILE A O   1 
ATOM 7766  C CB  . ILE A 1 1058 ? 280.013 14.367  7.251   1.00 90.17  ? 1125 ILE A CB  1 
ATOM 7767  C CG1 . ILE A 1 1058 ? 279.568 14.071  8.688   1.00 90.84  ? 1125 ILE A CG1 1 
ATOM 7768  C CG2 . ILE A 1 1058 ? 278.959 15.131  6.456   1.00 90.46  ? 1125 ILE A CG2 1 
ATOM 7769  C CD1 . ILE A 1 1058 ? 279.238 12.589  8.986   1.00 91.71  ? 1125 ILE A CD1 1 
ATOM 7770  N N   . ASP A 1 1059 ? 278.872 12.870  4.608   1.00 89.42  ? 1126 ASP A N   1 
ATOM 7771  C CA  . ASP A 1 1059 ? 277.716 12.365  3.841   1.00 86.92  ? 1126 ASP A CA  1 
ATOM 7772  C C   . ASP A 1 1059 ? 276.285 12.502  4.419   1.00 84.58  ? 1126 ASP A C   1 
ATOM 7773  O O   . ASP A 1 1059 ? 275.808 13.627  4.620   1.00 84.04  ? 1126 ASP A O   1 
ATOM 7774  C CB  . ASP A 1 1059 ? 277.927 10.890  3.457   1.00 87.34  ? 1126 ASP A CB  1 
ATOM 7775  C CG  . ASP A 1 1059 ? 279.387 10.479  3.442   1.00 87.68  ? 1126 ASP A CG  1 
ATOM 7776  O OD1 . ASP A 1 1059 ? 280.009 10.448  4.523   1.00 89.46  ? 1126 ASP A OD1 1 
ATOM 7777  O OD2 . ASP A 1 1059 ? 279.912 10.173  2.352   1.00 86.05  ? 1126 ASP A OD2 1 
ATOM 7778  N N   . GLY A 1 1060 ? 275.610 11.361  4.673   1.00 81.49  ? 1127 GLY A N   1 
ATOM 7779  C CA  . GLY A 1 1060 ? 274.227 11.406  5.153   1.00 77.69  ? 1127 GLY A CA  1 
ATOM 7780  C C   . GLY A 1 1060 ? 273.395 10.442  6.019   1.00 75.68  ? 1127 GLY A C   1 
ATOM 7781  O O   . GLY A 1 1060 ? 273.385 10.605  7.238   1.00 75.79  ? 1127 GLY A O   1 
ATOM 7782  N N   . ARG A 1 1061 ? 272.699 9.449   5.446   1.00 73.39  ? 1128 ARG A N   1 
ATOM 7783  C CA  . ARG A 1 1061 ? 271.797 8.650   6.293   1.00 70.83  ? 1128 ARG A CA  1 
ATOM 7784  C C   . ARG A 1 1061 ? 271.194 7.318   5.825   1.00 70.55  ? 1128 ARG A C   1 
ATOM 7785  O O   . ARG A 1 1061 ? 271.614 6.719   4.836   1.00 67.51  ? 1128 ARG A O   1 
ATOM 7786  C CB  . ARG A 1 1061 ? 270.632 9.578   6.662   1.00 68.11  ? 1128 ARG A CB  1 
ATOM 7787  C CG  . ARG A 1 1061 ? 269.550 9.039   7.579   1.00 64.13  ? 1128 ARG A CG  1 
ATOM 7788  C CD  . ARG A 1 1061 ? 269.612 9.741   8.913   1.00 61.87  ? 1128 ARG A CD  1 
ATOM 7789  N NE  . ARG A 1 1061 ? 269.567 11.194  8.753   1.00 60.71  ? 1128 ARG A NE  1 
ATOM 7790  C CZ  . ARG A 1 1061 ? 269.816 12.075  9.719   1.00 61.20  ? 1128 ARG A CZ  1 
ATOM 7791  N NH1 . ARG A 1 1061 ? 270.128 11.679  10.944  1.00 60.33  ? 1128 ARG A NH1 1 
ATOM 7792  N NH2 . ARG A 1 1061 ? 269.788 13.361  9.444   1.00 61.60  ? 1128 ARG A NH2 1 
ATOM 7793  N N   . PHE A 1 1062 ? 270.190 6.902   6.608   1.00 71.97  ? 1129 PHE A N   1 
ATOM 7794  C CA  . PHE A 1 1062 ? 269.329 5.724   6.450   1.00 73.75  ? 1129 PHE A CA  1 
ATOM 7795  C C   . PHE A 1 1062 ? 269.689 4.406   7.141   1.00 74.21  ? 1129 PHE A C   1 
ATOM 7796  O O   . PHE A 1 1062 ? 270.797 4.230   7.639   1.00 74.96  ? 1129 PHE A O   1 
ATOM 7797  C CB  . PHE A 1 1062 ? 269.036 5.464   4.964   1.00 75.52  ? 1129 PHE A CB  1 
ATOM 7798  C CG  . PHE A 1 1062 ? 267.781 4.669   4.735   1.00 79.65  ? 1129 PHE A CG  1 
ATOM 7799  C CD1 . PHE A 1 1062 ? 266.719 4.765   5.626   1.00 82.18  ? 1129 PHE A CD1 1 
ATOM 7800  C CD2 . PHE A 1 1062 ? 267.652 3.829   3.642   1.00 80.99  ? 1129 PHE A CD2 1 
ATOM 7801  C CE1 . PHE A 1 1062 ? 265.550 4.033   5.432   1.00 82.75  ? 1129 PHE A CE1 1 
ATOM 7802  C CE2 . PHE A 1 1062 ? 266.488 3.095   3.438   1.00 80.90  ? 1129 PHE A CE2 1 
ATOM 7803  C CZ  . PHE A 1 1062 ? 265.435 3.198   4.336   1.00 81.52  ? 1129 PHE A CZ  1 
ATOM 7804  N N   . CYS A 1 1063 ? 268.714 3.497   7.178   1.00 73.80  ? 1130 CYS A N   1 
ATOM 7805  C CA  . CYS A 1 1063 ? 268.860 2.178   7.782   1.00 72.57  ? 1130 CYS A CA  1 
ATOM 7806  C C   . CYS A 1 1063 ? 268.478 1.045   6.811   1.00 72.67  ? 1130 CYS A C   1 
ATOM 7807  O O   . CYS A 1 1063 ? 269.018 -0.053  6.907   1.00 72.20  ? 1130 CYS A O   1 
ATOM 7808  C CB  . CYS A 1 1063 ? 267.984 2.065   9.028   1.00 72.32  ? 1130 CYS A CB  1 
ATOM 7809  S SG  . CYS A 1 1063 ? 266.664 0.814   8.893   1.00 67.49  ? 1130 CYS A SG  1 
ATOM 7810  N N   . ILE A 1 1064 ? 267.560 1.312   5.880   1.00 72.45  ? 1131 ILE A N   1 
ATOM 7811  C CA  . ILE A 1 1064 ? 267.086 0.317   4.905   1.00 72.84  ? 1131 ILE A CA  1 
ATOM 7812  C C   . ILE A 1 1064 ? 266.983 -1.104  5.436   1.00 73.08  ? 1131 ILE A C   1 
ATOM 7813  O O   . ILE A 1 1064 ? 265.951 -1.471  5.969   1.00 72.77  ? 1131 ILE A O   1 
ATOM 7814  C CB  . ILE A 1 1064 ? 267.949 0.288   3.662   1.00 73.06  ? 1131 ILE A CB  1 
ATOM 7815  C CG1 . ILE A 1 1064 ? 267.534 -0.874  2.763   1.00 72.05  ? 1131 ILE A CG1 1 
ATOM 7816  C CG2 . ILE A 1 1064 ? 269.366 0.188   4.079   1.00 72.46  ? 1131 ILE A CG2 1 
ATOM 7817  C CD1 . ILE A 1 1064 ? 267.839 -0.654  1.323   1.00 91.71  ? 1131 ILE A CD1 1 
ATOM 7818  N N   . SER A 1 1065 ? 268.034 -1.907  5.289   1.00 74.09  ? 1132 SER A N   1 
ATOM 7819  C CA  . SER A 1 1065 ? 268.001 -3.287  5.761   1.00 75.22  ? 1132 SER A CA  1 
ATOM 7820  C C   . SER A 1 1065 ? 266.832 -3.951  5.082   1.00 76.08  ? 1132 SER A C   1 
ATOM 7821  O O   . SER A 1 1065 ? 266.102 -4.727  5.698   1.00 76.81  ? 1132 SER A O   1 
ATOM 7822  C CB  . SER A 1 1065 ? 267.783 -3.352  7.276   1.00 74.12  ? 1132 SER A CB  1 
ATOM 7823  O OG  . SER A 1 1065 ? 268.847 -2.755  7.986   1.00 74.48  ? 1132 SER A OG  1 
ATOM 7824  N N   . ILE A 1 1066 ? 266.639 -3.633  3.812   1.00 76.26  ? 1133 ILE A N   1 
ATOM 7825  C CA  . ILE A 1 1066 ? 265.527 -4.209  3.086   1.00 75.96  ? 1133 ILE A CA  1 
ATOM 7826  C C   . ILE A 1 1066 ? 265.993 -5.414  2.290   1.00 75.62  ? 1133 ILE A C   1 
ATOM 7827  O O   . ILE A 1 1066 ? 266.909 -5.298  1.487   1.00 75.83  ? 1133 ILE A O   1 
ATOM 7828  C CB  . ILE A 1 1066 ? 264.880 -3.152  2.169   1.00 76.14  ? 1133 ILE A CB  1 
ATOM 7829  C CG1 . ILE A 1 1066 ? 263.646 -3.723  1.487   1.00 76.08  ? 1133 ILE A CG1 1 
ATOM 7830  C CG2 . ILE A 1 1066 ? 265.832 -2.728  1.115   1.00 75.87  ? 1133 ILE A CG2 1 
ATOM 7831  C CD1 . ILE A 1 1066 ? 263.942 -4.683  0.361   1.00 91.71  ? 1133 ILE A CD1 1 
ATOM 7832  N N   . HIS A 1 1067 ? 265.364 -6.568  2.530   1.00 75.33  ? 1134 HIS A N   1 
ATOM 7833  C CA  . HIS A 1 1067 ? 265.714 -7.822  1.849   1.00 72.53  ? 1134 HIS A CA  1 
ATOM 7834  C C   . HIS A 1 1067 ? 267.229 -8.065  1.916   1.00 69.15  ? 1134 HIS A C   1 
ATOM 7835  O O   . HIS A 1 1067 ? 267.791 -8.385  2.968   1.00 68.87  ? 1134 HIS A O   1 
ATOM 7836  C CB  . HIS A 1 1067 ? 265.259 -7.774  0.377   1.00 73.87  ? 1134 HIS A CB  1 
ATOM 7837  C CG  . HIS A 1 1067 ? 263.870 -8.292  0.138   1.00 74.93  ? 1134 HIS A CG  1 
ATOM 7838  N ND1 . HIS A 1 1067 ? 262.852 -7.511  -0.374  1.00 74.78  ? 1134 HIS A ND1 1 
ATOM 7839  C CD2 . HIS A 1 1067 ? 263.340 -9.526  0.315   1.00 75.12  ? 1134 HIS A CD2 1 
ATOM 7840  C CE1 . HIS A 1 1067 ? 261.758 -8.242  -0.500  1.00 75.25  ? 1134 HIS A CE1 1 
ATOM 7841  N NE2 . HIS A 1 1067 ? 262.026 -9.469  -0.089  1.00 75.74  ? 1134 HIS A NE2 1 
ATOM 7842  N N   . ASP A 1 1068 ? 267.880 -7.925  0.770   1.00 64.76  ? 1135 ASP A N   1 
ATOM 7843  C CA  . ASP A 1 1068 ? 269.322 -8.077  0.670   1.00 61.67  ? 1135 ASP A CA  1 
ATOM 7844  C C   . ASP A 1 1068 ? 269.834 -6.683  0.265   1.00 59.96  ? 1135 ASP A C   1 
ATOM 7845  O O   . ASP A 1 1068 ? 270.978 -6.504  -0.118  1.00 60.92  ? 1135 ASP A O   1 
ATOM 7846  C CB  . ASP A 1 1068 ? 269.664 -9.155  -0.383  1.00 59.99  ? 1135 ASP A CB  1 
ATOM 7847  C CG  . ASP A 1 1068 ? 269.593 -10.602 0.180   1.00 57.82  ? 1135 ASP A CG  1 
ATOM 7848  O OD1 . ASP A 1 1068 ? 268.673 -10.925 0.972   1.00 54.92  ? 1135 ASP A OD1 1 
ATOM 7849  O OD2 . ASP A 1 1068 ? 270.462 -11.425 -0.192  1.00 55.80  ? 1135 ASP A OD2 1 
ATOM 7850  N N   . GLU A 1 1069 ? 268.952 -5.694  0.363   1.00 58.10  ? 1136 GLU A N   1 
ATOM 7851  C CA  . GLU A 1 1069 ? 269.286 -4.319  0.026   1.00 56.09  ? 1136 GLU A CA  1 
ATOM 7852  C C   . GLU A 1 1069 ? 269.411 -3.516  1.301   1.00 55.43  ? 1136 GLU A C   1 
ATOM 7853  O O   . GLU A 1 1069 ? 268.687 -3.726  2.285   1.00 54.22  ? 1136 GLU A O   1 
ATOM 7854  C CB  . GLU A 1 1069 ? 268.211 -3.646  -0.845  1.00 55.17  ? 1136 GLU A CB  1 
ATOM 7855  C CG  . GLU A 1 1069 ? 267.760 -4.420  -2.063  1.00 52.88  ? 1136 GLU A CG  1 
ATOM 7856  C CD  . GLU A 1 1069 ? 266.740 -5.510  -1.724  1.00 50.72  ? 1136 GLU A CD  1 
ATOM 7857  O OE1 . GLU A 1 1069 ? 265.546 -5.350  -2.086  1.00 51.25  ? 1136 GLU A OE1 1 
ATOM 7858  O OE2 . GLU A 1 1069 ? 267.131 -6.522  -1.092  1.00 47.55  ? 1136 GLU A OE2 1 
ATOM 7859  N N   . VAL A 1 1070 ? 270.338 -2.570  1.252   1.00 55.93  ? 1137 VAL A N   1 
ATOM 7860  C CA  . VAL A 1 1070 ? 270.623 -1.691  2.366   1.00 56.05  ? 1137 VAL A CA  1 
ATOM 7861  C C   . VAL A 1 1070 ? 271.091 -0.331  1.790   1.00 54.26  ? 1137 VAL A C   1 
ATOM 7862  O O   . VAL A 1 1070 ? 272.263 -0.151  1.452   1.00 52.36  ? 1137 VAL A O   1 
ATOM 7863  C CB  . VAL A 1 1070 ? 271.688 -2.342  3.281   1.00 57.77  ? 1137 VAL A CB  1 
ATOM 7864  C CG1 . VAL A 1 1070 ? 271.789 -1.600  4.580   1.00 59.20  ? 1137 VAL A CG1 1 
ATOM 7865  C CG2 . VAL A 1 1070 ? 271.319 -3.808  3.547   1.00 59.16  ? 1137 VAL A CG2 1 
ATOM 7866  N N   . ARG A 1 1071 ? 270.141 0.604   1.667   1.00 54.13  ? 1138 ARG A N   1 
ATOM 7867  C CA  . ARG A 1 1071 ? 270.361 1.946   1.132   1.00 54.19  ? 1138 ARG A CA  1 
ATOM 7868  C C   . ARG A 1 1071 ? 270.586 3.035   2.153   1.00 54.95  ? 1138 ARG A C   1 
ATOM 7869  O O   . ARG A 1 1071 ? 269.967 3.064   3.201   1.00 53.76  ? 1138 ARG A O   1 
ATOM 7870  C CB  . ARG A 1 1071 ? 269.182 2.355   0.267   1.00 52.57  ? 1138 ARG A CB  1 
ATOM 7871  C CG  . ARG A 1 1071 ? 269.355 2.006   -1.174  1.00 52.71  ? 1138 ARG A CG  1 
ATOM 7872  C CD  . ARG A 1 1071 ? 269.823 0.574   -1.341  1.00 53.70  ? 1138 ARG A CD  1 
ATOM 7873  N NE  . ARG A 1 1071 ? 270.121 0.281   -2.738  1.00 52.82  ? 1138 ARG A NE  1 
ATOM 7874  C CZ  . ARG A 1 1071 ? 269.351 -0.443  -3.542  1.00 52.56  ? 1138 ARG A CZ  1 
ATOM 7875  N NH1 . ARG A 1 1071 ? 268.211 -0.972  -3.097  1.00 53.18  ? 1138 ARG A NH1 1 
ATOM 7876  N NH2 . ARG A 1 1071 ? 269.729 -0.635  -4.800  1.00 51.86  ? 1138 ARG A NH2 1 
ATOM 7877  N N   . TYR A 1 1072 ? 271.465 3.961   1.807   1.00 58.09  ? 1139 TYR A N   1 
ATOM 7878  C CA  . TYR A 1 1072 ? 271.791 5.069   2.681   1.00 60.96  ? 1139 TYR A CA  1 
ATOM 7879  C C   . TYR A 1 1072 ? 271.712 6.349   1.900   1.00 60.71  ? 1139 TYR A C   1 
ATOM 7880  O O   . TYR A 1 1072 ? 271.969 6.367   0.707   1.00 59.00  ? 1139 TYR A O   1 
ATOM 7881  C CB  . TYR A 1 1072 ? 273.198 4.908   3.222   1.00 63.21  ? 1139 TYR A CB  1 
ATOM 7882  C CG  . TYR A 1 1072 ? 273.441 3.546   3.799   1.00 65.75  ? 1139 TYR A CG  1 
ATOM 7883  C CD1 . TYR A 1 1072 ? 273.740 2.458   2.980   1.00 65.87  ? 1139 TYR A CD1 1 
ATOM 7884  C CD2 . TYR A 1 1072 ? 273.334 3.333   5.160   1.00 66.81  ? 1139 TYR A CD2 1 
ATOM 7885  C CE1 . TYR A 1 1072 ? 273.928 1.182   3.514   1.00 67.43  ? 1139 TYR A CE1 1 
ATOM 7886  C CE2 . TYR A 1 1072 ? 273.514 2.069   5.705   1.00 68.43  ? 1139 TYR A CE2 1 
ATOM 7887  C CZ  . TYR A 1 1072 ? 273.811 0.996   4.881   1.00 68.66  ? 1139 TYR A CZ  1 
ATOM 7888  O OH  . TYR A 1 1072 ? 273.988 -0.257  5.429   1.00 71.03  ? 1139 TYR A OH  1 
ATOM 7889  N N   . LEU A 1 1073 ? 271.367 7.434   2.562   1.00 60.61  ? 1140 LEU A N   1 
ATOM 7890  C CA  . LEU A 1 1073 ? 271.284 8.681   1.847   1.00 61.71  ? 1140 LEU A CA  1 
ATOM 7891  C C   . LEU A 1 1073 ? 272.572 9.480   2.017   1.00 62.43  ? 1140 LEU A C   1 
ATOM 7892  O O   . LEU A 1 1073 ? 273.232 9.367   3.046   1.00 61.91  ? 1140 LEU A O   1 
ATOM 7893  C CB  . LEU A 1 1073 ? 270.097 9.479   2.348   1.00 62.75  ? 1140 LEU A CB  1 
ATOM 7894  C CG  . LEU A 1 1073 ? 269.421 10.330  1.275   1.00 62.46  ? 1140 LEU A CG  1 
ATOM 7895  C CD1 . LEU A 1 1073 ? 268.451 11.230  1.961   1.00 62.54  ? 1140 LEU A CD1 1 
ATOM 7896  C CD2 . LEU A 1 1073 ? 270.406 11.169  0.491   1.00 63.88  ? 1140 LEU A CD2 1 
ATOM 7897  N N   . VAL A 1 1074 ? 272.913 10.280  1.000   1.00 64.00  ? 1141 VAL A N   1 
ATOM 7898  C CA  . VAL A 1 1074 ? 274.123 11.119  0.977   1.00 65.47  ? 1141 VAL A CA  1 
ATOM 7899  C C   . VAL A 1 1074 ? 273.902 12.446  0.226   1.00 67.27  ? 1141 VAL A C   1 
ATOM 7900  O O   . VAL A 1 1074 ? 273.011 12.545  -0.608  1.00 65.82  ? 1141 VAL A O   1 
ATOM 7901  C CB  . VAL A 1 1074 ? 275.301 10.382  0.246   1.00 64.99  ? 1141 VAL A CB  1 
ATOM 7902  C CG1 . VAL A 1 1074 ? 276.576 11.211  0.314   1.00 64.37  ? 1141 VAL A CG1 1 
ATOM 7903  C CG2 . VAL A 1 1074 ? 275.531 9.001   0.845   1.00 66.38  ? 1141 VAL A CG2 1 
ATOM 7904  N N   . ARG A 1 1075 ? 274.702 13.463  0.535   1.00 70.20  ? 1142 ARG A N   1 
ATOM 7905  C CA  . ARG A 1 1075 ? 274.635 14.723  -0.193  1.00 73.43  ? 1142 ARG A CA  1 
ATOM 7906  C C   . ARG A 1 1075 ? 275.206 14.201  -1.530  1.00 75.80  ? 1142 ARG A C   1 
ATOM 7907  O O   . ARG A 1 1075 ? 275.712 13.083  -1.560  1.00 77.41  ? 1142 ARG A O   1 
ATOM 7908  C CB  . ARG A 1 1075 ? 275.578 15.737  0.459   1.00 73.64  ? 1142 ARG A CB  1 
ATOM 7909  C CG  . ARG A 1 1075 ? 275.724 15.547  1.966   1.00 75.27  ? 1142 ARG A CG  1 
ATOM 7910  C CD  . ARG A 1 1075 ? 275.129 16.696  2.746   1.00 77.56  ? 1142 ARG A CD  1 
ATOM 7911  N NE  . ARG A 1 1075 ? 274.933 16.386  4.166   1.00 77.85  ? 1142 ARG A NE  1 
ATOM 7912  C CZ  . ARG A 1 1075 ? 274.162 17.102  4.983   1.00 77.42  ? 1142 ARG A CZ  1 
ATOM 7913  N NH1 . ARG A 1 1075 ? 273.520 18.168  4.519   1.00 77.59  ? 1142 ARG A NH1 1 
ATOM 7914  N NH2 . ARG A 1 1075 ? 274.013 16.753  6.258   1.00 76.34  ? 1142 ARG A NH2 1 
ATOM 7915  N N   . GLU A 1 1076 ? 275.138 14.949  -2.630  1.00 77.42  ? 1143 GLU A N   1 
ATOM 7916  C CA  . GLU A 1 1076 ? 275.676 14.415  -3.899  1.00 78.51  ? 1143 GLU A CA  1 
ATOM 7917  C C   . GLU A 1 1076 ? 277.160 14.124  -3.837  1.00 78.59  ? 1143 GLU A C   1 
ATOM 7918  O O   . GLU A 1 1076 ? 277.626 13.052  -4.213  1.00 78.03  ? 1143 GLU A O   1 
ATOM 7919  C CB  . GLU A 1 1076 ? 275.415 15.366  -5.065  1.00 79.19  ? 1143 GLU A CB  1 
ATOM 7920  C CG  . GLU A 1 1076 ? 273.979 15.343  -5.552  1.00 81.66  ? 1143 GLU A CG  1 
ATOM 7921  C CD  . GLU A 1 1076 ? 273.247 16.615  -5.224  1.00 84.20  ? 1143 GLU A CD  1 
ATOM 7922  O OE1 . GLU A 1 1076 ? 273.788 17.385  -4.401  1.00 85.45  ? 1143 GLU A OE1 1 
ATOM 7923  O OE2 . GLU A 1 1076 ? 272.140 16.837  -5.777  1.00 85.35  ? 1143 GLU A OE2 1 
ATOM 7924  N N   . GLU A 1 1077 ? 277.898 15.126  -3.398  1.00 78.64  ? 1144 GLU A N   1 
ATOM 7925  C CA  . GLU A 1 1077 ? 279.331 15.029  -3.205  1.00 78.62  ? 1144 GLU A CA  1 
ATOM 7926  C C   . GLU A 1 1077 ? 279.430 13.927  -2.146  1.00 78.67  ? 1144 GLU A C   1 
ATOM 7927  O O   . GLU A 1 1077 ? 278.404 13.464  -1.651  1.00 77.88  ? 1144 GLU A O   1 
ATOM 7928  C CB  . GLU A 1 1077 ? 279.790 16.368  -2.657  1.00 79.23  ? 1144 GLU A CB  1 
ATOM 7929  C CG  . GLU A 1 1077 ? 278.670 16.971  -1.811  1.00 80.49  ? 1144 GLU A CG  1 
ATOM 7930  C CD  . GLU A 1 1077 ? 278.728 18.474  -1.671  1.00 81.69  ? 1144 GLU A CD  1 
ATOM 7931  O OE1 . GLU A 1 1077 ? 279.589 18.971  -0.921  1.00 82.62  ? 1144 GLU A OE1 1 
ATOM 7932  O OE2 . GLU A 1 1077 ? 277.904 19.166  -2.308  1.00 82.36  ? 1144 GLU A OE2 1 
ATOM 7933  N N   . ASP A 1 1078 ? 280.632 13.503  -1.779  1.00 80.06  ? 1145 ASP A N   1 
ATOM 7934  C CA  . ASP A 1 1078 ? 280.752 12.453  -0.773  1.00 81.51  ? 1145 ASP A CA  1 
ATOM 7935  C C   . ASP A 1 1078 ? 279.702 11.370  -0.913  1.00 82.17  ? 1145 ASP A C   1 
ATOM 7936  O O   . ASP A 1 1078 ? 279.333 10.719  0.052   1.00 81.99  ? 1145 ASP A O   1 
ATOM 7937  C CB  . ASP A 1 1078 ? 280.666 13.030  0.641   1.00 80.35  ? 1145 ASP A CB  1 
ATOM 7938  C CG  . ASP A 1 1078 ? 279.754 14.223  0.740   1.00 79.22  ? 1145 ASP A CG  1 
ATOM 7939  O OD1 . ASP A 1 1078 ? 280.039 15.234  0.072   1.00 79.10  ? 1145 ASP A OD1 1 
ATOM 7940  O OD2 . ASP A 1 1078 ? 278.762 14.159  1.492   1.00 78.38  ? 1145 ASP A OD2 1 
ATOM 7941  N N   . ARG A 1 1079 ? 279.196 11.197  -2.117  1.00 82.60  ? 1146 ARG A N   1 
ATOM 7942  C CA  . ARG A 1 1079 ? 278.216 10.165  -2.365  1.00 83.21  ? 1146 ARG A CA  1 
ATOM 7943  C C   . ARG A 1 1079 ? 279.099 9.075   -2.946  1.00 83.48  ? 1146 ARG A C   1 
ATOM 7944  O O   . ARG A 1 1079 ? 278.814 7.875   -2.859  1.00 83.48  ? 1146 ARG A O   1 
ATOM 7945  C CB  . ARG A 1 1079 ? 277.220 10.652  -3.394  1.00 84.09  ? 1146 ARG A CB  1 
ATOM 7946  C CG  . ARG A 1 1079 ? 276.098 9.717   -3.640  1.00 85.16  ? 1146 ARG A CG  1 
ATOM 7947  C CD  . ARG A 1 1079 ? 274.938 9.983   -2.729  1.00 85.97  ? 1146 ARG A CD  1 
ATOM 7948  N NE  . ARG A 1 1079 ? 273.743 9.560   -3.434  1.00 85.63  ? 1146 ARG A NE  1 
ATOM 7949  C CZ  . ARG A 1 1079 ? 273.519 8.320   -3.854  1.00 85.83  ? 1146 ARG A CZ  1 
ATOM 7950  N NH1 . ARG A 1 1079 ? 274.401 7.374   -3.612  1.00 85.61  ? 1146 ARG A NH1 1 
ATOM 7951  N NH2 . ARG A 1 1079 ? 272.450 8.032   -4.591  1.00 85.94  ? 1146 ARG A NH2 1 
ATOM 7952  N N   . TYR A 1 1080 ? 280.190 9.539   -3.545  1.00 84.85  ? 1147 TYR A N   1 
ATOM 7953  C CA  . TYR A 1 1080 ? 281.196 8.682   -4.132  1.00 86.73  ? 1147 TYR A CA  1 
ATOM 7954  C C   . TYR A 1 1080 ? 281.934 8.195   -2.909  1.00 88.12  ? 1147 TYR A C   1 
ATOM 7955  O O   . TYR A 1 1080 ? 282.283 7.023   -2.797  1.00 88.14  ? 1147 TYR A O   1 
ATOM 7956  C CB  . TYR A 1 1080 ? 282.134 9.506   -5.005  1.00 85.70  ? 1147 TYR A CB  1 
ATOM 7957  C CG  . TYR A 1 1080 ? 281.477 10.131  -6.216  1.00 85.53  ? 1147 TYR A CG  1 
ATOM 7958  C CD1 . TYR A 1 1080 ? 281.941 9.841   -7.499  1.00 85.75  ? 1147 TYR A CD1 1 
ATOM 7959  C CD2 . TYR A 1 1080 ? 280.392 11.011  -6.088  1.00 85.28  ? 1147 TYR A CD2 1 
ATOM 7960  C CE1 . TYR A 1 1080 ? 281.343 10.408  -8.640  1.00 84.75  ? 1147 TYR A CE1 1 
ATOM 7961  C CE2 . TYR A 1 1080 ? 279.780 11.588  -7.227  1.00 84.71  ? 1147 TYR A CE2 1 
ATOM 7962  C CZ  . TYR A 1 1080 ? 280.262 11.279  -8.506  1.00 83.94  ? 1147 TYR A CZ  1 
ATOM 7963  O OH  . TYR A 1 1080 ? 279.670 11.810  -9.650  1.00 81.81  ? 1147 TYR A OH  1 
ATOM 7964  N N   . ARG A 1 1081 ? 282.142 9.128   -1.985  1.00 89.06  ? 1148 ARG A N   1 
ATOM 7965  C CA  . ARG A 1 1081 ? 282.824 8.860   -0.729  1.00 89.59  ? 1148 ARG A CA  1 
ATOM 7966  C C   . ARG A 1 1081 ? 282.213 7.643   -0.032  1.00 89.58  ? 1148 ARG A C   1 
ATOM 7967  O O   . ARG A 1 1081 ? 282.903 6.675   0.269   1.00 89.96  ? 1148 ARG A O   1 
ATOM 7968  C CB  . ARG A 1 1081 ? 282.728 10.084  0.196   1.00 89.60  ? 1148 ARG A CB  1 
ATOM 7969  C CG  . ARG A 1 1081 ? 284.056 10.777  0.502   1.00 88.85  ? 1148 ARG A CG  1 
ATOM 7970  C CD  . ARG A 1 1081 ? 284.419 11.865  -0.510  1.00 88.47  ? 1148 ARG A CD  1 
ATOM 7971  N NE  . ARG A 1 1081 ? 283.944 13.222  -0.195  1.00 87.64  ? 1148 ARG A NE  1 
ATOM 7972  C CZ  . ARG A 1 1081 ? 283.355 13.613  0.936   1.00 86.45  ? 1148 ARG A CZ  1 
ATOM 7973  N NH1 . ARG A 1 1081 ? 283.127 12.767  1.922   1.00 85.65  ? 1148 ARG A NH1 1 
ATOM 7974  N NH2 . ARG A 1 1081 ? 282.979 14.877  1.084   1.00 85.69  ? 1148 ARG A NH2 1 
ATOM 7975  N N   . ALA A 1 1082 ? 280.912 7.692   0.221   1.00 89.07  ? 1149 ALA A N   1 
ATOM 7976  C CA  . ALA A 1 1082 ? 280.228 6.586   0.884   1.00 87.93  ? 1149 ALA A CA  1 
ATOM 7977  C C   . ALA A 1 1082 ? 280.459 5.282   0.148   1.00 86.29  ? 1149 ALA A C   1 
ATOM 7978  O O   . ALA A 1 1082 ? 280.605 4.232   0.768   1.00 85.71  ? 1149 ALA A O   1 
ATOM 7979  C CB  . ALA A 1 1082 ? 278.733 6.870   0.973   1.00 89.14  ? 1149 ALA A CB  1 
ATOM 7980  N N   . ALA A 1 1083 ? 280.482 5.357   -1.179  1.00 84.86  ? 1150 ALA A N   1 
ATOM 7981  C CA  . ALA A 1 1083 ? 280.693 4.181   -2.004  1.00 84.71  ? 1150 ALA A CA  1 
ATOM 7982  C C   . ALA A 1 1083 ? 281.747 3.288   -1.363  1.00 84.79  ? 1150 ALA A C   1 
ATOM 7983  O O   . ALA A 1 1083 ? 281.514 2.103   -1.116  1.00 85.71  ? 1150 ALA A O   1 
ATOM 7984  C CB  . ALA A 1 1083 ? 281.128 4.594   -3.390  1.00 84.35  ? 1150 ALA A CB  1 
ATOM 7985  N N   . LEU A 1 1084 ? 282.911 3.856   -1.088  1.00 83.34  ? 1151 LEU A N   1 
ATOM 7986  C CA  . LEU A 1 1084 ? 283.966 3.075   -0.458  1.00 81.09  ? 1151 LEU A CA  1 
ATOM 7987  C C   . LEU A 1 1084 ? 283.422 2.481   0.815   1.00 79.01  ? 1151 LEU A C   1 
ATOM 7988  O O   . LEU A 1 1084 ? 283.535 1.279   1.056   1.00 78.99  ? 1151 LEU A O   1 
ATOM 7989  C CB  . LEU A 1 1084 ? 285.176 3.945   -0.111  1.00 80.99  ? 1151 LEU A CB  1 
ATOM 7990  C CG  . LEU A 1 1084 ? 286.237 4.102   -1.194  1.00 81.19  ? 1151 LEU A CG  1 
ATOM 7991  C CD1 . LEU A 1 1084 ? 287.398 4.921   -0.640  1.00 81.32  ? 1151 LEU A CD1 1 
ATOM 7992  C CD2 . LEU A 1 1084 ? 286.693 2.716   -1.665  1.00 79.26  ? 1151 LEU A CD2 1 
ATOM 7993  N N   . ALA A 1 1085 ? 282.825 3.346   1.625   1.00 76.54  ? 1152 ALA A N   1 
ATOM 7994  C CA  . ALA A 1 1085 ? 282.271 2.931   2.893   1.00 74.59  ? 1152 ALA A CA  1 
ATOM 7995  C C   . ALA A 1 1085 ? 281.591 1.600   2.692   1.00 73.52  ? 1152 ALA A C   1 
ATOM 7996  O O   . ALA A 1 1085 ? 282.083 0.567   3.145   1.00 73.30  ? 1152 ALA A O   1 
ATOM 7997  C CB  . ALA A 1 1085 ? 281.287 3.965   3.398   1.00 73.18  ? 1152 ALA A CB  1 
ATOM 7998  N N   . LEU A 1 1086 ? 280.472 1.621   1.984   1.00 72.66  ? 1153 LEU A N   1 
ATOM 7999  C CA  . LEU A 1 1086 ? 279.735 0.397   1.739   1.00 70.18  ? 1153 LEU A CA  1 
ATOM 8000  C C   . LEU A 1 1086 ? 280.710 -0.693  1.302   1.00 67.95  ? 1153 LEU A C   1 
ATOM 8001  O O   . LEU A 1 1086 ? 280.855 -1.718  1.970   1.00 66.96  ? 1153 LEU A O   1 
ATOM 8002  C CB  . LEU A 1 1086 ? 278.675 0.630   0.656   1.00 71.57  ? 1153 LEU A CB  1 
ATOM 8003  C CG  . LEU A 1 1086 ? 277.547 -0.383  0.392   1.00 73.80  ? 1153 LEU A CG  1 
ATOM 8004  C CD1 . LEU A 1 1086 ? 277.999 -1.771  0.752   1.00 74.84  ? 1153 LEU A CD1 1 
ATOM 8005  C CD2 . LEU A 1 1086 ? 276.311 -0.027  1.180   1.00 74.27  ? 1153 LEU A CD2 1 
ATOM 8006  N N   . GLN A 1 1087 ? 281.392 -0.461  0.189   1.00 66.09  ? 1154 GLN A N   1 
ATOM 8007  C CA  . GLN A 1 1087 ? 282.314 -1.448  -0.312  1.00 65.01  ? 1154 GLN A CA  1 
ATOM 8008  C C   . GLN A 1 1087 ? 283.047 -2.089  0.826   1.00 64.67  ? 1154 GLN A C   1 
ATOM 8009  O O   . GLN A 1 1087 ? 282.840 -3.258  1.155   1.00 64.90  ? 1154 GLN A O   1 
ATOM 8010  C CB  . GLN A 1 1087 ? 283.333 -0.808  -1.220  1.00 64.14  ? 1154 GLN A CB  1 
ATOM 8011  C CG  . GLN A 1 1087 ? 283.416 -1.470  -2.549  1.00 64.20  ? 1154 GLN A CG  1 
ATOM 8012  C CD  . GLN A 1 1087 ? 282.422 -0.879  -3.489  1.00 65.57  ? 1154 GLN A CD  1 
ATOM 8013  O OE1 . GLN A 1 1087 ? 282.110 0.301   -3.377  1.00 66.13  ? 1154 GLN A OE1 1 
ATOM 8014  N NE2 . GLN A 1 1087 ? 281.925 -1.676  -4.437  1.00 65.83  ? 1154 GLN A NE2 1 
ATOM 8015  N N   . ILE A 1 1088 ? 283.906 -1.293  1.435   1.00 63.66  ? 1155 ILE A N   1 
ATOM 8016  C CA  . ILE A 1 1088 ? 284.724 -1.754  2.532   1.00 61.86  ? 1155 ILE A CA  1 
ATOM 8017  C C   . ILE A 1 1088 ? 283.916 -2.419  3.633   1.00 60.60  ? 1155 ILE A C   1 
ATOM 8018  O O   . ILE A 1 1088 ? 284.243 -3.517  4.103   1.00 60.67  ? 1155 ILE A O   1 
ATOM 8019  C CB  . ILE A 1 1088 ? 285.530 -0.582  3.102   1.00 61.95  ? 1155 ILE A CB  1 
ATOM 8020  C CG1 . ILE A 1 1088 ? 286.275 0.115   1.959   1.00 62.00  ? 1155 ILE A CG1 1 
ATOM 8021  C CG2 . ILE A 1 1088 ? 286.512 -1.080  4.162   1.00 61.68  ? 1155 ILE A CG2 1 
ATOM 8022  C CD1 . ILE A 1 1088 ? 287.180 -0.800  1.152   1.00 91.71  ? 1155 ILE A CD1 1 
ATOM 8023  N N   . THR A 1 1089 ? 282.850 -1.753  4.035   1.00 58.14  ? 1156 THR A N   1 
ATOM 8024  C CA  . THR A 1 1089 ? 282.013 -2.279  5.081   1.00 54.88  ? 1156 THR A CA  1 
ATOM 8025  C C   . THR A 1 1089 ? 281.657 -3.737  4.839   1.00 52.12  ? 1156 THR A C   1 
ATOM 8026  O O   . THR A 1 1089 ? 281.564 -4.517  5.781   1.00 51.18  ? 1156 THR A O   1 
ATOM 8027  C CB  . THR A 1 1089 ? 280.750 -1.432  5.218   1.00 55.73  ? 1156 THR A CB  1 
ATOM 8028  O OG1 . THR A 1 1089 ? 280.967 -0.428  6.212   1.00 56.45  ? 1156 THR A OG1 1 
ATOM 8029  C CG2 . THR A 1 1089 ? 279.579 -2.267  5.608   1.00 54.68  ? 1156 THR A CG2 1 
ATOM 8030  N N   . ASN A 1 1090 ? 281.480 -4.120  3.583   1.00 48.86  ? 1157 ASN A N   1 
ATOM 8031  C CA  . ASN A 1 1090 ? 281.114 -5.492  3.297   1.00 45.38  ? 1157 ASN A CA  1 
ATOM 8032  C C   . ASN A 1 1090 ? 282.261 -6.415  3.390   1.00 45.30  ? 1157 ASN A C   1 
ATOM 8033  O O   . ASN A 1 1090 ? 282.127 -7.540  3.868   1.00 45.15  ? 1157 ASN A O   1 
ATOM 8034  C CB  . ASN A 1 1090 ? 280.502 -5.584  1.933   1.00 44.31  ? 1157 ASN A CB  1 
ATOM 8035  C CG  . ASN A 1 1090 ? 279.151 -4.940  1.896   1.00 43.05  ? 1157 ASN A CG  1 
ATOM 8036  O OD1 . ASN A 1 1090 ? 278.134 -5.580  1.584   1.00 43.57  ? 1157 ASN A OD1 1 
ATOM 8037  N ND2 . ASN A 1 1090 ? 279.116 -3.658  2.241   1.00 44.58  ? 1157 ASN A ND2 1 
ATOM 8038  N N   . LEU A 1 1091 ? 283.395 -5.926  2.921   1.00 45.76  ? 1158 LEU A N   1 
ATOM 8039  C CA  . LEU A 1 1091 ? 284.618 -6.692  2.958   1.00 45.39  ? 1158 LEU A CA  1 
ATOM 8040  C C   . LEU A 1 1091 ? 284.757 -7.114  4.400   1.00 45.03  ? 1158 LEU A C   1 
ATOM 8041  O O   . LEU A 1 1091 ? 284.838 -8.304  4.722   1.00 44.71  ? 1158 LEU A O   1 
ATOM 8042  C CB  . LEU A 1 1091 ? 285.758 -5.794  2.517   1.00 44.35  ? 1158 LEU A CB  1 
ATOM 8043  C CG  . LEU A 1 1091 ? 285.131 -5.001  1.365   1.00 44.87  ? 1158 LEU A CG  1 
ATOM 8044  C CD1 . LEU A 1 1091 ? 286.108 -4.031  0.745   1.00 44.33  ? 1158 LEU A CD1 1 
ATOM 8045  C CD2 . LEU A 1 1091 ? 284.639 -5.959  0.343   1.00 43.91  ? 1158 LEU A CD2 1 
ATOM 8046  N N   . LEU A 1 1092 ? 284.725 -6.121  5.272   1.00 44.69  ? 1159 LEU A N   1 
ATOM 8047  C CA  . LEU A 1 1092 ? 284.815 -6.368  6.700   1.00 45.95  ? 1159 LEU A CA  1 
ATOM 8048  C C   . LEU A 1 1092 ? 283.784 -7.412  7.158   1.00 47.10  ? 1159 LEU A C   1 
ATOM 8049  O O   . LEU A 1 1092 ? 284.146 -8.460  7.693   1.00 47.13  ? 1159 LEU A O   1 
ATOM 8050  C CB  . LEU A 1 1092 ? 284.572 -5.065  7.444   1.00 44.70  ? 1159 LEU A CB  1 
ATOM 8051  C CG  . LEU A 1 1092 ? 285.291 -3.865  6.846   1.00 41.94  ? 1159 LEU A CG  1 
ATOM 8052  C CD1 . LEU A 1 1092 ? 284.891 -2.643  7.635   1.00 39.31  ? 1159 LEU A CD1 1 
ATOM 8053  C CD2 . LEU A 1 1092 ? 286.793 -4.062  6.888   1.00 42.14  ? 1159 LEU A CD2 1 
ATOM 8054  N N   . THR A 1 1093 ? 282.504 -7.107  6.953   1.00 48.75  ? 1160 THR A N   1 
ATOM 8055  C CA  . THR A 1 1093 ? 281.428 -7.998  7.344   1.00 49.23  ? 1160 THR A CA  1 
ATOM 8056  C C   . THR A 1 1093 ? 281.826 -9.374  6.923   1.00 50.64  ? 1160 THR A C   1 
ATOM 8057  O O   . THR A 1 1093 ? 281.997 -10.282 7.719   1.00 50.74  ? 1160 THR A O   1 
ATOM 8058  C CB  . THR A 1 1093 ? 280.150 -7.681  6.603   1.00 47.53  ? 1160 THR A CB  1 
ATOM 8059  O OG1 . THR A 1 1093 ? 280.284 -6.436  5.929   1.00 46.62  ? 1160 THR A OG1 1 
ATOM 8060  C CG2 . THR A 1 1093 ? 279.008 -7.605  7.558   1.00 46.34  ? 1160 THR A CG2 1 
ATOM 8061  N N   . ARG A 1 1094 ? 281.971 -9.506  5.627   1.00 51.91  ? 1161 ARG A N   1 
ATOM 8062  C CA  . ARG A 1 1094 ? 282.339 -10.760 5.061   1.00 52.76  ? 1161 ARG A CA  1 
ATOM 8063  C C   . ARG A 1 1094 ? 283.548 -11.291 5.750   1.00 53.41  ? 1161 ARG A C   1 
ATOM 8064  O O   . ARG A 1 1094 ? 283.505 -12.370 6.323   1.00 53.14  ? 1161 ARG A O   1 
ATOM 8065  C CB  . ARG A 1 1094 ? 282.584 -10.542 3.599   1.00 54.04  ? 1161 ARG A CB  1 
ATOM 8066  C CG  . ARG A 1 1094 ? 281.303 -10.100 2.991   1.00 56.47  ? 1161 ARG A CG  1 
ATOM 8067  C CD  . ARG A 1 1094 ? 281.481 -9.205  1.825   1.00 58.07  ? 1161 ARG A CD  1 
ATOM 8068  N NE  . ARG A 1 1094 ? 280.168 -8.868  1.304   1.00 59.59  ? 1161 ARG A NE  1 
ATOM 8069  C CZ  . ARG A 1 1094 ? 279.963 -8.048  0.287   1.00 60.55  ? 1161 ARG A CZ  1 
ATOM 8070  N NH1 . ARG A 1 1094 ? 281.003 -7.474  -0.316  1.00 61.55  ? 1161 ARG A NH1 1 
ATOM 8071  N NH2 . ARG A 1 1094 ? 278.720 -7.814  -0.125  1.00 58.12  ? 1161 ARG A NH2 1 
ATOM 8072  N N   . CYS A 1 1095 ? 284.622 -10.520 5.704   1.00 54.63  ? 1162 CYS A N   1 
ATOM 8073  C CA  . CYS A 1 1095 ? 285.855 -10.924 6.340   1.00 56.44  ? 1162 CYS A CA  1 
ATOM 8074  C C   . CYS A 1 1095 ? 285.514 -11.560 7.673   1.00 55.84  ? 1162 CYS A C   1 
ATOM 8075  O O   . CYS A 1 1095 ? 285.655 -12.773 7.867   1.00 56.51  ? 1162 CYS A O   1 
ATOM 8076  C CB  . CYS A 1 1095 ? 286.740 -9.707  6.586   1.00 59.38  ? 1162 CYS A CB  1 
ATOM 8077  S SG  . CYS A 1 1095 ? 287.087 -8.731  5.143   1.00 68.30  ? 1162 CYS A SG  1 
ATOM 8078  N N   . MET A 1 1096 ? 285.047 -10.705 8.580   1.00 54.79  ? 1163 MET A N   1 
ATOM 8079  C CA  . MET A 1 1096 ? 284.672 -11.072 9.942   1.00 54.50  ? 1163 MET A CA  1 
ATOM 8080  C C   . MET A 1 1096 ? 283.856 -12.348 10.078  1.00 56.19  ? 1163 MET A C   1 
ATOM 8081  O O   . MET A 1 1096 ? 284.111 -13.182 10.952  1.00 56.83  ? 1163 MET A O   1 
ATOM 8082  C CB  . MET A 1 1096 ? 283.908 -9.926  10.576  1.00 52.22  ? 1163 MET A CB  1 
ATOM 8083  C CG  . MET A 1 1096 ? 283.390 -10.291 11.905  1.00 49.98  ? 1163 MET A CG  1 
ATOM 8084  S SD  . MET A 1 1096 ? 283.229 -8.826  12.808  1.00 48.13  ? 1163 MET A SD  1 
ATOM 8085  C CE  . MET A 1 1096 ? 282.175 -9.414  14.166  1.00 48.62  ? 1163 MET A CE  1 
ATOM 8086  N N   . PHE A 1 1097 ? 282.851 -12.488 9.234   1.00 57.65  ? 1164 PHE A N   1 
ATOM 8087  C CA  . PHE A 1 1097 ? 282.061 -13.678 9.301   1.00 60.39  ? 1164 PHE A CA  1 
ATOM 8088  C C   . PHE A 1 1097 ? 282.965 -14.919 9.402   1.00 63.16  ? 1164 PHE A C   1 
ATOM 8089  O O   . PHE A 1 1097 ? 282.912 -15.638 10.393  1.00 63.91  ? 1164 PHE A O   1 
ATOM 8090  C CB  . PHE A 1 1097 ? 281.148 -13.726 8.086   1.00 60.24  ? 1164 PHE A CB  1 
ATOM 8091  C CG  . PHE A 1 1097 ? 279.885 -12.958 8.277   1.00 63.63  ? 1164 PHE A CG  1 
ATOM 8092  C CD1 . PHE A 1 1097 ? 279.849 -11.581 8.103   1.00 65.49  ? 1164 PHE A CD1 1 
ATOM 8093  C CD2 . PHE A 1 1097 ? 278.737 -13.604 8.721   1.00 63.50  ? 1164 PHE A CD2 1 
ATOM 8094  C CE1 . PHE A 1 1097 ? 278.679 -10.849 8.377   1.00 65.91  ? 1164 PHE A CE1 1 
ATOM 8095  C CE2 . PHE A 1 1097 ? 277.563 -12.889 8.999   1.00 63.79  ? 1164 PHE A CE2 1 
ATOM 8096  C CZ  . PHE A 1 1097 ? 277.534 -11.510 8.829   1.00 65.72  ? 1164 PHE A CZ  1 
ATOM 8097  N N   . ALA A 1 1098 ? 283.832 -15.126 8.410   1.00 65.78  ? 1165 ALA A N   1 
ATOM 8098  C CA  . ALA A 1 1098 ? 284.736 -16.288 8.348   1.00 68.27  ? 1165 ALA A CA  1 
ATOM 8099  C C   . ALA A 1 1098 ? 285.553 -16.561 9.578   1.00 70.79  ? 1165 ALA A C   1 
ATOM 8100  O O   . ALA A 1 1098 ? 285.709 -17.689 9.989   1.00 71.87  ? 1165 ALA A O   1 
ATOM 8101  C CB  . ALA A 1 1098 ? 285.682 -16.156 7.166   1.00 67.54  ? 1165 ALA A CB  1 
ATOM 8102  N N   . TYR A 1 1099 ? 286.090 -15.526 10.171  1.00 74.35  ? 1166 TYR A N   1 
ATOM 8103  C CA  . TYR A 1 1099 ? 286.922 -15.725 11.327  1.00 77.45  ? 1166 TYR A CA  1 
ATOM 8104  C C   . TYR A 1 1099 ? 286.187 -16.411 12.446  1.00 78.22  ? 1166 TYR A C   1 
ATOM 8105  O O   . TYR A 1 1099 ? 286.640 -17.445 12.928  1.00 77.90  ? 1166 TYR A O   1 
ATOM 8106  C CB  . TYR A 1 1099 ? 287.506 -14.384 11.701  1.00 79.97  ? 1166 TYR A CB  1 
ATOM 8107  C CG  . TYR A 1 1099 ? 288.313 -13.904 10.522  1.00 83.03  ? 1166 TYR A CG  1 
ATOM 8108  C CD1 . TYR A 1 1099 ? 287.813 -14.050 9.223   1.00 84.16  ? 1166 TYR A CD1 1 
ATOM 8109  C CD2 . TYR A 1 1099 ? 289.600 -13.395 10.676  1.00 84.91  ? 1166 TYR A CD2 1 
ATOM 8110  C CE1 . TYR A 1 1099 ? 288.556 -13.719 8.119   1.00 85.05  ? 1166 TYR A CE1 1 
ATOM 8111  C CE2 . TYR A 1 1099 ? 290.370 -13.050 9.555   1.00 85.86  ? 1166 TYR A CE2 1 
ATOM 8112  C CZ  . TYR A 1 1099 ? 289.830 -13.222 8.281   1.00 84.82  ? 1166 TYR A CZ  1 
ATOM 8113  O OH  . TYR A 1 1099 ? 290.537 -12.920 7.148   1.00 83.14  ? 1166 TYR A OH  1 
ATOM 8114  N N   . LYS A 1 1100 ? 285.048 -15.858 12.852  1.00 78.92  ? 1167 LYS A N   1 
ATOM 8115  C CA  . LYS A 1 1100 ? 284.257 -16.498 13.896  1.00 79.23  ? 1167 LYS A CA  1 
ATOM 8116  C C   . LYS A 1 1100 ? 283.820 -17.810 13.262  1.00 80.51  ? 1167 LYS A C   1 
ATOM 8117  O O   . LYS A 1 1100 ? 284.438 -18.861 13.458  1.00 80.77  ? 1167 LYS A O   1 
ATOM 8118  C CB  . LYS A 1 1100 ? 282.985 -15.700 14.243  1.00 77.62  ? 1167 LYS A CB  1 
ATOM 8119  C CG  . LYS A 1 1100 ? 283.193 -14.272 14.665  1.00 76.76  ? 1167 LYS A CG  1 
ATOM 8120  C CD  . LYS A 1 1100 ? 282.178 -13.849 15.717  1.00 78.10  ? 1167 LYS A CD  1 
ATOM 8121  C CE  . LYS A 1 1100 ? 282.379 -12.385 16.092  1.00 78.46  ? 1167 LYS A CE  1 
ATOM 8122  N NZ  . LYS A 1 1100 ? 281.540 -11.952 17.241  1.00 79.23  ? 1167 LYS A NZ  1 
ATOM 8123  N N   . LEU A 1 1101 ? 282.752 -17.702 12.473  1.00 81.59  ? 1168 LEU A N   1 
ATOM 8124  C CA  . LEU A 1 1101 ? 282.120 -18.810 11.760  1.00 82.72  ? 1168 LEU A CA  1 
ATOM 8125  C C   . LEU A 1 1101 ? 283.068 -19.943 11.389  1.00 82.88  ? 1168 LEU A C   1 
ATOM 8126  O O   . LEU A 1 1101 ? 282.978 -21.054 11.927  1.00 83.98  ? 1168 LEU A O   1 
ATOM 8127  C CB  . LEU A 1 1101 ? 281.440 -18.275 10.495  1.00 82.59  ? 1168 LEU A CB  1 
ATOM 8128  C CG  . LEU A 1 1101 ? 280.551 -17.049 10.717  1.00 83.40  ? 1168 LEU A CG  1 
ATOM 8129  C CD1 . LEU A 1 1101 ? 280.061 -16.555 9.376   1.00 84.32  ? 1168 LEU A CD1 1 
ATOM 8130  C CD2 . LEU A 1 1101 ? 279.384 -17.385 11.650  1.00 83.46  ? 1168 LEU A CD2 1 
ATOM 8131  N N   . GLY A 1 1102 ? 283.973 -19.654 10.461  1.00 82.10  ? 1169 GLY A N   1 
ATOM 8132  C CA  . GLY A 1 1102 ? 284.922 -20.655 10.013  1.00 81.24  ? 1169 GLY A CA  1 
ATOM 8133  C C   . GLY A 1 1102 ? 286.267 -20.455 10.663  1.00 80.33  ? 1169 GLY A C   1 
ATOM 8134  O O   . GLY A 1 1102 ? 286.612 -21.183 11.594  1.00 81.65  ? 1169 GLY A O   1 
ATOM 8135  N N   . LEU A 1 1103 ? 287.020 -19.477 10.161  1.00 78.37  ? 1170 LEU A N   1 
ATOM 8136  C CA  . LEU A 1 1103 ? 288.331 -19.163 10.697  1.00 76.88  ? 1170 LEU A CA  1 
ATOM 8137  C C   . LEU A 1 1103 ? 289.310 -18.453 9.759   1.00 76.51  ? 1170 LEU A C   1 
ATOM 8138  O O   . LEU A 1 1103 ? 289.539 -18.864 8.621   1.00 76.05  ? 1170 LEU A O   1 
ATOM 8139  C CB  . LEU A 1 1103 ? 289.002 -20.439 11.229  1.00 75.86  ? 1170 LEU A CB  1 
ATOM 8140  C CG  . LEU A 1 1103 ? 289.393 -21.567 10.267  1.00 74.71  ? 1170 LEU A CG  1 
ATOM 8141  C CD1 . LEU A 1 1103 ? 288.638 -21.447 8.957   1.00 74.53  ? 1170 LEU A CD1 1 
ATOM 8142  C CD2 . LEU A 1 1103 ? 290.883 -21.503 10.006  1.00 73.71  ? 1170 LEU A CD2 1 
ATOM 8143  N N   . ASN A 1 1104 ? 289.860 -17.365 10.287  1.00 75.70  ? 1171 ASN A N   1 
ATOM 8144  C CA  . ASN A 1 1104 ? 290.893 -16.524 9.686   1.00 74.14  ? 1171 ASN A CA  1 
ATOM 8145  C C   . ASN A 1 1104 ? 291.035 -16.164 8.200   1.00 73.64  ? 1171 ASN A C   1 
ATOM 8146  O O   . ASN A 1 1104 ? 292.121 -15.748 7.813   1.00 72.51  ? 1171 ASN A O   1 
ATOM 8147  C CB  . ASN A 1 1104 ? 292.255 -17.056 10.144  1.00 71.90  ? 1171 ASN A CB  1 
ATOM 8148  C CG  . ASN A 1 1104 ? 292.185 -17.779 11.473  1.00 70.16  ? 1171 ASN A CG  1 
ATOM 8149  O OD1 . ASN A 1 1104 ? 291.222 -17.633 12.222  1.00 68.62  ? 1171 ASN A OD1 1 
ATOM 8150  N ND2 . ASN A 1 1104 ? 293.216 -18.556 11.777  1.00 68.88  ? 1171 ASN A ND2 1 
ATOM 8151  N N   . ASP A 1 1105 ? 290.008 -16.289 7.360   1.00 73.67  ? 1172 ASP A N   1 
ATOM 8152  C CA  . ASP A 1 1105 ? 290.202 -15.924 5.943   1.00 73.21  ? 1172 ASP A CA  1 
ATOM 8153  C C   . ASP A 1 1105 ? 288.992 -16.069 5.017   1.00 73.12  ? 1172 ASP A C   1 
ATOM 8154  O O   . ASP A 1 1105 ? 288.044 -16.800 5.308   1.00 73.65  ? 1172 ASP A O   1 
ATOM 8155  C CB  . ASP A 1 1105 ? 291.374 -16.729 5.346   1.00 71.96  ? 1172 ASP A CB  1 
ATOM 8156  C CG  . ASP A 1 1105 ? 292.574 -15.849 4.959   1.00 70.74  ? 1172 ASP A CG  1 
ATOM 8157  O OD1 . ASP A 1 1105 ? 293.030 -15.037 5.788   1.00 71.32  ? 1172 ASP A OD1 1 
ATOM 8158  O OD2 . ASP A 1 1105 ? 293.072 -15.983 3.823   1.00 69.63  ? 1172 ASP A OD2 1 
ATOM 8159  N N   . LEU A 1 1106 ? 289.053 -15.360 3.891   1.00 71.86  ? 1173 LEU A N   1 
ATOM 8160  C CA  . LEU A 1 1106 ? 288.007 -15.383 2.872   1.00 70.50  ? 1173 LEU A CA  1 
ATOM 8161  C C   . LEU A 1 1106 ? 288.479 -14.766 1.552   1.00 68.95  ? 1173 LEU A C   1 
ATOM 8162  O O   . LEU A 1 1106 ? 289.479 -14.095 1.520   1.00 70.76  ? 1173 LEU A O   1 
ATOM 8163  C CB  . LEU A 1 1106 ? 286.750 -14.676 3.367   1.00 70.99  ? 1173 LEU A CB  1 
ATOM 8164  C CG  . LEU A 1 1106 ? 285.840 -15.581 4.188   1.00 71.41  ? 1173 LEU A CG  1 
ATOM 8165  C CD1 . LEU A 1 1106 ? 284.566 -14.841 4.436   1.00 71.88  ? 1173 LEU A CD1 1 
ATOM 8166  C CD2 . LEU A 1 1106 ? 285.551 -16.890 3.463   1.00 70.63  ? 1173 LEU A CD2 1 
ATOM 8167  N N   . PRO A 1 1107 ? 287.760 -15.019 0.450   1.00 65.79  ? 1174 PRO A N   1 
ATOM 8168  C CA  . PRO A 1 1107 ? 287.971 -14.583 -0.940  1.00 63.22  ? 1174 PRO A CA  1 
ATOM 8169  C C   . PRO A 1 1107 ? 287.550 -13.270 -1.601  1.00 62.02  ? 1174 PRO A C   1 
ATOM 8170  O O   . PRO A 1 1107 ? 286.806 -12.458 -1.064  1.00 60.64  ? 1174 PRO A O   1 
ATOM 8171  C CB  . PRO A 1 1107 ? 287.408 -15.732 -1.719  1.00 62.65  ? 1174 PRO A CB  1 
ATOM 8172  C CG  . PRO A 1 1107 ? 287.625 -16.896 -0.814  1.00 62.63  ? 1174 PRO A CG  1 
ATOM 8173  C CD  . PRO A 1 1107 ? 287.110 -16.335 0.446   1.00 64.72  ? 1174 PRO A CD  1 
ATOM 8174  N N   . GLN A 1 1108 ? 288.012 -13.145 -2.843  1.00 62.51  ? 1175 GLN A N   1 
ATOM 8175  C CA  . GLN A 1 1108 ? 287.823 -11.973 -3.678  1.00 62.37  ? 1175 GLN A CA  1 
ATOM 8176  C C   . GLN A 1 1108 ? 286.448 -11.636 -4.188  1.00 62.01  ? 1175 GLN A C   1 
ATOM 8177  O O   . GLN A 1 1108 ? 285.899 -10.611 -3.831  1.00 63.24  ? 1175 GLN A O   1 
ATOM 8178  C CB  . GLN A 1 1108 ? 288.766 -12.043 -4.883  1.00 64.17  ? 1175 GLN A CB  1 
ATOM 8179  C CG  . GLN A 1 1108 ? 288.405 -13.105 -5.911  1.00 66.35  ? 1175 GLN A CG  1 
ATOM 8180  C CD  . GLN A 1 1108 ? 289.287 -13.057 -7.162  1.00 65.88  ? 1175 GLN A CD  1 
ATOM 8181  O OE1 . GLN A 1 1108 ? 289.108 -13.847 -8.095  1.00 66.95  ? 1175 GLN A OE1 1 
ATOM 8182  N NE2 . GLN A 1 1108 ? 290.240 -12.130 -7.184  1.00 62.64  ? 1175 GLN A NE2 1 
ATOM 8183  N N   . SER A 1 1109 ? 285.908 -12.483 -5.049  1.00 60.50  ? 1176 SER A N   1 
ATOM 8184  C CA  . SER A 1 1109 ? 284.606 -12.234 -5.648  1.00 59.02  ? 1176 SER A CA  1 
ATOM 8185  C C   . SER A 1 1109 ? 283.625 -11.497 -4.754  1.00 56.69  ? 1176 SER A C   1 
ATOM 8186  O O   . SER A 1 1109 ? 283.096 -10.456 -5.128  1.00 55.17  ? 1176 SER A O   1 
ATOM 8187  C CB  . SER A 1 1109 ? 283.982 -13.540 -6.098  1.00 60.10  ? 1176 SER A CB  1 
ATOM 8188  O OG  . SER A 1 1109 ? 283.906 -14.440 -5.011  1.00 62.53  ? 1176 SER A OG  1 
ATOM 8189  N N   . VAL A 1 1110 ? 283.366 -12.040 -3.577  1.00 55.97  ? 1177 VAL A N   1 
ATOM 8190  C CA  . VAL A 1 1110 ? 282.447 -11.393 -2.650  1.00 56.37  ? 1177 VAL A CA  1 
ATOM 8191  C C   . VAL A 1 1110 ? 282.947 -9.995  -2.342  1.00 58.86  ? 1177 VAL A C   1 
ATOM 8192  O O   . VAL A 1 1110 ? 282.250 -9.007  -2.567  1.00 60.60  ? 1177 VAL A O   1 
ATOM 8193  C CB  . VAL A 1 1110 ? 282.383 -12.133 -1.328  1.00 54.50  ? 1177 VAL A CB  1 
ATOM 8194  C CG1 . VAL A 1 1110 ? 280.970 -12.640 -1.087  1.00 53.63  ? 1177 VAL A CG1 1 
ATOM 8195  C CG2 . VAL A 1 1110 ? 283.406 -13.261 -1.326  1.00 51.97  ? 1177 VAL A CG2 1 
ATOM 8196  N N   . ALA A 1 1111 ? 284.165 -9.941  -1.811  1.00 60.09  ? 1178 ALA A N   1 
ATOM 8197  C CA  . ALA A 1 1111 ? 284.829 -8.700  -1.437  1.00 61.84  ? 1178 ALA A CA  1 
ATOM 8198  C C   . ALA A 1 1111 ? 284.338 -7.511  -2.215  1.00 63.56  ? 1178 ALA A C   1 
ATOM 8199  O O   . ALA A 1 1111 ? 283.736 -6.590  -1.666  1.00 61.78  ? 1178 ALA A O   1 
ATOM 8200  C CB  . ALA A 1 1111 ? 286.324 -8.837  -1.634  1.00 60.93  ? 1178 ALA A CB  1 
ATOM 8201  N N   . PHE A 1 1112 ? 284.557 -7.527  -3.517  1.00 66.63  ? 1179 PHE A N   1 
ATOM 8202  C CA  . PHE A 1 1112 ? 284.129 -6.368  -4.236  1.00 69.49  ? 1179 PHE A CA  1 
ATOM 8203  C C   . PHE A 1 1112 ? 282.802 -6.327  -4.927  1.00 71.54  ? 1179 PHE A C   1 
ATOM 8204  O O   . PHE A 1 1112 ? 282.613 -5.838  -6.042  1.00 70.96  ? 1179 PHE A O   1 
ATOM 8205  C CB  . PHE A 1 1112 ? 285.313 -5.871  -5.012  1.00 71.00  ? 1179 PHE A CB  1 
ATOM 8206  C CG  . PHE A 1 1112 ? 286.287 -5.280  -4.086  1.00 73.60  ? 1179 PHE A CG  1 
ATOM 8207  C CD1 . PHE A 1 1112 ? 285.907 -4.148  -3.372  1.00 74.48  ? 1179 PHE A CD1 1 
ATOM 8208  C CD2 . PHE A 1 1112 ? 287.434 -5.960  -3.704  1.00 74.53  ? 1179 PHE A CD2 1 
ATOM 8209  C CE1 . PHE A 1 1112 ? 286.620 -3.707  -2.299  1.00 75.77  ? 1179 PHE A CE1 1 
ATOM 8210  C CE2 . PHE A 1 1112 ? 288.167 -5.521  -2.612  1.00 75.55  ? 1179 PHE A CE2 1 
ATOM 8211  C CZ  . PHE A 1 1112 ? 287.754 -4.390  -1.906  1.00 76.02  ? 1179 PHE A CZ  1 
ATOM 8212  N N   . PHE A 1 1113 ? 281.864 -6.815  -4.131  1.00 74.51  ? 1180 PHE A N   1 
ATOM 8213  C CA  . PHE A 1 1113 ? 280.468 -6.848  -4.447  1.00 76.69  ? 1180 PHE A CA  1 
ATOM 8214  C C   . PHE A 1 1113 ? 280.159 -7.141  -5.875  1.00 77.33  ? 1180 PHE A C   1 
ATOM 8215  O O   . PHE A 1 1113 ? 280.620 -8.109  -6.472  1.00 78.12  ? 1180 PHE A O   1 
ATOM 8216  C CB  . PHE A 1 1113 ? 279.872 -5.496  -4.113  1.00 77.03  ? 1180 PHE A CB  1 
ATOM 8217  C CG  . PHE A 1 1113 ? 278.805 -5.566  -3.108  1.00 77.70  ? 1180 PHE A CG  1 
ATOM 8218  C CD1 . PHE A 1 1113 ? 277.933 -6.639  -3.098  1.00 78.66  ? 1180 PHE A CD1 1 
ATOM 8219  C CD2 . PHE A 1 1113 ? 278.665 -4.573  -2.162  1.00 77.36  ? 1180 PHE A CD2 1 
ATOM 8220  C CE1 . PHE A 1 1113 ? 276.950 -6.718  -2.163  1.00 78.45  ? 1180 PHE A CE1 1 
ATOM 8221  C CE2 . PHE A 1 1113 ? 277.670 -4.647  -1.212  1.00 77.65  ? 1180 PHE A CE2 1 
ATOM 8222  C CZ  . PHE A 1 1113 ? 276.809 -5.724  -1.210  1.00 78.11  ? 1180 PHE A CZ  1 
ATOM 8223  N N   . SER A 1 1114 ? 279.337 -6.258  -6.403  1.00 76.97  ? 1181 SER A N   1 
ATOM 8224  C CA  . SER A 1 1114 ? 278.900 -6.301  -7.770  1.00 76.50  ? 1181 SER A CA  1 
ATOM 8225  C C   . SER A 1 1114 ? 279.250 -4.902  -8.214  1.00 75.54  ? 1181 SER A C   1 
ATOM 8226  O O   . SER A 1 1114 ? 279.940 -4.681  -9.209  1.00 74.58  ? 1181 SER A O   1 
ATOM 8227  C CB  . SER A 1 1114 ? 277.390 -6.517  -7.794  1.00 76.84  ? 1181 SER A CB  1 
ATOM 8228  O OG  . SER A 1 1114 ? 276.732 -5.670  -6.860  1.00 76.30  ? 1181 SER A OG  1 
ATOM 8229  N N   . ALA A 1 1115 ? 278.787 -3.973  -7.389  1.00 74.69  ? 1182 ALA A N   1 
ATOM 8230  C CA  . ALA A 1 1115 ? 278.962 -2.557  -7.585  1.00 73.19  ? 1182 ALA A CA  1 
ATOM 8231  C C   . ALA A 1 1115 ? 278.030 -1.849  -6.595  1.00 71.51  ? 1182 ALA A C   1 
ATOM 8232  O O   . ALA A 1 1115 ? 277.042 -2.425  -6.144  1.00 70.60  ? 1182 ALA A O   1 
ATOM 8233  C CB  . ALA A 1 1115 ? 278.597 -2.198  -9.017  1.00 73.75  ? 1182 ALA A CB  1 
ATOM 8234  N N   . VAL A 1 1116 ? 278.361 -0.610  -6.248  1.00 70.61  ? 1183 VAL A N   1 
ATOM 8235  C CA  . VAL A 1 1116 ? 277.549 0.198   -5.332  1.00 70.02  ? 1183 VAL A CA  1 
ATOM 8236  C C   . VAL A 1 1116 ? 276.706 1.162   -6.152  1.00 71.28  ? 1183 VAL A C   1 
ATOM 8237  O O   . VAL A 1 1116 ? 277.231 1.959   -6.928  1.00 70.28  ? 1183 VAL A O   1 
ATOM 8238  C CB  . VAL A 1 1116 ? 278.419 1.030   -4.346  1.00 68.22  ? 1183 VAL A CB  1 
ATOM 8239  C CG1 . VAL A 1 1116 ? 277.578 2.119   -3.679  1.00 66.98  ? 1183 VAL A CG1 1 
ATOM 8240  C CG2 . VAL A 1 1116 ? 279.016 0.123   -3.287  1.00 68.38  ? 1183 VAL A CG2 1 
ATOM 8241  N N   . ASP A 1 1117 ? 275.399 1.104   -5.948  1.00 72.67  ? 1184 ASP A N   1 
ATOM 8242  C CA  . ASP A 1 1117 ? 274.474 1.929   -6.700  1.00 73.46  ? 1184 ASP A CA  1 
ATOM 8243  C C   . ASP A 1 1117 ? 274.111 3.280   -6.124  1.00 75.34  ? 1184 ASP A C   1 
ATOM 8244  O O   . ASP A 1 1117 ? 273.792 3.429   -4.941  1.00 75.84  ? 1184 ASP A O   1 
ATOM 8245  C CB  . ASP A 1 1117 ? 273.210 1.127   -6.985  1.00 72.28  ? 1184 ASP A CB  1 
ATOM 8246  C CG  . ASP A 1 1117 ? 273.503 -0.131  -7.762  1.00 71.17  ? 1184 ASP A CG  1 
ATOM 8247  O OD1 . ASP A 1 1117 ? 274.593 -0.704  -7.537  1.00 69.44  ? 1184 ASP A OD1 1 
ATOM 8248  O OD2 . ASP A 1 1117 ? 272.656 -0.549  -8.579  1.00 71.25  ? 1184 ASP A OD2 1 
ATOM 8249  N N   . ILE A 1 1118 ? 274.135 4.251   -7.029  1.00 76.52  ? 1185 ILE A N   1 
ATOM 8250  C CA  . ILE A 1 1118 ? 273.851 5.644   -6.743  1.00 77.63  ? 1185 ILE A CA  1 
ATOM 8251  C C   . ILE A 1 1118 ? 272.772 6.196   -7.695  1.00 78.67  ? 1185 ILE A C   1 
ATOM 8252  O O   . ILE A 1 1118 ? 272.904 6.115   -8.921  1.00 79.38  ? 1185 ILE A O   1 
ATOM 8253  C CB  . ILE A 1 1118 ? 275.141 6.468   -6.923  1.00 78.00  ? 1185 ILE A CB  1 
ATOM 8254  C CG1 . ILE A 1 1118 ? 276.315 5.744   -6.253  1.00 79.31  ? 1185 ILE A CG1 1 
ATOM 8255  C CG2 . ILE A 1 1118 ? 274.975 7.850   -6.337  1.00 79.29  ? 1185 ILE A CG2 1 
ATOM 8256  C CD1 . ILE A 1 1118 ? 277.690 6.311   -6.615  1.00 91.71  ? 1185 ILE A CD1 1 
ATOM 8257  N N   . ASP A 1 1119 ? 271.707 6.748   -7.124  1.00 79.65  ? 1186 ASP A N   1 
ATOM 8258  C CA  . ASP A 1 1119 ? 270.639 7.330   -7.919  1.00 81.30  ? 1186 ASP A CA  1 
ATOM 8259  C C   . ASP A 1 1119 ? 269.661 8.064   -7.007  1.00 83.49  ? 1186 ASP A C   1 
ATOM 8260  O O   . ASP A 1 1119 ? 269.661 7.875   -5.791  1.00 83.47  ? 1186 ASP A O   1 
ATOM 8261  C CB  . ASP A 1 1119 ? 269.914 6.247   -8.725  1.00 79.95  ? 1186 ASP A CB  1 
ATOM 8262  C CG  . ASP A 1 1119 ? 269.420 6.756   -10.067 1.00 79.42  ? 1186 ASP A CG  1 
ATOM 8263  O OD1 . ASP A 1 1119 ? 269.731 7.913   -10.398 1.00 78.25  ? 1186 ASP A OD1 1 
ATOM 8264  O OD2 . ASP A 1 1119 ? 268.733 6.009   -10.796 1.00 78.78  ? 1186 ASP A OD2 1 
ATOM 8265  N N   . ARG A 1 1120 ? 268.844 8.917   -7.607  1.00 86.54  ? 1187 ARG A N   1 
ATOM 8266  C CA  . ARG A 1 1120 ? 267.853 9.700   -6.883  1.00 89.09  ? 1187 ARG A CA  1 
ATOM 8267  C C   . ARG A 1 1120 ? 266.591 8.852   -6.853  1.00 89.64  ? 1187 ARG A C   1 
ATOM 8268  O O   . ARG A 1 1120 ? 265.581 9.226   -6.263  1.00 89.96  ? 1187 ARG A O   1 
ATOM 8269  C CB  . ARG A 1 1120 ? 267.577 10.997  -7.649  1.00 90.99  ? 1187 ARG A CB  1 
ATOM 8270  C CG  . ARG A 1 1120 ? 268.817 11.688  -8.207  1.00 93.61  ? 1187 ARG A CG  1 
ATOM 8271  C CD  . ARG A 1 1120 ? 268.453 12.789  -9.197  1.00 95.11  ? 1187 ARG A CD  1 
ATOM 8272  N NE  . ARG A 1 1120 ? 268.489 12.337  -10.585 1.00 96.51  ? 1187 ARG A NE  1 
ATOM 8273  C CZ  . ARG A 1 1120 ? 268.132 13.084  -11.625 1.00 97.80  ? 1187 ARG A CZ  1 
ATOM 8274  N NH1 . ARG A 1 1120 ? 267.704 14.321  -11.444 1.00 98.28  ? 1187 ARG A NH1 1 
ATOM 8275  N NH2 . ARG A 1 1120 ? 268.227 12.603  -12.851 1.00 98.89  ? 1187 ARG A NH2 1 
ATOM 8276  N N   . CYS A 1 1121 ? 266.692 7.699   -7.508  1.00 89.97  ? 1188 CYS A N   1 
ATOM 8277  C CA  . CYS A 1 1121 ? 265.608 6.733   -7.674  1.00 90.15  ? 1188 CYS A CA  1 
ATOM 8278  C C   . CYS A 1 1121 ? 265.823 5.487   -6.819  1.00 89.73  ? 1188 CYS A C   1 
ATOM 8279  O O   . CYS A 1 1121 ? 266.920 5.253   -6.314  1.00 89.63  ? 1188 CYS A O   1 
ATOM 8280  C CB  . CYS A 1 1121 ? 265.519 6.363   -9.165  1.00 90.42  ? 1188 CYS A CB  1 
ATOM 8281  S SG  . CYS A 1 1121 ? 264.423 5.018   -9.645  1.00 94.30  ? 1188 CYS A SG  1 
ATOM 8282  N N   . LEU A 1 1122 ? 264.773 4.684   -6.664  1.00 89.31  ? 1189 LEU A N   1 
ATOM 8283  C CA  . LEU A 1 1122 ? 264.844 3.486   -5.830  1.00 88.42  ? 1189 LEU A CA  1 
ATOM 8284  C C   . LEU A 1 1122 ? 264.533 2.161   -6.462  1.00 88.48  ? 1189 LEU A C   1 
ATOM 8285  O O   . LEU A 1 1122 ? 263.587 1.487   -6.054  1.00 88.79  ? 1189 LEU A O   1 
ATOM 8286  C CB  . LEU A 1 1122 ? 263.929 3.636   -4.632  1.00 86.99  ? 1189 LEU A CB  1 
ATOM 8287  C CG  . LEU A 1 1122 ? 264.521 4.570   -3.608  1.00 86.17  ? 1189 LEU A CG  1 
ATOM 8288  C CD1 . LEU A 1 1122 ? 265.707 3.876   -2.984  1.00 86.28  ? 1189 LEU A CD1 1 
ATOM 8289  C CD2 . LEU A 1 1122 ? 264.915 5.893   -4.260  1.00 86.92  ? 1189 LEU A CD2 1 
ATOM 8290  N N   . ARG A 1 1123 ? 265.315 1.777   -7.455  1.00 88.13  ? 1190 ARG A N   1 
ATOM 8291  C CA  . ARG A 1 1123 ? 265.089 0.492   -8.060  1.00 88.78  ? 1190 ARG A CA  1 
ATOM 8292  C C   . ARG A 1 1123 ? 266.409 -0.193  -8.233  1.00 89.28  ? 1190 ARG A C   1 
ATOM 8293  O O   . ARG A 1 1123 ? 267.414 0.433   -8.547  1.00 88.64  ? 1190 ARG A O   1 
ATOM 8294  C CB  . ARG A 1 1123 ? 264.383 0.615   -9.389  1.00 89.22  ? 1190 ARG A CB  1 
ATOM 8295  C CG  . ARG A 1 1123 ? 263.376 -0.510  -9.597  1.00 89.96  ? 1190 ARG A CG  1 
ATOM 8296  C CD  . ARG A 1 1123 ? 262.791 -0.435  -10.985 1.00 91.32  ? 1190 ARG A CD  1 
ATOM 8297  N NE  . ARG A 1 1123 ? 262.944 0.913   -11.517 1.00 91.69  ? 1190 ARG A NE  1 
ATOM 8298  C CZ  . ARG A 1 1123 ? 262.219 1.952   -11.130 1.00 91.17  ? 1190 ARG A CZ  1 
ATOM 8299  N NH1 . ARG A 1 1123 ? 261.277 1.795   -10.213 1.00 91.56  ? 1190 ARG A NH1 1 
ATOM 8300  N NH2 . ARG A 1 1123 ? 262.444 3.143   -11.657 1.00 89.75  ? 1190 ARG A NH2 1 
ATOM 8301  N N   . LYS A 1 1124 ? 266.386 -1.499  -8.025  1.00 90.69  ? 1191 LYS A N   1 
ATOM 8302  C CA  . LYS A 1 1124 ? 267.582 -2.310  -8.087  1.00 91.46  ? 1191 LYS A CA  1 
ATOM 8303  C C   . LYS A 1 1124 ? 268.127 -2.595  -9.489  1.00 91.12  ? 1191 LYS A C   1 
ATOM 8304  O O   . LYS A 1 1124 ? 267.573 -3.387  -10.255 1.00 90.76  ? 1191 LYS A O   1 
ATOM 8305  C CB  . LYS A 1 1124 ? 267.335 -3.586  -7.246  1.00 92.04  ? 1191 LYS A CB  1 
ATOM 8306  C CG  . LYS A 1 1124 ? 267.432 -4.963  -7.907  1.00 91.28  ? 1191 LYS A CG  1 
ATOM 8307  C CD  . LYS A 1 1124 ? 267.398 -6.050  -6.827  1.00 91.14  ? 1191 LYS A CD  1 
ATOM 8308  C CE  . LYS A 1 1124 ? 268.488 -5.790  -5.820  1.00 91.37  ? 1191 LYS A CE  1 
ATOM 8309  N NZ  . LYS A 1 1124 ? 269.697 -5.417  -6.595  1.00 91.63  ? 1191 LYS A NZ  1 
ATOM 8310  N N   . GLU A 1 1125 ? 269.224 -1.905  -9.808  1.00 91.02  ? 1192 GLU A N   1 
ATOM 8311  C CA  . GLU A 1 1125 ? 269.911 -2.030  -11.095 1.00 90.51  ? 1192 GLU A CA  1 
ATOM 8312  C C   . GLU A 1 1125 ? 269.416 -0.916  -12.017 1.00 90.05  ? 1192 GLU A C   1 
ATOM 8313  O O   . GLU A 1 1125 ? 268.718 -1.132  -13.003 1.00 89.86  ? 1192 GLU A O   1 
ATOM 8314  C CB  . GLU A 1 1125 ? 269.665 -3.436  -11.635 1.00 89.65  ? 1192 GLU A CB  1 
ATOM 8315  C CG  . GLU A 1 1125 ? 269.974 -3.747  -13.053 1.00 89.25  ? 1192 GLU A CG  1 
ATOM 8316  C CD  . GLU A 1 1125 ? 269.097 -4.892  -13.483 1.00 89.23  ? 1192 GLU A CD  1 
ATOM 8317  O OE1 . GLU A 1 1125 ? 269.505 -5.723  -14.327 1.00 88.60  ? 1192 GLU A OE1 1 
ATOM 8318  O OE2 . GLU A 1 1125 ? 267.970 -4.946  -12.950 1.00 89.53  ? 1192 GLU A OE2 1 
ATOM 8319  N N   . VAL A 1 1126 ? 269.823 0.286   -11.619 1.00 88.94  ? 1193 VAL A N   1 
ATOM 8320  C CA  . VAL A 1 1126 ? 269.543 1.597   -12.206 1.00 88.46  ? 1193 VAL A CA  1 
ATOM 8321  C C   . VAL A 1 1126 ? 268.981 1.833   -13.608 1.00 87.04  ? 1193 VAL A C   1 
ATOM 8322  O O   . VAL A 1 1126 ? 267.873 2.352   -13.744 1.00 86.49  ? 1193 VAL A O   1 
ATOM 8323  C CB  . VAL A 1 1126 ? 270.796 2.496   -12.038 1.00 89.62  ? 1193 VAL A CB  1 
ATOM 8324  C CG1 . VAL A 1 1126 ? 271.630 1.992   -10.866 1.00 90.44  ? 1193 VAL A CG1 1 
ATOM 8325  C CG2 . VAL A 1 1126 ? 271.632 2.511   -13.296 1.00 90.35  ? 1193 VAL A CG2 1 
ATOM 8326  N N   . THR A 1 1127 ? 269.732 1.487   -14.645 1.00 86.17  ? 1194 THR A N   1 
ATOM 8327  C CA  . THR A 1 1127 ? 269.278 1.729   -16.007 1.00 86.17  ? 1194 THR A CA  1 
ATOM 8328  C C   . THR A 1 1127 ? 267.825 1.347   -16.203 1.00 86.75  ? 1194 THR A C   1 
ATOM 8329  O O   . THR A 1 1127 ? 267.143 1.893   -17.058 1.00 87.10  ? 1194 THR A O   1 
ATOM 8330  C CB  . THR A 1 1127 ? 270.084 0.936   -17.005 1.00 86.21  ? 1194 THR A CB  1 
ATOM 8331  O OG1 . THR A 1 1127 ? 269.523 -0.376  -17.121 1.00 86.53  ? 1194 THR A OG1 1 
ATOM 8332  C CG2 . THR A 1 1127 ? 271.520 0.835   -16.543 1.00 87.71  ? 1194 THR A CG2 1 
ATOM 8333  N N   . MET A 1 1128 ? 267.365 0.399   -15.400 1.00 86.72  ? 1195 MET A N   1 
ATOM 8334  C CA  . MET A 1 1128 ? 266.001 -0.109  -15.457 1.00 86.86  ? 1195 MET A CA  1 
ATOM 8335  C C   . MET A 1 1128 ? 264.972 0.786   -16.151 1.00 86.98  ? 1195 MET A C   1 
ATOM 8336  O O   . MET A 1 1128 ? 264.515 0.451   -17.242 1.00 87.10  ? 1195 MET A O   1 
ATOM 8337  C CB  . MET A 1 1128 ? 265.518 -0.429  -14.049 1.00 86.34  ? 1195 MET A CB  1 
ATOM 8338  C CG  . MET A 1 1128 ? 264.569 -1.603  -13.995 1.00 86.31  ? 1195 MET A CG  1 
ATOM 8339  S SD  . MET A 1 1128 ? 265.374 -3.038  -13.291 1.00 85.19  ? 1195 MET A SD  1 
ATOM 8340  C CE  . MET A 1 1128 ? 264.708 -3.028  -11.670 1.00 87.55  ? 1195 MET A CE  1 
ATOM 8341  N N   . ASP A 1 1129 ? 264.602 1.896   -15.508 1.00 86.92  ? 1196 ASP A N   1 
ATOM 8342  C CA  . ASP A 1 1129 ? 263.623 2.881   -16.028 1.00 85.52  ? 1196 ASP A CA  1 
ATOM 8343  C C   . ASP A 1 1129 ? 262.198 2.650   -15.557 1.00 85.47  ? 1196 ASP A C   1 
ATOM 8344  O O   . ASP A 1 1129 ? 261.342 3.541   -15.599 1.00 85.05  ? 1196 ASP A O   1 
ATOM 8345  C CB  . ASP A 1 1129 ? 263.640 2.956   -17.573 1.00 83.31  ? 1196 ASP A CB  1 
ATOM 8346  C CG  . ASP A 1 1129 ? 262.696 1.952   -18.250 1.00 81.55  ? 1196 ASP A CG  1 
ATOM 8347  O OD1 . ASP A 1 1129 ? 262.613 1.989   -19.494 1.00 80.60  ? 1196 ASP A OD1 1 
ATOM 8348  O OD2 . ASP A 1 1129 ? 262.048 1.134   -17.569 1.00 78.95  ? 1196 ASP A OD2 1 
ATOM 8349  N N   . CYS A 1 1130 ? 261.971 1.423   -15.125 1.00 85.47  ? 1197 CYS A N   1 
ATOM 8350  C CA  . CYS A 1 1130 ? 260.697 0.965   -14.622 1.00 85.29  ? 1197 CYS A CA  1 
ATOM 8351  C C   . CYS A 1 1130 ? 259.430 1.367   -15.352 1.00 83.89  ? 1197 CYS A C   1 
ATOM 8352  O O   . CYS A 1 1130 ? 258.619 2.138   -14.832 1.00 83.92  ? 1197 CYS A O   1 
ATOM 8353  C CB  . CYS A 1 1130 ? 260.545 1.341   -13.154 1.00 85.56  ? 1197 CYS A CB  1 
ATOM 8354  S SG  . CYS A 1 1130 ? 259.888 0.007   -12.109 1.00 85.56  ? 1197 CYS A SG  1 
ATOM 8355  N N   . LYS A 1 1131 ? 259.254 0.865   -16.565 1.00 81.22  ? 1198 LYS A N   1 
ATOM 8356  C CA  . LYS A 1 1131 ? 258.001 1.124   -17.246 1.00 78.75  ? 1198 LYS A CA  1 
ATOM 8357  C C   . LYS A 1 1131 ? 257.204 0.199   -16.365 1.00 78.00  ? 1198 LYS A C   1 
ATOM 8358  O O   . LYS A 1 1131 ? 257.733 -0.834  -15.968 1.00 78.70  ? 1198 LYS A O   1 
ATOM 8359  C CB  . LYS A 1 1131 ? 258.037 0.590   -18.668 1.00 77.07  ? 1198 LYS A CB  1 
ATOM 8360  C CG  . LYS A 1 1131 ? 257.779 1.659   -19.692 1.00 74.92  ? 1198 LYS A CG  1 
ATOM 8361  C CD  . LYS A 1 1131 ? 258.596 2.893   -19.380 1.00 72.67  ? 1198 LYS A CD  1 
ATOM 8362  C CE  . LYS A 1 1131 ? 259.727 2.980   -20.344 1.00 72.68  ? 1198 LYS A CE  1 
ATOM 8363  N NZ  . LYS A 1 1131 ? 259.108 2.939   -21.701 1.00 73.39  ? 1198 LYS A NZ  1 
ATOM 8364  N N   . THR A 1 1132 ? 255.970 0.544   -16.038 1.00 76.53  ? 1199 THR A N   1 
ATOM 8365  C CA  . THR A 1 1132 ? 255.187 -0.302  -15.149 1.00 75.27  ? 1199 THR A CA  1 
ATOM 8366  C C   . THR A 1 1132 ? 255.634 -0.077  -13.701 1.00 73.54  ? 1199 THR A C   1 
ATOM 8367  O O   . THR A 1 1132 ? 256.796 -0.256  -13.357 1.00 73.09  ? 1199 THR A O   1 
ATOM 8368  C CB  . THR A 1 1132 ? 255.290 -1.827  -15.490 1.00 75.83  ? 1199 THR A CB  1 
ATOM 8369  O OG1 . THR A 1 1132 ? 256.434 -2.416  -14.851 1.00 75.93  ? 1199 THR A OG1 1 
ATOM 8370  C CG2 . THR A 1 1132 ? 255.386 -2.031  -16.989 1.00 77.04  ? 1199 THR A CG2 1 
ATOM 8371  N N   . PRO A 1 1133 ? 254.710 0.322   -12.832 1.00 72.11  ? 1200 PRO A N   1 
ATOM 8372  C CA  . PRO A 1 1133 ? 253.308 0.551   -13.146 1.00 71.24  ? 1200 PRO A CA  1 
ATOM 8373  C C   . PRO A 1 1133 ? 252.899 0.611   -14.620 1.00 71.24  ? 1200 PRO A C   1 
ATOM 8374  O O   . PRO A 1 1133 ? 253.223 1.583   -15.294 1.00 71.93  ? 1200 PRO A O   1 
ATOM 8375  C CB  . PRO A 1 1133 ? 253.015 1.837   -12.378 1.00 70.65  ? 1200 PRO A CB  1 
ATOM 8376  C CG  . PRO A 1 1133 ? 254.344 2.426   -12.108 1.00 70.21  ? 1200 PRO A CG  1 
ATOM 8377  C CD  . PRO A 1 1133 ? 255.110 1.219   -11.744 1.00 71.73  ? 1200 PRO A CD  1 
ATOM 8378  N N   . SER A 1 1134 ? 252.236 -0.452  -15.116 1.00 70.82  ? 1201 SER A N   1 
ATOM 8379  C CA  . SER A 1 1134 ? 251.744 -0.524  -16.496 1.00 71.61  ? 1201 SER A CA  1 
ATOM 8380  C C   . SER A 1 1134 ? 251.180 0.863   -16.564 1.00 70.70  ? 1201 SER A C   1 
ATOM 8381  O O   . SER A 1 1134 ? 251.157 1.516   -17.595 1.00 70.34  ? 1201 SER A O   1 
ATOM 8382  C CB  . SER A 1 1134 ? 250.637 -1.545  -16.613 1.00 73.45  ? 1201 SER A CB  1 
ATOM 8383  O OG  . SER A 1 1134 ? 249.622 -1.211  -15.704 1.00 75.47  ? 1201 SER A OG  1 
ATOM 8384  N N   . ASN A 1 1135 ? 250.710 1.283   -15.405 1.00 70.43  ? 1202 ASN A N   1 
ATOM 8385  C CA  . ASN A 1 1135 ? 250.253 2.630   -15.170 1.00 69.52  ? 1202 ASN A CA  1 
ATOM 8386  C C   . ASN A 1 1135 ? 250.836 2.863   -13.792 1.00 67.74  ? 1202 ASN A C   1 
ATOM 8387  O O   . ASN A 1 1135 ? 250.614 2.063   -12.881 1.00 67.36  ? 1202 ASN A O   1 
ATOM 8388  C CB  . ASN A 1 1135 ? 248.774 2.752   -14.973 1.00 72.53  ? 1202 ASN A CB  1 
ATOM 8389  C CG  . ASN A 1 1135 ? 248.454 3.755   -13.865 1.00 74.20  ? 1202 ASN A CG  1 
ATOM 8390  O OD1 . ASN A 1 1135 ? 248.299 4.944   -14.120 1.00 74.66  ? 1202 ASN A OD1 1 
ATOM 8391  N ND2 . ASN A 1 1135 ? 248.375 3.273   -12.621 1.00 75.46  ? 1202 ASN A ND2 1 
ATOM 8392  N N   . PRO A 1 1136 ? 251.566 3.960   -13.599 1.00 66.45  ? 1203 PRO A N   1 
ATOM 8393  C CA  . PRO A 1 1136 ? 251.924 5.010   -14.560 1.00 64.94  ? 1203 PRO A CA  1 
ATOM 8394  C C   . PRO A 1 1136 ? 253.205 4.708   -15.354 1.00 64.10  ? 1203 PRO A C   1 
ATOM 8395  O O   . PRO A 1 1136 ? 254.225 4.330   -14.772 1.00 64.17  ? 1203 PRO A O   1 
ATOM 8396  C CB  . PRO A 1 1136 ? 252.055 6.246   -13.670 1.00 65.72  ? 1203 PRO A CB  1 
ATOM 8397  C CG  . PRO A 1 1136 ? 252.469 5.675   -12.350 1.00 66.23  ? 1203 PRO A CG  1 
ATOM 8398  C CD  . PRO A 1 1136 ? 251.584 4.479   -12.223 1.00 66.50  ? 1203 PRO A CD  1 
ATOM 8399  N N   . THR A 1 1137 ? 253.160 4.902   -16.677 1.00 63.32  ? 1204 THR A N   1 
ATOM 8400  C CA  . THR A 1 1137 ? 254.322 4.599   -17.503 1.00 62.33  ? 1204 THR A CA  1 
ATOM 8401  C C   . THR A 1 1137 ? 254.884 5.466   -18.621 1.00 62.86  ? 1204 THR A C   1 
ATOM 8402  O O   . THR A 1 1137 ? 255.015 5.035   -19.756 1.00 62.96  ? 1204 THR A O   1 
ATOM 8403  C CB  . THR A 1 1137 ? 254.192 3.231   -18.092 1.00 60.87  ? 1204 THR A CB  1 
ATOM 8404  O OG1 . THR A 1 1137 ? 254.079 2.286   -17.036 1.00 59.72  ? 1204 THR A OG1 1 
ATOM 8405  C CG2 . THR A 1 1137 ? 255.407 2.886   -18.849 1.00 59.58  ? 1204 THR A CG2 1 
ATOM 8406  N N   . GLY A 1 1138 ? 255.201 6.703   -18.326 1.00 62.79  ? 1205 GLY A N   1 
ATOM 8407  C CA  . GLY A 1 1138 ? 255.876 7.463   -19.339 1.00 61.36  ? 1205 GLY A CA  1 
ATOM 8408  C C   . GLY A 1 1138 ? 257.189 7.204   -18.635 1.00 60.80  ? 1205 GLY A C   1 
ATOM 8409  O O   . GLY A 1 1138 ? 258.249 7.022   -19.207 1.00 59.89  ? 1205 GLY A O   1 
ATOM 8410  N N   . MET A 1 1139 ? 257.014 7.075   -17.327 1.00 61.72  ? 1206 MET A N   1 
ATOM 8411  C CA  . MET A 1 1139 ? 258.032 6.887   -16.305 1.00 63.81  ? 1206 MET A CA  1 
ATOM 8412  C C   . MET A 1 1139 ? 259.520 6.888   -16.456 1.00 64.35  ? 1206 MET A C   1 
ATOM 8413  O O   . MET A 1 1139 ? 260.186 5.893   -16.757 1.00 63.71  ? 1206 MET A O   1 
ATOM 8414  C CB  . MET A 1 1139 ? 257.659 5.761   -15.394 1.00 63.68  ? 1206 MET A CB  1 
ATOM 8415  C CG  . MET A 1 1139 ? 257.631 6.416   -14.069 1.00 63.62  ? 1206 MET A CG  1 
ATOM 8416  S SD  . MET A 1 1139 ? 256.878 5.568   -12.809 1.00 66.13  ? 1206 MET A SD  1 
ATOM 8417  C CE  . MET A 1 1139 ? 258.360 5.450   -11.767 1.00 66.44  ? 1206 MET A CE  1 
ATOM 8418  N N   . GLU A 1 1140 ? 260.003 8.053   -16.045 1.00 65.01  ? 1207 GLU A N   1 
ATOM 8419  C CA  . GLU A 1 1140 ? 261.373 8.463   -16.138 1.00 66.24  ? 1207 GLU A CA  1 
ATOM 8420  C C   . GLU A 1 1140 ? 261.233 8.763   -17.603 1.00 65.74  ? 1207 GLU A C   1 
ATOM 8421  O O   . GLU A 1 1140 ? 261.786 8.086   -18.471 1.00 64.89  ? 1207 GLU A O   1 
ATOM 8422  C CB  . GLU A 1 1140 ? 262.306 7.327   -15.927 1.00 70.29  ? 1207 GLU A CB  1 
ATOM 8423  C CG  . GLU A 1 1140 ? 262.209 6.716   -14.593 1.00 75.50  ? 1207 GLU A CG  1 
ATOM 8424  C CD  . GLU A 1 1140 ? 263.348 5.781   -14.443 1.00 77.98  ? 1207 GLU A CD  1 
ATOM 8425  O OE1 . GLU A 1 1140 ? 263.968 5.533   -15.496 1.00 80.23  ? 1207 GLU A OE1 1 
ATOM 8426  O OE2 . GLU A 1 1140 ? 263.641 5.303   -13.325 1.00 78.49  ? 1207 GLU A OE2 1 
ATOM 8427  N N   . ARG A 1 1141 ? 260.420 9.790   -17.829 1.00 66.59  ? 1208 ARG A N   1 
ATOM 8428  C CA  . ARG A 1 1141 ? 260.029 10.296  -19.121 1.00 67.82  ? 1208 ARG A CA  1 
ATOM 8429  C C   . ARG A 1 1141 ? 258.838 11.021  -18.532 1.00 67.92  ? 1208 ARG A C   1 
ATOM 8430  O O   . ARG A 1 1141 ? 258.719 12.229  -18.660 1.00 69.02  ? 1208 ARG A O   1 
ATOM 8431  C CB  . ARG A 1 1141 ? 259.599 9.124   -19.985 1.00 67.86  ? 1208 ARG A CB  1 
ATOM 8432  C CG  . ARG A 1 1141 ? 259.418 9.419   -21.429 1.00 68.15  ? 1208 ARG A CG  1 
ATOM 8433  C CD  . ARG A 1 1141 ? 259.121 8.156   -22.252 1.00 67.64  ? 1208 ARG A CD  1 
ATOM 8434  N NE  . ARG A 1 1141 ? 258.702 8.602   -23.572 1.00 67.42  ? 1208 ARG A NE  1 
ATOM 8435  C CZ  . ARG A 1 1141 ? 257.441 8.857   -23.907 1.00 66.92  ? 1208 ARG A CZ  1 
ATOM 8436  N NH1 . ARG A 1 1141 ? 256.447 8.668   -23.048 1.00 67.16  ? 1208 ARG A NH1 1 
ATOM 8437  N NH2 . ARG A 1 1141 ? 257.182 9.449   -25.053 1.00 66.02  ? 1208 ARG A NH2 1 
ATOM 8438  N N   . ARG A 1 1142 ? 257.995 10.250  -17.835 1.00 66.79  ? 1209 ARG A N   1 
ATOM 8439  C CA  . ARG A 1 1142 ? 256.821 10.758  -17.110 1.00 65.49  ? 1209 ARG A CA  1 
ATOM 8440  C C   . ARG A 1 1142 ? 257.628 11.578  -16.148 1.00 64.11  ? 1209 ARG A C   1 
ATOM 8441  O O   . ARG A 1 1142 ? 257.266 12.665  -15.698 1.00 61.90  ? 1209 ARG A O   1 
ATOM 8442  C CB  . ARG A 1 1142 ? 256.117 9.622   -16.369 1.00 65.96  ? 1209 ARG A CB  1 
ATOM 8443  C CG  . ARG A 1 1142 ? 254.654 9.880   -16.051 1.00 65.54  ? 1209 ARG A CG  1 
ATOM 8444  C CD  . ARG A 1 1142 ? 253.722 9.574   -17.232 1.00 66.45  ? 1209 ARG A CD  1 
ATOM 8445  N NE  . ARG A 1 1142 ? 254.287 9.922   -18.539 1.00 69.55  ? 1209 ARG A NE  1 
ATOM 8446  C CZ  . ARG A 1 1142 ? 253.593 10.027  -19.671 1.00 69.89  ? 1209 ARG A CZ  1 
ATOM 8447  N NH1 . ARG A 1 1142 ? 252.287 9.821   -19.696 1.00 70.19  ? 1209 ARG A NH1 1 
ATOM 8448  N NH2 . ARG A 1 1142 ? 254.211 10.334  -20.793 1.00 69.52  ? 1209 ARG A NH2 1 
ATOM 8449  N N   . TYR A 1 1143 ? 258.753 10.966  -15.837 1.00 64.39  ? 1210 TYR A N   1 
ATOM 8450  C CA  . TYR A 1 1143 ? 259.801 11.561  -15.059 1.00 66.07  ? 1210 TYR A CA  1 
ATOM 8451  C C   . TYR A 1 1143 ? 259.852 12.009  -13.623 1.00 68.45  ? 1210 TYR A C   1 
ATOM 8452  O O   . TYR A 1 1143 ? 258.983 11.822  -12.755 1.00 69.74  ? 1210 TYR A O   1 
ATOM 8453  C CB  . TYR A 1 1143 ? 260.369 12.736  -15.864 1.00 65.44  ? 1210 TYR A CB  1 
ATOM 8454  C CG  . TYR A 1 1143 ? 261.585 12.426  -16.709 1.00 66.03  ? 1210 TYR A CG  1 
ATOM 8455  C CD1 . TYR A 1 1143 ? 262.155 11.167  -16.715 1.00 66.45  ? 1210 TYR A CD1 1 
ATOM 8456  C CD2 . TYR A 1 1143 ? 262.147 13.396  -17.532 1.00 65.66  ? 1210 TYR A CD2 1 
ATOM 8457  C CE1 . TYR A 1 1143 ? 263.237 10.861  -17.527 1.00 64.78  ? 1210 TYR A CE1 1 
ATOM 8458  C CE2 . TYR A 1 1143 ? 263.256 13.102  -18.343 1.00 65.46  ? 1210 TYR A CE2 1 
ATOM 8459  C CZ  . TYR A 1 1143 ? 263.792 11.819  -18.331 1.00 64.58  ? 1210 TYR A CZ  1 
ATOM 8460  O OH  . TYR A 1 1143 ? 264.890 11.489  -19.097 1.00 64.17  ? 1210 TYR A OH  1 
ATOM 8461  N N   . GLY A 1 1144 ? 260.995 12.658  -13.489 1.00 71.28  ? 1211 GLY A N   1 
ATOM 8462  C CA  . GLY A 1 1144 ? 261.526 13.246  -12.310 1.00 75.60  ? 1211 GLY A CA  1 
ATOM 8463  C C   . GLY A 1 1144 ? 262.983 13.017  -12.668 1.00 78.80  ? 1211 GLY A C   1 
ATOM 8464  O O   . GLY A 1 1144 ? 263.572 13.719  -13.478 1.00 80.07  ? 1211 GLY A O   1 
ATOM 8465  N N   . ILE A 1 1145 ? 263.485 11.905  -12.167 1.00 81.40  ? 1212 ILE A N   1 
ATOM 8466  C CA  . ILE A 1 1145 ? 264.868 11.473  -12.235 1.00 84.92  ? 1212 ILE A CA  1 
ATOM 8467  C C   . ILE A 1 1145 ? 265.784 11.011  -13.399 1.00 86.80  ? 1212 ILE A C   1 
ATOM 8468  O O   . ILE A 1 1145 ? 266.483 11.825  -13.997 1.00 87.49  ? 1212 ILE A O   1 
ATOM 8469  C CB  . ILE A 1 1145 ? 265.023 10.452  -11.092 1.00 85.67  ? 1212 ILE A CB  1 
ATOM 8470  C CG1 . ILE A 1 1145 ? 265.039 11.195  -9.753  1.00 87.68  ? 1212 ILE A CG1 1 
ATOM 8471  C CG2 . ILE A 1 1145 ? 266.287 9.627   -11.247 1.00 86.79  ? 1212 ILE A CG2 1 
ATOM 8472  C CD1 . ILE A 1 1145 ? 263.879 12.148  -9.525  1.00 91.71  ? 1212 ILE A CD1 1 
ATOM 8473  N N   . PRO A 1 1146 ? 265.765 9.707   -13.737 1.00 88.43  ? 1213 PRO A N   1 
ATOM 8474  C CA  . PRO A 1 1146 ? 266.432 8.807   -14.679 1.00 89.20  ? 1213 PRO A CA  1 
ATOM 8475  C C   . PRO A 1 1146 ? 267.902 8.372   -14.484 1.00 89.00  ? 1213 PRO A C   1 
ATOM 8476  O O   . PRO A 1 1146 ? 268.857 9.156   -14.571 1.00 89.35  ? 1213 PRO A O   1 
ATOM 8477  C CB  . PRO A 1 1146 ? 266.103 9.447   -15.999 1.00 89.34  ? 1213 PRO A CB  1 
ATOM 8478  C CG  . PRO A 1 1146 ? 264.615 9.497   -15.782 1.00 88.90  ? 1213 PRO A CG  1 
ATOM 8479  C CD  . PRO A 1 1146 ? 264.391 9.811   -14.269 1.00 87.93  ? 1213 PRO A CD  1 
ATOM 8480  N N   . GLN A 1 1147 ? 267.998 7.069   -14.201 1.00 89.30  ? 1214 GLN A N   1 
ATOM 8481  C CA  . GLN A 1 1147 ? 269.191 6.257   -13.943 1.00 89.43  ? 1214 GLN A CA  1 
ATOM 8482  C C   . GLN A 1 1147 ? 270.642 6.716   -14.108 1.00 88.71  ? 1214 GLN A C   1 
ATOM 8483  O O   . GLN A 1 1147 ? 271.075 7.167   -15.176 1.00 87.04  ? 1214 GLN A O   1 
ATOM 8484  C CB  . GLN A 1 1147 ? 269.023 4.916   -14.678 1.00 89.92  ? 1214 GLN A CB  1 
ATOM 8485  C CG  . GLN A 1 1147 ? 268.345 5.025   -16.055 1.00 91.51  ? 1214 GLN A CG  1 
ATOM 8486  C CD  . GLN A 1 1147 ? 269.317 5.067   -17.235 1.00 92.50  ? 1214 GLN A CD  1 
ATOM 8487  O OE1 . GLN A 1 1147 ? 270.380 5.688   -17.170 1.00 93.16  ? 1214 GLN A OE1 1 
ATOM 8488  N NE2 . GLN A 1 1147 ? 268.938 4.416   -18.330 1.00 94.20  ? 1214 GLN A NE2 1 
ATOM 8489  N N   . GLY A 1 1148 ? 271.379 6.535   -13.009 1.00 88.66  ? 1215 GLY A N   1 
ATOM 8490  C CA  . GLY A 1 1148 ? 272.799 6.840   -12.913 1.00 89.48  ? 1215 GLY A CA  1 
ATOM 8491  C C   . GLY A 1 1148 ? 273.431 5.560   -12.378 1.00 89.79  ? 1215 GLY A C   1 
ATOM 8492  O O   . GLY A 1 1148 ? 272.927 4.977   -11.421 1.00 90.01  ? 1215 GLY A O   1 
ATOM 8493  N N   . GLU A 1 1149 ? 274.538 5.126   -12.971 1.00 90.51  ? 1216 GLU A N   1 
ATOM 8494  C CA  . GLU A 1 1149 ? 275.182 3.866   -12.587 1.00 89.31  ? 1216 GLU A CA  1 
ATOM 8495  C C   . GLU A 1 1149 ? 275.820 3.715   -11.222 1.00 86.59  ? 1216 GLU A C   1 
ATOM 8496  O O   . GLU A 1 1149 ? 275.954 4.666   -10.469 1.00 84.31  ? 1216 GLU A O   1 
ATOM 8497  C CB  . GLU A 1 1149 ? 276.230 3.480   -13.637 1.00 91.99  ? 1216 GLU A CB  1 
ATOM 8498  C CG  . GLU A 1 1149 ? 277.410 4.443   -13.763 1.00 95.61  ? 1216 GLU A CG  1 
ATOM 8499  C CD  . GLU A 1 1149 ? 278.442 3.954   -14.764 1.00 98.41  ? 1216 GLU A CD  1 
ATOM 8500  O OE1 . GLU A 1 1149 ? 278.389 2.765   -15.136 1.00 100.78 ? 1216 GLU A OE1 1 
ATOM 8501  O OE2 . GLU A 1 1149 ? 279.313 4.746   -15.175 1.00 100.41 ? 1216 GLU A OE2 1 
ATOM 8502  N N   . ALA A 1 1150 ? 276.195 2.477   -10.926 1.00 84.49  ? 1217 ALA A N   1 
ATOM 8503  C CA  . ALA A 1 1150 ? 276.872 2.119   -9.698  1.00 82.48  ? 1217 ALA A CA  1 
ATOM 8504  C C   . ALA A 1 1150 ? 278.277 1.949   -10.216 1.00 81.48  ? 1217 ALA A C   1 
ATOM 8505  O O   . ALA A 1 1150 ? 278.504 1.168   -11.122 1.00 80.48  ? 1217 ALA A O   1 
ATOM 8506  C CB  . ALA A 1 1150 ? 276.352 0.825   -9.193  1.00 83.14  ? 1217 ALA A CB  1 
ATOM 8507  N N   . LEU A 1 1151 ? 279.219 2.668   -9.632  1.00 81.09  ? 1218 LEU A N   1 
ATOM 8508  C CA  . LEU A 1 1151 ? 280.599 2.665   -10.092 1.00 80.88  ? 1218 LEU A CA  1 
ATOM 8509  C C   . LEU A 1 1151 ? 281.485 1.437   -10.291 1.00 80.80  ? 1218 LEU A C   1 
ATOM 8510  O O   . LEU A 1 1151 ? 282.326 1.460   -11.181 1.00 81.96  ? 1218 LEU A O   1 
ATOM 8511  C CB  . LEU A 1 1151 ? 281.381 3.685   -9.262  1.00 79.83  ? 1218 LEU A CB  1 
ATOM 8512  C CG  . LEU A 1 1151 ? 281.453 5.092   -9.872  1.00 79.68  ? 1218 LEU A CG  1 
ATOM 8513  C CD1 . LEU A 1 1151 ? 280.205 5.366   -10.667 1.00 78.52  ? 1218 LEU A CD1 1 
ATOM 8514  C CD2 . LEU A 1 1151 ? 281.631 6.141   -8.801  1.00 79.31  ? 1218 LEU A CD2 1 
ATOM 8515  N N   . ASP A 1 1152 ? 281.304 0.382   -9.504  1.00 80.25  ? 1219 ASP A N   1 
ATOM 8516  C CA  . ASP A 1 1152 ? 282.163 -0.812  -9.566  1.00 79.29  ? 1219 ASP A CA  1 
ATOM 8517  C C   . ASP A 1 1152 ? 283.101 -0.532  -8.425  1.00 76.90  ? 1219 ASP A C   1 
ATOM 8518  O O   . ASP A 1 1152 ? 282.949 0.468   -7.740  1.00 75.90  ? 1219 ASP A O   1 
ATOM 8519  C CB  . ASP A 1 1152 ? 282.994 -0.886  -10.849 1.00 82.97  ? 1219 ASP A CB  1 
ATOM 8520  C CG  . ASP A 1 1152 ? 282.387 -1.791  -11.891 1.00 86.80  ? 1219 ASP A CG  1 
ATOM 8521  O OD1 . ASP A 1 1152 ? 281.145 -1.772  -12.050 1.00 86.97  ? 1219 ASP A OD1 1 
ATOM 8522  O OD2 . ASP A 1 1152 ? 283.159 -2.513  -12.557 1.00 88.45  ? 1219 ASP A OD2 1 
ATOM 8523  N N   . ILE A 1 1153 ? 284.090 -1.374  -8.215  1.00 74.10  ? 1220 ILE A N   1 
ATOM 8524  C CA  . ILE A 1 1153 ? 284.971 -1.091  -7.116  1.00 71.36  ? 1220 ILE A CA  1 
ATOM 8525  C C   . ILE A 1 1153 ? 286.196 -0.376  -7.588  1.00 69.83  ? 1220 ILE A C   1 
ATOM 8526  O O   . ILE A 1 1153 ? 286.665 0.563   -6.948  1.00 70.98  ? 1220 ILE A O   1 
ATOM 8527  C CB  . ILE A 1 1153 ? 285.415 -2.331  -6.441  1.00 71.17  ? 1220 ILE A CB  1 
ATOM 8528  C CG1 . ILE A 1 1153 ? 284.198 -3.073  -5.904  1.00 72.12  ? 1220 ILE A CG1 1 
ATOM 8529  C CG2 . ILE A 1 1153 ? 286.387 -1.960  -5.349  1.00 70.07  ? 1220 ILE A CG2 1 
ATOM 8530  C CD1 . ILE A 1 1153 ? 283.157 -3.410  -6.951  1.00 91.71  ? 1220 ILE A CD1 1 
ATOM 8531  N N   . TYR A 1 1154 ? 286.714 -0.835  -8.720  1.00 66.97  ? 1221 TYR A N   1 
ATOM 8532  C CA  . TYR A 1 1154 ? 287.918 -0.264  -9.308  1.00 62.88  ? 1221 TYR A CA  1 
ATOM 8533  C C   . TYR A 1 1154 ? 287.731 1.225   -9.595  1.00 60.89  ? 1221 TYR A C   1 
ATOM 8534  O O   . TYR A 1 1154 ? 288.524 2.062   -9.173  1.00 59.78  ? 1221 TYR A O   1 
ATOM 8535  C CB  . TYR A 1 1154 ? 288.280 -1.013  -10.608 1.00 62.21  ? 1221 TYR A CB  1 
ATOM 8536  C CG  . TYR A 1 1154 ? 288.181 -2.530  -10.529 1.00 60.45  ? 1221 TYR A CG  1 
ATOM 8537  C CD1 . TYR A 1 1154 ? 286.935 -3.158  -10.473 1.00 58.76  ? 1221 TYR A CD1 1 
ATOM 8538  C CD2 . TYR A 1 1154 ? 289.325 -3.330  -10.508 1.00 60.49  ? 1221 TYR A CD2 1 
ATOM 8539  C CE1 . TYR A 1 1154 ? 286.830 -4.520  -10.398 1.00 56.53  ? 1221 TYR A CE1 1 
ATOM 8540  C CE2 . TYR A 1 1154 ? 289.226 -4.698  -10.429 1.00 58.85  ? 1221 TYR A CE2 1 
ATOM 8541  C CZ  . TYR A 1 1154 ? 287.971 -5.282  -10.373 1.00 56.55  ? 1221 TYR A CZ  1 
ATOM 8542  O OH  . TYR A 1 1154 ? 287.830 -6.638  -10.272 1.00 54.88  ? 1221 TYR A OH  1 
ATOM 8543  N N   . GLN A 1 1155 ? 286.667 1.542   -10.313 1.00 59.12  ? 1222 GLN A N   1 
ATOM 8544  C CA  . GLN A 1 1155 ? 286.363 2.914   -10.674 1.00 58.59  ? 1222 GLN A CA  1 
ATOM 8545  C C   . GLN A 1 1155 ? 286.245 3.830   -9.451  1.00 57.23  ? 1222 GLN A C   1 
ATOM 8546  O O   . GLN A 1 1155 ? 287.054 4.733   -9.246  1.00 55.70  ? 1222 GLN A O   1 
ATOM 8547  C CB  . GLN A 1 1155 ? 285.056 2.935   -11.472 1.00 59.53  ? 1222 GLN A CB  1 
ATOM 8548  C CG  . GLN A 1 1155 ? 284.999 1.920   -12.621 1.00 59.29  ? 1222 GLN A CG  1 
ATOM 8549  C CD  . GLN A 1 1155 ? 283.649 1.898   -13.337 1.00 59.35  ? 1222 GLN A CD  1 
ATOM 8550  O OE1 . GLN A 1 1155 ? 283.138 2.931   -13.760 1.00 58.70  ? 1222 GLN A OE1 1 
ATOM 8551  N NE2 . GLN A 1 1155 ? 283.076 0.711   -13.479 1.00 58.69  ? 1222 GLN A NE2 1 
ATOM 8552  N N   . ILE A 1 1156 ? 285.221 3.586   -8.649  1.00 56.42  ? 1223 ILE A N   1 
ATOM 8553  C CA  . ILE A 1 1156 ? 284.973 4.381   -7.466  1.00 56.18  ? 1223 ILE A CA  1 
ATOM 8554  C C   . ILE A 1 1156 ? 286.248 4.787   -6.749  1.00 56.81  ? 1223 ILE A C   1 
ATOM 8555  O O   . ILE A 1 1156 ? 286.468 5.965   -6.481  1.00 54.68  ? 1223 ILE A O   1 
ATOM 8556  C CB  . ILE A 1 1156 ? 284.030 3.624   -6.496  1.00 56.61  ? 1223 ILE A CB  1 
ATOM 8557  C CG1 . ILE A 1 1156 ? 284.019 4.286   -5.117  1.00 56.71  ? 1223 ILE A CG1 1 
ATOM 8558  C CG2 . ILE A 1 1156 ? 284.453 2.190   -6.391  1.00 56.66  ? 1223 ILE A CG2 1 
ATOM 8559  C CD1 . ILE A 1 1156 ? 285.012 3.696   -4.153  1.00 91.71  ? 1223 ILE A CD1 1 
ATOM 8560  N N   . ILE A 1 1157 ? 287.102 3.827   -6.444  1.00 59.09  ? 1224 ILE A N   1 
ATOM 8561  C CA  . ILE A 1 1157 ? 288.316 4.170   -5.738  1.00 62.32  ? 1224 ILE A CA  1 
ATOM 8562  C C   . ILE A 1 1157 ? 289.130 5.225   -6.494  1.00 65.48  ? 1224 ILE A C   1 
ATOM 8563  O O   . ILE A 1 1157 ? 289.730 6.103   -5.883  1.00 66.39  ? 1224 ILE A O   1 
ATOM 8564  C CB  . ILE A 1 1157 ? 289.153 2.922   -5.495  1.00 61.21  ? 1224 ILE A CB  1 
ATOM 8565  C CG1 . ILE A 1 1157 ? 290.314 3.205   -4.525  1.00 60.41  ? 1224 ILE A CG1 1 
ATOM 8566  C CG2 . ILE A 1 1157 ? 289.669 2.405   -6.810  1.00 61.37  ? 1224 ILE A CG2 1 
ATOM 8567  C CD1 . ILE A 1 1157 ? 290.482 4.625   -3.967  1.00 91.71  ? 1224 ILE A CD1 1 
ATOM 8568  N N   . GLU A 1 1158 ? 289.133 5.163   -7.818  1.00 67.81  ? 1225 GLU A N   1 
ATOM 8569  C CA  . GLU A 1 1158 ? 289.896 6.129   -8.604  1.00 68.92  ? 1225 GLU A CA  1 
ATOM 8570  C C   . GLU A 1 1158 ? 289.571 7.597   -8.306  1.00 68.42  ? 1225 GLU A C   1 
ATOM 8571  O O   . GLU A 1 1158 ? 290.471 8.424   -8.183  1.00 67.67  ? 1225 GLU A O   1 
ATOM 8572  C CB  . GLU A 1 1158 ? 289.690 5.867   -10.096 1.00 71.69  ? 1225 GLU A CB  1 
ATOM 8573  C CG  . GLU A 1 1158 ? 290.824 5.140   -10.798 1.00 77.37  ? 1225 GLU A CG  1 
ATOM 8574  C CD  . GLU A 1 1158 ? 291.449 5.991   -11.886 1.00 80.33  ? 1225 GLU A CD  1 
ATOM 8575  O OE1 . GLU A 1 1158 ? 291.917 5.414   -12.893 1.00 82.12  ? 1225 GLU A OE1 1 
ATOM 8576  O OE2 . GLU A 1 1158 ? 291.478 7.236   -11.730 1.00 83.13  ? 1225 GLU A OE2 1 
ATOM 8577  N N   . LEU A 1 1159 ? 288.288 7.923   -8.198  1.00 69.31  ? 1226 LEU A N   1 
ATOM 8578  C CA  . LEU A 1 1159 ? 287.869 9.302   -7.947  1.00 70.44  ? 1226 LEU A CA  1 
ATOM 8579  C C   . LEU A 1 1159 ? 288.140 9.741   -6.511  1.00 70.53  ? 1226 LEU A C   1 
ATOM 8580  O O   . LEU A 1 1159 ? 288.639 10.842  -6.261  1.00 71.24  ? 1226 LEU A O   1 
ATOM 8581  C CB  . LEU A 1 1159 ? 286.369 9.480   -8.228  1.00 71.99  ? 1226 LEU A CB  1 
ATOM 8582  C CG  . LEU A 1 1159 ? 285.596 8.653   -9.266  1.00 74.51  ? 1226 LEU A CG  1 
ATOM 8583  C CD1 . LEU A 1 1159 ? 286.314 8.661   -10.612 1.00 75.17  ? 1226 LEU A CD1 1 
ATOM 8584  C CD2 . LEU A 1 1159 ? 285.433 7.236   -8.756  1.00 75.59  ? 1226 LEU A CD2 1 
ATOM 8585  N N   . THR A 1 1160 ? 287.791 8.873   -5.571  1.00 69.64  ? 1227 THR A N   1 
ATOM 8586  C CA  . THR A 1 1160 ? 287.973 9.159   -4.157  1.00 68.29  ? 1227 THR A CA  1 
ATOM 8587  C C   . THR A 1 1160 ? 289.432 9.058   -3.747  1.00 68.82  ? 1227 THR A C   1 
ATOM 8588  O O   . THR A 1 1160 ? 289.894 9.814   -2.902  1.00 68.21  ? 1227 THR A O   1 
ATOM 8589  C CB  . THR A 1 1160 ? 287.210 8.174   -3.299  1.00 67.14  ? 1227 THR A CB  1 
ATOM 8590  O OG1 . THR A 1 1160 ? 288.125 7.202   -2.786  1.00 65.71  ? 1227 THR A OG1 1 
ATOM 8591  C CG2 . THR A 1 1160 ? 286.160 7.463   -4.123  1.00 67.18  ? 1227 THR A CG2 1 
ATOM 8592  N N   . LYS A 1 1161 ? 290.145 8.105   -4.337  1.00 70.03  ? 1228 LYS A N   1 
ATOM 8593  C CA  . LYS A 1 1161 ? 291.555 7.894   -4.034  1.00 72.17  ? 1228 LYS A CA  1 
ATOM 8594  C C   . LYS A 1 1161 ? 291.770 7.873   -2.536  1.00 73.12  ? 1228 LYS A C   1 
ATOM 8595  O O   . LYS A 1 1161 ? 291.817 8.919   -1.901  1.00 73.47  ? 1228 LYS A O   1 
ATOM 8596  C CB  . LYS A 1 1161 ? 292.438 9.007   -4.648  1.00 73.02  ? 1228 LYS A CB  1 
ATOM 8597  C CG  . LYS A 1 1161 ? 292.649 8.963   -6.183  1.00 74.43  ? 1228 LYS A CG  1 
ATOM 8598  C CD  . LYS A 1 1161 ? 293.800 8.048   -6.663  1.00 75.84  ? 1228 LYS A CD  1 
ATOM 8599  C CE  . LYS A 1 1161 ? 293.562 6.565   -6.336  1.00 76.48  ? 1228 LYS A CE  1 
ATOM 8600  N NZ  . LYS A 1 1161 ? 294.409 5.634   -7.140  1.00 76.54  ? 1228 LYS A NZ  1 
ATOM 8601  N N   . GLY A 1 1162 ? 291.882 6.678   -1.976  1.00 73.93  ? 1229 GLY A N   1 
ATOM 8602  C CA  . GLY A 1 1162 ? 292.141 6.547   -0.555  1.00 75.85  ? 1229 GLY A CA  1 
ATOM 8603  C C   . GLY A 1 1162 ? 291.297 7.330   0.427   1.00 77.83  ? 1229 GLY A C   1 
ATOM 8604  O O   . GLY A 1 1162 ? 291.820 7.918   1.371   1.00 77.70  ? 1229 GLY A O   1 
ATOM 8605  N N   . SER A 1 1163 ? 289.991 7.332   0.202   1.00 80.02  ? 1230 SER A N   1 
ATOM 8606  C CA  . SER A 1 1163 ? 289.029 7.999   1.077   1.00 81.23  ? 1230 SER A CA  1 
ATOM 8607  C C   . SER A 1 1163 ? 289.270 9.423   1.529   1.00 83.72  ? 1230 SER A C   1 
ATOM 8608  O O   . SER A 1 1163 ? 289.751 10.245  0.751   1.00 83.61  ? 1230 SER A O   1 
ATOM 8609  C CB  . SER A 1 1163 ? 288.768 7.143   2.301   1.00 79.61  ? 1230 SER A CB  1 
ATOM 8610  O OG  . SER A 1 1163 ? 287.967 6.040   1.942   1.00 77.71  ? 1230 SER A OG  1 
ATOM 8611  N N   . LEU A 1 1164 ? 288.950 9.721   2.793   1.00 87.17  ? 1231 LEU A N   1 
ATOM 8612  C CA  . LEU A 1 1164 ? 289.088 11.100  3.234   1.00 91.24  ? 1231 LEU A CA  1 
ATOM 8613  C C   . LEU A 1 1164 ? 289.156 11.550  4.701   1.00 95.73  ? 1231 LEU A C   1 
ATOM 8614  O O   . LEU A 1 1164 ? 289.291 10.783  5.656   1.00 95.17  ? 1231 LEU A O   1 
ATOM 8615  C CB  . LEU A 1 1164 ? 287.962 11.917  2.576   1.00 88.76  ? 1231 LEU A CB  1 
ATOM 8616  C CG  . LEU A 1 1164 ? 288.226 13.328  2.022   1.00 87.60  ? 1231 LEU A CG  1 
ATOM 8617  C CD1 . LEU A 1 1164 ? 288.788 13.203  0.629   1.00 87.19  ? 1231 LEU A CD1 1 
ATOM 8618  C CD2 . LEU A 1 1164 ? 286.942 14.149  1.979   1.00 86.72  ? 1231 LEU A CD2 1 
ATOM 8619  N N   . GLU A 1 1165 ? 289.055 12.876  4.769   1.00 101.45 ? 1232 GLU A N   1 
ATOM 8620  C CA  . GLU A 1 1165 ? 289.029 13.792  5.907   1.00 106.62 ? 1232 GLU A CA  1 
ATOM 8621  C C   . GLU A 1 1165 ? 288.559 14.981  5.037   1.00 109.17 ? 1232 GLU A C   1 
ATOM 8622  O O   . GLU A 1 1165 ? 287.362 15.147  4.786   1.00 109.81 ? 1232 GLU A O   1 
ATOM 8623  C CB  . GLU A 1 1165 ? 290.433 14.088  6.451   1.00 107.75 ? 1232 GLU A CB  1 
ATOM 8624  C CG  . GLU A 1 1165 ? 291.323 12.886  6.610   1.00 108.14 ? 1232 GLU A CG  1 
ATOM 8625  C CD  . GLU A 1 1165 ? 292.240 13.002  7.797   1.00 108.17 ? 1232 GLU A CD  1 
ATOM 8626  O OE1 . GLU A 1 1165 ? 292.818 14.085  8.013   1.00 109.42 ? 1232 GLU A OE1 1 
ATOM 8627  O OE2 . GLU A 1 1165 ? 292.392 11.995  8.510   1.00 107.30 ? 1232 GLU A OE2 1 
ATOM 8628  N N   . LYS A 1 1166 ? 289.522 15.768  4.547   1.00 111.86 ? 1233 LYS A N   1 
ATOM 8629  C CA  . LYS A 1 1166 ? 289.289 16.895  3.634   1.00 113.64 ? 1233 LYS A CA  1 
ATOM 8630  C C   . LYS A 1 1166 ? 290.531 16.886  2.733   1.00 114.76 ? 1233 LYS A C   1 
ATOM 8631  O O   . LYS A 1 1166 ? 290.761 17.785  1.924   1.00 114.85 ? 1233 LYS A O   1 
ATOM 8632  C CB  . LYS A 1 1166 ? 289.158 18.241  4.390   1.00 113.85 ? 1233 LYS A CB  1 
ATOM 8633  C CG  . LYS A 1 1166 ? 289.466 18.213  5.901   1.00 113.49 ? 1233 LYS A CG  1 
ATOM 8634  C CD  . LYS A 1 1166 ? 288.899 19.432  6.676   1.00 113.54 ? 1233 LYS A CD  1 
ATOM 8635  C CE  . LYS A 1 1166 ? 287.427 19.264  7.083   1.00 113.17 ? 1233 LYS A CE  1 
ATOM 8636  N NZ  . LYS A 1 1166 ? 286.447 19.796  6.086   1.00 113.39 ? 1233 LYS A NZ  1 
ATOM 8637  N N   . ARG A 1 1167 ? 291.299 15.808  2.874   1.00 116.28 ? 1234 ARG A N   1 
ATOM 8638  C CA  . ARG A 1 1167 ? 292.551 15.598  2.161   1.00 117.94 ? 1234 ARG A CA  1 
ATOM 8639  C C   . ARG A 1 1167 ? 292.565 15.090  0.700   1.00 118.62 ? 1234 ARG A C   1 
ATOM 8640  O O   . ARG A 1 1167 ? 293.299 15.654  -0.108  1.00 118.68 ? 1234 ARG A O   1 
ATOM 8641  C CB  . ARG A 1 1167 ? 293.476 14.709  3.026   1.00 118.45 ? 1234 ARG A CB  1 
ATOM 8642  C CG  . ARG A 1 1167 ? 292.847 13.384  3.488   1.00 119.55 ? 1234 ARG A CG  1 
ATOM 8643  C CD  . ARG A 1 1167 ? 293.837 12.376  4.115   1.00 119.68 ? 1234 ARG A CD  1 
ATOM 8644  N NE  . ARG A 1 1167 ? 293.992 12.469  5.574   1.00 120.95 ? 1234 ARG A NE  1 
ATOM 8645  C CZ  . ARG A 1 1167 ? 294.350 11.448  6.359   1.00 121.42 ? 1234 ARG A CZ  1 
ATOM 8646  N NH1 . ARG A 1 1167 ? 294.583 10.249  5.840   1.00 121.92 ? 1234 ARG A NH1 1 
ATOM 8647  N NH2 . ARG A 1 1167 ? 294.499 11.620  7.666   1.00 121.55 ? 1234 ARG A NH2 1 
ATOM 8648  N N   . SER A 1 1168 ? 291.792 14.062  0.333   1.00 119.22 ? 1235 SER A N   1 
ATOM 8649  C CA  . SER A 1 1168 ? 291.847 13.555  -1.060  1.00 119.61 ? 1235 SER A CA  1 
ATOM 8650  C C   . SER A 1 1168 ? 291.487 14.642  -2.084  1.00 119.98 ? 1235 SER A C   1 
ATOM 8651  O O   . SER A 1 1168 ? 292.116 14.778  -3.134  1.00 119.59 ? 1235 SER A O   1 
ATOM 8652  C CB  . SER A 1 1168 ? 290.930 12.334  -1.234  1.00 119.52 ? 1235 SER A CB  1 
ATOM 8653  O OG  . SER A 1 1168 ? 291.423 11.456  -2.233  1.00 119.20 ? 1235 SER A OG  1 
ATOM 8654  N N   . GLN A 1 1169 ? 290.453 15.392  -1.737  1.00 120.89 ? 1236 GLN A N   1 
ATOM 8655  C CA  . GLN A 1 1169 ? 289.893 16.533  -2.455  1.00 122.34 ? 1236 GLN A CA  1 
ATOM 8656  C C   . GLN A 1 1169 ? 289.933 16.875  -3.970  1.00 123.15 ? 1236 GLN A C   1 
ATOM 8657  O O   . GLN A 1 1169 ? 289.283 16.189  -4.764  1.00 123.75 ? 1236 GLN A O   1 
ATOM 8658  C CB  . GLN A 1 1169 ? 290.265 17.775  -1.640  1.00 122.87 ? 1236 GLN A CB  1 
ATOM 8659  C CG  . GLN A 1 1169 ? 289.218 18.181  -0.643  1.00 122.97 ? 1236 GLN A CG  1 
ATOM 8660  C CD  . GLN A 1 1169 ? 288.642 17.005  0.116   1.00 122.97 ? 1236 GLN A CD  1 
ATOM 8661  O OE1 . GLN A 1 1169 ? 287.468 17.011  0.470   1.00 123.14 ? 1236 GLN A OE1 1 
ATOM 8662  N NE2 . GLN A 1 1169 ? 289.465 15.997  0.380   1.00 121.64 ? 1236 GLN A NE2 1 
ATOM 8663  N N   . PRO A 1 1170 ? 290.694 17.928  -4.387  1.00 123.33 ? 1237 PRO A N   1 
ATOM 8664  C CA  . PRO A 1 1170 ? 290.784 18.373  -5.788  1.00 123.02 ? 1237 PRO A CA  1 
ATOM 8665  C C   . PRO A 1 1170 ? 291.398 17.503  -6.892  1.00 122.90 ? 1237 PRO A C   1 
ATOM 8666  O O   . PRO A 1 1170 ? 292.288 16.681  -6.649  1.00 122.38 ? 1237 PRO A O   1 
ATOM 8667  C CB  . PRO A 1 1170 ? 291.526 19.695  -5.657  1.00 123.33 ? 1237 PRO A CB  1 
ATOM 8668  C CG  . PRO A 1 1170 ? 292.583 19.325  -4.702  1.00 123.42 ? 1237 PRO A CG  1 
ATOM 8669  C CD  . PRO A 1 1170 ? 291.825 18.524  -3.637  1.00 123.10 ? 1237 PRO A CD  1 
ATOM 8670  N N   . GLY A 1 1171 ? 290.923 17.730  -8.120  1.00 123.14 ? 1238 GLY A N   1 
ATOM 8671  C CA  . GLY A 1 1171 ? 291.414 16.992  -9.275  1.00 123.38 ? 1238 GLY A CA  1 
ATOM 8672  C C   . GLY A 1 1171 ? 290.371 16.393  -10.218 1.00 123.76 ? 1238 GLY A C   1 
ATOM 8673  O O   . GLY A 1 1171 ? 290.254 16.842  -11.369 1.00 123.18 ? 1238 GLY A O   1 
ATOM 8674  N N   . PRO A 1 1172 ? 289.596 15.380  -9.766  1.00 124.26 ? 1239 PRO A N   1 
ATOM 8675  C CA  . PRO A 1 1172 ? 288.562 14.706  -10.561 1.00 124.47 ? 1239 PRO A CA  1 
ATOM 8676  C C   . PRO A 1 1172 ? 287.821 15.617  -11.524 1.00 124.17 ? 1239 PRO A C   1 
ATOM 8677  O O   . PRO A 1 1172 ? 288.058 15.499  -12.744 1.00 91.71  ? 1239 PRO A O   1 
ATOM 8678  C CB  . PRO A 1 1172 ? 287.637 14.137  -9.498  1.00 124.68 ? 1239 PRO A CB  1 
ATOM 8679  C CG  . PRO A 1 1172 ? 288.590 13.752  -8.430  1.00 124.44 ? 1239 PRO A CG  1 
ATOM 8680  C CD  . PRO A 1 1172 ? 289.518 14.946  -8.357  1.00 124.35 ? 1239 PRO A CD  1 
ATOM 8681  O OXT . PRO A 1 1172 ? 287.017 16.438  -11.039 1.00 79.96  ? 1239 PRO A OXT 1 
ATOM 8682  N N   . GLU B 2 9    ? 236.888 52.558  -38.735 1.00 80.02  ? 67   GLU B N   1 
ATOM 8683  C CA  . GLU B 2 9    ? 235.482 52.716  -38.293 1.00 81.04  ? 67   GLU B CA  1 
ATOM 8684  C C   . GLU B 2 9    ? 235.434 52.776  -36.777 1.00 82.60  ? 67   GLU B C   1 
ATOM 8685  O O   . GLU B 2 9    ? 236.314 52.243  -36.101 1.00 82.93  ? 67   GLU B O   1 
ATOM 8686  C CB  . GLU B 2 9    ? 234.643 51.538  -38.782 1.00 80.46  ? 67   GLU B CB  1 
ATOM 8687  C CG  . GLU B 2 9    ? 233.186 51.599  -38.382 1.00 80.44  ? 67   GLU B CG  1 
ATOM 8688  C CD  . GLU B 2 9    ? 232.414 52.639  -39.162 1.00 81.13  ? 67   GLU B CD  1 
ATOM 8689  O OE1 . GLU B 2 9    ? 231.359 53.089  -38.669 1.00 81.74  ? 67   GLU B OE1 1 
ATOM 8690  O OE2 . GLU B 2 9    ? 232.856 52.997  -40.273 1.00 81.63  ? 67   GLU B OE2 1 
ATOM 8691  N N   . ALA B 2 10   ? 234.406 53.444  -36.255 1.00 84.78  ? 68   ALA B N   1 
ATOM 8692  C CA  . ALA B 2 10   ? 234.211 53.568  -34.814 1.00 86.71  ? 68   ALA B CA  1 
ATOM 8693  C C   . ALA B 2 10   ? 234.253 52.148  -34.265 1.00 87.55  ? 68   ALA B C   1 
ATOM 8694  O O   . ALA B 2 10   ? 235.008 51.839  -33.345 1.00 86.85  ? 68   ALA B O   1 
ATOM 8695  C CB  . ALA B 2 10   ? 232.850 54.230  -34.510 1.00 87.11  ? 68   ALA B CB  1 
ATOM 8696  N N   . LEU B 2 11   ? 233.451 51.273  -34.849 1.00 89.48  ? 69   LEU B N   1 
ATOM 8697  C CA  . LEU B 2 11   ? 233.456 49.905  -34.406 1.00 91.11  ? 69   LEU B CA  1 
ATOM 8698  C C   . LEU B 2 11   ? 234.754 49.257  -34.860 1.00 92.81  ? 69   LEU B C   1 
ATOM 8699  O O   . LEU B 2 11   ? 235.359 48.493  -34.127 1.00 92.83  ? 69   LEU B O   1 
ATOM 8700  C CB  . LEU B 2 11   ? 232.250 49.168  -34.969 1.00 89.85  ? 69   LEU B CB  1 
ATOM 8701  C CG  . LEU B 2 11   ? 232.050 49.133  -36.474 1.00 89.11  ? 69   LEU B CG  1 
ATOM 8702  C CD1 . LEU B 2 11   ? 232.919 48.057  -37.096 1.00 88.18  ? 69   LEU B CD1 1 
ATOM 8703  C CD2 . LEU B 2 11   ? 230.591 48.854  -36.748 1.00 88.47  ? 69   LEU B CD2 1 
ATOM 8704  N N   . LEU B 2 12   ? 235.213 49.589  -36.058 1.00 95.13  ? 70   LEU B N   1 
ATOM 8705  C CA  . LEU B 2 12   ? 236.440 48.985  -36.551 1.00 97.78  ? 70   LEU B CA  1 
ATOM 8706  C C   . LEU B 2 12   ? 237.532 48.853  -35.497 1.00 100.04 ? 70   LEU B C   1 
ATOM 8707  O O   . LEU B 2 12   ? 238.045 47.757  -35.298 1.00 100.08 ? 70   LEU B O   1 
ATOM 8708  C CB  . LEU B 2 12   ? 236.992 49.751  -37.758 1.00 97.44  ? 70   LEU B CB  1 
ATOM 8709  C CG  . LEU B 2 12   ? 237.007 48.883  -39.019 1.00 97.29  ? 70   LEU B CG  1 
ATOM 8710  C CD1 . LEU B 2 12   ? 235.571 48.545  -39.381 1.00 96.87  ? 70   LEU B CD1 1 
ATOM 8711  C CD2 . LEU B 2 12   ? 237.704 49.591  -40.165 1.00 97.15  ? 70   LEU B CD2 1 
ATOM 8712  N N   . GLU B 2 13   ? 237.883 49.949  -34.818 1.00 103.17 ? 71   GLU B N   1 
ATOM 8713  C CA  . GLU B 2 13   ? 238.942 49.909  -33.801 1.00 105.30 ? 71   GLU B CA  1 
ATOM 8714  C C   . GLU B 2 13   ? 238.566 49.038  -32.617 1.00 106.24 ? 71   GLU B C   1 
ATOM 8715  O O   . GLU B 2 13   ? 239.395 48.284  -32.107 1.00 106.70 ? 71   GLU B O   1 
ATOM 8716  C CB  . GLU B 2 13   ? 239.280 51.311  -33.303 1.00 105.71 ? 71   GLU B CB  1 
ATOM 8717  C CG  . GLU B 2 13   ? 240.027 52.149  -34.324 1.00 106.73 ? 71   GLU B CG  1 
ATOM 8718  C CD  . GLU B 2 13   ? 240.521 53.453  -33.734 1.00 107.87 ? 71   GLU B CD  1 
ATOM 8719  O OE1 . GLU B 2 13   ? 239.680 54.244  -33.256 1.00 108.16 ? 71   GLU B OE1 1 
ATOM 8720  O OE2 . GLU B 2 13   ? 241.751 53.682  -33.737 1.00 108.32 ? 71   GLU B OE2 1 
ATOM 8721  N N   . ILE B 2 14   ? 237.322 49.143  -32.170 1.00 107.03 ? 72   ILE B N   1 
ATOM 8722  C CA  . ILE B 2 14   ? 236.880 48.323  -31.056 1.00 107.84 ? 72   ILE B CA  1 
ATOM 8723  C C   . ILE B 2 14   ? 236.779 46.879  -31.550 1.00 109.63 ? 72   ILE B C   1 
ATOM 8724  O O   . ILE B 2 14   ? 237.153 45.952  -30.848 1.00 110.24 ? 72   ILE B O   1 
ATOM 8725  C CB  . ILE B 2 14   ? 235.516 48.747  -30.579 1.00 106.91 ? 72   ILE B CB  1 
ATOM 8726  C CG1 . ILE B 2 14   ? 234.546 48.459  -31.700 1.00 106.38 ? 72   ILE B CG1 1 
ATOM 8727  C CG2 . ILE B 2 14   ? 235.533 50.224  -30.194 1.00 107.10 ? 72   ILE B CG2 1 
ATOM 8728  C CD1 . ILE B 2 14   ? 233.152 48.694  -31.371 1.00 105.22 ? 72   ILE B CD1 1 
ATOM 8729  N N   . CYS B 2 15   ? 236.240 46.679  -32.748 1.00 111.18 ? 73   CYS B N   1 
ATOM 8730  C CA  . CYS B 2 15   ? 236.095 45.328  -33.300 1.00 112.27 ? 73   CYS B CA  1 
ATOM 8731  C C   . CYS B 2 15   ? 237.304 44.383  -33.101 1.00 113.13 ? 73   CYS B C   1 
ATOM 8732  O O   . CYS B 2 15   ? 237.114 43.202  -32.775 1.00 113.68 ? 73   CYS B O   1 
ATOM 8733  C CB  . CYS B 2 15   ? 235.782 45.424  -34.780 1.00 112.32 ? 73   CYS B CB  1 
ATOM 8734  S SG  . CYS B 2 15   ? 234.258 46.301  -35.114 1.00 111.38 ? 73   CYS B SG  1 
ATOM 8735  N N   . GLN B 2 16   ? 238.534 44.874  -33.278 1.00 114.09 ? 74   GLN B N   1 
ATOM 8736  C CA  . GLN B 2 16   ? 239.715 44.012  -33.109 1.00 115.05 ? 74   GLN B CA  1 
ATOM 8737  C C   . GLN B 2 16   ? 239.954 43.648  -31.665 1.00 114.22 ? 74   GLN B C   1 
ATOM 8738  O O   . GLN B 2 16   ? 240.288 42.543  -31.361 1.00 114.00 ? 74   GLN B O   1 
ATOM 8739  C CB  . GLN B 2 16   ? 241.015 44.710  -33.524 1.00 117.54 ? 74   GLN B CB  1 
ATOM 8740  C CG  . GLN B 2 16   ? 241.597 45.501  -32.323 1.00 121.39 ? 74   GLN B CG  1 
ATOM 8741  C CD  . GLN B 2 16   ? 243.114 45.626  -32.169 1.00 123.24 ? 74   GLN B CD  1 
ATOM 8742  O OE1 . GLN B 2 16   ? 243.600 46.728  -31.918 1.00 124.37 ? 74   GLN B OE1 1 
ATOM 8743  N NE2 . GLN B 2 16   ? 243.850 44.516  -32.251 1.00 123.26 ? 74   GLN B NE2 1 
ATOM 8744  N N   . ARG B 2 17   ? 239.838 44.626  -30.781 1.00 113.23 ? 75   ARG B N   1 
ATOM 8745  C CA  . ARG B 2 17   ? 240.157 44.465  -29.362 1.00 112.21 ? 75   ARG B CA  1 
ATOM 8746  C C   . ARG B 2 17   ? 240.409 43.024  -28.878 1.00 111.94 ? 75   ARG B C   1 
ATOM 8747  O O   . ARG B 2 17   ? 239.530 42.172  -28.789 1.00 112.14 ? 75   ARG B O   1 
ATOM 8748  C CB  . ARG B 2 17   ? 239.121 45.226  -28.560 1.00 111.21 ? 75   ARG B CB  1 
ATOM 8749  C CG  . ARG B 2 17   ? 239.083 46.594  -29.221 1.00 110.73 ? 75   ARG B CG  1 
ATOM 8750  C CD  . ARG B 2 17   ? 238.905 47.851  -28.423 1.00 110.40 ? 75   ARG B CD  1 
ATOM 8751  N NE  . ARG B 2 17   ? 238.786 48.948  -29.388 1.00 110.47 ? 75   ARG B NE  1 
ATOM 8752  C CZ  . ARG B 2 17   ? 239.174 50.200  -29.174 1.00 109.85 ? 75   ARG B CZ  1 
ATOM 8753  N NH1 . ARG B 2 17   ? 239.717 50.540  -28.012 1.00 109.79 ? 75   ARG B NH1 1 
ATOM 8754  N NH2 . ARG B 2 17   ? 239.033 51.112  -30.130 1.00 109.42 ? 75   ARG B NH2 1 
ATOM 8755  N N   . ARG B 2 18   ? 241.682 42.784  -28.591 1.00 111.79 ? 76   ARG B N   1 
ATOM 8756  C CA  . ARG B 2 18   ? 242.186 41.496  -28.143 1.00 111.04 ? 76   ARG B CA  1 
ATOM 8757  C C   . ARG B 2 18   ? 241.847 40.661  -29.337 1.00 110.67 ? 76   ARG B C   1 
ATOM 8758  O O   . ARG B 2 18   ? 241.422 39.516  -29.210 1.00 110.00 ? 76   ARG B O   1 
ATOM 8759  C CB  . ARG B 2 18   ? 241.413 40.965  -26.931 1.00 111.22 ? 76   ARG B CB  1 
ATOM 8760  C CG  . ARG B 2 18   ? 240.707 41.989  -26.068 1.00 110.88 ? 76   ARG B CG  1 
ATOM 8761  C CD  . ARG B 2 18   ? 241.647 42.759  -25.141 1.00 110.55 ? 76   ARG B CD  1 
ATOM 8762  N NE  . ARG B 2 18   ? 240.919 43.470  -24.083 1.00 108.63 ? 76   ARG B NE  1 
ATOM 8763  C CZ  . ARG B 2 18   ? 240.702 44.783  -24.051 1.00 107.49 ? 76   ARG B CZ  1 
ATOM 8764  N NH1 . ARG B 2 18   ? 241.153 45.562  -25.018 1.00 107.00 ? 76   ARG B NH1 1 
ATOM 8765  N NH2 . ARG B 2 18   ? 240.023 45.317  -23.048 1.00 106.73 ? 76   ARG B NH2 1 
ATOM 8766  N N   . HIS B 2 19   ? 241.998 41.289  -30.495 1.00 110.67 ? 77   HIS B N   1 
ATOM 8767  C CA  . HIS B 2 19   ? 241.663 40.704  -31.783 1.00 110.64 ? 77   HIS B CA  1 
ATOM 8768  C C   . HIS B 2 19   ? 240.477 39.766  -31.811 1.00 110.56 ? 77   HIS B C   1 
ATOM 8769  O O   . HIS B 2 19   ? 240.497 38.698  -31.212 1.00 111.43 ? 77   HIS B O   1 
ATOM 8770  C CB  . HIS B 2 19   ? 242.872 40.059  -32.411 1.00 110.79 ? 77   HIS B CB  1 
ATOM 8771  C CG  . HIS B 2 19   ? 243.474 40.902  -33.491 1.00 111.20 ? 77   HIS B CG  1 
ATOM 8772  N ND1 . HIS B 2 19   ? 244.610 40.545  -34.184 1.00 111.75 ? 77   HIS B ND1 1 
ATOM 8773  C CD2 . HIS B 2 19   ? 243.088 42.096  -33.998 1.00 111.19 ? 77   HIS B CD2 1 
ATOM 8774  C CE1 . HIS B 2 19   ? 244.899 41.482  -35.070 1.00 111.69 ? 77   HIS B CE1 1 
ATOM 8775  N NE2 . HIS B 2 19   ? 243.991 42.435  -34.978 1.00 111.51 ? 77   HIS B NE2 1 
ATOM 8776  N N   . PHE B 2 20   ? 239.418 40.214  -32.472 1.00 109.75 ? 78   PHE B N   1 
ATOM 8777  C CA  . PHE B 2 20   ? 238.198 39.433  -32.614 1.00 108.94 ? 78   PHE B CA  1 
ATOM 8778  C C   . PHE B 2 20   ? 238.153 39.189  -34.105 1.00 108.49 ? 78   PHE B C   1 
ATOM 8779  O O   . PHE B 2 20   ? 237.124 39.339  -34.761 1.00 108.47 ? 78   PHE B O   1 
ATOM 8780  C CB  . PHE B 2 20   ? 236.990 40.257  -32.182 1.00 109.35 ? 78   PHE B CB  1 
ATOM 8781  C CG  . PHE B 2 20   ? 235.714 39.469  -32.084 1.00 110.51 ? 78   PHE B CG  1 
ATOM 8782  C CD1 . PHE B 2 20   ? 235.374 38.533  -33.052 1.00 111.25 ? 78   PHE B CD1 1 
ATOM 8783  C CD2 . PHE B 2 20   ? 234.829 39.694  -31.035 1.00 111.03 ? 78   PHE B CD2 1 
ATOM 8784  C CE1 . PHE B 2 20   ? 234.180 37.838  -32.982 1.00 111.56 ? 78   PHE B CE1 1 
ATOM 8785  C CE2 . PHE B 2 20   ? 233.628 38.997  -30.957 1.00 111.67 ? 78   PHE B CE2 1 
ATOM 8786  C CZ  . PHE B 2 20   ? 233.304 38.065  -31.935 1.00 111.86 ? 78   PHE B CZ  1 
ATOM 8787  N N   . LEU B 2 21   ? 239.315 38.834  -34.630 1.00 108.39 ? 79   LEU B N   1 
ATOM 8788  C CA  . LEU B 2 21   ? 239.509 38.596  -36.047 1.00 108.09 ? 79   LEU B CA  1 
ATOM 8789  C C   . LEU B 2 21   ? 241.015 38.787  -36.203 1.00 108.26 ? 79   LEU B C   1 
ATOM 8790  O O   . LEU B 2 21   ? 241.577 39.734  -35.654 1.00 107.51 ? 79   LEU B O   1 
ATOM 8791  C CB  . LEU B 2 21   ? 238.752 39.650  -36.861 1.00 107.73 ? 79   LEU B CB  1 
ATOM 8792  C CG  . LEU B 2 21   ? 238.432 39.368  -38.323 1.00 107.31 ? 79   LEU B CG  1 
ATOM 8793  C CD1 . LEU B 2 21   ? 237.561 40.484  -38.856 1.00 107.20 ? 79   LEU B CD1 1 
ATOM 8794  C CD2 . LEU B 2 21   ? 239.704 39.252  -39.123 1.00 107.41 ? 79   LEU B CD2 1 
ATOM 8795  N N   . SER B 2 22   ? 241.676 37.885  -36.921 1.00 108.50 ? 80   SER B N   1 
ATOM 8796  C CA  . SER B 2 22   ? 243.122 37.993  -37.108 1.00 109.28 ? 80   SER B CA  1 
ATOM 8797  C C   . SER B 2 22   ? 243.482 38.923  -38.264 1.00 109.41 ? 80   SER B C   1 
ATOM 8798  O O   . SER B 2 22   ? 243.104 38.681  -39.411 1.00 109.31 ? 80   SER B O   1 
ATOM 8799  C CB  . SER B 2 22   ? 243.743 36.604  -37.336 1.00 110.10 ? 80   SER B CB  1 
ATOM 8800  O OG  . SER B 2 22   ? 243.204 35.951  -38.474 1.00 111.53 ? 80   SER B OG  1 
ATOM 8801  N N   . GLY B 2 23   ? 244.208 39.992  -37.959 1.00 109.95 ? 81   GLY B N   1 
ATOM 8802  C CA  . GLY B 2 23   ? 244.595 40.924  -38.999 1.00 110.66 ? 81   GLY B CA  1 
ATOM 8803  C C   . GLY B 2 23   ? 244.820 42.345  -38.524 1.00 111.41 ? 81   GLY B C   1 
ATOM 8804  O O   . GLY B 2 23   ? 244.018 42.895  -37.771 1.00 111.76 ? 81   GLY B O   1 
ATOM 8805  N N   . SER B 2 24   ? 245.919 42.940  -38.971 1.00 111.90 ? 82   SER B N   1 
ATOM 8806  C CA  . SER B 2 24   ? 246.257 44.301  -38.604 1.00 112.25 ? 82   SER B CA  1 
ATOM 8807  C C   . SER B 2 24   ? 245.320 45.233  -39.364 1.00 111.82 ? 82   SER B C   1 
ATOM 8808  O O   . SER B 2 24   ? 244.346 44.784  -39.974 1.00 111.09 ? 82   SER B O   1 
ATOM 8809  C CB  . SER B 2 24   ? 247.719 44.596  -38.949 1.00 112.68 ? 82   SER B CB  1 
ATOM 8810  O OG  . SER B 2 24   ? 248.124 45.852  -38.444 1.00 112.47 ? 82   SER B OG  1 
ATOM 8811  N N   . LYS B 2 25   ? 245.629 46.524  -39.336 1.00 111.85 ? 83   LYS B N   1 
ATOM 8812  C CA  . LYS B 2 25   ? 244.804 47.552  -39.968 1.00 112.12 ? 83   LYS B CA  1 
ATOM 8813  C C   . LYS B 2 25   ? 244.574 47.455  -41.478 1.00 112.33 ? 83   LYS B C   1 
ATOM 8814  O O   . LYS B 2 25   ? 243.466 47.155  -41.929 1.00 112.13 ? 83   LYS B O   1 
ATOM 8815  C CB  . LYS B 2 25   ? 245.364 48.936  -39.614 1.00 112.21 ? 83   LYS B CB  1 
ATOM 8816  C CG  . LYS B 2 25   ? 245.450 49.185  -38.103 1.00 112.20 ? 83   LYS B CG  1 
ATOM 8817  C CD  . LYS B 2 25   ? 246.614 48.422  -37.456 1.00 111.93 ? 83   LYS B CD  1 
ATOM 8818  C CE  . LYS B 2 25   ? 246.266 47.873  -36.068 1.00 111.32 ? 83   LYS B CE  1 
ATOM 8819  N NZ  . LYS B 2 25   ? 245.435 46.633  -36.140 1.00 109.99 ? 83   LYS B NZ  1 
ATOM 8820  N N   . GLN B 2 26   ? 245.609 47.718  -42.263 1.00 112.87 ? 84   GLN B N   1 
ATOM 8821  C CA  . GLN B 2 26   ? 245.462 47.669  -43.707 1.00 113.42 ? 84   GLN B CA  1 
ATOM 8822  C C   . GLN B 2 26   ? 245.213 46.249  -44.199 1.00 113.82 ? 84   GLN B C   1 
ATOM 8823  O O   . GLN B 2 26   ? 244.682 46.057  -45.288 1.00 114.71 ? 84   GLN B O   1 
ATOM 8824  C CB  . GLN B 2 26   ? 246.713 48.226  -44.381 1.00 113.25 ? 84   GLN B CB  1 
ATOM 8825  C CG  . GLN B 2 26   ? 247.806 47.187  -44.610 1.00 112.91 ? 84   GLN B CG  1 
ATOM 8826  C CD  . GLN B 2 26   ? 247.551 46.312  -45.836 1.00 112.60 ? 84   GLN B CD  1 
ATOM 8827  O OE1 . GLN B 2 26   ? 248.215 45.293  -46.041 1.00 111.68 ? 84   GLN B OE1 1 
ATOM 8828  N NE2 . GLN B 2 26   ? 246.591 46.716  -46.661 1.00 112.53 ? 84   GLN B NE2 1 
ATOM 8829  N N   . GLN B 2 27   ? 245.612 45.262  -43.401 1.00 113.40 ? 85   GLN B N   1 
ATOM 8830  C CA  . GLN B 2 27   ? 245.443 43.854  -43.760 1.00 112.24 ? 85   GLN B CA  1 
ATOM 8831  C C   . GLN B 2 27   ? 244.005 43.535  -44.117 1.00 112.17 ? 85   GLN B C   1 
ATOM 8832  O O   . GLN B 2 27   ? 243.700 42.976  -45.177 1.00 110.94 ? 85   GLN B O   1 
ATOM 8833  C CB  . GLN B 2 27   ? 245.818 42.968  -42.584 1.00 110.89 ? 85   GLN B CB  1 
ATOM 8834  C CG  . GLN B 2 27   ? 247.006 43.443  -41.828 1.00 107.74 ? 85   GLN B CG  1 
ATOM 8835  C CD  . GLN B 2 27   ? 248.204 43.557  -42.711 1.00 106.36 ? 85   GLN B CD  1 
ATOM 8836  O OE1 . GLN B 2 27   ? 248.464 42.675  -43.529 1.00 106.20 ? 85   GLN B OE1 1 
ATOM 8837  N NE2 . GLN B 2 27   ? 248.953 44.640  -42.558 1.00 104.69 ? 85   GLN B NE2 1 
ATOM 8838  N N   . LEU B 2 28   ? 243.130 43.886  -43.186 1.00 112.94 ? 86   LEU B N   1 
ATOM 8839  C CA  . LEU B 2 28   ? 241.708 43.644  -43.313 1.00 113.46 ? 86   LEU B CA  1 
ATOM 8840  C C   . LEU B 2 28   ? 240.978 44.900  -43.790 1.00 113.72 ? 86   LEU B C   1 
ATOM 8841  O O   . LEU B 2 28   ? 240.932 45.912  -43.081 1.00 113.36 ? 86   LEU B O   1 
ATOM 8842  C CB  . LEU B 2 28   ? 241.160 43.222  -41.952 1.00 113.61 ? 86   LEU B CB  1 
ATOM 8843  C CG  . LEU B 2 28   ? 242.037 42.303  -41.100 1.00 113.42 ? 86   LEU B CG  1 
ATOM 8844  C CD1 . LEU B 2 28   ? 241.961 42.759  -39.662 1.00 113.47 ? 86   LEU B CD1 1 
ATOM 8845  C CD2 . LEU B 2 28   ? 241.591 40.856  -41.239 1.00 112.74 ? 86   LEU B CD2 1 
ATOM 8846  N N   . SER B 2 29   ? 240.416 44.844  -44.993 1.00 113.70 ? 87   SER B N   1 
ATOM 8847  C CA  . SER B 2 29   ? 239.675 45.982  -45.514 1.00 113.34 ? 87   SER B CA  1 
ATOM 8848  C C   . SER B 2 29   ? 238.251 45.545  -45.738 1.00 113.74 ? 87   SER B C   1 
ATOM 8849  O O   . SER B 2 29   ? 237.996 44.378  -46.025 1.00 114.38 ? 87   SER B O   1 
ATOM 8850  C CB  . SER B 2 29   ? 240.259 46.477  -46.830 1.00 112.64 ? 87   SER B CB  1 
ATOM 8851  O OG  . SER B 2 29   ? 239.555 47.627  -47.263 1.00 110.93 ? 87   SER B OG  1 
ATOM 8852  N N   . ARG B 2 30   ? 237.330 46.490  -45.617 1.00 113.98 ? 88   ARG B N   1 
ATOM 8853  C CA  . ARG B 2 30   ? 235.906 46.226  -45.787 1.00 114.03 ? 88   ARG B CA  1 
ATOM 8854  C C   . ARG B 2 30   ? 235.567 45.646  -47.172 1.00 113.45 ? 88   ARG B C   1 
ATOM 8855  O O   . ARG B 2 30   ? 234.395 45.587  -47.567 1.00 112.90 ? 88   ARG B O   1 
ATOM 8856  C CB  . ARG B 2 30   ? 235.135 47.528  -45.512 1.00 114.94 ? 88   ARG B CB  1 
ATOM 8857  C CG  . ARG B 2 30   ? 235.587 48.191  -44.202 1.00 116.04 ? 88   ARG B CG  1 
ATOM 8858  C CD  . ARG B 2 30   ? 234.954 49.554  -43.894 1.00 116.02 ? 88   ARG B CD  1 
ATOM 8859  N NE  . ARG B 2 30   ? 235.655 50.190  -42.776 1.00 115.18 ? 88   ARG B NE  1 
ATOM 8860  C CZ  . ARG B 2 30   ? 235.335 51.363  -42.243 1.00 114.96 ? 88   ARG B CZ  1 
ATOM 8861  N NH1 . ARG B 2 30   ? 236.047 51.839  -41.233 1.00 114.93 ? 88   ARG B NH1 1 
ATOM 8862  N NH2 . ARG B 2 30   ? 234.309 52.054  -42.712 1.00 115.62 ? 88   ARG B NH2 1 
ATOM 8863  N N   . ASP B 2 31   ? 236.607 45.200  -47.886 1.00 112.96 ? 89   ASP B N   1 
ATOM 8864  C CA  . ASP B 2 31   ? 236.488 44.610  -49.229 1.00 112.57 ? 89   ASP B CA  1 
ATOM 8865  C C   . ASP B 2 31   ? 237.241 43.272  -49.265 1.00 111.29 ? 89   ASP B C   1 
ATOM 8866  O O   . ASP B 2 31   ? 236.855 42.332  -49.967 1.00 110.56 ? 89   ASP B O   1 
ATOM 8867  C CB  . ASP B 2 31   ? 237.083 45.563  -50.272 1.00 114.21 ? 89   ASP B CB  1 
ATOM 8868  C CG  . ASP B 2 31   ? 236.700 47.026  -50.024 1.00 115.31 ? 89   ASP B CG  1 
ATOM 8869  O OD1 . ASP B 2 31   ? 237.027 47.564  -48.932 1.00 116.01 ? 89   ASP B OD1 1 
ATOM 8870  O OD2 . ASP B 2 31   ? 236.079 47.634  -50.929 1.00 115.99 ? 89   ASP B OD2 1 
ATOM 8871  N N   . SER B 2 32   ? 238.338 43.218  -48.517 1.00 110.52 ? 90   SER B N   1 
ATOM 8872  C CA  . SER B 2 32   ? 239.131 42.012  -48.406 1.00 109.46 ? 90   SER B CA  1 
ATOM 8873  C C   . SER B 2 32   ? 238.349 41.159  -47.431 1.00 109.31 ? 90   SER B C   1 
ATOM 8874  O O   . SER B 2 32   ? 238.425 39.934  -47.443 1.00 108.12 ? 90   SER B O   1 
ATOM 8875  C CB  . SER B 2 32   ? 240.504 42.318  -47.824 1.00 108.99 ? 90   SER B CB  1 
ATOM 8876  O OG  . SER B 2 32   ? 241.149 41.121  -47.429 1.00 108.09 ? 90   SER B OG  1 
ATOM 8877  N N   . LEU B 2 33   ? 237.605 41.844  -46.572 1.00 109.62 ? 91   LEU B N   1 
ATOM 8878  C CA  . LEU B 2 33   ? 236.761 41.202  -45.578 1.00 109.89 ? 91   LEU B CA  1 
ATOM 8879  C C   . LEU B 2 33   ? 235.598 40.622  -46.368 1.00 110.20 ? 91   LEU B C   1 
ATOM 8880  O O   . LEU B 2 33   ? 235.030 39.585  -46.013 1.00 110.94 ? 91   LEU B O   1 
ATOM 8881  C CB  . LEU B 2 33   ? 236.269 42.246  -44.572 1.00 109.70 ? 91   LEU B CB  1 
ATOM 8882  C CG  . LEU B 2 33   ? 237.369 42.876  -43.709 1.00 109.21 ? 91   LEU B CG  1 
ATOM 8883  C CD1 . LEU B 2 33   ? 236.909 44.195  -43.083 1.00 108.85 ? 91   LEU B CD1 1 
ATOM 8884  C CD2 . LEU B 2 33   ? 237.771 41.862  -42.652 1.00 109.32 ? 91   LEU B CD2 1 
ATOM 8885  N N   . LEU B 2 34   ? 235.256 41.313  -47.450 1.00 110.05 ? 92   LEU B N   1 
ATOM 8886  C CA  . LEU B 2 34   ? 234.196 40.876  -48.334 1.00 110.33 ? 92   LEU B CA  1 
ATOM 8887  C C   . LEU B 2 34   ? 234.858 39.938  -49.325 1.00 110.58 ? 92   LEU B C   1 
ATOM 8888  O O   . LEU B 2 34   ? 234.224 39.435  -50.247 1.00 111.95 ? 92   LEU B O   1 
ATOM 8889  C CB  . LEU B 2 34   ? 233.585 42.062  -49.074 1.00 109.90 ? 92   LEU B CB  1 
ATOM 8890  C CG  . LEU B 2 34   ? 232.428 41.694  -50.007 1.00 109.72 ? 92   LEU B CG  1 
ATOM 8891  C CD1 . LEU B 2 34   ? 231.301 41.050  -49.206 1.00 109.08 ? 92   LEU B CD1 1 
ATOM 8892  C CD2 . LEU B 2 34   ? 231.933 42.940  -50.724 1.00 109.76 ? 92   LEU B CD2 1 
ATOM 8893  N N   . SER B 2 35   ? 236.152 39.716  -49.130 1.00 110.04 ? 93   SER B N   1 
ATOM 8894  C CA  . SER B 2 35   ? 236.896 38.826  -50.000 1.00 108.91 ? 93   SER B CA  1 
ATOM 8895  C C   . SER B 2 35   ? 237.451 37.668  -49.184 1.00 107.27 ? 93   SER B C   1 
ATOM 8896  O O   . SER B 2 35   ? 238.045 36.748  -49.731 1.00 106.74 ? 93   SER B O   1 
ATOM 8897  C CB  . SER B 2 35   ? 238.046 39.576  -50.672 1.00 109.77 ? 93   SER B CB  1 
ATOM 8898  O OG  . SER B 2 35   ? 239.097 39.809  -49.759 1.00 108.97 ? 93   SER B OG  1 
ATOM 8899  N N   . GLY B 2 36   ? 237.251 37.708  -47.872 1.00 105.43 ? 94   GLY B N   1 
ATOM 8900  C CA  . GLY B 2 36   ? 237.774 36.651  -47.034 1.00 103.65 ? 94   GLY B CA  1 
ATOM 8901  C C   . GLY B 2 36   ? 239.265 36.554  -47.273 1.00 102.75 ? 94   GLY B C   1 
ATOM 8902  O O   . GLY B 2 36   ? 239.937 35.711  -46.689 1.00 102.46 ? 94   GLY B O   1 
ATOM 8903  N N   . CYS B 2 37   ? 239.777 37.424  -48.146 1.00 102.33 ? 95   CYS B N   1 
ATOM 8904  C CA  . CYS B 2 37   ? 241.200 37.465  -48.482 1.00 102.34 ? 95   CYS B CA  1 
ATOM 8905  C C   . CYS B 2 37   ? 241.966 38.041  -47.318 1.00 101.66 ? 95   CYS B C   1 
ATOM 8906  O O   . CYS B 2 37   ? 243.187 37.896  -47.229 1.00 102.38 ? 95   CYS B O   1 
ATOM 8907  C CB  . CYS B 2 37   ? 241.454 38.339  -49.711 1.00 102.79 ? 95   CYS B CB  1 
ATOM 8908  S SG  . CYS B 2 37   ? 240.919 37.611  -51.268 1.00 103.12 ? 95   CYS B SG  1 
ATOM 8909  N N   . HIS B 2 38   ? 241.237 38.715  -46.437 1.00 100.33 ? 96   HIS B N   1 
ATOM 8910  C CA  . HIS B 2 38   ? 241.837 39.296  -45.258 1.00 99.47  ? 96   HIS B CA  1 
ATOM 8911  C C   . HIS B 2 38   ? 242.797 38.243  -44.718 1.00 98.38  ? 96   HIS B C   1 
ATOM 8912  O O   . HIS B 2 38   ? 242.637 37.052  -44.979 1.00 98.26  ? 96   HIS B O   1 
ATOM 8913  C CB  . HIS B 2 38   ? 240.756 39.616  -44.219 1.00 100.39 ? 96   HIS B CB  1 
ATOM 8914  C CG  . HIS B 2 38   ? 239.933 38.432  -43.806 1.00 101.14 ? 96   HIS B CG  1 
ATOM 8915  N ND1 . HIS B 2 38   ? 239.001 38.495  -42.793 1.00 101.30 ? 96   HIS B ND1 1 
ATOM 8916  C CD2 . HIS B 2 38   ? 239.902 37.158  -44.265 1.00 101.77 ? 96   HIS B CD2 1 
ATOM 8917  C CE1 . HIS B 2 38   ? 238.435 37.311  -42.645 1.00 101.26 ? 96   HIS B CE1 1 
ATOM 8918  N NE2 . HIS B 2 38   ? 238.964 36.482  -43.526 1.00 101.69 ? 96   HIS B NE2 1 
ATOM 8919  N N   . PRO B 2 39   ? 243.814 38.667  -43.969 1.00 97.52  ? 97   PRO B N   1 
ATOM 8920  C CA  . PRO B 2 39   ? 244.795 37.742  -43.401 1.00 96.46  ? 97   PRO B CA  1 
ATOM 8921  C C   . PRO B 2 39   ? 244.208 36.485  -42.774 1.00 95.35  ? 97   PRO B C   1 
ATOM 8922  O O   . PRO B 2 39   ? 244.914 35.500  -42.574 1.00 95.81  ? 97   PRO B O   1 
ATOM 8923  C CB  . PRO B 2 39   ? 245.530 38.604  -42.382 1.00 97.02  ? 97   PRO B CB  1 
ATOM 8924  C CG  . PRO B 2 39   ? 244.549 39.688  -42.063 1.00 97.83  ? 97   PRO B CG  1 
ATOM 8925  C CD  . PRO B 2 39   ? 243.996 40.012  -43.411 1.00 98.04  ? 97   PRO B CD  1 
ATOM 8926  N N   . GLY B 2 40   ? 242.921 36.517  -42.458 1.00 94.35  ? 98   GLY B N   1 
ATOM 8927  C CA  . GLY B 2 40   ? 242.306 35.350  -41.865 1.00 93.08  ? 98   GLY B CA  1 
ATOM 8928  C C   . GLY B 2 40   ? 241.322 35.707  -40.781 1.00 92.67  ? 98   GLY B C   1 
ATOM 8929  O O   . GLY B 2 40   ? 241.221 36.851  -40.354 1.00 92.27  ? 98   GLY B O   1 
ATOM 8930  N N   . PHE B 2 41   ? 240.607 34.700  -40.322 1.00 92.76  ? 99   PHE B N   1 
ATOM 8931  C CA  . PHE B 2 41   ? 239.596 34.863  -39.299 1.00 93.28  ? 99   PHE B CA  1 
ATOM 8932  C C   . PHE B 2 41   ? 240.231 34.776  -37.901 1.00 94.71  ? 99   PHE B C   1 
ATOM 8933  O O   . PHE B 2 41   ? 241.113 33.948  -37.675 1.00 95.45  ? 99   PHE B O   1 
ATOM 8934  C CB  . PHE B 2 41   ? 238.564 33.776  -39.552 1.00 90.94  ? 99   PHE B CB  1 
ATOM 8935  C CG  . PHE B 2 41   ? 238.288 33.543  -41.033 1.00 89.02  ? 99   PHE B CG  1 
ATOM 8936  C CD1 . PHE B 2 41   ? 237.289 34.230  -41.696 1.00 88.07  ? 99   PHE B CD1 1 
ATOM 8937  C CD2 . PHE B 2 41   ? 239.025 32.622  -41.755 1.00 88.50  ? 99   PHE B CD2 1 
ATOM 8938  C CE1 . PHE B 2 41   ? 237.040 33.982  -43.046 1.00 86.96  ? 99   PHE B CE1 1 
ATOM 8939  C CE2 . PHE B 2 41   ? 238.775 32.371  -43.092 1.00 87.86  ? 99   PHE B CE2 1 
ATOM 8940  C CZ  . PHE B 2 41   ? 237.780 33.050  -43.739 1.00 87.20  ? 99   PHE B CZ  1 
ATOM 8941  N N   . GLY B 2 42   ? 239.783 35.632  -36.976 1.00 95.91  ? 100  GLY B N   1 
ATOM 8942  C CA  . GLY B 2 42   ? 240.358 35.664  -35.633 1.00 96.58  ? 100  GLY B CA  1 
ATOM 8943  C C   . GLY B 2 42   ? 239.644 35.059  -34.431 1.00 97.34  ? 100  GLY B C   1 
ATOM 8944  O O   . GLY B 2 42   ? 238.534 34.546  -34.543 1.00 97.69  ? 100  GLY B O   1 
ATOM 8945  N N   . PRO B 2 43   ? 240.274 35.126  -33.245 1.00 97.61  ? 101  PRO B N   1 
ATOM 8946  C CA  . PRO B 2 43   ? 239.787 34.609  -31.969 1.00 97.77  ? 101  PRO B CA  1 
ATOM 8947  C C   . PRO B 2 43   ? 238.292 34.544  -31.758 1.00 98.09  ? 101  PRO B C   1 
ATOM 8948  O O   . PRO B 2 43   ? 237.646 33.587  -32.174 1.00 98.19  ? 101  PRO B O   1 
ATOM 8949  C CB  . PRO B 2 43   ? 240.494 35.489  -30.965 1.00 97.30  ? 101  PRO B CB  1 
ATOM 8950  C CG  . PRO B 2 43   ? 241.838 35.591  -31.590 1.00 96.95  ? 101  PRO B CG  1 
ATOM 8951  C CD  . PRO B 2 43   ? 241.502 35.909  -33.030 1.00 97.55  ? 101  PRO B CD  1 
ATOM 8952  N N   . LEU B 2 44   ? 237.736 35.560  -31.118 1.00 98.41  ? 102  LEU B N   1 
ATOM 8953  C CA  . LEU B 2 44   ? 236.308 35.572  -30.815 1.00 98.71  ? 102  LEU B CA  1 
ATOM 8954  C C   . LEU B 2 44   ? 235.350 35.287  -31.971 1.00 97.78  ? 102  LEU B C   1 
ATOM 8955  O O   . LEU B 2 44   ? 234.207 34.880  -31.749 1.00 96.79  ? 102  LEU B O   1 
ATOM 8956  C CB  . LEU B 2 44   ? 235.923 36.900  -30.173 1.00 100.34 ? 102  LEU B CB  1 
ATOM 8957  C CG  . LEU B 2 44   ? 236.693 37.374  -28.941 1.00 101.08 ? 102  LEU B CG  1 
ATOM 8958  C CD1 . LEU B 2 44   ? 238.076 37.835  -29.366 1.00 102.04 ? 102  LEU B CD1 1 
ATOM 8959  C CD2 . LEU B 2 44   ? 235.942 38.512  -28.260 1.00 100.79 ? 102  LEU B CD2 1 
ATOM 8960  N N   . GLY B 2 45   ? 235.799 35.507  -33.200 1.00 97.10  ? 103  GLY B N   1 
ATOM 8961  C CA  . GLY B 2 45   ? 234.927 35.257  -34.336 1.00 96.22  ? 103  GLY B CA  1 
ATOM 8962  C C   . GLY B 2 45   ? 234.441 33.822  -34.387 1.00 95.19  ? 103  GLY B C   1 
ATOM 8963  O O   . GLY B 2 45   ? 233.244 33.544  -34.482 1.00 95.19  ? 103  GLY B O   1 
ATOM 8964  N N   . VAL B 2 46   ? 235.396 32.907  -34.317 1.00 93.97  ? 104  VAL B N   1 
ATOM 8965  C CA  . VAL B 2 46   ? 235.126 31.483  -34.363 1.00 92.06  ? 104  VAL B CA  1 
ATOM 8966  C C   . VAL B 2 46   ? 234.021 31.011  -33.444 1.00 90.45  ? 104  VAL B C   1 
ATOM 8967  O O   . VAL B 2 46   ? 233.043 30.401  -33.891 1.00 89.91  ? 104  VAL B O   1 
ATOM 8968  C CB  . VAL B 2 46   ? 236.389 30.721  -34.035 1.00 92.88  ? 104  VAL B CB  1 
ATOM 8969  C CG1 . VAL B 2 46   ? 236.109 29.210  -33.928 1.00 93.65  ? 104  VAL B CG1 1 
ATOM 8970  C CG2 . VAL B 2 46   ? 237.398 31.031  -35.101 1.00 93.94  ? 104  VAL B CG2 1 
ATOM 8971  N N   . GLU B 2 47   ? 234.190 31.265  -32.153 1.00 88.93  ? 105  GLU B N   1 
ATOM 8972  C CA  . GLU B 2 47   ? 233.179 30.852  -31.209 1.00 88.56  ? 105  GLU B CA  1 
ATOM 8973  C C   . GLU B 2 47   ? 231.890 31.192  -31.922 1.00 88.93  ? 105  GLU B C   1 
ATOM 8974  O O   . GLU B 2 47   ? 231.081 30.316  -32.221 1.00 89.96  ? 105  GLU B O   1 
ATOM 8975  C CB  . GLU B 2 47   ? 233.286 31.644  -29.909 1.00 87.98  ? 105  GLU B CB  1 
ATOM 8976  C CG  . GLU B 2 47   ? 232.470 31.039  -28.801 1.00 87.44  ? 105  GLU B CG  1 
ATOM 8977  C CD  . GLU B 2 47   ? 231.100 30.606  -29.283 1.00 86.66  ? 105  GLU B CD  1 
ATOM 8978  O OE1 . GLU B 2 47   ? 230.273 31.468  -29.648 1.00 85.85  ? 105  GLU B OE1 1 
ATOM 8979  O OE2 . GLU B 2 47   ? 230.852 29.390  -29.319 1.00 86.40  ? 105  GLU B OE2 1 
ATOM 8980  N N   . LEU B 2 48   ? 231.733 32.470  -32.235 1.00 88.69  ? 106  LEU B N   1 
ATOM 8981  C CA  . LEU B 2 48   ? 230.549 32.910  -32.928 1.00 88.23  ? 106  LEU B CA  1 
ATOM 8982  C C   . LEU B 2 48   ? 230.271 31.989  -34.101 1.00 87.86  ? 106  LEU B C   1 
ATOM 8983  O O   . LEU B 2 48   ? 229.206 31.405  -34.183 1.00 86.67  ? 106  LEU B O   1 
ATOM 8984  C CB  . LEU B 2 48   ? 230.720 34.338  -33.431 1.00 89.77  ? 106  LEU B CB  1 
ATOM 8985  C CG  . LEU B 2 48   ? 229.490 34.793  -34.217 1.00 90.87  ? 106  LEU B CG  1 
ATOM 8986  C CD1 . LEU B 2 48   ? 228.276 34.732  -33.313 1.00 91.73  ? 106  LEU B CD1 1 
ATOM 8987  C CD2 . LEU B 2 48   ? 229.689 36.199  -34.762 1.00 91.39  ? 106  LEU B CD2 1 
ATOM 8988  N N   . ARG B 2 49   ? 231.240 31.853  -34.999 1.00 88.62  ? 107  ARG B N   1 
ATOM 8989  C CA  . ARG B 2 49   ? 231.084 31.011  -36.182 1.00 89.52  ? 107  ARG B CA  1 
ATOM 8990  C C   . ARG B 2 49   ? 230.662 29.589  -35.858 1.00 89.13  ? 107  ARG B C   1 
ATOM 8991  O O   . ARG B 2 49   ? 229.631 29.113  -36.339 1.00 89.60  ? 107  ARG B O   1 
ATOM 8992  C CB  . ARG B 2 49   ? 232.381 30.990  -36.979 1.00 90.60  ? 107  ARG B CB  1 
ATOM 8993  C CG  . ARG B 2 49   ? 232.328 30.141  -38.235 1.00 92.54  ? 107  ARG B CG  1 
ATOM 8994  C CD  . ARG B 2 49   ? 233.438 30.573  -39.179 1.00 94.29  ? 107  ARG B CD  1 
ATOM 8995  N NE  . ARG B 2 49   ? 234.315 29.478  -39.579 1.00 96.31  ? 107  ARG B NE  1 
ATOM 8996  C CZ  . ARG B 2 49   ? 235.482 29.652  -40.190 1.00 97.03  ? 107  ARG B CZ  1 
ATOM 8997  N NH1 . ARG B 2 49   ? 235.911 30.875  -40.467 1.00 97.42  ? 107  ARG B NH1 1 
ATOM 8998  N NH2 . ARG B 2 49   ? 236.220 28.604  -40.530 1.00 97.51  ? 107  ARG B NH2 1 
ATOM 8999  N N   . LYS B 2 50   ? 231.471 28.899  -35.064 1.00 87.45  ? 108  LYS B N   1 
ATOM 9000  C CA  . LYS B 2 50   ? 231.127 27.546  -34.682 1.00 85.75  ? 108  LYS B CA  1 
ATOM 9001  C C   . LYS B 2 50   ? 229.732 27.663  -34.099 1.00 84.75  ? 108  LYS B C   1 
ATOM 9002  O O   . LYS B 2 50   ? 228.901 26.771  -34.257 1.00 83.25  ? 108  LYS B O   1 
ATOM 9003  C CB  . LYS B 2 50   ? 232.083 27.015  -33.615 1.00 84.92  ? 108  LYS B CB  1 
ATOM 9004  C CG  . LYS B 2 50   ? 231.625 25.691  -32.994 1.00 85.96  ? 108  LYS B CG  1 
ATOM 9005  C CD  . LYS B 2 50   ? 232.561 25.201  -31.886 1.00 85.97  ? 108  LYS B CD  1 
ATOM 9006  C CE  . LYS B 2 50   ? 233.835 24.552  -32.439 1.00 86.57  ? 108  LYS B CE  1 
ATOM 9007  N NZ  . LYS B 2 50   ? 233.588 23.241  -33.113 1.00 85.44  ? 108  LYS B NZ  1 
ATOM 9008  N N   . ASN B 2 51   ? 229.487 28.790  -33.438 1.00 85.01  ? 109  ASN B N   1 
ATOM 9009  C CA  . ASN B 2 51   ? 228.199 29.069  -32.815 1.00 86.06  ? 109  ASN B CA  1 
ATOM 9010  C C   . ASN B 2 51   ? 227.103 29.283  -33.853 1.00 87.45  ? 109  ASN B C   1 
ATOM 9011  O O   . ASN B 2 51   ? 225.996 28.746  -33.756 1.00 89.11  ? 109  ASN B O   1 
ATOM 9012  C CB  . ASN B 2 51   ? 228.317 30.313  -31.943 1.00 85.61  ? 109  ASN B CB  1 
ATOM 9013  C CG  . ASN B 2 51   ? 227.061 31.130  -31.939 1.00 85.65  ? 109  ASN B CG  1 
ATOM 9014  O OD1 . ASN B 2 51   ? 226.031 30.695  -31.438 1.00 84.90  ? 109  ASN B OD1 1 
ATOM 9015  N ND2 . ASN B 2 51   ? 227.130 32.321  -32.512 1.00 86.33  ? 109  ASN B ND2 1 
ATOM 9016  N N   . LEU B 2 52   ? 227.422 30.084  -34.850 1.00 88.04  ? 110  LEU B N   1 
ATOM 9017  C CA  . LEU B 2 52   ? 226.483 30.387  -35.909 1.00 88.32  ? 110  LEU B CA  1 
ATOM 9018  C C   . LEU B 2 52   ? 226.071 29.139  -36.657 1.00 87.58  ? 110  LEU B C   1 
ATOM 9019  O O   . LEU B 2 52   ? 224.945 28.649  -36.522 1.00 87.09  ? 110  LEU B O   1 
ATOM 9020  C CB  . LEU B 2 52   ? 227.140 31.358  -36.871 1.00 89.55  ? 110  LEU B CB  1 
ATOM 9021  C CG  . LEU B 2 52   ? 226.412 31.771  -38.142 1.00 90.08  ? 110  LEU B CG  1 
ATOM 9022  C CD1 . LEU B 2 52   ? 224.924 32.041  -37.889 1.00 90.29  ? 110  LEU B CD1 1 
ATOM 9023  C CD2 . LEU B 2 52   ? 227.123 33.011  -38.656 1.00 89.47  ? 110  LEU B CD2 1 
ATOM 9024  N N   . ALA B 2 53   ? 227.006 28.654  -37.462 1.00 86.53  ? 111  ALA B N   1 
ATOM 9025  C CA  . ALA B 2 53   ? 226.800 27.472  -38.258 1.00 86.45  ? 111  ALA B CA  1 
ATOM 9026  C C   . ALA B 2 53   ? 225.927 26.532  -37.465 1.00 86.85  ? 111  ALA B C   1 
ATOM 9027  O O   . ALA B 2 53   ? 224.833 26.186  -37.887 1.00 86.42  ? 111  ALA B O   1 
ATOM 9028  C CB  . ALA B 2 53   ? 228.127 26.826  -38.552 1.00 85.88  ? 111  ALA B CB  1 
ATOM 9029  N N   . ALA B 2 54   ? 226.411 26.148  -36.292 1.00 88.36  ? 112  ALA B N   1 
ATOM 9030  C CA  . ALA B 2 54   ? 225.685 25.232  -35.430 1.00 90.17  ? 112  ALA B CA  1 
ATOM 9031  C C   . ALA B 2 54   ? 224.196 25.550  -35.339 1.00 90.94  ? 112  ALA B C   1 
ATOM 9032  O O   . ALA B 2 54   ? 223.366 24.692  -35.620 1.00 91.51  ? 112  ALA B O   1 
ATOM 9033  C CB  . ALA B 2 54   ? 226.306 25.219  -34.040 1.00 89.62  ? 112  ALA B CB  1 
ATOM 9034  N N   . GLU B 2 55   ? 223.838 26.773  -34.964 1.00 91.22  ? 113  GLU B N   1 
ATOM 9035  C CA  . GLU B 2 55   ? 222.418 27.094  -34.846 1.00 92.14  ? 113  GLU B CA  1 
ATOM 9036  C C   . GLU B 2 55   ? 221.669 26.870  -36.177 1.00 92.97  ? 113  GLU B C   1 
ATOM 9037  O O   . GLU B 2 55   ? 220.447 26.670  -36.198 1.00 92.68  ? 113  GLU B O   1 
ATOM 9038  C CB  . GLU B 2 55   ? 222.242 28.532  -34.317 1.00 91.71  ? 113  GLU B CB  1 
ATOM 9039  C CG  . GLU B 2 55   ? 221.278 28.639  -33.107 1.00 92.65  ? 113  GLU B CG  1 
ATOM 9040  C CD  . GLU B 2 55   ? 221.726 27.836  -31.875 1.00 93.19  ? 113  GLU B CD  1 
ATOM 9041  O OE1 . GLU B 2 55   ? 222.778 28.165  -31.288 1.00 93.73  ? 113  GLU B OE1 1 
ATOM 9042  O OE2 . GLU B 2 55   ? 221.020 26.875  -31.487 1.00 92.65  ? 113  GLU B OE2 1 
ATOM 9043  N N   . TRP B 2 56   ? 222.402 26.887  -37.287 1.00 94.25  ? 114  TRP B N   1 
ATOM 9044  C CA  . TRP B 2 56   ? 221.801 26.673  -38.604 1.00 95.43  ? 114  TRP B CA  1 
ATOM 9045  C C   . TRP B 2 56   ? 221.548 25.200  -38.653 1.00 96.32  ? 114  TRP B C   1 
ATOM 9046  O O   . TRP B 2 56   ? 220.508 24.723  -39.112 1.00 94.60  ? 114  TRP B O   1 
ATOM 9047  C CB  . TRP B 2 56   ? 222.787 27.014  -39.693 1.00 96.13  ? 114  TRP B CB  1 
ATOM 9048  C CG  . TRP B 2 56   ? 222.149 27.250  -41.001 1.00 97.29  ? 114  TRP B CG  1 
ATOM 9049  C CD1 . TRP B 2 56   ? 221.528 28.386  -41.393 1.00 97.76  ? 114  TRP B CD1 1 
ATOM 9050  C CD2 . TRP B 2 56   ? 222.088 26.352  -42.116 1.00 97.50  ? 114  TRP B CD2 1 
ATOM 9051  N NE1 . TRP B 2 56   ? 221.089 28.266  -42.683 1.00 97.68  ? 114  TRP B NE1 1 
ATOM 9052  C CE2 . TRP B 2 56   ? 221.419 27.024  -43.152 1.00 97.54  ? 114  TRP B CE2 1 
ATOM 9053  C CE3 . TRP B 2 56   ? 222.533 25.050  -42.339 1.00 97.59  ? 114  TRP B CE3 1 
ATOM 9054  C CZ2 . TRP B 2 56   ? 221.183 26.440  -44.400 1.00 96.87  ? 114  TRP B CZ2 1 
ATOM 9055  C CZ3 . TRP B 2 56   ? 222.295 24.468  -43.586 1.00 97.71  ? 114  TRP B CZ3 1 
ATOM 9056  C CH2 . TRP B 2 56   ? 221.627 25.165  -44.595 1.00 97.03  ? 114  TRP B CH2 1 
ATOM 9057  N N   . TRP B 2 57   ? 222.556 24.491  -38.164 1.00 98.59  ? 115  TRP B N   1 
ATOM 9058  C CA  . TRP B 2 57   ? 222.567 23.051  -38.069 1.00 100.47 ? 115  TRP B CA  1 
ATOM 9059  C C   . TRP B 2 57   ? 221.208 22.679  -37.500 1.00 101.58 ? 115  TRP B C   1 
ATOM 9060  O O   . TRP B 2 57   ? 220.658 21.611  -37.770 1.00 101.71 ? 115  TRP B O   1 
ATOM 9061  C CB  . TRP B 2 57   ? 223.718 22.665  -37.138 1.00 100.42 ? 115  TRP B CB  1 
ATOM 9062  C CG  . TRP B 2 57   ? 224.013 21.246  -37.126 1.00 100.38 ? 115  TRP B CG  1 
ATOM 9063  C CD1 . TRP B 2 57   ? 223.262 20.267  -36.561 1.00 100.46 ? 115  TRP B CD1 1 
ATOM 9064  C CD2 . TRP B 2 57   ? 225.087 20.600  -37.803 1.00 100.90 ? 115  TRP B CD2 1 
ATOM 9065  N NE1 . TRP B 2 57   ? 223.795 19.038  -36.847 1.00 101.72 ? 115  TRP B NE1 1 
ATOM 9066  C CE2 . TRP B 2 57   ? 224.918 19.213  -37.611 1.00 101.71 ? 115  TRP B CE2 1 
ATOM 9067  C CE3 . TRP B 2 57   ? 226.182 21.057  -38.555 1.00 101.09 ? 115  TRP B CE3 1 
ATOM 9068  C CZ2 . TRP B 2 57   ? 225.793 18.272  -38.151 1.00 102.17 ? 115  TRP B CZ2 1 
ATOM 9069  C CZ3 . TRP B 2 57   ? 227.058 20.122  -39.092 1.00 101.63 ? 115  TRP B CZ3 1 
ATOM 9070  C CH2 . TRP B 2 57   ? 226.857 18.741  -38.885 1.00 102.03 ? 115  TRP B CH2 1 
ATOM 9071  N N   . THR B 2 58   ? 220.665 23.573  -36.695 1.00 103.14 ? 116  THR B N   1 
ATOM 9072  C CA  . THR B 2 58   ? 219.365 23.297  -36.160 1.00 104.90 ? 116  THR B CA  1 
ATOM 9073  C C   . THR B 2 58   ? 218.431 23.770  -37.253 1.00 106.06 ? 116  THR B C   1 
ATOM 9074  O O   . THR B 2 58   ? 217.715 22.970  -37.856 1.00 105.81 ? 116  THR B O   1 
ATOM 9075  C CB  . THR B 2 58   ? 219.135 24.062  -34.870 1.00 104.90 ? 116  THR B CB  1 
ATOM 9076  O OG1 . THR B 2 58   ? 220.207 23.779  -33.964 1.00 105.02 ? 116  THR B OG1 1 
ATOM 9077  C CG2 . THR B 2 58   ? 217.832 23.628  -34.228 1.00 105.10 ? 116  THR B CG2 1 
ATOM 9078  N N   . SER B 2 59   ? 218.501 25.070  -37.532 1.00 107.24 ? 117  SER B N   1 
ATOM 9079  C CA  . SER B 2 59   ? 217.689 25.733  -38.558 1.00 108.43 ? 117  SER B CA  1 
ATOM 9080  C C   . SER B 2 59   ? 216.952 24.864  -39.533 1.00 110.32 ? 117  SER B C   1 
ATOM 9081  O O   . SER B 2 59   ? 215.746 24.891  -39.658 1.00 110.05 ? 117  SER B O   1 
ATOM 9082  C CB  . SER B 2 59   ? 218.526 26.632  -39.438 1.00 107.26 ? 117  SER B CB  1 
ATOM 9083  O OG  . SER B 2 59   ? 217.747 27.052  -40.549 1.00 104.86 ? 117  SER B OG  1 
ATOM 9084  N N   . VAL B 2 60   ? 217.697 24.141  -40.320 1.00 112.77 ? 118  VAL B N   1 
ATOM 9085  C CA  . VAL B 2 60   ? 217.009 23.331  -41.253 1.00 115.10 ? 118  VAL B CA  1 
ATOM 9086  C C   . VAL B 2 60   ? 217.367 21.941  -40.884 1.00 117.05 ? 118  VAL B C   1 
ATOM 9087  O O   . VAL B 2 60   ? 216.518 21.072  -40.829 1.00 117.88 ? 118  VAL B O   1 
ATOM 9088  C CB  . VAL B 2 60   ? 217.447 23.690  -42.671 1.00 114.32 ? 118  VAL B CB  1 
ATOM 9089  C CG1 . VAL B 2 60   ? 218.953 23.923  -42.711 1.00 113.96 ? 118  VAL B CG1 1 
ATOM 9090  C CG2 . VAL B 2 60   ? 217.044 22.618  -43.608 1.00 114.35 ? 118  VAL B CG2 1 
ATOM 9091  N N   . VAL B 2 61   ? 218.631 21.743  -40.559 1.00 118.55 ? 119  VAL B N   1 
ATOM 9092  C CA  . VAL B 2 61   ? 219.090 20.415  -40.233 1.00 119.55 ? 119  VAL B CA  1 
ATOM 9093  C C   . VAL B 2 61   ? 218.439 19.720  -39.040 1.00 119.87 ? 119  VAL B C   1 
ATOM 9094  O O   . VAL B 2 61   ? 218.008 18.588  -39.180 1.00 119.36 ? 119  VAL B O   1 
ATOM 9095  C CB  . VAL B 2 61   ? 220.615 20.400  -40.090 1.00 120.11 ? 119  VAL B CB  1 
ATOM 9096  C CG1 . VAL B 2 61   ? 221.098 18.984  -39.865 1.00 120.05 ? 119  VAL B CG1 1 
ATOM 9097  C CG2 . VAL B 2 61   ? 221.252 20.974  -41.339 1.00 121.08 ? 119  VAL B CG2 1 
ATOM 9098  N N   . VAL B 2 62   ? 218.339 20.358  -37.882 1.00 120.76 ? 120  VAL B N   1 
ATOM 9099  C CA  . VAL B 2 62   ? 217.725 19.659  -36.756 1.00 122.41 ? 120  VAL B CA  1 
ATOM 9100  C C   . VAL B 2 62   ? 216.209 19.508  -36.824 1.00 123.08 ? 120  VAL B C   1 
ATOM 9101  O O   . VAL B 2 62   ? 215.679 18.428  -36.568 1.00 123.09 ? 120  VAL B O   1 
ATOM 9102  C CB  . VAL B 2 62   ? 218.120 20.330  -35.418 1.00 122.76 ? 120  VAL B CB  1 
ATOM 9103  C CG1 . VAL B 2 62   ? 217.415 19.642  -34.265 1.00 123.18 ? 120  VAL B CG1 1 
ATOM 9104  C CG2 . VAL B 2 62   ? 219.613 20.275  -35.223 1.00 123.11 ? 120  VAL B CG2 1 
ATOM 9105  N N   . PHE B 2 63   ? 215.553 20.594  -37.207 1.00 123.93 ? 121  PHE B N   1 
ATOM 9106  C CA  . PHE B 2 63   ? 214.088 20.729  -37.289 1.00 124.12 ? 121  PHE B CA  1 
ATOM 9107  C C   . PHE B 2 63   ? 213.105 19.660  -37.837 1.00 123.82 ? 121  PHE B C   1 
ATOM 9108  O O   . PHE B 2 63   ? 212.130 19.288  -37.192 1.00 124.00 ? 121  PHE B O   1 
ATOM 9109  C CB  . PHE B 2 63   ? 213.768 22.024  -38.017 1.00 123.82 ? 121  PHE B CB  1 
ATOM 9110  C CG  . PHE B 2 63   ? 214.059 23.277  -37.227 1.00 122.50 ? 121  PHE B CG  1 
ATOM 9111  C CD1 . PHE B 2 63   ? 213.042 24.056  -36.755 1.00 121.59 ? 121  PHE B CD1 1 
ATOM 9112  C CD2 . PHE B 2 63   ? 215.341 23.697  -36.988 1.00 121.80 ? 121  PHE B CD2 1 
ATOM 9113  C CE1 . PHE B 2 63   ? 213.322 25.251  -36.048 1.00 120.51 ? 121  PHE B CE1 1 
ATOM 9114  C CE2 . PHE B 2 63   ? 215.615 24.865  -36.296 1.00 120.85 ? 121  PHE B CE2 1 
ATOM 9115  C CZ  . PHE B 2 63   ? 214.600 25.648  -35.826 1.00 120.43 ? 121  PHE B CZ  1 
ATOM 9116  N N   . ARG B 2 64   ? 213.390 19.116  -39.005 1.00 122.89 ? 122  ARG B N   1 
ATOM 9117  C CA  . ARG B 2 64   ? 212.535 18.115  -39.598 1.00 121.30 ? 122  ARG B CA  1 
ATOM 9118  C C   . ARG B 2 64   ? 213.495 17.164  -40.269 1.00 120.64 ? 122  ARG B C   1 
ATOM 9119  O O   . ARG B 2 64   ? 213.875 17.350  -41.420 1.00 120.15 ? 122  ARG B O   1 
ATOM 9120  C CB  . ARG B 2 64   ? 211.472 18.756  -40.546 1.00 120.72 ? 122  ARG B CB  1 
ATOM 9121  C CG  . ARG B 2 64   ? 211.935 19.779  -41.574 1.00 119.44 ? 122  ARG B CG  1 
ATOM 9122  C CD  . ARG B 2 64   ? 210.743 20.477  -42.270 1.00 118.79 ? 122  ARG B CD  1 
ATOM 9123  N NE  . ARG B 2 64   ? 210.105 21.540  -41.477 1.00 118.93 ? 122  ARG B NE  1 
ATOM 9124  C CZ  . ARG B 2 64   ? 209.239 21.360  -40.478 1.00 119.15 ? 122  ARG B CZ  1 
ATOM 9125  N NH1 . ARG B 2 64   ? 208.869 20.137  -40.115 1.00 119.88 ? 122  ARG B NH1 1 
ATOM 9126  N NH2 . ARG B 2 64   ? 208.753 22.414  -39.821 1.00 118.34 ? 122  ARG B NH2 1 
ATOM 9127  N N   . GLU B 2 65   ? 213.925 16.192  -39.457 1.00 120.40 ? 123  GLU B N   1 
ATOM 9128  C CA  . GLU B 2 65   ? 214.901 15.161  -39.802 1.00 120.21 ? 123  GLU B CA  1 
ATOM 9129  C C   . GLU B 2 65   ? 214.596 14.430  -41.095 1.00 120.09 ? 123  GLU B C   1 
ATOM 9130  O O   . GLU B 2 65   ? 214.644 13.202  -41.156 1.00 120.19 ? 123  GLU B O   1 
ATOM 9131  C CB  . GLU B 2 65   ? 215.009 14.159  -38.650 1.00 120.05 ? 123  GLU B CB  1 
ATOM 9132  C CG  . GLU B 2 65   ? 216.416 13.726  -38.260 1.00 118.31 ? 123  GLU B CG  1 
ATOM 9133  C CD  . GLU B 2 65   ? 216.847 12.430  -38.919 1.00 117.11 ? 123  GLU B CD  1 
ATOM 9134  O OE1 . GLU B 2 65   ? 216.174 11.394  -38.713 1.00 116.15 ? 123  GLU B OE1 1 
ATOM 9135  O OE2 . GLU B 2 65   ? 217.867 12.451  -39.634 1.00 116.06 ? 123  GLU B OE2 1 
ATOM 9136  N N   . GLN B 2 66   ? 214.264 15.195  -42.123 1.00 119.65 ? 124  GLN B N   1 
ATOM 9137  C CA  . GLN B 2 66   ? 213.958 14.644  -43.422 1.00 119.42 ? 124  GLN B CA  1 
ATOM 9138  C C   . GLN B 2 66   ? 215.266 14.691  -44.194 1.00 118.98 ? 124  GLN B C   1 
ATOM 9139  O O   . GLN B 2 66   ? 215.435 13.996  -45.191 1.00 119.17 ? 124  GLN B O   1 
ATOM 9140  C CB  . GLN B 2 66   ? 212.914 15.519  -44.128 1.00 120.27 ? 124  GLN B CB  1 
ATOM 9141  C CG  . GLN B 2 66   ? 211.671 15.852  -43.301 1.00 120.85 ? 124  GLN B CG  1 
ATOM 9142  C CD  . GLN B 2 66   ? 210.714 16.817  -44.004 1.00 120.54 ? 124  GLN B CD  1 
ATOM 9143  O OE1 . GLN B 2 66   ? 210.295 16.583  -45.132 1.00 119.80 ? 124  GLN B OE1 1 
ATOM 9144  N NE2 . GLN B 2 66   ? 210.361 17.897  -43.326 1.00 120.03 ? 124  GLN B NE2 1 
ATOM 9145  N N   . VAL B 2 67   ? 216.189 15.521  -43.711 1.00 118.54 ? 125  VAL B N   1 
ATOM 9146  C CA  . VAL B 2 67   ? 217.495 15.715  -44.342 1.00 117.76 ? 125  VAL B CA  1 
ATOM 9147  C C   . VAL B 2 67   ? 218.615 15.165  -43.471 1.00 117.47 ? 125  VAL B C   1 
ATOM 9148  O O   . VAL B 2 67   ? 218.391 14.820  -42.310 1.00 117.54 ? 125  VAL B O   1 
ATOM 9149  C CB  . VAL B 2 67   ? 217.755 17.218  -44.592 1.00 117.10 ? 125  VAL B CB  1 
ATOM 9150  C CG1 . VAL B 2 67   ? 219.026 17.419  -45.394 1.00 116.83 ? 125  VAL B CG1 1 
ATOM 9151  C CG2 . VAL B 2 67   ? 216.574 17.824  -45.318 1.00 116.30 ? 125  VAL B CG2 1 
ATOM 9152  N N   . PHE B 2 68   ? 219.817 15.077  -44.039 1.00 116.50 ? 126  PHE B N   1 
ATOM 9153  C CA  . PHE B 2 68   ? 220.970 14.560  -43.308 1.00 115.31 ? 126  PHE B CA  1 
ATOM 9154  C C   . PHE B 2 68   ? 222.306 15.197  -43.670 1.00 113.58 ? 126  PHE B C   1 
ATOM 9155  O O   . PHE B 2 68   ? 222.464 15.807  -44.729 1.00 113.59 ? 126  PHE B O   1 
ATOM 9156  C CB  . PHE B 2 68   ? 221.083 13.050  -43.498 1.00 116.58 ? 126  PHE B CB  1 
ATOM 9157  C CG  . PHE B 2 68   ? 219.808 12.320  -43.246 1.00 117.93 ? 126  PHE B CG  1 
ATOM 9158  C CD1 . PHE B 2 68   ? 218.819 12.283  -44.217 1.00 118.38 ? 126  PHE B CD1 1 
ATOM 9159  C CD2 . PHE B 2 68   ? 219.578 11.695  -42.025 1.00 118.21 ? 126  PHE B CD2 1 
ATOM 9160  C CE1 . PHE B 2 68   ? 217.619 11.636  -43.979 1.00 118.72 ? 126  PHE B CE1 1 
ATOM 9161  C CE2 . PHE B 2 68   ? 218.379 11.045  -41.780 1.00 118.91 ? 126  PHE B CE2 1 
ATOM 9162  C CZ  . PHE B 2 68   ? 217.397 11.016  -42.756 1.00 119.23 ? 126  PHE B CZ  1 
ATOM 9163  N N   . PRO B 2 69   ? 223.296 15.052  -42.779 1.00 111.78 ? 127  PRO B N   1 
ATOM 9164  C CA  . PRO B 2 69   ? 224.613 15.620  -43.027 1.00 110.29 ? 127  PRO B CA  1 
ATOM 9165  C C   . PRO B 2 69   ? 225.323 14.828  -44.105 1.00 108.60 ? 127  PRO B C   1 
ATOM 9166  O O   . PRO B 2 69   ? 225.670 13.663  -43.932 1.00 108.14 ? 127  PRO B O   1 
ATOM 9167  C CB  . PRO B 2 69   ? 225.285 15.524  -41.663 1.00 111.02 ? 127  PRO B CB  1 
ATOM 9168  C CG  . PRO B 2 69   ? 224.720 14.266  -41.114 1.00 111.17 ? 127  PRO B CG  1 
ATOM 9169  C CD  . PRO B 2 69   ? 223.255 14.380  -41.467 1.00 111.41 ? 127  PRO B CD  1 
ATOM 9170  N N   . VAL B 2 70   ? 225.499 15.472  -45.241 1.00 107.10 ? 128  VAL B N   1 
ATOM 9171  C CA  . VAL B 2 70   ? 226.171 14.852  -46.349 1.00 106.32 ? 128  VAL B CA  1 
ATOM 9172  C C   . VAL B 2 70   ? 227.618 15.320  -46.267 1.00 107.42 ? 128  VAL B C   1 
ATOM 9173  O O   . VAL B 2 70   ? 227.880 16.431  -45.797 1.00 107.88 ? 128  VAL B O   1 
ATOM 9174  C CB  . VAL B 2 70   ? 225.552 15.319  -47.658 1.00 104.62 ? 128  VAL B CB  1 
ATOM 9175  C CG1 . VAL B 2 70   ? 225.636 16.822  -47.741 1.00 103.51 ? 128  VAL B CG1 1 
ATOM 9176  C CG2 . VAL B 2 70   ? 226.260 14.685  -48.828 1.00 103.52 ? 128  VAL B CG2 1 
ATOM 9177  N N   . ASP B 2 71   ? 228.550 14.477  -46.710 1.00 108.49 ? 129  ASP B N   1 
ATOM 9178  C CA  . ASP B 2 71   ? 229.974 14.819  -46.692 1.00 109.64 ? 129  ASP B CA  1 
ATOM 9179  C C   . ASP B 2 71   ? 230.579 14.845  -48.103 1.00 110.42 ? 129  ASP B C   1 
ATOM 9180  O O   . ASP B 2 71   ? 231.018 13.821  -48.634 1.00 110.07 ? 129  ASP B O   1 
ATOM 9181  C CB  . ASP B 2 71   ? 230.741 13.835  -45.806 1.00 109.24 ? 129  ASP B CB  1 
ATOM 9182  C CG  . ASP B 2 71   ? 232.136 14.315  -45.478 1.00 108.59 ? 129  ASP B CG  1 
ATOM 9183  O OD1 . ASP B 2 71   ? 232.272 15.397  -44.865 1.00 107.13 ? 129  ASP B OD1 1 
ATOM 9184  O OD2 . ASP B 2 71   ? 233.097 13.606  -45.835 1.00 109.32 ? 129  ASP B OD2 1 
ATOM 9185  N N   . ALA B 2 72   ? 230.585 16.034  -48.699 1.00 111.23 ? 130  ALA B N   1 
ATOM 9186  C CA  . ALA B 2 72   ? 231.118 16.255  -50.040 1.00 111.65 ? 130  ALA B CA  1 
ATOM 9187  C C   . ALA B 2 72   ? 232.589 16.680  -49.961 1.00 112.29 ? 130  ALA B C   1 
ATOM 9188  O O   . ALA B 2 72   ? 233.014 17.279  -48.971 1.00 112.79 ? 130  ALA B O   1 
ATOM 9189  C CB  . ALA B 2 72   ? 230.295 17.331  -50.743 1.00 110.66 ? 130  ALA B CB  1 
ATOM 9190  N N   . LEU B 2 73   ? 233.358 16.384  -51.005 1.00 113.06 ? 131  LEU B N   1 
ATOM 9191  C CA  . LEU B 2 73   ? 234.782 16.724  -51.026 1.00 114.21 ? 131  LEU B CA  1 
ATOM 9192  C C   . LEU B 2 73   ? 235.111 18.207  -51.112 1.00 114.61 ? 131  LEU B C   1 
ATOM 9193  O O   . LEU B 2 73   ? 234.249 19.032  -51.402 1.00 114.84 ? 131  LEU B O   1 
ATOM 9194  C CB  . LEU B 2 73   ? 235.486 16.005  -52.182 1.00 114.43 ? 131  LEU B CB  1 
ATOM 9195  C CG  . LEU B 2 73   ? 236.160 14.658  -51.907 1.00 114.59 ? 131  LEU B CG  1 
ATOM 9196  C CD1 . LEU B 2 73   ? 236.882 14.199  -53.161 1.00 114.06 ? 131  LEU B CD1 1 
ATOM 9197  C CD2 . LEU B 2 73   ? 237.153 14.791  -50.753 1.00 114.88 ? 131  LEU B CD2 1 
ATOM 9198  N N   . HIS B 2 74   ? 236.376 18.528  -50.856 1.00 115.33 ? 132  HIS B N   1 
ATOM 9199  C CA  . HIS B 2 74   ? 236.858 19.895  -50.919 1.00 116.39 ? 132  HIS B CA  1 
ATOM 9200  C C   . HIS B 2 74   ? 237.675 20.108  -52.211 1.00 116.87 ? 132  HIS B C   1 
ATOM 9201  O O   . HIS B 2 74   ? 237.702 21.219  -52.746 1.00 116.94 ? 132  HIS B O   1 
ATOM 9202  C CB  . HIS B 2 74   ? 237.727 20.213  -49.691 1.00 117.68 ? 132  HIS B CB  1 
ATOM 9203  C CG  . HIS B 2 74   ? 236.976 20.266  -48.392 1.00 118.92 ? 132  HIS B CG  1 
ATOM 9204  N ND1 . HIS B 2 74   ? 236.313 19.179  -47.865 1.00 119.76 ? 132  HIS B ND1 1 
ATOM 9205  C CD2 . HIS B 2 74   ? 236.791 21.278  -47.509 1.00 119.32 ? 132  HIS B CD2 1 
ATOM 9206  C CE1 . HIS B 2 74   ? 235.753 19.518  -46.717 1.00 120.14 ? 132  HIS B CE1 1 
ATOM 9207  N NE2 . HIS B 2 74   ? 236.027 20.787  -46.478 1.00 119.85 ? 132  HIS B NE2 1 
ATOM 9208  N N   . HIS B 2 75   ? 238.316 19.044  -52.713 1.00 117.48 ? 133  HIS B N   1 
ATOM 9209  C CA  . HIS B 2 75   ? 239.155 19.094  -53.935 1.00 117.76 ? 133  HIS B CA  1 
ATOM 9210  C C   . HIS B 2 75   ? 238.644 18.222  -55.106 1.00 118.43 ? 133  HIS B C   1 
ATOM 9211  O O   . HIS B 2 75   ? 237.732 17.416  -54.934 1.00 118.09 ? 133  HIS B O   1 
ATOM 9212  C CB  . HIS B 2 75   ? 240.563 18.590  -53.638 1.00 116.36 ? 133  HIS B CB  1 
ATOM 9213  C CG  . HIS B 2 75   ? 240.709 17.123  -53.881 1.00 114.68 ? 133  HIS B CG  1 
ATOM 9214  N ND1 . HIS B 2 75   ? 240.173 16.181  -53.030 1.00 114.37 ? 133  HIS B ND1 1 
ATOM 9215  C CD2 . HIS B 2 75   ? 241.163 16.441  -54.958 1.00 114.00 ? 133  HIS B CD2 1 
ATOM 9216  C CE1 . HIS B 2 75   ? 240.281 14.985  -53.575 1.00 114.06 ? 133  HIS B CE1 1 
ATOM 9217  N NE2 . HIS B 2 75   ? 240.878 15.115  -54.747 1.00 113.72 ? 133  HIS B NE2 1 
ATOM 9218  N N   . LYS B 2 76   ? 239.290 18.349  -56.273 1.00 119.50 ? 134  LYS B N   1 
ATOM 9219  C CA  . LYS B 2 76   ? 238.939 17.570  -57.478 1.00 120.43 ? 134  LYS B CA  1 
ATOM 9220  C C   . LYS B 2 76   ? 240.123 17.271  -58.413 1.00 120.91 ? 134  LYS B C   1 
ATOM 9221  O O   . LYS B 2 76   ? 240.774 18.185  -58.923 1.00 120.58 ? 134  LYS B O   1 
ATOM 9222  C CB  . LYS B 2 76   ? 237.855 18.289  -58.293 1.00 120.55 ? 134  LYS B CB  1 
ATOM 9223  C CG  . LYS B 2 76   ? 237.562 17.678  -59.686 1.00 120.79 ? 134  LYS B CG  1 
ATOM 9224  C CD  . LYS B 2 76   ? 236.858 16.315  -59.622 1.00 120.79 ? 134  LYS B CD  1 
ATOM 9225  C CE  . LYS B 2 76   ? 236.311 15.886  -60.991 1.00 119.90 ? 134  LYS B CE  1 
ATOM 9226  N NZ  . LYS B 2 76   ? 237.368 15.631  -62.010 1.00 118.92 ? 134  LYS B NZ  1 
ATOM 9227  N N   . PRO B 2 77   ? 240.413 15.979  -58.647 1.00 121.82 ? 135  PRO B N   1 
ATOM 9228  C CA  . PRO B 2 77   ? 241.515 15.575  -59.527 1.00 122.33 ? 135  PRO B CA  1 
ATOM 9229  C C   . PRO B 2 77   ? 241.113 15.676  -60.990 1.00 122.63 ? 135  PRO B C   1 
ATOM 9230  O O   . PRO B 2 77   ? 240.058 16.213  -61.314 1.00 121.94 ? 135  PRO B O   1 
ATOM 9231  C CB  . PRO B 2 77   ? 241.779 14.127  -59.115 1.00 122.63 ? 135  PRO B CB  1 
ATOM 9232  C CG  . PRO B 2 77   ? 241.312 14.081  -57.696 1.00 122.48 ? 135  PRO B CG  1 
ATOM 9233  C CD  . PRO B 2 77   ? 240.020 14.853  -57.787 1.00 122.52 ? 135  PRO B CD  1 
ATOM 9234  N N   . GLY B 2 78   ? 241.945 15.133  -61.871 1.00 123.77 ? 136  GLY B N   1 
ATOM 9235  C CA  . GLY B 2 78   ? 241.645 15.201  -63.286 1.00 125.99 ? 136  GLY B CA  1 
ATOM 9236  C C   . GLY B 2 78   ? 241.743 16.648  -63.724 1.00 127.85 ? 136  GLY B C   1 
ATOM 9237  O O   . GLY B 2 78   ? 242.849 17.193  -63.782 1.00 128.02 ? 136  GLY B O   1 
ATOM 9238  N N   . PRO B 2 79   ? 240.609 17.304  -64.038 1.00 128.71 ? 137  PRO B N   1 
ATOM 9239  C CA  . PRO B 2 79   ? 240.632 18.710  -64.463 1.00 128.96 ? 137  PRO B CA  1 
ATOM 9240  C C   . PRO B 2 79   ? 241.120 19.720  -63.386 1.00 128.66 ? 137  PRO B C   1 
ATOM 9241  O O   . PRO B 2 79   ? 240.986 20.932  -63.573 1.00 128.45 ? 137  PRO B O   1 
ATOM 9242  C CB  . PRO B 2 79   ? 239.178 18.959  -64.894 1.00 129.58 ? 137  PRO B CB  1 
ATOM 9243  C CG  . PRO B 2 79   ? 238.730 17.609  -65.379 1.00 129.10 ? 137  PRO B CG  1 
ATOM 9244  C CD  . PRO B 2 79   ? 239.287 16.702  -64.301 1.00 128.85 ? 137  PRO B CD  1 
ATOM 9245  N N   . GLY B 2 121  ? 241.684 19.217  -62.278 1.00 128.53 ? 179  GLY B N   1 
ATOM 9246  C CA  . GLY B 2 121  ? 242.186 20.059  -61.184 1.00 128.77 ? 179  GLY B CA  1 
ATOM 9247  C C   . GLY B 2 121  ? 241.472 21.387  -60.919 1.00 128.12 ? 179  GLY B C   1 
ATOM 9248  O O   . GLY B 2 121  ? 241.962 22.445  -61.326 1.00 128.64 ? 179  GLY B O   1 
ATOM 9249  N N   . LYS B 2 122  ? 240.345 21.349  -60.204 1.00 126.45 ? 180  LYS B N   1 
ATOM 9250  C CA  . LYS B 2 122  ? 239.551 22.559  -59.938 1.00 124.07 ? 180  LYS B CA  1 
ATOM 9251  C C   . LYS B 2 122  ? 239.370 22.896  -58.460 1.00 123.15 ? 180  LYS B C   1 
ATOM 9252  O O   . LYS B 2 122  ? 239.697 22.105  -57.579 1.00 123.47 ? 180  LYS B O   1 
ATOM 9253  C CB  . LYS B 2 122  ? 238.164 22.405  -60.580 1.00 122.62 ? 180  LYS B CB  1 
ATOM 9254  C CG  . LYS B 2 122  ? 237.393 23.698  -60.865 1.00 119.89 ? 180  LYS B CG  1 
ATOM 9255  C CD  . LYS B 2 122  ? 237.911 24.394  -62.116 1.00 118.55 ? 180  LYS B CD  1 
ATOM 9256  C CE  . LYS B 2 122  ? 236.849 25.295  -62.737 1.00 117.93 ? 180  LYS B CE  1 
ATOM 9257  N NZ  . LYS B 2 122  ? 235.664 24.523  -63.206 1.00 117.68 ? 180  LYS B NZ  1 
ATOM 9258  N N   . LEU B 2 123  ? 238.824 24.081  -58.209 1.00 121.46 ? 181  LEU B N   1 
ATOM 9259  C CA  . LEU B 2 123  ? 238.578 24.550  -56.856 1.00 119.30 ? 181  LEU B CA  1 
ATOM 9260  C C   . LEU B 2 123  ? 237.125 24.316  -56.468 1.00 117.86 ? 181  LEU B C   1 
ATOM 9261  O O   . LEU B 2 123  ? 236.268 24.134  -57.332 1.00 117.70 ? 181  LEU B O   1 
ATOM 9262  C CB  . LEU B 2 123  ? 238.882 26.036  -56.767 1.00 118.89 ? 181  LEU B CB  1 
ATOM 9263  C CG  . LEU B 2 123  ? 240.190 26.433  -57.433 1.00 118.07 ? 181  LEU B CG  1 
ATOM 9264  C CD1 . LEU B 2 123  ? 240.405 27.910  -57.219 1.00 118.38 ? 181  LEU B CD1 1 
ATOM 9265  C CD2 . LEU B 2 123  ? 241.336 25.628  -56.857 1.00 118.00 ? 181  LEU B CD2 1 
ATOM 9266  N N   . ARG B 2 124  ? 236.857 24.333  -55.165 1.00 115.70 ? 182  ARG B N   1 
ATOM 9267  C CA  . ARG B 2 124  ? 235.512 24.130  -54.621 1.00 113.19 ? 182  ARG B CA  1 
ATOM 9268  C C   . ARG B 2 124  ? 234.690 25.418  -54.705 1.00 111.83 ? 182  ARG B C   1 
ATOM 9269  O O   . ARG B 2 124  ? 234.677 26.204  -53.764 1.00 111.31 ? 182  ARG B O   1 
ATOM 9270  C CB  . ARG B 2 124  ? 235.628 23.668  -53.160 1.00 112.95 ? 182  ARG B CB  1 
ATOM 9271  C CG  . ARG B 2 124  ? 234.385 23.868  -52.314 1.00 112.75 ? 182  ARG B CG  1 
ATOM 9272  C CD  . ARG B 2 124  ? 234.629 23.502  -50.846 1.00 113.28 ? 182  ARG B CD  1 
ATOM 9273  N NE  . ARG B 2 124  ? 234.615 22.055  -50.611 1.00 113.22 ? 182  ARG B NE  1 
ATOM 9274  C CZ  . ARG B 2 124  ? 234.425 21.487  -49.421 1.00 112.84 ? 182  ARG B CZ  1 
ATOM 9275  N NH1 . ARG B 2 124  ? 234.236 22.237  -48.343 1.00 112.50 ? 182  ARG B NH1 1 
ATOM 9276  N NH2 . ARG B 2 124  ? 234.401 20.166  -49.303 1.00 112.81 ? 182  ARG B NH2 1 
ATOM 9277  N N   . GLU B 2 125  ? 234.004 25.645  -55.823 1.00 110.91 ? 183  GLU B N   1 
ATOM 9278  C CA  . GLU B 2 125  ? 233.225 26.869  -55.940 1.00 110.05 ? 183  GLU B CA  1 
ATOM 9279  C C   . GLU B 2 125  ? 231.734 26.644  -55.808 1.00 107.69 ? 183  GLU B C   1 
ATOM 9280  O O   . GLU B 2 125  ? 231.070 27.309  -55.025 1.00 107.39 ? 183  GLU B O   1 
ATOM 9281  C CB  . GLU B 2 125  ? 233.552 27.618  -57.250 1.00 112.26 ? 183  GLU B CB  1 
ATOM 9282  C CG  . GLU B 2 125  ? 233.179 26.941  -58.563 1.00 115.93 ? 183  GLU B CG  1 
ATOM 9283  C CD  . GLU B 2 125  ? 233.577 27.788  -59.770 1.00 117.59 ? 183  GLU B CD  1 
ATOM 9284  O OE1 . GLU B 2 125  ? 233.097 28.937  -59.881 1.00 118.44 ? 183  GLU B OE1 1 
ATOM 9285  O OE2 . GLU B 2 125  ? 234.374 27.307  -60.604 1.00 118.64 ? 183  GLU B OE2 1 
ATOM 9286  N N   . ASN B 2 126  ? 231.191 25.709  -56.562 1.00 105.18 ? 184  ASN B N   1 
ATOM 9287  C CA  . ASN B 2 126  ? 229.773 25.468  -56.446 1.00 102.80 ? 184  ASN B CA  1 
ATOM 9288  C C   . ASN B 2 126  ? 229.632 24.326  -55.473 1.00 100.78 ? 184  ASN B C   1 
ATOM 9289  O O   . ASN B 2 126  ? 229.421 23.189  -55.875 1.00 101.03 ? 184  ASN B O   1 
ATOM 9290  C CB  . ASN B 2 126  ? 229.181 25.095  -57.803 1.00 102.75 ? 184  ASN B CB  1 
ATOM 9291  C CG  . ASN B 2 126  ? 228.073 26.037  -58.233 1.00 101.87 ? 184  ASN B CG  1 
ATOM 9292  O OD1 . ASN B 2 126  ? 227.087 26.224  -57.519 1.00 101.52 ? 184  ASN B OD1 1 
ATOM 9293  N ND2 . ASN B 2 126  ? 228.229 26.634  -59.408 1.00 100.96 ? 184  ASN B ND2 1 
ATOM 9294  N N   . LEU B 2 127  ? 229.767 24.618  -54.186 1.00 97.96  ? 185  LEU B N   1 
ATOM 9295  C CA  . LEU B 2 127  ? 229.649 23.559  -53.189 1.00 95.08  ? 185  LEU B CA  1 
ATOM 9296  C C   . LEU B 2 127  ? 228.322 22.859  -53.407 1.00 93.08  ? 185  LEU B C   1 
ATOM 9297  O O   . LEU B 2 127  ? 228.103 21.736  -52.952 1.00 92.83  ? 185  LEU B O   1 
ATOM 9298  C CB  . LEU B 2 127  ? 229.719 24.118  -51.764 1.00 94.86  ? 185  LEU B CB  1 
ATOM 9299  C CG  . LEU B 2 127  ? 228.547 24.930  -51.233 1.00 93.63  ? 185  LEU B CG  1 
ATOM 9300  C CD1 . LEU B 2 127  ? 228.827 25.292  -49.785 1.00 93.01  ? 185  LEU B CD1 1 
ATOM 9301  C CD2 . LEU B 2 127  ? 228.347 26.171  -52.092 1.00 92.81  ? 185  LEU B CD2 1 
ATOM 9302  N N   . LEU B 2 128  ? 227.443 23.545  -54.119 1.00 91.19  ? 186  LEU B N   1 
ATOM 9303  C CA  . LEU B 2 128  ? 226.128 23.032  -54.452 1.00 90.03  ? 186  LEU B CA  1 
ATOM 9304  C C   . LEU B 2 128  ? 226.314 21.721  -55.233 1.00 89.98  ? 186  LEU B C   1 
ATOM 9305  O O   . LEU B 2 128  ? 225.393 20.910  -55.347 1.00 88.48  ? 186  LEU B O   1 
ATOM 9306  C CB  . LEU B 2 128  ? 225.426 24.074  -55.319 1.00 88.80  ? 186  LEU B CB  1 
ATOM 9307  C CG  . LEU B 2 128  ? 223.921 24.136  -55.568 1.00 86.98  ? 186  LEU B CG  1 
ATOM 9308  C CD1 . LEU B 2 128  ? 223.702 25.285  -56.529 1.00 85.59  ? 186  LEU B CD1 1 
ATOM 9309  C CD2 . LEU B 2 128  ? 223.370 22.834  -56.152 1.00 87.25  ? 186  LEU B CD2 1 
ATOM 9310  N N   . HIS B 2 129  ? 227.526 21.524  -55.746 1.00 91.13  ? 187  HIS B N   1 
ATOM 9311  C CA  . HIS B 2 129  ? 227.873 20.356  -56.547 1.00 92.75  ? 187  HIS B CA  1 
ATOM 9312  C C   . HIS B 2 129  ? 228.080 19.036  -55.816 1.00 94.08  ? 187  HIS B C   1 
ATOM 9313  O O   . HIS B 2 129  ? 227.475 18.021  -56.159 1.00 94.29  ? 187  HIS B O   1 
ATOM 9314  C CB  . HIS B 2 129  ? 229.121 20.662  -57.366 1.00 93.12  ? 187  HIS B CB  1 
ATOM 9315  C CG  . HIS B 2 129  ? 229.677 19.472  -58.078 1.00 94.73  ? 187  HIS B CG  1 
ATOM 9316  N ND1 . HIS B 2 129  ? 228.882 18.572  -58.755 1.00 95.96  ? 187  HIS B ND1 1 
ATOM 9317  C CD2 . HIS B 2 129  ? 230.950 19.043  -58.239 1.00 95.34  ? 187  HIS B CD2 1 
ATOM 9318  C CE1 . HIS B 2 129  ? 229.642 17.641  -59.304 1.00 95.99  ? 187  HIS B CE1 1 
ATOM 9319  N NE2 . HIS B 2 129  ? 230.901 17.904  -59.006 1.00 96.35  ? 187  HIS B NE2 1 
ATOM 9320  N N   . GLY B 2 130  ? 228.957 19.039  -54.827 1.00 96.11  ? 188  GLY B N   1 
ATOM 9321  C CA  . GLY B 2 130  ? 229.215 17.816  -54.093 1.00 98.57  ? 188  GLY B CA  1 
ATOM 9322  C C   . GLY B 2 130  ? 227.972 16.990  -53.828 1.00 100.10 ? 188  GLY B C   1 
ATOM 9323  O O   . GLY B 2 130  ? 228.001 15.763  -53.886 1.00 99.33  ? 188  GLY B O   1 
ATOM 9324  N N   . ALA B 2 131  ? 226.868 17.661  -53.535 1.00 102.01 ? 189  ALA B N   1 
ATOM 9325  C CA  . ALA B 2 131  ? 225.627 16.957  -53.256 1.00 103.84 ? 189  ALA B CA  1 
ATOM 9326  C C   . ALA B 2 131  ? 225.242 16.127  -54.464 1.00 104.98 ? 189  ALA B C   1 
ATOM 9327  O O   . ALA B 2 131  ? 225.019 14.922  -54.365 1.00 104.31 ? 189  ALA B O   1 
ATOM 9328  C CB  . ALA B 2 131  ? 224.522 17.949  -52.932 1.00 103.72 ? 189  ALA B CB  1 
ATOM 9329  N N   . LEU B 2 132  ? 225.169 16.798  -55.604 1.00 107.28 ? 190  LEU B N   1 
ATOM 9330  C CA  . LEU B 2 132  ? 224.812 16.164  -56.858 1.00 109.30 ? 190  LEU B CA  1 
ATOM 9331  C C   . LEU B 2 132  ? 225.282 14.715  -56.922 1.00 110.14 ? 190  LEU B C   1 
ATOM 9332  O O   . LEU B 2 132  ? 224.479 13.798  -57.103 1.00 110.11 ? 190  LEU B O   1 
ATOM 9333  C CB  . LEU B 2 132  ? 225.419 16.955  -58.026 1.00 109.88 ? 190  LEU B CB  1 
ATOM 9334  C CG  . LEU B 2 132  ? 224.782 18.265  -58.527 1.00 110.66 ? 190  LEU B CG  1 
ATOM 9335  C CD1 . LEU B 2 132  ? 223.548 17.944  -59.350 1.00 110.53 ? 190  LEU B CD1 1 
ATOM 9336  C CD2 . LEU B 2 132  ? 224.438 19.189  -57.366 1.00 111.17 ? 190  LEU B CD2 1 
ATOM 9337  N N   . GLU B 2 133  ? 226.587 14.520  -56.753 1.00 111.18 ? 191  GLU B N   1 
ATOM 9338  C CA  . GLU B 2 133  ? 227.197 13.193  -56.833 1.00 112.40 ? 191  GLU B CA  1 
ATOM 9339  C C   . GLU B 2 133  ? 226.646 12.146  -55.885 1.00 112.85 ? 191  GLU B C   1 
ATOM 9340  O O   . GLU B 2 133  ? 226.524 10.971  -56.240 1.00 112.88 ? 191  GLU B O   1 
ATOM 9341  C CB  . GLU B 2 133  ? 228.718 13.293  -56.631 1.00 112.53 ? 191  GLU B CB  1 
ATOM 9342  C CG  . GLU B 2 133  ? 229.469 14.031  -57.745 1.00 112.63 ? 191  GLU B CG  1 
ATOM 9343  C CD  . GLU B 2 133  ? 230.975 13.777  -57.723 1.00 112.57 ? 191  GLU B CD  1 
ATOM 9344  O OE1 . GLU B 2 133  ? 231.624 14.064  -56.695 1.00 112.71 ? 191  GLU B OE1 1 
ATOM 9345  O OE2 . GLU B 2 133  ? 231.514 13.289  -58.739 1.00 112.14 ? 191  GLU B OE2 1 
ATOM 9346  N N   . HIS B 2 134  ? 226.312 12.565  -54.677 1.00 113.23 ? 192  HIS B N   1 
ATOM 9347  C CA  . HIS B 2 134  ? 225.810 11.616  -53.711 1.00 112.94 ? 192  HIS B CA  1 
ATOM 9348  C C   . HIS B 2 134  ? 224.308 11.372  -53.768 1.00 112.48 ? 192  HIS B C   1 
ATOM 9349  O O   . HIS B 2 134  ? 223.828 10.411  -53.174 1.00 112.68 ? 192  HIS B O   1 
ATOM 9350  C CB  . HIS B 2 134  ? 226.245 12.034  -52.301 1.00 113.04 ? 192  HIS B CB  1 
ATOM 9351  C CG  . HIS B 2 134  ? 227.679 11.715  -51.990 1.00 113.35 ? 192  HIS B CG  1 
ATOM 9352  N ND1 . HIS B 2 134  ? 228.161 10.423  -51.915 1.00 113.59 ? 192  HIS B ND1 1 
ATOM 9353  C CD2 . HIS B 2 134  ? 228.736 12.522  -51.735 1.00 113.85 ? 192  HIS B CD2 1 
ATOM 9354  C CE1 . HIS B 2 134  ? 229.450 10.449  -51.628 1.00 113.60 ? 192  HIS B CE1 1 
ATOM 9355  N NE2 . HIS B 2 134  ? 229.824 11.711  -51.513 1.00 113.92 ? 192  HIS B NE2 1 
ATOM 9356  N N   . TYR B 2 135  ? 223.562 12.212  -54.485 1.00 111.61 ? 193  TYR B N   1 
ATOM 9357  C CA  . TYR B 2 135  ? 222.117 12.009  -54.567 1.00 110.82 ? 193  TYR B CA  1 
ATOM 9358  C C   . TYR B 2 135  ? 221.831 10.541  -54.800 1.00 110.63 ? 193  TYR B C   1 
ATOM 9359  O O   . TYR B 2 135  ? 221.075 9.921   -54.064 1.00 110.54 ? 193  TYR B O   1 
ATOM 9360  C CB  . TYR B 2 135  ? 221.502 12.808  -55.706 1.00 110.23 ? 193  TYR B CB  1 
ATOM 9361  C CG  . TYR B 2 135  ? 220.062 12.421  -56.007 1.00 108.91 ? 193  TYR B CG  1 
ATOM 9362  C CD1 . TYR B 2 135  ? 219.047 12.592  -55.060 1.00 108.41 ? 193  TYR B CD1 1 
ATOM 9363  C CD2 . TYR B 2 135  ? 219.709 11.910  -57.254 1.00 108.76 ? 193  TYR B CD2 1 
ATOM 9364  C CE1 . TYR B 2 135  ? 217.711 12.266  -55.359 1.00 108.11 ? 193  TYR B CE1 1 
ATOM 9365  C CE2 . TYR B 2 135  ? 218.382 11.581  -57.563 1.00 108.26 ? 193  TYR B CE2 1 
ATOM 9366  C CZ  . TYR B 2 135  ? 217.392 11.764  -56.615 1.00 108.09 ? 193  TYR B CZ  1 
ATOM 9367  O OH  . TYR B 2 135  ? 216.094 11.454  -56.934 1.00 107.79 ? 193  TYR B OH  1 
ATOM 9368  N N   . VAL B 2 136  ? 222.439 9.986   -55.837 1.00 110.85 ? 194  VAL B N   1 
ATOM 9369  C CA  . VAL B 2 136  ? 222.250 8.578   -56.139 1.00 111.58 ? 194  VAL B CA  1 
ATOM 9370  C C   . VAL B 2 136  ? 222.678 7.774   -54.926 1.00 111.41 ? 194  VAL B C   1 
ATOM 9371  O O   . VAL B 2 136  ? 221.978 6.870   -54.475 1.00 110.98 ? 194  VAL B O   1 
ATOM 9372  C CB  . VAL B 2 136  ? 223.109 8.146   -57.349 1.00 112.59 ? 194  VAL B CB  1 
ATOM 9373  C CG1 . VAL B 2 136  ? 224.536 8.686   -57.199 1.00 113.40 ? 194  VAL B CG1 1 
ATOM 9374  C CG2 . VAL B 2 136  ? 223.118 6.617   -57.467 1.00 112.99 ? 194  VAL B CG2 1 
ATOM 9375  N N   . ASN B 2 137  ? 223.844 8.130   -54.407 1.00 111.67 ? 195  ASN B N   1 
ATOM 9376  C CA  . ASN B 2 137  ? 224.427 7.467   -53.255 1.00 112.31 ? 195  ASN B CA  1 
ATOM 9377  C C   . ASN B 2 137  ? 223.445 7.379   -52.092 1.00 111.48 ? 195  ASN B C   1 
ATOM 9378  O O   . ASN B 2 137  ? 223.220 6.301   -51.533 1.00 111.40 ? 195  ASN B O   1 
ATOM 9379  C CB  . ASN B 2 137  ? 225.692 8.219   -52.839 1.00 113.94 ? 195  ASN B CB  1 
ATOM 9380  C CG  . ASN B 2 137  ? 226.442 7.531   -51.727 1.00 115.03 ? 195  ASN B CG  1 
ATOM 9381  O OD1 . ASN B 2 137  ? 226.741 6.344   -51.806 1.00 116.00 ? 195  ASN B OD1 1 
ATOM 9382  N ND2 . ASN B 2 137  ? 226.764 8.279   -50.685 1.00 115.10 ? 195  ASN B ND2 1 
ATOM 9383  N N   . CYS B 2 138  ? 222.848 8.513   -51.740 1.00 110.59 ? 196  CYS B N   1 
ATOM 9384  C CA  . CYS B 2 138  ? 221.894 8.553   -50.635 1.00 109.76 ? 196  CYS B CA  1 
ATOM 9385  C C   . CYS B 2 138  ? 220.454 8.216   -51.042 1.00 109.19 ? 196  CYS B C   1 
ATOM 9386  O O   . CYS B 2 138  ? 219.651 7.824   -50.199 1.00 109.36 ? 196  CYS B O   1 
ATOM 9387  C CB  . CYS B 2 138  ? 221.933 9.924   -49.939 1.00 109.64 ? 196  CYS B CB  1 
ATOM 9388  S SG  . CYS B 2 138  ? 221.337 11.311  -50.908 1.00 110.42 ? 196  CYS B SG  1 
ATOM 9389  N N   . LEU B 2 139  ? 220.119 8.370   -52.322 1.00 108.21 ? 197  LEU B N   1 
ATOM 9390  C CA  . LEU B 2 139  ? 218.766 8.055   -52.777 1.00 107.01 ? 197  LEU B CA  1 
ATOM 9391  C C   . LEU B 2 139  ? 218.347 6.772   -52.090 1.00 106.29 ? 197  LEU B C   1 
ATOM 9392  O O   . LEU B 2 139  ? 217.374 6.742   -51.342 1.00 105.56 ? 197  LEU B O   1 
ATOM 9393  C CB  . LEU B 2 139  ? 218.736 7.843   -54.291 1.00 106.83 ? 197  LEU B CB  1 
ATOM 9394  C CG  . LEU B 2 139  ? 217.409 7.321   -54.846 1.00 106.39 ? 197  LEU B CG  1 
ATOM 9395  C CD1 . LEU B 2 139  ? 216.299 8.292   -54.492 1.00 106.50 ? 197  LEU B CD1 1 
ATOM 9396  C CD2 . LEU B 2 139  ? 217.509 7.143   -56.350 1.00 105.99 ? 197  LEU B CD2 1 
ATOM 9397  N N   . ASP B 2 140  ? 219.125 5.725   -52.347 1.00 105.73 ? 198  ASP B N   1 
ATOM 9398  C CA  . ASP B 2 140  ? 218.913 4.397   -51.786 1.00 105.26 ? 198  ASP B CA  1 
ATOM 9399  C C   . ASP B 2 140  ? 218.519 4.494   -50.303 1.00 105.51 ? 198  ASP B C   1 
ATOM 9400  O O   . ASP B 2 140  ? 217.825 3.620   -49.776 1.00 105.18 ? 198  ASP B O   1 
ATOM 9401  C CB  . ASP B 2 140  ? 220.205 3.578   -51.957 1.00 104.30 ? 198  ASP B CB  1 
ATOM 9402  C CG  . ASP B 2 140  ? 219.948 2.103   -52.216 1.00 104.01 ? 198  ASP B CG  1 
ATOM 9403  O OD1 . ASP B 2 140  ? 219.665 1.353   -51.257 1.00 104.23 ? 198  ASP B OD1 1 
ATOM 9404  O OD2 . ASP B 2 140  ? 220.034 1.693   -53.391 1.00 103.55 ? 198  ASP B OD2 1 
ATOM 9405  N N   . LEU B 2 141  ? 218.945 5.567   -49.641 1.00 105.76 ? 199  LEU B N   1 
ATOM 9406  C CA  . LEU B 2 141  ? 218.651 5.763   -48.223 1.00 105.97 ? 199  LEU B CA  1 
ATOM 9407  C C   . LEU B 2 141  ? 217.181 5.546   -47.903 1.00 107.01 ? 199  LEU B C   1 
ATOM 9408  O O   . LEU B 2 141  ? 216.807 4.508   -47.362 1.00 107.87 ? 199  LEU B O   1 
ATOM 9409  C CB  . LEU B 2 141  ? 219.089 7.163   -47.782 1.00 104.70 ? 199  LEU B CB  1 
ATOM 9410  C CG  . LEU B 2 141  ? 219.000 7.561   -46.309 1.00 103.58 ? 199  LEU B CG  1 
ATOM 9411  C CD1 . LEU B 2 141  ? 217.655 8.184   -46.017 1.00 103.31 ? 199  LEU B CD1 1 
ATOM 9412  C CD2 . LEU B 2 141  ? 219.247 6.350   -45.434 1.00 103.02 ? 199  LEU B CD2 1 
ATOM 9413  N N   . VAL B 2 142  ? 216.343 6.518   -48.242 1.00 108.43 ? 200  VAL B N   1 
ATOM 9414  C CA  . VAL B 2 142  ? 214.906 6.409   -47.975 1.00 110.18 ? 200  VAL B CA  1 
ATOM 9415  C C   . VAL B 2 142  ? 214.124 5.695   -49.071 1.00 110.83 ? 200  VAL B C   1 
ATOM 9416  O O   . VAL B 2 142  ? 213.357 6.323   -49.809 1.00 111.32 ? 200  VAL B O   1 
ATOM 9417  C CB  . VAL B 2 142  ? 214.256 7.797   -47.763 1.00 110.09 ? 200  VAL B CB  1 
ATOM 9418  C CG1 . VAL B 2 142  ? 214.492 8.268   -46.335 1.00 110.75 ? 200  VAL B CG1 1 
ATOM 9419  C CG2 . VAL B 2 142  ? 214.823 8.805   -48.770 1.00 110.66 ? 200  VAL B CG2 1 
ATOM 9420  N N   . ASN B 2 143  ? 214.298 4.380   -49.156 1.00 111.23 ? 201  ASN B N   1 
ATOM 9421  C CA  . ASN B 2 143  ? 213.609 3.602   -50.176 1.00 111.29 ? 201  ASN B CA  1 
ATOM 9422  C C   . ASN B 2 143  ? 213.820 4.355   -51.462 1.00 110.06 ? 201  ASN B C   1 
ATOM 9423  O O   . ASN B 2 143  ? 214.857 4.250   -52.110 1.00 110.79 ? 201  ASN B O   1 
ATOM 9424  C CB  . ASN B 2 143  ? 212.113 3.551   -49.896 1.00 113.64 ? 201  ASN B CB  1 
ATOM 9425  C CG  . ASN B 2 143  ? 211.365 2.729   -50.922 1.00 115.84 ? 201  ASN B CG  1 
ATOM 9426  O OD1 . ASN B 2 143  ? 211.844 2.513   -52.032 1.00 117.14 ? 201  ASN B OD1 1 
ATOM 9427  N ND2 . ASN B 2 143  ? 210.178 2.275   -50.560 1.00 116.75 ? 201  ASN B ND2 1 
ATOM 9428  N N   . LYS B 2 144  ? 212.806 5.123   -51.823 1.00 108.36 ? 202  LYS B N   1 
ATOM 9429  C CA  . LYS B 2 144  ? 212.874 5.941   -53.006 1.00 107.13 ? 202  LYS B CA  1 
ATOM 9430  C C   . LYS B 2 144  ? 211.993 7.157   -52.822 1.00 106.86 ? 202  LYS B C   1 
ATOM 9431  O O   . LYS B 2 144  ? 211.769 7.829   -53.777 1.00 107.13 ? 202  LYS B O   1 
ATOM 9432  C CB  . LYS B 2 144  ? 212.403 5.179   -54.255 1.00 107.33 ? 202  LYS B CB  1 
ATOM 9433  C CG  . LYS B 2 144  ? 213.395 4.169   -54.847 1.00 108.03 ? 202  LYS B CG  1 
ATOM 9434  C CD  . LYS B 2 144  ? 214.555 4.824   -55.604 1.00 108.16 ? 202  LYS B CD  1 
ATOM 9435  C CE  . LYS B 2 144  ? 215.501 3.770   -56.187 1.00 107.91 ? 202  LYS B CE  1 
ATOM 9436  N NZ  . LYS B 2 144  ? 216.699 4.363   -56.848 1.00 107.50 ? 202  LYS B NZ  1 
ATOM 9437  N N   . ARG B 2 145  ? 211.507 7.458   -51.616 1.00 106.58 ? 203  ARG B N   1 
ATOM 9438  C CA  . ARG B 2 145  ? 210.621 8.629   -51.414 1.00 105.61 ? 203  ARG B CA  1 
ATOM 9439  C C   . ARG B 2 145  ? 211.166 9.992   -51.925 1.00 105.10 ? 203  ARG B C   1 
ATOM 9440  O O   . ARG B 2 145  ? 212.320 10.083  -52.346 1.00 105.17 ? 203  ARG B O   1 
ATOM 9441  C CB  . ARG B 2 145  ? 210.281 8.776   -49.931 1.00 105.24 ? 203  ARG B CB  1 
ATOM 9442  C CG  . ARG B 2 145  ? 211.371 9.458   -49.118 1.00 104.98 ? 203  ARG B CG  1 
ATOM 9443  C CD  . ARG B 2 145  ? 210.804 10.592  -48.267 1.00 104.47 ? 203  ARG B CD  1 
ATOM 9444  N NE  . ARG B 2 145  ? 211.820 11.585  -47.905 1.00 105.57 ? 203  ARG B NE  1 
ATOM 9445  C CZ  . ARG B 2 145  ? 212.408 11.681  -46.714 1.00 105.97 ? 203  ARG B CZ  1 
ATOM 9446  N NH1 . ARG B 2 145  ? 213.322 12.619  -46.490 1.00 105.62 ? 203  ARG B NH1 1 
ATOM 9447  N NH2 . ARG B 2 145  ? 212.073 10.853  -45.737 1.00 106.56 ? 203  ARG B NH2 1 
ATOM 9448  N N   . LEU B 2 146  ? 210.323 11.035  -51.893 1.00 104.57 ? 204  LEU B N   1 
ATOM 9449  C CA  . LEU B 2 146  ? 210.683 12.411  -52.307 1.00 103.94 ? 204  LEU B CA  1 
ATOM 9450  C C   . LEU B 2 146  ? 209.882 13.412  -51.471 1.00 103.28 ? 204  LEU B C   1 
ATOM 9451  O O   . LEU B 2 146  ? 208.680 13.223  -51.269 1.00 102.50 ? 204  LEU B O   1 
ATOM 9452  C CB  . LEU B 2 146  ? 210.368 12.674  -53.793 1.00 103.67 ? 204  LEU B CB  1 
ATOM 9453  C CG  . LEU B 2 146  ? 211.511 12.845  -54.810 1.00 102.92 ? 204  LEU B CG  1 
ATOM 9454  C CD1 . LEU B 2 146  ? 210.967 13.275  -56.163 1.00 102.32 ? 204  LEU B CD1 1 
ATOM 9455  C CD2 . LEU B 2 146  ? 212.490 13.879  -54.327 1.00 102.26 ? 204  LEU B CD2 1 
ATOM 9456  N N   . PRO B 2 147  ? 210.525 14.502  -50.992 1.00 102.74 ? 205  PRO B N   1 
ATOM 9457  C CA  . PRO B 2 147  ? 211.933 14.881  -51.151 1.00 102.85 ? 205  PRO B CA  1 
ATOM 9458  C C   . PRO B 2 147  ? 212.641 15.222  -49.827 1.00 103.18 ? 205  PRO B C   1 
ATOM 9459  O O   . PRO B 2 147  ? 212.121 14.957  -48.739 1.00 103.32 ? 205  PRO B O   1 
ATOM 9460  C CB  . PRO B 2 147  ? 211.827 16.108  -52.027 1.00 102.24 ? 205  PRO B CB  1 
ATOM 9461  C CG  . PRO B 2 147  ? 210.712 16.840  -51.327 1.00 102.35 ? 205  PRO B CG  1 
ATOM 9462  C CD  . PRO B 2 147  ? 209.722 15.731  -50.869 1.00 102.66 ? 205  PRO B CD  1 
ATOM 9463  N N   . TYR B 2 148  ? 213.824 15.829  -49.951 1.00 103.39 ? 206  TYR B N   1 
ATOM 9464  C CA  . TYR B 2 148  ? 214.658 16.243  -48.823 1.00 103.12 ? 206  TYR B CA  1 
ATOM 9465  C C   . TYR B 2 148  ? 215.981 16.753  -49.387 1.00 103.43 ? 206  TYR B C   1 
ATOM 9466  O O   . TYR B 2 148  ? 216.157 16.828  -50.600 1.00 103.07 ? 206  TYR B O   1 
ATOM 9467  C CB  . TYR B 2 148  ? 214.913 15.068  -47.885 1.00 102.77 ? 206  TYR B CB  1 
ATOM 9468  C CG  . TYR B 2 148  ? 215.782 14.017  -48.505 1.00 102.82 ? 206  TYR B CG  1 
ATOM 9469  C CD1 . TYR B 2 148  ? 217.164 14.103  -48.430 1.00 102.86 ? 206  TYR B CD1 1 
ATOM 9470  C CD2 . TYR B 2 148  ? 215.224 12.969  -49.228 1.00 103.46 ? 206  TYR B CD2 1 
ATOM 9471  C CE1 . TYR B 2 148  ? 217.977 13.169  -49.066 1.00 103.57 ? 206  TYR B CE1 1 
ATOM 9472  C CE2 . TYR B 2 148  ? 216.022 12.030  -49.870 1.00 104.07 ? 206  TYR B CE2 1 
ATOM 9473  C CZ  . TYR B 2 148  ? 217.395 12.134  -49.789 1.00 104.06 ? 206  TYR B CZ  1 
ATOM 9474  O OH  . TYR B 2 148  ? 218.175 11.211  -50.447 1.00 105.08 ? 206  TYR B OH  1 
ATOM 9475  N N   . GLY B 2 149  ? 216.916 17.098  -48.514 1.00 104.14 ? 207  GLY B N   1 
ATOM 9476  C CA  . GLY B 2 149  ? 218.190 17.589  -48.999 1.00 106.32 ? 207  GLY B CA  1 
ATOM 9477  C C   . GLY B 2 149  ? 219.370 16.866  -48.391 1.00 107.63 ? 207  GLY B C   1 
ATOM 9478  O O   . GLY B 2 149  ? 219.252 15.742  -47.911 1.00 107.28 ? 207  GLY B O   1 
ATOM 9479  N N   . LEU B 2 150  ? 220.522 17.519  -48.414 1.00 108.96 ? 208  LEU B N   1 
ATOM 9480  C CA  . LEU B 2 150  ? 221.737 16.952  -47.849 1.00 110.64 ? 208  LEU B CA  1 
ATOM 9481  C C   . LEU B 2 150  ? 222.649 18.122  -47.522 1.00 111.54 ? 208  LEU B C   1 
ATOM 9482  O O   . LEU B 2 150  ? 223.497 18.513  -48.320 1.00 112.21 ? 208  LEU B O   1 
ATOM 9483  C CB  . LEU B 2 150  ? 222.407 15.984  -48.841 1.00 110.26 ? 208  LEU B CB  1 
ATOM 9484  C CG  . LEU B 2 150  ? 222.859 16.448  -50.228 1.00 110.13 ? 208  LEU B CG  1 
ATOM 9485  C CD1 . LEU B 2 150  ? 223.375 15.260  -51.003 1.00 110.54 ? 208  LEU B CD1 1 
ATOM 9486  C CD2 . LEU B 2 150  ? 221.714 17.079  -50.975 1.00 109.23 ? 208  LEU B CD2 1 
ATOM 9487  N N   . ALA B 2 151  ? 222.445 18.689  -46.339 1.00 112.12 ? 209  ALA B N   1 
ATOM 9488  C CA  . ALA B 2 151  ? 223.222 19.831  -45.886 1.00 112.25 ? 209  ALA B CA  1 
ATOM 9489  C C   . ALA B 2 151  ? 224.680 19.489  -45.588 1.00 111.92 ? 209  ALA B C   1 
ATOM 9490  O O   . ALA B 2 151  ? 224.998 18.383  -45.143 1.00 111.61 ? 209  ALA B O   1 
ATOM 9491  C CB  . ALA B 2 151  ? 222.567 20.441  -44.653 1.00 112.82 ? 209  ALA B CB  1 
ATOM 9492  N N   . GLN B 2 152  ? 225.555 20.457  -45.849 1.00 111.74 ? 210  GLN B N   1 
ATOM 9493  C CA  . GLN B 2 152  ? 226.990 20.331  -45.611 1.00 112.10 ? 210  GLN B CA  1 
ATOM 9494  C C   . GLN B 2 152  ? 227.592 21.727  -45.597 1.00 111.22 ? 210  GLN B C   1 
ATOM 9495  O O   . GLN B 2 152  ? 227.648 22.409  -46.620 1.00 110.91 ? 210  GLN B O   1 
ATOM 9496  C CB  . GLN B 2 152  ? 227.657 19.468  -46.695 1.00 113.67 ? 210  GLN B CB  1 
ATOM 9497  C CG  . GLN B 2 152  ? 228.896 20.076  -47.356 1.00 116.44 ? 210  GLN B CG  1 
ATOM 9498  C CD  . GLN B 2 152  ? 228.607 20.610  -48.746 1.00 117.67 ? 210  GLN B CD  1 
ATOM 9499  O OE1 . GLN B 2 152  ? 228.303 19.843  -49.660 1.00 118.31 ? 210  GLN B OE1 1 
ATOM 9500  N NE2 . GLN B 2 152  ? 228.693 21.929  -48.910 1.00 118.33 ? 210  GLN B NE2 1 
ATOM 9501  N N   . ILE B 2 153  ? 228.017 22.168  -44.423 1.00 110.29 ? 211  ILE B N   1 
ATOM 9502  C CA  . ILE B 2 153  ? 228.609 23.484  -44.317 1.00 109.76 ? 211  ILE B CA  1 
ATOM 9503  C C   . ILE B 2 153  ? 230.068 23.357  -44.736 1.00 109.32 ? 211  ILE B C   1 
ATOM 9504  O O   . ILE B 2 153  ? 230.954 23.078  -43.918 1.00 109.04 ? 211  ILE B O   1 
ATOM 9505  C CB  . ILE B 2 153  ? 228.497 24.034  -42.885 1.00 110.13 ? 211  ILE B CB  1 
ATOM 9506  C CG1 . ILE B 2 153  ? 227.024 24.137  -42.490 1.00 109.63 ? 211  ILE B CG1 1 
ATOM 9507  C CG2 . ILE B 2 153  ? 229.138 25.400  -42.801 1.00 110.72 ? 211  ILE B CG2 1 
ATOM 9508  C CD1 . ILE B 2 153  ? 226.790 24.808  -41.163 1.00 108.59 ? 211  ILE B CD1 1 
ATOM 9509  N N   . GLY B 2 154  ? 230.299 23.547  -46.031 1.00 109.09 ? 212  GLY B N   1 
ATOM 9510  C CA  . GLY B 2 154  ? 231.641 23.444  -46.559 1.00 109.31 ? 212  GLY B CA  1 
ATOM 9511  C C   . GLY B 2 154  ? 232.236 24.771  -46.973 1.00 109.64 ? 212  GLY B C   1 
ATOM 9512  O O   . GLY B 2 154  ? 231.614 25.552  -47.687 1.00 109.39 ? 212  GLY B O   1 
ATOM 9513  N N   . VAL B 2 155  ? 233.452 25.018  -46.505 1.00 110.60 ? 213  VAL B N   1 
ATOM 9514  C CA  . VAL B 2 155  ? 234.175 26.229  -46.827 1.00 112.48 ? 213  VAL B CA  1 
ATOM 9515  C C   . VAL B 2 155  ? 234.466 26.207  -48.321 1.00 114.99 ? 213  VAL B C   1 
ATOM 9516  O O   . VAL B 2 155  ? 235.503 25.724  -48.770 1.00 115.66 ? 213  VAL B O   1 
ATOM 9517  C CB  . VAL B 2 155  ? 235.455 26.295  -46.005 1.00 111.43 ? 213  VAL B CB  1 
ATOM 9518  C CG1 . VAL B 2 155  ? 236.171 24.969  -46.093 1.00 111.97 ? 213  VAL B CG1 1 
ATOM 9519  C CG2 . VAL B 2 155  ? 236.328 27.433  -46.479 1.00 111.08 ? 213  VAL B CG2 1 
ATOM 9520  N N   . CYS B 2 156  ? 233.520 26.735  -49.089 1.00 117.73 ? 214  CYS B N   1 
ATOM 9521  C CA  . CYS B 2 156  ? 233.623 26.758  -50.544 1.00 119.75 ? 214  CYS B CA  1 
ATOM 9522  C C   . CYS B 2 156  ? 234.670 27.739  -51.064 1.00 120.27 ? 214  CYS B C   1 
ATOM 9523  O O   . CYS B 2 156  ? 235.596 28.102  -50.337 1.00 119.79 ? 214  CYS B O   1 
ATOM 9524  C CB  . CYS B 2 156  ? 232.253 27.070  -51.153 1.00 120.74 ? 214  CYS B CB  1 
ATOM 9525  S SG  . CYS B 2 156  ? 232.034 26.466  -52.842 1.00 123.05 ? 214  CYS B SG  1 
ATOM 9526  N N   . PHE B 2 157  ? 234.532 28.183  -52.311 1.00 121.30 ? 215  PHE B N   1 
ATOM 9527  C CA  . PHE B 2 157  ? 235.539 29.081  -52.840 1.00 122.32 ? 215  PHE B CA  1 
ATOM 9528  C C   . PHE B 2 157  ? 235.260 30.250  -53.736 1.00 122.89 ? 215  PHE B C   1 
ATOM 9529  O O   . PHE B 2 157  ? 234.147 30.511  -54.190 1.00 121.51 ? 215  PHE B O   1 
ATOM 9530  C CB  . PHE B 2 157  ? 236.648 28.278  -53.492 1.00 123.33 ? 215  PHE B CB  1 
ATOM 9531  C CG  . PHE B 2 157  ? 237.500 27.577  -52.513 1.00 125.11 ? 215  PHE B CG  1 
ATOM 9532  C CD1 . PHE B 2 157  ? 237.243 26.259  -52.168 1.00 125.70 ? 215  PHE B CD1 1 
ATOM 9533  C CD2 . PHE B 2 157  ? 238.513 28.261  -51.864 1.00 125.57 ? 215  PHE B CD2 1 
ATOM 9534  C CE1 . PHE B 2 157  ? 237.979 25.630  -51.189 1.00 125.91 ? 215  PHE B CE1 1 
ATOM 9535  C CE2 . PHE B 2 157  ? 239.258 27.644  -50.881 1.00 126.06 ? 215  PHE B CE2 1 
ATOM 9536  C CZ  . PHE B 2 157  ? 238.991 26.323  -50.540 1.00 126.40 ? 215  PHE B CZ  1 
ATOM 9537  N N   . HIS B 2 158  ? 236.368 30.927  -53.989 1.00 125.03 ? 216  HIS B N   1 
ATOM 9538  C CA  . HIS B 2 158  ? 236.443 32.127  -54.784 1.00 127.20 ? 216  HIS B CA  1 
ATOM 9539  C C   . HIS B 2 158  ? 237.651 32.781  -54.105 1.00 126.30 ? 216  HIS B C   1 
ATOM 9540  O O   . HIS B 2 158  ? 237.606 33.094  -52.914 1.00 126.35 ? 216  HIS B O   1 
ATOM 9541  C CB  . HIS B 2 158  ? 235.187 32.972  -54.561 1.00 130.58 ? 216  HIS B CB  1 
ATOM 9542  C CG  . HIS B 2 158  ? 234.742 33.737  -55.764 1.00 134.46 ? 216  HIS B CG  1 
ATOM 9543  N ND1 . HIS B 2 158  ? 233.530 33.510  -56.377 1.00 135.92 ? 216  HIS B ND1 1 
ATOM 9544  C CD2 . HIS B 2 158  ? 235.335 34.738  -56.456 1.00 135.55 ? 216  HIS B CD2 1 
ATOM 9545  C CE1 . HIS B 2 158  ? 233.394 34.340  -57.396 1.00 136.29 ? 216  HIS B CE1 1 
ATOM 9546  N NE2 . HIS B 2 158  ? 234.474 35.096  -57.465 1.00 136.29 ? 216  HIS B NE2 1 
ATOM 9547  N N   . PRO B 2 159  ? 238.779 32.884  -54.813 1.00 125.15 ? 217  PRO B N   1 
ATOM 9548  C CA  . PRO B 2 159  ? 239.917 33.520  -54.145 1.00 123.98 ? 217  PRO B CA  1 
ATOM 9549  C C   . PRO B 2 159  ? 240.489 34.654  -55.014 1.00 123.38 ? 217  PRO B C   1 
ATOM 9550  O O   . PRO B 2 159  ? 241.537 34.487  -55.628 1.00 122.57 ? 217  PRO B O   1 
ATOM 9551  C CB  . PRO B 2 159  ? 240.903 32.352  -53.968 1.00 123.47 ? 217  PRO B CB  1 
ATOM 9552  C CG  . PRO B 2 159  ? 240.206 31.127  -54.630 1.00 123.27 ? 217  PRO B CG  1 
ATOM 9553  C CD  . PRO B 2 159  ? 239.262 31.749  -55.606 1.00 124.63 ? 217  PRO B CD  1 
ATOM 9554  N N   . VAL B 2 160  ? 239.799 35.799  -55.056 1.00 123.28 ? 218  VAL B N   1 
ATOM 9555  C CA  . VAL B 2 160  ? 240.221 36.950  -55.872 1.00 123.28 ? 218  VAL B CA  1 
ATOM 9556  C C   . VAL B 2 160  ? 241.478 37.644  -55.393 1.00 122.45 ? 218  VAL B C   1 
ATOM 9557  O O   . VAL B 2 160  ? 242.139 38.319  -56.180 1.00 122.24 ? 218  VAL B O   1 
ATOM 9558  C CB  . VAL B 2 160  ? 239.117 38.057  -55.994 1.00 123.92 ? 218  VAL B CB  1 
ATOM 9559  C CG1 . VAL B 2 160  ? 237.881 37.494  -56.671 1.00 124.35 ? 218  VAL B CG1 1 
ATOM 9560  C CG2 . VAL B 2 160  ? 238.780 38.637  -54.626 1.00 124.63 ? 218  VAL B CG2 1 
ATOM 9561  N N   . LYS B 2 171  ? 246.032 39.880  -59.196 1.00 108.31 ? 229  LYS B N   1 
ATOM 9562  C CA  . LYS B 2 171  ? 245.317 38.703  -58.733 1.00 108.73 ? 229  LYS B CA  1 
ATOM 9563  C C   . LYS B 2 171  ? 245.596 38.492  -57.262 1.00 110.02 ? 229  LYS B C   1 
ATOM 9564  O O   . LYS B 2 171  ? 246.533 39.064  -56.713 1.00 111.22 ? 229  LYS B O   1 
ATOM 9565  C CB  . LYS B 2 171  ? 245.754 37.461  -59.508 1.00 106.77 ? 229  LYS B CB  1 
ATOM 9566  C CG  . LYS B 2 171  ? 245.460 37.522  -60.987 1.00 104.67 ? 229  LYS B CG  1 
ATOM 9567  C CD  . LYS B 2 171  ? 246.276 38.592  -61.652 1.00 104.37 ? 229  LYS B CD  1 
ATOM 9568  C CE  . LYS B 2 171  ? 246.007 38.643  -63.132 1.00 105.04 ? 229  LYS B CE  1 
ATOM 9569  N NZ  . LYS B 2 171  ? 246.825 39.703  -63.764 1.00 104.96 ? 229  LYS B NZ  1 
ATOM 9570  N N   . SER B 2 172  ? 244.773 37.664  -56.631 1.00 110.69 ? 230  SER B N   1 
ATOM 9571  C CA  . SER B 2 172  ? 244.896 37.349  -55.208 1.00 110.79 ? 230  SER B CA  1 
ATOM 9572  C C   . SER B 2 172  ? 243.941 36.194  -54.857 1.00 110.70 ? 230  SER B C   1 
ATOM 9573  O O   . SER B 2 172  ? 243.318 35.626  -55.752 1.00 111.23 ? 230  SER B O   1 
ATOM 9574  C CB  . SER B 2 172  ? 244.590 38.600  -54.361 1.00 111.19 ? 230  SER B CB  1 
ATOM 9575  O OG  . SER B 2 172  ? 243.916 39.606  -55.108 1.00 110.49 ? 230  SER B OG  1 
ATOM 9576  N N   . ILE B 2 173  ? 243.826 35.847  -53.572 1.00 109.78 ? 231  ILE B N   1 
ATOM 9577  C CA  . ILE B 2 173  ? 242.955 34.745  -53.137 1.00 108.18 ? 231  ILE B CA  1 
ATOM 9578  C C   . ILE B 2 173  ? 242.361 34.838  -51.720 1.00 106.40 ? 231  ILE B C   1 
ATOM 9579  O O   . ILE B 2 173  ? 242.895 35.502  -50.833 1.00 106.56 ? 231  ILE B O   1 
ATOM 9580  C CB  . ILE B 2 173  ? 243.679 33.368  -53.238 1.00 108.42 ? 231  ILE B CB  1 
ATOM 9581  C CG1 . ILE B 2 173  ? 244.915 33.347  -52.338 1.00 108.00 ? 231  ILE B CG1 1 
ATOM 9582  C CG2 . ILE B 2 173  ? 244.055 33.073  -54.688 1.00 107.72 ? 231  ILE B CG2 1 
ATOM 9583  C CD1 . ILE B 2 173  ? 246.045 34.226  -52.831 1.00 108.64 ? 231  ILE B CD1 1 
ATOM 9584  N N   . GLY B 2 174  ? 241.252 34.135  -51.521 1.00 103.84 ? 232  GLY B N   1 
ATOM 9585  C CA  . GLY B 2 174  ? 240.579 34.124  -50.236 1.00 99.96  ? 232  GLY B CA  1 
ATOM 9586  C C   . GLY B 2 174  ? 239.679 32.906  -50.147 1.00 97.82  ? 232  GLY B C   1 
ATOM 9587  O O   . GLY B 2 174  ? 239.383 32.283  -51.163 1.00 97.53  ? 232  GLY B O   1 
ATOM 9588  N N   . GLU B 2 175  ? 239.236 32.565  -48.941 1.00 95.65  ? 233  GLU B N   1 
ATOM 9589  C CA  . GLU B 2 175  ? 238.372 31.396  -48.728 1.00 93.32  ? 233  GLU B CA  1 
ATOM 9590  C C   . GLU B 2 175  ? 237.008 31.708  -48.100 1.00 92.06  ? 233  GLU B C   1 
ATOM 9591  O O   . GLU B 2 175  ? 236.941 32.335  -47.039 1.00 91.24  ? 233  GLU B O   1 
ATOM 9592  C CB  . GLU B 2 175  ? 239.079 30.387  -47.830 1.00 92.86  ? 233  GLU B CB  1 
ATOM 9593  C CG  . GLU B 2 175  ? 240.210 29.657  -48.471 1.00 91.77  ? 233  GLU B CG  1 
ATOM 9594  C CD  . GLU B 2 175  ? 240.869 28.721  -47.499 1.00 91.51  ? 233  GLU B CD  1 
ATOM 9595  O OE1 . GLU B 2 175  ? 240.150 28.010  -46.775 1.00 90.17  ? 233  GLU B OE1 1 
ATOM 9596  O OE2 . GLU B 2 175  ? 242.106 28.692  -47.453 1.00 91.44  ? 233  GLU B OE2 1 
ATOM 9597  N N   . LYS B 2 176  ? 235.928 31.250  -48.737 1.00 90.44  ? 234  LYS B N   1 
ATOM 9598  C CA  . LYS B 2 176  ? 234.577 31.483  -48.224 1.00 89.27  ? 234  LYS B CA  1 
ATOM 9599  C C   . LYS B 2 176  ? 234.035 30.252  -47.517 1.00 88.90  ? 234  LYS B C   1 
ATOM 9600  O O   . LYS B 2 176  ? 233.636 29.293  -48.163 1.00 88.87  ? 234  LYS B O   1 
ATOM 9601  C CB  . LYS B 2 176  ? 233.633 31.847  -49.360 1.00 89.65  ? 234  LYS B CB  1 
ATOM 9602  C CG  . LYS B 2 176  ? 233.805 33.243  -49.916 1.00 90.66  ? 234  LYS B CG  1 
ATOM 9603  C CD  . LYS B 2 176  ? 234.980 33.361  -50.859 1.00 92.23  ? 234  LYS B CD  1 
ATOM 9604  C CE  . LYS B 2 176  ? 236.253 33.769  -50.138 1.00 94.23  ? 234  LYS B CE  1 
ATOM 9605  N NZ  . LYS B 2 176  ? 236.082 35.012  -49.325 1.00 97.03  ? 234  LYS B NZ  1 
ATOM 9606  N N   . THR B 2 177  ? 234.006 30.280  -46.191 1.00 88.50  ? 235  THR B N   1 
ATOM 9607  C CA  . THR B 2 177  ? 233.524 29.133  -45.432 1.00 88.13  ? 235  THR B CA  1 
ATOM 9608  C C   . THR B 2 177  ? 232.212 28.581  -45.976 1.00 87.33  ? 235  THR B C   1 
ATOM 9609  O O   . THR B 2 177  ? 232.182 27.482  -46.501 1.00 86.76  ? 235  THR B O   1 
ATOM 9610  C CB  . THR B 2 177  ? 233.348 29.481  -43.957 1.00 88.70  ? 235  THR B CB  1 
ATOM 9611  O OG1 . THR B 2 177  ? 232.295 30.437  -43.817 1.00 88.76  ? 235  THR B OG1 1 
ATOM 9612  C CG2 . THR B 2 177  ? 234.641 30.061  -43.396 1.00 89.09  ? 235  THR B CG2 1 
ATOM 9613  N N   . GLU B 2 178  ? 231.123 29.327  -45.845 1.00 87.08  ? 236  GLU B N   1 
ATOM 9614  C CA  . GLU B 2 178  ? 229.834 28.876  -46.374 1.00 87.18  ? 236  GLU B CA  1 
ATOM 9615  C C   . GLU B 2 178  ? 229.275 27.562  -45.821 1.00 87.63  ? 236  GLU B C   1 
ATOM 9616  O O   . GLU B 2 178  ? 229.973 26.788  -45.177 1.00 86.56  ? 236  GLU B O   1 
ATOM 9617  C CB  . GLU B 2 178  ? 229.896 28.717  -47.899 1.00 86.35  ? 236  GLU B CB  1 
ATOM 9618  C CG  . GLU B 2 178  ? 231.043 29.387  -48.591 1.00 85.91  ? 236  GLU B CG  1 
ATOM 9619  C CD  . GLU B 2 178  ? 230.773 29.656  -50.047 1.00 86.14  ? 236  GLU B CD  1 
ATOM 9620  O OE1 . GLU B 2 178  ? 229.656 29.358  -50.502 1.00 86.06  ? 236  GLU B OE1 1 
ATOM 9621  O OE2 . GLU B 2 178  ? 231.671 30.184  -50.733 1.00 86.76  ? 236  GLU B OE2 1 
ATOM 9622  N N   . ALA B 2 179  ? 228.004 27.326  -46.127 1.00 88.77  ? 237  ALA B N   1 
ATOM 9623  C CA  . ALA B 2 179  ? 227.271 26.134  -45.732 1.00 90.57  ? 237  ALA B CA  1 
ATOM 9624  C C   . ALA B 2 179  ? 226.312 25.935  -46.885 1.00 92.29  ? 237  ALA B C   1 
ATOM 9625  O O   . ALA B 2 179  ? 225.936 26.905  -47.529 1.00 93.22  ? 237  ALA B O   1 
ATOM 9626  C CB  . ALA B 2 179  ? 226.499 26.391  -44.467 1.00 89.93  ? 237  ALA B CB  1 
ATOM 9627  N N   . SER B 2 180  ? 225.901 24.702  -47.158 1.00 93.92  ? 238  SER B N   1 
ATOM 9628  C CA  . SER B 2 180  ? 224.983 24.472  -48.280 1.00 95.36  ? 238  SER B CA  1 
ATOM 9629  C C   . SER B 2 180  ? 223.884 23.431  -48.081 1.00 96.31  ? 238  SER B C   1 
ATOM 9630  O O   . SER B 2 180  ? 224.071 22.436  -47.374 1.00 96.10  ? 238  SER B O   1 
ATOM 9631  C CB  . SER B 2 180  ? 225.768 24.087  -49.538 1.00 95.36  ? 238  SER B CB  1 
ATOM 9632  O OG  . SER B 2 180  ? 224.887 23.816  -50.623 1.00 95.44  ? 238  SER B OG  1 
ATOM 9633  N N   . LEU B 2 181  ? 222.741 23.667  -48.724 1.00 98.15  ? 239  LEU B N   1 
ATOM 9634  C CA  . LEU B 2 181  ? 221.619 22.736  -48.667 1.00 99.42  ? 239  LEU B CA  1 
ATOM 9635  C C   . LEU B 2 181  ? 221.181 22.433  -50.087 1.00 101.03 ? 239  LEU B C   1 
ATOM 9636  O O   . LEU B 2 181  ? 221.061 23.330  -50.919 1.00 100.36 ? 239  LEU B O   1 
ATOM 9637  C CB  . LEU B 2 181  ? 220.439 23.313  -47.881 1.00 98.08  ? 239  LEU B CB  1 
ATOM 9638  C CG  . LEU B 2 181  ? 219.192 22.415  -47.874 1.00 96.73  ? 239  LEU B CG  1 
ATOM 9639  C CD1 . LEU B 2 181  ? 219.511 21.061  -47.264 1.00 95.51  ? 239  LEU B CD1 1 
ATOM 9640  C CD2 . LEU B 2 181  ? 218.090 23.085  -47.089 1.00 96.94  ? 239  LEU B CD2 1 
ATOM 9641  N N   . VAL B 2 182  ? 220.947 21.159  -50.358 1.00 103.23 ? 240  VAL B N   1 
ATOM 9642  C CA  . VAL B 2 182  ? 220.537 20.744  -51.681 1.00 105.91 ? 240  VAL B CA  1 
ATOM 9643  C C   . VAL B 2 182  ? 219.326 19.830  -51.614 1.00 108.04 ? 240  VAL B C   1 
ATOM 9644  O O   . VAL B 2 182  ? 219.444 18.611  -51.501 1.00 108.51 ? 240  VAL B O   1 
ATOM 9645  C CB  . VAL B 2 182  ? 221.677 20.019  -52.396 1.00 105.55 ? 240  VAL B CB  1 
ATOM 9646  C CG1 . VAL B 2 182  ? 221.249 19.650  -53.799 1.00 106.27 ? 240  VAL B CG1 1 
ATOM 9647  C CG2 . VAL B 2 182  ? 222.909 20.904  -52.422 1.00 104.92 ? 240  VAL B CG2 1 
ATOM 9648  N N   . TRP B 2 183  ? 218.155 20.442  -51.688 1.00 110.30 ? 241  TRP B N   1 
ATOM 9649  C CA  . TRP B 2 183  ? 216.895 19.719  -51.649 1.00 112.38 ? 241  TRP B CA  1 
ATOM 9650  C C   . TRP B 2 183  ? 216.476 19.449  -53.104 1.00 112.23 ? 241  TRP B C   1 
ATOM 9651  O O   . TRP B 2 183  ? 216.919 20.144  -54.017 1.00 112.06 ? 241  TRP B O   1 
ATOM 9652  C CB  . TRP B 2 183  ? 215.869 20.584  -50.906 1.00 115.23 ? 241  TRP B CB  1 
ATOM 9653  C CG  . TRP B 2 183  ? 214.568 19.921  -50.597 1.00 118.89 ? 241  TRP B CG  1 
ATOM 9654  C CD1 . TRP B 2 183  ? 213.559 19.656  -51.471 1.00 120.10 ? 241  TRP B CD1 1 
ATOM 9655  C CD2 . TRP B 2 183  ? 214.114 19.476  -49.313 1.00 120.55 ? 241  TRP B CD2 1 
ATOM 9656  N NE1 . TRP B 2 183  ? 212.499 19.079  -50.815 1.00 121.12 ? 241  TRP B NE1 1 
ATOM 9657  C CE2 . TRP B 2 183  ? 212.812 18.957  -49.488 1.00 121.04 ? 241  TRP B CE2 1 
ATOM 9658  C CE3 . TRP B 2 183  ? 214.680 19.469  -48.030 1.00 121.63 ? 241  TRP B CE3 1 
ATOM 9659  C CZ2 . TRP B 2 183  ? 212.062 18.432  -48.429 1.00 121.39 ? 241  TRP B CZ2 1 
ATOM 9660  C CZ3 . TRP B 2 183  ? 213.932 18.947  -46.972 1.00 121.54 ? 241  TRP B CZ3 1 
ATOM 9661  C CH2 . TRP B 2 183  ? 212.635 18.437  -47.181 1.00 121.55 ? 241  TRP B CH2 1 
ATOM 9662  N N   . PHE B 2 184  ? 215.645 18.437  -53.328 1.00 112.09 ? 242  PHE B N   1 
ATOM 9663  C CA  . PHE B 2 184  ? 215.201 18.104  -54.682 1.00 112.35 ? 242  PHE B CA  1 
ATOM 9664  C C   . PHE B 2 184  ? 213.697 17.861  -54.766 1.00 112.10 ? 242  PHE B C   1 
ATOM 9665  O O   . PHE B 2 184  ? 213.228 16.760  -54.485 1.00 110.73 ? 242  PHE B O   1 
ATOM 9666  C CB  . PHE B 2 184  ? 215.967 16.879  -55.179 1.00 112.89 ? 242  PHE B CB  1 
ATOM 9667  C CG  . PHE B 2 184  ? 216.427 15.966  -54.077 1.00 113.14 ? 242  PHE B CG  1 
ATOM 9668  C CD1 . PHE B 2 184  ? 215.577 15.005  -53.537 1.00 112.33 ? 242  PHE B CD1 1 
ATOM 9669  C CD2 . PHE B 2 184  ? 217.716 16.072  -53.569 1.00 113.31 ? 242  PHE B CD2 1 
ATOM 9670  C CE1 . PHE B 2 184  ? 216.009 14.161  -52.506 1.00 112.24 ? 242  PHE B CE1 1 
ATOM 9671  C CE2 . PHE B 2 184  ? 218.152 15.235  -52.541 1.00 112.79 ? 242  PHE B CE2 1 
ATOM 9672  C CZ  . PHE B 2 184  ? 217.294 14.280  -52.013 1.00 112.30 ? 242  PHE B CZ  1 
ATOM 9673  N N   . THR B 2 185  ? 212.957 18.900  -55.171 1.00 113.40 ? 243  THR B N   1 
ATOM 9674  C CA  . THR B 2 185  ? 211.486 18.867  -55.286 1.00 114.89 ? 243  THR B CA  1 
ATOM 9675  C C   . THR B 2 185  ? 210.957 18.571  -56.683 1.00 115.50 ? 243  THR B C   1 
ATOM 9676  O O   . THR B 2 185  ? 211.607 18.874  -57.677 1.00 115.87 ? 243  THR B O   1 
ATOM 9677  C CB  . THR B 2 185  ? 210.852 20.222  -54.865 1.00 114.82 ? 243  THR B CB  1 
ATOM 9678  O OG1 . THR B 2 185  ? 209.429 20.188  -55.066 1.00 113.45 ? 243  THR B OG1 1 
ATOM 9679  C CG2 . THR B 2 185  ? 211.433 21.351  -55.700 1.00 114.66 ? 243  THR B CG2 1 
ATOM 9680  N N   . PRO B 2 186  ? 209.753 17.982  -56.771 1.00 115.77 ? 244  PRO B N   1 
ATOM 9681  C CA  . PRO B 2 186  ? 209.160 17.667  -58.066 1.00 115.39 ? 244  PRO B CA  1 
ATOM 9682  C C   . PRO B 2 186  ? 208.524 18.932  -58.632 1.00 114.15 ? 244  PRO B C   1 
ATOM 9683  O O   . PRO B 2 186  ? 208.203 19.861  -57.894 1.00 113.37 ? 244  PRO B O   1 
ATOM 9684  C CB  . PRO B 2 186  ? 208.130 16.606  -57.714 1.00 115.86 ? 244  PRO B CB  1 
ATOM 9685  C CG  . PRO B 2 186  ? 207.620 17.105  -56.411 1.00 116.70 ? 244  PRO B CG  1 
ATOM 9686  C CD  . PRO B 2 186  ? 208.905 17.466  -55.683 1.00 116.45 ? 244  PRO B CD  1 
ATOM 9687  N N   . PRO B 2 187  ? 208.314 18.963  -59.950 1.00 113.56 ? 245  PRO B N   1 
ATOM 9688  C CA  . PRO B 2 187  ? 207.721 20.090  -60.675 1.00 113.38 ? 245  PRO B CA  1 
ATOM 9689  C C   . PRO B 2 187  ? 206.444 20.713  -60.089 1.00 113.02 ? 245  PRO B C   1 
ATOM 9690  O O   . PRO B 2 187  ? 206.452 21.869  -59.674 1.00 112.47 ? 245  PRO B O   1 
ATOM 9691  C CB  . PRO B 2 187  ? 207.508 19.515  -62.077 1.00 113.59 ? 245  PRO B CB  1 
ATOM 9692  C CG  . PRO B 2 187  ? 207.336 18.033  -61.824 1.00 113.31 ? 245  PRO B CG  1 
ATOM 9693  C CD  . PRO B 2 187  ? 208.412 17.774  -60.816 1.00 113.20 ? 245  PRO B CD  1 
ATOM 9694  N N   . ARG B 2 188  ? 205.354 19.952  -60.067 1.00 112.71 ? 246  ARG B N   1 
ATOM 9695  C CA  . ARG B 2 188  ? 204.071 20.440  -59.563 1.00 111.95 ? 246  ARG B CA  1 
ATOM 9696  C C   . ARG B 2 188  ? 204.241 21.230  -58.279 1.00 111.28 ? 246  ARG B C   1 
ATOM 9697  O O   . ARG B 2 188  ? 204.501 22.432  -58.310 1.00 111.11 ? 246  ARG B O   1 
ATOM 9698  C CB  . ARG B 2 188  ? 203.109 19.269  -59.320 1.00 112.31 ? 246  ARG B CB  1 
ATOM 9699  C CG  . ARG B 2 188  ? 201.622 19.603  -59.471 1.00 112.61 ? 246  ARG B CG  1 
ATOM 9700  C CD  . ARG B 2 188  ? 201.138 20.644  -58.474 1.00 112.00 ? 246  ARG B CD  1 
ATOM 9701  N NE  . ARG B 2 188  ? 201.702 21.965  -58.733 1.00 111.96 ? 246  ARG B NE  1 
ATOM 9702  C CZ  . ARG B 2 188  ? 201.517 23.017  -57.948 1.00 112.26 ? 246  ARG B CZ  1 
ATOM 9703  N NH1 . ARG B 2 188  ? 200.778 22.897  -56.854 1.00 111.57 ? 246  ARG B NH1 1 
ATOM 9704  N NH2 . ARG B 2 188  ? 202.079 24.181  -58.250 1.00 113.43 ? 246  ARG B NH2 1 
ATOM 9705  N N   . THR B 2 189  ? 204.086 20.550  -57.150 1.00 110.27 ? 247  THR B N   1 
ATOM 9706  C CA  . THR B 2 189  ? 204.214 21.206  -55.862 1.00 109.08 ? 247  THR B CA  1 
ATOM 9707  C C   . THR B 2 189  ? 205.663 21.657  -55.653 1.00 107.93 ? 247  THR B C   1 
ATOM 9708  O O   . THR B 2 189  ? 206.132 21.768  -54.524 1.00 107.16 ? 247  THR B O   1 
ATOM 9709  C CB  . THR B 2 189  ? 203.755 20.268  -54.707 1.00 109.70 ? 247  THR B CB  1 
ATOM 9710  O OG1 . THR B 2 189  ? 202.596 19.531  -55.116 1.00 110.69 ? 247  THR B OG1 1 
ATOM 9711  C CG2 . THR B 2 189  ? 203.362 21.079  -53.488 1.00 110.27 ? 247  THR B CG2 1 
ATOM 9712  N N   . SER B 2 190  ? 206.374 21.905  -56.750 1.00 106.77 ? 248  SER B N   1 
ATOM 9713  C CA  . SER B 2 190  ? 207.745 22.380  -56.663 1.00 105.21 ? 248  SER B CA  1 
ATOM 9714  C C   . SER B 2 190  ? 207.666 23.834  -56.279 1.00 104.81 ? 248  SER B C   1 
ATOM 9715  O O   . SER B 2 190  ? 208.223 24.250  -55.279 1.00 103.86 ? 248  SER B O   1 
ATOM 9716  C CB  . SER B 2 190  ? 208.454 22.292  -58.000 1.00 104.14 ? 248  SER B CB  1 
ATOM 9717  O OG  . SER B 2 190  ? 209.807 22.643  -57.853 1.00 102.46 ? 248  SER B OG  1 
ATOM 9718  N N   . ASN B 2 191  ? 206.960 24.609  -57.090 1.00 105.15 ? 249  ASN B N   1 
ATOM 9719  C CA  . ASN B 2 191  ? 206.814 26.025  -56.821 1.00 105.67 ? 249  ASN B CA  1 
ATOM 9720  C C   . ASN B 2 191  ? 206.247 26.225  -55.421 1.00 106.49 ? 249  ASN B C   1 
ATOM 9721  O O   . ASN B 2 191  ? 206.830 26.949  -54.623 1.00 106.75 ? 249  ASN B O   1 
ATOM 9722  C CB  . ASN B 2 191  ? 205.916 26.692  -57.869 1.00 105.10 ? 249  ASN B CB  1 
ATOM 9723  C CG  . ASN B 2 191  ? 206.531 27.966  -58.435 1.00 104.28 ? 249  ASN B CG  1 
ATOM 9724  O OD1 . ASN B 2 191  ? 207.656 27.955  -58.929 1.00 103.81 ? 249  ASN B OD1 1 
ATOM 9725  N ND2 . ASN B 2 191  ? 205.795 29.066  -58.365 1.00 103.78 ? 249  ASN B ND2 1 
ATOM 9726  N N   . GLN B 2 192  ? 205.118 25.597  -55.104 1.00 107.24 ? 250  GLN B N   1 
ATOM 9727  C CA  . GLN B 2 192  ? 204.564 25.755  -53.755 1.00 109.06 ? 250  GLN B CA  1 
ATOM 9728  C C   . GLN B 2 192  ? 205.707 25.462  -52.796 1.00 109.93 ? 250  GLN B C   1 
ATOM 9729  O O   . GLN B 2 192  ? 206.150 26.335  -52.043 1.00 109.78 ? 250  GLN B O   1 
ATOM 9730  C CB  . GLN B 2 192  ? 203.398 24.778  -53.511 1.00 109.93 ? 250  GLN B CB  1 
ATOM 9731  C CG  . GLN B 2 192  ? 203.202 24.340  -52.042 1.00 111.33 ? 250  GLN B CG  1 
ATOM 9732  C CD  . GLN B 2 192  ? 202.832 25.476  -51.088 1.00 112.10 ? 250  GLN B CD  1 
ATOM 9733  O OE1 . GLN B 2 192  ? 203.060 25.385  -49.878 1.00 113.76 ? 250  GLN B OE1 1 
ATOM 9734  N NE2 . GLN B 2 192  ? 202.244 26.535  -51.624 1.00 111.94 ? 250  GLN B NE2 1 
ATOM 9735  N N   . TRP B 2 193  ? 206.184 24.222  -52.842 1.00 111.21 ? 251  TRP B N   1 
ATOM 9736  C CA  . TRP B 2 193  ? 207.299 23.803  -52.012 1.00 112.22 ? 251  TRP B CA  1 
ATOM 9737  C C   . TRP B 2 193  ? 208.505 24.516  -52.615 1.00 112.09 ? 251  TRP B C   1 
ATOM 9738  O O   . TRP B 2 193  ? 209.476 23.883  -53.007 1.00 112.68 ? 251  TRP B O   1 
ATOM 9739  C CB  . TRP B 2 193  ? 207.492 22.275  -52.088 1.00 113.19 ? 251  TRP B CB  1 
ATOM 9740  C CG  . TRP B 2 193  ? 206.516 21.441  -51.270 1.00 114.24 ? 251  TRP B CG  1 
ATOM 9741  C CD1 . TRP B 2 193  ? 206.050 20.189  -51.577 1.00 114.56 ? 251  TRP B CD1 1 
ATOM 9742  C CD2 . TRP B 2 193  ? 205.918 21.788  -50.013 1.00 114.96 ? 251  TRP B CD2 1 
ATOM 9743  N NE1 . TRP B 2 193  ? 205.199 19.739  -50.593 1.00 114.54 ? 251  TRP B NE1 1 
ATOM 9744  C CE2 . TRP B 2 193  ? 205.100 20.701  -49.622 1.00 115.14 ? 251  TRP B CE2 1 
ATOM 9745  C CE3 . TRP B 2 193  ? 205.995 22.912  -49.177 1.00 115.44 ? 251  TRP B CE3 1 
ATOM 9746  C CZ2 . TRP B 2 193  ? 204.363 20.708  -48.435 1.00 115.64 ? 251  TRP B CZ2 1 
ATOM 9747  C CZ3 . TRP B 2 193  ? 205.264 22.916  -48.001 1.00 115.60 ? 251  TRP B CZ3 1 
ATOM 9748  C CH2 . TRP B 2 193  ? 204.457 21.820  -47.642 1.00 116.11 ? 251  TRP B CH2 1 
ATOM 9749  N N   . LEU B 2 194  ? 208.423 25.837  -52.717 1.00 111.97 ? 252  LEU B N   1 
ATOM 9750  C CA  . LEU B 2 194  ? 209.511 26.631  -53.277 1.00 112.29 ? 252  LEU B CA  1 
ATOM 9751  C C   . LEU B 2 194  ? 209.462 28.045  -52.684 1.00 112.76 ? 252  LEU B C   1 
ATOM 9752  O O   . LEU B 2 194  ? 210.301 28.407  -51.858 1.00 112.84 ? 252  LEU B O   1 
ATOM 9753  C CB  . LEU B 2 194  ? 209.393 26.700  -54.811 1.00 111.72 ? 252  LEU B CB  1 
ATOM 9754  C CG  . LEU B 2 194  ? 210.579 26.401  -55.737 1.00 111.47 ? 252  LEU B CG  1 
ATOM 9755  C CD1 . LEU B 2 194  ? 210.913 24.931  -55.650 1.00 111.65 ? 252  LEU B CD1 1 
ATOM 9756  C CD2 . LEU B 2 194  ? 210.234 26.762  -57.181 1.00 111.13 ? 252  LEU B CD2 1 
ATOM 9757  N N   . ASP B 2 195  ? 208.469 28.832  -53.098 1.00 112.95 ? 253  ASP B N   1 
ATOM 9758  C CA  . ASP B 2 195  ? 208.316 30.213  -52.627 1.00 113.00 ? 253  ASP B CA  1 
ATOM 9759  C C   . ASP B 2 195  ? 208.262 30.271  -51.095 1.00 114.24 ? 253  ASP B C   1 
ATOM 9760  O O   . ASP B 2 195  ? 208.841 31.158  -50.468 1.00 114.09 ? 253  ASP B O   1 
ATOM 9761  C CB  . ASP B 2 195  ? 207.041 30.857  -53.226 1.00 110.34 ? 253  ASP B CB  1 
ATOM 9762  C CG  . ASP B 2 195  ? 207.066 30.948  -54.770 1.00 107.73 ? 253  ASP B CG  1 
ATOM 9763  O OD1 . ASP B 2 195  ? 206.116 31.518  -55.350 1.00 105.39 ? 253  ASP B OD1 1 
ATOM 9764  O OD2 . ASP B 2 195  ? 208.018 30.454  -55.409 1.00 107.02 ? 253  ASP B OD2 1 
ATOM 9765  N N   . PHE B 2 196  ? 207.561 29.315  -50.502 1.00 116.02 ? 254  PHE B N   1 
ATOM 9766  C CA  . PHE B 2 196  ? 207.436 29.252  -49.056 1.00 117.30 ? 254  PHE B CA  1 
ATOM 9767  C C   . PHE B 2 196  ? 208.819 29.153  -48.445 1.00 116.92 ? 254  PHE B C   1 
ATOM 9768  O O   . PHE B 2 196  ? 209.131 29.814  -47.463 1.00 116.74 ? 254  PHE B O   1 
ATOM 9769  C CB  . PHE B 2 196  ? 206.591 28.029  -48.663 1.00 118.95 ? 254  PHE B CB  1 
ATOM 9770  C CG  . PHE B 2 196  ? 207.204 27.170  -47.577 1.00 120.41 ? 254  PHE B CG  1 
ATOM 9771  C CD1 . PHE B 2 196  ? 207.341 27.645  -46.274 1.00 120.27 ? 254  PHE B CD1 1 
ATOM 9772  C CD2 . PHE B 2 196  ? 207.639 25.881  -47.864 1.00 121.02 ? 254  PHE B CD2 1 
ATOM 9773  C CE1 . PHE B 2 196  ? 207.903 26.851  -45.278 1.00 120.46 ? 254  PHE B CE1 1 
ATOM 9774  C CE2 . PHE B 2 196  ? 208.201 25.082  -46.875 1.00 121.39 ? 254  PHE B CE2 1 
ATOM 9775  C CZ  . PHE B 2 196  ? 208.332 25.570  -45.579 1.00 121.13 ? 254  PHE B CZ  1 
ATOM 9776  N N   . TRP B 2 197  ? 209.651 28.316  -49.039 1.00 116.34 ? 255  TRP B N   1 
ATOM 9777  C CA  . TRP B 2 197  ? 210.992 28.111  -48.535 1.00 116.55 ? 255  TRP B CA  1 
ATOM 9778  C C   . TRP B 2 197  ? 211.670 29.395  -48.109 1.00 115.93 ? 255  TRP B C   1 
ATOM 9779  O O   . TRP B 2 197  ? 212.273 29.471  -47.034 1.00 115.68 ? 255  TRP B O   1 
ATOM 9780  C CB  . TRP B 2 197  ? 211.806 27.360  -49.584 1.00 117.84 ? 255  TRP B CB  1 
ATOM 9781  C CG  . TRP B 2 197  ? 211.379 25.929  -49.641 1.00 119.22 ? 255  TRP B CG  1 
ATOM 9782  C CD1 . TRP B 2 197  ? 210.144 25.456  -49.986 1.00 119.18 ? 255  TRP B CD1 1 
ATOM 9783  C CD2 . TRP B 2 197  ? 212.134 24.795  -49.197 1.00 120.01 ? 255  TRP B CD2 1 
ATOM 9784  N NE1 . TRP B 2 197  ? 210.078 24.099  -49.773 1.00 119.65 ? 255  TRP B NE1 1 
ATOM 9785  C CE2 . TRP B 2 197  ? 211.286 23.666  -49.291 1.00 119.95 ? 255  TRP B CE2 1 
ATOM 9786  C CE3 . TRP B 2 197  ? 213.448 24.623  -48.726 1.00 120.18 ? 255  TRP B CE3 1 
ATOM 9787  C CZ2 . TRP B 2 197  ? 211.708 22.378  -48.922 1.00 119.25 ? 255  TRP B CZ2 1 
ATOM 9788  C CZ3 . TRP B 2 197  ? 213.868 23.342  -48.359 1.00 119.50 ? 255  TRP B CZ3 1 
ATOM 9789  C CH2 . TRP B 2 197  ? 212.997 22.239  -48.462 1.00 118.85 ? 255  TRP B CH2 1 
ATOM 9790  N N   . LEU B 2 198  ? 211.562 30.412  -48.949 1.00 115.08 ? 256  LEU B N   1 
ATOM 9791  C CA  . LEU B 2 198  ? 212.157 31.686  -48.614 1.00 114.54 ? 256  LEU B CA  1 
ATOM 9792  C C   . LEU B 2 198  ? 211.721 31.894  -47.176 1.00 114.17 ? 256  LEU B C   1 
ATOM 9793  O O   . LEU B 2 198  ? 212.538 32.036  -46.263 1.00 113.47 ? 256  LEU B O   1 
ATOM 9794  C CB  . LEU B 2 198  ? 211.571 32.786  -49.498 1.00 114.97 ? 256  LEU B CB  1 
ATOM 9795  C CG  . LEU B 2 198  ? 212.300 34.127  -49.501 1.00 114.89 ? 256  LEU B CG  1 
ATOM 9796  C CD1 . LEU B 2 198  ? 212.342 34.728  -48.106 1.00 114.90 ? 256  LEU B CD1 1 
ATOM 9797  C CD2 . LEU B 2 198  ? 213.695 33.904  -50.027 1.00 114.52 ? 256  LEU B CD2 1 
ATOM 9798  N N   . ARG B 2 199  ? 210.408 31.868  -46.994 1.00 114.11 ? 257  ARG B N   1 
ATOM 9799  C CA  . ARG B 2 199  ? 209.818 32.053  -45.691 1.00 114.49 ? 257  ARG B CA  1 
ATOM 9800  C C   . ARG B 2 199  ? 210.637 31.375  -44.624 1.00 114.65 ? 257  ARG B C   1 
ATOM 9801  O O   . ARG B 2 199  ? 211.186 32.046  -43.765 1.00 114.42 ? 257  ARG B O   1 
ATOM 9802  C CB  . ARG B 2 199  ? 208.374 31.525  -45.680 1.00 114.11 ? 257  ARG B CB  1 
ATOM 9803  C CG  . ARG B 2 199  ? 207.915 30.881  -44.362 1.00 112.71 ? 257  ARG B CG  1 
ATOM 9804  C CD  . ARG B 2 199  ? 206.453 30.407  -44.425 1.00 110.59 ? 257  ARG B CD  1 
ATOM 9805  N NE  . ARG B 2 199  ? 205.503 31.363  -43.849 1.00 108.81 ? 257  ARG B NE  1 
ATOM 9806  C CZ  . ARG B 2 199  ? 205.087 31.351  -42.584 1.00 107.30 ? 257  ARG B CZ  1 
ATOM 9807  N NH1 . ARG B 2 199  ? 204.226 32.267  -42.163 1.00 106.69 ? 257  ARG B NH1 1 
ATOM 9808  N NH2 . ARG B 2 199  ? 205.517 30.421  -41.740 1.00 105.85 ? 257  ARG B NH2 1 
ATOM 9809  N N   . HIS B 2 200  ? 210.760 30.055  -44.696 1.00 114.79 ? 258  HIS B N   1 
ATOM 9810  C CA  . HIS B 2 200  ? 211.486 29.356  -43.652 1.00 114.62 ? 258  HIS B CA  1 
ATOM 9811  C C   . HIS B 2 200  ? 212.617 30.156  -43.048 1.00 112.97 ? 258  HIS B C   1 
ATOM 9812  O O   . HIS B 2 200  ? 212.419 30.940  -42.121 1.00 113.18 ? 258  HIS B O   1 
ATOM 9813  C CB  . HIS B 2 200  ? 212.052 28.015  -44.114 1.00 116.41 ? 258  HIS B CB  1 
ATOM 9814  C CG  . HIS B 2 200  ? 213.049 27.445  -43.148 1.00 118.79 ? 258  HIS B CG  1 
ATOM 9815  N ND1 . HIS B 2 200  ? 212.934 27.618  -41.785 1.00 120.14 ? 258  HIS B ND1 1 
ATOM 9816  C CD2 . HIS B 2 200  ? 214.214 26.782  -43.344 1.00 119.85 ? 258  HIS B CD2 1 
ATOM 9817  C CE1 . HIS B 2 200  ? 213.987 27.091  -41.183 1.00 121.01 ? 258  HIS B CE1 1 
ATOM 9818  N NE2 . HIS B 2 200  ? 214.779 26.578  -42.106 1.00 120.65 ? 258  HIS B NE2 1 
ATOM 9819  N N   . ARG B 2 201  ? 213.816 29.956  -43.563 1.00 110.77 ? 259  ARG B N   1 
ATOM 9820  C CA  . ARG B 2 201  ? 214.916 30.677  -42.997 1.00 108.34 ? 259  ARG B CA  1 
ATOM 9821  C C   . ARG B 2 201  ? 214.774 32.131  -43.292 1.00 106.70 ? 259  ARG B C   1 
ATOM 9822  O O   . ARG B 2 201  ? 215.602 32.909  -42.838 1.00 105.92 ? 259  ARG B O   1 
ATOM 9823  C CB  . ARG B 2 201  ? 216.263 30.158  -43.494 1.00 108.76 ? 259  ARG B CB  1 
ATOM 9824  C CG  . ARG B 2 201  ? 216.846 29.093  -42.578 1.00 108.91 ? 259  ARG B CG  1 
ATOM 9825  C CD  . ARG B 2 201  ? 218.361 29.100  -42.562 1.00 109.38 ? 259  ARG B CD  1 
ATOM 9826  N NE  . ARG B 2 201  ? 218.935 28.596  -43.794 1.00 111.01 ? 259  ARG B NE  1 
ATOM 9827  C CZ  . ARG B 2 201  ? 219.044 29.291  -44.919 1.00 112.24 ? 259  ARG B CZ  1 
ATOM 9828  N NH1 . ARG B 2 201  ? 218.617 30.544  -44.988 1.00 112.03 ? 259  ARG B NH1 1 
ATOM 9829  N NH2 . ARG B 2 201  ? 219.591 28.723  -45.983 1.00 113.42 ? 259  ARG B NH2 1 
ATOM 9830  N N   . LEU B 2 202  ? 213.751 32.521  -44.056 1.00 105.40 ? 260  LEU B N   1 
ATOM 9831  C CA  . LEU B 2 202  ? 213.593 33.948  -44.281 1.00 104.78 ? 260  LEU B CA  1 
ATOM 9832  C C   . LEU B 2 202  ? 213.980 34.355  -42.880 1.00 104.08 ? 260  LEU B C   1 
ATOM 9833  O O   . LEU B 2 202  ? 214.908 35.134  -42.675 1.00 103.58 ? 260  LEU B O   1 
ATOM 9834  C CB  . LEU B 2 202  ? 212.139 34.322  -44.550 1.00 105.63 ? 260  LEU B CB  1 
ATOM 9835  C CG  . LEU B 2 202  ? 211.730 35.772  -44.294 1.00 106.66 ? 260  LEU B CG  1 
ATOM 9836  C CD1 . LEU B 2 202  ? 212.868 36.684  -44.705 1.00 107.33 ? 260  LEU B CD1 1 
ATOM 9837  C CD2 . LEU B 2 202  ? 210.442 36.102  -45.056 1.00 107.87 ? 260  LEU B CD2 1 
ATOM 9838  N N   . GLN B 2 203  ? 213.341 33.672  -41.932 1.00 103.76 ? 261  GLN B N   1 
ATOM 9839  C CA  . GLN B 2 203  ? 213.528 33.857  -40.502 1.00 102.91 ? 261  GLN B CA  1 
ATOM 9840  C C   . GLN B 2 203  ? 214.815 33.433  -39.847 1.00 101.40 ? 261  GLN B C   1 
ATOM 9841  O O   . GLN B 2 203  ? 215.024 33.751  -38.689 1.00 101.46 ? 261  GLN B O   1 
ATOM 9842  C CB  . GLN B 2 203  ? 212.384 33.201  -39.724 1.00 103.65 ? 261  GLN B CB  1 
ATOM 9843  C CG  . GLN B 2 203  ? 212.465 33.517  -38.229 1.00 104.25 ? 261  GLN B CG  1 
ATOM 9844  C CD  . GLN B 2 203  ? 211.126 33.600  -37.543 1.00 104.21 ? 261  GLN B CD  1 
ATOM 9845  O OE1 . GLN B 2 203  ? 210.665 32.648  -36.922 1.00 103.03 ? 261  GLN B OE1 1 
ATOM 9846  N NE2 . GLN B 2 203  ? 210.488 34.746  -37.659 1.00 104.26 ? 261  GLN B NE2 1 
ATOM 9847  N N   . TRP B 2 204  ? 215.676 32.701  -40.523 1.00 99.12  ? 262  TRP B N   1 
ATOM 9848  C CA  . TRP B 2 204  ? 216.878 32.319  -39.825 1.00 96.46  ? 262  TRP B CA  1 
ATOM 9849  C C   . TRP B 2 204  ? 217.501 33.530  -39.235 1.00 93.14  ? 262  TRP B C   1 
ATOM 9850  O O   . TRP B 2 204  ? 217.285 33.861  -38.100 1.00 91.17  ? 262  TRP B O   1 
ATOM 9851  C CB  . TRP B 2 204  ? 217.877 31.653  -40.738 1.00 99.78  ? 262  TRP B CB  1 
ATOM 9852  C CG  . TRP B 2 204  ? 218.340 30.536  -40.004 1.00 102.74 ? 262  TRP B CG  1 
ATOM 9853  C CD1 . TRP B 2 204  ? 217.536 29.593  -39.460 1.00 103.93 ? 262  TRP B CD1 1 
ATOM 9854  C CD2 . TRP B 2 204  ? 219.619 30.373  -39.389 1.00 103.63 ? 262  TRP B CD2 1 
ATOM 9855  N NE1 . TRP B 2 204  ? 218.212 28.874  -38.541 1.00 104.64 ? 262  TRP B NE1 1 
ATOM 9856  C CE2 . TRP B 2 204  ? 219.504 29.312  -38.492 1.00 104.13 ? 262  TRP B CE2 1 
ATOM 9857  C CE3 . TRP B 2 204  ? 220.858 31.000  -39.534 1.00 103.52 ? 262  TRP B CE3 1 
ATOM 9858  C CZ2 . TRP B 2 204  ? 220.546 28.901  -37.700 1.00 104.30 ? 262  TRP B CZ2 1 
ATOM 9859  C CZ3 . TRP B 2 204  ? 221.904 30.580  -38.740 1.00 103.94 ? 262  TRP B CZ3 1 
ATOM 9860  C CH2 . TRP B 2 204  ? 221.750 29.529  -37.851 1.00 104.38 ? 262  TRP B CH2 1 
ATOM 9861  N N   . TRP B 2 205  ? 218.294 34.177  -40.047 1.00 91.71  ? 263  TRP B N   1 
ATOM 9862  C CA  . TRP B 2 205  ? 218.946 35.388  -39.695 1.00 90.88  ? 263  TRP B CA  1 
ATOM 9863  C C   . TRP B 2 205  ? 217.967 36.278  -38.940 1.00 90.18  ? 263  TRP B C   1 
ATOM 9864  O O   . TRP B 2 205  ? 218.182 36.563  -37.767 1.00 90.24  ? 263  TRP B O   1 
ATOM 9865  C CB  . TRP B 2 205  ? 219.449 35.931  -41.009 1.00 90.27  ? 263  TRP B CB  1 
ATOM 9866  C CG  . TRP B 2 205  ? 220.635 35.084  -41.441 1.00 88.93  ? 263  TRP B CG  1 
ATOM 9867  C CD1 . TRP B 2 205  ? 221.830 35.039  -40.811 1.00 88.65  ? 263  TRP B CD1 1 
ATOM 9868  C CD2 . TRP B 2 205  ? 220.751 34.195  -42.579 1.00 88.02  ? 263  TRP B CD2 1 
ATOM 9869  N NE1 . TRP B 2 205  ? 222.691 34.200  -41.472 1.00 88.44  ? 263  TRP B NE1 1 
ATOM 9870  C CE2 . TRP B 2 205  ? 222.056 33.668  -42.558 1.00 87.90  ? 263  TRP B CE2 1 
ATOM 9871  C CE3 . TRP B 2 205  ? 219.886 33.799  -43.605 1.00 87.24  ? 263  TRP B CE3 1 
ATOM 9872  C CZ2 . TRP B 2 205  ? 222.522 32.774  -43.513 1.00 87.58  ? 263  TRP B CZ2 1 
ATOM 9873  C CZ3 . TRP B 2 205  ? 220.355 32.903  -44.561 1.00 87.73  ? 263  TRP B CZ3 1 
ATOM 9874  C CH2 . TRP B 2 205  ? 221.662 32.403  -44.504 1.00 87.35  ? 263  TRP B CH2 1 
ATOM 9875  N N   . ARG B 2 206  ? 216.878 36.688  -39.569 1.00 88.96  ? 264  ARG B N   1 
ATOM 9876  C CA  . ARG B 2 206  ? 215.905 37.494  -38.838 1.00 88.85  ? 264  ARG B CA  1 
ATOM 9877  C C   . ARG B 2 206  ? 215.758 36.863  -37.447 1.00 89.36  ? 264  ARG B C   1 
ATOM 9878  O O   . ARG B 2 206  ? 215.700 37.555  -36.448 1.00 89.02  ? 264  ARG B O   1 
ATOM 9879  C CB  . ARG B 2 206  ? 214.574 37.440  -39.554 1.00 88.29  ? 264  ARG B CB  1 
ATOM 9880  C CG  . ARG B 2 206  ? 214.671 36.771  -40.893 1.00 88.43  ? 264  ARG B CG  1 
ATOM 9881  C CD  . ARG B 2 206  ? 213.309 36.630  -41.484 1.00 88.49  ? 264  ARG B CD  1 
ATOM 9882  N NE  . ARG B 2 206  ? 212.349 36.283  -40.455 1.00 89.80  ? 264  ARG B NE  1 
ATOM 9883  C CZ  . ARG B 2 206  ? 211.313 37.035  -40.138 1.00 90.91  ? 264  ARG B CZ  1 
ATOM 9884  N NH1 . ARG B 2 206  ? 211.114 38.156  -40.776 1.00 91.26  ? 264  ARG B NH1 1 
ATOM 9885  N NH2 . ARG B 2 206  ? 210.491 36.673  -39.178 1.00 91.60  ? 264  ARG B NH2 1 
ATOM 9886  N N   . LYS B 2 207  ? 215.728 35.533  -37.422 1.00 90.73  ? 265  LYS B N   1 
ATOM 9887  C CA  . LYS B 2 207  ? 215.598 34.698  -36.216 1.00 92.05  ? 265  LYS B CA  1 
ATOM 9888  C C   . LYS B 2 207  ? 215.065 35.342  -34.975 1.00 93.86  ? 265  LYS B C   1 
ATOM 9889  O O   . LYS B 2 207  ? 215.667 35.216  -33.911 1.00 93.64  ? 265  LYS B O   1 
ATOM 9890  C CB  . LYS B 2 207  ? 216.920 34.026  -35.847 1.00 90.92  ? 265  LYS B CB  1 
ATOM 9891  C CG  . LYS B 2 207  ? 218.031 34.935  -35.402 1.00 90.66  ? 265  LYS B CG  1 
ATOM 9892  C CD  . LYS B 2 207  ? 219.385 34.286  -35.647 1.00 88.36  ? 265  LYS B CD  1 
ATOM 9893  C CE  . LYS B 2 207  ? 219.375 32.828  -35.311 1.00 86.71  ? 265  LYS B CE  1 
ATOM 9894  N NZ  . LYS B 2 207  ? 218.868 32.642  -33.947 1.00 86.55  ? 265  LYS B NZ  1 
ATOM 9895  N N   . PHE B 2 208  ? 213.913 35.989  -35.082 1.00 96.46  ? 266  PHE B N   1 
ATOM 9896  C CA  . PHE B 2 208  ? 213.330 36.643  -33.914 1.00 98.99  ? 266  PHE B CA  1 
ATOM 9897  C C   . PHE B 2 208  ? 214.262 37.813  -33.583 1.00 100.90 ? 266  PHE B C   1 
ATOM 9898  O O   . PHE B 2 208  ? 214.771 37.904  -32.479 1.00 100.84 ? 266  PHE B O   1 
ATOM 9899  C CB  . PHE B 2 208  ? 213.290 35.660  -32.737 1.00 98.99  ? 266  PHE B CB  1 
ATOM 9900  C CG  . PHE B 2 208  ? 212.579 34.355  -33.039 1.00 99.76  ? 266  PHE B CG  1 
ATOM 9901  C CD1 . PHE B 2 208  ? 211.608 34.279  -34.031 1.00 100.22 ? 266  PHE B CD1 1 
ATOM 9902  C CD2 . PHE B 2 208  ? 212.820 33.225  -32.263 1.00 99.47  ? 266  PHE B CD2 1 
ATOM 9903  C CE1 . PHE B 2 208  ? 210.889 33.101  -34.240 1.00 100.08 ? 266  PHE B CE1 1 
ATOM 9904  C CE2 . PHE B 2 208  ? 212.104 32.043  -32.466 1.00 99.24  ? 266  PHE B CE2 1 
ATOM 9905  C CZ  . PHE B 2 208  ? 211.133 31.985  -33.456 1.00 99.65  ? 266  PHE B CZ  1 
ATOM 9906  N N   . ALA B 2 209  ? 214.439 38.701  -34.567 1.00 102.88 ? 267  ALA B N   1 
ATOM 9907  C CA  . ALA B 2 209  ? 215.332 39.898  -34.597 1.00 103.96 ? 267  ALA B CA  1 
ATOM 9908  C C   . ALA B 2 209  ? 215.469 40.985  -33.483 1.00 104.58 ? 267  ALA B C   1 
ATOM 9909  O O   . ALA B 2 209  ? 214.688 41.063  -32.524 1.00 105.98 ? 267  ALA B O   1 
ATOM 9910  C CB  . ALA B 2 209  ? 215.082 40.618  -35.911 1.00 104.34 ? 267  ALA B CB  1 
ATOM 9911  N N   . MET B 2 210  ? 216.504 41.819  -33.663 1.00 103.90 ? 268  MET B N   1 
ATOM 9912  C CA  . MET B 2 210  ? 216.866 42.970  -32.811 1.00 102.60 ? 268  MET B CA  1 
ATOM 9913  C C   . MET B 2 210  ? 216.849 44.167  -33.766 1.00 100.78 ? 268  MET B C   1 
ATOM 9914  O O   . MET B 2 210  ? 216.028 45.069  -33.633 1.00 100.20 ? 268  MET B O   1 
ATOM 9915  C CB  . MET B 2 210  ? 218.274 42.814  -32.232 1.00 103.23 ? 268  MET B CB  1 
ATOM 9916  C CG  . MET B 2 210  ? 218.727 44.010  -31.418 1.00 103.46 ? 268  MET B CG  1 
ATOM 9917  S SD  . MET B 2 210  ? 220.497 44.010  -31.122 1.00 104.07 ? 268  MET B SD  1 
ATOM 9918  C CE  . MET B 2 210  ? 220.582 42.934  -29.709 1.00 104.07 ? 268  MET B CE  1 
ATOM 9919  N N   . SER B 2 211  ? 217.784 44.179  -34.710 1.00 99.09  ? 269  SER B N   1 
ATOM 9920  C CA  . SER B 2 211  ? 217.812 45.203  -35.742 1.00 97.76  ? 269  SER B CA  1 
ATOM 9921  C C   . SER B 2 211  ? 217.455 44.538  -37.067 1.00 97.42  ? 269  SER B C   1 
ATOM 9922  O O   . SER B 2 211  ? 217.234 45.222  -38.057 1.00 98.04  ? 269  SER B O   1 
ATOM 9923  C CB  . SER B 2 211  ? 219.176 45.873  -35.867 1.00 96.96  ? 269  SER B CB  1 
ATOM 9924  O OG  . SER B 2 211  ? 219.426 46.701  -34.749 1.00 95.10  ? 269  SER B OG  1 
ATOM 9925  N N   . PRO B 2 212  ? 217.417 43.188  -37.107 1.00 96.80  ? 270  PRO B N   1 
ATOM 9926  C CA  . PRO B 2 212  ? 217.069 42.493  -38.352 1.00 96.31  ? 270  PRO B CA  1 
ATOM 9927  C C   . PRO B 2 212  ? 215.678 42.859  -38.848 1.00 96.18  ? 270  PRO B C   1 
ATOM 9928  O O   . PRO B 2 212  ? 214.921 42.018  -39.336 1.00 95.31  ? 270  PRO B O   1 
ATOM 9929  C CB  . PRO B 2 212  ? 217.178 41.024  -37.969 1.00 96.14  ? 270  PRO B CB  1 
ATOM 9930  C CG  . PRO B 2 212  ? 218.300 41.031  -36.997 1.00 95.62  ? 270  PRO B CG  1 
ATOM 9931  C CD  . PRO B 2 212  ? 217.986 42.231  -36.137 1.00 96.27  ? 270  PRO B CD  1 
ATOM 9932  N N   . SER B 2 213  ? 215.347 44.129  -38.676 1.00 96.32  ? 271  SER B N   1 
ATOM 9933  C CA  . SER B 2 213  ? 214.092 44.684  -39.133 1.00 96.66  ? 271  SER B CA  1 
ATOM 9934  C C   . SER B 2 213  ? 214.587 45.224  -40.457 1.00 96.79  ? 271  SER B C   1 
ATOM 9935  O O   . SER B 2 213  ? 213.921 46.012  -41.130 1.00 97.33  ? 271  SER B O   1 
ATOM 9936  C CB  . SER B 2 213  ? 213.673 45.852  -38.242 1.00 96.67  ? 271  SER B CB  1 
ATOM 9937  O OG  . SER B 2 213  ? 213.890 45.567  -36.871 1.00 97.21  ? 271  SER B OG  1 
ATOM 9938  N N   . ASN B 2 214  ? 215.791 44.782  -40.809 1.00 96.53  ? 272  ASN B N   1 
ATOM 9939  C CA  . ASN B 2 214  ? 216.447 45.229  -42.019 1.00 95.75  ? 272  ASN B CA  1 
ATOM 9940  C C   . ASN B 2 214  ? 217.148 44.126  -42.816 1.00 95.45  ? 272  ASN B C   1 
ATOM 9941  O O   . ASN B 2 214  ? 218.363 44.174  -43.004 1.00 94.51  ? 272  ASN B O   1 
ATOM 9942  C CB  . ASN B 2 214  ? 217.452 46.325  -41.651 1.00 95.22  ? 272  ASN B CB  1 
ATOM 9943  C CG  . ASN B 2 214  ? 217.414 46.683  -40.167 1.00 94.70  ? 272  ASN B CG  1 
ATOM 9944  O OD1 . ASN B 2 214  ? 216.368 47.051  -39.627 1.00 94.26  ? 272  ASN B OD1 1 
ATOM 9945  N ND2 . ASN B 2 214  ? 218.560 46.575  -39.504 1.00 93.46  ? 272  ASN B ND2 1 
ATOM 9946  N N   . PHE B 2 215  ? 216.383 43.134  -43.270 1.00 95.50  ? 273  PHE B N   1 
ATOM 9947  C CA  . PHE B 2 215  ? 216.915 42.041  -44.087 1.00 95.65  ? 273  PHE B CA  1 
ATOM 9948  C C   . PHE B 2 215  ? 216.149 42.061  -45.394 1.00 95.95  ? 273  PHE B C   1 
ATOM 9949  O O   . PHE B 2 215  ? 214.994 41.655  -45.444 1.00 96.00  ? 273  PHE B O   1 
ATOM 9950  C CB  . PHE B 2 215  ? 216.734 40.678  -43.406 1.00 95.61  ? 273  PHE B CB  1 
ATOM 9951  C CG  . PHE B 2 215  ? 217.866 40.306  -42.493 1.00 95.41  ? 273  PHE B CG  1 
ATOM 9952  C CD1 . PHE B 2 215  ? 219.186 40.478  -42.907 1.00 95.61  ? 273  PHE B CD1 1 
ATOM 9953  C CD2 . PHE B 2 215  ? 217.621 39.786  -41.223 1.00 95.78  ? 273  PHE B CD2 1 
ATOM 9954  C CE1 . PHE B 2 215  ? 220.246 40.144  -42.071 1.00 95.35  ? 273  PHE B CE1 1 
ATOM 9955  C CE2 . PHE B 2 215  ? 218.673 39.446  -40.377 1.00 95.64  ? 273  PHE B CE2 1 
ATOM 9956  C CZ  . PHE B 2 215  ? 219.988 39.626  -40.801 1.00 95.50  ? 273  PHE B CZ  1 
ATOM 9957  N N   . SER B 2 216  ? 216.805 42.537  -46.446 1.00 96.43  ? 274  SER B N   1 
ATOM 9958  C CA  . SER B 2 216  ? 216.194 42.663  -47.766 1.00 97.27  ? 274  SER B CA  1 
ATOM 9959  C C   . SER B 2 216  ? 216.299 41.440  -48.673 1.00 97.88  ? 274  SER B C   1 
ATOM 9960  O O   . SER B 2 216  ? 217.195 40.614  -48.520 1.00 98.30  ? 274  SER B O   1 
ATOM 9961  C CB  . SER B 2 216  ? 216.794 43.878  -48.482 1.00 97.02  ? 274  SER B CB  1 
ATOM 9962  O OG  . SER B 2 216  ? 216.231 44.052  -49.768 1.00 97.72  ? 274  SER B OG  1 
ATOM 9963  N N   . SER B 2 217  ? 215.370 41.362  -49.624 1.00 98.56  ? 275  SER B N   1 
ATOM 9964  C CA  . SER B 2 217  ? 215.286 40.281  -50.598 1.00 100.26 ? 275  SER B CA  1 
ATOM 9965  C C   . SER B 2 217  ? 214.845 40.851  -51.953 1.00 101.94 ? 275  SER B C   1 
ATOM 9966  O O   . SER B 2 217  ? 213.854 41.589  -52.025 1.00 102.15 ? 275  SER B O   1 
ATOM 9967  C CB  . SER B 2 217  ? 214.276 39.237  -50.126 1.00 100.00 ? 275  SER B CB  1 
ATOM 9968  O OG  . SER B 2 217  ? 213.076 39.854  -49.688 1.00 101.02 ? 275  SER B OG  1 
ATOM 9969  N N   . SER B 2 218  ? 215.597 40.529  -53.012 1.00 103.87 ? 276  SER B N   1 
ATOM 9970  C CA  . SER B 2 218  ? 215.295 40.985  -54.388 1.00 104.91 ? 276  SER B CA  1 
ATOM 9971  C C   . SER B 2 218  ? 214.974 39.822  -55.303 1.00 105.69 ? 276  SER B C   1 
ATOM 9972  O O   . SER B 2 218  ? 215.406 38.711  -55.062 1.00 105.19 ? 276  SER B O   1 
ATOM 9973  C CB  . SER B 2 218  ? 216.467 41.719  -55.042 1.00 104.33 ? 276  SER B CB  1 
ATOM 9974  O OG  . SER B 2 218  ? 216.316 41.732  -56.460 1.00 105.19 ? 276  SER B OG  1 
ATOM 9975  N N   . ASP B 2 219  ? 214.225 40.111  -56.369 1.00 106.70 ? 277  ASP B N   1 
ATOM 9976  C CA  . ASP B 2 219  ? 213.787 39.137  -57.384 1.00 107.52 ? 277  ASP B CA  1 
ATOM 9977  C C   . ASP B 2 219  ? 214.566 39.365  -58.704 1.00 107.11 ? 277  ASP B C   1 
ATOM 9978  O O   . ASP B 2 219  ? 214.705 40.496  -59.155 1.00 107.52 ? 277  ASP B O   1 
ATOM 9979  C CB  . ASP B 2 219  ? 212.270 39.306  -57.693 1.00 108.59 ? 277  ASP B CB  1 
ATOM 9980  C CG  . ASP B 2 219  ? 211.345 39.234  -56.447 1.00 109.54 ? 277  ASP B CG  1 
ATOM 9981  O OD1 . ASP B 2 219  ? 211.785 39.158  -55.283 1.00 110.12 ? 277  ASP B OD1 1 
ATOM 9982  O OD2 . ASP B 2 219  ? 210.115 39.269  -56.654 1.00 109.30 ? 277  ASP B OD2 1 
ATOM 9983  N N   . CYS B 2 220  ? 215.080 38.311  -59.326 1.00 106.35 ? 278  CYS B N   1 
ATOM 9984  C CA  . CYS B 2 220  ? 215.803 38.502  -60.580 1.00 106.13 ? 278  CYS B CA  1 
ATOM 9985  C C   . CYS B 2 220  ? 215.190 37.662  -61.694 1.00 105.81 ? 278  CYS B C   1 
ATOM 9986  O O   . CYS B 2 220  ? 214.916 36.462  -61.518 1.00 105.20 ? 278  CYS B O   1 
ATOM 9987  C CB  . CYS B 2 220  ? 217.292 38.162  -60.388 1.00 107.42 ? 278  CYS B CB  1 
ATOM 9988  S SG  . CYS B 2 220  ? 218.444 38.552  -61.758 1.00 107.74 ? 278  CYS B SG  1 
ATOM 9989  N N   . GLN B 2 221  ? 214.945 38.322  -62.826 1.00 106.34 ? 279  GLN B N   1 
ATOM 9990  C CA  . GLN B 2 221  ? 214.385 37.658  -63.966 1.00 107.32 ? 279  GLN B CA  1 
ATOM 9991  C C   . GLN B 2 221  ? 215.408 36.743  -64.381 1.00 108.11 ? 279  GLN B C   1 
ATOM 9992  O O   . GLN B 2 221  ? 216.617 37.030  -64.465 1.00 108.51 ? 279  GLN B O   1 
ATOM 9993  C CB  . GLN B 2 221  ? 214.130 38.550  -65.179 1.00 107.66 ? 279  GLN B CB  1 
ATOM 9994  C CG  . GLN B 2 221  ? 213.057 39.559  -64.952 1.00 107.55 ? 279  GLN B CG  1 
ATOM 9995  C CD  . GLN B 2 221  ? 213.550 40.748  -64.157 1.00 107.15 ? 279  GLN B CD  1 
ATOM 9996  O OE1 . GLN B 2 221  ? 214.742 40.869  -63.854 1.00 107.02 ? 279  GLN B OE1 1 
ATOM 9997  N NE2 . GLN B 2 221  ? 212.634 41.647  -63.826 1.00 105.71 ? 279  GLN B NE2 1 
ATOM 9998  N N   . ASP B 2 222  ? 214.898 35.556  -64.519 1.00 108.56 ? 280  ASP B N   1 
ATOM 9999  C CA  . ASP B 2 222  ? 215.781 34.595  -65.049 1.00 108.84 ? 280  ASP B CA  1 
ATOM 10000 C C   . ASP B 2 222  ? 216.640 33.622  -64.203 1.00 109.69 ? 280  ASP B C   1 
ATOM 10001 O O   . ASP B 2 222  ? 216.434 33.178  -63.258 1.00 110.03 ? 280  ASP B O   1 
ATOM 10002 C CB  . ASP B 2 222  ? 216.796 35.324  -66.001 1.00 107.16 ? 280  ASP B CB  1 
ATOM 10003 C CG  . ASP B 2 222  ? 216.284 35.593  -67.338 1.00 105.76 ? 280  ASP B CG  1 
ATOM 10004 O OD1 . ASP B 2 222  ? 215.084 35.382  -67.484 1.00 104.15 ? 280  ASP B OD1 1 
ATOM 10005 O OD2 . ASP B 2 222  ? 217.048 36.020  -68.229 1.00 106.16 ? 280  ASP B OD2 1 
ATOM 10006 N N   . GLU B 2 223  ? 217.618 33.346  -65.028 1.00 110.19 ? 281  GLU B N   1 
ATOM 10007 C CA  . GLU B 2 223  ? 218.792 32.754  -65.473 1.00 110.66 ? 281  GLU B CA  1 
ATOM 10008 C C   . GLU B 2 223  ? 219.181 31.416  -65.185 1.00 110.49 ? 281  GLU B C   1 
ATOM 10009 O O   . GLU B 2 223  ? 219.556 31.016  -64.038 1.00 109.64 ? 281  GLU B O   1 
ATOM 10010 C CB  . GLU B 2 223  ? 219.871 33.845  -65.718 1.00 111.22 ? 281  GLU B CB  1 
ATOM 10011 C CG  . GLU B 2 223  ? 220.441 33.542  -67.166 1.00 111.07 ? 281  GLU B CG  1 
ATOM 10012 C CD  . GLU B 2 223  ? 219.357 33.603  -68.341 1.00 110.48 ? 281  GLU B CD  1 
ATOM 10013 O OE1 . GLU B 2 223  ? 218.107 33.554  -68.119 1.00 110.40 ? 281  GLU B OE1 1 
ATOM 10014 O OE2 . GLU B 2 223  ? 219.781 33.709  -69.509 1.00 109.64 ? 281  GLU B OE2 1 
ATOM 10015 N N   . GLU B 2 224  ? 219.305 30.898  -66.433 1.00 110.91 ? 282  GLU B N   1 
ATOM 10016 C CA  . GLU B 2 224  ? 219.757 29.607  -66.646 1.00 110.63 ? 282  GLU B CA  1 
ATOM 10017 C C   . GLU B 2 224  ? 219.639 28.724  -65.457 1.00 110.71 ? 282  GLU B C   1 
ATOM 10018 O O   . GLU B 2 224  ? 220.610 28.113  -65.031 1.00 110.06 ? 282  GLU B O   1 
ATOM 10019 C CB  . GLU B 2 224  ? 221.213 29.709  -67.100 1.00 110.58 ? 282  GLU B CB  1 
ATOM 10020 C CG  . GLU B 2 224  ? 221.442 30.410  -68.409 1.00 110.23 ? 282  GLU B CG  1 
ATOM 10021 C CD  . GLU B 2 224  ? 220.817 29.670  -69.576 1.00 110.41 ? 282  GLU B CD  1 
ATOM 10022 O OE1 . GLU B 2 224  ? 220.143 28.641  -69.351 1.00 110.27 ? 282  GLU B OE1 1 
ATOM 10023 O OE2 . GLU B 2 224  ? 220.995 30.119  -70.727 1.00 110.39 ? 282  GLU B OE2 1 
ATOM 10024 N N   . GLY B 2 225  ? 218.449 28.660  -64.908 1.00 110.81 ? 283  GLY B N   1 
ATOM 10025 C CA  . GLY B 2 225  ? 218.260 27.830  -63.750 1.00 110.18 ? 283  GLY B CA  1 
ATOM 10026 C C   . GLY B 2 225  ? 216.777 27.684  -63.633 1.00 109.92 ? 283  GLY B C   1 
ATOM 10027 O O   . GLY B 2 225  ? 216.272 26.586  -63.448 1.00 109.74 ? 283  GLY B O   1 
ATOM 10028 N N   . ARG B 2 226  ? 216.108 28.826  -63.782 1.00 109.58 ? 284  ARG B N   1 
ATOM 10029 C CA  . ARG B 2 226  ? 214.656 29.019  -63.742 1.00 109.13 ? 284  ARG B CA  1 
ATOM 10030 C C   . ARG B 2 226  ? 214.259 29.947  -62.586 1.00 108.39 ? 284  ARG B C   1 
ATOM 10031 O O   . ARG B 2 226  ? 213.092 30.078  -62.250 1.00 107.46 ? 284  ARG B O   1 
ATOM 10032 C CB  . ARG B 2 226  ? 213.886 27.685  -63.692 1.00 109.57 ? 284  ARG B CB  1 
ATOM 10033 C CG  . ARG B 2 226  ? 212.432 27.759  -64.244 1.00 109.88 ? 284  ARG B CG  1 
ATOM 10034 C CD  . ARG B 2 226  ? 212.318 28.648  -65.515 1.00 110.52 ? 284  ARG B CD  1 
ATOM 10035 N NE  . ARG B 2 226  ? 212.375 30.090  -65.218 1.00 111.00 ? 284  ARG B NE  1 
ATOM 10036 C CZ  . ARG B 2 226  ? 212.700 31.043  -66.093 1.00 111.49 ? 284  ARG B CZ  1 
ATOM 10037 N NH1 . ARG B 2 226  ? 213.007 30.719  -67.341 1.00 112.30 ? 284  ARG B NH1 1 
ATOM 10038 N NH2 . ARG B 2 226  ? 212.723 32.319  -65.716 1.00 111.54 ? 284  ARG B NH2 1 
ATOM 10039 N N   . LYS B 2 227  ? 215.268 30.568  -61.978 1.00 108.39 ? 285  LYS B N   1 
ATOM 10040 C CA  . LYS B 2 227  ? 215.087 31.549  -60.917 1.00 108.35 ? 285  LYS B CA  1 
ATOM 10041 C C   . LYS B 2 227  ? 215.138 31.208  -59.406 1.00 108.03 ? 285  LYS B C   1 
ATOM 10042 O O   . LYS B 2 227  ? 215.590 30.168  -59.000 1.00 107.27 ? 285  LYS B O   1 
ATOM 10043 C CB  . LYS B 2 227  ? 213.824 32.325  -61.244 1.00 108.70 ? 285  LYS B CB  1 
ATOM 10044 C CG  . LYS B 2 227  ? 213.499 33.335  -60.239 1.00 108.16 ? 285  LYS B CG  1 
ATOM 10045 C CD  . LYS B 2 227  ? 212.136 33.847  -60.382 1.00 108.60 ? 285  LYS B CD  1 
ATOM 10046 C CE  . LYS B 2 227  ? 211.950 34.863  -59.284 1.00 108.19 ? 285  LYS B CE  1 
ATOM 10047 N NZ  . LYS B 2 227  ? 210.692 35.601  -59.495 1.00 107.40 ? 285  LYS B NZ  1 
ATOM 10048 N N   . GLY B 2 228  ? 214.640 32.096  -58.567 1.00 107.62 ? 286  GLY B N   1 
ATOM 10049 C CA  . GLY B 2 228  ? 214.737 31.906  -57.140 1.00 108.87 ? 286  GLY B CA  1 
ATOM 10050 C C   . GLY B 2 228  ? 215.292 33.271  -56.891 1.00 109.96 ? 286  GLY B C   1 
ATOM 10051 O O   . GLY B 2 228  ? 215.794 33.898  -57.817 1.00 109.62 ? 286  GLY B O   1 
ATOM 10052 N N   . ASN B 2 229  ? 215.193 33.754  -55.675 1.00 111.88 ? 287  ASN B N   1 
ATOM 10053 C CA  . ASN B 2 229  ? 215.658 35.083  -55.398 1.00 113.76 ? 287  ASN B CA  1 
ATOM 10054 C C   . ASN B 2 229  ? 216.934 35.083  -54.601 1.00 115.12 ? 287  ASN B C   1 
ATOM 10055 O O   . ASN B 2 229  ? 217.359 34.043  -54.125 1.00 115.14 ? 287  ASN B O   1 
ATOM 10056 C CB  . ASN B 2 229  ? 214.552 35.803  -54.648 1.00 113.92 ? 287  ASN B CB  1 
ATOM 10057 C CG  . ASN B 2 229  ? 213.645 36.540  -55.550 1.00 113.34 ? 287  ASN B CG  1 
ATOM 10058 O OD1 . ASN B 2 229  ? 213.463 36.206  -56.719 1.00 112.82 ? 287  ASN B OD1 1 
ATOM 10059 N ND2 . ASN B 2 229  ? 213.047 37.550  -55.011 1.00 113.42 ? 287  ASN B ND2 1 
ATOM 10060 N N   . LYS B 2 230  ? 217.525 36.264  -54.446 1.00 117.13 ? 288  LYS B N   1 
ATOM 10061 C CA  . LYS B 2 230  ? 218.765 36.433  -53.683 1.00 119.22 ? 288  LYS B CA  1 
ATOM 10062 C C   . LYS B 2 230  ? 218.477 37.054  -52.315 1.00 120.56 ? 288  LYS B C   1 
ATOM 10063 O O   . LYS B 2 230  ? 217.344 37.443  -52.037 1.00 121.00 ? 288  LYS B O   1 
ATOM 10064 C CB  . LYS B 2 230  ? 219.780 37.330  -54.444 1.00 118.85 ? 288  LYS B CB  1 
ATOM 10065 C CG  . LYS B 2 230  ? 220.318 36.824  -55.790 1.00 118.71 ? 288  LYS B CG  1 
ATOM 10066 C CD  . LYS B 2 230  ? 221.184 37.899  -56.486 1.00 117.88 ? 288  LYS B CD  1 
ATOM 10067 C CE  . LYS B 2 230  ? 222.007 37.376  -57.679 1.00 116.83 ? 288  LYS B CE  1 
ATOM 10068 N NZ  . LYS B 2 230  ? 221.167 36.965  -58.832 1.00 115.45 ? 288  LYS B NZ  1 
ATOM 10069 N N   . LEU B 2 231  ? 219.502 37.161  -51.475 1.00 122.02 ? 289  LEU B N   1 
ATOM 10070 C CA  . LEU B 2 231  ? 219.337 37.753  -50.152 1.00 123.36 ? 289  LEU B CA  1 
ATOM 10071 C C   . LEU B 2 231  ? 220.287 38.926  -49.915 1.00 124.49 ? 289  LEU B C   1 
ATOM 10072 O O   . LEU B 2 231  ? 221.409 38.931  -50.422 1.00 124.72 ? 289  LEU B O   1 
ATOM 10073 C CB  . LEU B 2 231  ? 219.556 36.709  -49.065 1.00 122.66 ? 289  LEU B CB  1 
ATOM 10074 C CG  . LEU B 2 231  ? 218.402 35.763  -48.784 1.00 122.66 ? 289  LEU B CG  1 
ATOM 10075 C CD1 . LEU B 2 231  ? 217.174 36.579  -48.405 1.00 122.14 ? 289  LEU B CD1 1 
ATOM 10076 C CD2 . LEU B 2 231  ? 218.139 34.902  -50.003 1.00 122.54 ? 289  LEU B CD2 1 
ATOM 10077 N N   . TYR B 2 232  ? 219.846 39.914  -49.134 1.00 125.99 ? 290  TYR B N   1 
ATOM 10078 C CA  . TYR B 2 232  ? 220.669 41.091  -48.851 1.00 127.52 ? 290  TYR B CA  1 
ATOM 10079 C C   . TYR B 2 232  ? 220.444 41.626  -47.428 1.00 127.10 ? 290  TYR B C   1 
ATOM 10080 O O   . TYR B 2 232  ? 219.447 41.296  -46.781 1.00 126.68 ? 290  TYR B O   1 
ATOM 10081 C CB  . TYR B 2 232  ? 220.353 42.207  -49.863 1.00 130.37 ? 290  TYR B CB  1 
ATOM 10082 C CG  . TYR B 2 232  ? 220.525 41.849  -51.336 1.00 132.67 ? 290  TYR B CG  1 
ATOM 10083 C CD1 . TYR B 2 232  ? 221.736 42.062  -51.998 1.00 133.92 ? 290  TYR B CD1 1 
ATOM 10084 C CD2 . TYR B 2 232  ? 219.462 41.327  -52.073 1.00 133.25 ? 290  TYR B CD2 1 
ATOM 10085 C CE1 . TYR B 2 232  ? 221.877 41.770  -53.360 1.00 135.06 ? 290  TYR B CE1 1 
ATOM 10086 C CE2 . TYR B 2 232  ? 219.595 41.030  -53.431 1.00 134.31 ? 290  TYR B CE2 1 
ATOM 10087 C CZ  . TYR B 2 232  ? 220.801 41.255  -54.067 1.00 135.26 ? 290  TYR B CZ  1 
ATOM 10088 O OH  . TYR B 2 232  ? 220.926 40.975  -55.408 1.00 136.47 ? 290  TYR B OH  1 
ATOM 10089 N N   . TYR B 2 233  ? 221.382 42.449  -46.953 1.00 126.88 ? 291  TYR B N   1 
ATOM 10090 C CA  . TYR B 2 233  ? 221.298 43.067  -45.623 1.00 127.08 ? 291  TYR B CA  1 
ATOM 10091 C C   . TYR B 2 233  ? 221.483 44.586  -45.725 1.00 126.12 ? 291  TYR B C   1 
ATOM 10092 O O   . TYR B 2 233  ? 222.235 45.070  -46.580 1.00 126.31 ? 291  TYR B O   1 
ATOM 10093 C CB  . TYR B 2 233  ? 222.364 42.500  -44.680 1.00 129.29 ? 291  TYR B CB  1 
ATOM 10094 C CG  . TYR B 2 233  ? 222.433 43.218  -43.341 1.00 132.91 ? 291  TYR B CG  1 
ATOM 10095 C CD1 . TYR B 2 233  ? 221.342 43.230  -42.474 1.00 134.43 ? 291  TYR B CD1 1 
ATOM 10096 C CD2 . TYR B 2 233  ? 223.593 43.883  -42.941 1.00 134.65 ? 291  TYR B CD2 1 
ATOM 10097 C CE1 . TYR B 2 233  ? 221.406 43.886  -41.239 1.00 136.04 ? 291  TYR B CE1 1 
ATOM 10098 C CE2 . TYR B 2 233  ? 223.666 44.541  -41.710 1.00 136.13 ? 291  TYR B CE2 1 
ATOM 10099 C CZ  . TYR B 2 233  ? 222.569 44.535  -40.865 1.00 136.48 ? 291  TYR B CZ  1 
ATOM 10100 O OH  . TYR B 2 233  ? 222.634 45.162  -39.641 1.00 137.51 ? 291  TYR B OH  1 
ATOM 10101 N N   . ASN B 2 234  ? 220.812 45.327  -44.837 1.00 124.96 ? 292  ASN B N   1 
ATOM 10102 C CA  . ASN B 2 234  ? 220.877 46.791  -44.829 1.00 123.84 ? 292  ASN B CA  1 
ATOM 10103 C C   . ASN B 2 234  ? 222.191 47.395  -44.358 1.00 123.05 ? 292  ASN B C   1 
ATOM 10104 O O   . ASN B 2 234  ? 222.334 47.765  -43.190 1.00 123.55 ? 292  ASN B O   1 
ATOM 10105 C CB  . ASN B 2 234  ? 219.747 47.380  -43.983 1.00 123.69 ? 292  ASN B CB  1 
ATOM 10106 C CG  . ASN B 2 234  ? 219.756 48.895  -43.985 1.00 123.50 ? 292  ASN B CG  1 
ATOM 10107 O OD1 . ASN B 2 234  ? 220.693 49.526  -43.492 1.00 122.60 ? 292  ASN B OD1 1 
ATOM 10108 N ND2 . ASN B 2 234  ? 218.714 49.488  -44.552 1.00 124.08 ? 292  ASN B ND2 1 
ATOM 10109 N N   . PHE B 2 235  ? 223.145 47.497  -45.277 1.00 121.42 ? 293  PHE B N   1 
ATOM 10110 C CA  . PHE B 2 235  ? 224.431 48.089  -44.969 1.00 119.75 ? 293  PHE B CA  1 
ATOM 10111 C C   . PHE B 2 235  ? 224.416 49.549  -45.325 1.00 117.97 ? 293  PHE B C   1 
ATOM 10112 O O   . PHE B 2 235  ? 224.349 49.918  -46.501 1.00 117.23 ? 293  PHE B O   1 
ATOM 10113 C CB  . PHE B 2 235  ? 225.546 47.383  -45.712 1.00 121.23 ? 293  PHE B CB  1 
ATOM 10114 C CG  . PHE B 2 235  ? 226.140 46.287  -44.932 1.00 122.69 ? 293  PHE B CG  1 
ATOM 10115 C CD1 . PHE B 2 235  ? 226.719 46.556  -43.694 1.00 123.44 ? 293  PHE B CD1 1 
ATOM 10116 C CD2 . PHE B 2 235  ? 226.067 44.980  -45.381 1.00 122.85 ? 293  PHE B CD2 1 
ATOM 10117 C CE1 . PHE B 2 235  ? 227.221 45.535  -42.904 1.00 123.75 ? 293  PHE B CE1 1 
ATOM 10118 C CE2 . PHE B 2 235  ? 226.564 43.942  -44.604 1.00 123.38 ? 293  PHE B CE2 1 
ATOM 10119 C CZ  . PHE B 2 235  ? 227.145 44.219  -43.354 1.00 124.23 ? 293  PHE B CZ  1 
ATOM 10120 N N   . PRO B 2 236  ? 224.491 50.407  -44.302 1.00 116.77 ? 294  PRO B N   1 
ATOM 10121 C CA  . PRO B 2 236  ? 224.475 51.835  -44.576 1.00 116.66 ? 294  PRO B CA  1 
ATOM 10122 C C   . PRO B 2 236  ? 225.496 52.147  -45.653 1.00 116.71 ? 294  PRO B C   1 
ATOM 10123 O O   . PRO B 2 236  ? 225.148 52.591  -46.748 1.00 117.35 ? 294  PRO B O   1 
ATOM 10124 C CB  . PRO B 2 236  ? 224.816 52.443  -43.218 1.00 116.47 ? 294  PRO B CB  1 
ATOM 10125 C CG  . PRO B 2 236  ? 225.711 51.420  -42.610 1.00 115.88 ? 294  PRO B CG  1 
ATOM 10126 C CD  . PRO B 2 236  ? 224.996 50.141  -42.942 1.00 116.23 ? 294  PRO B CD  1 
ATOM 10127 N N   . TRP B 2 237  ? 226.756 51.876  -45.346 1.00 116.09 ? 295  TRP B N   1 
ATOM 10128 C CA  . TRP B 2 237  ? 227.840 52.137  -46.273 1.00 115.02 ? 295  TRP B CA  1 
ATOM 10129 C C   . TRP B 2 237  ? 227.507 51.626  -47.677 1.00 114.41 ? 295  TRP B C   1 
ATOM 10130 O O   . TRP B 2 237  ? 227.676 52.337  -48.670 1.00 114.28 ? 295  TRP B O   1 
ATOM 10131 C CB  . TRP B 2 237  ? 229.108 51.484  -45.733 1.00 114.88 ? 295  TRP B CB  1 
ATOM 10132 C CG  . TRP B 2 237  ? 230.312 51.792  -46.508 1.00 115.53 ? 295  TRP B CG  1 
ATOM 10133 C CD1 . TRP B 2 237  ? 230.555 51.450  -47.803 1.00 115.38 ? 295  TRP B CD1 1 
ATOM 10134 C CD2 . TRP B 2 237  ? 231.466 52.508  -46.053 1.00 115.89 ? 295  TRP B CD2 1 
ATOM 10135 N NE1 . TRP B 2 237  ? 231.790 51.907  -48.189 1.00 116.11 ? 295  TRP B NE1 1 
ATOM 10136 C CE2 . TRP B 2 237  ? 232.374 52.561  -47.134 1.00 116.17 ? 295  TRP B CE2 1 
ATOM 10137 C CE3 . TRP B 2 237  ? 231.825 53.108  -44.836 1.00 116.14 ? 295  TRP B CE3 1 
ATOM 10138 C CZ2 . TRP B 2 237  ? 233.628 53.200  -47.038 1.00 116.01 ? 295  TRP B CZ2 1 
ATOM 10139 C CZ3 . TRP B 2 237  ? 233.076 53.744  -44.740 1.00 116.59 ? 295  TRP B CZ3 1 
ATOM 10140 C CH2 . TRP B 2 237  ? 233.958 53.781  -45.837 1.00 116.31 ? 295  TRP B CH2 1 
ATOM 10141 N N   . GLY B 2 238  ? 227.011 50.399  -47.749 1.00 113.96 ? 296  GLY B N   1 
ATOM 10142 C CA  . GLY B 2 238  ? 226.664 49.822  -49.032 1.00 112.86 ? 296  GLY B CA  1 
ATOM 10143 C C   . GLY B 2 238  ? 226.150 48.411  -48.848 1.00 112.33 ? 296  GLY B C   1 
ATOM 10144 O O   . GLY B 2 238  ? 226.913 47.502  -48.523 1.00 112.16 ? 296  GLY B O   1 
ATOM 10145 N N   . LYS B 2 239  ? 224.849 48.231  -49.046 1.00 111.07 ? 297  LYS B N   1 
ATOM 10146 C CA  . LYS B 2 239  ? 224.195 46.928  -48.905 1.00 109.91 ? 297  LYS B CA  1 
ATOM 10147 C C   . LYS B 2 239  ? 224.991 45.780  -49.527 1.00 109.63 ? 297  LYS B C   1 
ATOM 10148 O O   . LYS B 2 239  ? 225.790 45.997  -50.434 1.00 110.02 ? 297  LYS B O   1 
ATOM 10149 C CB  . LYS B 2 239  ? 222.810 46.979  -49.548 1.00 109.15 ? 297  LYS B CB  1 
ATOM 10150 C CG  . LYS B 2 239  ? 221.918 48.094  -49.023 1.00 107.98 ? 297  LYS B CG  1 
ATOM 10151 C CD  . LYS B 2 239  ? 220.503 47.953  -49.554 1.00 107.40 ? 297  LYS B CD  1 
ATOM 10152 C CE  . LYS B 2 239  ? 219.553 48.858  -48.806 1.00 106.94 ? 297  LYS B CE  1 
ATOM 10153 N NZ  . LYS B 2 239  ? 218.146 48.500  -49.110 1.00 106.12 ? 297  LYS B NZ  1 
ATOM 10154 N N   . GLU B 2 240  ? 224.763 44.556  -49.056 1.00 108.71 ? 298  GLU B N   1 
ATOM 10155 C CA  . GLU B 2 240  ? 225.486 43.405  -49.598 1.00 106.95 ? 298  GLU B CA  1 
ATOM 10156 C C   . GLU B 2 240  ? 224.634 42.132  -49.726 1.00 105.82 ? 298  GLU B C   1 
ATOM 10157 O O   . GLU B 2 240  ? 223.733 41.896  -48.920 1.00 104.83 ? 298  GLU B O   1 
ATOM 10158 C CB  . GLU B 2 240  ? 226.709 43.113  -48.725 1.00 106.13 ? 298  GLU B CB  1 
ATOM 10159 C CG  . GLU B 2 240  ? 228.001 42.904  -49.496 1.00 104.70 ? 298  GLU B CG  1 
ATOM 10160 C CD  . GLU B 2 240  ? 228.519 44.181  -50.108 1.00 103.99 ? 298  GLU B CD  1 
ATOM 10161 O OE1 . GLU B 2 240  ? 227.847 44.738  -50.991 1.00 102.68 ? 298  GLU B OE1 1 
ATOM 10162 O OE2 . GLU B 2 240  ? 229.605 44.636  -49.703 1.00 105.65 ? 298  GLU B OE2 1 
ATOM 10163 N N   . LEU B 2 241  ? 224.936 41.322  -50.742 1.00 104.85 ? 299  LEU B N   1 
ATOM 10164 C CA  . LEU B 2 241  ? 224.244 40.053  -51.010 1.00 104.16 ? 299  LEU B CA  1 
ATOM 10165 C C   . LEU B 2 241  ? 224.675 39.006  -49.974 1.00 103.74 ? 299  LEU B C   1 
ATOM 10166 O O   . LEU B 2 241  ? 225.871 38.746  -49.837 1.00 104.79 ? 299  LEU B O   1 
ATOM 10167 C CB  . LEU B 2 241  ? 224.608 39.566  -52.429 1.00 102.81 ? 299  LEU B CB  1 
ATOM 10168 C CG  . LEU B 2 241  ? 224.127 38.245  -53.065 1.00 100.88 ? 299  LEU B CG  1 
ATOM 10169 C CD1 . LEU B 2 241  ? 224.549 38.227  -54.531 1.00 98.94  ? 299  LEU B CD1 1 
ATOM 10170 C CD2 . LEU B 2 241  ? 224.706 37.033  -52.349 1.00 100.49 ? 299  LEU B CD2 1 
ATOM 10171 N N   . ILE B 2 242  ? 223.719 38.403  -49.256 1.00 102.54 ? 300  ILE B N   1 
ATOM 10172 C CA  . ILE B 2 242  ? 224.042 37.387  -48.231 1.00 101.60 ? 300  ILE B CA  1 
ATOM 10173 C C   . ILE B 2 242  ? 223.862 35.913  -48.669 1.00 99.66  ? 300  ILE B C   1 
ATOM 10174 O O   . ILE B 2 242  ? 224.732 35.068  -48.418 1.00 99.84  ? 300  ILE B O   1 
ATOM 10175 C CB  . ILE B 2 242  ? 223.233 37.622  -46.896 1.00 101.92 ? 300  ILE B CB  1 
ATOM 10176 C CG1 . ILE B 2 242  ? 221.730 37.498  -47.141 1.00 102.41 ? 300  ILE B CG1 1 
ATOM 10177 C CG2 . ILE B 2 242  ? 223.527 39.010  -46.337 1.00 102.11 ? 300  ILE B CG2 1 
ATOM 10178 C CD1 . ILE B 2 242  ? 220.878 37.620  -45.884 1.00 103.27 ? 300  ILE B CD1 1 
ATOM 10179 N N   . GLU B 2 243  ? 222.744 35.604  -49.316 1.00 97.56  ? 301  GLU B N   1 
ATOM 10180 C CA  . GLU B 2 243  ? 222.498 34.248  -49.769 1.00 96.26  ? 301  GLU B CA  1 
ATOM 10181 C C   . GLU B 2 243  ? 221.782 34.299  -51.090 1.00 95.08  ? 301  GLU B C   1 
ATOM 10182 O O   . GLU B 2 243  ? 221.073 35.251  -51.375 1.00 95.44  ? 301  GLU B O   1 
ATOM 10183 C CB  . GLU B 2 243  ? 221.655 33.489  -48.752 1.00 96.22  ? 301  GLU B CB  1 
ATOM 10184 C CG  . GLU B 2 243  ? 221.220 32.114  -49.223 1.00 97.03  ? 301  GLU B CG  1 
ATOM 10185 C CD  . GLU B 2 243  ? 220.698 31.235  -48.095 1.00 96.66  ? 301  GLU B CD  1 
ATOM 10186 O OE1 . GLU B 2 243  ? 219.803 31.680  -47.351 1.00 97.07  ? 301  GLU B OE1 1 
ATOM 10187 O OE2 . GLU B 2 243  ? 221.177 30.088  -47.954 1.00 97.14  ? 301  GLU B OE2 1 
ATOM 10188 N N   . THR B 2 244  ? 221.967 33.269  -51.900 1.00 93.10  ? 302  THR B N   1 
ATOM 10189 C CA  . THR B 2 244  ? 221.334 33.220  -53.206 1.00 91.73  ? 302  THR B CA  1 
ATOM 10190 C C   . THR B 2 244  ? 220.679 31.866  -53.508 1.00 91.88  ? 302  THR B C   1 
ATOM 10191 O O   . THR B 2 244  ? 221.348 30.876  -53.819 1.00 91.58  ? 302  THR B O   1 
ATOM 10192 C CB  . THR B 2 244  ? 222.359 33.562  -54.304 1.00 91.15  ? 302  THR B CB  1 
ATOM 10193 O OG1 . THR B 2 244  ? 223.545 32.785  -54.112 1.00 91.41  ? 302  THR B OG1 1 
ATOM 10194 C CG2 . THR B 2 244  ? 222.728 35.027  -54.241 1.00 91.19  ? 302  THR B CG2 1 
ATOM 10195 N N   . LEU B 2 245  ? 219.357 31.829  -53.413 1.00 93.18  ? 303  LEU B N   1 
ATOM 10196 C CA  . LEU B 2 245  ? 218.630 30.604  -53.677 1.00 94.77  ? 303  LEU B CA  1 
ATOM 10197 C C   . LEU B 2 245  ? 218.199 30.574  -55.120 1.00 96.02  ? 303  LEU B C   1 
ATOM 10198 O O   . LEU B 2 245  ? 217.693 31.554  -55.645 1.00 96.03  ? 303  LEU B O   1 
ATOM 10199 C CB  . LEU B 2 245  ? 217.416 30.506  -52.762 1.00 93.98  ? 303  LEU B CB  1 
ATOM 10200 C CG  . LEU B 2 245  ? 217.785 30.395  -51.281 1.00 93.79  ? 303  LEU B CG  1 
ATOM 10201 C CD1 . LEU B 2 245  ? 218.376 31.707  -50.800 1.00 93.52  ? 303  LEU B CD1 1 
ATOM 10202 C CD2 . LEU B 2 245  ? 216.558 30.039  -50.468 1.00 93.97  ? 303  LEU B CD2 1 
ATOM 10203 N N   . TRP B 2 246  ? 218.400 29.433  -55.755 1.00 97.97  ? 304  TRP B N   1 
ATOM 10204 C CA  . TRP B 2 246  ? 218.055 29.267  -57.152 1.00 100.75 ? 304  TRP B CA  1 
ATOM 10205 C C   . TRP B 2 246  ? 216.780 28.459  -57.385 1.00 101.65 ? 304  TRP B C   1 
ATOM 10206 O O   . TRP B 2 246  ? 215.928 28.352  -56.510 1.00 101.72 ? 304  TRP B O   1 
ATOM 10207 C CB  . TRP B 2 246  ? 219.238 28.611  -57.866 1.00 103.37 ? 304  TRP B CB  1 
ATOM 10208 C CG  . TRP B 2 246  ? 220.276 29.589  -58.336 1.00 107.33 ? 304  TRP B CG  1 
ATOM 10209 C CD1 . TRP B 2 246  ? 221.543 29.301  -58.767 1.00 108.06 ? 304  TRP B CD1 1 
ATOM 10210 C CD2 . TRP B 2 246  ? 220.099 30.999  -58.533 1.00 108.98 ? 304  TRP B CD2 1 
ATOM 10211 N NE1 . TRP B 2 246  ? 222.163 30.443  -59.226 1.00 108.64 ? 304  TRP B NE1 1 
ATOM 10212 C CE2 . TRP B 2 246  ? 221.299 31.499  -59.092 1.00 109.57 ? 304  TRP B CE2 1 
ATOM 10213 C CE3 . TRP B 2 246  ? 219.043 31.891  -58.293 1.00 109.72 ? 304  TRP B CE3 1 
ATOM 10214 C CZ2 . TRP B 2 246  ? 221.466 32.852  -59.422 1.00 110.50 ? 304  TRP B CZ2 1 
ATOM 10215 C CZ3 . TRP B 2 246  ? 219.208 33.233  -58.622 1.00 110.49 ? 304  TRP B CZ3 1 
ATOM 10216 C CH2 . TRP B 2 246  ? 220.412 33.700  -59.178 1.00 111.14 ? 304  TRP B CH2 1 
ATOM 10217 N N   . ASN B 2 247  ? 216.641 27.946  -58.601 1.00 103.09 ? 305  ASN B N   1 
ATOM 10218 C CA  . ASN B 2 247  ? 215.521 27.092  -59.004 1.00 104.44 ? 305  ASN B CA  1 
ATOM 10219 C C   . ASN B 2 247  ? 215.995 26.365  -60.254 1.00 105.06 ? 305  ASN B C   1 
ATOM 10220 O O   . ASN B 2 247  ? 215.472 26.606  -61.344 1.00 104.69 ? 305  ASN B O   1 
ATOM 10221 C CB  . ASN B 2 247  ? 214.233 27.861  -59.379 1.00 105.26 ? 305  ASN B CB  1 
ATOM 10222 C CG  . ASN B 2 247  ? 213.452 28.366  -58.177 1.00 104.89 ? 305  ASN B CG  1 
ATOM 10223 O OD1 . ASN B 2 247  ? 213.110 27.610  -57.280 1.00 104.63 ? 305  ASN B OD1 1 
ATOM 10224 N ND2 . ASN B 2 247  ? 213.146 29.655  -58.174 1.00 105.00 ? 305  ASN B ND2 1 
ATOM 10225 N N   . LEU B 2 248  ? 217.000 25.504  -60.103 1.00 105.96 ? 306  LEU B N   1 
ATOM 10226 C CA  . LEU B 2 248  ? 217.510 24.724  -61.223 1.00 107.07 ? 306  LEU B CA  1 
ATOM 10227 C C   . LEU B 2 248  ? 216.480 23.624  -61.434 1.00 107.65 ? 306  LEU B C   1 
ATOM 10228 O O   . LEU B 2 248  ? 216.814 22.438  -61.500 1.00 107.47 ? 306  LEU B O   1 
ATOM 10229 C CB  . LEU B 2 248  ? 218.885 24.130  -60.890 1.00 107.62 ? 306  LEU B CB  1 
ATOM 10230 C CG  . LEU B 2 248  ? 220.059 25.120  -60.863 1.00 108.35 ? 306  LEU B CG  1 
ATOM 10231 C CD1 . LEU B 2 248  ? 221.191 24.608  -59.980 1.00 109.17 ? 306  LEU B CD1 1 
ATOM 10232 C CD2 . LEU B 2 248  ? 220.534 25.362  -62.289 1.00 108.46 ? 306  LEU B CD2 1 
ATOM 10233 N N   . GLY B 2 249  ? 215.215 24.045  -61.523 1.00 107.83 ? 307  GLY B N   1 
ATOM 10234 C CA  . GLY B 2 249  ? 214.115 23.125  -61.740 1.00 108.25 ? 307  GLY B CA  1 
ATOM 10235 C C   . GLY B 2 249  ? 214.609 22.226  -62.832 1.00 108.58 ? 307  GLY B C   1 
ATOM 10236 O O   . GLY B 2 249  ? 214.075 21.156  -63.105 1.00 108.82 ? 307  GLY B O   1 
ATOM 10237 N N   . ASP B 2 250  ? 215.668 22.707  -63.460 1.00 109.35 ? 308  ASP B N   1 
ATOM 10238 C CA  . ASP B 2 250  ? 216.319 21.988  -64.504 1.00 110.24 ? 308  ASP B CA  1 
ATOM 10239 C C   . ASP B 2 250  ? 217.760 21.597  -64.137 1.00 110.95 ? 308  ASP B C   1 
ATOM 10240 O O   . ASP B 2 250  ? 218.410 22.125  -63.230 1.00 111.12 ? 308  ASP B O   1 
ATOM 10241 C CB  . ASP B 2 250  ? 216.325 22.819  -65.805 1.00 109.61 ? 308  ASP B CB  1 
ATOM 10242 C CG  . ASP B 2 250  ? 214.970 22.837  -66.538 1.00 109.21 ? 308  ASP B CG  1 
ATOM 10243 O OD1 . ASP B 2 250  ? 214.200 21.857  -66.453 1.00 108.84 ? 308  ASP B OD1 1 
ATOM 10244 O OD2 . ASP B 2 250  ? 214.692 23.837  -67.238 1.00 109.41 ? 308  ASP B OD2 1 
ATOM 10245 N N   . HIS B 2 251  ? 218.185 20.618  -64.907 1.00 111.70 ? 309  HIS B N   1 
ATOM 10246 C CA  . HIS B 2 251  ? 219.474 19.960  -65.007 1.00 111.76 ? 309  HIS B CA  1 
ATOM 10247 C C   . HIS B 2 251  ? 220.835 20.496  -64.586 1.00 111.45 ? 309  HIS B C   1 
ATOM 10248 O O   . HIS B 2 251  ? 221.473 21.191  -65.368 1.00 110.89 ? 309  HIS B O   1 
ATOM 10249 C CB  . HIS B 2 251  ? 219.628 19.669  -66.469 1.00 112.20 ? 309  HIS B CB  1 
ATOM 10250 C CG  . HIS B 2 251  ? 219.469 20.910  -67.293 1.00 112.72 ? 309  HIS B CG  1 
ATOM 10251 N ND1 . HIS B 2 251  ? 218.631 21.930  -66.900 1.00 112.57 ? 309  HIS B ND1 1 
ATOM 10252 C CD2 . HIS B 2 251  ? 220.092 21.348  -68.411 1.00 112.92 ? 309  HIS B CD2 1 
ATOM 10253 C CE1 . HIS B 2 251  ? 218.746 22.947  -67.734 1.00 112.90 ? 309  HIS B CE1 1 
ATOM 10254 N NE2 . HIS B 2 251  ? 219.628 22.620  -68.662 1.00 112.67 ? 309  HIS B NE2 1 
ATOM 10255 N N   . GLU B 2 252  ? 221.313 20.208  -63.396 1.00 111.06 ? 310  GLU B N   1 
ATOM 10256 C CA  . GLU B 2 252  ? 222.700 20.554  -63.169 1.00 109.18 ? 310  GLU B CA  1 
ATOM 10257 C C   . GLU B 2 252  ? 223.143 19.184  -62.706 1.00 108.52 ? 310  GLU B C   1 
ATOM 10258 O O   . GLU B 2 252  ? 224.088 18.987  -61.953 1.00 107.99 ? 310  GLU B O   1 
ATOM 10259 C CB  . GLU B 2 252  ? 222.917 21.704  -62.190 1.00 107.28 ? 310  GLU B CB  1 
ATOM 10260 C CG  . GLU B 2 252  ? 222.872 23.110  -62.888 1.00 104.63 ? 310  GLU B CG  1 
ATOM 10261 C CD  . GLU B 2 252  ? 223.641 23.227  -64.218 1.00 103.48 ? 310  GLU B CD  1 
ATOM 10262 O OE1 . GLU B 2 252  ? 224.693 22.589  -64.392 1.00 103.05 ? 310  GLU B OE1 1 
ATOM 10263 O OE2 . GLU B 2 252  ? 223.189 23.986  -65.095 1.00 102.51 ? 310  GLU B OE2 1 
ATOM 10264 N N   . LEU B 2 253  ? 222.372 18.246  -63.253 1.00 107.56 ? 311  LEU B N   1 
ATOM 10265 C CA  . LEU B 2 253  ? 222.482 16.811  -63.110 1.00 106.11 ? 311  LEU B CA  1 
ATOM 10266 C C   . LEU B 2 253  ? 222.252 16.488  -64.582 1.00 105.16 ? 311  LEU B C   1 
ATOM 10267 O O   . LEU B 2 253  ? 222.982 16.998  -65.419 1.00 104.64 ? 311  LEU B O   1 
ATOM 10268 C CB  . LEU B 2 253  ? 221.350 16.269  -62.221 1.00 106.11 ? 311  LEU B CB  1 
ATOM 10269 C CG  . LEU B 2 253  ? 219.979 15.874  -62.782 1.00 105.65 ? 311  LEU B CG  1 
ATOM 10270 C CD1 . LEU B 2 253  ? 219.902 14.370  -62.783 1.00 106.48 ? 311  LEU B CD1 1 
ATOM 10271 C CD2 . LEU B 2 253  ? 218.836 16.452  -61.964 1.00 104.68 ? 311  LEU B CD2 1 
ATOM 10272 N N   . LEU B 2 254  ? 221.228 15.708  -64.909 1.00 104.32 ? 312  LEU B N   1 
ATOM 10273 C CA  . LEU B 2 254  ? 220.940 15.368  -66.292 1.00 104.24 ? 312  LEU B CA  1 
ATOM 10274 C C   . LEU B 2 254  ? 222.242 15.003  -66.981 1.00 104.85 ? 312  LEU B C   1 
ATOM 10275 O O   . LEU B 2 254  ? 222.610 13.843  -67.020 1.00 105.29 ? 312  LEU B O   1 
ATOM 10276 C CB  . LEU B 2 254  ? 220.209 16.544  -66.972 1.00 104.37 ? 312  LEU B CB  1 
ATOM 10277 C CG  . LEU B 2 254  ? 218.678 16.333  -67.037 1.00 105.06 ? 312  LEU B CG  1 
ATOM 10278 C CD1 . LEU B 2 254  ? 218.280 15.560  -65.788 1.00 104.88 ? 312  LEU B CD1 1 
ATOM 10279 C CD2 . LEU B 2 254  ? 217.851 17.625  -67.179 1.00 104.29 ? 312  LEU B CD2 1 
ATOM 10280 N N   . HIS B 2 255  ? 222.954 15.981  -67.512 1.00 105.45 ? 313  HIS B N   1 
ATOM 10281 C CA  . HIS B 2 255  ? 224.229 15.680  -68.135 1.00 106.06 ? 313  HIS B CA  1 
ATOM 10282 C C   . HIS B 2 255  ? 225.102 15.012  -67.067 1.00 106.22 ? 313  HIS B C   1 
ATOM 10283 O O   . HIS B 2 255  ? 225.507 13.867  -67.231 1.00 106.61 ? 313  HIS B O   1 
ATOM 10284 C CB  . HIS B 2 255  ? 224.825 16.987  -68.751 1.00 106.15 ? 313  HIS B CB  1 
ATOM 10285 C CG  . HIS B 2 255  ? 226.059 17.540  -68.089 1.00 106.40 ? 313  HIS B CG  1 
ATOM 10286 N ND1 . HIS B 2 255  ? 226.336 18.891  -68.086 1.00 106.43 ? 313  HIS B ND1 1 
ATOM 10287 C CD2 . HIS B 2 255  ? 227.116 16.942  -67.489 1.00 106.57 ? 313  HIS B CD2 1 
ATOM 10288 C CE1 . HIS B 2 255  ? 227.506 19.100  -67.509 1.00 106.70 ? 313  HIS B CE1 1 
ATOM 10289 N NE2 . HIS B 2 255  ? 228.000 17.934  -67.138 1.00 107.04 ? 313  HIS B NE2 1 
ATOM 10290 N N   . MET B 2 256  ? 225.336 15.700  -65.953 1.00 105.39 ? 314  MET B N   1 
ATOM 10291 C CA  . MET B 2 256  ? 226.173 15.155  -64.890 1.00 104.48 ? 314  MET B CA  1 
ATOM 10292 C C   . MET B 2 256  ? 225.822 13.697  -64.636 1.00 103.36 ? 314  MET B C   1 
ATOM 10293 O O   . MET B 2 256  ? 226.685 12.860  -64.382 1.00 102.99 ? 314  MET B O   1 
ATOM 10294 C CB  . MET B 2 256  ? 225.986 15.965  -63.609 1.00 105.69 ? 314  MET B CB  1 
ATOM 10295 C CG  . MET B 2 256  ? 227.085 15.756  -62.597 1.00 107.22 ? 314  MET B CG  1 
ATOM 10296 S SD  . MET B 2 256  ? 226.865 16.877  -61.235 1.00 107.94 ? 314  MET B SD  1 
ATOM 10297 C CE  . MET B 2 256  ? 227.221 18.424  -62.045 1.00 109.10 ? 314  MET B CE  1 
ATOM 10298 N N   . TYR B 2 257  ? 224.534 13.407  -64.732 1.00 102.12 ? 315  TYR B N   1 
ATOM 10299 C CA  . TYR B 2 257  ? 224.012 12.070  -64.510 1.00 100.93 ? 315  TYR B CA  1 
ATOM 10300 C C   . TYR B 2 257  ? 223.021 11.825  -65.634 1.00 100.72 ? 315  TYR B C   1 
ATOM 10301 O O   . TYR B 2 257  ? 221.810 11.947  -65.466 1.00 100.95 ? 315  TYR B O   1 
ATOM 10302 C CB  . TYR B 2 257  ? 223.324 12.046  -63.159 1.00 100.60 ? 315  TYR B CB  1 
ATOM 10303 C CG  . TYR B 2 257  ? 224.156 12.720  -62.103 1.00 100.04 ? 315  TYR B CG  1 
ATOM 10304 C CD1 . TYR B 2 257  ? 225.292 12.101  -61.589 1.00 100.26 ? 315  TYR B CD1 1 
ATOM 10305 C CD2 . TYR B 2 257  ? 223.837 14.001  -61.651 1.00 100.31 ? 315  TYR B CD2 1 
ATOM 10306 C CE1 . TYR B 2 257  ? 226.095 12.740  -60.651 1.00 100.78 ? 315  TYR B CE1 1 
ATOM 10307 C CE2 . TYR B 2 257  ? 224.631 14.652  -60.714 1.00 100.88 ? 315  TYR B CE2 1 
ATOM 10308 C CZ  . TYR B 2 257  ? 225.761 14.019  -60.219 1.00 101.22 ? 315  TYR B CZ  1 
ATOM 10309 O OH  . TYR B 2 257  ? 226.572 14.679  -59.321 1.00 101.32 ? 315  TYR B OH  1 
ATOM 10310 N N   . PRO B 2 258  ? 223.541 11.490  -66.812 1.00 100.38 ? 316  PRO B N   1 
ATOM 10311 C CA  . PRO B 2 258  ? 222.817 11.219  -68.048 1.00 101.55 ? 316  PRO B CA  1 
ATOM 10312 C C   . PRO B 2 258  ? 222.594 9.741   -68.279 1.00 102.89 ? 316  PRO B C   1 
ATOM 10313 O O   . PRO B 2 258  ? 222.582 8.953   -67.331 1.00 104.32 ? 316  PRO B O   1 
ATOM 10314 C CB  . PRO B 2 258  ? 223.751 11.796  -69.072 1.00 100.25 ? 316  PRO B CB  1 
ATOM 10315 C CG  . PRO B 2 258  ? 225.064 11.267  -68.536 1.00 99.89  ? 316  PRO B CG  1 
ATOM 10316 C CD  . PRO B 2 258  ? 224.988 11.377  -67.041 1.00 99.56  ? 316  PRO B CD  1 
ATOM 10317 N N   . GLY B 2 259  ? 222.421 9.385   -69.553 1.00 103.43 ? 317  GLY B N   1 
ATOM 10318 C CA  . GLY B 2 259  ? 222.222 7.996   -69.941 1.00 102.58 ? 317  GLY B CA  1 
ATOM 10319 C C   . GLY B 2 259  ? 220.845 7.401   -69.703 1.00 102.81 ? 317  GLY B C   1 
ATOM 10320 O O   . GLY B 2 259  ? 219.916 7.657   -70.470 1.00 102.48 ? 317  GLY B O   1 
ATOM 10321 N N   . ASN B 2 260  ? 220.731 6.588   -68.651 1.00 103.53 ? 318  ASN B N   1 
ATOM 10322 C CA  . ASN B 2 260  ? 219.476 5.936   -68.269 1.00 104.37 ? 318  ASN B CA  1 
ATOM 10323 C C   . ASN B 2 260  ? 218.840 6.763   -67.148 1.00 104.66 ? 318  ASN B C   1 
ATOM 10324 O O   . ASN B 2 260  ? 218.829 6.339   -65.994 1.00 104.39 ? 318  ASN B O   1 
ATOM 10325 C CB  . ASN B 2 260  ? 219.755 4.516   -67.756 1.00 104.27 ? 318  ASN B CB  1 
ATOM 10326 C CG  . ASN B 2 260  ? 218.737 3.491   -68.252 1.00 104.27 ? 318  ASN B CG  1 
ATOM 10327 O OD1 . ASN B 2 260  ? 218.694 2.358   -67.763 1.00 103.73 ? 318  ASN B OD1 1 
ATOM 10328 N ND2 . ASN B 2 260  ? 217.928 3.877   -69.234 1.00 104.42 ? 318  ASN B ND2 1 
ATOM 10329 N N   . VAL B 2 261  ? 218.307 7.934   -67.500 1.00 105.56 ? 319  VAL B N   1 
ATOM 10330 C CA  . VAL B 2 261  ? 217.690 8.852   -66.535 1.00 107.16 ? 319  VAL B CA  1 
ATOM 10331 C C   . VAL B 2 261  ? 216.770 8.196   -65.509 1.00 108.79 ? 319  VAL B C   1 
ATOM 10332 O O   . VAL B 2 261  ? 216.663 8.662   -64.372 1.00 108.83 ? 319  VAL B O   1 
ATOM 10333 C CB  . VAL B 2 261  ? 216.890 9.980   -67.246 1.00 106.46 ? 319  VAL B CB  1 
ATOM 10334 C CG1 . VAL B 2 261  ? 215.786 9.391   -68.092 1.00 106.40 ? 319  VAL B CG1 1 
ATOM 10335 C CG2 . VAL B 2 261  ? 216.294 10.922  -66.217 1.00 105.98 ? 319  VAL B CG2 1 
ATOM 10336 N N   . SER B 2 262  ? 216.100 7.121   -65.907 1.00 110.53 ? 320  SER B N   1 
ATOM 10337 C CA  . SER B 2 262  ? 215.194 6.427   -65.002 1.00 112.02 ? 320  SER B CA  1 
ATOM 10338 C C   . SER B 2 262  ? 215.907 5.904   -63.749 1.00 112.75 ? 320  SER B C   1 
ATOM 10339 O O   . SER B 2 262  ? 215.254 5.433   -62.822 1.00 113.04 ? 320  SER B O   1 
ATOM 10340 C CB  . SER B 2 262  ? 214.504 5.261   -65.725 1.00 112.14 ? 320  SER B CB  1 
ATOM 10341 O OG  . SER B 2 262  ? 213.639 5.707   -66.760 1.00 111.32 ? 320  SER B OG  1 
ATOM 10342 N N   . LYS B 2 263  ? 217.237 5.986   -63.713 1.00 113.14 ? 321  LYS B N   1 
ATOM 10343 C CA  . LYS B 2 263  ? 217.996 5.502   -62.555 1.00 113.02 ? 321  LYS B CA  1 
ATOM 10344 C C   . LYS B 2 263  ? 217.962 6.511   -61.404 1.00 112.56 ? 321  LYS B C   1 
ATOM 10345 O O   . LYS B 2 263  ? 218.086 6.149   -60.232 1.00 112.16 ? 321  LYS B O   1 
ATOM 10346 C CB  . LYS B 2 263  ? 219.445 5.217   -62.961 1.00 113.36 ? 321  LYS B CB  1 
ATOM 10347 C CG  . LYS B 2 263  ? 220.197 6.444   -63.471 1.00 113.56 ? 321  LYS B CG  1 
ATOM 10348 C CD  . LYS B 2 263  ? 221.559 6.083   -64.054 1.00 113.53 ? 321  LYS B CD  1 
ATOM 10349 C CE  . LYS B 2 263  ? 222.318 7.321   -64.518 1.00 113.73 ? 321  LYS B CE  1 
ATOM 10350 N NZ  . LYS B 2 263  ? 222.710 8.200   -63.382 1.00 114.33 ? 321  LYS B NZ  1 
ATOM 10351 N N   . LEU B 2 264  ? 217.792 7.779   -61.760 1.00 111.95 ? 322  LEU B N   1 
ATOM 10352 C CA  . LEU B 2 264  ? 217.729 8.868   -60.800 1.00 111.79 ? 322  LEU B CA  1 
ATOM 10353 C C   . LEU B 2 264  ? 216.300 9.085   -60.476 1.00 112.03 ? 322  LEU B C   1 
ATOM 10354 O O   . LEU B 2 264  ? 215.578 8.202   -60.028 1.00 112.53 ? 322  LEU B O   1 
ATOM 10355 C CB  . LEU B 2 264  ? 218.217 10.157  -61.432 1.00 110.75 ? 322  LEU B CB  1 
ATOM 10356 C CG  . LEU B 2 264  ? 219.714 10.288  -61.554 1.00 110.27 ? 322  LEU B CG  1 
ATOM 10357 C CD1 . LEU B 2 264  ? 220.064 11.277  -62.640 1.00 110.49 ? 322  LEU B CD1 1 
ATOM 10358 C CD2 . LEU B 2 264  ? 220.250 10.706  -60.208 1.00 109.80 ? 322  LEU B CD2 1 
ATOM 10359 N N   . HIS B 2 265  ? 215.919 10.322  -60.709 1.00 112.24 ? 323  HIS B N   1 
ATOM 10360 C CA  . HIS B 2 265  ? 214.573 10.715  -60.529 1.00 112.81 ? 323  HIS B CA  1 
ATOM 10361 C C   . HIS B 2 265  ? 213.968 10.230  -59.230 1.00 113.57 ? 323  HIS B C   1 
ATOM 10362 O O   . HIS B 2 265  ? 214.504 9.355   -58.543 1.00 112.88 ? 323  HIS B O   1 
ATOM 10363 C CB  . HIS B 2 265  ? 213.789 10.215  -61.732 1.00 112.83 ? 323  HIS B CB  1 
ATOM 10364 C CG  . HIS B 2 265  ? 213.451 8.769   -61.686 1.00 113.62 ? 323  HIS B CG  1 
ATOM 10365 N ND1 . HIS B 2 265  ? 212.527 8.244   -60.809 1.00 113.75 ? 323  HIS B ND1 1 
ATOM 10366 C CD2 . HIS B 2 265  ? 213.902 7.734   -62.424 1.00 113.71 ? 323  HIS B CD2 1 
ATOM 10367 C CE1 . HIS B 2 265  ? 212.424 6.944   -61.012 1.00 114.25 ? 323  HIS B CE1 1 
ATOM 10368 N NE2 . HIS B 2 265  ? 213.248 6.609   -61.987 1.00 114.25 ? 323  HIS B NE2 1 
ATOM 10369 N N   . GLY B 2 266  ? 212.836 10.834  -58.907 1.00 114.72 ? 324  GLY B N   1 
ATOM 10370 C CA  . GLY B 2 266  ? 212.119 10.507  -57.702 1.00 116.31 ? 324  GLY B CA  1 
ATOM 10371 C C   . GLY B 2 266  ? 210.666 10.088  -57.831 1.00 117.38 ? 324  GLY B C   1 
ATOM 10372 O O   . GLY B 2 266  ? 210.338 9.225   -58.649 1.00 117.79 ? 324  GLY B O   1 
ATOM 10373 N N   . ARG B 2 267  ? 209.800 10.694  -57.012 1.00 118.24 ? 325  ARG B N   1 
ATOM 10374 C CA  . ARG B 2 267  ? 208.371 10.379  -57.014 1.00 118.48 ? 325  ARG B CA  1 
ATOM 10375 C C   . ARG B 2 267  ? 207.429 11.454  -56.506 1.00 118.43 ? 325  ARG B C   1 
ATOM 10376 O O   . ARG B 2 267  ? 207.771 12.280  -55.665 1.00 118.26 ? 325  ARG B O   1 
ATOM 10377 C CB  . ARG B 2 267  ? 208.093 9.126   -56.192 1.00 118.79 ? 325  ARG B CB  1 
ATOM 10378 C CG  . ARG B 2 267  ? 208.679 9.167   -54.806 1.00 119.55 ? 325  ARG B CG  1 
ATOM 10379 C CD  . ARG B 2 267  ? 210.106 8.695   -54.888 1.00 120.50 ? 325  ARG B CD  1 
ATOM 10380 N NE  . ARG B 2 267  ? 211.096 9.763   -55.049 1.00 121.54 ? 325  ARG B NE  1 
ATOM 10381 C CZ  . ARG B 2 267  ? 212.403 9.581   -55.268 1.00 122.61 ? 325  ARG B CZ  1 
ATOM 10382 N NH1 . ARG B 2 267  ? 212.926 8.369   -55.366 1.00 123.40 ? 325  ARG B NH1 1 
ATOM 10383 N NH2 . ARG B 2 267  ? 213.208 10.627  -55.400 1.00 123.15 ? 325  ARG B NH2 1 
ATOM 10384 N N   . ASP B 2 268  ? 206.214 11.385  -57.025 1.00 118.72 ? 326  ASP B N   1 
ATOM 10385 C CA  . ASP B 2 268  ? 205.138 12.284  -56.670 1.00 119.15 ? 326  ASP B CA  1 
ATOM 10386 C C   . ASP B 2 268  ? 204.564 11.654  -55.406 1.00 118.99 ? 326  ASP B C   1 
ATOM 10387 O O   . ASP B 2 268  ? 204.336 12.315  -54.388 1.00 118.63 ? 326  ASP B O   1 
ATOM 10388 C CB  . ASP B 2 268  ? 204.111 12.271  -57.809 1.00 119.42 ? 326  ASP B CB  1 
ATOM 10389 C CG  . ASP B 2 268  ? 202.925 13.180  -57.559 1.00 119.90 ? 326  ASP B CG  1 
ATOM 10390 O OD1 . ASP B 2 268  ? 202.777 13.675  -56.426 1.00 119.02 ? 326  ASP B OD1 1 
ATOM 10391 O OD2 . ASP B 2 268  ? 202.130 13.389  -58.504 1.00 121.05 ? 326  ASP B OD2 1 
ATOM 10392 N N   . GLY B 2 269  ? 204.362 10.348  -55.486 1.00 118.77 ? 327  GLY B N   1 
ATOM 10393 C CA  . GLY B 2 269  ? 203.821 9.605   -54.371 1.00 118.75 ? 327  GLY B CA  1 
ATOM 10394 C C   . GLY B 2 269  ? 203.576 8.168   -54.786 1.00 119.18 ? 327  GLY B C   1 
ATOM 10395 O O   . GLY B 2 269  ? 203.554 7.269   -53.949 1.00 119.07 ? 327  GLY B O   1 
ATOM 10396 N N   . ARG B 2 270  ? 203.386 7.957   -56.086 1.00 119.65 ? 328  ARG B N   1 
ATOM 10397 C CA  . ARG B 2 270  ? 203.144 6.625   -56.645 1.00 119.67 ? 328  ARG B CA  1 
ATOM 10398 C C   . ARG B 2 270  ? 203.895 6.536   -57.962 1.00 119.63 ? 328  ARG B C   1 
ATOM 10399 O O   . ARG B 2 270  ? 204.156 5.445   -58.469 1.00 119.82 ? 328  ARG B O   1 
ATOM 10400 C CB  . ARG B 2 270  ? 201.650 6.411   -56.943 1.00 119.74 ? 328  ARG B CB  1 
ATOM 10401 C CG  . ARG B 2 270  ? 200.705 6.592   -55.761 1.00 119.29 ? 328  ARG B CG  1 
ATOM 10402 C CD  . ARG B 2 270  ? 199.230 6.566   -56.197 1.00 118.80 ? 328  ARG B CD  1 
ATOM 10403 N NE  . ARG B 2 270  ? 198.846 5.309   -56.838 1.00 117.79 ? 328  ARG B NE  1 
ATOM 10404 C CZ  . ARG B 2 270  ? 197.637 5.050   -57.333 1.00 116.89 ? 328  ARG B CZ  1 
ATOM 10405 N NH1 . ARG B 2 270  ? 196.674 5.959   -57.269 1.00 117.30 ? 328  ARG B NH1 1 
ATOM 10406 N NH2 . ARG B 2 270  ? 197.388 3.874   -57.893 1.00 116.00 ? 328  ARG B NH2 1 
ATOM 10407 N N   . LYS B 2 271  ? 204.249 7.693   -58.510 1.00 119.03 ? 329  LYS B N   1 
ATOM 10408 C CA  . LYS B 2 271  ? 204.919 7.722   -59.793 1.00 118.59 ? 329  LYS B CA  1 
ATOM 10409 C C   . LYS B 2 271  ? 206.351 8.199   -59.860 1.00 118.28 ? 329  LYS B C   1 
ATOM 10410 O O   . LYS B 2 271  ? 206.689 9.276   -59.378 1.00 118.27 ? 329  LYS B O   1 
ATOM 10411 C CB  . LYS B 2 271  ? 204.084 8.533   -60.770 1.00 118.46 ? 329  LYS B CB  1 
ATOM 10412 C CG  . LYS B 2 271  ? 202.753 7.892   -61.054 1.00 118.71 ? 329  LYS B CG  1 
ATOM 10413 C CD  . LYS B 2 271  ? 201.968 8.679   -62.071 1.00 118.47 ? 329  LYS B CD  1 
ATOM 10414 C CE  . LYS B 2 271  ? 200.641 7.997   -62.352 1.00 118.13 ? 329  LYS B CE  1 
ATOM 10415 N NZ  . LYS B 2 271  ? 199.857 8.738   -63.375 1.00 117.80 ? 329  LYS B NZ  1 
ATOM 10416 N N   . ASN B 2 272  ? 207.175 7.370   -60.494 1.00 117.84 ? 330  ASN B N   1 
ATOM 10417 C CA  . ASN B 2 272  ? 208.596 7.629   -60.719 1.00 118.12 ? 330  ASN B CA  1 
ATOM 10418 C C   . ASN B 2 272  ? 208.716 8.910   -61.547 1.00 118.59 ? 330  ASN B C   1 
ATOM 10419 O O   . ASN B 2 272  ? 207.946 9.112   -62.491 1.00 119.48 ? 330  ASN B O   1 
ATOM 10420 C CB  . ASN B 2 272  ? 209.193 6.486   -61.528 1.00 118.04 ? 330  ASN B CB  1 
ATOM 10421 C CG  . ASN B 2 272  ? 208.541 6.364   -62.887 1.00 118.20 ? 330  ASN B CG  1 
ATOM 10422 O OD1 . ASN B 2 272  ? 207.356 6.053   -62.990 1.00 117.81 ? 330  ASN B OD1 1 
ATOM 10423 N ND2 . ASN B 2 272  ? 209.301 6.641   -63.938 1.00 118.30 ? 330  ASN B ND2 1 
ATOM 10424 N N   . VAL B 2 273  ? 209.680 9.762   -61.208 1.00 118.55 ? 331  VAL B N   1 
ATOM 10425 C CA  . VAL B 2 273  ? 209.895 11.022  -61.926 1.00 118.29 ? 331  VAL B CA  1 
ATOM 10426 C C   . VAL B 2 273  ? 211.270 11.484  -61.537 1.00 118.84 ? 331  VAL B C   1 
ATOM 10427 O O   . VAL B 2 273  ? 211.757 11.073  -60.512 1.00 119.47 ? 331  VAL B O   1 
ATOM 10428 C CB  . VAL B 2 273  ? 208.938 12.153  -61.457 1.00 118.11 ? 331  VAL B CB  1 
ATOM 10429 C CG1 . VAL B 2 273  ? 207.677 11.577  -60.862 1.00 117.62 ? 331  VAL B CG1 1 
ATOM 10430 C CG2 . VAL B 2 273  ? 209.639 13.043  -60.434 1.00 118.05 ? 331  VAL B CG2 1 
ATOM 10431 N N   . VAL B 2 274  ? 211.901 12.331  -62.338 1.00 119.23 ? 332  VAL B N   1 
ATOM 10432 C CA  . VAL B 2 274  ? 213.195 12.854  -61.941 1.00 119.31 ? 332  VAL B CA  1 
ATOM 10433 C C   . VAL B 2 274  ? 212.901 14.191  -61.327 1.00 118.77 ? 332  VAL B C   1 
ATOM 10434 O O   . VAL B 2 274  ? 212.380 15.076  -61.982 1.00 118.34 ? 332  VAL B O   1 
ATOM 10435 C CB  . VAL B 2 274  ? 214.168 12.984  -63.117 1.00 119.94 ? 332  VAL B CB  1 
ATOM 10436 C CG1 . VAL B 2 274  ? 213.469 13.582  -64.311 1.00 121.09 ? 332  VAL B CG1 1 
ATOM 10437 C CG2 . VAL B 2 274  ? 215.366 13.811  -62.688 1.00 119.37 ? 332  VAL B CG2 1 
ATOM 10438 N N   . PRO B 2 275  ? 213.212 14.348  -60.043 1.00 118.08 ? 333  PRO B N   1 
ATOM 10439 C CA  . PRO B 2 275  ? 212.951 15.607  -59.361 1.00 117.83 ? 333  PRO B CA  1 
ATOM 10440 C C   . PRO B 2 275  ? 213.708 16.778  -59.943 1.00 118.03 ? 333  PRO B C   1 
ATOM 10441 O O   . PRO B 2 275  ? 214.483 16.627  -60.886 1.00 118.21 ? 333  PRO B O   1 
ATOM 10442 C CB  . PRO B 2 275  ? 213.366 15.304  -57.933 1.00 118.00 ? 333  PRO B CB  1 
ATOM 10443 C CG  . PRO B 2 275  ? 214.530 14.423  -58.136 1.00 118.52 ? 333  PRO B CG  1 
ATOM 10444 C CD  . PRO B 2 275  ? 214.027 13.470  -59.194 1.00 118.11 ? 333  PRO B CD  1 
ATOM 10445 N N   . CYS B 2 276  ? 213.462 17.948  -59.360 1.00 118.28 ? 334  CYS B N   1 
ATOM 10446 C CA  . CYS B 2 276  ? 214.095 19.192  -59.776 1.00 118.13 ? 334  CYS B CA  1 
ATOM 10447 C C   . CYS B 2 276  ? 215.360 19.421  -58.944 1.00 117.98 ? 334  CYS B C   1 
ATOM 10448 O O   . CYS B 2 276  ? 215.617 18.707  -57.967 1.00 117.79 ? 334  CYS B O   1 
ATOM 10449 C CB  . CYS B 2 276  ? 213.132 20.386  -59.582 1.00 118.01 ? 334  CYS B CB  1 
ATOM 10450 S SG  . CYS B 2 276  ? 211.652 20.470  -60.656 1.00 118.53 ? 334  CYS B SG  1 
ATOM 10451 N N   . VAL B 2 277  ? 216.135 20.429  -59.343 1.00 117.42 ? 335  VAL B N   1 
ATOM 10452 C CA  . VAL B 2 277  ? 217.382 20.800  -58.669 1.00 116.71 ? 335  VAL B CA  1 
ATOM 10453 C C   . VAL B 2 277  ? 217.268 22.169  -57.967 1.00 116.44 ? 335  VAL B C   1 
ATOM 10454 O O   . VAL B 2 277  ? 216.648 23.091  -58.502 1.00 116.20 ? 335  VAL B O   1 
ATOM 10455 C CB  . VAL B 2 277  ? 218.545 20.880  -59.682 1.00 116.36 ? 335  VAL B CB  1 
ATOM 10456 C CG1 . VAL B 2 277  ? 219.849 21.111  -58.940 1.00 116.26 ? 335  VAL B CG1 1 
ATOM 10457 C CG2 . VAL B 2 277  ? 218.598 19.612  -60.534 1.00 115.27 ? 335  VAL B CG2 1 
ATOM 10458 N N   . LEU B 2 278  ? 217.876 22.303  -56.786 1.00 115.93 ? 336  LEU B N   1 
ATOM 10459 C CA  . LEU B 2 278  ? 217.820 23.559  -56.033 1.00 115.85 ? 336  LEU B CA  1 
ATOM 10460 C C   . LEU B 2 278  ? 219.126 23.981  -55.381 1.00 115.56 ? 336  LEU B C   1 
ATOM 10461 O O   . LEU B 2 278  ? 220.036 23.179  -55.200 1.00 115.28 ? 336  LEU B O   1 
ATOM 10462 C CB  . LEU B 2 278  ? 216.724 23.494  -54.961 1.00 116.86 ? 336  LEU B CB  1 
ATOM 10463 C CG  . LEU B 2 278  ? 216.726 24.577  -53.872 1.00 117.69 ? 336  LEU B CG  1 
ATOM 10464 C CD1 . LEU B 2 278  ? 215.325 24.777  -53.327 1.00 118.02 ? 336  LEU B CD1 1 
ATOM 10465 C CD2 . LEU B 2 278  ? 217.689 24.182  -52.765 1.00 117.75 ? 336  LEU B CD2 1 
ATOM 10466 N N   . SER B 2 279  ? 219.186 25.255  -55.011 1.00 115.26 ? 337  SER B N   1 
ATOM 10467 C CA  . SER B 2 279  ? 220.362 25.838  -54.385 1.00 114.64 ? 337  SER B CA  1 
ATOM 10468 C C   . SER B 2 279  ? 220.009 26.786  -53.245 1.00 113.60 ? 337  SER B C   1 
ATOM 10469 O O   . SER B 2 279  ? 219.270 27.752  -53.437 1.00 113.36 ? 337  SER B O   1 
ATOM 10470 C CB  . SER B 2 279  ? 221.168 26.609  -55.427 1.00 115.44 ? 337  SER B CB  1 
ATOM 10471 O OG  . SER B 2 279  ? 222.270 27.267  -54.831 1.00 115.25 ? 337  SER B OG  1 
ATOM 10472 N N   . VAL B 2 280  ? 220.543 26.510  -52.060 1.00 112.38 ? 338  VAL B N   1 
ATOM 10473 C CA  . VAL B 2 280  ? 220.300 27.364  -50.909 1.00 111.09 ? 338  VAL B CA  1 
ATOM 10474 C C   . VAL B 2 280  ? 221.608 27.704  -50.255 1.00 110.47 ? 338  VAL B C   1 
ATOM 10475 O O   . VAL B 2 280  ? 221.906 27.279  -49.135 1.00 109.72 ? 338  VAL B O   1 
ATOM 10476 C CB  . VAL B 2 280  ? 219.397 26.704  -49.883 1.00 111.05 ? 338  VAL B CB  1 
ATOM 10477 C CG1 . VAL B 2 280  ? 219.174 27.650  -48.715 1.00 110.95 ? 338  VAL B CG1 1 
ATOM 10478 C CG2 . VAL B 2 280  ? 218.075 26.357  -50.525 1.00 111.31 ? 338  VAL B CG2 1 
ATOM 10479 N N   . ASN B 2 281  ? 222.393 28.467  -51.003 1.00 110.73 ? 339  ASN B N   1 
ATOM 10480 C CA  . ASN B 2 281  ? 223.690 28.923  -50.558 1.00 111.14 ? 339  ASN B CA  1 
ATOM 10481 C C   . ASN B 2 281  ? 223.886 30.431  -50.785 1.00 111.78 ? 339  ASN B C   1 
ATOM 10482 O O   . ASN B 2 281  ? 223.274 31.058  -51.663 1.00 112.23 ? 339  ASN B O   1 
ATOM 10483 C CB  . ASN B 2 281  ? 224.809 28.137  -51.256 1.00 110.43 ? 339  ASN B CB  1 
ATOM 10484 C CG  . ASN B 2 281  ? 224.720 26.630  -51.020 1.00 109.46 ? 339  ASN B CG  1 
ATOM 10485 O OD1 . ASN B 2 281  ? 225.487 25.859  -51.605 1.00 108.40 ? 339  ASN B OD1 1 
ATOM 10486 N ND2 . ASN B 2 281  ? 223.789 26.206  -50.171 1.00 109.05 ? 339  ASN B ND2 1 
ATOM 10487 N N   . GLY B 2 282  ? 224.749 30.958  -49.927 1.00 112.26 ? 340  GLY B N   1 
ATOM 10488 C CA  . GLY B 2 282  ? 225.169 32.340  -49.850 1.00 113.47 ? 340  GLY B CA  1 
ATOM 10489 C C   . GLY B 2 282  ? 226.228 31.922  -48.868 1.00 114.48 ? 340  GLY B C   1 
ATOM 10490 O O   . GLY B 2 282  ? 226.025 30.913  -48.194 1.00 114.81 ? 340  GLY B O   1 
ATOM 10491 N N   . ASP B 2 283  ? 227.328 32.629  -48.714 1.00 115.17 ? 341  ASP B N   1 
ATOM 10492 C CA  . ASP B 2 283  ? 228.269 32.049  -47.788 1.00 116.00 ? 341  ASP B CA  1 
ATOM 10493 C C   . ASP B 2 283  ? 228.445 32.613  -46.424 1.00 116.35 ? 341  ASP B C   1 
ATOM 10494 O O   . ASP B 2 283  ? 228.623 33.798  -46.242 1.00 116.54 ? 341  ASP B O   1 
ATOM 10495 C CB  . ASP B 2 283  ? 229.608 31.912  -48.452 1.00 116.26 ? 341  ASP B CB  1 
ATOM 10496 C CG  . ASP B 2 283  ? 230.115 33.200  -48.979 1.00 117.03 ? 341  ASP B CG  1 
ATOM 10497 O OD1 . ASP B 2 283  ? 229.422 34.227  -48.844 1.00 118.37 ? 341  ASP B OD1 1 
ATOM 10498 O OD2 . ASP B 2 283  ? 231.223 33.193  -49.533 1.00 116.60 ? 341  ASP B OD2 1 
ATOM 10499 N N   . LEU B 2 284  ? 228.424 31.696  -45.471 1.00 116.98 ? 342  LEU B N   1 
ATOM 10500 C CA  . LEU B 2 284  ? 228.554 32.001  -44.060 1.00 117.42 ? 342  LEU B CA  1 
ATOM 10501 C C   . LEU B 2 284  ? 229.767 32.801  -43.623 1.00 117.29 ? 342  LEU B C   1 
ATOM 10502 O O   . LEU B 2 284  ? 229.632 33.728  -42.818 1.00 116.88 ? 342  LEU B O   1 
ATOM 10503 C CB  . LEU B 2 284  ? 228.554 30.717  -43.238 1.00 117.77 ? 342  LEU B CB  1 
ATOM 10504 C CG  . LEU B 2 284  ? 228.477 30.973  -41.731 1.00 118.11 ? 342  LEU B CG  1 
ATOM 10505 C CD1 . LEU B 2 284  ? 229.813 31.451  -41.098 1.00 118.10 ? 342  LEU B CD1 1 
ATOM 10506 C CD2 . LEU B 2 284  ? 227.389 32.007  -41.576 1.00 117.72 ? 342  LEU B CD2 1 
ATOM 10507 N N   . ASP B 2 285  ? 230.947 32.416  -44.099 1.00 117.19 ? 343  ASP B N   1 
ATOM 10508 C CA  . ASP B 2 285  ? 232.173 33.093  -43.704 1.00 117.43 ? 343  ASP B CA  1 
ATOM 10509 C C   . ASP B 2 285  ? 231.962 34.530  -43.218 1.00 117.79 ? 343  ASP B C   1 
ATOM 10510 O O   . ASP B 2 285  ? 232.528 34.940  -42.202 1.00 117.44 ? 343  ASP B O   1 
ATOM 10511 C CB  . ASP B 2 285  ? 233.191 33.059  -44.850 1.00 117.46 ? 343  ASP B CB  1 
ATOM 10512 C CG  . ASP B 2 285  ? 234.458 33.800  -44.498 1.00 117.27 ? 343  ASP B CG  1 
ATOM 10513 O OD1 . ASP B 2 285  ? 234.601 34.120  -43.302 1.00 117.73 ? 343  ASP B OD1 1 
ATOM 10514 O OD2 . ASP B 2 285  ? 235.301 34.068  -45.384 1.00 116.86 ? 343  ASP B OD2 1 
ATOM 10515 N N   . ARG B 2 286  ? 231.129 35.274  -43.938 1.00 118.68 ? 344  ARG B N   1 
ATOM 10516 C CA  . ARG B 2 286  ? 230.823 36.668  -43.634 1.00 119.76 ? 344  ARG B CA  1 
ATOM 10517 C C   . ARG B 2 286  ? 229.408 36.823  -43.090 1.00 120.16 ? 344  ARG B C   1 
ATOM 10518 O O   . ARG B 2 286  ? 228.982 37.919  -42.722 1.00 120.48 ? 344  ARG B O   1 
ATOM 10519 C CB  . ARG B 2 286  ? 231.001 37.522  -44.898 1.00 119.87 ? 344  ARG B CB  1 
ATOM 10520 C CG  . ARG B 2 286  ? 230.306 36.991  -46.162 1.00 119.36 ? 344  ARG B CG  1 
ATOM 10521 C CD  . ARG B 2 286  ? 230.697 35.551  -46.536 1.00 118.80 ? 344  ARG B CD  1 
ATOM 10522 N NE  . ARG B 2 286  ? 232.129 35.262  -46.413 1.00 119.22 ? 344  ARG B NE  1 
ATOM 10523 C CZ  . ARG B 2 286  ? 233.083 35.809  -47.160 1.00 118.43 ? 344  ARG B CZ  1 
ATOM 10524 N NH1 . ARG B 2 286  ? 232.763 36.684  -48.098 1.00 118.21 ? 344  ARG B NH1 1 
ATOM 10525 N NH2 . ARG B 2 286  ? 234.358 35.488  -46.973 1.00 117.89 ? 344  ARG B NH2 1 
ATOM 10526 N N   . GLY B 2 287  ? 228.684 35.710  -43.048 1.00 120.22 ? 345  GLY B N   1 
ATOM 10527 C CA  . GLY B 2 287  ? 227.328 35.711  -42.535 1.00 119.82 ? 345  GLY B CA  1 
ATOM 10528 C C   . GLY B 2 287  ? 227.313 36.250  -41.123 1.00 119.34 ? 345  GLY B C   1 
ATOM 10529 O O   . GLY B 2 287  ? 226.273 36.650  -40.611 1.00 118.49 ? 345  GLY B O   1 
ATOM 10530 N N   . MET B 2 288  ? 228.478 36.249  -40.488 1.00 118.59 ? 346  MET B N   1 
ATOM 10531 C CA  . MET B 2 288  ? 228.614 36.763  -39.134 1.00 118.13 ? 346  MET B CA  1 
ATOM 10532 C C   . MET B 2 288  ? 229.032 38.224  -39.237 1.00 117.39 ? 346  MET B C   1 
ATOM 10533 O O   . MET B 2 288  ? 228.713 39.051  -38.378 1.00 117.07 ? 346  MET B O   1 
ATOM 10534 C CB  . MET B 2 288  ? 229.655 35.939  -38.374 1.00 119.11 ? 346  MET B CB  1 
ATOM 10535 C CG  . MET B 2 288  ? 230.741 35.335  -39.254 1.00 119.66 ? 346  MET B CG  1 
ATOM 10536 S SD  . MET B 2 288  ? 231.470 33.830  -38.546 1.00 120.27 ? 346  MET B SD  1 
ATOM 10537 C CE  . MET B 2 288  ? 232.728 34.498  -37.477 1.00 120.06 ? 346  MET B CE  1 
ATOM 10538 N N   . LEU B 2 289  ? 229.735 38.524  -40.322 1.00 117.14 ? 347  LEU B N   1 
ATOM 10539 C CA  . LEU B 2 289  ? 230.207 39.867  -40.609 1.00 117.22 ? 347  LEU B CA  1 
ATOM 10540 C C   . LEU B 2 289  ? 229.003 40.812  -40.507 1.00 117.07 ? 347  LEU B C   1 
ATOM 10541 O O   . LEU B 2 289  ? 229.071 41.873  -39.881 1.00 116.58 ? 347  LEU B O   1 
ATOM 10542 C CB  . LEU B 2 289  ? 230.797 39.890  -42.027 1.00 117.16 ? 347  LEU B CB  1 
ATOM 10543 C CG  . LEU B 2 289  ? 231.978 40.804  -42.345 1.00 117.42 ? 347  LEU B CG  1 
ATOM 10544 C CD1 . LEU B 2 289  ? 231.584 42.227  -42.026 1.00 117.43 ? 347  LEU B CD1 1 
ATOM 10545 C CD2 . LEU B 2 289  ? 233.205 40.391  -41.541 1.00 117.81 ? 347  LEU B CD2 1 
ATOM 10546 N N   . ALA B 2 290  ? 227.897 40.404  -41.121 1.00 116.72 ? 348  ALA B N   1 
ATOM 10547 C CA  . ALA B 2 290  ? 226.670 41.190  -41.111 1.00 116.32 ? 348  ALA B CA  1 
ATOM 10548 C C   . ALA B 2 290  ? 226.120 41.303  -39.698 1.00 116.41 ? 348  ALA B C   1 
ATOM 10549 O O   . ALA B 2 290  ? 226.099 42.384  -39.118 1.00 115.80 ? 348  ALA B O   1 
ATOM 10550 C CB  . ALA B 2 290  ? 225.647 40.547  -42.013 1.00 115.94 ? 348  ALA B CB  1 
ATOM 10551 N N   . TYR B 2 291  ? 225.669 40.177  -39.159 1.00 117.33 ? 349  TYR B N   1 
ATOM 10552 C CA  . TYR B 2 291  ? 225.135 40.117  -37.805 1.00 118.12 ? 349  TYR B CA  1 
ATOM 10553 C C   . TYR B 2 291  ? 226.038 40.956  -36.908 1.00 117.60 ? 349  TYR B C   1 
ATOM 10554 O O   . TYR B 2 291  ? 225.641 41.429  -35.847 1.00 116.32 ? 349  TYR B O   1 
ATOM 10555 C CB  . TYR B 2 291  ? 225.138 38.664  -37.329 1.00 119.85 ? 349  TYR B CB  1 
ATOM 10556 C CG  . TYR B 2 291  ? 223.783 38.122  -36.928 1.00 121.41 ? 349  TYR B CG  1 
ATOM 10557 C CD1 . TYR B 2 291  ? 223.084 38.679  -35.865 1.00 122.40 ? 349  TYR B CD1 1 
ATOM 10558 C CD2 . TYR B 2 291  ? 223.198 37.045  -37.609 1.00 121.77 ? 349  TYR B CD2 1 
ATOM 10559 C CE1 . TYR B 2 291  ? 221.837 38.187  -35.484 1.00 122.58 ? 349  TYR B CE1 1 
ATOM 10560 C CE2 . TYR B 2 291  ? 221.942 36.542  -37.233 1.00 121.81 ? 349  TYR B CE2 1 
ATOM 10561 C CZ  . TYR B 2 291  ? 221.271 37.127  -36.169 1.00 122.04 ? 349  TYR B CZ  1 
ATOM 10562 O OH  . TYR B 2 291  ? 220.025 36.703  -35.783 1.00 120.57 ? 349  TYR B OH  1 
ATOM 10563 N N   . LEU B 2 292  ? 227.266 41.135  -37.363 1.00 117.81 ? 350  LEU B N   1 
ATOM 10564 C CA  . LEU B 2 292  ? 228.257 41.907  -36.648 1.00 118.56 ? 350  LEU B CA  1 
ATOM 10565 C C   . LEU B 2 292  ? 227.935 43.402  -36.673 1.00 119.63 ? 350  LEU B C   1 
ATOM 10566 O O   . LEU B 2 292  ? 228.617 44.201  -36.038 1.00 119.45 ? 350  LEU B O   1 
ATOM 10567 C CB  . LEU B 2 292  ? 229.627 41.630  -37.277 1.00 117.75 ? 350  LEU B CB  1 
ATOM 10568 C CG  . LEU B 2 292  ? 230.910 42.361  -36.876 1.00 117.49 ? 350  LEU B CG  1 
ATOM 10569 C CD1 . LEU B 2 292  ? 230.911 43.765  -37.463 1.00 116.88 ? 350  LEU B CD1 1 
ATOM 10570 C CD2 . LEU B 2 292  ? 231.047 42.386  -35.366 1.00 117.36 ? 350  LEU B CD2 1 
ATOM 10571 N N   . TYR B 2 293  ? 226.882 43.787  -37.383 1.00 121.23 ? 351  TYR B N   1 
ATOM 10572 C CA  . TYR B 2 293  ? 226.535 45.200  -37.466 1.00 123.01 ? 351  TYR B CA  1 
ATOM 10573 C C   . TYR B 2 293  ? 225.256 45.638  -36.769 1.00 123.16 ? 351  TYR B C   1 
ATOM 10574 O O   . TYR B 2 293  ? 225.162 46.776  -36.310 1.00 123.00 ? 351  TYR B O   1 
ATOM 10575 C CB  . TYR B 2 293  ? 226.513 45.643  -38.929 1.00 124.95 ? 351  TYR B CB  1 
ATOM 10576 C CG  . TYR B 2 293  ? 227.710 46.485  -39.285 1.00 126.87 ? 351  TYR B CG  1 
ATOM 10577 C CD1 . TYR B 2 293  ? 228.999 46.060  -38.966 1.00 127.40 ? 351  TYR B CD1 1 
ATOM 10578 C CD2 . TYR B 2 293  ? 227.555 47.735  -39.889 1.00 127.90 ? 351  TYR B CD2 1 
ATOM 10579 C CE1 . TYR B 2 293  ? 230.107 46.860  -39.230 1.00 128.77 ? 351  TYR B CE1 1 
ATOM 10580 C CE2 . TYR B 2 293  ? 228.654 48.545  -40.160 1.00 129.28 ? 351  TYR B CE2 1 
ATOM 10581 C CZ  . TYR B 2 293  ? 229.928 48.107  -39.826 1.00 129.36 ? 351  TYR B CZ  1 
ATOM 10582 O OH  . TYR B 2 293  ? 231.011 48.934  -40.062 1.00 130.07 ? 351  TYR B OH  1 
ATOM 10583 N N   . ASP B 2 294  ? 224.270 44.751  -36.692 1.00 123.74 ? 352  ASP B N   1 
ATOM 10584 C CA  . ASP B 2 294  ? 223.019 45.084  -36.014 1.00 124.36 ? 352  ASP B CA  1 
ATOM 10585 C C   . ASP B 2 294  ? 223.386 45.501  -34.593 1.00 124.33 ? 352  ASP B C   1 
ATOM 10586 O O   . ASP B 2 294  ? 222.748 46.361  -33.984 1.00 123.78 ? 352  ASP B O   1 
ATOM 10587 C CB  . ASP B 2 294  ? 222.087 43.860  -35.989 1.00 124.97 ? 352  ASP B CB  1 
ATOM 10588 C CG  . ASP B 2 294  ? 221.414 43.652  -34.632 1.00 125.61 ? 352  ASP B CG  1 
ATOM 10589 O OD1 . ASP B 2 294  ? 220.446 44.372  -34.308 1.00 125.10 ? 352  ASP B OD1 1 
ATOM 10590 O OD2 . ASP B 2 294  ? 221.865 42.760  -33.880 1.00 126.62 ? 352  ASP B OD2 1 
ATOM 10591 N N   . SER B 2 295  ? 224.444 44.885  -34.087 1.00 124.13 ? 353  SER B N   1 
ATOM 10592 C CA  . SER B 2 295  ? 224.931 45.148  -32.748 1.00 123.65 ? 353  SER B CA  1 
ATOM 10593 C C   . SER B 2 295  ? 225.045 46.625  -32.427 1.00 124.25 ? 353  SER B C   1 
ATOM 10594 O O   . SER B 2 295  ? 224.148 47.213  -31.834 1.00 124.40 ? 353  SER B O   1 
ATOM 10595 C CB  . SER B 2 295  ? 226.296 44.503  -32.573 1.00 122.69 ? 353  SER B CB  1 
ATOM 10596 O OG  . SER B 2 295  ? 227.168 44.951  -33.595 1.00 121.76 ? 353  SER B OG  1 
ATOM 10597 N N   . PHE B 2 296  ? 226.159 47.216  -32.831 1.00 124.69 ? 354  PHE B N   1 
ATOM 10598 C CA  . PHE B 2 296  ? 226.438 48.617  -32.554 1.00 124.95 ? 354  PHE B CA  1 
ATOM 10599 C C   . PHE B 2 296  ? 225.294 49.608  -32.802 1.00 124.95 ? 354  PHE B C   1 
ATOM 10600 O O   . PHE B 2 296  ? 224.248 49.249  -33.350 1.00 124.97 ? 354  PHE B O   1 
ATOM 10601 C CB  . PHE B 2 296  ? 227.689 49.041  -33.334 1.00 125.09 ? 354  PHE B CB  1 
ATOM 10602 C CG  . PHE B 2 296  ? 228.421 50.209  -32.725 1.00 125.87 ? 354  PHE B CG  1 
ATOM 10603 C CD1 . PHE B 2 296  ? 228.412 50.406  -31.348 1.00 126.31 ? 354  PHE B CD1 1 
ATOM 10604 C CD2 . PHE B 2 296  ? 229.150 51.088  -33.521 1.00 126.13 ? 354  PHE B CD2 1 
ATOM 10605 C CE1 . PHE B 2 296  ? 229.115 51.456  -30.772 1.00 126.78 ? 354  PHE B CE1 1 
ATOM 10606 C CE2 . PHE B 2 296  ? 229.857 52.142  -32.953 1.00 126.55 ? 354  PHE B CE2 1 
ATOM 10607 C CZ  . PHE B 2 296  ? 229.838 52.325  -31.576 1.00 126.88 ? 354  PHE B CZ  1 
ATOM 10608 N N   . GLN B 2 297  ? 225.511 50.853  -32.373 1.00 125.25 ? 355  GLN B N   1 
ATOM 10609 C CA  . GLN B 2 297  ? 224.547 51.939  -32.525 1.00 125.40 ? 355  GLN B CA  1 
ATOM 10610 C C   . GLN B 2 297  ? 224.963 52.816  -33.694 1.00 124.89 ? 355  GLN B C   1 
ATOM 10611 O O   . GLN B 2 297  ? 226.078 53.331  -33.718 1.00 124.41 ? 355  GLN B O   1 
ATOM 10612 C CB  . GLN B 2 297  ? 224.503 52.782  -31.250 1.00 126.04 ? 355  GLN B CB  1 
ATOM 10613 C CG  . GLN B 2 297  ? 223.503 53.942  -31.265 1.00 127.33 ? 355  GLN B CG  1 
ATOM 10614 C CD  . GLN B 2 297  ? 223.885 55.082  -32.206 1.00 128.36 ? 355  GLN B CD  1 
ATOM 10615 O OE1 . GLN B 2 297  ? 225.044 55.234  -32.583 1.00 129.55 ? 355  GLN B OE1 1 
ATOM 10616 N NE2 . GLN B 2 297  ? 222.905 55.901  -32.569 1.00 128.30 ? 355  GLN B NE2 1 
ATOM 10617 N N   . ARG B 2 311  ? 233.146 56.010  -22.716 1.00 138.52 ? 369  ARG B N   1 
ATOM 10618 C CA  . ARG B 2 311  ? 232.133 54.972  -22.860 1.00 138.57 ? 369  ARG B CA  1 
ATOM 10619 C C   . ARG B 2 311  ? 232.243 54.252  -24.205 1.00 138.18 ? 369  ARG B C   1 
ATOM 10620 O O   . ARG B 2 311  ? 232.345 54.888  -25.258 1.00 138.60 ? 369  ARG B O   1 
ATOM 10621 C CB  . ARG B 2 311  ? 230.728 55.573  -22.720 1.00 139.05 ? 369  ARG B CB  1 
ATOM 10622 C CG  . ARG B 2 311  ? 229.588 54.561  -22.853 1.00 140.26 ? 369  ARG B CG  1 
ATOM 10623 C CD  . ARG B 2 311  ? 228.232 55.253  -22.874 1.00 141.89 ? 369  ARG B CD  1 
ATOM 10624 N NE  . ARG B 2 311  ? 227.119 54.317  -23.024 1.00 142.99 ? 369  ARG B NE  1 
ATOM 10625 C CZ  . ARG B 2 311  ? 226.597 53.598  -22.034 1.00 143.19 ? 369  ARG B CZ  1 
ATOM 10626 N NH1 . ARG B 2 311  ? 227.086 53.703  -20.809 1.00 143.10 ? 369  ARG B NH1 1 
ATOM 10627 N NH2 . ARG B 2 311  ? 225.581 52.778  -22.270 1.00 143.52 ? 369  ARG B NH2 1 
ATOM 10628 N N   . LYS B 2 312  ? 232.227 52.921  -24.144 1.00 137.32 ? 370  LYS B N   1 
ATOM 10629 C CA  . LYS B 2 312  ? 232.298 52.046  -25.318 1.00 135.98 ? 370  LYS B CA  1 
ATOM 10630 C C   . LYS B 2 312  ? 231.551 50.781  -24.921 1.00 135.42 ? 370  LYS B C   1 
ATOM 10631 O O   . LYS B 2 312  ? 231.941 50.125  -23.960 1.00 136.05 ? 370  LYS B O   1 
ATOM 10632 C CB  . LYS B 2 312  ? 233.739 51.626  -25.635 1.00 134.89 ? 370  LYS B CB  1 
ATOM 10633 C CG  . LYS B 2 312  ? 234.830 52.535  -25.124 1.00 133.20 ? 370  LYS B CG  1 
ATOM 10634 C CD  . LYS B 2 312  ? 235.096 53.659  -26.084 1.00 132.32 ? 370  LYS B CD  1 
ATOM 10635 C CE  . LYS B 2 312  ? 236.287 54.462  -25.635 1.00 132.02 ? 370  LYS B CE  1 
ATOM 10636 N NZ  . LYS B 2 312  ? 236.547 55.575  -26.578 1.00 131.31 ? 370  LYS B NZ  1 
ATOM 10637 N N   . VAL B 2 313  ? 230.491 50.429  -25.637 1.00 134.08 ? 371  VAL B N   1 
ATOM 10638 C CA  . VAL B 2 313  ? 229.762 49.216  -25.295 1.00 132.64 ? 371  VAL B CA  1 
ATOM 10639 C C   . VAL B 2 313  ? 229.228 48.520  -26.531 1.00 132.34 ? 371  VAL B C   1 
ATOM 10640 O O   . VAL B 2 313  ? 228.762 49.175  -27.458 1.00 132.33 ? 371  VAL B O   1 
ATOM 10641 C CB  . VAL B 2 313  ? 228.598 49.508  -24.313 1.00 131.93 ? 371  VAL B CB  1 
ATOM 10642 C CG1 . VAL B 2 313  ? 227.601 50.458  -24.941 1.00 131.94 ? 371  VAL B CG1 1 
ATOM 10643 C CG2 . VAL B 2 313  ? 227.927 48.214  -23.907 1.00 131.00 ? 371  VAL B CG2 1 
ATOM 10644 N N   . LEU B 2 314  ? 229.314 47.192  -26.542 1.00 131.84 ? 372  LEU B N   1 
ATOM 10645 C CA  . LEU B 2 314  ? 228.843 46.386  -27.668 1.00 131.10 ? 372  LEU B CA  1 
ATOM 10646 C C   . LEU B 2 314  ? 227.885 45.288  -27.224 1.00 129.86 ? 372  LEU B C   1 
ATOM 10647 O O   . LEU B 2 314  ? 228.299 44.299  -26.629 1.00 129.44 ? 372  LEU B O   1 
ATOM 10648 C CB  . LEU B 2 314  ? 230.027 45.751  -28.404 1.00 132.16 ? 372  LEU B CB  1 
ATOM 10649 C CG  . LEU B 2 314  ? 230.945 46.645  -29.257 1.00 132.84 ? 372  LEU B CG  1 
ATOM 10650 C CD1 . LEU B 2 314  ? 231.881 47.475  -28.381 1.00 132.63 ? 372  LEU B CD1 1 
ATOM 10651 C CD2 . LEU B 2 314  ? 231.757 45.759  -30.203 1.00 132.77 ? 372  LEU B CD2 1 
ATOM 10652 N N   . LYS B 2 315  ? 226.605 45.463  -27.527 1.00 128.27 ? 373  LYS B N   1 
ATOM 10653 C CA  . LYS B 2 315  ? 225.596 44.491  -27.139 1.00 126.37 ? 373  LYS B CA  1 
ATOM 10654 C C   . LYS B 2 315  ? 225.471 43.397  -28.185 1.00 124.78 ? 373  LYS B C   1 
ATOM 10655 O O   . LYS B 2 315  ? 225.784 43.612  -29.355 1.00 125.15 ? 373  LYS B O   1 
ATOM 10656 C CB  . LYS B 2 315  ? 224.258 45.203  -26.897 1.00 127.53 ? 373  LYS B CB  1 
ATOM 10657 C CG  . LYS B 2 315  ? 224.344 46.258  -25.778 1.00 128.38 ? 373  LYS B CG  1 
ATOM 10658 C CD  . LYS B 2 315  ? 223.016 46.952  -25.475 1.00 129.30 ? 373  LYS B CD  1 
ATOM 10659 C CE  . LYS B 2 315  ? 223.227 48.136  -24.531 1.00 129.30 ? 373  LYS B CE  1 
ATOM 10660 N NZ  . LYS B 2 315  ? 221.967 48.847  -24.157 1.00 129.66 ? 373  LYS B NZ  1 
ATOM 10661 N N   . LEU B 2 316  ? 225.016 42.223  -27.754 1.00 122.74 ? 374  LEU B N   1 
ATOM 10662 C CA  . LEU B 2 316  ? 224.888 41.074  -28.640 1.00 120.17 ? 374  LEU B CA  1 
ATOM 10663 C C   . LEU B 2 316  ? 223.761 40.084  -28.360 1.00 117.12 ? 374  LEU B C   1 
ATOM 10664 O O   . LEU B 2 316  ? 223.330 39.902  -27.221 1.00 116.06 ? 374  LEU B O   1 
ATOM 10665 C CB  . LEU B 2 316  ? 226.199 40.297  -28.656 1.00 122.37 ? 374  LEU B CB  1 
ATOM 10666 C CG  . LEU B 2 316  ? 227.009 40.375  -29.943 1.00 123.93 ? 374  LEU B CG  1 
ATOM 10667 C CD1 . LEU B 2 316  ? 228.221 39.463  -29.836 1.00 124.30 ? 374  LEU B CD1 1 
ATOM 10668 C CD2 . LEU B 2 316  ? 226.130 39.962  -31.109 1.00 124.78 ? 374  LEU B CD2 1 
ATOM 10669 N N   . HIS B 2 317  ? 223.319 39.426  -29.428 1.00 113.74 ? 375  HIS B N   1 
ATOM 10670 C CA  . HIS B 2 317  ? 222.258 38.438  -29.362 1.00 110.55 ? 375  HIS B CA  1 
ATOM 10671 C C   . HIS B 2 317  ? 222.776 37.282  -28.531 1.00 109.34 ? 375  HIS B C   1 
ATOM 10672 O O   . HIS B 2 317  ? 223.583 36.477  -28.993 1.00 109.18 ? 375  HIS B O   1 
ATOM 10673 C CB  . HIS B 2 317  ? 221.911 37.957  -30.768 1.00 109.39 ? 375  HIS B CB  1 
ATOM 10674 C CG  . HIS B 2 317  ? 220.603 37.234  -30.867 1.00 107.88 ? 375  HIS B CG  1 
ATOM 10675 N ND1 . HIS B 2 317  ? 220.272 36.165  -30.061 1.00 106.87 ? 375  HIS B ND1 1 
ATOM 10676 C CD2 . HIS B 2 317  ? 219.569 37.389  -31.727 1.00 107.40 ? 375  HIS B CD2 1 
ATOM 10677 C CE1 . HIS B 2 317  ? 219.093 35.691  -30.424 1.00 107.05 ? 375  HIS B CE1 1 
ATOM 10678 N NE2 . HIS B 2 317  ? 218.645 36.415  -31.433 1.00 107.20 ? 375  HIS B NE2 1 
ATOM 10679 N N   . PRO B 2 318  ? 222.298 37.180  -27.291 1.00 108.24 ? 376  PRO B N   1 
ATOM 10680 C CA  . PRO B 2 318  ? 222.695 36.132  -26.354 1.00 107.66 ? 376  PRO B CA  1 
ATOM 10681 C C   . PRO B 2 318  ? 223.238 34.848  -26.972 1.00 107.38 ? 376  PRO B C   1 
ATOM 10682 O O   . PRO B 2 318  ? 224.442 34.721  -27.216 1.00 106.74 ? 376  PRO B O   1 
ATOM 10683 C CB  . PRO B 2 318  ? 221.418 35.898  -25.537 1.00 107.31 ? 376  PRO B CB  1 
ATOM 10684 C CG  . PRO B 2 318  ? 220.319 36.557  -26.342 1.00 107.11 ? 376  PRO B CG  1 
ATOM 10685 C CD  . PRO B 2 318  ? 221.013 37.759  -26.878 1.00 107.66 ? 376  PRO B CD  1 
ATOM 10686 N N   . CYS B 2 319  ? 222.340 33.901  -27.213 1.00 107.18 ? 377  CYS B N   1 
ATOM 10687 C CA  . CYS B 2 319  ? 222.708 32.613  -27.772 1.00 106.86 ? 377  CYS B CA  1 
ATOM 10688 C C   . CYS B 2 319  ? 223.901 32.666  -28.712 1.00 107.02 ? 377  CYS B C   1 
ATOM 10689 O O   . CYS B 2 319  ? 224.669 31.709  -28.809 1.00 107.45 ? 377  CYS B O   1 
ATOM 10690 C CB  . CYS B 2 319  ? 221.505 32.013  -28.484 1.00 105.96 ? 377  CYS B CB  1 
ATOM 10691 S SG  . CYS B 2 319  ? 220.494 33.260  -29.250 1.00 103.12 ? 377  CYS B SG  1 
ATOM 10692 N N   . LEU B 2 320  ? 224.077 33.789  -29.389 1.00 106.42 ? 378  LEU B N   1 
ATOM 10693 C CA  . LEU B 2 320  ? 225.184 33.910  -30.317 1.00 105.47 ? 378  LEU B CA  1 
ATOM 10694 C C   . LEU B 2 320  ? 226.502 34.258  -29.639 1.00 105.10 ? 378  LEU B C   1 
ATOM 10695 O O   . LEU B 2 320  ? 227.500 33.552  -29.794 1.00 105.05 ? 378  LEU B O   1 
ATOM 10696 C CB  . LEU B 2 320  ? 224.834 34.946  -31.382 1.00 105.55 ? 378  LEU B CB  1 
ATOM 10697 C CG  . LEU B 2 320  ? 223.683 34.553  -32.317 1.00 106.70 ? 378  LEU B CG  1 
ATOM 10698 C CD1 . LEU B 2 320  ? 222.399 34.351  -31.533 1.00 107.30 ? 378  LEU B CD1 1 
ATOM 10699 C CD2 . LEU B 2 320  ? 223.491 35.633  -33.364 1.00 107.11 ? 378  LEU B CD2 1 
ATOM 10700 N N   . ALA B 2 321  ? 226.491 35.344  -28.878 1.00 105.01 ? 379  ALA B N   1 
ATOM 10701 C CA  . ALA B 2 321  ? 227.677 35.813  -28.185 1.00 105.19 ? 379  ALA B CA  1 
ATOM 10702 C C   . ALA B 2 321  ? 228.676 34.706  -27.974 1.00 105.46 ? 379  ALA B C   1 
ATOM 10703 O O   . ALA B 2 321  ? 228.475 33.841  -27.132 1.00 105.54 ? 379  ALA B O   1 
ATOM 10704 C CB  . ALA B 2 321  ? 227.298 36.417  -26.854 1.00 104.30 ? 379  ALA B CB  1 
ATOM 10705 N N   . PRO B 2 322  ? 229.767 34.715  -28.751 1.00 105.90 ? 380  PRO B N   1 
ATOM 10706 C CA  . PRO B 2 322  ? 230.788 33.688  -28.613 1.00 106.88 ? 380  PRO B CA  1 
ATOM 10707 C C   . PRO B 2 322  ? 230.836 33.168  -27.190 1.00 108.24 ? 380  PRO B C   1 
ATOM 10708 O O   . PRO B 2 322  ? 230.548 31.999  -26.946 1.00 109.15 ? 380  PRO B O   1 
ATOM 10709 C CB  . PRO B 2 322  ? 232.047 34.422  -29.039 1.00 106.30 ? 380  PRO B CB  1 
ATOM 10710 C CG  . PRO B 2 322  ? 231.547 35.186  -30.208 1.00 105.87 ? 380  PRO B CG  1 
ATOM 10711 C CD  . PRO B 2 322  ? 230.228 35.763  -29.678 1.00 105.74 ? 380  PRO B CD  1 
ATOM 10712 N N   . ILE B 2 323  ? 231.184 34.037  -26.248 1.00 109.25 ? 381  ILE B N   1 
ATOM 10713 C CA  . ILE B 2 323  ? 231.224 33.633  -24.849 1.00 109.62 ? 381  ILE B CA  1 
ATOM 10714 C C   . ILE B 2 323  ? 229.907 34.036  -24.204 1.00 109.81 ? 381  ILE B C   1 
ATOM 10715 O O   . ILE B 2 323  ? 229.153 34.842  -24.763 1.00 110.35 ? 381  ILE B O   1 
ATOM 10716 C CB  . ILE B 2 323  ? 232.412 34.279  -24.067 1.00 109.20 ? 381  ILE B CB  1 
ATOM 10717 C CG1 . ILE B 2 323  ? 232.716 35.679  -24.610 1.00 109.40 ? 381  ILE B CG1 1 
ATOM 10718 C CG2 . ILE B 2 323  ? 233.635 33.369  -24.133 1.00 108.73 ? 381  ILE B CG2 1 
ATOM 10719 C CD1 . ILE B 2 323  ? 231.586 36.680  -24.435 1.00 108.81 ? 381  ILE B CD1 1 
ATOM 10720 N N   . LYS B 2 324  ? 229.638 33.468  -23.032 1.00 109.54 ? 382  LYS B N   1 
ATOM 10721 C CA  . LYS B 2 324  ? 228.403 33.732  -22.300 1.00 109.06 ? 382  LYS B CA  1 
ATOM 10722 C C   . LYS B 2 324  ? 228.542 34.626  -21.062 1.00 108.80 ? 382  LYS B C   1 
ATOM 10723 O O   . LYS B 2 324  ? 227.702 35.495  -20.819 1.00 108.97 ? 382  LYS B O   1 
ATOM 10724 C CB  . LYS B 2 324  ? 227.757 32.404  -21.899 1.00 109.29 ? 382  LYS B CB  1 
ATOM 10725 C CG  . LYS B 2 324  ? 226.575 31.989  -22.766 1.00 109.12 ? 382  LYS B CG  1 
ATOM 10726 C CD  . LYS B 2 324  ? 226.939 31.679  -24.215 1.00 108.41 ? 382  LYS B CD  1 
ATOM 10727 C CE  . LYS B 2 324  ? 225.685 31.282  -24.984 1.00 107.34 ? 382  LYS B CE  1 
ATOM 10728 N NZ  . LYS B 2 324  ? 225.943 30.837  -26.376 1.00 107.82 ? 382  LYS B NZ  1 
ATOM 10729 N N   . VAL B 2 325  ? 229.598 34.418  -20.280 1.00 108.54 ? 383  VAL B N   1 
ATOM 10730 C CA  . VAL B 2 325  ? 229.810 35.216  -19.074 1.00 108.61 ? 383  VAL B CA  1 
ATOM 10731 C C   . VAL B 2 325  ? 231.293 35.345  -18.666 1.00 109.01 ? 383  VAL B C   1 
ATOM 10732 O O   . VAL B 2 325  ? 232.173 34.763  -19.304 1.00 108.99 ? 383  VAL B O   1 
ATOM 10733 C CB  . VAL B 2 325  ? 228.969 34.633  -17.910 1.00 108.33 ? 383  VAL B CB  1 
ATOM 10734 C CG1 . VAL B 2 325  ? 229.415 33.261  -17.573 1.00 107.60 ? 383  VAL B CG1 1 
ATOM 10735 C CG2 . VAL B 2 325  ? 229.026 35.541  -16.717 1.00 108.70 ? 383  VAL B CG2 1 
ATOM 10736 N N   . ALA B 2 326  ? 231.565 36.126  -17.620 1.00 109.14 ? 384  ALA B N   1 
ATOM 10737 C CA  . ALA B 2 326  ? 232.930 36.333  -17.130 1.00 109.26 ? 384  ALA B CA  1 
ATOM 10738 C C   . ALA B 2 326  ? 232.962 36.690  -15.638 1.00 109.19 ? 384  ALA B C   1 
ATOM 10739 O O   . ALA B 2 326  ? 231.924 36.885  -15.008 1.00 108.62 ? 384  ALA B O   1 
ATOM 10740 C CB  . ALA B 2 326  ? 233.615 37.421  -17.944 1.00 109.61 ? 384  ALA B CB  1 
ATOM 10741 N N   . LEU B 2 327  ? 234.161 36.792  -15.079 1.00 110.21 ? 385  LEU B N   1 
ATOM 10742 C CA  . LEU B 2 327  ? 234.307 37.097  -13.667 1.00 112.13 ? 385  LEU B CA  1 
ATOM 10743 C C   . LEU B 2 327  ? 235.775 37.223  -13.321 1.00 113.81 ? 385  LEU B C   1 
ATOM 10744 O O   . LEU B 2 327  ? 236.640 36.923  -14.142 1.00 114.03 ? 385  LEU B O   1 
ATOM 10745 C CB  . LEU B 2 327  ? 233.739 35.961  -12.837 1.00 112.32 ? 385  LEU B CB  1 
ATOM 10746 C CG  . LEU B 2 327  ? 234.557 34.663  -12.935 1.00 112.58 ? 385  LEU B CG  1 
ATOM 10747 C CD1 . LEU B 2 327  ? 234.081 33.682  -11.883 1.00 112.81 ? 385  LEU B CD1 1 
ATOM 10748 C CD2 . LEU B 2 327  ? 234.436 34.052  -14.319 1.00 112.31 ? 385  LEU B CD2 1 
ATOM 10749 N N   . ASP B 2 328  ? 236.046 37.650  -12.091 1.00 116.13 ? 386  ASP B N   1 
ATOM 10750 C CA  . ASP B 2 328  ? 237.413 37.791  -11.586 1.00 118.30 ? 386  ASP B CA  1 
ATOM 10751 C C   . ASP B 2 328  ? 237.303 37.748  -10.073 1.00 119.39 ? 386  ASP B C   1 
ATOM 10752 O O   . ASP B 2 328  ? 236.247 37.423  -9.534  1.00 118.47 ? 386  ASP B O   1 
ATOM 10753 C CB  . ASP B 2 328  ? 238.050 39.128  -12.014 1.00 118.94 ? 386  ASP B CB  1 
ATOM 10754 C CG  . ASP B 2 328  ? 239.585 39.101  -11.960 1.00 119.04 ? 386  ASP B CG  1 
ATOM 10755 O OD1 . ASP B 2 328  ? 240.153 38.602  -10.962 1.00 119.47 ? 386  ASP B OD1 1 
ATOM 10756 O OD2 . ASP B 2 328  ? 240.229 39.587  -12.917 1.00 118.66 ? 386  ASP B OD2 1 
ATOM 10757 N N   . VAL B 2 329  ? 238.389 38.079  -9.392  1.00 121.36 ? 387  VAL B N   1 
ATOM 10758 C CA  . VAL B 2 329  ? 238.388 38.070  -7.947  1.00 123.40 ? 387  VAL B CA  1 
ATOM 10759 C C   . VAL B 2 329  ? 238.021 39.434  -7.410  1.00 123.62 ? 387  VAL B C   1 
ATOM 10760 O O   . VAL B 2 329  ? 237.792 40.373  -8.173  1.00 123.06 ? 387  VAL B O   1 
ATOM 10761 C CB  . VAL B 2 329  ? 239.758 37.653  -7.387  1.00 124.40 ? 387  VAL B CB  1 
ATOM 10762 C CG1 . VAL B 2 329  ? 239.993 36.197  -7.682  1.00 124.65 ? 387  VAL B CG1 1 
ATOM 10763 C CG2 . VAL B 2 329  ? 240.861 38.497  -7.998  1.00 125.31 ? 387  VAL B CG2 1 
ATOM 10764 N N   . GLY B 2 330  ? 237.955 39.530  -6.089  1.00 124.57 ? 388  GLY B N   1 
ATOM 10765 C CA  . GLY B 2 330  ? 237.607 40.786  -5.466  1.00 125.43 ? 388  GLY B CA  1 
ATOM 10766 C C   . GLY B 2 330  ? 237.281 40.635  -4.000  1.00 126.54 ? 388  GLY B C   1 
ATOM 10767 O O   . GLY B 2 330  ? 236.680 39.649  -3.583  1.00 127.51 ? 388  GLY B O   1 
ATOM 10768 N N   . ARG B 2 331  ? 237.704 41.624  -3.224  1.00 126.59 ? 389  ARG B N   1 
ATOM 10769 C CA  . ARG B 2 331  ? 237.469 41.674  -1.789  1.00 126.51 ? 389  ARG B CA  1 
ATOM 10770 C C   . ARG B 2 331  ? 238.128 40.568  -0.956  1.00 126.32 ? 389  ARG B C   1 
ATOM 10771 O O   . ARG B 2 331  ? 238.599 40.828  0.157   1.00 126.25 ? 389  ARG B O   1 
ATOM 10772 C CB  . ARG B 2 331  ? 235.961 41.693  -1.512  1.00 126.50 ? 389  ARG B CB  1 
ATOM 10773 C CG  . ARG B 2 331  ? 235.164 42.754  -2.278  1.00 126.22 ? 389  ARG B CG  1 
ATOM 10774 C CD  . ARG B 2 331  ? 235.905 44.077  -2.397  1.00 127.19 ? 389  ARG B CD  1 
ATOM 10775 N NE  . ARG B 2 331  ? 236.758 44.110  -3.585  1.00 128.22 ? 389  ARG B NE  1 
ATOM 10776 C CZ  . ARG B 2 331  ? 237.571 45.115  -3.910  1.00 128.91 ? 389  ARG B CZ  1 
ATOM 10777 N NH1 . ARG B 2 331  ? 237.661 46.193  -3.139  1.00 129.26 ? 389  ARG B NH1 1 
ATOM 10778 N NH2 . ARG B 2 331  ? 238.291 45.046  -5.021  1.00 129.27 ? 389  ARG B NH2 1 
ATOM 10779 N N   . GLY B 2 332  ? 238.159 39.347  -1.488  1.00 125.51 ? 390  GLY B N   1 
ATOM 10780 C CA  . GLY B 2 332  ? 238.750 38.229  -0.763  1.00 124.21 ? 390  GLY B CA  1 
ATOM 10781 C C   . GLY B 2 332  ? 240.076 38.544  -0.091  1.00 123.02 ? 390  GLY B C   1 
ATOM 10782 O O   . GLY B 2 332  ? 240.153 38.647  1.139   1.00 123.15 ? 390  GLY B O   1 
ATOM 10783 N N   . PRO B 2 333  ? 241.149 38.696  -0.881  1.00 121.88 ? 391  PRO B N   1 
ATOM 10784 C CA  . PRO B 2 333  ? 241.067 38.569  -2.336  1.00 119.42 ? 391  PRO B CA  1 
ATOM 10785 C C   . PRO B 2 333  ? 241.938 37.438  -2.847  1.00 116.52 ? 391  PRO B C   1 
ATOM 10786 O O   . PRO B 2 333  ? 241.496 36.601  -3.627  1.00 116.55 ? 391  PRO B O   1 
ATOM 10787 C CB  . PRO B 2 333  ? 241.547 39.928  -2.815  1.00 120.43 ? 391  PRO B CB  1 
ATOM 10788 C CG  . PRO B 2 333  ? 242.532 40.395  -1.704  1.00 121.79 ? 391  PRO B CG  1 
ATOM 10789 C CD  . PRO B 2 333  ? 242.339 39.479  -0.505  1.00 122.25 ? 391  PRO B CD  1 
ATOM 10790 N N   . THR B 2 334  ? 243.186 37.437  -2.396  1.00 113.45 ? 392  THR B N   1 
ATOM 10791 C CA  . THR B 2 334  ? 244.156 36.419  -2.767  1.00 109.89 ? 392  THR B CA  1 
ATOM 10792 C C   . THR B 2 334  ? 243.660 34.995  -2.400  1.00 108.06 ? 392  THR B C   1 
ATOM 10793 O O   . THR B 2 334  ? 242.774 34.830  -1.556  1.00 107.03 ? 392  THR B O   1 
ATOM 10794 C CB  . THR B 2 334  ? 245.503 36.691  -2.040  1.00 109.18 ? 392  THR B CB  1 
ATOM 10795 O OG1 . THR B 2 334  ? 245.936 38.028  -2.317  1.00 107.49 ? 392  THR B OG1 1 
ATOM 10796 C CG2 . THR B 2 334  ? 246.571 35.711  -2.495  1.00 107.90 ? 392  THR B CG2 1 
ATOM 10797 N N   . LEU B 2 335  ? 244.227 33.990  -3.073  1.00 106.32 ? 393  LEU B N   1 
ATOM 10798 C CA  . LEU B 2 335  ? 243.953 32.569  -2.840  1.00 104.71 ? 393  LEU B CA  1 
ATOM 10799 C C   . LEU B 2 335  ? 242.591 31.943  -3.128  1.00 103.95 ? 393  LEU B C   1 
ATOM 10800 O O   . LEU B 2 335  ? 242.102 31.964  -4.253  1.00 103.64 ? 393  LEU B O   1 
ATOM 10801 C CB  . LEU B 2 335  ? 244.309 32.212  -1.406  1.00 103.78 ? 393  LEU B CB  1 
ATOM 10802 C CG  . LEU B 2 335  ? 245.784 32.315  -1.087  1.00 102.80 ? 393  LEU B CG  1 
ATOM 10803 C CD1 . LEU B 2 335  ? 245.951 31.987  0.373   1.00 102.21 ? 393  LEU B CD1 1 
ATOM 10804 C CD2 . LEU B 2 335  ? 246.597 31.375  -1.975  1.00 101.53 ? 393  LEU B CD2 1 
ATOM 10805 N N   . GLU B 2 336  ? 242.019 31.351  -2.078  1.00 103.21 ? 394  GLU B N   1 
ATOM 10806 C CA  . GLU B 2 336  ? 240.748 30.623  -2.100  1.00 102.85 ? 394  GLU B CA  1 
ATOM 10807 C C   . GLU B 2 336  ? 239.488 31.158  -2.807  1.00 102.14 ? 394  GLU B C   1 
ATOM 10808 O O   . GLU B 2 336  ? 238.771 30.371  -3.438  1.00 101.15 ? 394  GLU B O   1 
ATOM 10809 C CB  . GLU B 2 336  ? 240.387 30.258  -0.671  1.00 103.61 ? 394  GLU B CB  1 
ATOM 10810 C CG  . GLU B 2 336  ? 239.710 28.911  -0.569  1.00 103.86 ? 394  GLU B CG  1 
ATOM 10811 C CD  . GLU B 2 336  ? 239.769 28.344  0.828   1.00 103.84 ? 394  GLU B CD  1 
ATOM 10812 O OE1 . GLU B 2 336  ? 240.337 29.003  1.725   1.00 102.90 ? 394  GLU B OE1 1 
ATOM 10813 O OE2 . GLU B 2 336  ? 239.245 27.234  1.027   1.00 103.86 ? 394  GLU B OE2 1 
ATOM 10814 N N   . LEU B 2 337  ? 239.189 32.455  -2.696  1.00 101.27 ? 395  LEU B N   1 
ATOM 10815 C CA  . LEU B 2 337  ? 237.988 33.008  -3.344  1.00 100.15 ? 395  LEU B CA  1 
ATOM 10816 C C   . LEU B 2 337  ? 238.144 32.803  -4.827  1.00 99.82  ? 395  LEU B C   1 
ATOM 10817 O O   . LEU B 2 337  ? 237.223 32.381  -5.533  1.00 100.15 ? 395  LEU B O   1 
ATOM 10818 C CB  . LEU B 2 337  ? 237.863 34.502  -3.073  1.00 98.40  ? 395  LEU B CB  1 
ATOM 10819 C CG  . LEU B 2 337  ? 236.632 35.141  -3.710  1.00 96.60  ? 395  LEU B CG  1 
ATOM 10820 C CD1 . LEU B 2 337  ? 235.365 34.385  -3.293  1.00 96.18  ? 395  LEU B CD1 1 
ATOM 10821 C CD2 . LEU B 2 337  ? 236.563 36.597  -3.287  1.00 95.60  ? 395  LEU B CD2 1 
ATOM 10822 N N   . ARG B 2 338  ? 239.339 33.148  -5.276  1.00 98.74  ? 396  ARG B N   1 
ATOM 10823 C CA  . ARG B 2 338  ? 239.721 33.013  -6.649  1.00 97.77  ? 396  ARG B CA  1 
ATOM 10824 C C   . ARG B 2 338  ? 239.609 31.555  -7.094  1.00 97.39  ? 396  ARG B C   1 
ATOM 10825 O O   . ARG B 2 338  ? 239.104 31.282  -8.175  1.00 96.66  ? 396  ARG B O   1 
ATOM 10826 C CB  . ARG B 2 338  ? 241.146 33.479  -6.792  1.00 97.77  ? 396  ARG B CB  1 
ATOM 10827 C CG  . ARG B 2 338  ? 241.665 33.287  -8.158  1.00 98.36  ? 396  ARG B CG  1 
ATOM 10828 C CD  . ARG B 2 338  ? 243.071 33.834  -8.276  1.00 99.65  ? 396  ARG B CD  1 
ATOM 10829 N NE  . ARG B 2 338  ? 244.047 32.991  -7.602  1.00 100.53 ? 396  ARG B NE  1 
ATOM 10830 C CZ  . ARG B 2 338  ? 244.679 31.959  -8.157  1.00 101.50 ? 396  ARG B CZ  1 
ATOM 10831 N NH1 . ARG B 2 338  ? 244.468 31.609  -9.416  1.00 100.79 ? 396  ARG B NH1 1 
ATOM 10832 N NH2 . ARG B 2 338  ? 245.536 31.260  -7.432  1.00 102.16 ? 396  ARG B NH2 1 
ATOM 10833 N N   . GLN B 2 339  ? 240.090 30.626  -6.264  1.00 97.42  ? 397  GLN B N   1 
ATOM 10834 C CA  . GLN B 2 339  ? 240.042 29.188  -6.567  1.00 97.44  ? 397  GLN B CA  1 
ATOM 10835 C C   . GLN B 2 339  ? 238.599 28.700  -6.656  1.00 96.45  ? 397  GLN B C   1 
ATOM 10836 O O   . GLN B 2 339  ? 238.261 27.845  -7.480  1.00 96.95  ? 397  GLN B O   1 
ATOM 10837 C CB  . GLN B 2 339  ? 240.790 28.395  -5.487  1.00 98.76  ? 397  GLN B CB  1 
ATOM 10838 C CG  . GLN B 2 339  ? 242.283 28.725  -5.385  1.00 101.70 ? 397  GLN B CG  1 
ATOM 10839 C CD  . GLN B 2 339  ? 242.996 27.936  -4.302  1.00 102.94 ? 397  GLN B CD  1 
ATOM 10840 O OE1 . GLN B 2 339  ? 242.405 27.071  -3.664  1.00 103.88 ? 397  GLN B OE1 1 
ATOM 10841 N NE2 . GLN B 2 339  ? 244.275 28.231  -4.094  1.00 103.90 ? 397  GLN B NE2 1 
ATOM 10842 N N   . VAL B 2 340  ? 237.749 29.256  -5.803  1.00 94.24  ? 398  VAL B N   1 
ATOM 10843 C CA  . VAL B 2 340  ? 236.343 28.901  -5.795  1.00 91.33  ? 398  VAL B CA  1 
ATOM 10844 C C   . VAL B 2 340  ? 235.640 29.358  -7.059  1.00 90.86  ? 398  VAL B C   1 
ATOM 10845 O O   . VAL B 2 340  ? 234.791 28.659  -7.595  1.00 89.27  ? 398  VAL B O   1 
ATOM 10846 C CB  . VAL B 2 340  ? 235.633 29.530  -4.624  1.00 89.93  ? 398  VAL B CB  1 
ATOM 10847 C CG1 . VAL B 2 340  ? 234.162 29.191  -4.689  1.00 88.17  ? 398  VAL B CG1 1 
ATOM 10848 C CG2 . VAL B 2 340  ? 236.253 29.039  -3.336  1.00 88.46  ? 398  VAL B CG2 1 
ATOM 10849 N N   . CYS B 2 341  ? 235.995 30.542  -7.532  1.00 91.19  ? 399  CYS B N   1 
ATOM 10850 C CA  . CYS B 2 341  ? 235.401 31.087  -8.745  1.00 92.16  ? 399  CYS B CA  1 
ATOM 10851 C C   . CYS B 2 341  ? 235.685 30.199  -9.958  1.00 93.07  ? 399  CYS B C   1 
ATOM 10852 O O   . CYS B 2 341  ? 234.819 29.958  -10.800 1.00 92.49  ? 399  CYS B O   1 
ATOM 10853 C CB  . CYS B 2 341  ? 235.949 32.494  -8.965  1.00 91.66  ? 399  CYS B CB  1 
ATOM 10854 S SG  . CYS B 2 341  ? 235.658 33.522  -7.522  1.00 92.69  ? 399  CYS B SG  1 
ATOM 10855 N N   . GLN B 2 342  ? 236.907 29.692  -10.015 1.00 94.77  ? 400  GLN B N   1 
ATOM 10856 C CA  . GLN B 2 342  ? 237.347 28.848  -11.112 1.00 96.74  ? 400  GLN B CA  1 
ATOM 10857 C C   . GLN B 2 342  ? 236.608 27.569  -11.100 1.00 97.10  ? 400  GLN B C   1 
ATOM 10858 O O   . GLN B 2 342  ? 236.205 27.068  -12.138 1.00 97.36  ? 400  GLN B O   1 
ATOM 10859 C CB  . GLN B 2 342  ? 238.838 28.571  -11.008 1.00 98.19  ? 400  GLN B CB  1 
ATOM 10860 C CG  . GLN B 2 342  ? 239.649 29.700  -11.614 1.00 100.45 ? 400  GLN B CG  1 
ATOM 10861 C CD  . GLN B 2 342  ? 239.171 31.075  -11.177 1.00 101.54 ? 400  GLN B CD  1 
ATOM 10862 O OE1 . GLN B 2 342  ? 238.233 31.227  -10.432 1.00 100.77 ? 400  GLN B OE1 1 
ATOM 10863 N NE2 . GLN B 2 342  ? 239.839 32.071  -11.634 1.00 102.65 ? 400  GLN B NE2 1 
ATOM 10864 N N   . GLY B 2 343  ? 236.456 27.013  -9.916  1.00 97.53  ? 401  GLY B N   1 
ATOM 10865 C CA  . GLY B 2 343  ? 235.724 25.779  -9.838  1.00 97.92  ? 401  GLY B CA  1 
ATOM 10866 C C   . GLY B 2 343  ? 234.311 26.041  -10.321 1.00 98.28  ? 401  GLY B C   1 
ATOM 10867 O O   . GLY B 2 343  ? 233.756 25.248  -11.076 1.00 97.89  ? 401  GLY B O   1 
ATOM 10868 N N   . LEU B 2 344  ? 233.728 27.161  -9.900  1.00 99.16  ? 402  LEU B N   1 
ATOM 10869 C CA  . LEU B 2 344  ? 232.369 27.481  -10.299 1.00 100.58 ? 402  LEU B CA  1 
ATOM 10870 C C   . LEU B 2 344  ? 232.358 27.517  -11.801 1.00 101.39 ? 402  LEU B C   1 
ATOM 10871 O O   . LEU B 2 344  ? 231.498 26.914  -12.424 1.00 101.18 ? 402  LEU B O   1 
ATOM 10872 C CB  . LEU B 2 344  ? 231.939 28.826  -9.724  1.00 100.93 ? 402  LEU B CB  1 
ATOM 10873 C CG  . LEU B 2 344  ? 231.877 28.838  -8.194  1.00 101.42 ? 402  LEU B CG  1 
ATOM 10874 C CD1 . LEU B 2 344  ? 231.442 30.201  -7.729  1.00 101.45 ? 402  LEU B CD1 1 
ATOM 10875 C CD2 . LEU B 2 344  ? 230.907 27.779  -7.685  1.00 101.65 ? 402  LEU B CD2 1 
ATOM 10876 N N   . PHE B 2 345  ? 233.348 28.201  -12.362 1.00 102.64 ? 403  PHE B N   1 
ATOM 10877 C CA  . PHE B 2 345  ? 233.504 28.331  -13.801 1.00 104.43 ? 403  PHE B CA  1 
ATOM 10878 C C   . PHE B 2 345  ? 233.424 26.957  -14.454 1.00 105.46 ? 403  PHE B C   1 
ATOM 10879 O O   . PHE B 2 345  ? 232.672 26.744  -15.413 1.00 105.42 ? 403  PHE B O   1 
ATOM 10880 C CB  . PHE B 2 345  ? 234.868 28.946  -14.110 1.00 105.12 ? 403  PHE B CB  1 
ATOM 10881 C CG  . PHE B 2 345  ? 235.158 29.079  -15.585 1.00 106.88 ? 403  PHE B CG  1 
ATOM 10882 C CD1 . PHE B 2 345  ? 235.159 30.318  -16.196 1.00 107.46 ? 403  PHE B CD1 1 
ATOM 10883 C CD2 . PHE B 2 345  ? 235.469 28.010  -16.374 1.00 107.65 ? 403  PHE B CD2 1 
ATOM 10884 C CE1 . PHE B 2 345  ? 235.460 30.462  -17.554 1.00 108.76 ? 403  PHE B CE1 1 
ATOM 10885 C CE2 . PHE B 2 345  ? 235.778 28.210  -17.773 1.00 108.44 ? 403  PHE B CE2 1 
ATOM 10886 C CZ  . PHE B 2 345  ? 235.777 29.363  -18.328 1.00 108.76 ? 403  PHE B CZ  1 
ATOM 10887 N N   . ASN B 2 346  ? 234.205 26.027  -13.914 1.00 107.04 ? 404  ASN B N   1 
ATOM 10888 C CA  . ASN B 2 346  ? 234.287 24.664  -14.430 1.00 108.66 ? 404  ASN B CA  1 
ATOM 10889 C C   . ASN B 2 346  ? 232.941 23.950  -14.389 1.00 109.17 ? 404  ASN B C   1 
ATOM 10890 O O   . ASN B 2 346  ? 232.553 23.259  -15.342 1.00 109.54 ? 404  ASN B O   1 
ATOM 10891 C CB  . ASN B 2 346  ? 235.346 23.872  -13.638 1.00 109.62 ? 404  ASN B CB  1 
ATOM 10892 C CG  . ASN B 2 346  ? 236.751 24.486  -13.738 1.00 110.74 ? 404  ASN B CG  1 
ATOM 10893 O OD1 . ASN B 2 346  ? 236.947 25.532  -14.366 1.00 110.19 ? 404  ASN B OD1 1 
ATOM 10894 N ND2 . ASN B 2 346  ? 237.732 23.829  -13.113 1.00 110.97 ? 404  ASN B ND2 1 
ATOM 10895 N N   . GLU B 2 347  ? 232.223 24.137  -13.290 1.00 109.48 ? 405  GLU B N   1 
ATOM 10896 C CA  . GLU B 2 347  ? 230.924 23.515  -13.126 1.00 110.42 ? 405  GLU B CA  1 
ATOM 10897 C C   . GLU B 2 347  ? 229.961 24.000  -14.208 1.00 110.45 ? 405  GLU B C   1 
ATOM 10898 O O   . GLU B 2 347  ? 229.253 23.203  -14.826 1.00 109.97 ? 405  GLU B O   1 
ATOM 10899 C CB  . GLU B 2 347  ? 230.373 23.832  -11.737 1.00 111.71 ? 405  GLU B CB  1 
ATOM 10900 C CG  . GLU B 2 347  ? 229.032 23.192  -11.449 1.00 112.30 ? 405  GLU B CG  1 
ATOM 10901 C CD  . GLU B 2 347  ? 229.056 21.683  -11.598 1.00 111.75 ? 405  GLU B CD  1 
ATOM 10902 O OE1 . GLU B 2 347  ? 230.142 21.124  -11.855 1.00 111.08 ? 405  GLU B OE1 1 
ATOM 10903 O OE2 . GLU B 2 347  ? 227.986 21.056  -11.451 1.00 111.17 ? 405  GLU B OE2 1 
ATOM 10904 N N   . LEU B 2 348  ? 229.947 25.312  -14.434 1.00 110.81 ? 406  LEU B N   1 
ATOM 10905 C CA  . LEU B 2 348  ? 229.082 25.921  -15.444 1.00 111.22 ? 406  LEU B CA  1 
ATOM 10906 C C   . LEU B 2 348  ? 229.436 25.365  -16.832 1.00 110.69 ? 406