data_3INU
# 
_entry.id   3INU 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.313 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3INU         
RCSB  RCSB054642   
WWPDB D_1000054642 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          3CSY 
_pdbx_database_related.details        
'Crystal structure of the trimeric prefusion Ebola virus glycoprotein in complex with a neutralizing antibody from a human survivor' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.entry_id                        3INU 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2009-08-12 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Lee, J.E.'     1 
'Fusco, M.L.'   2 
'Abelson, D.M.' 3 
'Hessell, A.J.' 4 
'Burton, D.R.'  5 
'Saphire, E.O.' 6 
# 
_citation.id                        primary 
_citation.title                     
'Techniques and tactics used in determining the structure of the trimeric ebolavirus glycoprotein.' 
_citation.journal_abbrev            'Acta Crystallogr.,Sect.D' 
_citation.journal_volume            65 
_citation.page_first                1162 
_citation.page_last                 1180 
_citation.year                      2009 
_citation.journal_id_ASTM           ABCRE6 
_citation.country                   DK 
_citation.journal_id_ISSN           0907-4449 
_citation.journal_id_CSD            0766 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19923712 
_citation.pdbx_database_id_DOI      10.1107/S0907444909032314 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Lee, J.E.'     1 ? 
primary 'Fusco, M.L.'   2 ? 
primary 'Abelson, D.M.' 3 ? 
primary 'Hessell, A.J.' 4 ? 
primary 'Burton, D.R.'  5 ? 
primary 'Saphire, E.O.' 6 ? 
# 
_cell.length_a           129.520 
_cell.length_b           129.520 
_cell.length_c           184.960 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        120.000 
_cell.entry_id           3INU 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              12 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 32 2 1' 
_symmetry.entry_id                         3INU 
_symmetry.Int_Tables_number                154 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'KZ52 antibody fragment heavy chain' 24020.977 2  ? ? ? ? 
2 polymer     man 'KZ52 antibody fragment light chain' 23896.557 2  ? ? ? ? 
3 non-polymer syn 'SULFATE ION'                        96.063    8  ? ? ? ? 
4 non-polymer syn GLYCEROL                             92.094    4  ? ? ? ? 
5 water       nat water                                18.015    76 ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)' no no 
;EVQLLESGGGLVKPGGSLRLSCAASGFTLINYRMNWVRQAPGKGLEWVSSISSSSSYIHYADSVKGRFTISRDNAENSLY
LQMNSLRAEDTAVYYCVREGPRATGYSMADVFDIWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPE
PVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
;
;EVQLLESGGGLVKPGGSLRLSCAASGFTLINYRMNWVRQAPGKGLEWVSSISSSSSYIHYADSVKGRFTISRDNAENSLY
LQMNSLRAEDTAVYYCVREGPRATGYSMADVFDIWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPE
PVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
;
H,M ? 
2 'polypeptide(L)' no no 
;ELVMTQSPDSLAVSLGERATINCKSSQSVLYSSNNKSYLAWYQQKPGQPPKLLIYWASTRESGVPDRFSGSGSGTDFTLT
ISSLQAEDVAVYYCQQYYSAPLTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNAL
QSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLRSPVTKSFNR
;
;ELVMTQSPDSLAVSLGERATINCKSSQSVLYSSNNKSYLAWYQQKPGQPPKLLIYWASTRESGVPDRFSGSGSGTDFTLT
ISSLQAEDVAVYYCQQYYSAPLTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNAL
QSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLRSPVTKSFNR
;
L,N ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLU n 
1 2   VAL n 
1 3   GLN n 
1 4   LEU n 
1 5   LEU n 
1 6   GLU n 
1 7   SER n 
1 8   GLY n 
1 9   GLY n 
1 10  GLY n 
1 11  LEU n 
1 12  VAL n 
1 13  LYS n 
1 14  PRO n 
1 15  GLY n 
1 16  GLY n 
1 17  SER n 
1 18  LEU n 
1 19  ARG n 
1 20  LEU n 
1 21  SER n 
1 22  CYS n 
1 23  ALA n 
1 24  ALA n 
1 25  SER n 
1 26  GLY n 
1 27  PHE n 
1 28  THR n 
1 29  LEU n 
1 30  ILE n 
1 31  ASN n 
1 32  TYR n 
1 33  ARG n 
1 34  MET n 
1 35  ASN n 
1 36  TRP n 
1 37  VAL n 
1 38  ARG n 
1 39  GLN n 
1 40  ALA n 
1 41  PRO n 
1 42  GLY n 
1 43  LYS n 
1 44  GLY n 
1 45  LEU n 
1 46  GLU n 
1 47  TRP n 
1 48  VAL n 
1 49  SER n 
1 50  SER n 
1 51  ILE n 
1 52  SER n 
1 53  SER n 
1 54  SER n 
1 55  SER n 
1 56  SER n 
1 57  TYR n 
1 58  ILE n 
1 59  HIS n 
1 60  TYR n 
1 61  ALA n 
1 62  ASP n 
1 63  SER n 
1 64  VAL n 
1 65  LYS n 
1 66  GLY n 
1 67  ARG n 
1 68  PHE n 
1 69  THR n 
1 70  ILE n 
1 71  SER n 
1 72  ARG n 
1 73  ASP n 
1 74  ASN n 
1 75  ALA n 
1 76  GLU n 
1 77  ASN n 
1 78  SER n 
1 79  LEU n 
1 80  TYR n 
1 81  LEU n 
1 82  GLN n 
1 83  MET n 
1 84  ASN n 
1 85  SER n 
1 86  LEU n 
1 87  ARG n 
1 88  ALA n 
1 89  GLU n 
1 90  ASP n 
1 91  THR n 
1 92  ALA n 
1 93  VAL n 
1 94  TYR n 
1 95  TYR n 
1 96  CYS n 
1 97  VAL n 
1 98  ARG n 
1 99  GLU n 
1 100 GLY n 
1 101 PRO n 
1 102 ARG n 
1 103 ALA n 
1 104 THR n 
1 105 GLY n 
1 106 TYR n 
1 107 SER n 
1 108 MET n 
1 109 ALA n 
1 110 ASP n 
1 111 VAL n 
1 112 PHE n 
1 113 ASP n 
1 114 ILE n 
1 115 TRP n 
1 116 GLY n 
1 117 GLN n 
1 118 GLY n 
1 119 THR n 
1 120 MET n 
1 121 VAL n 
1 122 THR n 
1 123 VAL n 
1 124 SER n 
1 125 SER n 
1 126 ALA n 
1 127 SER n 
1 128 THR n 
1 129 LYS n 
1 130 GLY n 
1 131 PRO n 
1 132 SER n 
1 133 VAL n 
1 134 PHE n 
1 135 PRO n 
1 136 LEU n 
1 137 ALA n 
1 138 PRO n 
1 139 SER n 
1 140 SER n 
1 141 LYS n 
1 142 SER n 
1 143 THR n 
1 144 SER n 
1 145 GLY n 
1 146 GLY n 
1 147 THR n 
1 148 ALA n 
1 149 ALA n 
1 150 LEU n 
1 151 GLY n 
1 152 CYS n 
1 153 LEU n 
1 154 VAL n 
1 155 LYS n 
1 156 ASP n 
1 157 TYR n 
1 158 PHE n 
1 159 PRO n 
1 160 GLU n 
1 161 PRO n 
1 162 VAL n 
1 163 THR n 
1 164 VAL n 
1 165 SER n 
1 166 TRP n 
1 167 ASN n 
1 168 SER n 
1 169 GLY n 
1 170 ALA n 
1 171 LEU n 
1 172 THR n 
1 173 SER n 
1 174 GLY n 
1 175 VAL n 
1 176 HIS n 
1 177 THR n 
1 178 PHE n 
1 179 PRO n 
1 180 ALA n 
1 181 VAL n 
1 182 LEU n 
1 183 GLN n 
1 184 SER n 
1 185 SER n 
1 186 GLY n 
1 187 LEU n 
1 188 TYR n 
1 189 SER n 
1 190 LEU n 
1 191 SER n 
1 192 SER n 
1 193 VAL n 
1 194 VAL n 
1 195 THR n 
1 196 VAL n 
1 197 PRO n 
1 198 SER n 
1 199 SER n 
1 200 SER n 
1 201 LEU n 
1 202 GLY n 
1 203 THR n 
1 204 GLN n 
1 205 THR n 
1 206 TYR n 
1 207 ILE n 
1 208 CYS n 
1 209 ASN n 
1 210 VAL n 
1 211 ASN n 
1 212 HIS n 
1 213 LYS n 
1 214 PRO n 
1 215 SER n 
1 216 ASN n 
1 217 THR n 
1 218 LYS n 
1 219 VAL n 
1 220 ASP n 
1 221 LYS n 
1 222 LYS n 
1 223 VAL n 
1 224 GLU n 
1 225 PRO n 
1 226 LYS n 
2 1   GLU n 
2 2   LEU n 
2 3   VAL n 
2 4   MET n 
2 5   THR n 
2 6   GLN n 
2 7   SER n 
2 8   PRO n 
2 9   ASP n 
2 10  SER n 
2 11  LEU n 
2 12  ALA n 
2 13  VAL n 
2 14  SER n 
2 15  LEU n 
2 16  GLY n 
2 17  GLU n 
2 18  ARG n 
2 19  ALA n 
2 20  THR n 
2 21  ILE n 
2 22  ASN n 
2 23  CYS n 
2 24  LYS n 
2 25  SER n 
2 26  SER n 
2 27  GLN n 
2 28  SER n 
2 29  VAL n 
2 30  LEU n 
2 31  TYR n 
2 32  SER n 
2 33  SER n 
2 34  ASN n 
2 35  ASN n 
2 36  LYS n 
2 37  SER n 
2 38  TYR n 
2 39  LEU n 
2 40  ALA n 
2 41  TRP n 
2 42  TYR n 
2 43  GLN n 
2 44  GLN n 
2 45  LYS n 
2 46  PRO n 
2 47  GLY n 
2 48  GLN n 
2 49  PRO n 
2 50  PRO n 
2 51  LYS n 
2 52  LEU n 
2 53  LEU n 
2 54  ILE n 
2 55  TYR n 
2 56  TRP n 
2 57  ALA n 
2 58  SER n 
2 59  THR n 
2 60  ARG n 
2 61  GLU n 
2 62  SER n 
2 63  GLY n 
2 64  VAL n 
2 65  PRO n 
2 66  ASP n 
2 67  ARG n 
2 68  PHE n 
2 69  SER n 
2 70  GLY n 
2 71  SER n 
2 72  GLY n 
2 73  SER n 
2 74  GLY n 
2 75  THR n 
2 76  ASP n 
2 77  PHE n 
2 78  THR n 
2 79  LEU n 
2 80  THR n 
2 81  ILE n 
2 82  SER n 
2 83  SER n 
2 84  LEU n 
2 85  GLN n 
2 86  ALA n 
2 87  GLU n 
2 88  ASP n 
2 89  VAL n 
2 90  ALA n 
2 91  VAL n 
2 92  TYR n 
2 93  TYR n 
2 94  CYS n 
2 95  GLN n 
2 96  GLN n 
2 97  TYR n 
2 98  TYR n 
2 99  SER n 
2 100 ALA n 
2 101 PRO n 
2 102 LEU n 
2 103 THR n 
2 104 PHE n 
2 105 GLY n 
2 106 GLY n 
2 107 GLY n 
2 108 THR n 
2 109 LYS n 
2 110 VAL n 
2 111 GLU n 
2 112 ILE n 
2 113 LYS n 
2 114 ARG n 
2 115 THR n 
2 116 VAL n 
2 117 ALA n 
2 118 ALA n 
2 119 PRO n 
2 120 SER n 
2 121 VAL n 
2 122 PHE n 
2 123 ILE n 
2 124 PHE n 
2 125 PRO n 
2 126 PRO n 
2 127 SER n 
2 128 ASP n 
2 129 GLU n 
2 130 GLN n 
2 131 LEU n 
2 132 LYS n 
2 133 SER n 
2 134 GLY n 
2 135 THR n 
2 136 ALA n 
2 137 SER n 
2 138 VAL n 
2 139 VAL n 
2 140 CYS n 
2 141 LEU n 
2 142 LEU n 
2 143 ASN n 
2 144 ASN n 
2 145 PHE n 
2 146 TYR n 
2 147 PRO n 
2 148 ARG n 
2 149 GLU n 
2 150 ALA n 
2 151 LYS n 
2 152 VAL n 
2 153 GLN n 
2 154 TRP n 
2 155 LYS n 
2 156 VAL n 
2 157 ASP n 
2 158 ASN n 
2 159 ALA n 
2 160 LEU n 
2 161 GLN n 
2 162 SER n 
2 163 GLY n 
2 164 ASN n 
2 165 SER n 
2 166 GLN n 
2 167 GLU n 
2 168 SER n 
2 169 VAL n 
2 170 THR n 
2 171 GLU n 
2 172 GLN n 
2 173 ASP n 
2 174 SER n 
2 175 LYS n 
2 176 ASP n 
2 177 SER n 
2 178 THR n 
2 179 TYR n 
2 180 SER n 
2 181 LEU n 
2 182 SER n 
2 183 SER n 
2 184 THR n 
2 185 LEU n 
2 186 THR n 
2 187 LEU n 
2 188 SER n 
2 189 LYS n 
2 190 ALA n 
2 191 ASP n 
2 192 TYR n 
2 193 GLU n 
2 194 LYS n 
2 195 HIS n 
2 196 LYS n 
2 197 VAL n 
2 198 TYR n 
2 199 ALA n 
2 200 CYS n 
2 201 GLU n 
2 202 VAL n 
2 203 THR n 
2 204 HIS n 
2 205 GLN n 
2 206 GLY n 
2 207 LEU n 
2 208 ARG n 
2 209 SER n 
2 210 PRO n 
2 211 VAL n 
2 212 THR n 
2 213 LYS n 
2 214 SER n 
2 215 PHE n 
2 216 ASN n 
2 217 ARG n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample ? ? ? ? ? ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Cricetulus griseus' 10029 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
? ? ? ? ? 
2 1 sample ? ? ? ? ? ? ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Cricetulus griseus' 10029 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_db_isoform 
1 PDB 3INU 3INU 1 1 
;EVQLLESGGGLVKPGGSLRLSCAASGFTLINYRMNWVRQAPGKGLEWVSSISSSSSYIHYADSVKGRFTISRDNAENSLY
LQMNSLRAEDTAVYYCVREGPRATGYSMADVFDIWGQGTMVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPE
PVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
;
? 
2 PDB 3INU 3INU 2 1 
;ELVMTQSPDSLAVSLGERATINCKSSQSVLYSSNNKSYLAWYQQKPGQPPKLLIYWASTRESGVPDRFSGSGSGTDFTLT
ISSLQAEDVAVYYCQQYYSAPLTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNAL
QSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEAHKVYACEVTHQGLRSPVTKSFNR
;
? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3INU H 1 ? 226 ? 3INU 1 ? 228 ? 1 228 
2 1 3INU M 1 ? 226 ? 3INU 1 ? 228 ? 1 228 
3 2 3INU L 1 ? 217 ? 3INU 1 ? 211 ? 1 211 
4 2 3INU N 1 ? 217 ? 3INU 1 ? 211 ? 1 211 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                               'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL        'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE       ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                               'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                               'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ?                               'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                               'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3INU 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      4.68 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   73.71 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.temp            295 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    
'1.5 M ammonium sulfate, 0.1 M Tris-HCl pH 8.5 and 12% (v/v) glycerol, VAPOR DIFFUSION, HANGING DROP, temperature 295K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2007-04-14 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.11588 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ALS BEAMLINE 8.3.1' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.11588 
_diffrn_source.pdbx_synchrotron_site       ALS 
_diffrn_source.pdbx_synchrotron_beamline   8.3.1 
# 
_reflns.entry_id                     3INU 
_reflns.d_resolution_high            2.500 
_reflns.d_resolution_low             47.960 
_reflns.number_obs                   114050 
_reflns.pdbx_scaling_rejects         48200 
_reflns.pdbx_Rmerge_I_obs            0.118 
_reflns.pdbx_netI_over_sigmaI        7.500 
_reflns.pdbx_chi_squared             0.860 
_reflns.pdbx_redundancy              6.990 
_reflns.percent_possible_obs         99.000 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   ? 
_reflns.number_all                   ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.50 
_reflns_shell.d_res_low              2.59 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_measured_all    42658 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.Rmerge_I_obs           0.627 
_reflns_shell.meanI_over_sigI_obs    2.0 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.pdbx_chi_squared       0.990 
_reflns_shell.pdbx_redundancy        6.41 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      6117 
_reflns_shell.percent_possible_all   98.80 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3INU 
_refine.ls_d_res_high                            2.500 
_refine.ls_d_res_low                             47.955 
_refine.pdbx_ls_sigma_F                          0.02 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    94.960 
_refine.ls_number_reflns_obs                     114050 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            random 
_refine.details                                  ? 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.205 
_refine.ls_R_factor_R_work                       0.203 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.252 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 4.930 
_refine.ls_number_reflns_R_free                  5622 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               66.853 
_refine.solvent_model_param_bsol                 56.866 
_refine.solvent_model_param_ksol                 0.374 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            2.274 
_refine.aniso_B[2][2]                            2.274 
_refine.aniso_B[3][3]                            -4.547 
_refine.aniso_B[1][2]                            -0.000 
_refine.aniso_B[1][3]                            -0.000 
_refine.aniso_B[2][3]                            -0.000 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.430 
_refine.overall_SU_B                             ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.pdbx_solvent_vdw_probe_radii             1.110 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.900 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      'PDB entry 1N0X' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                181.98 
_refine.B_iso_min                                29.53 
_refine.occupancy_max                            1.00 
_refine.occupancy_min                            1.00 
_refine.pdbx_ls_sigma_I                          ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6706 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         64 
_refine_hist.number_atoms_solvent             76 
_refine_hist.number_atoms_total               6846 
_refine_hist.d_res_high                       2.500 
_refine_hist.d_res_low                        47.955 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           6917 0.008  ? ? 'X-RAY DIFFRACTION' ? 
f_angle_d          9397 1.202  ? ? 'X-RAY DIFFRACTION' ? 
f_chiral_restr     1055 0.077  ? ? 'X-RAY DIFFRACTION' ? 
f_plane_restr      1195 0.005  ? ? 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 2425 19.220 ? ? 'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
2.500 2.528  30 86.000 3310 . 0.395 0.425 . 161 . 3471 . . 'X-RAY DIFFRACTION' 
2.528 2.558  30 89.000 3347 . 0.371 0.445 . 166 . 3513 . . 'X-RAY DIFFRACTION' 
2.558 2.589  30 89.000 3433 . 0.366 0.377 . 177 . 3610 . . 'X-RAY DIFFRACTION' 
2.589 2.622  30 90.000 3371 . 0.340 0.385 . 213 . 3584 . . 'X-RAY DIFFRACTION' 
2.622 2.657  30 91.000 3496 . 0.341 0.394 . 184 . 3680 . . 'X-RAY DIFFRACTION' 
2.657 2.693  30 92.000 3473 . 0.323 0.368 . 208 . 3681 . . 'X-RAY DIFFRACTION' 
2.693 2.731  30 91.000 3409 . 0.319 0.346 . 165 . 3574 . . 'X-RAY DIFFRACTION' 
2.731 2.772  30 92.000 3499 . 0.310 0.359 . 216 . 3715 . . 'X-RAY DIFFRACTION' 
2.772 2.816  30 92.000 3553 . 0.284 0.299 . 171 . 3724 . . 'X-RAY DIFFRACTION' 
2.816 2.862  30 93.000 3541 . 0.285 0.333 . 162 . 3703 . . 'X-RAY DIFFRACTION' 
2.862 2.911  30 94.000 3543 . 0.278 0.310 . 185 . 3728 . . 'X-RAY DIFFRACTION' 
2.911 2.964  30 93.000 3553 . 0.264 0.282 . 183 . 3736 . . 'X-RAY DIFFRACTION' 
2.964 3.021  30 95.000 3669 . 0.263 0.319 . 155 . 3824 . . 'X-RAY DIFFRACTION' 
3.021 3.083  30 95.000 3560 . 0.247 0.321 . 227 . 3787 . . 'X-RAY DIFFRACTION' 
3.083 3.150  30 96.000 3699 . 0.226 0.278 . 174 . 3873 . . 'X-RAY DIFFRACTION' 
3.150 3.223  30 96.000 3638 . 0.221 0.279 . 197 . 3835 . . 'X-RAY DIFFRACTION' 
3.223 3.303  30 97.000 3711 . 0.223 0.273 . 159 . 3870 . . 'X-RAY DIFFRACTION' 
3.303 3.393  30 97.000 3667 . 0.214 0.249 . 217 . 3884 . . 'X-RAY DIFFRACTION' 
3.393 3.493  30 97.000 3663 . 0.194 0.218 . 209 . 3872 . . 'X-RAY DIFFRACTION' 
3.493 3.605  30 98.000 3758 . 0.194 0.239 . 185 . 3943 . . 'X-RAY DIFFRACTION' 
3.605 3.734  30 98.000 3717 . 0.192 0.242 . 200 . 3917 . . 'X-RAY DIFFRACTION' 
3.734 3.883  30 98.000 3744 . 0.180 0.226 . 203 . 3947 . . 'X-RAY DIFFRACTION' 
3.883 4.060  30 98.000 3767 . 0.167 0.246 . 155 . 3922 . . 'X-RAY DIFFRACTION' 
4.060 4.274  30 98.000 3691 . 0.145 0.192 . 224 . 3915 . . 'X-RAY DIFFRACTION' 
4.274 4.542  30 98.000 3766 . 0.132 0.183 . 180 . 3946 . . 'X-RAY DIFFRACTION' 
4.542 4.892  30 99.000 3741 . 0.130 0.201 . 191 . 3932 . . 'X-RAY DIFFRACTION' 
4.892 5.384  30 99.000 3796 . 0.129 0.154 . 196 . 3992 . . 'X-RAY DIFFRACTION' 
5.384 6.161  30 99.000 3769 . 0.154 0.209 . 181 . 3950 . . 'X-RAY DIFFRACTION' 
6.161 7.757  30 99.000 3840 . 0.190 0.298 . 162 . 4002 . . 'X-RAY DIFFRACTION' 
7.757 47.963 30 98.000 3704 . 0.193 0.215 . 216 . 3920 . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3INU 
_struct.title                     'Crystal structure of an unbound KZ52 neutralizing anti-Ebolavirus antibody.' 
_struct.pdbx_descriptor           'KZ52 antibody fragment heavy chain, KZ52 antibody fragment light chain' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3INU 
_struct_keywords.pdbx_keywords   'IMMUNE SYSTEM' 
_struct_keywords.text            'antibody fragment (Fab), immunoglobulin fold, IMMUNE SYSTEM' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 1 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 4 ? 
I N N 3 ? 
J N N 4 ? 
K N N 3 ? 
L N N 3 ? 
M N N 3 ? 
N N N 4 ? 
O N N 3 ? 
P N N 4 ? 
Q N N 5 ? 
R N N 5 ? 
S N N 5 ? 
T N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  THR A 28  ? TYR A 32  ? THR H 28  TYR H 32  5 ? 5 
HELX_P HELX_P2  2  ASP A 62  ? LYS A 65  ? ASP H 61  LYS H 64  5 ? 4 
HELX_P HELX_P3  3  ASN A 74  ? GLU A 76  ? ASN H 73  GLU H 75  5 ? 3 
HELX_P HELX_P4  4  ARG A 87  ? THR A 91  ? ARG H 83  THR H 87  5 ? 5 
HELX_P HELX_P5  5  SER A 139 ? LYS A 141 ? SER H 127 LYS H 129 5 ? 3 
HELX_P HELX_P6  6  SER A 168 ? ALA A 170 ? SER H 163 ALA H 165 5 ? 3 
HELX_P HELX_P7  7  SER A 199 ? LEU A 201 ? SER H 196 LEU H 198 5 ? 3 
HELX_P HELX_P8  8  LYS A 213 ? ASN A 216 ? LYS H 213 ASN H 216 5 ? 4 
HELX_P HELX_P9  9  GLN B 85  ? VAL B 89  ? GLN L 79  VAL L 83  5 ? 5 
HELX_P HELX_P10 10 SER B 127 ? LYS B 132 ? SER L 121 LYS L 126 1 ? 6 
HELX_P HELX_P11 12 THR C 28  ? TYR C 32  ? THR M 28  TYR M 32  5 ? 5 
HELX_P HELX_P12 13 ASN C 74  ? GLU C 76  ? ASN M 73  GLU M 75  5 ? 3 
HELX_P HELX_P13 14 ARG C 87  ? THR C 91  ? ARG M 83  THR M 87  5 ? 5 
HELX_P HELX_P14 15 SER C 139 ? LYS C 141 ? SER M 127 LYS M 129 5 ? 3 
HELX_P HELX_P15 16 SER C 168 ? ALA C 170 ? SER M 163 ALA M 165 5 ? 3 
HELX_P HELX_P16 17 SER C 199 ? THR C 203 ? SER M 196 THR M 200 5 ? 5 
HELX_P HELX_P17 18 LYS C 213 ? ASN C 216 ? LYS M 213 ASN M 216 5 ? 4 
HELX_P HELX_P18 19 GLN D 85  ? VAL D 89  ? GLN N 79  VAL N 83  5 ? 5 
HELX_P HELX_P19 20 SER D 127 ? LYS D 132 ? SER N 121 LYS N 126 1 ? 6 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
disulf1 disulf ? ? A CYS 22  SG ? ? ? 1_555 A CYS 96  SG ? ? H CYS 22  H CYS 92  1_555 ? ? ? ? ? ? ? 2.044 ? 
disulf2 disulf ? ? A CYS 152 SG ? ? ? 1_555 A CYS 208 SG ? ? H CYS 142 H CYS 208 1_555 ? ? ? ? ? ? ? 2.026 ? 
disulf3 disulf ? ? B CYS 23  SG ? ? ? 1_555 B CYS 94  SG ? ? L CYS 23  L CYS 88  1_555 ? ? ? ? ? ? ? 2.063 ? 
disulf4 disulf ? ? B CYS 140 SG ? ? ? 1_555 B CYS 200 SG ? ? L CYS 134 L CYS 194 1_555 ? ? ? ? ? ? ? 2.024 ? 
disulf5 disulf ? ? C CYS 22  SG ? ? ? 1_555 C CYS 96  SG ? ? M CYS 22  M CYS 92  1_555 ? ? ? ? ? ? ? 2.037 ? 
disulf6 disulf ? ? C CYS 152 SG ? ? ? 1_555 C CYS 208 SG ? ? M CYS 142 M CYS 208 1_555 ? ? ? ? ? ? ? 2.024 ? 
disulf7 disulf ? ? D CYS 23  SG ? ? ? 1_555 D CYS 94  SG ? ? N CYS 23  N CYS 88  1_555 ? ? ? ? ? ? ? 2.059 ? 
disulf8 disulf ? ? D CYS 140 SG ? ? ? 1_555 D CYS 200 SG ? ? N CYS 134 N CYS 194 1_555 ? ? ? ? ? ? ? 2.027 ? 
# 
_struct_conn_type.id          disulf 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1  PHE 158 A . ? PHE 148 H PRO 159 A ? PRO 149 H 1 -0.09 
2  GLU 160 A . ? GLU 150 H PRO 161 A ? PRO 151 H 1 -0.62 
3  SER 7   B . ? SER 7   L PRO 8   B ? PRO 8   L 1 -2.75 
4  ALA 100 B . ? ALA 94  L PRO 101 B ? PRO 95  L 1 3.75  
5  TYR 146 B . ? TYR 140 L PRO 147 B ? PRO 141 L 1 2.73  
6  PHE 158 C . ? PHE 148 M PRO 159 C ? PRO 149 M 1 -3.54 
7  GLU 160 C . ? GLU 150 M PRO 161 C ? PRO 151 M 1 -2.08 
8  SER 7   D . ? SER 7   N PRO 8   D ? PRO 8   N 1 1.33  
9  ALA 100 D . ? ALA 94  N PRO 101 D ? PRO 95  N 1 -3.53 
10 TYR 146 D . ? TYR 140 N PRO 147 D ? PRO 141 N 1 1.26  
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 6 ? 
C ? 4 ? 
D ? 4 ? 
E ? 4 ? 
F ? 3 ? 
G ? 4 ? 
H ? 6 ? 
I ? 4 ? 
J ? 4 ? 
K ? 4 ? 
L ? 4 ? 
M ? 6 ? 
N ? 4 ? 
O ? 4 ? 
P ? 4 ? 
Q ? 3 ? 
R ? 4 ? 
S ? 6 ? 
T ? 4 ? 
U ? 4 ? 
V ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
D 2 3 ? anti-parallel 
D 3 4 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
G 1 2 ? anti-parallel 
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
H 1 2 ? parallel      
H 2 3 ? anti-parallel 
H 3 4 ? anti-parallel 
H 4 5 ? anti-parallel 
H 5 6 ? anti-parallel 
I 1 2 ? parallel      
I 2 3 ? anti-parallel 
I 3 4 ? anti-parallel 
J 1 2 ? anti-parallel 
J 2 3 ? anti-parallel 
J 3 4 ? anti-parallel 
K 1 2 ? anti-parallel 
K 2 3 ? anti-parallel 
K 3 4 ? anti-parallel 
L 1 2 ? anti-parallel 
L 2 3 ? anti-parallel 
L 3 4 ? anti-parallel 
M 1 2 ? parallel      
M 2 3 ? anti-parallel 
M 3 4 ? anti-parallel 
M 4 5 ? anti-parallel 
M 5 6 ? anti-parallel 
N 1 2 ? parallel      
N 2 3 ? anti-parallel 
N 3 4 ? anti-parallel 
O 1 2 ? anti-parallel 
O 2 3 ? anti-parallel 
O 3 4 ? anti-parallel 
P 1 2 ? anti-parallel 
P 2 3 ? anti-parallel 
P 3 4 ? anti-parallel 
Q 1 2 ? anti-parallel 
Q 2 3 ? anti-parallel 
R 1 2 ? anti-parallel 
R 2 3 ? anti-parallel 
R 3 4 ? anti-parallel 
S 1 2 ? parallel      
S 2 3 ? anti-parallel 
S 3 4 ? anti-parallel 
S 4 5 ? anti-parallel 
S 5 6 ? anti-parallel 
T 1 2 ? parallel      
T 2 3 ? anti-parallel 
T 3 4 ? anti-parallel 
U 1 2 ? anti-parallel 
U 2 3 ? anti-parallel 
U 3 4 ? anti-parallel 
V 1 2 ? anti-parallel 
V 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 GLN A 3   ? SER A 7   ? GLN H 3   SER H 7   
A 2 LEU A 18  ? SER A 25  ? LEU H 18  SER H 25  
A 3 SER A 78  ? MET A 83  ? SER H 77  MET H 82  
A 4 PHE A 68  ? ASP A 73  ? PHE H 67  ASP H 72  
B 1 GLY A 10  ? VAL A 12  ? GLY H 10  VAL H 12  
B 2 THR A 119 ? VAL A 123 ? THR H 107 VAL H 111 
B 3 ALA A 92  ? GLU A 99  ? ALA H 88  GLU H 95  
B 4 MET A 34  ? GLN A 39  ? MET H 34  GLN H 39  
B 5 LEU A 45  ? ILE A 51  ? LEU H 45  ILE H 51  
B 6 ILE A 58  ? TYR A 60  ? ILE H 57  TYR H 59  
C 1 GLY A 10  ? VAL A 12  ? GLY H 10  VAL H 12  
C 2 THR A 119 ? VAL A 123 ? THR H 107 VAL H 111 
C 3 ALA A 92  ? GLU A 99  ? ALA H 88  GLU H 95  
C 4 PHE A 112 H TRP A 115 ? PHE H 100 TRP H 103 
D 1 SER A 132 ? LEU A 136 ? SER H 120 LEU H 124 
D 2 THR A 147 ? TYR A 157 ? THR H 137 TYR H 147 
D 3 TYR A 188 ? PRO A 197 ? TYR H 185 PRO H 194 
D 4 HIS A 176 ? THR A 177 ? HIS H 172 THR H 173 
E 1 THR A 143 ? SER A 144 ? THR H 131 SER H 132 
E 2 THR A 147 ? TYR A 157 ? THR H 137 TYR H 147 
E 3 TYR A 188 ? PRO A 197 ? TYR H 185 PRO H 194 
E 4 VAL A 181 ? LEU A 182 ? VAL H 177 LEU H 178 
F 1 THR A 163 ? TRP A 166 ? THR H 153 TRP H 157 
F 2 TYR A 206 ? HIS A 212 ? TYR H 206 HIS H 212 
F 3 THR A 217 ? VAL A 223 ? THR H 217 VAL H 225 
G 1 MET B 4   ? SER B 7   ? MET L 4   SER L 7   
G 2 ALA B 19  ? SER B 25  ? ALA L 19  SER L 25  
G 3 ASP B 76  ? ILE B 81  ? ASP L 70  ILE L 75  
G 4 PHE B 68  ? SER B 73  ? PHE L 62  SER L 67  
H 1 SER B 10  ? SER B 14  ? SER L 10  SER L 14  
H 2 THR B 108 ? LYS B 113 ? THR L 102 LYS L 107 
H 3 ALA B 90  ? GLN B 96  ? ALA L 84  GLN L 90  
H 4 LEU B 39  ? GLN B 44  ? LEU L 33  GLN L 38  
H 5 LYS B 51  ? TYR B 55  ? LYS L 45  TYR L 49  
H 6 THR B 59  ? ARG B 60  ? THR L 53  ARG L 54  
I 1 SER B 10  ? SER B 14  ? SER L 10  SER L 14  
I 2 THR B 108 ? LYS B 113 ? THR L 102 LYS L 107 
I 3 ALA B 90  ? GLN B 96  ? ALA L 84  GLN L 90  
I 4 THR B 103 ? PHE B 104 ? THR L 97  PHE L 98  
J 1 SER B 120 ? PHE B 124 ? SER L 114 PHE L 118 
J 2 THR B 135 ? PHE B 145 ? THR L 129 PHE L 139 
J 3 TYR B 179 ? SER B 188 ? TYR L 173 SER L 182 
J 4 SER B 165 ? VAL B 169 ? SER L 159 VAL L 163 
K 1 ALA B 159 ? LEU B 160 ? ALA L 153 LEU L 154 
K 2 LYS B 151 ? VAL B 156 ? LYS L 145 VAL L 150 
K 3 VAL B 197 ? THR B 203 ? VAL L 191 THR L 197 
K 4 VAL B 211 ? ASN B 216 ? VAL L 205 ASN L 210 
L 1 GLN C 3   ? SER C 7   ? GLN M 3   SER M 7   
L 2 LEU C 18  ? SER C 25  ? LEU M 18  SER M 25  
L 3 SER C 78  ? MET C 83  ? SER M 77  MET M 82  
L 4 PHE C 68  ? ASP C 73  ? PHE M 67  ASP M 72  
M 1 GLY C 10  ? VAL C 12  ? GLY M 10  VAL M 12  
M 2 THR C 119 ? VAL C 123 ? THR M 107 VAL M 111 
M 3 ALA C 92  ? GLU C 99  ? ALA M 88  GLU M 95  
M 4 MET C 34  ? GLN C 39  ? MET M 34  GLN M 39  
M 5 GLU C 46  ? ILE C 51  ? GLU M 46  ILE M 51  
M 6 ILE C 58  ? TYR C 60  ? ILE M 57  TYR M 59  
N 1 GLY C 10  ? VAL C 12  ? GLY M 10  VAL M 12  
N 2 THR C 119 ? VAL C 123 ? THR M 107 VAL M 111 
N 3 ALA C 92  ? GLU C 99  ? ALA M 88  GLU M 95  
N 4 PHE C 112 H TRP C 115 ? PHE M 100 TRP M 103 
O 1 SER C 132 ? LEU C 136 ? SER M 120 LEU M 124 
O 2 THR C 147 ? TYR C 157 ? THR M 137 TYR M 147 
O 3 TYR C 188 ? PRO C 197 ? TYR M 185 PRO M 194 
O 4 VAL C 175 ? THR C 177 ? VAL M 171 THR M 173 
P 1 THR C 143 ? SER C 144 ? THR M 131 SER M 132 
P 2 THR C 147 ? TYR C 157 ? THR M 137 TYR M 147 
P 3 TYR C 188 ? PRO C 197 ? TYR M 185 PRO M 194 
P 4 VAL C 181 ? LEU C 182 ? VAL M 177 LEU M 178 
Q 1 THR C 163 ? TRP C 166 ? THR M 153 TRP M 157 
Q 2 TYR C 206 ? HIS C 212 ? TYR M 206 HIS M 212 
Q 3 THR C 217 ? VAL C 223 ? THR M 217 VAL M 225 
R 1 MET D 4   ? SER D 7   ? MET N 4   SER N 7   
R 2 ALA D 19  ? SER D 25  ? ALA N 19  SER N 25  
R 3 ASP D 76  ? ILE D 81  ? ASP N 70  ILE N 75  
R 4 PHE D 68  ? SER D 73  ? PHE N 62  SER N 67  
S 1 SER D 10  ? SER D 14  ? SER N 10  SER N 14  
S 2 THR D 108 ? LYS D 113 ? THR N 102 LYS N 107 
S 3 ALA D 90  ? GLN D 96  ? ALA N 84  GLN N 90  
S 4 LEU D 39  ? GLN D 44  ? LEU N 33  GLN N 38  
S 5 LYS D 51  ? TYR D 55  ? LYS N 45  TYR N 49  
S 6 THR D 59  ? ARG D 60  ? THR N 53  ARG N 54  
T 1 SER D 10  ? SER D 14  ? SER N 10  SER N 14  
T 2 THR D 108 ? LYS D 113 ? THR N 102 LYS N 107 
T 3 ALA D 90  ? GLN D 96  ? ALA N 84  GLN N 90  
T 4 THR D 103 ? PHE D 104 ? THR N 97  PHE N 98  
U 1 SER D 120 ? PHE D 124 ? SER N 114 PHE N 118 
U 2 THR D 135 ? PHE D 145 ? THR N 129 PHE N 139 
U 3 TYR D 179 ? SER D 188 ? TYR N 173 SER N 182 
U 4 SER D 165 ? VAL D 169 ? SER N 159 VAL N 163 
V 1 LYS D 151 ? VAL D 156 ? LYS N 145 VAL N 150 
V 2 VAL D 197 ? THR D 203 ? VAL N 191 THR N 197 
V 3 VAL D 211 ? ASN D 216 ? VAL N 205 ASN N 210 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 5   ? N LEU H 5   O ALA A 23  ? O ALA H 23  
A 2 3 N LEU A 20  ? N LEU H 20  O LEU A 81  ? O LEU H 80  
A 3 4 O SER A 78  ? O SER H 77  N ASP A 73  ? N ASP H 72  
B 1 2 N VAL A 12  ? N VAL H 12  O THR A 122 ? O THR H 110 
B 2 3 O THR A 119 ? O THR H 107 N TYR A 94  ? N TYR H 90  
B 3 4 O TYR A 95  ? O TYR H 91  N VAL A 37  ? N VAL H 37  
B 4 5 N ARG A 38  ? N ARG H 38  O GLU A 46  ? O GLU H 46  
B 5 6 N SER A 50  ? N SER H 50  O HIS A 59  ? O HIS H 58  
C 1 2 N VAL A 12  ? N VAL H 12  O THR A 122 ? O THR H 110 
C 2 3 O THR A 119 ? O THR H 107 N TYR A 94  ? N TYR H 90  
C 3 4 N ARG A 98  ? N ARG H 94  O ILE A 114 ? O ILE H 102 
D 1 2 N SER A 132 ? N SER H 120 O LYS A 155 ? O LYS H 145 
D 2 3 N ALA A 148 ? N ALA H 138 O VAL A 196 ? O VAL H 193 
D 3 4 O VAL A 193 ? O VAL H 190 N HIS A 176 ? N HIS H 172 
E 1 2 N SER A 144 ? N SER H 132 O THR A 147 ? O THR H 137 
E 2 3 N ALA A 148 ? N ALA H 138 O VAL A 196 ? O VAL H 193 
E 3 4 O SER A 189 ? O SER H 186 N VAL A 181 ? N VAL H 177 
F 1 2 N SER A 165 ? N SER H 156 O ASN A 209 ? O ASN H 209 
F 2 3 N TYR A 206 ? N TYR H 206 O VAL A 223 ? O VAL H 225 
G 1 2 N SER B 7   ? N SER L 7   O ASN B 22  ? O ASN L 22  
G 2 3 N ILE B 21  ? N ILE L 21  O LEU B 79  ? O LEU L 73  
G 3 4 O THR B 80  ? O THR L 74  N SER B 69  ? N SER L 63  
H 1 2 N LEU B 11  ? N LEU L 11  O GLU B 111 ? O GLU L 105 
H 2 3 O THR B 108 ? O THR L 102 N TYR B 92  ? N TYR L 86  
H 3 4 O TYR B 93  ? O TYR L 87  N TYR B 42  ? N TYR L 36  
H 4 5 N GLN B 43  ? N GLN L 37  O LYS B 51  ? O LYS L 45  
H 5 6 N TYR B 55  ? N TYR L 49  O THR B 59  ? O THR L 53  
I 1 2 N LEU B 11  ? N LEU L 11  O GLU B 111 ? O GLU L 105 
I 2 3 O THR B 108 ? O THR L 102 N TYR B 92  ? N TYR L 86  
I 3 4 N GLN B 96  ? N GLN L 90  O THR B 103 ? O THR L 97  
J 1 2 N PHE B 122 ? N PHE L 116 O LEU B 141 ? O LEU L 135 
J 2 3 N VAL B 138 ? N VAL L 132 O LEU B 185 ? O LEU L 179 
J 3 4 O THR B 184 ? O THR L 178 N GLN B 166 ? N GLN L 160 
K 1 2 O ALA B 159 ? O ALA L 153 N VAL B 156 ? N VAL L 150 
K 2 3 N GLN B 153 ? N GLN L 147 O GLU B 201 ? O GLU L 195 
K 3 4 N VAL B 202 ? N VAL L 196 O VAL B 211 ? O VAL L 205 
L 1 2 N GLN C 3   ? N GLN M 3   O SER C 25  ? O SER M 25  
L 2 3 N LEU C 18  ? N LEU M 18  O MET C 83  ? O MET M 82  
L 3 4 O TYR C 80  ? O TYR M 79  N SER C 71  ? N SER M 70  
M 1 2 N GLY C 10  ? N GLY M 10  O THR C 122 ? O THR M 110 
M 2 3 O THR C 119 ? O THR M 107 N TYR C 94  ? N TYR M 90  
M 3 4 O TYR C 95  ? O TYR M 91  N VAL C 37  ? N VAL M 37  
M 4 5 N ARG C 38  ? N ARG M 38  O GLU C 46  ? O GLU M 46  
M 5 6 N SER C 50  ? N SER M 50  O HIS C 59  ? O HIS M 58  
N 1 2 N GLY C 10  ? N GLY M 10  O THR C 122 ? O THR M 110 
N 2 3 O THR C 119 ? O THR M 107 N TYR C 94  ? N TYR M 90  
N 3 4 N ARG C 98  ? N ARG M 94  O ILE C 114 ? O ILE M 102 
O 1 2 N PHE C 134 ? N PHE M 122 O LEU C 153 ? O LEU M 143 
O 2 3 N ALA C 148 ? N ALA M 138 O VAL C 196 ? O VAL M 193 
O 3 4 O VAL C 193 ? O VAL M 190 N HIS C 176 ? N HIS M 172 
P 1 2 N SER C 144 ? N SER M 132 O THR C 147 ? O THR M 137 
P 2 3 N ALA C 148 ? N ALA M 138 O VAL C 196 ? O VAL M 193 
P 3 4 O SER C 189 ? O SER M 186 N VAL C 181 ? N VAL M 177 
Q 1 2 N SER C 165 ? N SER M 156 O ASN C 209 ? O ASN M 209 
Q 2 3 N VAL C 210 ? N VAL M 210 O VAL C 219 ? O VAL M 219 
R 1 2 N SER D 7   ? N SER N 7   O ASN D 22  ? O ASN N 22  
R 2 3 N CYS D 23  ? N CYS N 23  O PHE D 77  ? O PHE N 71  
R 3 4 O THR D 80  ? O THR N 74  N SER D 69  ? N SER N 63  
S 1 2 N LEU D 11  ? N LEU N 11  O GLU D 111 ? O GLU N 105 
S 2 3 O THR D 108 ? O THR N 102 N TYR D 92  ? N TYR N 86  
S 3 4 O TYR D 93  ? O TYR N 87  N TYR D 42  ? N TYR N 36  
S 4 5 N GLN D 43  ? N GLN N 37  O LYS D 51  ? O LYS N 45  
S 5 6 N TYR D 55  ? N TYR N 49  O THR D 59  ? O THR N 53  
T 1 2 N LEU D 11  ? N LEU N 11  O GLU D 111 ? O GLU N 105 
T 2 3 O THR D 108 ? O THR N 102 N TYR D 92  ? N TYR N 86  
T 3 4 N GLN D 96  ? N GLN N 90  O THR D 103 ? O THR N 97  
U 1 2 N PHE D 122 ? N PHE N 116 O LEU D 141 ? O LEU N 135 
U 2 3 N LEU D 142 ? N LEU N 136 O LEU D 181 ? O LEU N 175 
U 3 4 O THR D 184 ? O THR N 178 N GLN D 166 ? N GLN N 160 
V 1 2 N LYS D 155 ? N LYS N 149 O ALA D 199 ? O ALA N 193 
V 2 3 N VAL D 202 ? N VAL N 196 O VAL D 211 ? O VAL N 205 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 H 229' 
AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 H 230' 
AC3 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SO4 H 231' 
AC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE GOL H 232' 
AC5 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 L 212' 
AC6 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE GOL L 213' 
AC7 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE SO4 M 229' 
AC8 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 M 230' 
AC9 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SO4 M 231' 
BC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE GOL M 232' 
BC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 N 212' 
BC3 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE GOL N 213' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 PHE A 27  ? PHE H 27  . ? 1_555 ? 
2  AC1 4 THR A 28  ? THR H 28  . ? 1_555 ? 
3  AC1 4 ASN A 31  ? ASN H 31  . ? 1_555 ? 
4  AC1 4 TYR A 32  ? TYR H 32  . ? 1_555 ? 
5  AC2 4 SER A 52  ? SER H 52  . ? 1_555 ? 
6  AC2 4 SER A 53  A SER H 52  . ? 1_555 ? 
7  AC2 4 SER A 54  ? SER H 53  . ? 1_555 ? 
8  AC2 4 GLY A 105 A GLY H 100 . ? 1_555 ? 
9  AC3 3 SER A 124 ? SER H 112 . ? 1_555 ? 
10 AC3 3 SER A 125 ? SER H 113 . ? 1_555 ? 
11 AC3 3 ARG D 114 ? ARG N 108 . ? 3_455 ? 
12 AC4 4 GLN A 39  ? GLN H 39  . ? 1_555 ? 
13 AC4 4 ALA A 40  ? ALA H 40  . ? 1_555 ? 
14 AC4 4 GLY A 44  ? GLY H 44  . ? 1_555 ? 
15 AC4 4 GLU A 46  ? GLU H 46  . ? 1_555 ? 
16 AC5 4 LYS B 45  ? LYS L 39  . ? 1_555 ? 
17 AC5 4 GLN B 48  ? GLN L 42  . ? 1_555 ? 
18 AC5 4 LYS B 51  ? LYS L 45  . ? 1_555 ? 
19 AC5 4 GOL J .   ? GOL L 213 . ? 1_555 ? 
20 AC6 6 GLN B 43  ? GLN L 37  . ? 1_555 ? 
21 AC6 6 LYS B 45  ? LYS L 39  . ? 1_555 ? 
22 AC6 6 LYS B 51  ? LYS L 45  . ? 1_555 ? 
23 AC6 6 LEU B 53  ? LEU L 47  . ? 1_555 ? 
24 AC6 6 ASP B 88  ? ASP L 82  . ? 1_555 ? 
25 AC6 6 SO4 I .   ? SO4 L 212 . ? 1_555 ? 
26 AC7 2 ARG B 114 ? ARG L 108 . ? 1_555 ? 
27 AC7 2 SER C 125 ? SER M 113 . ? 1_555 ? 
28 AC8 4 PHE C 27  ? PHE M 27  . ? 1_555 ? 
29 AC8 4 THR C 28  ? THR M 28  . ? 1_555 ? 
30 AC8 4 ASN C 31  ? ASN M 31  . ? 1_555 ? 
31 AC8 4 TYR C 32  ? TYR M 32  . ? 1_555 ? 
32 AC9 5 SER C 52  ? SER M 52  . ? 1_555 ? 
33 AC9 5 SER C 53  A SER M 52  . ? 1_555 ? 
34 AC9 5 SER C 54  ? SER M 53  . ? 1_555 ? 
35 AC9 5 THR C 104 ? THR M 100 . ? 1_555 ? 
36 AC9 5 GLY C 105 A GLY M 100 . ? 1_555 ? 
37 BC1 3 ALA C 40  ? ALA M 40  . ? 1_555 ? 
38 BC1 3 GLY C 44  ? GLY M 44  . ? 1_555 ? 
39 BC1 3 GLU C 46  ? GLU M 46  . ? 1_555 ? 
40 BC2 4 LYS D 45  ? LYS N 39  . ? 1_555 ? 
41 BC2 4 GLN D 48  ? GLN N 42  . ? 1_555 ? 
42 BC2 4 LYS D 51  ? LYS N 45  . ? 1_555 ? 
43 BC2 4 GOL P .   ? GOL N 213 . ? 1_555 ? 
44 BC3 5 GLN D 43  ? GLN N 37  . ? 1_555 ? 
45 BC3 5 LYS D 45  ? LYS N 39  . ? 1_555 ? 
46 BC3 5 LYS D 51  ? LYS N 45  . ? 1_555 ? 
47 BC3 5 ASP D 88  ? ASP N 82  . ? 1_555 ? 
48 BC3 5 SO4 O .   ? SO4 N 212 . ? 1_555 ? 
# 
_atom_sites.entry_id                    3INU 
_atom_sites.fract_transf_matrix[1][1]   0.007721 
_atom_sites.fract_transf_matrix[1][2]   0.004458 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.008915 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005407 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . GLU A 1 1   ? -65.903 73.839 -156.295 1.00 83.36  ? 1   GLU H N   1 
ATOM   2    C CA  . GLU A 1 1   ? -66.693 75.054 -156.392 1.00 89.72  ? 1   GLU H CA  1 
ATOM   3    C C   . GLU A 1 1   ? -68.132 74.799 -155.970 1.00 85.10  ? 1   GLU H C   1 
ATOM   4    O O   . GLU A 1 1   ? -68.660 75.538 -155.138 1.00 92.34  ? 1   GLU H O   1 
ATOM   5    C CB  . GLU A 1 1   ? -66.652 75.622 -157.807 1.00 101.11 ? 1   GLU H CB  1 
ATOM   6    C CG  . GLU A 1 1   ? -65.250 75.804 -158.343 1.00 114.30 ? 1   GLU H CG  1 
ATOM   7    C CD  . GLU A 1 1   ? -65.220 75.968 -159.849 1.00 123.46 ? 1   GLU H CD  1 
ATOM   8    O OE1 . GLU A 1 1   ? -66.060 76.729 -160.377 1.00 124.69 ? 1   GLU H OE1 1 
ATOM   9    O OE2 . GLU A 1 1   ? -64.355 75.337 -160.500 1.00 125.81 ? 1   GLU H OE2 1 
ATOM   10   N N   . VAL A 1 2   ? -68.773 73.773 -156.534 1.00 68.05  ? 2   VAL H N   1 
ATOM   11   C CA  . VAL A 1 2   ? -70.145 73.450 -156.120 1.00 64.68  ? 2   VAL H CA  1 
ATOM   12   C C   . VAL A 1 2   ? -70.162 72.349 -155.073 1.00 64.68  ? 2   VAL H C   1 
ATOM   13   O O   . VAL A 1 2   ? -69.826 71.205 -155.368 1.00 62.14  ? 2   VAL H O   1 
ATOM   14   C CB  . VAL A 1 2   ? -71.062 73.062 -157.301 1.00 63.66  ? 2   VAL H CB  1 
ATOM   15   C CG1 . VAL A 1 2   ? -72.362 72.500 -156.791 1.00 58.72  ? 2   VAL H CG1 1 
ATOM   16   C CG2 . VAL A 1 2   ? -71.351 74.276 -158.168 1.00 63.71  ? 2   VAL H CG2 1 
ATOM   17   N N   . GLN A 1 3   ? -70.558 72.690 -153.848 1.00 66.73  ? 3   GLN H N   1 
ATOM   18   C CA  . GLN A 1 3   ? -70.370 71.760 -152.745 1.00 70.83  ? 3   GLN H CA  1 
ATOM   19   C C   . GLN A 1 3   ? -71.206 72.013 -151.494 1.00 66.86  ? 3   GLN H C   1 
ATOM   20   O O   . GLN A 1 3   ? -71.835 73.054 -151.344 1.00 70.98  ? 3   GLN H O   1 
ATOM   21   C CB  . GLN A 1 3   ? -68.922 71.808 -152.331 1.00 75.28  ? 3   GLN H CB  1 
ATOM   22   C CG  . GLN A 1 3   ? -68.611 73.107 -151.680 1.00 82.96  ? 3   GLN H CG  1 
ATOM   23   C CD  . GLN A 1 3   ? -67.146 73.337 -151.622 1.00 92.53  ? 3   GLN H CD  1 
ATOM   24   O OE1 . GLN A 1 3   ? -66.378 72.591 -152.225 1.00 90.42  ? 3   GLN H OE1 1 
ATOM   25   N NE2 . GLN A 1 3   ? -66.731 74.372 -150.898 1.00 99.99  ? 3   GLN H NE2 1 
ATOM   26   N N   . LEU A 1 4   ? -71.155 71.047 -150.581 1.00 60.62  ? 4   LEU H N   1 
ATOM   27   C CA  . LEU A 1 4   ? -71.918 71.078 -149.343 1.00 53.69  ? 4   LEU H CA  1 
ATOM   28   C C   . LEU A 1 4   ? -70.999 70.878 -148.141 1.00 56.11  ? 4   LEU H C   1 
ATOM   29   O O   . LEU A 1 4   ? -70.404 69.816 -147.982 1.00 59.00  ? 4   LEU H O   1 
ATOM   30   C CB  . LEU A 1 4   ? -72.978 69.982 -149.386 1.00 48.66  ? 4   LEU H CB  1 
ATOM   31   C CG  . LEU A 1 4   ? -74.043 70.210 -150.459 1.00 45.03  ? 4   LEU H CG  1 
ATOM   32   C CD1 . LEU A 1 4   ? -74.892 68.976 -150.683 1.00 40.61  ? 4   LEU H CD1 1 
ATOM   33   C CD2 . LEU A 1 4   ? -74.904 71.400 -150.087 1.00 42.93  ? 4   LEU H CD2 1 
ATOM   34   N N   . LEU A 1 5   ? -70.866 71.898 -147.298 1.00 61.06  ? 5   LEU H N   1 
ATOM   35   C CA  . LEU A 1 5   ? -69.989 71.793 -146.131 1.00 67.34  ? 5   LEU H CA  1 
ATOM   36   C C   . LEU A 1 5   ? -70.802 71.467 -144.896 1.00 65.42  ? 5   LEU H C   1 
ATOM   37   O O   . LEU A 1 5   ? -71.647 72.256 -144.474 1.00 69.83  ? 5   LEU H O   1 
ATOM   38   C CB  . LEU A 1 5   ? -69.201 73.076 -145.899 1.00 75.37  ? 5   LEU H CB  1 
ATOM   39   C CG  . LEU A 1 5   ? -68.563 73.647 -147.159 1.00 94.54  ? 5   LEU H CG  1 
ATOM   40   C CD1 . LEU A 1 5   ? -67.535 74.731 -146.813 1.00 103.94 ? 5   LEU H CD1 1 
ATOM   41   C CD2 . LEU A 1 5   ? -67.930 72.523 -147.968 1.00 96.81  ? 5   LEU H CD2 1 
ATOM   42   N N   . GLU A 1 6   ? -70.524 70.301 -144.322 1.00 55.68  ? 6   GLU H N   1 
ATOM   43   C CA  . GLU A 1 6   ? -71.286 69.765 -143.207 1.00 49.87  ? 6   GLU H CA  1 
ATOM   44   C C   . GLU A 1 6   ? -70.615 70.054 -141.879 1.00 52.82  ? 6   GLU H C   1 
ATOM   45   O O   . GLU A 1 6   ? -69.394 70.018 -141.777 1.00 52.98  ? 6   GLU H O   1 
ATOM   46   C CB  . GLU A 1 6   ? -71.421 68.244 -143.346 1.00 45.55  ? 6   GLU H CB  1 
ATOM   47   C CG  . GLU A 1 6   ? -72.072 67.775 -144.614 1.00 47.51  ? 6   GLU H CG  1 
ATOM   48   C CD  . GLU A 1 6   ? -72.623 66.373 -144.493 1.00 50.36  ? 6   GLU H CD  1 
ATOM   49   O OE1 . GLU A 1 6   ? -72.503 65.606 -145.464 1.00 51.18  ? 6   GLU H OE1 1 
ATOM   50   O OE2 . GLU A 1 6   ? -73.167 66.034 -143.423 1.00 51.29  ? 6   GLU H OE2 1 
ATOM   51   N N   . SER A 1 7   ? -71.418 70.308 -140.853 1.00 57.41  ? 7   SER H N   1 
ATOM   52   C CA  . SER A 1 7   ? -70.906 70.351 -139.487 1.00 58.47  ? 7   SER H CA  1 
ATOM   53   C C   . SER A 1 7   ? -71.892 69.739 -138.500 1.00 59.00  ? 7   SER H C   1 
ATOM   54   O O   . SER A 1 7   ? -73.041 69.463 -138.833 1.00 61.77  ? 7   SER H O   1 
ATOM   55   C CB  . SER A 1 7   ? -70.573 71.777 -139.077 1.00 53.88  ? 7   SER H CB  1 
ATOM   56   O OG  . SER A 1 7   ? -71.511 72.664 -139.641 1.00 62.48  ? 7   SER H OG  1 
ATOM   57   N N   . GLY A 1 8   ? -71.431 69.543 -137.275 1.00 56.89  ? 8   GLY H N   1 
ATOM   58   C CA  . GLY A 1 8   ? -72.232 68.892 -136.264 1.00 58.92  ? 8   GLY H CA  1 
ATOM   59   C C   . GLY A 1 8   ? -71.817 67.444 -136.112 1.00 57.11  ? 8   GLY H C   1 
ATOM   60   O O   . GLY A 1 8   ? -70.813 67.009 -136.666 1.00 66.48  ? 8   GLY H O   1 
ATOM   61   N N   . GLY A 1 9   ? -72.589 66.694 -135.346 1.00 52.05  ? 9   GLY H N   1 
ATOM   62   C CA  . GLY A 1 9   ? -72.299 65.289 -135.159 1.00 54.38  ? 9   GLY H CA  1 
ATOM   63   C C   . GLY A 1 9   ? -71.423 65.009 -133.962 1.00 56.49  ? 9   GLY H C   1 
ATOM   64   O O   . GLY A 1 9   ? -71.082 65.895 -133.185 1.00 57.47  ? 9   GLY H O   1 
ATOM   65   N N   . GLY A 1 10  ? -71.059 63.750 -133.804 1.00 57.17  ? 10  GLY H N   1 
ATOM   66   C CA  . GLY A 1 10  ? -70.232 63.371 -132.685 1.00 54.53  ? 10  GLY H CA  1 
ATOM   67   C C   . GLY A 1 10  ? -70.921 62.398 -131.762 1.00 52.21  ? 10  GLY H C   1 
ATOM   68   O O   . GLY A 1 10  ? -71.871 61.721 -132.141 1.00 47.76  ? 10  GLY H O   1 
ATOM   69   N N   . LEU A 1 11  ? -70.421 62.339 -130.537 1.00 53.77  ? 11  LEU H N   1 
ATOM   70   C CA  . LEU A 1 11  ? -70.890 61.390 -129.554 1.00 48.10  ? 11  LEU H CA  1 
ATOM   71   C C   . LEU A 1 11  ? -72.117 61.943 -128.853 1.00 51.74  ? 11  LEU H C   1 
ATOM   72   O O   . LEU A 1 11  ? -72.181 63.129 -128.528 1.00 49.42  ? 11  LEU H O   1 
ATOM   73   C CB  . LEU A 1 11  ? -69.786 61.150 -128.544 1.00 38.42  ? 11  LEU H CB  1 
ATOM   74   C CG  . LEU A 1 11  ? -70.073 60.175 -127.414 1.00 44.11  ? 11  LEU H CG  1 
ATOM   75   C CD1 . LEU A 1 11  ? -70.477 58.852 -127.993 1.00 44.17  ? 11  LEU H CD1 1 
ATOM   76   C CD2 . LEU A 1 11  ? -68.828 60.035 -126.555 1.00 48.30  ? 11  LEU H CD2 1 
ATOM   77   N N   . VAL A 1 12  ? -73.094 61.084 -128.605 1.00 48.16  ? 12  VAL H N   1 
ATOM   78   C CA  . VAL A 1 12  ? -74.267 61.523 -127.876 1.00 46.80  ? 12  VAL H CA  1 
ATOM   79   C C   . VAL A 1 12  ? -74.830 60.335 -127.108 1.00 46.64  ? 12  VAL H C   1 
ATOM   80   O O   . VAL A 1 12  ? -74.718 59.195 -127.548 1.00 47.81  ? 12  VAL H O   1 
ATOM   81   C CB  . VAL A 1 12  ? -75.308 62.135 -128.836 1.00 49.79  ? 12  VAL H CB  1 
ATOM   82   C CG1 . VAL A 1 12  ? -75.601 61.177 -129.958 1.00 55.70  ? 12  VAL H CG1 1 
ATOM   83   C CG2 . VAL A 1 12  ? -76.573 62.473 -128.111 1.00 48.05  ? 12  VAL H CG2 1 
ATOM   84   N N   . LYS A 1 13  ? -75.413 60.596 -125.945 1.00 46.32  ? 13  LYS H N   1 
ATOM   85   C CA  . LYS A 1 13  ? -75.968 59.518 -125.137 1.00 45.36  ? 13  LYS H CA  1 
ATOM   86   C C   . LYS A 1 13  ? -77.318 59.059 -125.663 1.00 45.91  ? 13  LYS H C   1 
ATOM   87   O O   . LYS A 1 13  ? -78.055 59.832 -126.278 1.00 47.47  ? 13  LYS H O   1 
ATOM   88   C CB  . LYS A 1 13  ? -76.073 59.944 -123.679 1.00 40.49  ? 13  LYS H CB  1 
ATOM   89   C CG  . LYS A 1 13  ? -74.764 59.844 -122.955 1.00 51.47  ? 13  LYS H CG  1 
ATOM   90   C CD  . LYS A 1 13  ? -74.788 60.583 -121.641 1.00 63.09  ? 13  LYS H CD  1 
ATOM   91   C CE  . LYS A 1 13  ? -73.630 60.140 -120.759 1.00 68.37  ? 13  LYS H CE  1 
ATOM   92   N NZ  . LYS A 1 13  ? -72.361 59.990 -121.540 1.00 71.46  ? 13  LYS H NZ  1 
ATOM   93   N N   . PRO A 1 14  ? -77.642 57.786 -125.447 1.00 44.08  ? 14  PRO H N   1 
ATOM   94   C CA  . PRO A 1 14  ? -78.978 57.334 -125.833 1.00 49.96  ? 14  PRO H CA  1 
ATOM   95   C C   . PRO A 1 14  ? -79.991 58.275 -125.221 1.00 51.87  ? 14  PRO H C   1 
ATOM   96   O O   . PRO A 1 14  ? -79.849 58.661 -124.057 1.00 50.62  ? 14  PRO H O   1 
ATOM   97   C CB  . PRO A 1 14  ? -79.081 55.960 -125.174 1.00 43.45  ? 14  PRO H CB  1 
ATOM   98   C CG  . PRO A 1 14  ? -77.686 55.504 -125.086 1.00 49.66  ? 14  PRO H CG  1 
ATOM   99   C CD  . PRO A 1 14  ? -76.872 56.727 -124.787 1.00 48.31  ? 14  PRO H CD  1 
ATOM   100  N N   . GLY A 1 15  ? -80.989 58.657 -126.000 1.00 47.58  ? 15  GLY H N   1 
ATOM   101  C CA  . GLY A 1 15  ? -82.024 59.538 -125.501 1.00 47.17  ? 15  GLY H CA  1 
ATOM   102  C C   . GLY A 1 15  ? -81.618 60.985 -125.688 1.00 47.07  ? 15  GLY H C   1 
ATOM   103  O O   . GLY A 1 15  ? -82.430 61.903 -125.587 1.00 50.87  ? 15  GLY H O   1 
ATOM   104  N N   . GLY A 1 16  ? -80.343 61.186 -125.977 1.00 43.32  ? 16  GLY H N   1 
ATOM   105  C CA  . GLY A 1 16  ? -79.832 62.524 -126.182 1.00 38.78  ? 16  GLY H CA  1 
ATOM   106  C C   . GLY A 1 16  ? -80.221 63.075 -127.538 1.00 43.74  ? 16  GLY H C   1 
ATOM   107  O O   . GLY A 1 16  ? -80.958 62.446 -128.301 1.00 45.42  ? 16  GLY H O   1 
ATOM   108  N N   . SER A 1 17  ? -79.704 64.252 -127.852 1.00 43.85  ? 17  SER H N   1 
ATOM   109  C CA  . SER A 1 17  ? -80.071 64.912 -129.088 1.00 47.29  ? 17  SER H CA  1 
ATOM   110  C C   . SER A 1 17  ? -78.887 65.655 -129.660 1.00 42.32  ? 17  SER H C   1 
ATOM   111  O O   . SER A 1 17  ? -77.930 65.943 -128.961 1.00 47.13  ? 17  SER H O   1 
ATOM   112  C CB  . SER A 1 17  ? -81.272 65.855 -128.880 1.00 54.08  ? 17  SER H CB  1 
ATOM   113  O OG  . SER A 1 17  ? -80.933 66.960 -128.069 1.00 58.07  ? 17  SER H OG  1 
ATOM   114  N N   . LEU A 1 18  ? -78.985 65.992 -130.936 1.00 47.10  ? 18  LEU H N   1 
ATOM   115  C CA  . LEU A 1 18  ? -77.858 66.465 -131.703 1.00 44.74  ? 18  LEU H CA  1 
ATOM   116  C C   . LEU A 1 18  ? -78.433 67.213 -132.896 1.00 50.82  ? 18  LEU H C   1 
ATOM   117  O O   . LEU A 1 18  ? -79.473 66.823 -133.421 1.00 54.56  ? 18  LEU H O   1 
ATOM   118  C CB  . LEU A 1 18  ? -77.123 65.239 -132.198 1.00 45.48  ? 18  LEU H CB  1 
ATOM   119  C CG  . LEU A 1 18  ? -75.623 65.332 -132.277 1.00 54.88  ? 18  LEU H CG  1 
ATOM   120  C CD1 . LEU A 1 18  ? -75.197 66.339 -131.279 1.00 60.18  ? 18  LEU H CD1 1 
ATOM   121  C CD2 . LEU A 1 18  ? -75.078 63.977 -131.938 1.00 59.93  ? 18  LEU H CD2 1 
ATOM   122  N N   . ARG A 1 19  ? -77.781 68.287 -133.326 1.00 48.44  ? 19  ARG H N   1 
ATOM   123  C CA  . ARG A 1 19  ? -78.232 69.018 -134.513 1.00 49.70  ? 19  ARG H CA  1 
ATOM   124  C C   . ARG A 1 19  ? -77.163 69.064 -135.611 1.00 52.69  ? 19  ARG H C   1 
ATOM   125  O O   . ARG A 1 19  ? -76.049 69.539 -135.389 1.00 55.75  ? 19  ARG H O   1 
ATOM   126  C CB  . ARG A 1 19  ? -78.650 70.437 -134.135 1.00 51.92  ? 19  ARG H CB  1 
ATOM   127  C CG  . ARG A 1 19  ? -78.959 71.362 -135.303 1.00 60.91  ? 19  ARG H CG  1 
ATOM   128  C CD  . ARG A 1 19  ? -78.726 72.810 -134.874 1.00 78.06  ? 19  ARG H CD  1 
ATOM   129  N NE  . ARG A 1 19  ? -79.367 73.810 -135.724 1.00 91.27  ? 19  ARG H NE  1 
ATOM   130  C CZ  . ARG A 1 19  ? -80.685 73.957 -135.845 1.00 100.74 ? 19  ARG H CZ  1 
ATOM   131  N NH1 . ARG A 1 19  ? -81.180 74.911 -136.629 1.00 103.33 ? 19  ARG H NH1 1 
ATOM   132  N NH2 . ARG A 1 19  ? -81.511 73.144 -135.193 1.00 100.85 ? 19  ARG H NH2 1 
ATOM   133  N N   . LEU A 1 20  ? -77.503 68.566 -136.795 1.00 50.29  ? 20  LEU H N   1 
ATOM   134  C CA  . LEU A 1 20  ? -76.593 68.637 -137.928 1.00 45.92  ? 20  LEU H CA  1 
ATOM   135  C C   . LEU A 1 20  ? -76.924 69.848 -138.779 1.00 47.47  ? 20  LEU H C   1 
ATOM   136  O O   . LEU A 1 20  ? -78.083 70.256 -138.877 1.00 55.63  ? 20  LEU H O   1 
ATOM   137  C CB  . LEU A 1 20  ? -76.696 67.380 -138.786 1.00 48.72  ? 20  LEU H CB  1 
ATOM   138  C CG  . LEU A 1 20  ? -76.528 66.037 -138.073 1.00 53.20  ? 20  LEU H CG  1 
ATOM   139  C CD1 . LEU A 1 20  ? -76.785 64.874 -139.033 1.00 44.66  ? 20  LEU H CD1 1 
ATOM   140  C CD2 . LEU A 1 20  ? -75.162 65.934 -137.392 1.00 47.98  ? 20  LEU H CD2 1 
ATOM   141  N N   . SER A 1 21  ? -75.904 70.429 -139.393 1.00 43.31  ? 21  SER H N   1 
ATOM   142  C CA  . SER A 1 21  ? -76.138 71.464 -140.384 1.00 50.54  ? 21  SER H CA  1 
ATOM   143  C C   . SER A 1 21  ? -75.218 71.359 -141.599 1.00 54.49  ? 21  SER H C   1 
ATOM   144  O O   . SER A 1 21  ? -74.112 70.813 -141.541 1.00 53.20  ? 21  SER H O   1 
ATOM   145  C CB  . SER A 1 21  ? -76.061 72.854 -139.763 1.00 54.39  ? 21  SER H CB  1 
ATOM   146  O OG  . SER A 1 21  ? -74.755 73.138 -139.323 1.00 60.46  ? 21  SER H OG  1 
ATOM   147  N N   . CYS A 1 22  ? -75.711 71.885 -142.707 1.00 55.28  ? 22  CYS H N   1 
ATOM   148  C CA  . CYS A 1 22  ? -75.001 71.842 -143.963 1.00 55.12  ? 22  CYS H CA  1 
ATOM   149  C C   . CYS A 1 22  ? -75.099 73.203 -144.630 1.00 61.10  ? 22  CYS H C   1 
ATOM   150  O O   . CYS A 1 22  ? -76.168 73.816 -144.688 1.00 60.98  ? 22  CYS H O   1 
ATOM   151  C CB  . CYS A 1 22  ? -75.623 70.792 -144.856 1.00 49.70  ? 22  CYS H CB  1 
ATOM   152  S SG  . CYS A 1 22  ? -74.727 70.521 -146.345 1.00 92.16  ? 22  CYS H SG  1 
ATOM   153  N N   . ALA A 1 23  ? -73.972 73.687 -145.115 1.00 63.10  ? 23  ALA H N   1 
ATOM   154  C CA  . ALA A 1 23  ? -73.947 74.951 -145.815 1.00 62.10  ? 23  ALA H CA  1 
ATOM   155  C C   . ALA A 1 23  ? -73.562 74.699 -147.259 1.00 59.02  ? 23  ALA H C   1 
ATOM   156  O O   . ALA A 1 23  ? -72.563 74.029 -147.538 1.00 58.94  ? 23  ALA H O   1 
ATOM   157  C CB  . ALA A 1 23  ? -72.962 75.883 -145.159 1.00 63.13  ? 23  ALA H CB  1 
ATOM   158  N N   . ALA A 1 24  ? -74.362 75.216 -148.179 1.00 55.38  ? 24  ALA H N   1 
ATOM   159  C CA  . ALA A 1 24  ? -74.044 75.078 -149.589 1.00 60.80  ? 24  ALA H CA  1 
ATOM   160  C C   . ALA A 1 24  ? -73.225 76.271 -150.062 1.00 64.18  ? 24  ALA H C   1 
ATOM   161  O O   . ALA A 1 24  ? -73.494 77.409 -149.684 1.00 70.36  ? 24  ALA H O   1 
ATOM   162  C CB  . ALA A 1 24  ? -75.316 74.943 -150.407 1.00 65.15  ? 24  ALA H CB  1 
ATOM   163  N N   . SER A 1 25  ? -72.208 76.006 -150.870 1.00 66.95  ? 25  SER H N   1 
ATOM   164  C CA  . SER A 1 25  ? -71.520 77.067 -151.600 1.00 71.25  ? 25  SER H CA  1 
ATOM   165  C C   . SER A 1 25  ? -71.426 76.678 -153.071 1.00 70.10  ? 25  SER H C   1 
ATOM   166  O O   . SER A 1 25  ? -71.349 75.493 -153.409 1.00 66.35  ? 25  SER H O   1 
ATOM   167  C CB  . SER A 1 25  ? -70.126 77.326 -151.030 1.00 75.69  ? 25  SER H CB  1 
ATOM   168  O OG  . SER A 1 25  ? -69.235 76.285 -151.383 1.00 79.75  ? 25  SER H OG  1 
ATOM   169  N N   . GLY A 1 26  ? -71.450 77.675 -153.945 1.00 73.62  ? 26  GLY H N   1 
ATOM   170  C CA  . GLY A 1 26  ? -71.312 77.428 -155.368 1.00 72.46  ? 26  GLY H CA  1 
ATOM   171  C C   . GLY A 1 26  ? -72.644 77.207 -156.054 1.00 72.10  ? 26  GLY H C   1 
ATOM   172  O O   . GLY A 1 26  ? -72.692 76.924 -157.256 1.00 72.83  ? 26  GLY H O   1 
ATOM   173  N N   . PHE A 1 27  ? -73.724 77.315 -155.280 1.00 64.75  ? 27  PHE H N   1 
ATOM   174  C CA  . PHE A 1 27  ? -75.076 77.263 -155.825 1.00 57.59  ? 27  PHE H CA  1 
ATOM   175  C C   . PHE A 1 27  ? -76.070 77.738 -154.781 1.00 61.52  ? 27  PHE H C   1 
ATOM   176  O O   . PHE A 1 27  ? -75.697 78.020 -153.644 1.00 60.60  ? 27  PHE H O   1 
ATOM   177  C CB  . PHE A 1 27  ? -75.432 75.866 -156.331 1.00 55.94  ? 27  PHE H CB  1 
ATOM   178  C CG  . PHE A 1 27  ? -75.786 74.888 -155.247 1.00 62.88  ? 27  PHE H CG  1 
ATOM   179  C CD1 . PHE A 1 27  ? -77.105 74.708 -154.863 1.00 60.69  ? 27  PHE H CD1 1 
ATOM   180  C CD2 . PHE A 1 27  ? -74.799 74.130 -154.623 1.00 66.42  ? 27  PHE H CD2 1 
ATOM   181  C CE1 . PHE A 1 27  ? -77.433 73.805 -153.867 1.00 62.59  ? 27  PHE H CE1 1 
ATOM   182  C CE2 . PHE A 1 27  ? -75.124 73.222 -153.627 1.00 65.37  ? 27  PHE H CE2 1 
ATOM   183  C CZ  . PHE A 1 27  ? -76.441 73.058 -153.249 1.00 64.11  ? 27  PHE H CZ  1 
ATOM   184  N N   . THR A 1 28  ? -77.335 77.834 -155.173 1.00 63.85  ? 28  THR H N   1 
ATOM   185  C CA  . THR A 1 28  ? -78.338 78.465 -154.331 1.00 65.81  ? 28  THR H CA  1 
ATOM   186  C C   . THR A 1 28  ? -79.385 77.448 -153.904 1.00 66.43  ? 28  THR H C   1 
ATOM   187  O O   . THR A 1 28  ? -80.107 76.892 -154.735 1.00 66.68  ? 28  THR H O   1 
ATOM   188  C CB  . THR A 1 28  ? -79.012 79.637 -155.074 1.00 68.50  ? 28  THR H CB  1 
ATOM   189  O OG1 . THR A 1 28  ? -78.052 80.263 -155.927 1.00 69.64  ? 28  THR H OG1 1 
ATOM   190  C CG2 . THR A 1 28  ? -79.550 80.667 -154.101 1.00 68.40  ? 28  THR H CG2 1 
ATOM   191  N N   . LEU A 1 29  ? -79.456 77.208 -152.600 1.00 67.88  ? 29  LEU H N   1 
ATOM   192  C CA  . LEU A 1 29  ? -80.354 76.203 -152.045 1.00 66.96  ? 29  LEU H CA  1 
ATOM   193  C C   . LEU A 1 29  ? -81.761 76.301 -152.600 1.00 72.99  ? 29  LEU H C   1 
ATOM   194  O O   . LEU A 1 29  ? -82.401 75.284 -152.861 1.00 73.08  ? 29  LEU H O   1 
ATOM   195  C CB  . LEU A 1 29  ? -80.431 76.346 -150.534 1.00 62.46  ? 29  LEU H CB  1 
ATOM   196  C CG  . LEU A 1 29  ? -79.613 75.363 -149.724 1.00 59.30  ? 29  LEU H CG  1 
ATOM   197  C CD1 . LEU A 1 29  ? -80.408 75.035 -148.468 1.00 62.90  ? 29  LEU H CD1 1 
ATOM   198  C CD2 . LEU A 1 29  ? -79.374 74.129 -150.548 1.00 49.32  ? 29  LEU H CD2 1 
ATOM   199  N N   . ILE A 1 30  ? -82.236 77.533 -152.758 1.00 73.54  ? 30  ILE H N   1 
ATOM   200  C CA  . ILE A 1 30  ? -83.617 77.794 -153.133 1.00 75.25  ? 30  ILE H CA  1 
ATOM   201  C C   . ILE A 1 30  ? -84.088 76.923 -154.307 1.00 74.89  ? 30  ILE H C   1 
ATOM   202  O O   . ILE A 1 30  ? -85.248 76.520 -154.367 1.00 79.01  ? 30  ILE H O   1 
ATOM   203  C CB  . ILE A 1 30  ? -83.813 79.289 -153.465 1.00 80.82  ? 30  ILE H CB  1 
ATOM   204  C CG1 . ILE A 1 30  ? -85.286 79.612 -153.739 1.00 77.26  ? 30  ILE H CG1 1 
ATOM   205  C CG2 . ILE A 1 30  ? -82.937 79.686 -154.650 1.00 84.22  ? 30  ILE H CG2 1 
ATOM   206  C CD1 . ILE A 1 30  ? -86.141 79.771 -152.496 1.00 71.69  ? 30  ILE H CD1 1 
ATOM   207  N N   . ASN A 1 31  ? -83.189 76.608 -155.228 1.00 65.06  ? 31  ASN H N   1 
ATOM   208  C CA  . ASN A 1 31  ? -83.598 75.904 -156.434 1.00 66.14  ? 31  ASN H CA  1 
ATOM   209  C C   . ASN A 1 31  ? -83.760 74.394 -156.319 1.00 67.44  ? 31  ASN H C   1 
ATOM   210  O O   . ASN A 1 31  ? -84.337 73.775 -157.204 1.00 72.69  ? 31  ASN H O   1 
ATOM   211  C CB  . ASN A 1 31  ? -82.640 76.221 -157.576 1.00 74.27  ? 31  ASN H CB  1 
ATOM   212  C CG  . ASN A 1 31  ? -82.750 77.652 -158.036 1.00 89.16  ? 31  ASN H CG  1 
ATOM   213  O OD1 . ASN A 1 31  ? -83.798 78.290 -157.876 1.00 96.38  ? 31  ASN H OD1 1 
ATOM   214  N ND2 . ASN A 1 31  ? -81.672 78.172 -158.613 1.00 91.76  ? 31  ASN H ND2 1 
ATOM   215  N N   . TYR A 1 32  ? -83.247 73.789 -155.253 1.00 62.96  ? 32  TYR H N   1 
ATOM   216  C CA  . TYR A 1 32  ? -83.222 72.330 -155.187 1.00 58.27  ? 32  TYR H CA  1 
ATOM   217  C C   . TYR A 1 32  ? -83.937 71.751 -153.975 1.00 58.73  ? 32  TYR H C   1 
ATOM   218  O O   . TYR A 1 32  ? -84.094 72.406 -152.949 1.00 56.89  ? 32  TYR H O   1 
ATOM   219  C CB  . TYR A 1 32  ? -81.786 71.819 -155.216 1.00 57.84  ? 32  TYR H CB  1 
ATOM   220  C CG  . TYR A 1 32  ? -80.969 72.372 -156.351 1.00 59.85  ? 32  TYR H CG  1 
ATOM   221  C CD1 . TYR A 1 32  ? -80.443 73.654 -156.284 1.00 58.15  ? 32  TYR H CD1 1 
ATOM   222  C CD2 . TYR A 1 32  ? -80.724 71.617 -157.487 1.00 60.12  ? 32  TYR H CD2 1 
ATOM   223  C CE1 . TYR A 1 32  ? -79.704 74.170 -157.311 1.00 59.95  ? 32  TYR H CE1 1 
ATOM   224  C CE2 . TYR A 1 32  ? -79.977 72.123 -158.526 1.00 62.88  ? 32  TYR H CE2 1 
ATOM   225  C CZ  . TYR A 1 32  ? -79.467 73.400 -158.432 1.00 65.97  ? 32  TYR H CZ  1 
ATOM   226  O OH  . TYR A 1 32  ? -78.715 73.919 -159.462 1.00 74.07  ? 32  TYR H OH  1 
ATOM   227  N N   . ARG A 1 33  ? -84.379 70.509 -154.118 1.00 57.70  ? 33  ARG H N   1 
ATOM   228  C CA  . ARG A 1 33  ? -84.956 69.770 -153.017 1.00 51.71  ? 33  ARG H CA  1 
ATOM   229  C C   . ARG A 1 33  ? -83.797 69.152 -152.248 1.00 53.16  ? 33  ARG H C   1 
ATOM   230  O O   . ARG A 1 33  ? -82.878 68.599 -152.863 1.00 47.09  ? 33  ARG H O   1 
ATOM   231  C CB  . ARG A 1 33  ? -85.885 68.688 -153.553 1.00 51.47  ? 33  ARG H CB  1 
ATOM   232  C CG  . ARG A 1 33  ? -86.611 67.924 -152.481 1.00 59.57  ? 33  ARG H CG  1 
ATOM   233  C CD  . ARG A 1 33  ? -87.925 67.406 -153.009 1.00 64.84  ? 33  ARG H CD  1 
ATOM   234  N NE  . ARG A 1 33  ? -87.801 66.055 -153.538 1.00 66.96  ? 33  ARG H NE  1 
ATOM   235  C CZ  . ARG A 1 33  ? -88.645 65.517 -154.409 1.00 67.33  ? 33  ARG H CZ  1 
ATOM   236  N NH1 . ARG A 1 33  ? -89.675 66.227 -154.871 1.00 72.41  ? 33  ARG H NH1 1 
ATOM   237  N NH2 . ARG A 1 33  ? -88.447 64.276 -154.832 1.00 60.03  ? 33  ARG H NH2 1 
ATOM   238  N N   . MET A 1 34  ? -83.824 69.259 -150.917 1.00 49.79  ? 34  MET H N   1 
ATOM   239  C CA  . MET A 1 34  ? -82.677 68.850 -150.110 1.00 45.18  ? 34  MET H CA  1 
ATOM   240  C C   . MET A 1 34  ? -82.966 67.615 -149.275 1.00 50.59  ? 34  MET H C   1 
ATOM   241  O O   . MET A 1 34  ? -84.068 67.450 -148.735 1.00 52.07  ? 34  MET H O   1 
ATOM   242  C CB  . MET A 1 34  ? -82.206 69.991 -149.212 1.00 48.28  ? 34  MET H CB  1 
ATOM   243  C CG  . MET A 1 34  ? -81.498 71.133 -149.944 1.00 56.96  ? 34  MET H CG  1 
ATOM   244  S SD  . MET A 1 34  ? -79.985 70.693 -150.831 1.00 53.95  ? 34  MET H SD  1 
ATOM   245  C CE  . MET A 1 34  ? -80.691 70.393 -152.435 1.00 181.31 ? 34  MET H CE  1 
ATOM   246  N N   . ASN A 1 35  ? -81.968 66.745 -149.164 1.00 41.86  ? 35  ASN H N   1 
ATOM   247  C CA  . ASN A 1 35  ? -82.154 65.517 -148.418 1.00 41.54  ? 35  ASN H CA  1 
ATOM   248  C C   . ASN A 1 35  ? -81.050 65.248 -147.418 1.00 42.71  ? 35  ASN H C   1 
ATOM   249  O O   . ASN A 1 35  ? -79.990 65.875 -147.453 1.00 48.15  ? 35  ASN H O   1 
ATOM   250  C CB  . ASN A 1 35  ? -82.255 64.317 -149.364 1.00 49.59  ? 35  ASN H CB  1 
ATOM   251  C CG  . ASN A 1 35  ? -83.323 64.481 -150.408 1.00 51.40  ? 35  ASN H CG  1 
ATOM   252  O OD1 . ASN A 1 35  ? -84.361 63.814 -150.367 1.00 49.45  ? 35  ASN H OD1 1 
ATOM   253  N ND2 . ASN A 1 35  ? -83.084 65.378 -151.353 1.00 55.56  ? 35  ASN H ND2 1 
ATOM   254  N N   . TRP A 1 36  ? -81.321 64.301 -146.526 1.00 38.26  ? 36  TRP H N   1 
ATOM   255  C CA  . TRP A 1 36  ? -80.306 63.712 -145.673 1.00 40.89  ? 36  TRP H CA  1 
ATOM   256  C C   . TRP A 1 36  ? -80.299 62.215 -145.937 1.00 43.37  ? 36  TRP H C   1 
ATOM   257  O O   . TRP A 1 36  ? -81.356 61.604 -146.041 1.00 48.33  ? 36  TRP H O   1 
ATOM   258  C CB  . TRP A 1 36  ? -80.608 63.971 -144.198 1.00 41.42  ? 36  TRP H CB  1 
ATOM   259  C CG  . TRP A 1 36  ? -80.390 65.374 -143.749 1.00 43.82  ? 36  TRP H CG  1 
ATOM   260  C CD1 . TRP A 1 36  ? -81.336 66.333 -143.587 1.00 50.98  ? 36  TRP H CD1 1 
ATOM   261  C CD2 . TRP A 1 36  ? -79.145 65.972 -143.380 1.00 44.94  ? 36  TRP H CD2 1 
ATOM   262  N NE1 . TRP A 1 36  ? -80.762 67.498 -143.145 1.00 51.44  ? 36  TRP H NE1 1 
ATOM   263  C CE2 . TRP A 1 36  ? -79.417 67.300 -143.007 1.00 52.00  ? 36  TRP H CE2 1 
ATOM   264  C CE3 . TRP A 1 36  ? -77.829 65.513 -143.328 1.00 42.53  ? 36  TRP H CE3 1 
ATOM   265  C CZ2 . TRP A 1 36  ? -78.419 68.176 -142.586 1.00 54.71  ? 36  TRP H CZ2 1 
ATOM   266  C CZ3 . TRP A 1 36  ? -76.843 66.381 -142.917 1.00 44.14  ? 36  TRP H CZ3 1 
ATOM   267  C CH2 . TRP A 1 36  ? -77.141 67.700 -142.550 1.00 48.21  ? 36  TRP H CH2 1 
ATOM   268  N N   . VAL A 1 37  ? -79.109 61.630 -146.049 1.00 41.74  ? 37  VAL H N   1 
ATOM   269  C CA  . VAL A 1 37  ? -78.951 60.186 -146.222 1.00 40.36  ? 37  VAL H CA  1 
ATOM   270  C C   . VAL A 1 37  ? -77.917 59.706 -145.209 1.00 45.50  ? 37  VAL H C   1 
ATOM   271  O O   . VAL A 1 37  ? -76.946 60.405 -144.939 1.00 52.46  ? 37  VAL H O   1 
ATOM   272  C CB  . VAL A 1 37  ? -78.489 59.833 -147.658 1.00 39.67  ? 37  VAL H CB  1 
ATOM   273  C CG1 . VAL A 1 37  ? -78.337 58.351 -147.828 1.00 42.31  ? 37  VAL H CG1 1 
ATOM   274  C CG2 . VAL A 1 37  ? -79.487 60.351 -148.676 1.00 40.28  ? 37  VAL H CG2 1 
ATOM   275  N N   . ARG A 1 38  ? -78.132 58.529 -144.631 1.00 41.61  ? 38  ARG H N   1 
ATOM   276  C CA  . ARG A 1 38  ? -77.213 57.994 -143.629 1.00 39.20  ? 38  ARG H CA  1 
ATOM   277  C C   . ARG A 1 38  ? -76.618 56.669 -144.059 1.00 41.30  ? 38  ARG H C   1 
ATOM   278  O O   . ARG A 1 38  ? -77.184 55.908 -144.854 1.00 41.75  ? 38  ARG H O   1 
ATOM   279  C CB  . ARG A 1 38  ? -77.913 57.769 -142.285 1.00 42.74  ? 38  ARG H CB  1 
ATOM   280  C CG  . ARG A 1 38  ? -79.155 56.939 -142.445 1.00 49.71  ? 38  ARG H CG  1 
ATOM   281  C CD  . ARG A 1 38  ? -79.511 56.047 -141.276 1.00 48.02  ? 38  ARG H CD  1 
ATOM   282  N NE  . ARG A 1 38  ? -79.938 56.752 -140.075 1.00 49.92  ? 38  ARG H NE  1 
ATOM   283  C CZ  . ARG A 1 38  ? -80.915 56.325 -139.275 1.00 50.00  ? 38  ARG H CZ  1 
ATOM   284  N NH1 . ARG A 1 38  ? -81.605 55.242 -139.585 1.00 43.50  ? 38  ARG H NH1 1 
ATOM   285  N NH2 . ARG A 1 38  ? -81.217 56.995 -138.177 1.00 50.60  ? 38  ARG H NH2 1 
ATOM   286  N N   . GLN A 1 39  ? -75.473 56.373 -143.485 1.00 35.62  ? 39  GLN H N   1 
ATOM   287  C CA  . GLN A 1 39  ? -74.823 55.131 -143.782 1.00 38.65  ? 39  GLN H CA  1 
ATOM   288  C C   . GLN A 1 39  ? -74.141 54.697 -142.508 1.00 44.78  ? 39  GLN H C   1 
ATOM   289  O O   . GLN A 1 39  ? -73.306 55.420 -141.958 1.00 50.32  ? 39  GLN H O   1 
ATOM   290  C CB  . GLN A 1 39  ? -73.830 55.318 -144.930 1.00 35.93  ? 39  GLN H CB  1 
ATOM   291  C CG  . GLN A 1 39  ? -72.833 54.199 -145.064 1.00 38.92  ? 39  GLN H CG  1 
ATOM   292  C CD  . GLN A 1 39  ? -72.083 54.273 -146.371 1.00 46.06  ? 39  GLN H CD  1 
ATOM   293  O OE1 . GLN A 1 39  ? -71.451 55.281 -146.679 1.00 55.50  ? 39  GLN H OE1 1 
ATOM   294  N NE2 . GLN A 1 39  ? -72.158 53.210 -147.157 1.00 38.36  ? 39  GLN H NE2 1 
ATOM   295  N N   . ALA A 1 40  ? -74.533 53.529 -142.020 1.00 44.97  ? 40  ALA H N   1 
ATOM   296  C CA  . ALA A 1 40  ? -74.018 53.020 -140.761 1.00 47.10  ? 40  ALA H CA  1 
ATOM   297  C C   . ALA A 1 40  ? -72.743 52.271 -141.044 1.00 51.22  ? 40  ALA H C   1 
ATOM   298  O O   . ALA A 1 40  ? -72.640 51.590 -142.062 1.00 58.66  ? 40  ALA H O   1 
ATOM   299  C CB  . ALA A 1 40  ? -75.030 52.109 -140.101 1.00 44.79  ? 40  ALA H CB  1 
ATOM   300  N N   . PRO A 1 41  ? -71.777 52.370 -140.127 1.00 55.87  ? 41  PRO H N   1 
ATOM   301  C CA  . PRO A 1 41  ? -70.453 51.764 -140.290 1.00 57.28  ? 41  PRO H CA  1 
ATOM   302  C C   . PRO A 1 41  ? -70.563 50.346 -140.829 1.00 56.83  ? 41  PRO H C   1 
ATOM   303  O O   . PRO A 1 41  ? -71.036 49.462 -140.115 1.00 57.02  ? 41  PRO H O   1 
ATOM   304  C CB  . PRO A 1 41  ? -69.909 51.725 -138.862 1.00 61.34  ? 41  PRO H CB  1 
ATOM   305  C CG  . PRO A 1 41  ? -70.647 52.795 -138.134 1.00 64.27  ? 41  PRO H CG  1 
ATOM   306  C CD  . PRO A 1 41  ? -72.010 52.844 -138.750 1.00 64.00  ? 41  PRO H CD  1 
ATOM   307  N N   . GLY A 1 42  ? -70.161 50.148 -142.080 1.00 50.11  ? 42  GLY H N   1 
ATOM   308  C CA  . GLY A 1 42  ? -70.087 48.819 -142.645 1.00 53.43  ? 42  GLY H CA  1 
ATOM   309  C C   . GLY A 1 42  ? -71.295 48.406 -143.455 1.00 62.77  ? 42  GLY H C   1 
ATOM   310  O O   . GLY A 1 42  ? -71.365 47.282 -143.944 1.00 60.92  ? 42  GLY H O   1 
ATOM   311  N N   . LYS A 1 43  ? -72.258 49.301 -143.607 1.00 65.09  ? 43  LYS H N   1 
ATOM   312  C CA  . LYS A 1 43  ? -73.494 48.901 -144.260 1.00 64.79  ? 43  LYS H CA  1 
ATOM   313  C C   . LYS A 1 43  ? -73.868 49.823 -145.409 1.00 60.79  ? 43  LYS H C   1 
ATOM   314  O O   . LYS A 1 43  ? -73.059 50.651 -145.847 1.00 57.73  ? 43  LYS H O   1 
ATOM   315  C CB  . LYS A 1 43  ? -74.630 48.792 -143.239 1.00 66.89  ? 43  LYS H CB  1 
ATOM   316  C CG  . LYS A 1 43  ? -74.352 47.805 -142.105 1.00 66.04  ? 43  LYS H CG  1 
ATOM   317  C CD  . LYS A 1 43  ? -75.439 47.878 -141.040 1.00 74.10  ? 43  LYS H CD  1 
ATOM   318  C CE  . LYS A 1 43  ? -74.874 47.694 -139.623 1.00 79.14  ? 43  LYS H CE  1 
ATOM   319  N NZ  . LYS A 1 43  ? -75.722 48.319 -138.555 1.00 76.61  ? 43  LYS H NZ  1 
ATOM   320  N N   . GLY A 1 44  ? -75.096 49.668 -145.894 1.00 58.18  ? 44  GLY H N   1 
ATOM   321  C CA  . GLY A 1 44  ? -75.544 50.354 -147.092 1.00 59.96  ? 44  GLY H CA  1 
ATOM   322  C C   . GLY A 1 44  ? -76.030 51.762 -146.842 1.00 55.61  ? 44  GLY H C   1 
ATOM   323  O O   . GLY A 1 44  ? -75.739 52.345 -145.798 1.00 58.23  ? 44  GLY H O   1 
ATOM   324  N N   . LEU A 1 45  ? -76.762 52.316 -147.804 1.00 49.56  ? 45  LEU H N   1 
ATOM   325  C CA  . LEU A 1 45  ? -77.206 53.702 -147.697 1.00 44.21  ? 45  LEU H CA  1 
ATOM   326  C C   . LEU A 1 45  ? -78.699 53.768 -147.440 1.00 48.63  ? 45  LEU H C   1 
ATOM   327  O O   . LEU A 1 45  ? -79.475 53.008 -148.018 1.00 50.52  ? 45  LEU H O   1 
ATOM   328  C CB  . LEU A 1 45  ? -76.856 54.473 -148.957 1.00 44.59  ? 45  LEU H CB  1 
ATOM   329  C CG  . LEU A 1 45  ? -75.382 54.562 -149.337 1.00 46.89  ? 45  LEU H CG  1 
ATOM   330  C CD1 . LEU A 1 45  ? -75.285 54.778 -150.823 1.00 55.16  ? 45  LEU H CD1 1 
ATOM   331  C CD2 . LEU A 1 45  ? -74.735 55.702 -148.620 1.00 45.96  ? 45  LEU H CD2 1 
ATOM   332  N N   . GLU A 1 46  ? -79.104 54.674 -146.561 1.00 50.73  ? 46  GLU H N   1 
ATOM   333  C CA  . GLU A 1 46  ? -80.504 54.754 -146.160 1.00 47.21  ? 46  GLU H CA  1 
ATOM   334  C C   . GLU A 1 46  ? -80.991 56.190 -146.213 1.00 46.93  ? 46  GLU H C   1 
ATOM   335  O O   . GLU A 1 46  ? -80.503 57.049 -145.471 1.00 46.20  ? 46  GLU H O   1 
ATOM   336  C CB  . GLU A 1 46  ? -80.695 54.186 -144.753 1.00 52.64  ? 46  GLU H CB  1 
ATOM   337  C CG  . GLU A 1 46  ? -82.116 54.327 -144.239 1.00 71.50  ? 46  GLU H CG  1 
ATOM   338  C CD  . GLU A 1 46  ? -82.283 53.934 -142.771 1.00 85.95  ? 46  GLU H CD  1 
ATOM   339  O OE1 . GLU A 1 46  ? -83.430 53.977 -142.276 1.00 85.95  ? 46  GLU H OE1 1 
ATOM   340  O OE2 . GLU A 1 46  ? -81.281 53.583 -142.112 1.00 94.94  ? 46  GLU H OE2 1 
ATOM   341  N N   . TRP A 1 47  ? -81.954 56.451 -147.096 1.00 44.92  ? 47  TRP H N   1 
ATOM   342  C CA  . TRP A 1 47  ? -82.548 57.768 -147.166 1.00 41.49  ? 47  TRP H CA  1 
ATOM   343  C C   . TRP A 1 47  ? -83.225 58.070 -145.834 1.00 45.05  ? 47  TRP H C   1 
ATOM   344  O O   . TRP A 1 47  ? -83.914 57.220 -145.274 1.00 47.50  ? 47  TRP H O   1 
ATOM   345  C CB  . TRP A 1 47  ? -83.531 57.886 -148.331 1.00 41.83  ? 47  TRP H CB  1 
ATOM   346  C CG  . TRP A 1 47  ? -84.318 59.178 -148.301 1.00 44.33  ? 47  TRP H CG  1 
ATOM   347  C CD1 . TRP A 1 47  ? -83.906 60.412 -148.725 1.00 46.97  ? 47  TRP H CD1 1 
ATOM   348  C CD2 . TRP A 1 47  ? -85.644 59.350 -147.803 1.00 45.41  ? 47  TRP H CD2 1 
ATOM   349  N NE1 . TRP A 1 47  ? -84.905 61.346 -148.522 1.00 42.58  ? 47  TRP H NE1 1 
ATOM   350  C CE2 . TRP A 1 47  ? -85.979 60.714 -147.956 1.00 46.49  ? 47  TRP H CE2 1 
ATOM   351  C CE3 . TRP A 1 47  ? -86.584 58.482 -147.237 1.00 47.10  ? 47  TRP H CE3 1 
ATOM   352  C CZ2 . TRP A 1 47  ? -87.209 61.223 -147.562 1.00 45.91  ? 47  TRP H CZ2 1 
ATOM   353  C CZ3 . TRP A 1 47  ? -87.794 58.985 -146.850 1.00 46.93  ? 47  TRP H CZ3 1 
ATOM   354  C CH2 . TRP A 1 47  ? -88.104 60.346 -147.018 1.00 47.26  ? 47  TRP H CH2 1 
ATOM   355  N N   . VAL A 1 48  ? -83.008 59.280 -145.332 1.00 39.83  ? 48  VAL H N   1 
ATOM   356  C CA  . VAL A 1 48  ? -83.506 59.679 -144.023 1.00 45.43  ? 48  VAL H CA  1 
ATOM   357  C C   . VAL A 1 48  ? -84.615 60.724 -144.111 1.00 49.68  ? 48  VAL H C   1 
ATOM   358  O O   . VAL A 1 48  ? -85.641 60.618 -143.442 1.00 53.79  ? 48  VAL H O   1 
ATOM   359  C CB  . VAL A 1 48  ? -82.357 60.245 -143.173 1.00 43.12  ? 48  VAL H CB  1 
ATOM   360  C CG1 . VAL A 1 48  ? -82.861 60.821 -141.858 1.00 37.02  ? 48  VAL H CG1 1 
ATOM   361  C CG2 . VAL A 1 48  ? -81.353 59.164 -142.926 1.00 46.75  ? 48  VAL H CG2 1 
ATOM   362  N N   . SER A 1 49  ? -84.419 61.734 -144.944 1.00 48.39  ? 49  SER H N   1 
ATOM   363  C CA  . SER A 1 49  ? -85.380 62.818 -144.977 1.00 50.03  ? 49  SER H CA  1 
ATOM   364  C C   . SER A 1 49  ? -85.224 63.753 -146.178 1.00 51.56  ? 49  SER H C   1 
ATOM   365  O O   . SER A 1 49  ? -84.152 63.861 -146.780 1.00 51.15  ? 49  SER H O   1 
ATOM   366  C CB  . SER A 1 49  ? -85.284 63.602 -143.666 1.00 50.08  ? 49  SER H CB  1 
ATOM   367  O OG  . SER A 1 49  ? -86.147 64.720 -143.670 1.00 54.05  ? 49  SER H OG  1 
ATOM   368  N N   . SER A 1 50  ? -86.306 64.435 -146.528 1.00 50.52  ? 50  SER H N   1 
ATOM   369  C CA  . SER A 1 50  ? -86.247 65.365 -147.640 1.00 53.13  ? 50  SER H CA  1 
ATOM   370  C C   . SER A 1 50  ? -87.092 66.596 -147.383 1.00 48.10  ? 50  SER H C   1 
ATOM   371  O O   . SER A 1 50  ? -88.093 66.543 -146.674 1.00 56.64  ? 50  SER H O   1 
ATOM   372  C CB  . SER A 1 50  ? -86.701 64.690 -148.931 1.00 60.99  ? 50  SER H CB  1 
ATOM   373  O OG  . SER A 1 50  ? -88.108 64.587 -148.974 1.00 65.13  ? 50  SER H OG  1 
ATOM   374  N N   . ILE A 1 51  ? -86.684 67.702 -147.989 1.00 39.04  ? 51  ILE H N   1 
ATOM   375  C CA  . ILE A 1 51  ? -87.348 68.978 -147.800 1.00 41.40  ? 51  ILE H CA  1 
ATOM   376  C C   . ILE A 1 51  ? -87.352 69.762 -149.115 1.00 47.20  ? 51  ILE H C   1 
ATOM   377  O O   . ILE A 1 51  ? -86.305 70.082 -149.679 1.00 54.80  ? 51  ILE H O   1 
ATOM   378  C CB  . ILE A 1 51  ? -86.682 69.787 -146.659 1.00 39.23  ? 51  ILE H CB  1 
ATOM   379  C CG1 . ILE A 1 51  ? -87.405 71.100 -146.441 1.00 40.62  ? 51  ILE H CG1 1 
ATOM   380  C CG2 . ILE A 1 51  ? -85.235 70.067 -146.964 1.00 42.49  ? 51  ILE H CG2 1 
ATOM   381  C CD1 . ILE A 1 51  ? -87.257 71.631 -145.062 1.00 38.07  ? 51  ILE H CD1 1 
ATOM   382  N N   . SER A 1 52  ? -88.545 70.034 -149.616 1.00 49.65  ? 52  SER H N   1 
ATOM   383  C CA  . SER A 1 52  ? -88.708 70.817 -150.829 1.00 48.87  ? 52  SER H CA  1 
ATOM   384  C C   . SER A 1 52  ? -88.271 72.263 -150.597 1.00 53.28  ? 52  SER H C   1 
ATOM   385  O O   . SER A 1 52  ? -88.207 72.734 -149.457 1.00 49.68  ? 52  SER H O   1 
ATOM   386  C CB  . SER A 1 52  ? -90.161 70.783 -151.268 1.00 48.47  ? 52  SER H CB  1 
ATOM   387  O OG  . SER A 1 52  ? -90.945 71.572 -150.392 1.00 52.12  ? 52  SER H OG  1 
ATOM   388  N N   . SER A 1 53  A -87.978 72.959 -151.690 1.00 58.20  ? 52  SER H N   1 
ATOM   389  C CA  . SER A 1 53  A -87.449 74.319 -151.644 1.00 60.64  ? 52  SER H CA  1 
ATOM   390  C C   . SER A 1 53  A -88.153 75.271 -150.690 1.00 57.64  ? 52  SER H C   1 
ATOM   391  O O   . SER A 1 53  A -87.507 76.056 -150.006 1.00 61.97  ? 52  SER H O   1 
ATOM   392  C CB  . SER A 1 53  A -87.468 74.932 -153.037 1.00 68.56  ? 52  SER H CB  1 
ATOM   393  O OG  . SER A 1 53  A -87.430 76.343 -152.934 1.00 76.71  ? 52  SER H OG  1 
ATOM   394  N N   . SER A 1 54  ? -89.477 75.206 -150.655 1.00 56.90  ? 53  SER H N   1 
ATOM   395  C CA  . SER A 1 54  ? -90.276 76.134 -149.864 1.00 60.50  ? 53  SER H CA  1 
ATOM   396  C C   . SER A 1 54  ? -90.578 75.601 -148.477 1.00 57.22  ? 53  SER H C   1 
ATOM   397  O O   . SER A 1 54  ? -91.281 76.252 -147.703 1.00 57.66  ? 53  SER H O   1 
ATOM   398  C CB  . SER A 1 54  ? -91.602 76.356 -150.562 1.00 70.62  ? 53  SER H CB  1 
ATOM   399  O OG  . SER A 1 54  ? -92.260 75.109 -150.709 1.00 77.36  ? 53  SER H OG  1 
ATOM   400  N N   . SER A 1 55  ? -90.071 74.407 -148.182 1.00 52.08  ? 54  SER H N   1 
ATOM   401  C CA  . SER A 1 55  ? -90.414 73.686 -146.956 1.00 49.97  ? 54  SER H CA  1 
ATOM   402  C C   . SER A 1 55  ? -91.879 73.285 -146.932 1.00 56.06  ? 54  SER H C   1 
ATOM   403  O O   . SER A 1 55  ? -92.417 72.981 -145.881 1.00 59.18  ? 54  SER H O   1 
ATOM   404  C CB  . SER A 1 55  ? -90.104 74.518 -145.718 1.00 49.45  ? 54  SER H CB  1 
ATOM   405  O OG  . SER A 1 55  ? -88.746 74.902 -145.691 1.00 64.20  ? 54  SER H OG  1 
ATOM   406  N N   . SER A 1 56  ? -92.527 73.282 -148.091 1.00 59.32  ? 55  SER H N   1 
ATOM   407  C CA  . SER A 1 56  ? -93.945 72.953 -148.151 1.00 59.18  ? 55  SER H CA  1 
ATOM   408  C C   . SER A 1 56  ? -94.227 71.457 -148.215 1.00 52.88  ? 55  SER H C   1 
ATOM   409  O O   . SER A 1 56  ? -95.353 71.023 -147.975 1.00 47.35  ? 55  SER H O   1 
ATOM   410  C CB  . SER A 1 56  ? -94.597 73.665 -149.328 1.00 64.35  ? 55  SER H CB  1 
ATOM   411  O OG  . SER A 1 56  ? -94.524 75.065 -149.137 1.00 65.64  ? 55  SER H OG  1 
ATOM   412  N N   . TYR A 1 57  ? -93.196 70.681 -148.541 1.00 48.82  ? 56  TYR H N   1 
ATOM   413  C CA  . TYR A 1 57  ? -93.302 69.231 -148.628 1.00 44.72  ? 56  TYR H CA  1 
ATOM   414  C C   . TYR A 1 57  ? -92.087 68.607 -147.985 1.00 45.01  ? 56  TYR H C   1 
ATOM   415  O O   . TYR A 1 57  ? -90.969 68.743 -148.485 1.00 55.24  ? 56  TYR H O   1 
ATOM   416  C CB  . TYR A 1 57  ? -93.436 68.775 -150.080 1.00 50.17  ? 56  TYR H CB  1 
ATOM   417  C CG  . TYR A 1 57  ? -94.686 69.288 -150.744 1.00 62.94  ? 56  TYR H CG  1 
ATOM   418  C CD1 . TYR A 1 57  ? -94.691 70.492 -151.447 1.00 68.23  ? 56  TYR H CD1 1 
ATOM   419  C CD2 . TYR A 1 57  ? -95.875 68.582 -150.647 1.00 66.32  ? 56  TYR H CD2 1 
ATOM   420  C CE1 . TYR A 1 57  ? -95.852 70.964 -152.042 1.00 69.49  ? 56  TYR H CE1 1 
ATOM   421  C CE2 . TYR A 1 57  ? -97.038 69.047 -151.236 1.00 69.55  ? 56  TYR H CE2 1 
ATOM   422  C CZ  . TYR A 1 57  ? -97.022 70.230 -151.930 1.00 69.69  ? 56  TYR H CZ  1 
ATOM   423  O OH  . TYR A 1 57  ? -98.188 70.663 -152.502 1.00 70.50  ? 56  TYR H OH  1 
ATOM   424  N N   . ILE A 1 58  ? -92.324 67.915 -146.875 1.00 47.04  ? 57  ILE H N   1 
ATOM   425  C CA  . ILE A 1 58  ? -91.275 67.365 -146.023 1.00 46.42  ? 57  ILE H CA  1 
ATOM   426  C C   . ILE A 1 58  ? -91.579 65.895 -145.777 1.00 46.64  ? 57  ILE H C   1 
ATOM   427  O O   . ILE A 1 58  ? -92.731 65.545 -145.519 1.00 42.52  ? 57  ILE H O   1 
ATOM   428  C CB  . ILE A 1 58  ? -91.247 68.130 -144.702 1.00 42.92  ? 57  ILE H CB  1 
ATOM   429  C CG1 . ILE A 1 58  ? -90.929 69.599 -144.991 1.00 43.87  ? 57  ILE H CG1 1 
ATOM   430  C CG2 . ILE A 1 58  ? -90.275 67.506 -143.740 1.00 38.66  ? 57  ILE H CG2 1 
ATOM   431  C CD1 . ILE A 1 58  ? -90.407 70.384 -143.843 1.00 46.56  ? 57  ILE H CD1 1 
ATOM   432  N N   . HIS A 1 59  ? -90.572 65.028 -145.911 1.00 40.88  ? 58  HIS H N   1 
ATOM   433  C CA  . HIS A 1 59  ? -90.780 63.594 -145.669 1.00 43.02  ? 58  HIS H CA  1 
ATOM   434  C C   . HIS A 1 59  ? -89.686 62.944 -144.865 1.00 44.77  ? 58  HIS H C   1 
ATOM   435  O O   . HIS A 1 59  ? -88.543 63.388 -144.875 1.00 50.32  ? 58  HIS H O   1 
ATOM   436  C CB  . HIS A 1 59  ? -90.977 62.844 -146.974 1.00 49.20  ? 58  HIS H CB  1 
ATOM   437  C CG  . HIS A 1 59  ? -92.217 63.254 -147.690 1.00 64.32  ? 58  HIS H CG  1 
ATOM   438  N ND1 . HIS A 1 59  ? -92.220 64.206 -148.690 1.00 67.87  ? 58  HIS H ND1 1 
ATOM   439  C CD2 . HIS A 1 59  ? -93.509 62.895 -147.510 1.00 66.85  ? 58  HIS H CD2 1 
ATOM   440  C CE1 . HIS A 1 59  ? -93.452 64.392 -149.112 1.00 72.30  ? 58  HIS H CE1 1 
ATOM   441  N NE2 . HIS A 1 59  ? -94.257 63.606 -148.414 1.00 75.45  ? 58  HIS H NE2 1 
ATOM   442  N N   . TYR A 1 60  ? -90.043 61.876 -144.173 1.00 44.44  ? 59  TYR H N   1 
ATOM   443  C CA  . TYR A 1 60  ? -89.087 61.185 -143.331 1.00 44.59  ? 59  TYR H CA  1 
ATOM   444  C C   . TYR A 1 60  ? -89.144 59.690 -143.577 1.00 45.78  ? 59  TYR H C   1 
ATOM   445  O O   . TYR A 1 60  ? -90.180 59.153 -143.949 1.00 39.23  ? 59  TYR H O   1 
ATOM   446  C CB  . TYR A 1 60  ? -89.402 61.464 -141.871 1.00 37.16  ? 59  TYR H CB  1 
ATOM   447  C CG  . TYR A 1 60  ? -89.278 62.905 -141.471 1.00 38.98  ? 59  TYR H CG  1 
ATOM   448  C CD1 . TYR A 1 60  ? -90.398 63.718 -141.356 1.00 43.87  ? 59  TYR H CD1 1 
ATOM   449  C CD2 . TYR A 1 60  ? -88.042 63.456 -141.189 1.00 36.94  ? 59  TYR H CD2 1 
ATOM   450  C CE1 . TYR A 1 60  ? -90.281 65.060 -140.964 1.00 48.36  ? 59  TYR H CE1 1 
ATOM   451  C CE2 . TYR A 1 60  ? -87.915 64.785 -140.805 1.00 45.82  ? 59  TYR H CE2 1 
ATOM   452  C CZ  . TYR A 1 60  ? -89.033 65.580 -140.690 1.00 47.97  ? 59  TYR H CZ  1 
ATOM   453  O OH  . TYR A 1 60  ? -88.887 66.894 -140.316 1.00 44.05  ? 59  TYR H OH  1 
ATOM   454  N N   . ALA A 1 61  ? -88.028 59.011 -143.364 1.00 46.08  ? 60  ALA H N   1 
ATOM   455  C CA  . ALA A 1 61  ? -88.041 57.558 -143.377 1.00 46.09  ? 60  ALA H CA  1 
ATOM   456  C C   . ALA A 1 61  ? -88.787 57.041 -142.134 1.00 48.25  ? 60  ALA H C   1 
ATOM   457  O O   . ALA A 1 61  ? -88.855 57.735 -141.123 1.00 54.78  ? 60  ALA H O   1 
ATOM   458  C CB  . ALA A 1 61  ? -86.646 57.042 -143.419 1.00 46.95  ? 60  ALA H CB  1 
ATOM   459  N N   . ASP A 1 62  ? -89.355 55.839 -142.215 1.00 45.11  ? 61  ASP H N   1 
ATOM   460  C CA  . ASP A 1 62  ? -90.131 55.279 -141.114 1.00 51.19  ? 61  ASP H CA  1 
ATOM   461  C C   . ASP A 1 62  ? -89.343 55.242 -139.815 1.00 58.44  ? 61  ASP H C   1 
ATOM   462  O O   . ASP A 1 62  ? -89.854 55.609 -138.762 1.00 61.08  ? 61  ASP H O   1 
ATOM   463  C CB  . ASP A 1 62  ? -90.638 53.872 -141.444 1.00 58.26  ? 61  ASP H CB  1 
ATOM   464  C CG  . ASP A 1 62  ? -91.889 53.887 -142.317 1.00 76.11  ? 61  ASP H CG  1 
ATOM   465  O OD1 . ASP A 1 62  ? -92.103 52.912 -143.073 1.00 82.52  ? 61  ASP H OD1 1 
ATOM   466  O OD2 . ASP A 1 62  ? -92.662 54.869 -142.253 1.00 81.38  ? 61  ASP H OD2 1 
ATOM   467  N N   . SER A 1 63  ? -88.093 54.808 -139.909 1.00 56.49  ? 62  SER H N   1 
ATOM   468  C CA  . SER A 1 63  ? -87.246 54.557 -138.745 1.00 54.90  ? 62  SER H CA  1 
ATOM   469  C C   . SER A 1 63  ? -86.977 55.806 -137.920 1.00 49.97  ? 62  SER H C   1 
ATOM   470  O O   . SER A 1 63  ? -86.459 55.752 -136.814 1.00 54.72  ? 62  SER H O   1 
ATOM   471  C CB  . SER A 1 63  ? -85.906 53.975 -139.212 1.00 55.49  ? 62  SER H CB  1 
ATOM   472  O OG  . SER A 1 63  ? -85.274 54.842 -140.142 1.00 59.89  ? 62  SER H OG  1 
ATOM   473  N N   . VAL A 1 64  ? -87.334 56.945 -138.464 1.00 50.33  ? 63  VAL H N   1 
ATOM   474  C CA  . VAL A 1 64  ? -86.852 58.188 -137.919 1.00 55.31  ? 63  VAL H CA  1 
ATOM   475  C C   . VAL A 1 64  ? -88.009 59.063 -137.459 1.00 55.73  ? 63  VAL H C   1 
ATOM   476  O O   . VAL A 1 64  ? -87.829 60.084 -136.811 1.00 63.33  ? 63  VAL H O   1 
ATOM   477  C CB  . VAL A 1 64  ? -85.985 58.872 -138.991 1.00 55.73  ? 63  VAL H CB  1 
ATOM   478  C CG1 . VAL A 1 64  ? -86.357 60.320 -139.180 1.00 54.14  ? 63  VAL H CG1 1 
ATOM   479  C CG2 . VAL A 1 64  ? -84.522 58.675 -138.663 1.00 57.66  ? 63  VAL H CG2 1 
ATOM   480  N N   . LYS A 1 65  ? -89.214 58.626 -137.768 1.00 60.46  ? 64  LYS H N   1 
ATOM   481  C CA  . LYS A 1 65  ? -90.365 59.499 -137.644 1.00 67.48  ? 64  LYS H CA  1 
ATOM   482  C C   . LYS A 1 65  ? -90.682 59.878 -136.202 1.00 58.94  ? 64  LYS H C   1 
ATOM   483  O O   . LYS A 1 65  ? -90.685 59.037 -135.305 1.00 56.48  ? 64  LYS H O   1 
ATOM   484  C CB  . LYS A 1 65  ? -91.580 58.872 -138.321 1.00 68.33  ? 64  LYS H CB  1 
ATOM   485  C CG  . LYS A 1 65  ? -91.506 58.836 -139.823 1.00 62.36  ? 64  LYS H CG  1 
ATOM   486  C CD  . LYS A 1 65  ? -92.740 58.132 -140.371 1.00 73.37  ? 64  LYS H CD  1 
ATOM   487  C CE  . LYS A 1 65  ? -92.869 58.249 -141.886 1.00 77.14  ? 64  LYS H CE  1 
ATOM   488  N NZ  . LYS A 1 65  ? -93.969 57.366 -142.374 1.00 82.27  ? 64  LYS H NZ  1 
ATOM   489  N N   . GLY A 1 66  ? -90.952 61.162 -136.010 1.00 45.27  ? 65  GLY H N   1 
ATOM   490  C CA  . GLY A 1 66  ? -91.316 61.702 -134.721 1.00 42.19  ? 65  GLY H CA  1 
ATOM   491  C C   . GLY A 1 66  ? -90.103 62.313 -134.057 1.00 50.65  ? 65  GLY H C   1 
ATOM   492  O O   . GLY A 1 66  ? -90.233 63.271 -133.295 1.00 51.34  ? 65  GLY H O   1 
ATOM   493  N N   . ARG A 1 67  ? -88.918 61.780 -134.365 1.00 41.85  ? 66  ARG H N   1 
ATOM   494  C CA  . ARG A 1 67  ? -87.727 62.144 -133.609 1.00 42.72  ? 66  ARG H CA  1 
ATOM   495  C C   . ARG A 1 67  ? -86.828 63.134 -134.326 1.00 44.52  ? 66  ARG H C   1 
ATOM   496  O O   . ARG A 1 67  ? -86.000 63.792 -133.687 1.00 42.73  ? 66  ARG H O   1 
ATOM   497  C CB  . ARG A 1 67  ? -86.929 60.893 -133.226 1.00 44.58  ? 66  ARG H CB  1 
ATOM   498  C CG  . ARG A 1 67  ? -87.761 59.853 -132.500 1.00 45.38  ? 66  ARG H CG  1 
ATOM   499  C CD  . ARG A 1 67  ? -86.973 58.601 -132.143 1.00 49.85  ? 66  ARG H CD  1 
ATOM   500  N NE  . ARG A 1 67  ? -86.484 57.907 -133.330 1.00 56.07  ? 66  ARG H NE  1 
ATOM   501  C CZ  . ARG A 1 67  ? -85.198 57.692 -133.585 1.00 50.39  ? 66  ARG H CZ  1 
ATOM   502  N NH1 . ARG A 1 67  ? -84.285 58.107 -132.726 1.00 54.35  ? 66  ARG H NH1 1 
ATOM   503  N NH2 . ARG A 1 67  ? -84.827 57.063 -134.693 1.00 43.58  ? 66  ARG H NH2 1 
ATOM   504  N N   . PHE A 1 68  ? -86.977 63.220 -135.648 1.00 42.71  ? 67  PHE H N   1 
ATOM   505  C CA  . PHE A 1 68  ? -86.086 64.050 -136.468 1.00 48.30  ? 67  PHE H CA  1 
ATOM   506  C C   . PHE A 1 68  ? -86.876 65.170 -137.110 1.00 52.74  ? 67  PHE H C   1 
ATOM   507  O O   . PHE A 1 68  ? -87.982 64.945 -137.623 1.00 51.29  ? 67  PHE H O   1 
ATOM   508  C CB  . PHE A 1 68  ? -85.420 63.246 -137.594 1.00 42.82  ? 67  PHE H CB  1 
ATOM   509  C CG  . PHE A 1 68  ? -84.347 62.294 -137.141 1.00 42.11  ? 67  PHE H CG  1 
ATOM   510  C CD1 . PHE A 1 68  ? -84.291 61.842 -135.837 1.00 48.44  ? 67  PHE H CD1 1 
ATOM   511  C CD2 . PHE A 1 68  ? -83.417 61.818 -138.047 1.00 38.66  ? 67  PHE H CD2 1 
ATOM   512  C CE1 . PHE A 1 68  ? -83.306 60.954 -135.439 1.00 49.54  ? 67  PHE H CE1 1 
ATOM   513  C CE2 . PHE A 1 68  ? -82.448 60.942 -137.663 1.00 43.08  ? 67  PHE H CE2 1 
ATOM   514  C CZ  . PHE A 1 68  ? -82.390 60.499 -136.358 1.00 48.04  ? 67  PHE H CZ  1 
ATOM   515  N N   . THR A 1 69  ? -86.300 66.369 -137.091 1.00 50.76  ? 68  THR H N   1 
ATOM   516  C CA  . THR A 1 69  ? -86.900 67.502 -137.774 1.00 49.03  ? 68  THR H CA  1 
ATOM   517  C C   . THR A 1 69  ? -85.946 68.105 -138.771 1.00 49.00  ? 68  THR H C   1 
ATOM   518  O O   . THR A 1 69  ? -84.898 68.628 -138.391 1.00 46.10  ? 68  THR H O   1 
ATOM   519  C CB  . THR A 1 69  ? -87.260 68.627 -136.823 1.00 48.33  ? 68  THR H CB  1 
ATOM   520  O OG1 . THR A 1 69  ? -88.356 68.224 -136.002 1.00 55.08  ? 68  THR H OG1 1 
ATOM   521  C CG2 . THR A 1 69  ? -87.671 69.847 -137.630 1.00 43.96  ? 68  THR H CG2 1 
ATOM   522  N N   . ILE A 1 70  ? -86.320 68.051 -140.041 1.00 41.78  ? 69  ILE H N   1 
ATOM   523  C CA  . ILE A 1 70  ? -85.505 68.659 -141.066 1.00 45.42  ? 69  ILE H CA  1 
ATOM   524  C C   . ILE A 1 70  ? -85.992 70.076 -141.274 1.00 48.00  ? 69  ILE H C   1 
ATOM   525  O O   . ILE A 1 70  ? -87.178 70.353 -141.125 1.00 50.06  ? 69  ILE H O   1 
ATOM   526  C CB  . ILE A 1 70  ? -85.611 67.893 -142.376 1.00 48.79  ? 69  ILE H CB  1 
ATOM   527  C CG1 . ILE A 1 70  ? -84.591 68.411 -143.386 1.00 47.38  ? 69  ILE H CG1 1 
ATOM   528  C CG2 . ILE A 1 70  ? -87.033 67.972 -142.930 1.00 48.11  ? 69  ILE H CG2 1 
ATOM   529  C CD1 . ILE A 1 70  ? -84.509 67.549 -144.622 1.00 43.15  ? 69  ILE H CD1 1 
ATOM   530  N N   . SER A 1 71  ? -85.075 70.976 -141.598 1.00 40.10  ? 70  SER H N   1 
ATOM   531  C CA  . SER A 1 71  ? -85.456 72.344 -141.889 1.00 43.78  ? 70  SER H CA  1 
ATOM   532  C C   . SER A 1 71  ? -84.396 72.980 -142.750 1.00 46.77  ? 70  SER H C   1 
ATOM   533  O O   . SER A 1 71  ? -83.307 72.449 -142.903 1.00 52.81  ? 70  SER H O   1 
ATOM   534  C CB  . SER A 1 71  ? -85.647 73.163 -140.621 1.00 45.86  ? 70  SER H CB  1 
ATOM   535  O OG  . SER A 1 71  ? -84.423 73.295 -139.912 1.00 59.00  ? 70  SER H OG  1 
ATOM   536  N N   . ARG A 1 72  ? -84.714 74.149 -143.272 1.00 50.83  ? 71  ARG H N   1 
ATOM   537  C CA  . ARG A 1 72  ? -84.006 74.692 -144.409 1.00 56.24  ? 71  ARG H CA  1 
ATOM   538  C C   . ARG A 1 72  ? -83.956 76.187 -144.263 1.00 59.98  ? 71  ARG H C   1 
ATOM   539  O O   . ARG A 1 72  ? -84.913 76.787 -143.787 1.00 64.24  ? 71  ARG H O   1 
ATOM   540  C CB  . ARG A 1 72  ? -84.801 74.352 -145.656 1.00 56.47  ? 71  ARG H CB  1 
ATOM   541  C CG  . ARG A 1 72  ? -84.271 74.958 -146.889 1.00 59.54  ? 71  ARG H CG  1 
ATOM   542  C CD  . ARG A 1 72  ? -85.335 74.966 -147.925 1.00 58.80  ? 71  ARG H CD  1 
ATOM   543  N NE  . ARG A 1 72  ? -85.308 73.770 -148.745 1.00 63.14  ? 71  ARG H NE  1 
ATOM   544  C CZ  . ARG A 1 72  ? -84.647 73.672 -149.891 1.00 61.15  ? 71  ARG H CZ  1 
ATOM   545  N NH1 . ARG A 1 72  ? -84.697 72.545 -150.579 1.00 64.11  ? 71  ARG H NH1 1 
ATOM   546  N NH2 . ARG A 1 72  ? -83.940 74.694 -150.347 1.00 58.04  ? 71  ARG H NH2 1 
ATOM   547  N N   . ASP A 1 73  ? -82.850 76.803 -144.655 1.00 60.86  ? 72  ASP H N   1 
ATOM   548  C CA  . ASP A 1 73  ? -82.788 78.267 -144.626 1.00 65.89  ? 72  ASP H CA  1 
ATOM   549  C C   . ASP A 1 73  ? -82.207 78.845 -145.916 1.00 66.46  ? 72  ASP H C   1 
ATOM   550  O O   . ASP A 1 73  ? -81.012 79.137 -145.985 1.00 71.14  ? 72  ASP H O   1 
ATOM   551  C CB  . ASP A 1 73  ? -81.998 78.759 -143.415 1.00 69.28  ? 72  ASP H CB  1 
ATOM   552  C CG  . ASP A 1 73  ? -82.125 80.260 -143.206 1.00 76.99  ? 72  ASP H CG  1 
ATOM   553  O OD1 . ASP A 1 73  ? -82.106 81.011 -144.204 1.00 80.74  ? 72  ASP H OD1 1 
ATOM   554  O OD2 . ASP A 1 73  ? -82.240 80.693 -142.041 1.00 77.98  ? 72  ASP H OD2 1 
ATOM   555  N N   . ASN A 1 74  ? -83.059 79.009 -146.927 1.00 59.63  ? 73  ASN H N   1 
ATOM   556  C CA  . ASN A 1 74  ? -82.616 79.453 -148.245 1.00 60.64  ? 73  ASN H CA  1 
ATOM   557  C C   . ASN A 1 74  ? -81.792 80.743 -148.233 1.00 65.19  ? 73  ASN H C   1 
ATOM   558  O O   . ASN A 1 74  ? -80.778 80.846 -148.920 1.00 66.65  ? 73  ASN H O   1 
ATOM   559  C CB  . ASN A 1 74  ? -83.805 79.604 -149.179 1.00 62.30  ? 73  ASN H CB  1 
ATOM   560  C CG  . ASN A 1 74  ? -84.502 78.294 -149.446 1.00 66.76  ? 73  ASN H CG  1 
ATOM   561  O OD1 . ASN A 1 74  ? -83.872 77.225 -149.479 1.00 59.75  ? 73  ASN H OD1 1 
ATOM   562  N ND2 . ASN A 1 74  ? -85.814 78.364 -149.652 1.00 68.00  ? 73  ASN H ND2 1 
ATOM   563  N N   . ALA A 1 75  ? -82.228 81.725 -147.456 1.00 66.41  ? 74  ALA H N   1 
ATOM   564  C CA  . ALA A 1 75  ? -81.461 82.956 -147.306 1.00 74.60  ? 74  ALA H CA  1 
ATOM   565  C C   . ALA A 1 75  ? -79.993 82.667 -146.963 1.00 78.77  ? 74  ALA H C   1 
ATOM   566  O O   . ALA A 1 75  ? -79.084 83.226 -147.579 1.00 82.53  ? 74  ALA H O   1 
ATOM   567  C CB  . ALA A 1 75  ? -82.101 83.854 -146.250 1.00 72.21  ? 74  ALA H CB  1 
ATOM   568  N N   . GLU A 1 76  ? -79.775 81.786 -145.986 1.00 74.42  ? 75  GLU H N   1 
ATOM   569  C CA  . GLU A 1 76  ? -78.431 81.417 -145.542 1.00 74.29  ? 75  GLU H CA  1 
ATOM   570  C C   . GLU A 1 76  ? -77.839 80.249 -146.318 1.00 71.95  ? 75  GLU H C   1 
ATOM   571  O O   . GLU A 1 76  ? -76.741 79.788 -146.011 1.00 70.43  ? 75  GLU H O   1 
ATOM   572  C CB  . GLU A 1 76  ? -78.437 81.079 -144.051 1.00 78.36  ? 75  GLU H CB  1 
ATOM   573  C CG  . GLU A 1 76  ? -77.683 82.072 -143.178 1.00 89.62  ? 75  GLU H CG  1 
ATOM   574  C CD  . GLU A 1 76  ? -77.900 83.513 -143.600 1.00 102.47 ? 75  GLU H CD  1 
ATOM   575  O OE1 . GLU A 1 76  ? -76.943 84.316 -143.506 1.00 106.02 ? 75  GLU H OE1 1 
ATOM   576  O OE2 . GLU A 1 76  ? -79.024 83.844 -144.033 1.00 107.24 ? 75  GLU H OE2 1 
ATOM   577  N N   . ASN A 1 77  ? -78.560 79.777 -147.328 1.00 69.52  ? 76  ASN H N   1 
ATOM   578  C CA  . ASN A 1 77  ? -78.137 78.601 -148.071 1.00 67.05  ? 76  ASN H CA  1 
ATOM   579  C C   . ASN A 1 77  ? -77.708 77.485 -147.135 1.00 68.50  ? 76  ASN H C   1 
ATOM   580  O O   . ASN A 1 77  ? -76.612 76.942 -147.251 1.00 66.94  ? 76  ASN H O   1 
ATOM   581  C CB  . ASN A 1 77  ? -77.028 78.944 -149.065 1.00 71.57  ? 76  ASN H CB  1 
ATOM   582  C CG  . ASN A 1 77  ? -77.541 79.040 -150.494 1.00 80.85  ? 76  ASN H CG  1 
ATOM   583  O OD1 . ASN A 1 77  ? -77.076 78.324 -151.377 1.00 86.43  ? 76  ASN H OD1 1 
ATOM   584  N ND2 . ASN A 1 77  ? -78.520 79.911 -150.721 1.00 81.22  ? 76  ASN H ND2 1 
ATOM   585  N N   . SER A 1 78  ? -78.599 77.145 -146.209 1.00 69.26  ? 77  SER H N   1 
ATOM   586  C CA  . SER A 1 78  ? -78.316 76.141 -145.199 1.00 63.77  ? 77  SER H CA  1 
ATOM   587  C C   . SER A 1 78  ? -79.432 75.124 -145.019 1.00 59.45  ? 77  SER H C   1 
ATOM   588  O O   . SER A 1 78  ? -80.618 75.400 -145.258 1.00 57.53  ? 77  SER H O   1 
ATOM   589  C CB  . SER A 1 78  ? -78.016 76.810 -143.861 1.00 67.61  ? 77  SER H CB  1 
ATOM   590  O OG  . SER A 1 78  ? -76.710 77.347 -143.860 1.00 72.53  ? 77  SER H OG  1 
ATOM   591  N N   . LEU A 1 79  ? -79.029 73.942 -144.573 1.00 54.89  ? 78  LEU H N   1 
ATOM   592  C CA  . LEU A 1 79  ? -79.951 72.853 -144.313 1.00 53.85  ? 78  LEU H CA  1 
ATOM   593  C C   . LEU A 1 79  ? -79.676 72.290 -142.917 1.00 56.27  ? 78  LEU H C   1 
ATOM   594  O O   . LEU A 1 79  ? -78.520 72.169 -142.512 1.00 54.58  ? 78  LEU H O   1 
ATOM   595  C CB  . LEU A 1 79  ? -79.773 71.770 -145.377 1.00 40.63  ? 78  LEU H CB  1 
ATOM   596  C CG  . LEU A 1 79  ? -80.540 70.466 -145.164 1.00 42.73  ? 78  LEU H CG  1 
ATOM   597  C CD1 . LEU A 1 79  ? -82.002 70.638 -145.559 1.00 43.04  ? 78  LEU H CD1 1 
ATOM   598  C CD2 . LEU A 1 79  ? -79.889 69.308 -145.940 1.00 39.09  ? 78  LEU H CD2 1 
ATOM   599  N N   . TYR A 1 80  ? -80.731 71.952 -142.183 1.00 54.60  ? 79  TYR H N   1 
ATOM   600  C CA  . TYR A 1 80  ? -80.558 71.417 -140.837 1.00 57.36  ? 79  TYR H CA  1 
ATOM   601  C C   . TYR A 1 80  ? -81.281 70.092 -140.595 1.00 56.35  ? 79  TYR H C   1 
ATOM   602  O O   . TYR A 1 80  ? -82.303 69.793 -141.216 1.00 58.15  ? 79  TYR H O   1 
ATOM   603  C CB  . TYR A 1 80  ? -80.985 72.452 -139.798 1.00 58.89  ? 79  TYR H CB  1 
ATOM   604  C CG  . TYR A 1 80  ? -80.328 73.799 -140.006 1.00 62.48  ? 79  TYR H CG  1 
ATOM   605  C CD1 . TYR A 1 80  ? -80.959 74.800 -140.740 1.00 59.02  ? 79  TYR H CD1 1 
ATOM   606  C CD2 . TYR A 1 80  ? -79.066 74.064 -139.488 1.00 62.35  ? 79  TYR H CD2 1 
ATOM   607  C CE1 . TYR A 1 80  ? -80.354 76.035 -140.942 1.00 61.58  ? 79  TYR H CE1 1 
ATOM   608  C CE2 . TYR A 1 80  ? -78.450 75.296 -139.685 1.00 62.11  ? 79  TYR H CE2 1 
ATOM   609  C CZ  . TYR A 1 80  ? -79.097 76.282 -140.412 1.00 66.64  ? 79  TYR H CZ  1 
ATOM   610  O OH  . TYR A 1 80  ? -78.483 77.511 -140.615 1.00 68.52  ? 79  TYR H OH  1 
ATOM   611  N N   . LEU A 1 81  ? -80.724 69.296 -139.693 1.00 48.18  ? 80  LEU H N   1 
ATOM   612  C CA  . LEU A 1 81  ? -81.413 68.127 -139.183 1.00 48.47  ? 80  LEU H CA  1 
ATOM   613  C C   . LEU A 1 81  ? -81.317 68.150 -137.669 1.00 49.52  ? 80  LEU H C   1 
ATOM   614  O O   . LEU A 1 81  ? -80.226 68.056 -137.116 1.00 47.35  ? 80  LEU H O   1 
ATOM   615  C CB  . LEU A 1 81  ? -80.808 66.828 -139.727 1.00 43.08  ? 80  LEU H CB  1 
ATOM   616  C CG  . LEU A 1 81  ? -81.727 65.608 -139.581 1.00 38.70  ? 80  LEU H CG  1 
ATOM   617  C CD1 . LEU A 1 81  ? -83.060 65.853 -140.268 1.00 41.37  ? 80  LEU H CD1 1 
ATOM   618  C CD2 . LEU A 1 81  ? -81.112 64.311 -140.110 1.00 39.62  ? 80  LEU H CD2 1 
ATOM   619  N N   . GLN A 1 82  ? -82.458 68.309 -137.007 1.00 53.17  ? 81  GLN H N   1 
ATOM   620  C CA  . GLN A 1 82  ? -82.526 68.262 -135.551 1.00 50.16  ? 81  GLN H CA  1 
ATOM   621  C C   . GLN A 1 82  ? -82.937 66.863 -135.118 1.00 50.51  ? 81  GLN H C   1 
ATOM   622  O O   . GLN A 1 82  ? -84.061 66.423 -135.397 1.00 54.77  ? 81  GLN H O   1 
ATOM   623  C CB  . GLN A 1 82  ? -83.538 69.283 -135.027 1.00 51.62  ? 81  GLN H CB  1 
ATOM   624  C CG  . GLN A 1 82  ? -83.757 69.208 -133.524 1.00 56.49  ? 81  GLN H CG  1 
ATOM   625  C CD  . GLN A 1 82  ? -82.496 69.545 -132.747 1.00 62.01  ? 81  GLN H CD  1 
ATOM   626  O OE1 . GLN A 1 82  ? -81.766 70.463 -133.104 1.00 63.84  ? 81  GLN H OE1 1 
ATOM   627  N NE2 . GLN A 1 82  ? -82.237 68.801 -131.683 1.00 68.48  ? 81  GLN H NE2 1 
ATOM   628  N N   . MET A 1 83  ? -82.026 66.168 -134.443 1.00 45.40  ? 82  MET H N   1 
ATOM   629  C CA  . MET A 1 83  ? -82.237 64.776 -134.057 1.00 45.65  ? 82  MET H CA  1 
ATOM   630  C C   . MET A 1 83  ? -82.459 64.660 -132.547 1.00 51.62  ? 82  MET H C   1 
ATOM   631  O O   . MET A 1 83  ? -81.582 65.013 -131.761 1.00 53.85  ? 82  MET H O   1 
ATOM   632  C CB  . MET A 1 83  ? -81.037 63.926 -134.473 1.00 44.56  ? 82  MET H CB  1 
ATOM   633  C CG  . MET A 1 83  ? -80.643 64.001 -135.960 1.00 44.51  ? 82  MET H CG  1 
ATOM   634  S SD  . MET A 1 83  ? -79.333 62.797 -136.380 1.00 56.08  ? 82  MET H SD  1 
ATOM   635  C CE  . MET A 1 83  ? -77.886 63.679 -135.826 1.00 72.44  ? 82  MET H CE  1 
ATOM   636  N N   . ASN A 1 84  A -83.637 64.187 -132.147 1.00 47.88  ? 82  ASN H N   1 
ATOM   637  C CA  . ASN A 1 84  A -83.955 64.006 -130.733 1.00 44.52  ? 82  ASN H CA  1 
ATOM   638  C C   . ASN A 1 84  A -84.091 62.536 -130.358 1.00 48.23  ? 82  ASN H C   1 
ATOM   639  O O   . ASN A 1 84  A -84.288 61.683 -131.230 1.00 47.33  ? 82  ASN H O   1 
ATOM   640  C CB  . ASN A 1 84  A -85.270 64.694 -130.404 1.00 46.01  ? 82  ASN H CB  1 
ATOM   641  C CG  . ASN A 1 84  A -85.181 66.192 -130.494 1.00 50.06  ? 82  ASN H CG  1 
ATOM   642  O OD1 . ASN A 1 84  A -84.115 66.779 -130.293 1.00 53.96  ? 82  ASN H OD1 1 
ATOM   643  N ND2 . ASN A 1 84  A -86.315 66.831 -130.775 1.00 39.11  ? 82  ASN H ND2 1 
ATOM   644  N N   . SER A 1 85  B -84.002 62.236 -129.062 1.00 46.48  ? 82  SER H N   1 
ATOM   645  C CA  . SER A 1 85  B -84.308 60.896 -128.603 1.00 43.37  ? 82  SER H CA  1 
ATOM   646  C C   . SER A 1 85  B -83.517 59.876 -129.421 1.00 45.88  ? 82  SER H C   1 
ATOM   647  O O   . SER A 1 85  B -84.085 58.963 -130.013 1.00 47.67  ? 82  SER H O   1 
ATOM   648  C CB  . SER A 1 85  B -85.797 60.657 -128.820 1.00 43.83  ? 82  SER H CB  1 
ATOM   649  O OG  . SER A 1 85  B -86.347 59.812 -127.836 1.00 47.95  ? 82  SER H OG  1 
ATOM   650  N N   . LEU A 1 86  C -82.205 60.042 -129.468 1.00 43.20  ? 82  LEU H N   1 
ATOM   651  C CA  . LEU A 1 86  C -81.383 59.242 -130.358 1.00 46.53  ? 82  LEU H CA  1 
ATOM   652  C C   . LEU A 1 86  C -81.176 57.845 -129.808 1.00 50.75  ? 82  LEU H C   1 
ATOM   653  O O   . LEU A 1 86  C -81.110 57.663 -128.594 1.00 58.14  ? 82  LEU H O   1 
ATOM   654  C CB  . LEU A 1 86  C -80.041 59.930 -130.591 1.00 47.64  ? 82  LEU H CB  1 
ATOM   655  C CG  . LEU A 1 86  C -80.103 61.048 -131.628 1.00 50.94  ? 82  LEU H CG  1 
ATOM   656  C CD1 . LEU A 1 86  C -78.768 61.751 -131.723 1.00 56.67  ? 82  LEU H CD1 1 
ATOM   657  C CD2 . LEU A 1 86  C -80.485 60.471 -132.968 1.00 43.89  ? 82  LEU H CD2 1 
ATOM   658  N N   . ARG A 1 87  ? -81.074 56.864 -130.702 1.00 49.83  ? 83  ARG H N   1 
ATOM   659  C CA  . ARG A 1 87  ? -80.875 55.468 -130.312 1.00 53.12  ? 83  ARG H CA  1 
ATOM   660  C C   . ARG A 1 87  ? -79.626 54.846 -130.933 1.00 53.82  ? 83  ARG H C   1 
ATOM   661  O O   . ARG A 1 87  ? -79.107 55.320 -131.956 1.00 47.83  ? 83  ARG H O   1 
ATOM   662  C CB  . ARG A 1 87  ? -82.076 54.615 -130.705 1.00 56.75  ? 83  ARG H CB  1 
ATOM   663  C CG  . ARG A 1 87  ? -83.417 55.237 -130.423 1.00 70.80  ? 83  ARG H CG  1 
ATOM   664  C CD  . ARG A 1 87  ? -84.468 54.629 -131.335 1.00 77.93  ? 83  ARG H CD  1 
ATOM   665  N NE  . ARG A 1 87  ? -85.829 54.985 -130.948 1.00 83.11  ? 83  ARG H NE  1 
ATOM   666  C CZ  . ARG A 1 87  ? -86.893 54.719 -131.696 1.00 85.51  ? 83  ARG H CZ  1 
ATOM   667  N NH1 . ARG A 1 87  ? -88.108 55.066 -131.282 1.00 85.67  ? 83  ARG H NH1 1 
ATOM   668  N NH2 . ARG A 1 87  ? -86.730 54.104 -132.865 1.00 82.30  ? 83  ARG H NH2 1 
ATOM   669  N N   . ALA A 1 88  ? -79.163 53.762 -130.321 1.00 48.82  ? 84  ALA H N   1 
ATOM   670  C CA  . ALA A 1 88  ? -78.004 53.049 -130.837 1.00 52.83  ? 84  ALA H CA  1 
ATOM   671  C C   . ALA A 1 88  ? -78.075 52.881 -132.368 1.00 57.31  ? 84  ALA H C   1 
ATOM   672  O O   . ALA A 1 88  ? -77.073 53.040 -133.078 1.00 58.77  ? 84  ALA H O   1 
ATOM   673  C CB  . ALA A 1 88  ? -77.881 51.713 -130.164 1.00 43.80  ? 84  ALA H CB  1 
ATOM   674  N N   . GLU A 1 89  ? -79.269 52.579 -132.863 1.00 51.28  ? 85  GLU H N   1 
ATOM   675  C CA  . GLU A 1 89  ? -79.484 52.288 -134.278 1.00 50.78  ? 85  GLU H CA  1 
ATOM   676  C C   . GLU A 1 89  ? -79.340 53.507 -135.196 1.00 49.44  ? 85  GLU H C   1 
ATOM   677  O O   . GLU A 1 89  ? -79.273 53.357 -136.417 1.00 52.76  ? 85  GLU H O   1 
ATOM   678  C CB  . GLU A 1 89  ? -80.860 51.650 -134.468 1.00 59.96  ? 85  GLU H CB  1 
ATOM   679  C CG  . GLU A 1 89  ? -81.227 50.648 -133.369 1.00 82.61  ? 85  GLU H CG  1 
ATOM   680  C CD  . GLU A 1 89  ? -81.786 51.314 -132.110 1.00 94.34  ? 85  GLU H CD  1 
ATOM   681  O OE1 . GLU A 1 89  ? -82.809 52.028 -132.226 1.00 98.95  ? 85  GLU H OE1 1 
ATOM   682  O OE2 . GLU A 1 89  ? -81.212 51.118 -131.010 1.00 93.12  ? 85  GLU H OE2 1 
ATOM   683  N N   . ASP A 1 90  ? -79.304 54.705 -134.612 1.00 41.30  ? 86  ASP H N   1 
ATOM   684  C CA  . ASP A 1 90  ? -79.125 55.931 -135.382 1.00 43.13  ? 86  ASP H CA  1 
ATOM   685  C C   . ASP A 1 90  ? -77.642 56.238 -135.582 1.00 47.99  ? 86  ASP H C   1 
ATOM   686  O O   . ASP A 1 90  ? -77.292 57.231 -136.225 1.00 46.93  ? 86  ASP H O   1 
ATOM   687  C CB  . ASP A 1 90  ? -79.800 57.118 -134.687 1.00 42.41  ? 86  ASP H CB  1 
ATOM   688  C CG  . ASP A 1 90  ? -81.285 56.897 -134.449 1.00 55.52  ? 86  ASP H CG  1 
ATOM   689  O OD1 . ASP A 1 90  ? -81.935 56.211 -135.270 1.00 60.42  ? 86  ASP H OD1 1 
ATOM   690  O OD2 . ASP A 1 90  ? -81.803 57.418 -133.437 1.00 56.27  ? 86  ASP H OD2 1 
ATOM   691  N N   . THR A 1 91  ? -76.774 55.394 -135.020 1.00 46.21  ? 87  THR H N   1 
ATOM   692  C CA  . THR A 1 91  ? -75.333 55.559 -135.191 1.00 42.88  ? 87  THR H CA  1 
ATOM   693  C C   . THR A 1 91  ? -74.975 55.384 -136.658 1.00 42.60  ? 87  THR H C   1 
ATOM   694  O O   . THR A 1 91  ? -75.265 54.343 -137.238 1.00 46.87  ? 87  THR H O   1 
ATOM   695  C CB  . THR A 1 91  ? -74.532 54.538 -134.375 1.00 44.69  ? 87  THR H CB  1 
ATOM   696  O OG1 . THR A 1 91  ? -74.617 54.862 -132.985 1.00 45.07  ? 87  THR H OG1 1 
ATOM   697  C CG2 . THR A 1 91  ? -73.076 54.573 -134.776 1.00 35.55  ? 87  THR H CG2 1 
ATOM   698  N N   . ALA A 1 92  ? -74.369 56.406 -137.259 1.00 35.92  ? 88  ALA H N   1 
ATOM   699  C CA  . ALA A 1 92  ? -74.009 56.349 -138.674 1.00 41.86  ? 88  ALA H CA  1 
ATOM   700  C C   . ALA A 1 92  ? -73.302 57.620 -139.149 1.00 43.83  ? 88  ALA H C   1 
ATOM   701  O O   . ALA A 1 92  ? -73.174 58.594 -138.389 1.00 39.24  ? 88  ALA H O   1 
ATOM   702  C CB  . ALA A 1 92  ? -75.251 56.105 -139.517 1.00 41.03  ? 88  ALA H CB  1 
ATOM   703  N N   . VAL A 1 93  ? -72.837 57.593 -140.401 1.00 35.77  ? 89  VAL H N   1 
ATOM   704  C CA  . VAL A 1 93  ? -72.423 58.804 -141.106 1.00 40.95  ? 89  VAL H CA  1 
ATOM   705  C C   . VAL A 1 93  ? -73.650 59.406 -141.802 1.00 43.29  ? 89  VAL H C   1 
ATOM   706  O O   . VAL A 1 93  ? -74.328 58.721 -142.564 1.00 47.79  ? 89  VAL H O   1 
ATOM   707  C CB  . VAL A 1 93  ? -71.345 58.508 -142.169 1.00 40.72  ? 89  VAL H CB  1 
ATOM   708  C CG1 . VAL A 1 93  ? -70.951 59.769 -142.875 1.00 41.91  ? 89  VAL H CG1 1 
ATOM   709  C CG2 . VAL A 1 93  ? -70.128 57.892 -141.528 1.00 42.21  ? 89  VAL H CG2 1 
ATOM   710  N N   . TYR A 1 94  ? -73.940 60.673 -141.518 1.00 42.33  ? 90  TYR H N   1 
ATOM   711  C CA  . TYR A 1 94  ? -75.042 61.405 -142.165 1.00 46.01  ? 90  TYR H CA  1 
ATOM   712  C C   . TYR A 1 94  ? -74.526 62.359 -143.227 1.00 50.71  ? 90  TYR H C   1 
ATOM   713  O O   . TYR A 1 94  ? -73.636 63.182 -142.964 1.00 52.72  ? 90  TYR H O   1 
ATOM   714  C CB  . TYR A 1 94  ? -75.842 62.215 -141.148 1.00 36.62  ? 90  TYR H CB  1 
ATOM   715  C CG  . TYR A 1 94  ? -76.652 61.354 -140.242 1.00 38.58  ? 90  TYR H CG  1 
ATOM   716  C CD1 . TYR A 1 94  ? -76.034 60.581 -139.267 1.00 43.58  ? 90  TYR H CD1 1 
ATOM   717  C CD2 . TYR A 1 94  ? -78.035 61.291 -140.363 1.00 36.61  ? 90  TYR H CD2 1 
ATOM   718  C CE1 . TYR A 1 94  ? -76.776 59.760 -138.430 1.00 46.07  ? 90  TYR H CE1 1 
ATOM   719  C CE2 . TYR A 1 94  ? -78.793 60.464 -139.529 1.00 41.26  ? 90  TYR H CE2 1 
ATOM   720  C CZ  . TYR A 1 94  ? -78.150 59.712 -138.567 1.00 39.45  ? 90  TYR H CZ  1 
ATOM   721  O OH  . TYR A 1 94  ? -78.860 58.899 -137.749 1.00 40.41  ? 90  TYR H OH  1 
ATOM   722  N N   . TYR A 1 95  ? -75.092 62.249 -144.423 1.00 43.80  ? 91  TYR H N   1 
ATOM   723  C CA  . TYR A 1 95  ? -74.704 63.094 -145.542 1.00 43.28  ? 91  TYR H CA  1 
ATOM   724  C C   . TYR A 1 95  ? -75.848 64.032 -145.864 1.00 46.32  ? 91  TYR H C   1 
ATOM   725  O O   . TYR A 1 95  ? -77.002 63.603 -145.871 1.00 48.21  ? 91  TYR H O   1 
ATOM   726  C CB  . TYR A 1 95  ? -74.449 62.233 -146.781 1.00 46.45  ? 91  TYR H CB  1 
ATOM   727  C CG  . TYR A 1 95  ? -73.312 61.233 -146.679 1.00 48.73  ? 91  TYR H CG  1 
ATOM   728  C CD1 . TYR A 1 95  ? -72.003 61.618 -146.931 1.00 47.45  ? 91  TYR H CD1 1 
ATOM   729  C CD2 . TYR A 1 95  ? -73.552 59.897 -146.378 1.00 43.87  ? 91  TYR H CD2 1 
ATOM   730  C CE1 . TYR A 1 95  ? -70.964 60.716 -146.864 1.00 45.31  ? 91  TYR H CE1 1 
ATOM   731  C CE2 . TYR A 1 95  ? -72.514 58.978 -146.308 1.00 45.81  ? 91  TYR H CE2 1 
ATOM   732  C CZ  . TYR A 1 95  ? -71.217 59.400 -146.550 1.00 47.60  ? 91  TYR H CZ  1 
ATOM   733  O OH  . TYR A 1 95  ? -70.163 58.514 -146.487 1.00 45.68  ? 91  TYR H OH  1 
ATOM   734  N N   . CYS A 1 96  ? -75.573 65.302 -146.139 1.00 44.40  ? 92  CYS H N   1 
ATOM   735  C CA  . CYS A 1 96  ? -76.633 66.066 -146.774 1.00 53.51  ? 92  CYS H CA  1 
ATOM   736  C C   . CYS A 1 96  ? -76.429 65.972 -148.268 1.00 52.98  ? 92  CYS H C   1 
ATOM   737  O O   . CYS A 1 96  ? -75.304 65.844 -148.747 1.00 51.58  ? 92  CYS H O   1 
ATOM   738  C CB  . CYS A 1 96  ? -76.814 67.498 -146.238 1.00 58.51  ? 92  CYS H CB  1 
ATOM   739  S SG  . CYS A 1 96  ? -75.732 68.804 -146.813 1.00 92.00  ? 92  CYS H SG  1 
ATOM   740  N N   . VAL A 1 97  ? -77.528 65.946 -149.002 1.00 48.96  ? 93  VAL H N   1 
ATOM   741  C CA  . VAL A 1 97  ? -77.426 65.728 -150.422 1.00 52.50  ? 93  VAL H CA  1 
ATOM   742  C C   . VAL A 1 97  ? -78.412 66.596 -151.166 1.00 56.59  ? 93  VAL H C   1 
ATOM   743  O O   . VAL A 1 97  ? -79.514 66.869 -150.687 1.00 60.68  ? 93  VAL H O   1 
ATOM   744  C CB  . VAL A 1 97  ? -77.655 64.251 -150.776 1.00 56.10  ? 93  VAL H CB  1 
ATOM   745  C CG1 . VAL A 1 97  ? -76.770 63.359 -149.922 1.00 51.85  ? 93  VAL H CG1 1 
ATOM   746  C CG2 . VAL A 1 97  ? -79.099 63.890 -150.568 1.00 57.19  ? 93  VAL H CG2 1 
ATOM   747  N N   . ARG A 1 98  ? -77.993 67.043 -152.341 1.00 56.39  ? 94  ARG H N   1 
ATOM   748  C CA  . ARG A 1 98  ? -78.848 67.819 -153.214 1.00 48.71  ? 94  ARG H CA  1 
ATOM   749  C C   . ARG A 1 98  ? -79.528 66.887 -154.176 1.00 50.57  ? 94  ARG H C   1 
ATOM   750  O O   . ARG A 1 98  ? -78.894 65.993 -154.734 1.00 58.08  ? 94  ARG H O   1 
ATOM   751  C CB  . ARG A 1 98  ? -78.024 68.823 -154.012 1.00 50.13  ? 94  ARG H CB  1 
ATOM   752  C CG  . ARG A 1 98  ? -78.862 69.748 -154.847 1.00 48.95  ? 94  ARG H CG  1 
ATOM   753  C CD  . ARG A 1 98  ? -78.022 70.760 -155.541 1.00 55.73  ? 94  ARG H CD  1 
ATOM   754  N NE  . ARG A 1 98  ? -77.568 70.244 -156.816 1.00 67.09  ? 94  ARG H NE  1 
ATOM   755  C CZ  . ARG A 1 98  ? -76.820 70.932 -157.663 1.00 72.54  ? 94  ARG H CZ  1 
ATOM   756  N NH1 . ARG A 1 98  ? -76.447 72.168 -157.361 1.00 73.59  ? 94  ARG H NH1 1 
ATOM   757  N NH2 . ARG A 1 98  ? -76.447 70.381 -158.804 1.00 71.79  ? 94  ARG H NH2 1 
ATOM   758  N N   . GLU A 1 99  ? -80.821 67.096 -154.369 1.00 47.28  ? 95  GLU H N   1 
ATOM   759  C CA  . GLU A 1 99  ? -81.564 66.348 -155.353 1.00 48.42  ? 95  GLU H CA  1 
ATOM   760  C C   . GLU A 1 99  ? -81.446 67.116 -156.667 1.00 58.01  ? 95  GLU H C   1 
ATOM   761  O O   . GLU A 1 99  ? -81.413 68.341 -156.663 1.00 65.07  ? 95  GLU H O   1 
ATOM   762  C CB  . GLU A 1 99  ? -83.020 66.203 -154.908 1.00 49.37  ? 95  GLU H CB  1 
ATOM   763  C CG  . GLU A 1 99  ? -83.716 65.019 -155.520 1.00 58.08  ? 95  GLU H CG  1 
ATOM   764  C CD  . GLU A 1 99  ? -84.932 64.571 -154.745 1.00 69.07  ? 95  GLU H CD  1 
ATOM   765  O OE1 . GLU A 1 99  ? -85.005 64.800 -153.515 1.00 72.28  ? 95  GLU H OE1 1 
ATOM   766  O OE2 . GLU A 1 99  ? -85.823 63.973 -155.380 1.00 73.15  ? 95  GLU H OE2 1 
ATOM   767  N N   . GLY A 1 100 ? -81.348 66.396 -157.782 1.00 59.76  ? 96  GLY H N   1 
ATOM   768  C CA  . GLY A 1 100 ? -81.227 67.006 -159.090 1.00 57.10  ? 96  GLY H CA  1 
ATOM   769  C C   . GLY A 1 100 ? -82.342 67.993 -159.402 1.00 63.65  ? 96  GLY H C   1 
ATOM   770  O O   . GLY A 1 100 ? -83.399 67.975 -158.773 1.00 66.03  ? 96  GLY H O   1 
ATOM   771  N N   . PRO A 1 101 ? -82.114 68.862 -160.395 1.00 62.69  ? 97  PRO H N   1 
ATOM   772  C CA  . PRO A 1 101 ? -83.005 69.981 -160.707 1.00 60.77  ? 97  PRO H CA  1 
ATOM   773  C C   . PRO A 1 101 ? -84.418 69.593 -161.188 1.00 66.42  ? 97  PRO H C   1 
ATOM   774  O O   . PRO A 1 101 ? -85.301 70.438 -161.089 1.00 68.88  ? 97  PRO H O   1 
ATOM   775  C CB  . PRO A 1 101 ? -82.236 70.722 -161.803 1.00 55.48  ? 97  PRO H CB  1 
ATOM   776  C CG  . PRO A 1 101 ? -81.383 69.663 -162.414 1.00 55.06  ? 97  PRO H CG  1 
ATOM   777  C CD  . PRO A 1 101 ? -80.911 68.894 -161.241 1.00 59.78  ? 97  PRO H CD  1 
ATOM   778  N N   . ARG A 1 102 ? -84.641 68.377 -161.686 1.00 67.05  ? 98  ARG H N   1 
ATOM   779  C CA  . ARG A 1 102 ? -85.993 67.979 -162.108 1.00 63.39  ? 98  ARG H CA  1 
ATOM   780  C C   . ARG A 1 102 ? -86.926 67.668 -160.926 1.00 63.57  ? 98  ARG H C   1 
ATOM   781  O O   . ARG A 1 102 ? -88.076 67.259 -161.123 1.00 62.41  ? 98  ARG H O   1 
ATOM   782  C CB  . ARG A 1 102 ? -85.947 66.765 -163.035 1.00 66.13  ? 98  ARG H CB  1 
ATOM   783  C CG  . ARG A 1 102 ? -85.040 66.917 -164.232 1.00 81.14  ? 98  ARG H CG  1 
ATOM   784  C CD  . ARG A 1 102 ? -85.212 65.767 -165.225 1.00 96.04  ? 98  ARG H CD  1 
ATOM   785  N NE  . ARG A 1 102 ? -84.270 65.868 -166.340 1.00 112.53 ? 98  ARG H NE  1 
ATOM   786  C CZ  . ARG A 1 102 ? -82.998 65.468 -166.289 1.00 124.85 ? 98  ARG H CZ  1 
ATOM   787  N NH1 . ARG A 1 102 ? -82.499 64.937 -165.174 1.00 125.97 ? 98  ARG H NH1 1 
ATOM   788  N NH2 . ARG A 1 102 ? -82.216 65.600 -167.356 1.00 128.55 ? 98  ARG H NH2 1 
ATOM   789  N N   . ALA A 1 103 ? -86.427 67.834 -159.703 1.00 58.19  ? 99  ALA H N   1 
ATOM   790  C CA  . ALA A 1 103 ? -87.235 67.547 -158.521 1.00 62.68  ? 99  ALA H CA  1 
ATOM   791  C C   . ALA A 1 103 ? -87.822 68.816 -157.921 1.00 66.71  ? 99  ALA H C   1 
ATOM   792  O O   . ALA A 1 103 ? -87.098 69.727 -157.510 1.00 67.13  ? 99  ALA H O   1 
ATOM   793  C CB  . ALA A 1 103 ? -86.431 66.800 -157.488 1.00 63.32  ? 99  ALA H CB  1 
ATOM   794  N N   . THR A 1 104 ? -89.145 68.857 -157.861 1.00 69.93  ? 100 THR H N   1 
ATOM   795  C CA  . THR A 1 104 ? -89.860 70.058 -157.465 1.00 75.39  ? 100 THR H CA  1 
ATOM   796  C C   . THR A 1 104 ? -90.960 69.674 -156.501 1.00 81.75  ? 100 THR H C   1 
ATOM   797  O O   . THR A 1 104 ? -91.565 68.614 -156.647 1.00 89.50  ? 100 THR H O   1 
ATOM   798  C CB  . THR A 1 104 ? -90.483 70.759 -158.701 1.00 86.29  ? 100 THR H CB  1 
ATOM   799  O OG1 . THR A 1 104 ? -89.521 71.645 -159.294 1.00 79.66  ? 100 THR H OG1 1 
ATOM   800  C CG2 . THR A 1 104 ? -91.729 71.548 -158.317 1.00 89.58  ? 100 THR H CG2 1 
ATOM   801  N N   . GLY A 1 105 A -91.209 70.526 -155.513 1.00 78.80  ? 100 GLY H N   1 
ATOM   802  C CA  . GLY A 1 105 A -92.317 70.326 -154.600 1.00 82.74  ? 100 GLY H CA  1 
ATOM   803  C C   . GLY A 1 105 A -92.692 68.874 -154.356 1.00 85.14  ? 100 GLY H C   1 
ATOM   804  O O   . GLY A 1 105 A -92.080 68.202 -153.519 1.00 89.06  ? 100 GLY H O   1 
ATOM   805  N N   . TYR A 1 106 B -93.696 68.387 -155.084 1.00 80.90  ? 100 TYR H N   1 
ATOM   806  C CA  . TYR A 1 106 B -94.199 67.035 -154.874 1.00 83.12  ? 100 TYR H CA  1 
ATOM   807  C C   . TYR A 1 106 B -94.142 66.173 -156.135 1.00 83.95  ? 100 TYR H C   1 
ATOM   808  O O   . TYR A 1 106 B -94.875 65.192 -156.255 1.00 85.75  ? 100 TYR H O   1 
ATOM   809  C CB  . TYR A 1 106 B -95.625 67.077 -154.324 1.00 92.69  ? 100 TYR H CB  1 
ATOM   810  C CG  . TYR A 1 106 B -96.640 67.702 -155.261 1.00 106.86 ? 100 TYR H CG  1 
ATOM   811  C CD1 . TYR A 1 106 B -97.642 66.934 -155.842 1.00 113.67 ? 100 TYR H CD1 1 
ATOM   812  C CD2 . TYR A 1 106 B -96.601 69.061 -155.560 1.00 112.15 ? 100 TYR H CD2 1 
ATOM   813  C CE1 . TYR A 1 106 B -98.579 67.500 -156.698 1.00 120.83 ? 100 TYR H CE1 1 
ATOM   814  C CE2 . TYR A 1 106 B -97.533 69.637 -156.413 1.00 118.37 ? 100 TYR H CE2 1 
ATOM   815  C CZ  . TYR A 1 106 B -98.522 68.852 -156.982 1.00 123.20 ? 100 TYR H CZ  1 
ATOM   816  O OH  . TYR A 1 106 B -99.456 69.415 -157.834 1.00 124.04 ? 100 TYR H OH  1 
ATOM   817  N N   . SER A 1 107 C -93.256 66.535 -157.059 1.00 83.63  ? 100 SER H N   1 
ATOM   818  C CA  . SER A 1 107 C -93.087 65.804 -158.321 1.00 85.71  ? 100 SER H CA  1 
ATOM   819  C C   . SER A 1 107 C -92.256 64.525 -158.186 1.00 80.42  ? 100 SER H C   1 
ATOM   820  O O   . SER A 1 107 C -91.763 64.197 -157.108 1.00 81.02  ? 100 SER H O   1 
ATOM   821  C CB  . SER A 1 107 C -92.418 66.703 -159.363 1.00 85.53  ? 100 SER H CB  1 
ATOM   822  O OG  . SER A 1 107 C -91.069 66.978 -159.006 1.00 82.48  ? 100 SER H OG  1 
ATOM   823  N N   . MET A 1 108 D -92.111 63.810 -159.298 1.00 77.75  ? 100 MET H N   1 
ATOM   824  C CA  . MET A 1 108 D -91.182 62.691 -159.393 1.00 71.91  ? 100 MET H CA  1 
ATOM   825  C C   . MET A 1 108 D -89.812 63.164 -158.938 1.00 71.16  ? 100 MET H C   1 
ATOM   826  O O   . MET A 1 108 D -89.431 64.320 -159.169 1.00 71.74  ? 100 MET H O   1 
ATOM   827  C CB  . MET A 1 108 D -91.085 62.180 -160.840 1.00 71.62  ? 100 MET H CB  1 
ATOM   828  C CG  . MET A 1 108 D -92.240 61.300 -161.303 1.00 70.17  ? 100 MET H CG  1 
ATOM   829  S SD  . MET A 1 108 D -92.270 59.664 -160.538 1.00 78.42  ? 100 MET H SD  1 
ATOM   830  C CE  . MET A 1 108 D -93.215 59.993 -159.052 1.00 98.03  ? 100 MET H CE  1 
ATOM   831  N N   . ALA A 1 109 E -89.068 62.264 -158.306 1.00 63.84  ? 100 ALA H N   1 
ATOM   832  C CA  . ALA A 1 109 E -87.764 62.604 -157.760 1.00 57.34  ? 100 ALA H CA  1 
ATOM   833  C C   . ALA A 1 109 E -86.642 62.661 -158.824 1.00 57.40  ? 100 ALA H C   1 
ATOM   834  O O   . ALA A 1 109 E -86.821 62.221 -159.952 1.00 53.57  ? 100 ALA H O   1 
ATOM   835  C CB  . ALA A 1 109 E -87.416 61.632 -156.660 1.00 50.49  ? 100 ALA H CB  1 
ATOM   836  N N   . ASP A 1 110 F -85.496 63.220 -158.444 1.00 58.62  ? 100 ASP H N   1 
ATOM   837  C CA  . ASP A 1 110 F -84.289 63.245 -159.267 1.00 57.19  ? 100 ASP H CA  1 
ATOM   838  C C   . ASP A 1 110 F -83.147 62.572 -158.487 1.00 59.01  ? 100 ASP H C   1 
ATOM   839  O O   . ASP A 1 110 F -83.316 62.188 -157.328 1.00 59.47  ? 100 ASP H O   1 
ATOM   840  C CB  . ASP A 1 110 F -83.918 64.697 -159.584 1.00 56.11  ? 100 ASP H CB  1 
ATOM   841  C CG  . ASP A 1 110 F -83.163 64.846 -160.896 1.00 68.86  ? 100 ASP H CG  1 
ATOM   842  O OD1 . ASP A 1 110 F -83.164 65.966 -161.459 1.00 71.86  ? 100 ASP H OD1 1 
ATOM   843  O OD2 . ASP A 1 110 F -82.569 63.855 -161.371 1.00 74.52  ? 100 ASP H OD2 1 
ATOM   844  N N   . VAL A 1 111 G -81.981 62.457 -159.111 1.00 58.69  ? 100 VAL H N   1 
ATOM   845  C CA  . VAL A 1 111 G -80.823 61.797 -158.507 1.00 56.65  ? 100 VAL H CA  1 
ATOM   846  C C   . VAL A 1 111 G -80.122 62.631 -157.442 1.00 54.82  ? 100 VAL H C   1 
ATOM   847  O O   . VAL A 1 111 G -80.117 63.847 -157.510 1.00 58.49  ? 100 VAL H O   1 
ATOM   848  C CB  . VAL A 1 111 G -79.768 61.488 -159.565 1.00 57.49  ? 100 VAL H CB  1 
ATOM   849  C CG1 . VAL A 1 111 G -80.261 60.403 -160.514 1.00 60.10  ? 100 VAL H CG1 1 
ATOM   850  C CG2 . VAL A 1 111 G -79.425 62.757 -160.310 1.00 45.23  ? 100 VAL H CG2 1 
ATOM   851  N N   . PHE A 1 112 H -79.518 61.961 -156.464 1.00 55.83  ? 100 PHE H N   1 
ATOM   852  C CA  . PHE A 1 112 H -78.709 62.624 -155.446 1.00 52.90  ? 100 PHE H CA  1 
ATOM   853  C C   . PHE A 1 112 H -77.377 62.986 -156.067 1.00 51.19  ? 100 PHE H C   1 
ATOM   854  O O   . PHE A 1 112 H -76.460 62.175 -156.072 1.00 56.50  ? 100 PHE H O   1 
ATOM   855  C CB  . PHE A 1 112 H -78.447 61.691 -154.262 1.00 50.88  ? 100 PHE H CB  1 
ATOM   856  C CG  . PHE A 1 112 H -79.667 61.361 -153.458 1.00 50.92  ? 100 PHE H CG  1 
ATOM   857  C CD1 . PHE A 1 112 H -79.918 60.064 -153.067 1.00 51.40  ? 100 PHE H CD1 1 
ATOM   858  C CD2 . PHE A 1 112 H -80.567 62.348 -153.099 1.00 52.55  ? 100 PHE H CD2 1 
ATOM   859  C CE1 . PHE A 1 112 H -81.047 59.753 -152.320 1.00 52.07  ? 100 PHE H CE1 1 
ATOM   860  C CE2 . PHE A 1 112 H -81.686 62.046 -152.355 1.00 51.88  ? 100 PHE H CE2 1 
ATOM   861  C CZ  . PHE A 1 112 H -81.926 60.748 -151.963 1.00 49.99  ? 100 PHE H CZ  1 
ATOM   862  N N   . ASP A 1 113 ? -77.262 64.204 -156.571 1.00 44.63  ? 101 ASP H N   1 
ATOM   863  C CA  . ASP A 1 113 ? -76.149 64.560 -157.438 1.00 50.55  ? 101 ASP H CA  1 
ATOM   864  C C   . ASP A 1 113 ? -75.046 65.334 -156.729 1.00 54.05  ? 101 ASP H C   1 
ATOM   865  O O   . ASP A 1 113 ? -73.977 65.555 -157.288 1.00 60.55  ? 101 ASP H O   1 
ATOM   866  C CB  . ASP A 1 113 ? -76.649 65.360 -158.647 1.00 55.50  ? 101 ASP H CB  1 
ATOM   867  C CG  . ASP A 1 113 ? -77.026 66.783 -158.285 1.00 69.52  ? 101 ASP H CG  1 
ATOM   868  O OD1 . ASP A 1 113 ? -77.072 67.100 -157.075 1.00 76.03  ? 101 ASP H OD1 1 
ATOM   869  O OD2 . ASP A 1 113 ? -77.276 67.587 -159.206 1.00 73.90  ? 101 ASP H OD2 1 
ATOM   870  N N   . ILE A 1 114 ? -75.301 65.768 -155.506 1.00 52.64  ? 102 ILE H N   1 
ATOM   871  C CA  . ILE A 1 114 ? -74.248 66.411 -154.741 1.00 55.62  ? 102 ILE H CA  1 
ATOM   872  C C   . ILE A 1 114 ? -74.305 66.050 -153.264 1.00 56.16  ? 102 ILE H C   1 
ATOM   873  O O   . ILE A 1 114 ? -75.332 66.206 -152.611 1.00 57.24  ? 102 ILE H O   1 
ATOM   874  C CB  . ILE A 1 114 ? -74.244 67.923 -154.930 1.00 54.48  ? 102 ILE H CB  1 
ATOM   875  C CG1 . ILE A 1 114 ? -73.875 68.241 -156.378 1.00 62.45  ? 102 ILE H CG1 1 
ATOM   876  C CG2 . ILE A 1 114 ? -73.276 68.562 -153.951 1.00 45.67  ? 102 ILE H CG2 1 
ATOM   877  C CD1 . ILE A 1 114 ? -73.023 69.464 -156.559 1.00 64.69  ? 102 ILE H CD1 1 
ATOM   878  N N   . TRP A 1 115 ? -73.177 65.564 -152.758 1.00 55.54  ? 103 TRP H N   1 
ATOM   879  C CA  . TRP A 1 115 ? -73.091 64.974 -151.435 1.00 50.33  ? 103 TRP H CA  1 
ATOM   880  C C   . TRP A 1 115 ? -72.078 65.726 -150.583 1.00 53.36  ? 103 TRP H C   1 
ATOM   881  O O   . TRP A 1 115 ? -70.998 66.078 -151.061 1.00 55.61  ? 103 TRP H O   1 
ATOM   882  C CB  . TRP A 1 115 ? -72.651 63.511 -151.554 1.00 44.25  ? 103 TRP H CB  1 
ATOM   883  C CG  . TRP A 1 115 ? -73.637 62.618 -152.223 1.00 43.53  ? 103 TRP H CG  1 
ATOM   884  C CD1 . TRP A 1 115 ? -74.030 62.676 -153.516 1.00 45.14  ? 103 TRP H CD1 1 
ATOM   885  C CD2 . TRP A 1 115 ? -74.347 61.513 -151.634 1.00 47.54  ? 103 TRP H CD2 1 
ATOM   886  N NE1 . TRP A 1 115 ? -74.945 61.683 -153.778 1.00 51.84  ? 103 TRP H NE1 1 
ATOM   887  C CE2 . TRP A 1 115 ? -75.155 60.953 -152.637 1.00 44.75  ? 103 TRP H CE2 1 
ATOM   888  C CE3 . TRP A 1 115 ? -74.371 60.940 -150.358 1.00 41.97  ? 103 TRP H CE3 1 
ATOM   889  C CZ2 . TRP A 1 115 ? -75.984 59.860 -152.411 1.00 42.93  ? 103 TRP H CZ2 1 
ATOM   890  C CZ3 . TRP A 1 115 ? -75.199 59.862 -150.133 1.00 41.96  ? 103 TRP H CZ3 1 
ATOM   891  C CH2 . TRP A 1 115 ? -75.995 59.330 -151.152 1.00 41.87  ? 103 TRP H CH2 1 
ATOM   892  N N   . GLY A 1 116 ? -72.425 65.971 -149.323 1.00 50.39  ? 104 GLY H N   1 
ATOM   893  C CA  . GLY A 1 116 ? -71.470 66.491 -148.364 1.00 41.81  ? 104 GLY H CA  1 
ATOM   894  C C   . GLY A 1 116 ? -70.454 65.431 -147.963 1.00 45.64  ? 104 GLY H C   1 
ATOM   895  O O   . GLY A 1 116 ? -70.608 64.263 -148.317 1.00 45.64  ? 104 GLY H O   1 
ATOM   896  N N   . GLN A 1 117 ? -69.419 65.827 -147.223 1.00 43.84  ? 105 GLN H N   1 
ATOM   897  C CA  . GLN A 1 117 ? -68.363 64.896 -146.831 1.00 48.03  ? 105 GLN H CA  1 
ATOM   898  C C   . GLN A 1 117 ? -68.877 63.916 -145.802 1.00 48.12  ? 105 GLN H C   1 
ATOM   899  O O   . GLN A 1 117 ? -68.237 62.911 -145.536 1.00 54.72  ? 105 GLN H O   1 
ATOM   900  C CB  . GLN A 1 117 ? -67.135 65.613 -146.249 1.00 56.09  ? 105 GLN H CB  1 
ATOM   901  C CG  . GLN A 1 117 ? -67.181 67.132 -146.287 1.00 70.41  ? 105 GLN H CG  1 
ATOM   902  C CD  . GLN A 1 117 ? -68.127 67.735 -145.238 1.00 76.06  ? 105 GLN H CD  1 
ATOM   903  O OE1 . GLN A 1 117 ? -69.162 68.321 -145.587 1.00 76.04  ? 105 GLN H OE1 1 
ATOM   904  N NE2 . GLN A 1 117 ? -67.772 67.594 -143.951 1.00 68.31  ? 105 GLN H NE2 1 
ATOM   905  N N   . GLY A 1 118 ? -70.030 64.219 -145.213 1.00 45.43  ? 106 GLY H N   1 
ATOM   906  C CA  . GLY A 1 118 ? -70.608 63.373 -144.184 1.00 45.86  ? 106 GLY H CA  1 
ATOM   907  C C   . GLY A 1 118 ? -70.151 63.726 -142.777 1.00 52.69  ? 106 GLY H C   1 
ATOM   908  O O   . GLY A 1 118 ? -69.036 64.206 -142.575 1.00 48.03  ? 106 GLY H O   1 
ATOM   909  N N   . THR A 1 119 ? -71.030 63.483 -141.807 1.00 58.69  ? 107 THR H N   1 
ATOM   910  C CA  . THR A 1 119 ? -70.761 63.715 -140.388 1.00 55.55  ? 107 THR H CA  1 
ATOM   911  C C   . THR A 1 119 ? -71.069 62.434 -139.612 1.00 50.19  ? 107 THR H C   1 
ATOM   912  O O   . THR A 1 119 ? -72.172 61.899 -139.719 1.00 46.48  ? 107 THR H O   1 
ATOM   913  C CB  . THR A 1 119 ? -71.684 64.819 -139.842 1.00 65.70  ? 107 THR H CB  1 
ATOM   914  O OG1 . THR A 1 119 ? -71.294 66.083 -140.379 1.00 78.94  ? 107 THR H OG1 1 
ATOM   915  C CG2 . THR A 1 119 ? -71.580 64.898 -138.362 1.00 68.25  ? 107 THR H CG2 1 
ATOM   916  N N   . MET A 1 120 ? -70.115 61.932 -138.830 1.00 40.93  ? 108 MET H N   1 
ATOM   917  C CA  . MET A 1 120 ? -70.357 60.715 -138.054 1.00 41.96  ? 108 MET H CA  1 
ATOM   918  C C   . MET A 1 120 ? -71.139 61.017 -136.784 1.00 46.48  ? 108 MET H C   1 
ATOM   919  O O   . MET A 1 120 ? -70.879 62.008 -136.099 1.00 49.13  ? 108 MET H O   1 
ATOM   920  C CB  . MET A 1 120 ? -69.055 59.980 -137.720 1.00 45.46  ? 108 MET H CB  1 
ATOM   921  C CG  . MET A 1 120 ? -69.218 58.804 -136.741 1.00 49.11  ? 108 MET H CG  1 
ATOM   922  S SD  . MET A 1 120 ? -69.972 57.270 -137.372 1.00 63.55  ? 108 MET H SD  1 
ATOM   923  C CE  . MET A 1 120 ? -68.638 56.640 -138.398 1.00 142.62 ? 108 MET H CE  1 
ATOM   924  N N   . VAL A 1 121 ? -72.115 60.166 -136.487 1.00 44.11  ? 109 VAL H N   1 
ATOM   925  C CA  . VAL A 1 121 ? -72.894 60.309 -135.267 1.00 47.95  ? 109 VAL H CA  1 
ATOM   926  C C   . VAL A 1 121 ? -72.898 59.007 -134.475 1.00 48.47  ? 109 VAL H C   1 
ATOM   927  O O   . VAL A 1 121 ? -73.314 57.961 -134.966 1.00 49.63  ? 109 VAL H O   1 
ATOM   928  C CB  . VAL A 1 121 ? -74.343 60.737 -135.552 1.00 44.76  ? 109 VAL H CB  1 
ATOM   929  C CG1 . VAL A 1 121 ? -75.135 60.730 -134.267 1.00 35.06  ? 109 VAL H CG1 1 
ATOM   930  C CG2 . VAL A 1 121 ? -74.370 62.102 -136.201 1.00 41.94  ? 109 VAL H CG2 1 
ATOM   931  N N   . THR A 1 122 ? -72.426 59.078 -133.243 1.00 50.05  ? 110 THR H N   1 
ATOM   932  C CA  . THR A 1 122 ? -72.328 57.889 -132.423 1.00 49.70  ? 110 THR H CA  1 
ATOM   933  C C   . THR A 1 122 ? -73.209 58.030 -131.206 1.00 44.35  ? 110 THR H C   1 
ATOM   934  O O   . THR A 1 122 ? -72.992 58.911 -130.372 1.00 50.20  ? 110 THR H O   1 
ATOM   935  C CB  . THR A 1 122 ? -70.892 57.644 -131.958 1.00 54.50  ? 110 THR H CB  1 
ATOM   936  O OG1 . THR A 1 122 ? -70.022 57.546 -133.097 1.00 57.75  ? 110 THR H OG1 1 
ATOM   937  C CG2 . THR A 1 122 ? -70.829 56.358 -131.162 1.00 55.96  ? 110 THR H CG2 1 
ATOM   938  N N   . VAL A 1 123 ? -74.208 57.161 -131.119 1.00 39.18  ? 111 VAL H N   1 
ATOM   939  C CA  . VAL A 1 123 ? -75.108 57.128 -129.976 1.00 40.59  ? 111 VAL H CA  1 
ATOM   940  C C   . VAL A 1 123 ? -74.668 56.047 -129.005 1.00 43.89  ? 111 VAL H C   1 
ATOM   941  O O   . VAL A 1 123 ? -74.836 54.858 -129.276 1.00 45.98  ? 111 VAL H O   1 
ATOM   942  C CB  . VAL A 1 123 ? -76.525 56.838 -130.429 1.00 45.00  ? 111 VAL H CB  1 
ATOM   943  C CG1 . VAL A 1 123 ? -77.493 56.979 -129.259 1.00 43.16  ? 111 VAL H CG1 1 
ATOM   944  C CG2 . VAL A 1 123 ? -76.891 57.787 -131.562 1.00 45.68  ? 111 VAL H CG2 1 
ATOM   945  N N   . SER A 1 124 ? -74.096 56.466 -127.878 1.00 42.89  ? 112 SER H N   1 
ATOM   946  C CA  . SER A 1 124 ? -73.501 55.536 -126.917 1.00 46.48  ? 112 SER H CA  1 
ATOM   947  C C   . SER A 1 124 ? -73.581 56.029 -125.466 1.00 49.77  ? 112 SER H C   1 
ATOM   948  O O   . SER A 1 124 ? -73.499 57.234 -125.192 1.00 49.54  ? 112 SER H O   1 
ATOM   949  C CB  . SER A 1 124 ? -72.033 55.274 -127.276 1.00 50.63  ? 112 SER H CB  1 
ATOM   950  O OG  . SER A 1 124 ? -71.342 54.611 -126.229 1.00 47.88  ? 112 SER H OG  1 
ATOM   951  N N   . SER A 1 125 ? -73.726 55.084 -124.542 1.00 38.35  ? 113 SER H N   1 
ATOM   952  C CA  . SER A 1 125 ? -73.704 55.390 -123.118 1.00 39.96  ? 113 SER H CA  1 
ATOM   953  C C   . SER A 1 125 ? -72.297 55.714 -122.583 1.00 44.21  ? 113 SER H C   1 
ATOM   954  O O   . SER A 1 125 ? -72.154 56.293 -121.519 1.00 51.07  ? 113 SER H O   1 
ATOM   955  C CB  . SER A 1 125 ? -74.279 54.222 -122.343 1.00 36.00  ? 113 SER H CB  1 
ATOM   956  O OG  . SER A 1 125 ? -73.485 53.068 -122.541 1.00 47.45  ? 113 SER H OG  1 
ATOM   957  N N   . ALA A 1 126 ? -71.264 55.348 -123.330 1.00 35.60  ? 114 ALA H N   1 
ATOM   958  C CA  . ALA A 1 126 ? -69.887 55.469 -122.857 1.00 38.14  ? 114 ALA H CA  1 
ATOM   959  C C   . ALA A 1 126 ? -69.294 56.857 -123.085 1.00 42.18  ? 114 ALA H C   1 
ATOM   960  O O   . ALA A 1 126 ? -69.527 57.482 -124.111 1.00 53.18  ? 114 ALA H O   1 
ATOM   961  C CB  . ALA A 1 126 ? -69.012 54.399 -123.524 1.00 35.69  ? 114 ALA H CB  1 
ATOM   962  N N   . SER A 1 127 ? -68.510 57.338 -122.136 1.00 41.75  ? 115 SER H N   1 
ATOM   963  C CA  . SER A 1 127 ? -67.898 58.643 -122.298 1.00 47.13  ? 115 SER H CA  1 
ATOM   964  C C   . SER A 1 127 ? -66.764 58.539 -123.288 1.00 48.07  ? 115 SER H C   1 
ATOM   965  O O   . SER A 1 127 ? -66.242 57.457 -123.539 1.00 46.41  ? 115 SER H O   1 
ATOM   966  C CB  . SER A 1 127 ? -67.402 59.203 -120.968 1.00 51.58  ? 115 SER H CB  1 
ATOM   967  O OG  . SER A 1 127 ? -67.060 58.162 -120.093 1.00 54.71  ? 115 SER H OG  1 
ATOM   968  N N   . THR A 1 128 ? -66.400 59.670 -123.872 1.00 48.46  ? 116 THR H N   1 
ATOM   969  C CA  . THR A 1 128 ? -65.398 59.665 -124.913 1.00 45.00  ? 116 THR H CA  1 
ATOM   970  C C   . THR A 1 128 ? -64.037 59.446 -124.273 1.00 48.68  ? 116 THR H C   1 
ATOM   971  O O   . THR A 1 128 ? -63.814 59.818 -123.127 1.00 50.91  ? 116 THR H O   1 
ATOM   972  C CB  . THR A 1 128 ? -65.426 60.977 -125.707 1.00 43.16  ? 116 THR H CB  1 
ATOM   973  O OG1 . THR A 1 128 ? -64.501 60.900 -126.791 1.00 54.74  ? 116 THR H OG1 1 
ATOM   974  C CG2 . THR A 1 128 ? -65.023 62.115 -124.848 1.00 41.47  ? 116 THR H CG2 1 
ATOM   975  N N   . LYS A 1 129 ? -63.137 58.809 -125.002 1.00 50.06  ? 117 LYS H N   1 
ATOM   976  C CA  . LYS A 1 129 ? -61.773 58.644 -124.531 1.00 48.66  ? 117 LYS H CA  1 
ATOM   977  C C   . LYS A 1 129 ? -60.820 58.970 -125.669 1.00 46.93  ? 117 LYS H C   1 
ATOM   978  O O   . LYS A 1 129 ? -60.932 58.406 -126.752 1.00 48.07  ? 117 LYS H O   1 
ATOM   979  C CB  . LYS A 1 129 ? -61.533 57.223 -124.027 1.00 46.27  ? 117 LYS H CB  1 
ATOM   980  C CG  . LYS A 1 129 ? -60.104 56.969 -123.600 1.00 49.60  ? 117 LYS H CG  1 
ATOM   981  C CD  . LYS A 1 129 ? -59.929 55.612 -122.938 1.00 58.16  ? 117 LYS H CD  1 
ATOM   982  C CE  . LYS A 1 129 ? -58.788 55.642 -121.922 1.00 68.76  ? 117 LYS H CE  1 
ATOM   983  N NZ  . LYS A 1 129 ? -57.670 56.542 -122.337 1.00 74.29  ? 117 LYS H NZ  1 
ATOM   984  N N   . GLY A 1 130 ? -59.894 59.892 -125.425 1.00 45.08  ? 118 GLY H N   1 
ATOM   985  C CA  . GLY A 1 130 ? -58.932 60.272 -126.443 1.00 50.75  ? 118 GLY H CA  1 
ATOM   986  C C   . GLY A 1 130 ? -57.831 59.244 -126.611 1.00 50.38  ? 118 GLY H C   1 
ATOM   987  O O   . GLY A 1 130 ? -57.490 58.539 -125.658 1.00 46.49  ? 118 GLY H O   1 
ATOM   988  N N   . PRO A 1 131 ? -57.256 59.160 -127.823 1.00 53.40  ? 119 PRO H N   1 
ATOM   989  C CA  . PRO A 1 131 ? -56.269 58.120 -128.122 1.00 50.24  ? 119 PRO H CA  1 
ATOM   990  C C   . PRO A 1 131 ? -54.943 58.449 -127.472 1.00 53.40  ? 119 PRO H C   1 
ATOM   991  O O   . PRO A 1 131 ? -54.691 59.598 -127.136 1.00 58.98  ? 119 PRO H O   1 
ATOM   992  C CB  . PRO A 1 131 ? -56.098 58.217 -129.641 1.00 52.66  ? 119 PRO H CB  1 
ATOM   993  C CG  . PRO A 1 131 ? -56.854 59.457 -130.085 1.00 53.72  ? 119 PRO H CG  1 
ATOM   994  C CD  . PRO A 1 131 ? -57.301 60.189 -128.874 1.00 58.58  ? 119 PRO H CD  1 
ATOM   995  N N   . SER A 1 132 ? -54.106 57.442 -127.284 1.00 55.59  ? 120 SER H N   1 
ATOM   996  C CA  . SER A 1 132 ? -52.703 57.685 -127.001 1.00 56.76  ? 120 SER H CA  1 
ATOM   997  C C   . SER A 1 132 ? -51.985 57.476 -128.309 1.00 53.09  ? 120 SER H C   1 
ATOM   998  O O   . SER A 1 132 ? -52.222 56.495 -128.995 1.00 65.18  ? 120 SER H O   1 
ATOM   999  C CB  . SER A 1 132 ? -52.167 56.695 -125.968 1.00 59.50  ? 120 SER H CB  1 
ATOM   1000 O OG  . SER A 1 132 ? -52.965 56.703 -124.804 1.00 62.98  ? 120 SER H OG  1 
ATOM   1001 N N   . VAL A 1 133 ? -51.109 58.394 -128.662 1.00 49.68  ? 121 VAL H N   1 
ATOM   1002 C CA  . VAL A 1 133 ? -50.398 58.291 -129.917 1.00 50.64  ? 121 VAL H CA  1 
ATOM   1003 C C   . VAL A 1 133 ? -48.948 57.890 -129.655 1.00 61.47  ? 121 VAL H C   1 
ATOM   1004 O O   . VAL A 1 133 ? -48.185 58.638 -129.051 1.00 65.52  ? 121 VAL H O   1 
ATOM   1005 C CB  . VAL A 1 133 ? -50.476 59.618 -130.680 1.00 49.09  ? 121 VAL H CB  1 
ATOM   1006 C CG1 . VAL A 1 133 ? -49.832 59.495 -132.051 1.00 47.09  ? 121 VAL H CG1 1 
ATOM   1007 C CG2 . VAL A 1 133 ? -51.937 60.064 -130.802 1.00 46.96  ? 121 VAL H CG2 1 
ATOM   1008 N N   . PHE A 1 134 ? -48.574 56.696 -130.098 1.00 63.42  ? 122 PHE H N   1 
ATOM   1009 C CA  . PHE A 1 134 ? -47.207 56.225 -129.935 1.00 57.17  ? 122 PHE H CA  1 
ATOM   1010 C C   . PHE A 1 134 ? -46.494 56.123 -131.276 1.00 57.50  ? 122 PHE H C   1 
ATOM   1011 O O   . PHE A 1 134 ? -47.087 55.773 -132.285 1.00 55.48  ? 122 PHE H O   1 
ATOM   1012 C CB  . PHE A 1 134 ? -47.200 54.865 -129.259 1.00 54.10  ? 122 PHE H CB  1 
ATOM   1013 C CG  . PHE A 1 134 ? -47.893 54.848 -127.942 1.00 51.36  ? 122 PHE H CG  1 
ATOM   1014 C CD1 . PHE A 1 134 ? -49.018 54.064 -127.749 1.00 53.58  ? 122 PHE H CD1 1 
ATOM   1015 C CD2 . PHE A 1 134 ? -47.422 55.617 -126.885 1.00 54.13  ? 122 PHE H CD2 1 
ATOM   1016 C CE1 . PHE A 1 134 ? -49.664 54.039 -126.512 1.00 56.03  ? 122 PHE H CE1 1 
ATOM   1017 C CE2 . PHE A 1 134 ? -48.065 55.608 -125.648 1.00 51.43  ? 122 PHE H CE2 1 
ATOM   1018 C CZ  . PHE A 1 134 ? -49.185 54.816 -125.463 1.00 53.03  ? 122 PHE H CZ  1 
ATOM   1019 N N   . PRO A 1 135 ? -45.198 56.420 -131.289 1.00 66.48  ? 123 PRO H N   1 
ATOM   1020 C CA  . PRO A 1 135 ? -44.459 56.356 -132.551 1.00 61.79  ? 123 PRO H CA  1 
ATOM   1021 C C   . PRO A 1 135 ? -44.184 54.913 -132.958 1.00 61.21  ? 123 PRO H C   1 
ATOM   1022 O O   . PRO A 1 135 ? -44.090 54.026 -132.114 1.00 58.82  ? 123 PRO H O   1 
ATOM   1023 C CB  . PRO A 1 135 ? -43.155 57.039 -132.181 1.00 57.97  ? 123 PRO H CB  1 
ATOM   1024 C CG  . PRO A 1 135 ? -42.942 56.535 -130.766 1.00 57.39  ? 123 PRO H CG  1 
ATOM   1025 C CD  . PRO A 1 135 ? -44.305 56.730 -130.156 1.00 61.58  ? 123 PRO H CD  1 
ATOM   1026 N N   . LEU A 1 136 ? -44.091 54.686 -134.259 1.00 53.85  ? 124 LEU H N   1 
ATOM   1027 C CA  . LEU A 1 136 ? -43.560 53.446 -134.789 1.00 54.83  ? 124 LEU H CA  1 
ATOM   1028 C C   . LEU A 1 136 ? -42.237 53.800 -135.468 1.00 62.82  ? 124 LEU H C   1 
ATOM   1029 O O   . LEU A 1 136 ? -42.195 54.151 -136.648 1.00 62.44  ? 124 LEU H O   1 
ATOM   1030 C CB  . LEU A 1 136 ? -44.541 52.818 -135.773 1.00 53.89  ? 124 LEU H CB  1 
ATOM   1031 C CG  . LEU A 1 136 ? -45.813 52.318 -135.101 1.00 52.20  ? 124 LEU H CG  1 
ATOM   1032 C CD1 . LEU A 1 136 ? -46.835 51.875 -136.121 1.00 51.86  ? 124 LEU H CD1 1 
ATOM   1033 C CD2 . LEU A 1 136 ? -45.462 51.181 -134.173 1.00 62.70  ? 124 LEU H CD2 1 
ATOM   1034 N N   . ALA A 1 137 ? -41.158 53.731 -134.700 1.00 58.06  ? 125 ALA H N   1 
ATOM   1035 C CA  . ALA A 1 137 ? -39.867 54.218 -135.161 1.00 63.83  ? 125 ALA H CA  1 
ATOM   1036 C C   . ALA A 1 137 ? -39.270 53.368 -136.281 1.00 65.69  ? 125 ALA H C   1 
ATOM   1037 O O   . ALA A 1 137 ? -39.144 52.142 -136.148 1.00 66.17  ? 125 ALA H O   1 
ATOM   1038 C CB  . ALA A 1 137 ? -38.894 54.323 -133.993 1.00 61.14  ? 125 ALA H CB  1 
ATOM   1039 N N   . PRO A 1 138 ? -38.899 54.025 -137.389 1.00 62.18  ? 126 PRO H N   1 
ATOM   1040 C CA  . PRO A 1 138 ? -38.187 53.365 -138.486 1.00 64.49  ? 126 PRO H CA  1 
ATOM   1041 C C   . PRO A 1 138 ? -36.874 52.836 -137.930 1.00 68.54  ? 126 PRO H C   1 
ATOM   1042 O O   . PRO A 1 138 ? -36.268 53.477 -137.061 1.00 68.70  ? 126 PRO H O   1 
ATOM   1043 C CB  . PRO A 1 138 ? -37.917 54.515 -139.460 1.00 67.19  ? 126 PRO H CB  1 
ATOM   1044 C CG  . PRO A 1 138 ? -37.896 55.744 -138.566 1.00 73.38  ? 126 PRO H CG  1 
ATOM   1045 C CD  . PRO A 1 138 ? -39.027 55.473 -137.618 1.00 74.76  ? 126 PRO H CD  1 
ATOM   1046 N N   . SER A 1 139 ? -36.451 51.670 -138.394 1.00 66.82  ? 127 SER H N   1 
ATOM   1047 C CA  . SER A 1 139 ? -35.222 51.065 -137.906 1.00 68.83  ? 127 SER H CA  1 
ATOM   1048 C C   . SER A 1 139 ? -34.701 50.126 -138.979 1.00 70.31  ? 127 SER H C   1 
ATOM   1049 O O   . SER A 1 139 ? -35.283 50.042 -140.060 1.00 71.86  ? 127 SER H O   1 
ATOM   1050 C CB  . SER A 1 139 ? -35.466 50.315 -136.589 1.00 68.07  ? 127 SER H CB  1 
ATOM   1051 O OG  . SER A 1 139 ? -35.766 48.945 -136.810 1.00 79.08  ? 127 SER H OG  1 
ATOM   1052 N N   . SER A 1 140 ? -33.609 49.426 -138.701 1.00 72.28  ? 128 SER H N   1 
ATOM   1053 C CA  . SER A 1 140 ? -33.100 48.471 -139.677 1.00 73.80  ? 128 SER H CA  1 
ATOM   1054 C C   . SER A 1 140 ? -34.111 47.346 -139.841 1.00 75.36  ? 128 SER H C   1 
ATOM   1055 O O   . SER A 1 140 ? -34.038 46.570 -140.788 1.00 81.38  ? 128 SER H O   1 
ATOM   1056 C CB  . SER A 1 140 ? -31.747 47.904 -139.250 1.00 76.25  ? 128 SER H CB  1 
ATOM   1057 O OG  . SER A 1 140 ? -31.912 46.798 -138.378 1.00 100.53 ? 128 SER H OG  1 
ATOM   1058 N N   . LYS A 1 141 ? -35.058 47.265 -138.912 1.00 74.29  ? 129 LYS H N   1 
ATOM   1059 C CA  . LYS A 1 141 ? -36.068 46.216 -138.939 1.00 74.83  ? 129 LYS H CA  1 
ATOM   1060 C C   . LYS A 1 141 ? -37.379 46.668 -139.577 1.00 78.16  ? 129 LYS H C   1 
ATOM   1061 O O   . LYS A 1 141 ? -38.341 45.906 -139.643 1.00 75.63  ? 129 LYS H O   1 
ATOM   1062 C CB  . LYS A 1 141 ? -36.289 45.648 -137.536 1.00 69.14  ? 129 LYS H CB  1 
ATOM   1063 C CG  . LYS A 1 141 ? -35.215 44.652 -137.155 1.00 71.69  ? 129 LYS H CG  1 
ATOM   1064 C CD  . LYS A 1 141 ? -35.434 44.037 -135.784 1.00 77.45  ? 129 LYS H CD  1 
ATOM   1065 C CE  . LYS A 1 141 ? -34.201 43.224 -135.352 1.00 80.12  ? 129 LYS H CE  1 
ATOM   1066 N NZ  . LYS A 1 141 ? -33.832 42.126 -136.293 1.00 75.72  ? 129 LYS H NZ  1 
ATOM   1067 N N   . SER A 1 142 ? -37.404 47.912 -140.046 1.00 63.54  ? 130 SER H N   1 
ATOM   1068 C CA  . SER A 1 142 ? -38.523 48.430 -140.837 1.00 68.55  ? 130 SER H CA  1 
ATOM   1069 C C   . SER A 1 142 ? -38.002 48.936 -142.175 1.00 69.08  ? 130 SER H C   1 
ATOM   1070 O O   . SER A 1 142 ? -38.577 49.829 -142.789 1.00 68.82  ? 130 SER H O   1 
ATOM   1071 C CB  . SER A 1 142 ? -39.245 49.557 -140.095 1.00 71.56  ? 130 SER H CB  1 
ATOM   1072 O OG  . SER A 1 142 ? -38.326 50.409 -139.429 1.00 72.89  ? 130 SER H OG  1 
ATOM   1073 N N   . THR A 1 143 ? -36.894 48.354 -142.611 1.00 72.04  ? 131 THR H N   1 
ATOM   1074 C CA  . THR A 1 143 ? -36.232 48.779 -143.827 1.00 79.29  ? 131 THR H CA  1 
ATOM   1075 C C   . THR A 1 143 ? -36.109 47.597 -144.775 1.00 86.08  ? 131 THR H C   1 
ATOM   1076 O O   . THR A 1 143 ? -35.738 46.495 -144.364 1.00 87.80  ? 131 THR H O   1 
ATOM   1077 C CB  . THR A 1 143 ? -34.823 49.344 -143.521 1.00 79.99  ? 131 THR H CB  1 
ATOM   1078 O OG1 . THR A 1 143 ? -34.932 50.411 -142.573 1.00 86.53  ? 131 THR H OG1 1 
ATOM   1079 C CG2 . THR A 1 143 ? -34.168 49.883 -144.775 1.00 76.75  ? 131 THR H CG2 1 
ATOM   1080 N N   . SER A 1 144 ? -36.435 47.827 -146.043 1.00 87.11  ? 132 SER H N   1 
ATOM   1081 C CA  . SER A 1 144 ? -36.237 46.824 -147.083 1.00 89.43  ? 132 SER H CA  1 
ATOM   1082 C C   . SER A 1 144 ? -35.676 47.526 -148.306 1.00 90.32  ? 132 SER H C   1 
ATOM   1083 O O   . SER A 1 144 ? -36.264 48.489 -148.806 1.00 90.11  ? 132 SER H O   1 
ATOM   1084 C CB  . SER A 1 144 ? -37.556 46.126 -147.428 1.00 91.69  ? 132 SER H CB  1 
ATOM   1085 O OG  . SER A 1 144 ? -37.341 45.020 -148.283 1.00 91.99  ? 132 SER H OG  1 
ATOM   1086 N N   . GLY A 1 145 ? -34.533 47.053 -148.785 1.00 91.07  ? 133 GLY H N   1 
ATOM   1087 C CA  . GLY A 1 145 ? -33.858 47.735 -149.870 1.00 86.44  ? 133 GLY H CA  1 
ATOM   1088 C C   . GLY A 1 145 ? -33.691 49.197 -149.511 1.00 83.76  ? 133 GLY H C   1 
ATOM   1089 O O   . GLY A 1 145 ? -33.184 49.528 -148.436 1.00 87.71  ? 133 GLY H O   1 
ATOM   1090 N N   . GLY A 1 146 ? -34.138 50.078 -150.396 1.00 78.90  ? 134 GLY H N   1 
ATOM   1091 C CA  . GLY A 1 146 ? -33.972 51.504 -150.183 1.00 80.85  ? 134 GLY H CA  1 
ATOM   1092 C C   . GLY A 1 146 ? -35.057 52.205 -149.384 1.00 85.55  ? 134 GLY H C   1 
ATOM   1093 O O   . GLY A 1 146 ? -34.902 53.376 -149.046 1.00 89.45  ? 134 GLY H O   1 
ATOM   1094 N N   . THR A 1 147 ? -36.149 51.507 -149.076 1.00 85.19  ? 137 THR H N   1 
ATOM   1095 C CA  . THR A 1 147 ? -37.284 52.146 -148.405 1.00 84.62  ? 137 THR H CA  1 
ATOM   1096 C C   . THR A 1 147 ? -37.489 51.678 -146.956 1.00 81.53  ? 137 THR H C   1 
ATOM   1097 O O   . THR A 1 147 ? -37.319 50.497 -146.632 1.00 84.10  ? 137 THR H O   1 
ATOM   1098 C CB  . THR A 1 147 ? -38.599 51.934 -149.181 1.00 83.30  ? 137 THR H CB  1 
ATOM   1099 O OG1 . THR A 1 147 ? -38.936 50.542 -149.155 1.00 84.80  ? 137 THR H OG1 1 
ATOM   1100 C CG2 . THR A 1 147 ? -38.478 52.424 -150.635 1.00 77.19  ? 137 THR H CG2 1 
ATOM   1101 N N   . ALA A 1 148 ? -37.868 52.619 -146.095 1.00 71.93  ? 138 ALA H N   1 
ATOM   1102 C CA  . ALA A 1 148 ? -38.105 52.329 -144.688 1.00 64.85  ? 138 ALA H CA  1 
ATOM   1103 C C   . ALA A 1 148 ? -39.539 52.646 -144.338 1.00 64.45  ? 138 ALA H C   1 
ATOM   1104 O O   . ALA A 1 148 ? -40.120 53.602 -144.853 1.00 67.64  ? 138 ALA H O   1 
ATOM   1105 C CB  . ALA A 1 148 ? -37.161 53.138 -143.794 1.00 62.07  ? 138 ALA H CB  1 
ATOM   1106 N N   . ALA A 1 149 ? -40.100 51.845 -143.443 1.00 57.52  ? 139 ALA H N   1 
ATOM   1107 C CA  . ALA A 1 149 ? -41.446 52.073 -142.957 1.00 56.53  ? 139 ALA H CA  1 
ATOM   1108 C C   . ALA A 1 149 ? -41.427 52.705 -141.565 1.00 59.42  ? 139 ALA H C   1 
ATOM   1109 O O   . ALA A 1 149 ? -40.700 52.258 -140.679 1.00 69.73  ? 139 ALA H O   1 
ATOM   1110 C CB  . ALA A 1 149 ? -42.217 50.766 -142.939 1.00 56.01  ? 139 ALA H CB  1 
ATOM   1111 N N   . LEU A 1 150 ? -42.221 53.753 -141.387 1.00 50.88  ? 140 LEU H N   1 
ATOM   1112 C CA  . LEU A 1 150 ? -42.435 54.349 -140.080 1.00 51.35  ? 140 LEU H CA  1 
ATOM   1113 C C   . LEU A 1 150 ? -43.928 54.621 -139.922 1.00 53.15  ? 140 LEU H C   1 
ATOM   1114 O O   . LEU A 1 150 ? -44.680 54.521 -140.876 1.00 56.67  ? 140 LEU H O   1 
ATOM   1115 C CB  . LEU A 1 150 ? -41.649 55.646 -139.970 1.00 57.66  ? 140 LEU H CB  1 
ATOM   1116 C CG  . LEU A 1 150 ? -41.995 56.709 -141.016 1.00 63.22  ? 140 LEU H CG  1 
ATOM   1117 C CD1 . LEU A 1 150 ? -42.967 57.716 -140.445 1.00 61.00  ? 140 LEU H CD1 1 
ATOM   1118 C CD2 . LEU A 1 150 ? -40.737 57.419 -141.484 1.00 71.59  ? 140 LEU H CD2 1 
ATOM   1119 N N   . GLY A 1 151 ? -44.373 54.969 -138.725 1.00 57.94  ? 141 GLY H N   1 
ATOM   1120 C CA  . GLY A 1 151 ? -45.772 55.309 -138.557 1.00 58.46  ? 141 GLY H CA  1 
ATOM   1121 C C   . GLY A 1 151 ? -46.170 55.606 -137.134 1.00 55.45  ? 141 GLY H C   1 
ATOM   1122 O O   . GLY A 1 151 ? -45.319 55.716 -136.260 1.00 57.14  ? 141 GLY H O   1 
ATOM   1123 N N   . CYS A 1 152 ? -47.474 55.737 -136.912 1.00 53.20  ? 142 CYS H N   1 
ATOM   1124 C CA  . CYS A 1 152 ? -48.020 56.001 -135.586 1.00 55.72  ? 142 CYS H CA  1 
ATOM   1125 C C   . CYS A 1 152 ? -49.049 54.960 -135.178 1.00 61.63  ? 142 CYS H C   1 
ATOM   1126 O O   . CYS A 1 152 ? -49.893 54.543 -135.972 1.00 62.74  ? 142 CYS H O   1 
ATOM   1127 C CB  . CYS A 1 152 ? -48.680 57.371 -135.551 1.00 52.90  ? 142 CYS H CB  1 
ATOM   1128 S SG  . CYS A 1 152 ? -47.533 58.715 -135.726 1.00 124.65 ? 142 CYS H SG  1 
ATOM   1129 N N   . LEU A 1 153 ? -48.973 54.545 -133.925 1.00 61.06  ? 143 LEU H N   1 
ATOM   1130 C CA  . LEU A 1 153 ? -50.007 53.719 -133.327 1.00 55.58  ? 143 LEU H CA  1 
ATOM   1131 C C   . LEU A 1 153 ? -50.914 54.654 -132.540 1.00 56.16  ? 143 LEU H C   1 
ATOM   1132 O O   . LEU A 1 153 ? -50.455 55.376 -131.642 1.00 53.03  ? 143 LEU H O   1 
ATOM   1133 C CB  . LEU A 1 153 ? -49.374 52.679 -132.405 1.00 51.17  ? 143 LEU H CB  1 
ATOM   1134 C CG  . LEU A 1 153 ? -50.301 51.807 -131.569 1.00 54.02  ? 143 LEU H CG  1 
ATOM   1135 C CD1 . LEU A 1 153 ? -51.330 51.118 -132.462 1.00 45.92  ? 143 LEU H CD1 1 
ATOM   1136 C CD2 . LEU A 1 153 ? -49.476 50.797 -130.789 1.00 50.96  ? 143 LEU H CD2 1 
ATOM   1137 N N   . VAL A 1 154 ? -52.190 54.669 -132.907 1.00 52.93  ? 144 VAL H N   1 
ATOM   1138 C CA  . VAL A 1 154 ? -53.180 55.522 -132.256 1.00 51.77  ? 144 VAL H CA  1 
ATOM   1139 C C   . VAL A 1 154 ? -54.080 54.630 -131.404 1.00 52.81  ? 144 VAL H C   1 
ATOM   1140 O O   . VAL A 1 154 ? -54.989 53.980 -131.908 1.00 54.63  ? 144 VAL H O   1 
ATOM   1141 C CB  . VAL A 1 154 ? -53.995 56.317 -133.302 1.00 50.70  ? 144 VAL H CB  1 
ATOM   1142 C CG1 . VAL A 1 154 ? -54.920 57.311 -132.631 1.00 51.09  ? 144 VAL H CG1 1 
ATOM   1143 C CG2 . VAL A 1 154 ? -53.050 57.052 -134.256 1.00 46.76  ? 144 VAL H CG2 1 
ATOM   1144 N N   . LYS A 1 155 ? -53.814 54.592 -130.108 1.00 51.66  ? 145 LYS H N   1 
ATOM   1145 C CA  . LYS A 1 155 ? -54.350 53.535 -129.268 1.00 54.25  ? 145 LYS H CA  1 
ATOM   1146 C C   . LYS A 1 155 ? -55.415 53.953 -128.239 1.00 53.81  ? 145 LYS H C   1 
ATOM   1147 O O   . LYS A 1 155 ? -55.319 55.004 -127.600 1.00 47.39  ? 145 LYS H O   1 
ATOM   1148 C CB  . LYS A 1 155 ? -53.198 52.813 -128.564 1.00 56.44  ? 145 LYS H CB  1 
ATOM   1149 C CG  . LYS A 1 155 ? -53.602 51.498 -127.965 1.00 57.81  ? 145 LYS H CG  1 
ATOM   1150 C CD  . LYS A 1 155 ? -52.430 50.568 -127.807 1.00 61.00  ? 145 LYS H CD  1 
ATOM   1151 C CE  . LYS A 1 155 ? -52.939 49.151 -127.665 1.00 65.58  ? 145 LYS H CE  1 
ATOM   1152 N NZ  . LYS A 1 155 ? -53.889 49.038 -126.514 1.00 65.22  ? 145 LYS H NZ  1 
ATOM   1153 N N   . ASP A 1 156 ? -56.429 53.101 -128.107 1.00 51.68  ? 146 ASP H N   1 
ATOM   1154 C CA  . ASP A 1 156 ? -57.447 53.201 -127.069 1.00 48.38  ? 146 ASP H CA  1 
ATOM   1155 C C   . ASP A 1 156 ? -58.258 54.488 -127.083 1.00 50.14  ? 146 ASP H C   1 
ATOM   1156 O O   . ASP A 1 156 ? -58.152 55.314 -126.181 1.00 58.31  ? 146 ASP H O   1 
ATOM   1157 C CB  . ASP A 1 156 ? -56.821 52.970 -125.708 1.00 52.35  ? 146 ASP H CB  1 
ATOM   1158 C CG  . ASP A 1 156 ? -56.123 51.641 -125.626 1.00 60.52  ? 146 ASP H CG  1 
ATOM   1159 O OD1 . ASP A 1 156 ? -56.542 50.709 -126.339 1.00 60.17  ? 146 ASP H OD1 1 
ATOM   1160 O OD2 . ASP A 1 156 ? -55.153 51.524 -124.853 1.00 70.25  ? 146 ASP H OD2 1 
ATOM   1161 N N   . TYR A 1 157 ? -59.086 54.636 -128.109 1.00 46.13  ? 147 TYR H N   1 
ATOM   1162 C CA  . TYR A 1 157 ? -59.947 55.794 -128.216 1.00 45.36  ? 147 TYR H CA  1 
ATOM   1163 C C   . TYR A 1 157 ? -61.392 55.390 -128.481 1.00 47.49  ? 147 TYR H C   1 
ATOM   1164 O O   . TYR A 1 157 ? -61.666 54.274 -128.909 1.00 46.89  ? 147 TYR H O   1 
ATOM   1165 C CB  . TYR A 1 157 ? -59.445 56.734 -129.296 1.00 35.66  ? 147 TYR H CB  1 
ATOM   1166 C CG  . TYR A 1 157 ? -59.527 56.175 -130.699 1.00 44.98  ? 147 TYR H CG  1 
ATOM   1167 C CD1 . TYR A 1 157 ? -58.471 55.466 -131.250 1.00 48.42  ? 147 TYR H CD1 1 
ATOM   1168 C CD2 . TYR A 1 157 ? -60.646 56.387 -131.486 1.00 40.75  ? 147 TYR H CD2 1 
ATOM   1169 C CE1 . TYR A 1 157 ? -58.538 54.968 -132.540 1.00 46.66  ? 147 TYR H CE1 1 
ATOM   1170 C CE2 . TYR A 1 157 ? -60.716 55.898 -132.764 1.00 47.57  ? 147 TYR H CE2 1 
ATOM   1171 C CZ  . TYR A 1 157 ? -59.662 55.183 -133.289 1.00 46.81  ? 147 TYR H CZ  1 
ATOM   1172 O OH  . TYR A 1 157 ? -59.741 54.687 -134.571 1.00 47.97  ? 147 TYR H OH  1 
ATOM   1173 N N   . PHE A 1 158 ? -62.311 56.299 -128.174 1.00 46.53  ? 148 PHE H N   1 
ATOM   1174 C CA  . PHE A 1 158 ? -63.719 56.080 -128.405 1.00 41.67  ? 148 PHE H CA  1 
ATOM   1175 C C   . PHE A 1 158 ? -64.430 57.424 -128.449 1.00 47.69  ? 148 PHE H C   1 
ATOM   1176 O O   . PHE A 1 158 ? -64.164 58.279 -127.616 1.00 51.72  ? 148 PHE H O   1 
ATOM   1177 C CB  . PHE A 1 158 ? -64.316 55.216 -127.310 1.00 36.90  ? 148 PHE H CB  1 
ATOM   1178 C CG  . PHE A 1 158 ? -65.759 54.903 -127.537 1.00 43.32  ? 148 PHE H CG  1 
ATOM   1179 C CD1 . PHE A 1 158 ? -66.127 53.903 -128.413 1.00 43.53  ? 148 PHE H CD1 1 
ATOM   1180 C CD2 . PHE A 1 158 ? -66.748 55.640 -126.916 1.00 44.61  ? 148 PHE H CD2 1 
ATOM   1181 C CE1 . PHE A 1 158 ? -67.457 53.618 -128.645 1.00 38.65  ? 148 PHE H CE1 1 
ATOM   1182 C CE2 . PHE A 1 158 ? -68.074 55.369 -127.145 1.00 44.49  ? 148 PHE H CE2 1 
ATOM   1183 C CZ  . PHE A 1 158 ? -68.429 54.358 -128.026 1.00 41.55  ? 148 PHE H CZ  1 
ATOM   1184 N N   . PRO A 1 159 ? -65.325 57.622 -129.432 1.00 47.55  ? 149 PRO H N   1 
ATOM   1185 C CA  . PRO A 1 159 ? -65.680 56.662 -130.470 1.00 45.13  ? 149 PRO H CA  1 
ATOM   1186 C C   . PRO A 1 159 ? -64.862 56.974 -131.708 1.00 44.96  ? 149 PRO H C   1 
ATOM   1187 O O   . PRO A 1 159 ? -63.897 57.722 -131.630 1.00 45.39  ? 149 PRO H O   1 
ATOM   1188 C CB  . PRO A 1 159 ? -67.127 57.041 -130.750 1.00 44.03  ? 149 PRO H CB  1 
ATOM   1189 C CG  . PRO A 1 159 ? -67.063 58.545 -130.748 1.00 41.71  ? 149 PRO H CG  1 
ATOM   1190 C CD  . PRO A 1 159 ? -66.007 58.908 -129.681 1.00 47.84  ? 149 PRO H CD  1 
ATOM   1191 N N   . GLU A 1 160 ? -65.252 56.398 -132.836 1.00 45.50  ? 150 GLU H N   1 
ATOM   1192 C CA  . GLU A 1 160 ? -64.736 56.792 -134.139 1.00 46.20  ? 150 GLU H CA  1 
ATOM   1193 C C   . GLU A 1 160 ? -65.285 58.173 -134.517 1.00 51.36  ? 150 GLU H C   1 
ATOM   1194 O O   . GLU A 1 160 ? -66.301 58.609 -133.980 1.00 61.12  ? 150 GLU H O   1 
ATOM   1195 C CB  . GLU A 1 160 ? -65.189 55.768 -135.165 1.00 42.69  ? 150 GLU H CB  1 
ATOM   1196 C CG  . GLU A 1 160 ? -64.575 54.409 -135.006 1.00 51.57  ? 150 GLU H CG  1 
ATOM   1197 C CD  . GLU A 1 160 ? -63.528 54.160 -136.081 1.00 73.46  ? 150 GLU H CD  1 
ATOM   1198 O OE1 . GLU A 1 160 ? -62.362 54.648 -135.959 1.00 75.67  ? 150 GLU H OE1 1 
ATOM   1199 O OE2 . GLU A 1 160 ? -63.897 53.488 -137.071 1.00 77.42  ? 150 GLU H OE2 1 
ATOM   1200 N N   . PRO A 1 161 ? -64.624 58.871 -135.446 1.00 44.85  ? 151 PRO H N   1 
ATOM   1201 C CA  . PRO A 1 161 ? -63.406 58.485 -136.160 1.00 43.34  ? 151 PRO H CA  1 
ATOM   1202 C C   . PRO A 1 161 ? -62.205 59.212 -135.577 1.00 51.35  ? 151 PRO H C   1 
ATOM   1203 O O   . PRO A 1 161 ? -62.331 60.104 -134.737 1.00 52.90  ? 151 PRO H O   1 
ATOM   1204 C CB  . PRO A 1 161 ? -63.628 59.073 -137.553 1.00 39.08  ? 151 PRO H CB  1 
ATOM   1205 C CG  . PRO A 1 161 ? -64.644 60.250 -137.343 1.00 37.64  ? 151 PRO H CG  1 
ATOM   1206 C CD  . PRO A 1 161 ? -65.123 60.184 -135.900 1.00 43.55  ? 151 PRO H CD  1 
ATOM   1207 N N   . VAL A 1 162 ? -61.038 58.838 -136.064 1.00 50.84  ? 152 VAL H N   1 
ATOM   1208 C CA  . VAL A 1 162 ? -59.812 59.551 -135.784 1.00 49.10  ? 152 VAL H CA  1 
ATOM   1209 C C   . VAL A 1 162 ? -59.218 59.854 -137.144 1.00 55.49  ? 152 VAL H C   1 
ATOM   1210 O O   . VAL A 1 162 ? -59.256 59.009 -138.034 1.00 66.89  ? 152 VAL H O   1 
ATOM   1211 C CB  . VAL A 1 162 ? -58.852 58.674 -134.972 1.00 54.49  ? 152 VAL H CB  1 
ATOM   1212 C CG1 . VAL A 1 162 ? -57.527 58.534 -135.673 1.00 56.82  ? 152 VAL H CG1 1 
ATOM   1213 C CG2 . VAL A 1 162 ? -58.679 59.235 -133.567 1.00 57.97  ? 152 VAL H CG2 1 
ATOM   1214 N N   . THR A 1 163 ? -58.704 61.057 -137.344 1.00 49.72  ? 153 THR H N   1 
ATOM   1215 C CA  . THR A 1 163 ? -58.045 61.334 -138.609 1.00 53.93  ? 153 THR H CA  1 
ATOM   1216 C C   . THR A 1 163 ? -56.543 61.405 -138.430 1.00 52.45  ? 153 THR H C   1 
ATOM   1217 O O   . THR A 1 163 ? -56.055 61.860 -137.398 1.00 52.97  ? 153 THR H O   1 
ATOM   1218 C CB  . THR A 1 163 ? -58.570 62.602 -139.272 1.00 60.10  ? 153 THR H CB  1 
ATOM   1219 O OG1 . THR A 1 163 ? -58.337 63.723 -138.411 1.00 68.82  ? 153 THR H OG1 1 
ATOM   1220 C CG2 . THR A 1 163 ? -60.062 62.451 -139.545 1.00 54.98  ? 153 THR H CG2 1 
ATOM   1221 N N   . VAL A 1 164 ? -55.821 60.921 -139.434 1.00 52.59  ? 154 VAL H N   1 
ATOM   1222 C CA  . VAL A 1 164 ? -54.365 60.928 -139.415 1.00 50.24  ? 154 VAL H CA  1 
ATOM   1223 C C   . VAL A 1 164 ? -53.808 61.512 -140.693 1.00 53.15  ? 154 VAL H C   1 
ATOM   1224 O O   . VAL A 1 164 ? -54.096 61.038 -141.792 1.00 54.06  ? 154 VAL H O   1 
ATOM   1225 C CB  . VAL A 1 164 ? -53.788 59.521 -139.279 1.00 50.84  ? 154 VAL H CB  1 
ATOM   1226 C CG1 . VAL A 1 164 ? -52.295 59.568 -139.476 1.00 49.62  ? 154 VAL H CG1 1 
ATOM   1227 C CG2 . VAL A 1 164 ? -54.140 58.925 -137.924 1.00 56.11  ? 154 VAL H CG2 1 
ATOM   1228 N N   . SER A 1 165 ? -53.008 62.552 -140.555 1.00 57.68  ? 156 SER H N   1 
ATOM   1229 C CA  . SER A 1 165 ? -52.299 63.069 -141.701 1.00 62.24  ? 156 SER H CA  1 
ATOM   1230 C C   . SER A 1 165 ? -50.807 63.061 -141.394 1.00 68.50  ? 156 SER H C   1 
ATOM   1231 O O   . SER A 1 165 ? -50.391 62.981 -140.234 1.00 65.99  ? 156 SER H O   1 
ATOM   1232 C CB  . SER A 1 165 ? -52.783 64.473 -142.049 1.00 65.24  ? 156 SER H CB  1 
ATOM   1233 O OG  . SER A 1 165 ? -52.347 65.403 -141.075 1.00 74.74  ? 156 SER H OG  1 
ATOM   1234 N N   . TRP A 1 166 ? -50.002 63.130 -142.444 1.00 72.91  ? 157 TRP H N   1 
ATOM   1235 C CA  . TRP A 1 166 ? -48.563 63.155 -142.274 1.00 71.46  ? 157 TRP H CA  1 
ATOM   1236 C C   . TRP A 1 166 ? -47.994 64.475 -142.756 1.00 74.19  ? 157 TRP H C   1 
ATOM   1237 O O   . TRP A 1 166 ? -48.322 64.938 -143.857 1.00 73.17  ? 157 TRP H O   1 
ATOM   1238 C CB  . TRP A 1 166 ? -47.934 61.974 -142.997 1.00 67.91  ? 157 TRP H CB  1 
ATOM   1239 C CG  . TRP A 1 166 ? -48.171 60.713 -142.252 1.00 64.77  ? 157 TRP H CG  1 
ATOM   1240 C CD1 . TRP A 1 166 ? -49.241 59.876 -142.373 1.00 56.58  ? 157 TRP H CD1 1 
ATOM   1241 C CD2 . TRP A 1 166 ? -47.334 60.156 -141.237 1.00 63.54  ? 157 TRP H CD2 1 
ATOM   1242 N NE1 . TRP A 1 166 ? -49.113 58.823 -141.506 1.00 54.62  ? 157 TRP H NE1 1 
ATOM   1243 C CE2 . TRP A 1 166 ? -47.950 58.968 -140.795 1.00 56.42  ? 157 TRP H CE2 1 
ATOM   1244 C CE3 . TRP A 1 166 ? -46.119 60.539 -140.662 1.00 65.18  ? 157 TRP H CE3 1 
ATOM   1245 C CZ2 . TRP A 1 166 ? -47.394 58.160 -139.805 1.00 52.43  ? 157 TRP H CZ2 1 
ATOM   1246 C CZ3 . TRP A 1 166 ? -45.568 59.736 -139.677 1.00 65.38  ? 157 TRP H CZ3 1 
ATOM   1247 C CH2 . TRP A 1 166 ? -46.208 58.560 -139.258 1.00 58.92  ? 157 TRP H CH2 1 
ATOM   1248 N N   . ASN A 1 167 ? -47.152 65.076 -141.915 1.00 73.38  ? 162 ASN H N   1 
ATOM   1249 C CA  . ASN A 1 167 ? -46.570 66.386 -142.191 1.00 76.88  ? 162 ASN H CA  1 
ATOM   1250 C C   . ASN A 1 167 ? -47.612 67.357 -142.711 1.00 80.76  ? 162 ASN H C   1 
ATOM   1251 O O   . ASN A 1 167 ? -47.474 67.917 -143.803 1.00 78.97  ? 162 ASN H O   1 
ATOM   1252 C CB  . ASN A 1 167 ? -45.396 66.271 -143.160 1.00 77.51  ? 162 ASN H CB  1 
ATOM   1253 C CG  . ASN A 1 167 ? -44.212 65.570 -142.539 1.00 83.15  ? 162 ASN H CG  1 
ATOM   1254 O OD1 . ASN A 1 167 ? -43.937 65.738 -141.349 1.00 88.02  ? 162 ASN H OD1 1 
ATOM   1255 N ND2 . ASN A 1 167 ? -43.505 64.773 -143.334 1.00 84.27  ? 162 ASN H ND2 1 
ATOM   1256 N N   . SER A 1 168 ? -48.669 67.512 -141.916 1.00 83.48  ? 163 SER H N   1 
ATOM   1257 C CA  . SER A 1 168 ? -49.731 68.481 -142.156 1.00 79.18  ? 163 SER H CA  1 
ATOM   1258 C C   . SER A 1 168 ? -50.276 68.408 -143.572 1.00 77.74  ? 163 SER H C   1 
ATOM   1259 O O   . SER A 1 168 ? -50.561 69.428 -144.189 1.00 81.80  ? 163 SER H O   1 
ATOM   1260 C CB  . SER A 1 168 ? -49.225 69.883 -141.840 1.00 77.12  ? 163 SER H CB  1 
ATOM   1261 O OG  . SER A 1 168 ? -48.516 69.872 -140.612 1.00 79.86  ? 163 SER H OG  1 
ATOM   1262 N N   . GLY A 1 169 ? -50.416 67.195 -144.087 1.00 71.14  ? 164 GLY H N   1 
ATOM   1263 C CA  . GLY A 1 169 ? -50.942 67.013 -145.423 1.00 68.32  ? 164 GLY H CA  1 
ATOM   1264 C C   . GLY A 1 169 ? -49.885 66.888 -146.500 1.00 73.38  ? 164 GLY H C   1 
ATOM   1265 O O   . GLY A 1 169 ? -50.159 66.342 -147.563 1.00 80.95  ? 164 GLY H O   1 
ATOM   1266 N N   . ALA A 1 170 ? -48.677 67.378 -146.243 1.00 71.63  ? 165 ALA H N   1 
ATOM   1267 C CA  . ALA A 1 170 ? -47.636 67.374 -147.278 1.00 71.10  ? 165 ALA H CA  1 
ATOM   1268 C C   . ALA A 1 170 ? -47.315 65.968 -147.783 1.00 77.66  ? 165 ALA H C   1 
ATOM   1269 O O   . ALA A 1 170 ? -47.197 65.738 -148.989 1.00 81.05  ? 165 ALA H O   1 
ATOM   1270 C CB  . ALA A 1 170 ? -46.373 68.058 -146.776 1.00 63.48  ? 165 ALA H CB  1 
ATOM   1271 N N   . LEU A 1 171 ? -47.177 65.033 -146.849 1.00 79.58  ? 166 LEU H N   1 
ATOM   1272 C CA  . LEU A 1 171 ? -46.795 63.666 -147.171 1.00 74.69  ? 166 LEU H CA  1 
ATOM   1273 C C   . LEU A 1 171 ? -48.018 62.775 -147.313 1.00 76.16  ? 166 LEU H C   1 
ATOM   1274 O O   . LEU A 1 171 ? -48.768 62.580 -146.351 1.00 81.93  ? 166 LEU H O   1 
ATOM   1275 C CB  . LEU A 1 171 ? -45.890 63.124 -146.073 1.00 71.74  ? 166 LEU H CB  1 
ATOM   1276 C CG  . LEU A 1 171 ? -45.499 61.658 -146.162 1.00 67.90  ? 166 LEU H CG  1 
ATOM   1277 C CD1 . LEU A 1 171 ? -44.707 61.396 -147.435 1.00 59.12  ? 166 LEU H CD1 1 
ATOM   1278 C CD2 . LEU A 1 171 ? -44.695 61.298 -144.930 1.00 71.78  ? 166 LEU H CD2 1 
ATOM   1279 N N   . THR A 1 172 ? -48.214 62.229 -148.509 1.00 76.21  ? 167 THR H N   1 
ATOM   1280 C CA  . THR A 1 172 ? -49.388 61.403 -148.786 1.00 76.68  ? 167 THR H CA  1 
ATOM   1281 C C   . THR A 1 172 ? -49.036 60.111 -149.507 1.00 75.72  ? 167 THR H C   1 
ATOM   1282 O O   . THR A 1 172 ? -49.770 59.129 -149.420 1.00 74.45  ? 167 THR H O   1 
ATOM   1283 C CB  . THR A 1 172 ? -50.404 62.137 -149.668 1.00 75.99  ? 167 THR H CB  1 
ATOM   1284 O OG1 . THR A 1 172 ? -49.796 62.441 -150.932 1.00 79.95  ? 167 THR H OG1 1 
ATOM   1285 C CG2 . THR A 1 172 ? -50.877 63.416 -148.998 1.00 71.28  ? 167 THR H CG2 1 
ATOM   1286 N N   . SER A 1 173 ? -47.933 60.123 -150.242 1.00 73.96  ? 168 SER H N   1 
ATOM   1287 C CA  . SER A 1 173 ? -47.537 58.949 -151.004 1.00 76.98  ? 168 SER H CA  1 
ATOM   1288 C C   . SER A 1 173 ? -46.908 57.918 -150.089 1.00 71.86  ? 168 SER H C   1 
ATOM   1289 O O   . SER A 1 173 ? -46.074 58.248 -149.246 1.00 69.97  ? 168 SER H O   1 
ATOM   1290 C CB  . SER A 1 173 ? -46.561 59.324 -152.122 1.00 85.71  ? 168 SER H CB  1 
ATOM   1291 O OG  . SER A 1 173 ? -47.206 60.122 -153.097 1.00 91.51  ? 168 SER H OG  1 
ATOM   1292 N N   . GLY A 1 174 ? -47.309 56.666 -150.260 1.00 68.77  ? 169 GLY H N   1 
ATOM   1293 C CA  . GLY A 1 174 ? -46.776 55.586 -149.449 1.00 67.59  ? 169 GLY H CA  1 
ATOM   1294 C C   . GLY A 1 174 ? -47.542 55.409 -148.156 1.00 65.80  ? 169 GLY H C   1 
ATOM   1295 O O   . GLY A 1 174 ? -47.324 54.435 -147.427 1.00 68.96  ? 169 GLY H O   1 
ATOM   1296 N N   . VAL A 1 175 ? -48.443 56.350 -147.884 1.00 59.24  ? 171 VAL H N   1 
ATOM   1297 C CA  . VAL A 1 175 ? -49.240 56.343 -146.665 1.00 58.29  ? 171 VAL H CA  1 
ATOM   1298 C C   . VAL A 1 175 ? -50.295 55.251 -146.683 1.00 64.05  ? 171 VAL H C   1 
ATOM   1299 O O   . VAL A 1 175 ? -51.087 55.152 -147.628 1.00 68.97  ? 171 VAL H O   1 
ATOM   1300 C CB  . VAL A 1 175 ? -49.954 57.684 -146.450 1.00 55.66  ? 171 VAL H CB  1 
ATOM   1301 C CG1 . VAL A 1 175 ? -50.715 57.664 -145.129 1.00 57.78  ? 171 VAL H CG1 1 
ATOM   1302 C CG2 . VAL A 1 175 ? -48.961 58.818 -146.460 1.00 55.99  ? 171 VAL H CG2 1 
ATOM   1303 N N   . HIS A 1 176 ? -50.296 54.428 -145.638 1.00 60.96  ? 172 HIS H N   1 
ATOM   1304 C CA  . HIS A 1 176 ? -51.361 53.457 -145.413 1.00 58.02  ? 172 HIS H CA  1 
ATOM   1305 C C   . HIS A 1 176 ? -51.925 53.671 -144.030 1.00 58.45  ? 172 HIS H C   1 
ATOM   1306 O O   . HIS A 1 176 ? -51.262 53.378 -143.030 1.00 66.27  ? 172 HIS H O   1 
ATOM   1307 C CB  . HIS A 1 176 ? -50.841 52.029 -145.511 1.00 58.67  ? 172 HIS H CB  1 
ATOM   1308 C CG  . HIS A 1 176 ? -50.594 51.569 -146.907 1.00 61.75  ? 172 HIS H CG  1 
ATOM   1309 N ND1 . HIS A 1 176 ? -51.466 51.848 -147.942 1.00 65.82  ? 172 HIS H ND1 1 
ATOM   1310 C CD2 . HIS A 1 176 ? -49.598 50.833 -147.443 1.00 65.47  ? 172 HIS H CD2 1 
ATOM   1311 C CE1 . HIS A 1 176 ? -50.998 51.315 -149.056 1.00 72.02  ? 172 HIS H CE1 1 
ATOM   1312 N NE2 . HIS A 1 176 ? -49.867 50.688 -148.782 1.00 67.46  ? 172 HIS H NE2 1 
ATOM   1313 N N   . THR A 1 177 ? -53.137 54.203 -143.960 1.00 54.13  ? 173 THR H N   1 
ATOM   1314 C CA  . THR A 1 177 ? -53.800 54.367 -142.674 1.00 53.84  ? 173 THR H CA  1 
ATOM   1315 C C   . THR A 1 177 ? -54.825 53.256 -142.513 1.00 56.56  ? 173 THR H C   1 
ATOM   1316 O O   . THR A 1 177 ? -55.731 53.132 -143.320 1.00 61.72  ? 173 THR H O   1 
ATOM   1317 C CB  . THR A 1 177 ? -54.471 55.735 -142.556 1.00 51.96  ? 173 THR H CB  1 
ATOM   1318 O OG1 . THR A 1 177 ? -53.463 56.759 -142.528 1.00 55.57  ? 173 THR H OG1 1 
ATOM   1319 C CG2 . THR A 1 177 ? -55.293 55.811 -141.281 1.00 46.30  ? 173 THR H CG2 1 
ATOM   1320 N N   . PHE A 1 178 ? -54.675 52.429 -141.487 1.00 53.14  ? 174 PHE H N   1 
ATOM   1321 C CA  . PHE A 1 178 ? -55.520 51.249 -141.384 1.00 52.96  ? 174 PHE H CA  1 
ATOM   1322 C C   . PHE A 1 178 ? -56.868 51.529 -140.735 1.00 53.30  ? 174 PHE H C   1 
ATOM   1323 O O   . PHE A 1 178 ? -57.018 52.486 -139.993 1.00 58.34  ? 174 PHE H O   1 
ATOM   1324 C CB  . PHE A 1 178 ? -54.786 50.132 -140.656 1.00 53.40  ? 174 PHE H CB  1 
ATOM   1325 C CG  . PHE A 1 178 ? -53.561 49.675 -141.368 1.00 47.99  ? 174 PHE H CG  1 
ATOM   1326 C CD1 . PHE A 1 178 ? -53.582 48.531 -142.140 1.00 47.39  ? 174 PHE H CD1 1 
ATOM   1327 C CD2 . PHE A 1 178 ? -52.391 50.410 -141.294 1.00 44.61  ? 174 PHE H CD2 1 
ATOM   1328 C CE1 . PHE A 1 178 ? -52.448 48.120 -142.811 1.00 50.51  ? 174 PHE H CE1 1 
ATOM   1329 C CE2 . PHE A 1 178 ? -51.256 50.010 -141.970 1.00 45.41  ? 174 PHE H CE2 1 
ATOM   1330 C CZ  . PHE A 1 178 ? -51.281 48.868 -142.727 1.00 48.77  ? 174 PHE H CZ  1 
ATOM   1331 N N   . PRO A 1 179 ? -57.864 50.705 -141.056 1.00 49.17  ? 175 PRO H N   1 
ATOM   1332 C CA  . PRO A 1 179 ? -59.188 50.779 -140.448 1.00 47.85  ? 175 PRO H CA  1 
ATOM   1333 C C   . PRO A 1 179 ? -59.066 50.482 -138.978 1.00 51.40  ? 175 PRO H C   1 
ATOM   1334 O O   . PRO A 1 179 ? -58.333 49.566 -138.630 1.00 56.02  ? 175 PRO H O   1 
ATOM   1335 C CB  . PRO A 1 179 ? -59.945 49.623 -141.126 1.00 40.61  ? 175 PRO H CB  1 
ATOM   1336 C CG  . PRO A 1 179 ? -59.259 49.420 -142.396 1.00 42.99  ? 175 PRO H CG  1 
ATOM   1337 C CD  . PRO A 1 179 ? -57.811 49.699 -142.125 1.00 48.65  ? 175 PRO H CD  1 
ATOM   1338 N N   . ALA A 1 180 ? -59.776 51.217 -138.130 1.00 48.84  ? 176 ALA H N   1 
ATOM   1339 C CA  . ALA A 1 180 ? -59.714 50.952 -136.703 1.00 41.39  ? 176 ALA H CA  1 
ATOM   1340 C C   . ALA A 1 180 ? -60.130 49.516 -136.453 1.00 41.13  ? 176 ALA H C   1 
ATOM   1341 O O   . ALA A 1 180 ? -60.986 48.993 -137.147 1.00 42.61  ? 176 ALA H O   1 
ATOM   1342 C CB  . ALA A 1 180 ? -60.624 51.896 -135.951 1.00 43.32  ? 176 ALA H CB  1 
ATOM   1343 N N   . VAL A 1 181 ? -59.502 48.879 -135.478 1.00 44.85  ? 177 VAL H N   1 
ATOM   1344 C CA  . VAL A 1 181 ? -59.986 47.610 -134.962 1.00 49.82  ? 177 VAL H CA  1 
ATOM   1345 C C   . VAL A 1 181 ? -60.446 47.797 -133.528 1.00 49.94  ? 177 VAL H C   1 
ATOM   1346 O O   . VAL A 1 181 ? -59.907 48.588 -132.774 1.00 52.76  ? 177 VAL H O   1 
ATOM   1347 C CB  . VAL A 1 181 ? -58.918 46.494 -134.985 1.00 54.84  ? 177 VAL H CB  1 
ATOM   1348 C CG1 . VAL A 1 181 ? -58.693 46.020 -136.382 1.00 55.85  ? 177 VAL H CG1 1 
ATOM   1349 C CG2 . VAL A 1 181 ? -57.604 46.980 -134.349 1.00 56.72  ? 177 VAL H CG2 1 
ATOM   1350 N N   . LEU A 1 182 ? -61.457 47.042 -133.160 1.00 50.71  ? 178 LEU H N   1 
ATOM   1351 C CA  . LEU A 1 182 ? -61.998 47.096 -131.836 1.00 46.91  ? 178 LEU H CA  1 
ATOM   1352 C C   . LEU A 1 182 ? -61.186 46.154 -130.960 1.00 54.05  ? 178 LEU H C   1 
ATOM   1353 O O   . LEU A 1 182 ? -60.955 45.002 -131.313 1.00 58.09  ? 178 LEU H O   1 
ATOM   1354 C CB  . LEU A 1 182 ? -63.444 46.644 -131.919 1.00 43.84  ? 178 LEU H CB  1 
ATOM   1355 C CG  . LEU A 1 182 ? -64.398 47.007 -130.807 1.00 47.11  ? 178 LEU H CG  1 
ATOM   1356 C CD1 . LEU A 1 182 ? -64.361 48.499 -130.514 1.00 47.95  ? 178 LEU H CD1 1 
ATOM   1357 C CD2 . LEU A 1 182 ? -65.757 46.556 -131.277 1.00 43.01  ? 178 LEU H CD2 1 
ATOM   1358 N N   . GLN A 1 183 ? -60.737 46.649 -129.818 1.00 54.48  ? 179 GLN H N   1 
ATOM   1359 C CA  . GLN A 1 183 ? -59.976 45.830 -128.893 1.00 50.66  ? 179 GLN H CA  1 
ATOM   1360 C C   . GLN A 1 183 ? -60.907 45.115 -127.912 1.00 53.72  ? 179 GLN H C   1 
ATOM   1361 O O   . GLN A 1 183 ? -62.119 45.181 -128.053 1.00 54.36  ? 179 GLN H O   1 
ATOM   1362 C CB  . GLN A 1 183 ? -58.940 46.701 -128.192 1.00 49.98  ? 179 GLN H CB  1 
ATOM   1363 C CG  . GLN A 1 183 ? -57.798 47.094 -129.138 1.00 59.51  ? 179 GLN H CG  1 
ATOM   1364 C CD  . GLN A 1 183 ? -57.087 48.348 -128.704 1.00 69.23  ? 179 GLN H CD  1 
ATOM   1365 O OE1 . GLN A 1 183 ? -55.863 48.395 -128.664 1.00 73.66  ? 179 GLN H OE1 1 
ATOM   1366 N NE2 . GLN A 1 183 ? -57.854 49.375 -128.365 1.00 72.62  ? 179 GLN H NE2 1 
ATOM   1367 N N   . SER A 1 184 ? -60.356 44.419 -126.930 1.00 58.80  ? 180 SER H N   1 
ATOM   1368 C CA  . SER A 1 184 ? -61.203 43.693 -125.989 1.00 59.58  ? 180 SER H CA  1 
ATOM   1369 C C   . SER A 1 184 ? -61.812 44.639 -124.980 1.00 55.20  ? 180 SER H C   1 
ATOM   1370 O O   . SER A 1 184 ? -62.905 44.407 -124.463 1.00 58.05  ? 180 SER H O   1 
ATOM   1371 C CB  . SER A 1 184 ? -60.423 42.588 -125.284 1.00 62.62  ? 180 SER H CB  1 
ATOM   1372 O OG  . SER A 1 184 ? -60.684 41.347 -125.912 1.00 66.62  ? 180 SER H OG  1 
ATOM   1373 N N   . SER A 1 185 ? -61.087 45.713 -124.715 1.00 47.63  ? 182 SER H N   1 
ATOM   1374 C CA  . SER A 1 185 ? -61.540 46.752 -123.816 1.00 47.29  ? 182 SER H CA  1 
ATOM   1375 C C   . SER A 1 185 ? -62.779 47.466 -124.354 1.00 48.86  ? 182 SER H C   1 
ATOM   1376 O O   . SER A 1 185 ? -63.418 48.229 -123.630 1.00 46.74  ? 182 SER H O   1 
ATOM   1377 C CB  . SER A 1 185 ? -60.416 47.764 -123.612 1.00 50.72  ? 182 SER H CB  1 
ATOM   1378 O OG  . SER A 1 185 ? -59.955 48.259 -124.856 1.00 52.46  ? 182 SER H OG  1 
ATOM   1379 N N   . GLY A 1 186 ? -63.104 47.227 -125.625 1.00 42.49  ? 183 GLY H N   1 
ATOM   1380 C CA  . GLY A 1 186 ? -64.233 47.880 -126.261 1.00 38.69  ? 183 GLY H CA  1 
ATOM   1381 C C   . GLY A 1 186 ? -63.832 49.243 -126.797 1.00 46.18  ? 183 GLY H C   1 
ATOM   1382 O O   . GLY A 1 186 ? -64.676 50.017 -127.255 1.00 40.61  ? 183 GLY H O   1 
ATOM   1383 N N   . LEU A 1 187 ? -62.536 49.542 -126.716 1.00 45.49  ? 184 LEU H N   1 
ATOM   1384 C CA  . LEU A 1 187 ? -62.003 50.773 -127.279 1.00 45.80  ? 184 LEU H CA  1 
ATOM   1385 C C   . LEU A 1 187 ? -61.427 50.511 -128.671 1.00 46.50  ? 184 LEU H C   1 
ATOM   1386 O O   . LEU A 1 187 ? -61.090 49.381 -129.006 1.00 44.50  ? 184 LEU H O   1 
ATOM   1387 C CB  . LEU A 1 187 ? -60.927 51.354 -126.360 1.00 40.10  ? 184 LEU H CB  1 
ATOM   1388 C CG  . LEU A 1 187 ? -61.423 51.703 -124.962 1.00 44.80  ? 184 LEU H CG  1 
ATOM   1389 C CD1 . LEU A 1 187 ? -60.269 52.160 -124.109 1.00 41.92  ? 184 LEU H CD1 1 
ATOM   1390 C CD2 . LEU A 1 187 ? -62.514 52.771 -125.020 1.00 33.98  ? 184 LEU H CD2 1 
ATOM   1391 N N   . TYR A 1 188 ? -61.305 51.558 -129.475 1.00 47.16  ? 185 TYR H N   1 
ATOM   1392 C CA  . TYR A 1 188 ? -60.692 51.428 -130.793 1.00 47.90  ? 185 TYR H CA  1 
ATOM   1393 C C   . TYR A 1 188 ? -59.186 51.692 -130.807 1.00 53.41  ? 185 TYR H C   1 
ATOM   1394 O O   . TYR A 1 188 ? -58.650 52.471 -130.012 1.00 54.91  ? 185 TYR H O   1 
ATOM   1395 C CB  . TYR A 1 188 ? -61.338 52.381 -131.776 1.00 40.69  ? 185 TYR H CB  1 
ATOM   1396 C CG  . TYR A 1 188 ? -62.757 52.057 -132.139 1.00 42.28  ? 185 TYR H CG  1 
ATOM   1397 C CD1 . TYR A 1 188 ? -63.816 52.770 -131.583 1.00 42.50  ? 185 TYR H CD1 1 
ATOM   1398 C CD2 . TYR A 1 188 ? -63.042 51.061 -133.063 1.00 38.14  ? 185 TYR H CD2 1 
ATOM   1399 C CE1 . TYR A 1 188 ? -65.124 52.488 -131.924 1.00 48.54  ? 185 TYR H CE1 1 
ATOM   1400 C CE2 . TYR A 1 188 ? -64.341 50.772 -133.409 1.00 41.75  ? 185 TYR H CE2 1 
ATOM   1401 C CZ  . TYR A 1 188 ? -65.380 51.487 -132.838 1.00 47.82  ? 185 TYR H CZ  1 
ATOM   1402 O OH  . TYR A 1 188 ? -66.672 51.201 -133.190 1.00 41.10  ? 185 TYR H OH  1 
ATOM   1403 N N   . SER A 1 189 ? -58.518 51.043 -131.746 1.00 53.92  ? 186 SER H N   1 
ATOM   1404 C CA  . SER A 1 189 ? -57.108 51.263 -132.002 1.00 51.72  ? 186 SER H CA  1 
ATOM   1405 C C   . SER A 1 189 ? -56.904 51.268 -133.507 1.00 52.18  ? 186 SER H C   1 
ATOM   1406 O O   . SER A 1 189 ? -57.596 50.548 -134.240 1.00 48.05  ? 186 SER H O   1 
ATOM   1407 C CB  . SER A 1 189 ? -56.276 50.153 -131.384 1.00 54.47  ? 186 SER H CB  1 
ATOM   1408 O OG  . SER A 1 189 ? -55.040 50.677 -130.961 1.00 64.81  ? 186 SER H OG  1 
ATOM   1409 N N   . LEU A 1 190 ? -55.950 52.065 -133.965 1.00 49.18  ? 187 LEU H N   1 
ATOM   1410 C CA  . LEU A 1 190 ? -55.733 52.244 -135.391 1.00 53.35  ? 187 LEU H CA  1 
ATOM   1411 C C   . LEU A 1 190 ? -54.283 52.629 -135.594 1.00 57.58  ? 187 LEU H C   1 
ATOM   1412 O O   . LEU A 1 190 ? -53.693 53.293 -134.752 1.00 55.28  ? 187 LEU H O   1 
ATOM   1413 C CB  . LEU A 1 190 ? -56.676 53.336 -135.908 1.00 51.13  ? 187 LEU H CB  1 
ATOM   1414 C CG  . LEU A 1 190 ? -56.385 54.267 -137.085 1.00 51.21  ? 187 LEU H CG  1 
ATOM   1415 C CD1 . LEU A 1 190 ? -57.526 55.244 -137.196 1.00 54.08  ? 187 LEU H CD1 1 
ATOM   1416 C CD2 . LEU A 1 190 ? -55.105 55.036 -136.927 1.00 50.15  ? 187 LEU H CD2 1 
ATOM   1417 N N   . SER A 1 191 ? -53.693 52.214 -136.704 1.00 62.15  ? 188 SER H N   1 
ATOM   1418 C CA  . SER A 1 191 ? -52.322 52.616 -136.961 1.00 59.05  ? 188 SER H CA  1 
ATOM   1419 C C   . SER A 1 191 ? -52.149 53.127 -138.371 1.00 58.26  ? 188 SER H C   1 
ATOM   1420 O O   . SER A 1 191 ? -52.812 52.662 -139.302 1.00 61.89  ? 188 SER H O   1 
ATOM   1421 C CB  . SER A 1 191 ? -51.347 51.482 -136.667 1.00 56.66  ? 188 SER H CB  1 
ATOM   1422 O OG  . SER A 1 191 ? -51.647 50.379 -137.482 1.00 59.08  ? 188 SER H OG  1 
ATOM   1423 N N   . SER A 1 192 ? -51.262 54.107 -138.510 1.00 53.67  ? 189 SER H N   1 
ATOM   1424 C CA  . SER A 1 192 ? -50.967 54.699 -139.802 1.00 53.66  ? 189 SER H CA  1 
ATOM   1425 C C   . SER A 1 192 ? -49.494 54.560 -140.125 1.00 55.94  ? 189 SER H C   1 
ATOM   1426 O O   . SER A 1 192 ? -48.638 54.937 -139.330 1.00 54.09  ? 189 SER H O   1 
ATOM   1427 C CB  . SER A 1 192 ? -51.330 56.172 -139.799 1.00 49.01  ? 189 SER H CB  1 
ATOM   1428 O OG  . SER A 1 192 ? -50.976 56.745 -141.040 1.00 52.46  ? 189 SER H OG  1 
ATOM   1429 N N   . VAL A 1 193 ? -49.192 54.021 -141.298 1.00 55.30  ? 190 VAL H N   1 
ATOM   1430 C CA  . VAL A 1 193 ? -47.800 53.893 -141.702 1.00 53.57  ? 190 VAL H CA  1 
ATOM   1431 C C   . VAL A 1 193 ? -47.500 54.587 -143.024 1.00 58.67  ? 190 VAL H C   1 
ATOM   1432 O O   . VAL A 1 193 ? -48.374 54.746 -143.889 1.00 61.42  ? 190 VAL H O   1 
ATOM   1433 C CB  . VAL A 1 193 ? -47.394 52.437 -141.854 1.00 51.18  ? 190 VAL H CB  1 
ATOM   1434 C CG1 . VAL A 1 193 ? -47.491 51.737 -140.526 1.00 52.48  ? 190 VAL H CG1 1 
ATOM   1435 C CG2 . VAL A 1 193 ? -48.275 51.771 -142.911 1.00 50.60  ? 190 VAL H CG2 1 
ATOM   1436 N N   . VAL A 1 194 ? -46.246 54.991 -143.174 1.00 47.98  ? 191 VAL H N   1 
ATOM   1437 C CA  . VAL A 1 194 ? -45.790 55.519 -144.433 1.00 55.46  ? 191 VAL H CA  1 
ATOM   1438 C C   . VAL A 1 194 ? -44.487 54.808 -144.806 1.00 57.85  ? 191 VAL H C   1 
ATOM   1439 O O   . VAL A 1 194 ? -43.763 54.326 -143.944 1.00 54.20  ? 191 VAL H O   1 
ATOM   1440 C CB  . VAL A 1 194 ? -45.672 57.070 -144.381 1.00 70.11  ? 191 VAL H CB  1 
ATOM   1441 C CG1 . VAL A 1 194 ? -44.803 57.510 -143.226 1.00 69.19  ? 191 VAL H CG1 1 
ATOM   1442 C CG2 . VAL A 1 194 ? -45.169 57.628 -145.697 1.00 69.16  ? 191 VAL H CG2 1 
ATOM   1443 N N   . THR A 1 195 ? -44.228 54.676 -146.096 1.00 58.30  ? 192 THR H N   1 
ATOM   1444 C CA  . THR A 1 195 ? -42.949 54.154 -146.531 1.00 62.56  ? 192 THR H CA  1 
ATOM   1445 C C   . THR A 1 195 ? -42.216 55.268 -147.254 1.00 66.32  ? 192 THR H C   1 
ATOM   1446 O O   . THR A 1 195 ? -42.794 55.984 -148.072 1.00 67.47  ? 192 THR H O   1 
ATOM   1447 C CB  . THR A 1 195 ? -43.087 52.904 -147.421 1.00 63.43  ? 192 THR H CB  1 
ATOM   1448 O OG1 . THR A 1 195 ? -44.088 53.128 -148.420 1.00 71.59  ? 192 THR H OG1 1 
ATOM   1449 C CG2 . THR A 1 195 ? -43.469 51.682 -146.580 1.00 51.68  ? 192 THR H CG2 1 
ATOM   1450 N N   . VAL A 1 196 ? -40.947 55.430 -146.912 1.00 69.13  ? 193 VAL H N   1 
ATOM   1451 C CA  . VAL A 1 196 ? -40.154 56.541 -147.396 1.00 69.45  ? 193 VAL H CA  1 
ATOM   1452 C C   . VAL A 1 196 ? -38.758 56.037 -147.724 1.00 73.44  ? 193 VAL H C   1 
ATOM   1453 O O   . VAL A 1 196 ? -38.359 54.963 -147.266 1.00 73.59  ? 193 VAL H O   1 
ATOM   1454 C CB  . VAL A 1 196 ? -40.050 57.620 -146.317 1.00 70.12  ? 193 VAL H CB  1 
ATOM   1455 C CG1 . VAL A 1 196 ? -41.431 58.080 -145.905 1.00 69.86  ? 193 VAL H CG1 1 
ATOM   1456 C CG2 . VAL A 1 196 ? -39.319 57.074 -145.118 1.00 71.33  ? 193 VAL H CG2 1 
ATOM   1457 N N   . PRO A 1 197 ? -38.011 56.804 -148.530 1.00 71.93  ? 194 PRO H N   1 
ATOM   1458 C CA  . PRO A 1 197 ? -36.620 56.458 -148.842 1.00 77.01  ? 194 PRO H CA  1 
ATOM   1459 C C   . PRO A 1 197 ? -35.754 56.430 -147.577 1.00 85.12  ? 194 PRO H C   1 
ATOM   1460 O O   . PRO A 1 197 ? -35.744 57.401 -146.815 1.00 86.76  ? 194 PRO H O   1 
ATOM   1461 C CB  . PRO A 1 197 ? -36.169 57.609 -149.748 1.00 77.03  ? 194 PRO H CB  1 
ATOM   1462 C CG  . PRO A 1 197 ? -37.432 58.223 -150.268 1.00 71.95  ? 194 PRO H CG  1 
ATOM   1463 C CD  . PRO A 1 197 ? -38.439 58.051 -149.184 1.00 69.26  ? 194 PRO H CD  1 
ATOM   1464 N N   . SER A 1 198 ? -35.050 55.324 -147.354 1.00 85.70  ? 195 SER H N   1 
ATOM   1465 C CA  . SER A 1 198 ? -34.103 55.221 -146.255 1.00 83.90  ? 195 SER H CA  1 
ATOM   1466 C C   . SER A 1 198 ? -33.203 56.440 -146.238 1.00 87.09  ? 195 SER H C   1 
ATOM   1467 O O   . SER A 1 198 ? -32.921 57.005 -145.184 1.00 91.74  ? 195 SER H O   1 
ATOM   1468 C CB  . SER A 1 198 ? -33.240 53.972 -146.416 1.00 86.51  ? 195 SER H CB  1 
ATOM   1469 O OG  . SER A 1 198 ? -33.962 52.805 -146.072 1.00 88.51  ? 195 SER H OG  1 
ATOM   1470 N N   . SER A 1 199 ? -32.754 56.842 -147.421 1.00 86.21  ? 196 SER H N   1 
ATOM   1471 C CA  . SER A 1 199 ? -31.823 57.956 -147.559 1.00 85.17  ? 196 SER H CA  1 
ATOM   1472 C C   . SER A 1 199 ? -32.270 59.193 -146.787 1.00 85.42  ? 196 SER H C   1 
ATOM   1473 O O   . SER A 1 199 ? -31.442 59.924 -146.233 1.00 90.89  ? 196 SER H O   1 
ATOM   1474 C CB  . SER A 1 199 ? -31.684 58.328 -149.026 1.00 80.34  ? 196 SER H CB  1 
ATOM   1475 O OG  . SER A 1 199 ? -32.834 59.030 -149.458 1.00 79.11  ? 196 SER H OG  1 
ATOM   1476 N N   . SER A 1 200 ? -33.582 59.415 -146.758 1.00 73.46  ? 197 SER H N   1 
ATOM   1477 C CA  . SER A 1 200 ? -34.165 60.632 -146.205 1.00 76.15  ? 197 SER H CA  1 
ATOM   1478 C C   . SER A 1 200 ? -34.356 60.596 -144.690 1.00 79.46  ? 197 SER H C   1 
ATOM   1479 O O   . SER A 1 200 ? -34.701 61.609 -144.082 1.00 81.47  ? 197 SER H O   1 
ATOM   1480 C CB  . SER A 1 200 ? -35.533 60.853 -146.833 1.00 81.76  ? 197 SER H CB  1 
ATOM   1481 O OG  . SER A 1 200 ? -36.486 59.963 -146.261 1.00 79.97  ? 197 SER H OG  1 
ATOM   1482 N N   . LEU A 1 201 ? -34.154 59.434 -144.079 1.00 79.54  ? 198 LEU H N   1 
ATOM   1483 C CA  . LEU A 1 201 ? -34.485 59.265 -142.666 1.00 79.33  ? 198 LEU H CA  1 
ATOM   1484 C C   . LEU A 1 201 ? -33.811 60.272 -141.747 1.00 86.92  ? 198 LEU H C   1 
ATOM   1485 O O   . LEU A 1 201 ? -34.429 60.759 -140.807 1.00 92.81  ? 198 LEU H O   1 
ATOM   1486 C CB  . LEU A 1 201 ? -34.214 57.833 -142.188 1.00 74.20  ? 198 LEU H CB  1 
ATOM   1487 C CG  . LEU A 1 201 ? -35.364 56.861 -142.446 1.00 72.49  ? 198 LEU H CG  1 
ATOM   1488 C CD1 . LEU A 1 201 ? -35.126 55.543 -141.729 1.00 73.63  ? 198 LEU H CD1 1 
ATOM   1489 C CD2 . LEU A 1 201 ? -36.686 57.484 -142.012 1.00 65.10  ? 198 LEU H CD2 1 
ATOM   1490 N N   . GLY A 1 202 ? -32.550 60.585 -142.012 1.00 92.33  ? 199 GLY H N   1 
ATOM   1491 C CA  . GLY A 1 202 ? -31.812 61.484 -141.146 1.00 98.17  ? 199 GLY H CA  1 
ATOM   1492 C C   . GLY A 1 202 ? -32.145 62.945 -141.367 1.00 101.87 ? 199 GLY H C   1 
ATOM   1493 O O   . GLY A 1 202 ? -32.038 63.765 -140.457 1.00 105.50 ? 199 GLY H O   1 
ATOM   1494 N N   . THR A 1 203 ? -32.558 63.271 -142.584 1.00 99.23  ? 200 THR H N   1 
ATOM   1495 C CA  . THR A 1 203 ? -32.722 64.662 -142.973 1.00 98.21  ? 200 THR H CA  1 
ATOM   1496 C C   . THR A 1 203 ? -34.174 65.125 -142.983 1.00 94.48  ? 200 THR H C   1 
ATOM   1497 O O   . THR A 1 203 ? -34.465 66.263 -142.633 1.00 92.90  ? 200 THR H O   1 
ATOM   1498 C CB  . THR A 1 203 ? -32.070 64.936 -144.341 1.00 101.93 ? 200 THR H CB  1 
ATOM   1499 O OG1 . THR A 1 203 ? -33.020 65.579 -145.198 1.00 105.24 ? 200 THR H OG1 1 
ATOM   1500 C CG2 . THR A 1 203 ? -31.636 63.635 -144.984 1.00 101.50 ? 200 THR H CG2 1 
ATOM   1501 N N   . GLN A 1 204 ? -35.083 64.246 -143.386 1.00 94.94  ? 203 GLN H N   1 
ATOM   1502 C CA  . GLN A 1 204 ? -36.499 64.594 -143.437 1.00 93.20  ? 203 GLN H CA  1 
ATOM   1503 C C   . GLN A 1 204 ? -37.218 64.353 -142.117 1.00 91.19  ? 203 GLN H C   1 
ATOM   1504 O O   . GLN A 1 204 ? -37.151 63.260 -141.552 1.00 89.38  ? 203 GLN H O   1 
ATOM   1505 C CB  . GLN A 1 204 ? -37.194 63.819 -144.549 1.00 98.53  ? 203 GLN H CB  1 
ATOM   1506 C CG  . GLN A 1 204 ? -37.748 64.693 -145.651 1.00 105.08 ? 203 GLN H CG  1 
ATOM   1507 C CD  . GLN A 1 204 ? -39.061 65.317 -145.254 1.00 105.82 ? 203 GLN H CD  1 
ATOM   1508 O OE1 . GLN A 1 204 ? -39.250 65.691 -144.099 1.00 104.34 ? 203 GLN H OE1 1 
ATOM   1509 N NE2 . GLN A 1 204 ? -39.986 65.419 -146.204 1.00 108.25 ? 203 GLN H NE2 1 
ATOM   1510 N N   . THR A 1 205 ? -37.914 65.379 -141.637 1.00 90.56  ? 205 THR H N   1 
ATOM   1511 C CA  . THR A 1 205 ? -38.700 65.279 -140.409 1.00 91.05  ? 205 THR H CA  1 
ATOM   1512 C C   . THR A 1 205 ? -40.056 64.603 -140.686 1.00 82.76  ? 205 THR H C   1 
ATOM   1513 O O   . THR A 1 205 ? -40.747 64.955 -141.646 1.00 81.96  ? 205 THR H O   1 
ATOM   1514 C CB  . THR A 1 205 ? -38.928 66.678 -139.789 1.00 94.98  ? 205 THR H CB  1 
ATOM   1515 O OG1 . THR A 1 205 ? -38.338 66.733 -138.486 1.00 97.26  ? 205 THR H OG1 1 
ATOM   1516 C CG2 . THR A 1 205 ? -40.422 67.010 -139.704 1.00 94.61  ? 205 THR H CG2 1 
ATOM   1517 N N   . TYR A 1 206 ? -40.431 63.624 -139.866 1.00 75.28  ? 206 TYR H N   1 
ATOM   1518 C CA  . TYR A 1 206 ? -41.719 62.942 -140.061 1.00 71.60  ? 206 TYR H CA  1 
ATOM   1519 C C   . TYR A 1 206 ? -42.678 63.054 -138.872 1.00 69.26  ? 206 TYR H C   1 
ATOM   1520 O O   . TYR A 1 206 ? -42.416 62.548 -137.778 1.00 64.44  ? 206 TYR H O   1 
ATOM   1521 C CB  . TYR A 1 206 ? -41.530 61.478 -140.475 1.00 65.12  ? 206 TYR H CB  1 
ATOM   1522 C CG  . TYR A 1 206 ? -40.924 61.332 -141.841 1.00 65.88  ? 206 TYR H CG  1 
ATOM   1523 C CD1 . TYR A 1 206 ? -41.623 61.715 -142.977 1.00 70.16  ? 206 TYR H CD1 1 
ATOM   1524 C CD2 . TYR A 1 206 ? -39.643 60.823 -142.000 1.00 71.29  ? 206 TYR H CD2 1 
ATOM   1525 C CE1 . TYR A 1 206 ? -41.056 61.591 -144.242 1.00 77.94  ? 206 TYR H CE1 1 
ATOM   1526 C CE2 . TYR A 1 206 ? -39.064 60.695 -143.257 1.00 75.40  ? 206 TYR H CE2 1 
ATOM   1527 C CZ  . TYR A 1 206 ? -39.771 61.080 -144.373 1.00 77.70  ? 206 TYR H CZ  1 
ATOM   1528 O OH  . TYR A 1 206 ? -39.197 60.949 -145.616 1.00 76.45  ? 206 TYR H OH  1 
ATOM   1529 N N   . ILE A 1 207 ? -43.800 63.722 -139.105 1.00 71.38  ? 207 ILE H N   1 
ATOM   1530 C CA  . ILE A 1 207 ? -44.791 63.917 -138.064 1.00 73.83  ? 207 ILE H CA  1 
ATOM   1531 C C   . ILE A 1 207 ? -46.160 63.404 -138.484 1.00 70.84  ? 207 ILE H C   1 
ATOM   1532 O O   . ILE A 1 207 ? -46.599 63.633 -139.611 1.00 69.63  ? 207 ILE H O   1 
ATOM   1533 C CB  . ILE A 1 207 ? -44.918 65.390 -137.718 1.00 75.30  ? 207 ILE H CB  1 
ATOM   1534 C CG1 . ILE A 1 207 ? -43.586 65.906 -137.198 1.00 81.65  ? 207 ILE H CG1 1 
ATOM   1535 C CG2 . ILE A 1 207 ? -45.985 65.590 -136.673 1.00 77.02  ? 207 ILE H CG2 1 
ATOM   1536 C CD1 . ILE A 1 207 ? -43.472 67.401 -137.254 1.00 88.91  ? 207 ILE H CD1 1 
ATOM   1537 N N   . CYS A 1 208 ? -46.833 62.701 -137.578 1.00 71.11  ? 208 CYS H N   1 
ATOM   1538 C CA  . CYS A 1 208 ? -48.235 62.374 -137.808 1.00 72.01  ? 208 CYS H CA  1 
ATOM   1539 C C   . CYS A 1 208 ? -49.139 63.292 -137.001 1.00 68.68  ? 208 CYS H C   1 
ATOM   1540 O O   . CYS A 1 208 ? -48.877 63.605 -135.833 1.00 70.37  ? 208 CYS H O   1 
ATOM   1541 C CB  . CYS A 1 208 ? -48.551 60.900 -137.534 1.00 69.96  ? 208 CYS H CB  1 
ATOM   1542 S SG  . CYS A 1 208 ? -48.559 60.460 -135.814 1.00 92.51  ? 208 CYS H SG  1 
ATOM   1543 N N   . ASN A 1 209 ? -50.198 63.732 -137.660 1.00 60.17  ? 209 ASN H N   1 
ATOM   1544 C CA  . ASN A 1 209 ? -51.160 64.629 -137.068 1.00 55.72  ? 209 ASN H CA  1 
ATOM   1545 C C   . ASN A 1 209 ? -52.428 63.863 -136.758 1.00 57.48  ? 209 ASN H C   1 
ATOM   1546 O O   . ASN A 1 209 ? -53.197 63.518 -137.657 1.00 64.10  ? 209 ASN H O   1 
ATOM   1547 C CB  . ASN A 1 209 ? -51.446 65.755 -138.051 1.00 60.27  ? 209 ASN H CB  1 
ATOM   1548 C CG  . ASN A 1 209 ? -50.166 66.338 -138.648 1.00 65.67  ? 209 ASN H CG  1 
ATOM   1549 O OD1 . ASN A 1 209 ? -49.814 66.052 -139.794 1.00 64.00  ? 209 ASN H OD1 1 
ATOM   1550 N ND2 . ASN A 1 209 ? -49.454 67.136 -137.858 1.00 61.06  ? 209 ASN H ND2 1 
ATOM   1551 N N   . VAL A 1 210 ? -52.635 63.564 -135.484 1.00 52.44  ? 210 VAL H N   1 
ATOM   1552 C CA  . VAL A 1 210 ? -53.837 62.860 -135.080 1.00 51.26  ? 210 VAL H CA  1 
ATOM   1553 C C   . VAL A 1 210 ? -54.916 63.795 -134.548 1.00 53.81  ? 210 VAL H C   1 
ATOM   1554 O O   . VAL A 1 210 ? -54.685 64.594 -133.643 1.00 46.29  ? 210 VAL H O   1 
ATOM   1555 C CB  . VAL A 1 210 ? -53.553 61.802 -134.029 1.00 48.48  ? 210 VAL H CB  1 
ATOM   1556 C CG1 . VAL A 1 210 ? -54.862 61.261 -133.498 1.00 41.33  ? 210 VAL H CG1 1 
ATOM   1557 C CG2 . VAL A 1 210 ? -52.689 60.691 -134.618 1.00 50.65  ? 210 VAL H CG2 1 
ATOM   1558 N N   . ASN A 1 211 ? -56.101 63.698 -135.129 1.00 59.34  ? 211 ASN H N   1 
ATOM   1559 C CA  . ASN A 1 211 ? -57.218 64.462 -134.626 1.00 61.45  ? 211 ASN H CA  1 
ATOM   1560 C C   . ASN A 1 211 ? -58.336 63.539 -134.190 1.00 54.65  ? 211 ASN H C   1 
ATOM   1561 O O   . ASN A 1 211 ? -58.752 62.663 -134.934 1.00 56.66  ? 211 ASN H O   1 
ATOM   1562 C CB  . ASN A 1 211 ? -57.717 65.450 -135.676 1.00 69.14  ? 211 ASN H CB  1 
ATOM   1563 C CG  . ASN A 1 211 ? -58.483 66.603 -135.062 1.00 72.40  ? 211 ASN H CG  1 
ATOM   1564 O OD1 . ASN A 1 211 ? -58.360 66.875 -133.869 1.00 68.35  ? 211 ASN H OD1 1 
ATOM   1565 N ND2 . ASN A 1 211 ? -59.283 67.288 -135.876 1.00 79.40  ? 211 ASN H ND2 1 
ATOM   1566 N N   . HIS A 1 212 ? -58.798 63.729 -132.965 1.00 52.98  ? 212 HIS H N   1 
ATOM   1567 C CA  . HIS A 1 212 ? -59.965 63.024 -132.459 1.00 49.17  ? 212 HIS H CA  1 
ATOM   1568 C C   . HIS A 1 212 ? -60.914 64.093 -131.951 1.00 46.94  ? 212 HIS H C   1 
ATOM   1569 O O   . HIS A 1 212 ? -60.814 64.529 -130.806 1.00 49.10  ? 212 HIS H O   1 
ATOM   1570 C CB  . HIS A 1 212 ? -59.569 62.063 -131.334 1.00 45.70  ? 212 HIS H CB  1 
ATOM   1571 C CG  . HIS A 1 212 ? -60.685 61.184 -130.859 1.00 48.54  ? 212 HIS H CG  1 
ATOM   1572 N ND1 . HIS A 1 212 ? -61.110 61.166 -129.543 1.00 54.46  ? 212 HIS H ND1 1 
ATOM   1573 C CD2 . HIS A 1 212 ? -61.447 60.276 -131.514 1.00 40.67  ? 212 HIS H CD2 1 
ATOM   1574 C CE1 . HIS A 1 212 ? -62.087 60.283 -129.415 1.00 52.44  ? 212 HIS H CE1 1 
ATOM   1575 N NE2 . HIS A 1 212 ? -62.311 59.731 -130.596 1.00 42.35  ? 212 HIS H NE2 1 
ATOM   1576 N N   . LYS A 1 213 ? -61.824 64.530 -132.817 1.00 61.15  ? 213 LYS H N   1 
ATOM   1577 C CA  . LYS A 1 213 ? -62.727 65.626 -132.478 1.00 61.58  ? 213 LYS H CA  1 
ATOM   1578 C C   . LYS A 1 213 ? -63.534 65.401 -131.194 1.00 62.21  ? 213 LYS H C   1 
ATOM   1579 O O   . LYS A 1 213 ? -63.574 66.285 -130.328 1.00 62.45  ? 213 LYS H O   1 
ATOM   1580 C CB  . LYS A 1 213 ? -63.634 65.978 -133.660 1.00 63.27  ? 213 LYS H CB  1 
ATOM   1581 C CG  . LYS A 1 213 ? -62.901 66.721 -134.769 1.00 72.15  ? 213 LYS H CG  1 
ATOM   1582 C CD  . LYS A 1 213 ? -63.798 67.066 -135.950 1.00 79.32  ? 213 LYS H CD  1 
ATOM   1583 C CE  . LYS A 1 213 ? -63.004 67.837 -136.998 1.00 90.16  ? 213 LYS H CE  1 
ATOM   1584 N NZ  . LYS A 1 213 ? -63.884 68.569 -137.958 1.00 99.20  ? 213 LYS H NZ  1 
ATOM   1585 N N   . PRO A 1 214 ? -64.154 64.212 -131.056 1.00 60.48  ? 214 PRO H N   1 
ATOM   1586 C CA  . PRO A 1 214 ? -65.034 63.901 -129.926 1.00 48.95  ? 214 PRO H CA  1 
ATOM   1587 C C   . PRO A 1 214 ? -64.417 64.159 -128.560 1.00 54.89  ? 214 PRO H C   1 
ATOM   1588 O O   . PRO A 1 214 ? -65.163 64.463 -127.631 1.00 58.36  ? 214 PRO H O   1 
ATOM   1589 C CB  . PRO A 1 214 ? -65.288 62.406 -130.091 1.00 50.59  ? 214 PRO H CB  1 
ATOM   1590 C CG  . PRO A 1 214 ? -65.136 62.171 -131.554 1.00 53.47  ? 214 PRO H CG  1 
ATOM   1591 C CD  . PRO A 1 214 ? -64.022 63.064 -131.971 1.00 57.39  ? 214 PRO H CD  1 
ATOM   1592 N N   . SER A 1 215 ? -63.100 64.024 -128.424 1.00 51.80  ? 215 SER H N   1 
ATOM   1593 C CA  . SER A 1 215 ? -62.464 64.225 -127.128 1.00 50.90  ? 215 SER H CA  1 
ATOM   1594 C C   . SER A 1 215 ? -61.579 65.451 -127.152 1.00 64.68  ? 215 SER H C   1 
ATOM   1595 O O   . SER A 1 215 ? -60.847 65.714 -126.198 1.00 54.30  ? 215 SER H O   1 
ATOM   1596 C CB  . SER A 1 215 ? -61.635 63.011 -126.723 1.00 51.70  ? 215 SER H CB  1 
ATOM   1597 O OG  . SER A 1 215 ? -60.465 62.903 -127.507 1.00 51.79  ? 215 SER H OG  1 
ATOM   1598 N N   . ASN A 1 216 ? -61.649 66.199 -128.248 1.00 63.72  ? 216 ASN H N   1 
ATOM   1599 C CA  . ASN A 1 216 ? -60.788 67.360 -128.426 1.00 70.62  ? 216 ASN H CA  1 
ATOM   1600 C C   . ASN A 1 216 ? -59.310 67.043 -128.282 1.00 67.77  ? 216 ASN H C   1 
ATOM   1601 O O   . ASN A 1 216 ? -58.572 67.734 -127.587 1.00 73.20  ? 216 ASN H O   1 
ATOM   1602 C CB  . ASN A 1 216 ? -61.187 68.483 -127.479 1.00 78.48  ? 216 ASN H CB  1 
ATOM   1603 C CG  . ASN A 1 216 ? -62.196 69.407 -128.096 1.00 87.75  ? 216 ASN H CG  1 
ATOM   1604 O OD1 . ASN A 1 216 ? -63.249 68.967 -128.575 1.00 88.07  ? 216 ASN H OD1 1 
ATOM   1605 N ND2 . ASN A 1 216 ? -61.876 70.699 -128.115 1.00 92.47  ? 216 ASN H ND2 1 
ATOM   1606 N N   . THR A 1 217 ? -58.888 65.987 -128.955 1.00 64.33  ? 217 THR H N   1 
ATOM   1607 C CA  . THR A 1 217 ? -57.501 65.589 -128.952 1.00 64.48  ? 217 THR H CA  1 
ATOM   1608 C C   . THR A 1 217 ? -56.893 65.889 -130.308 1.00 65.67  ? 217 THR H C   1 
ATOM   1609 O O   . THR A 1 217 ? -57.302 65.346 -131.333 1.00 65.69  ? 217 THR H O   1 
ATOM   1610 C CB  . THR A 1 217 ? -57.361 64.100 -128.644 1.00 67.17  ? 217 THR H CB  1 
ATOM   1611 O OG1 . THR A 1 217 ? -58.055 63.805 -127.426 1.00 65.56  ? 217 THR H OG1 1 
ATOM   1612 C CG2 . THR A 1 217 ? -55.897 63.728 -128.492 1.00 68.99  ? 217 THR H CG2 1 
ATOM   1613 N N   . LYS A 1 218 ? -55.923 66.784 -130.305 1.00 67.68  ? 218 LYS H N   1 
ATOM   1614 C CA  . LYS A 1 218 ? -55.167 67.101 -131.493 1.00 69.04  ? 218 LYS H CA  1 
ATOM   1615 C C   . LYS A 1 218 ? -53.734 66.826 -131.086 1.00 69.37  ? 218 LYS H C   1 
ATOM   1616 O O   . LYS A 1 218 ? -53.183 67.527 -130.242 1.00 70.29  ? 218 LYS H O   1 
ATOM   1617 C CB  . LYS A 1 218 ? -55.358 68.575 -131.836 1.00 77.21  ? 218 LYS H CB  1 
ATOM   1618 C CG  . LYS A 1 218 ? -55.645 68.865 -133.293 1.00 83.26  ? 218 LYS H CG  1 
ATOM   1619 C CD  . LYS A 1 218 ? -56.370 70.197 -133.427 1.00 94.06  ? 218 LYS H CD  1 
ATOM   1620 C CE  . LYS A 1 218 ? -56.895 70.419 -134.843 1.00 102.04 ? 218 LYS H CE  1 
ATOM   1621 N NZ  . LYS A 1 218 ? -57.694 71.677 -134.948 1.00 108.01 ? 218 LYS H NZ  1 
ATOM   1622 N N   . VAL A 1 219 ? -53.140 65.781 -131.644 1.00 67.34  ? 219 VAL H N   1 
ATOM   1623 C CA  . VAL A 1 219 ? -51.777 65.420 -131.285 1.00 64.39  ? 219 VAL H CA  1 
ATOM   1624 C C   . VAL A 1 219 ? -50.885 65.428 -132.502 1.00 67.20  ? 219 VAL H C   1 
ATOM   1625 O O   . VAL A 1 219 ? -51.283 64.992 -133.572 1.00 67.30  ? 219 VAL H O   1 
ATOM   1626 C CB  . VAL A 1 219 ? -51.716 64.039 -130.635 1.00 62.57  ? 219 VAL H CB  1 
ATOM   1627 C CG1 . VAL A 1 219 ? -50.328 63.444 -130.774 1.00 57.26  ? 219 VAL H CG1 1 
ATOM   1628 C CG2 . VAL A 1 219 ? -52.104 64.142 -129.187 1.00 64.78  ? 219 VAL H CG2 1 
ATOM   1629 N N   . ASP A 1 220 ? -49.671 65.931 -132.332 1.00 76.29  ? 220 ASP H N   1 
ATOM   1630 C CA  . ASP A 1 220 ? -48.705 65.964 -133.419 1.00 83.53  ? 220 ASP H CA  1 
ATOM   1631 C C   . ASP A 1 220 ? -47.426 65.258 -133.007 1.00 80.44  ? 220 ASP H C   1 
ATOM   1632 O O   . ASP A 1 220 ? -46.528 65.875 -132.453 1.00 78.69  ? 220 ASP H O   1 
ATOM   1633 C CB  . ASP A 1 220 ? -48.404 67.410 -133.820 1.00 88.12  ? 220 ASP H CB  1 
ATOM   1634 C CG  . ASP A 1 220 ? -49.498 68.017 -134.683 1.00 92.44  ? 220 ASP H CG  1 
ATOM   1635 O OD1 . ASP A 1 220 ? -49.440 69.232 -134.943 1.00 92.65  ? 220 ASP H OD1 1 
ATOM   1636 O OD2 . ASP A 1 220 ? -50.416 67.284 -135.108 1.00 96.72  ? 220 ASP H OD2 1 
ATOM   1637 N N   . LYS A 1 221 ? -47.344 63.960 -133.267 1.00 78.98  ? 221 LYS H N   1 
ATOM   1638 C CA  . LYS A 1 221 ? -46.173 63.202 -132.853 1.00 79.33  ? 221 LYS H CA  1 
ATOM   1639 C C   . LYS A 1 221 ? -45.107 63.182 -133.946 1.00 77.28  ? 221 LYS H C   1 
ATOM   1640 O O   . LYS A 1 221 ? -45.387 62.880 -135.111 1.00 70.61  ? 221 LYS H O   1 
ATOM   1641 C CB  . LYS A 1 221 ? -46.566 61.780 -132.441 1.00 81.40  ? 221 LYS H CB  1 
ATOM   1642 C CG  . LYS A 1 221 ? -45.400 60.892 -132.027 1.00 83.33  ? 221 LYS H CG  1 
ATOM   1643 C CD  . LYS A 1 221 ? -44.855 61.261 -130.658 1.00 82.96  ? 221 LYS H CD  1 
ATOM   1644 C CE  . LYS A 1 221 ? -45.816 60.876 -129.556 1.00 83.18  ? 221 LYS H CE  1 
ATOM   1645 N NZ  . LYS A 1 221 ? -45.246 61.156 -128.207 1.00 85.34  ? 221 LYS H NZ  1 
ATOM   1646 N N   . LYS A 1 222 ? -43.887 63.537 -133.552 1.00 82.30  ? 222 LYS H N   1 
ATOM   1647 C CA  . LYS A 1 222 ? -42.721 63.459 -134.422 1.00 82.20  ? 222 LYS H CA  1 
ATOM   1648 C C   . LYS A 1 222 ? -42.121 62.069 -134.273 1.00 75.84  ? 222 LYS H C   1 
ATOM   1649 O O   . LYS A 1 222 ? -41.938 61.577 -133.161 1.00 75.04  ? 222 LYS H O   1 
ATOM   1650 C CB  . LYS A 1 222 ? -41.693 64.523 -134.031 1.00 89.62  ? 222 LYS H CB  1 
ATOM   1651 C CG  . LYS A 1 222 ? -40.442 64.576 -134.921 1.00 96.97  ? 222 LYS H CG  1 
ATOM   1652 C CD  . LYS A 1 222 ? -39.534 65.775 -134.580 1.00 100.39 ? 222 LYS H CD  1 
ATOM   1653 C CE  . LYS A 1 222 ? -38.280 65.810 -135.461 1.00 102.29 ? 222 LYS H CE  1 
ATOM   1654 N NZ  . LYS A 1 222 ? -37.376 66.976 -135.185 1.00 105.63 ? 222 LYS H NZ  1 
ATOM   1655 N N   . VAL A 1 223 ? -41.830 61.429 -135.395 1.00 70.59  ? 225 VAL H N   1 
ATOM   1656 C CA  . VAL A 1 223 ? -41.307 60.077 -135.369 1.00 68.93  ? 225 VAL H CA  1 
ATOM   1657 C C   . VAL A 1 223 ? -39.805 60.046 -135.665 1.00 75.33  ? 225 VAL H C   1 
ATOM   1658 O O   . VAL A 1 223 ? -39.351 60.521 -136.708 1.00 74.55  ? 225 VAL H O   1 
ATOM   1659 C CB  . VAL A 1 223 ? -42.069 59.198 -136.352 1.00 69.82  ? 225 VAL H CB  1 
ATOM   1660 C CG1 . VAL A 1 223 ? -41.662 57.740 -136.195 1.00 69.68  ? 225 VAL H CG1 1 
ATOM   1661 C CG2 . VAL A 1 223 ? -43.562 59.365 -136.121 1.00 71.28  ? 225 VAL H CG2 1 
ATOM   1662 N N   . GLU A 1 224 ? -39.039 59.487 -134.733 1.00 80.41  ? 226 GLU H N   1 
ATOM   1663 C CA  . GLU A 1 224 ? -37.581 59.493 -134.836 1.00 83.85  ? 226 GLU H CA  1 
ATOM   1664 C C   . GLU A 1 224 ? -37.005 58.108 -135.096 1.00 80.42  ? 226 GLU H C   1 
ATOM   1665 O O   . GLU A 1 224 ? -37.433 57.125 -134.486 1.00 77.63  ? 226 GLU H O   1 
ATOM   1666 C CB  . GLU A 1 224 ? -36.950 60.088 -133.575 1.00 87.28  ? 226 GLU H CB  1 
ATOM   1667 C CG  . GLU A 1 224 ? -37.599 61.375 -133.114 1.00 93.80  ? 226 GLU H CG  1 
ATOM   1668 C CD  . GLU A 1 224 ? -36.588 62.413 -132.683 1.00 105.97 ? 226 GLU H CD  1 
ATOM   1669 O OE1 . GLU A 1 224 ? -35.610 62.054 -131.992 1.00 111.56 ? 226 GLU H OE1 1 
ATOM   1670 O OE2 . GLU A 1 224 ? -36.771 63.595 -133.043 1.00 111.19 ? 226 GLU H OE2 1 
ATOM   1671 N N   . PRO A 1 225 ? -36.017 58.043 -135.998 1.00 73.16  ? 227 PRO H N   1 
ATOM   1672 C CA  . PRO A 1 225 ? -35.310 56.868 -136.519 1.00 74.27  ? 227 PRO H CA  1 
ATOM   1673 C C   . PRO A 1 225 ? -34.518 56.059 -135.486 1.00 75.76  ? 227 PRO H C   1 
ATOM   1674 O O   . PRO A 1 225 ? -34.458 56.440 -134.323 1.00 68.35  ? 227 PRO H O   1 
ATOM   1675 C CB  . PRO A 1 225 ? -34.357 57.476 -137.553 1.00 78.67  ? 227 PRO H CB  1 
ATOM   1676 C CG  . PRO A 1 225 ? -35.009 58.750 -137.953 1.00 76.85  ? 227 PRO H CG  1 
ATOM   1677 C CD  . PRO A 1 225 ? -35.625 59.271 -136.705 1.00 69.99  ? 227 PRO H CD  1 
ATOM   1678 N N   . LYS A 1 226 ? -33.881 54.978 -135.952 1.00 89.54  ? 228 LYS H N   1 
ATOM   1679 C CA  . LYS A 1 226 ? -33.294 53.928 -135.107 1.00 92.91  ? 228 LYS H CA  1 
ATOM   1680 C C   . LYS A 1 226 ? -34.264 53.605 -133.978 1.00 95.69  ? 228 LYS H C   1 
ATOM   1681 O O   . LYS A 1 226 ? -33.925 53.003 -132.962 1.00 95.31  ? 228 LYS H O   1 
ATOM   1682 C CB  . LYS A 1 226 ? -31.886 54.278 -134.577 1.00 91.85  ? 228 LYS H CB  1 
ATOM   1683 C CG  . LYS A 1 226 ? -31.132 53.067 -133.979 1.00 90.44  ? 228 LYS H CG  1 
ATOM   1684 C CD  . LYS A 1 226 ? -29.663 53.351 -133.669 1.00 89.46  ? 228 LYS H CD  1 
ATOM   1685 C CE  . LYS A 1 226 ? -28.839 52.058 -133.669 1.00 85.03  ? 228 LYS H CE  1 
ATOM   1686 N NZ  . LYS A 1 226 ? -29.537 50.913 -133.000 1.00 80.49  ? 228 LYS H NZ  1 
ATOM   1687 O OXT . LYS A 1 226 ? -35.440 53.946 -134.082 1.00 96.65  ? 228 LYS H OXT 1 
ATOM   1688 N N   . GLU B 2 1   ? -92.802 49.393 -150.499 1.00 93.25  ? 1   GLU L N   1 
ATOM   1689 C CA  . GLU B 2 1   ? -91.429 49.875 -150.548 1.00 84.88  ? 1   GLU L CA  1 
ATOM   1690 C C   . GLU B 2 1   ? -90.645 49.081 -151.577 1.00 82.28  ? 1   GLU L C   1 
ATOM   1691 O O   . GLU B 2 1   ? -90.603 47.857 -151.519 1.00 88.53  ? 1   GLU L O   1 
ATOM   1692 C CB  . GLU B 2 1   ? -90.774 49.728 -149.181 1.00 83.58  ? 1   GLU L CB  1 
ATOM   1693 C CG  . GLU B 2 1   ? -89.465 50.481 -149.045 1.00 94.72  ? 1   GLU L CG  1 
ATOM   1694 C CD  . GLU B 2 1   ? -88.492 49.801 -148.082 1.00 106.74 ? 1   GLU L CD  1 
ATOM   1695 O OE1 . GLU B 2 1   ? -88.342 48.559 -148.167 1.00 110.32 ? 1   GLU L OE1 1 
ATOM   1696 O OE2 . GLU B 2 1   ? -87.869 50.504 -147.249 1.00 106.87 ? 1   GLU L OE2 1 
ATOM   1697 N N   . LEU B 2 2   ? -90.021 49.768 -152.523 1.00 75.86  ? 2   LEU L N   1 
ATOM   1698 C CA  . LEU B 2 2   ? -89.205 49.073 -153.514 1.00 69.66  ? 2   LEU L CA  1 
ATOM   1699 C C   . LEU B 2 2   ? -87.952 48.474 -152.910 1.00 71.71  ? 2   LEU L C   1 
ATOM   1700 O O   . LEU B 2 2   ? -87.194 49.137 -152.201 1.00 75.77  ? 2   LEU L O   1 
ATOM   1701 C CB  . LEU B 2 2   ? -88.819 49.989 -154.670 1.00 65.32  ? 2   LEU L CB  1 
ATOM   1702 C CG  . LEU B 2 2   ? -89.840 50.030 -155.800 1.00 65.97  ? 2   LEU L CG  1 
ATOM   1703 C CD1 . LEU B 2 2   ? -91.162 50.544 -155.280 1.00 64.19  ? 2   LEU L CD1 1 
ATOM   1704 C CD2 . LEU B 2 2   ? -89.330 50.893 -156.923 1.00 66.52  ? 2   LEU L CD2 1 
ATOM   1705 N N   . VAL B 2 3   ? -87.729 47.209 -153.212 1.00 68.40  ? 3   VAL L N   1 
ATOM   1706 C CA  . VAL B 2 3   ? -86.520 46.548 -152.768 1.00 63.58  ? 3   VAL L CA  1 
ATOM   1707 C C   . VAL B 2 3   ? -85.563 46.325 -153.933 1.00 63.53  ? 3   VAL L C   1 
ATOM   1708 O O   . VAL B 2 3   ? -85.929 45.752 -154.968 1.00 64.23  ? 3   VAL L O   1 
ATOM   1709 C CB  . VAL B 2 3   ? -86.846 45.224 -152.096 1.00 64.51  ? 3   VAL L CB  1 
ATOM   1710 C CG1 . VAL B 2 3   ? -85.580 44.615 -151.511 1.00 56.44  ? 3   VAL L CG1 1 
ATOM   1711 C CG2 . VAL B 2 3   ? -87.921 45.443 -151.022 1.00 61.65  ? 3   VAL L CG2 1 
ATOM   1712 N N   . MET B 2 4   ? -84.336 46.801 -153.752 1.00 58.72  ? 4   MET L N   1 
ATOM   1713 C CA  . MET B 2 4   ? -83.307 46.734 -154.774 1.00 55.01  ? 4   MET L CA  1 
ATOM   1714 C C   . MET B 2 4   ? -82.345 45.635 -154.393 1.00 59.94  ? 4   MET L C   1 
ATOM   1715 O O   . MET B 2 4   ? -81.871 45.588 -153.261 1.00 64.95  ? 4   MET L O   1 
ATOM   1716 C CB  . MET B 2 4   ? -82.559 48.061 -154.879 1.00 53.52  ? 4   MET L CB  1 
ATOM   1717 C CG  . MET B 2 4   ? -83.455 49.265 -155.081 1.00 62.69  ? 4   MET L CG  1 
ATOM   1718 S SD  . MET B 2 4   ? -84.529 49.116 -156.523 1.00 75.04  ? 4   MET L SD  1 
ATOM   1719 C CE  . MET B 2 4   ? -83.281 49.248 -157.799 1.00 55.78  ? 4   MET L CE  1 
ATOM   1720 N N   . THR B 2 5   ? -82.065 44.749 -155.343 1.00 62.41  ? 5   THR L N   1 
ATOM   1721 C CA  . THR B 2 5   ? -81.248 43.575 -155.084 1.00 59.42  ? 5   THR L CA  1 
ATOM   1722 C C   . THR B 2 5   ? -80.074 43.550 -156.036 1.00 64.19  ? 5   THR L C   1 
ATOM   1723 O O   . THR B 2 5   ? -80.261 43.421 -157.250 1.00 74.46  ? 5   THR L O   1 
ATOM   1724 C CB  . THR B 2 5   ? -82.061 42.305 -155.304 1.00 57.47  ? 5   THR L CB  1 
ATOM   1725 O OG1 . THR B 2 5   ? -83.238 42.358 -154.492 1.00 62.60  ? 5   THR L OG1 1 
ATOM   1726 C CG2 . THR B 2 5   ? -81.236 41.078 -154.946 1.00 57.05  ? 5   THR L CG2 1 
ATOM   1727 N N   . GLN B 2 6   ? -78.862 43.689 -155.509 1.00 56.87  ? 6   GLN L N   1 
ATOM   1728 C CA  . GLN B 2 6   ? -77.703 43.648 -156.395 1.00 57.49  ? 6   GLN L CA  1 
ATOM   1729 C C   . GLN B 2 6   ? -77.001 42.301 -156.391 1.00 67.67  ? 6   GLN L C   1 
ATOM   1730 O O   . GLN B 2 6   ? -77.121 41.500 -155.454 1.00 68.85  ? 6   GLN L O   1 
ATOM   1731 C CB  . GLN B 2 6   ? -76.717 44.766 -156.108 1.00 51.99  ? 6   GLN L CB  1 
ATOM   1732 C CG  . GLN B 2 6   ? -77.299 46.134 -156.264 1.00 55.58  ? 6   GLN L CG  1 
ATOM   1733 C CD  . GLN B 2 6   ? -76.322 47.214 -155.878 1.00 60.16  ? 6   GLN L CD  1 
ATOM   1734 O OE1 . GLN B 2 6   ? -76.662 48.132 -155.137 1.00 58.68  ? 6   GLN L OE1 1 
ATOM   1735 N NE2 . GLN B 2 6   ? -75.089 47.104 -156.373 1.00 60.59  ? 6   GLN L NE2 1 
ATOM   1736 N N   . SER B 2 7   ? -76.258 42.074 -157.463 1.00 68.25  ? 7   SER L N   1 
ATOM   1737 C CA  . SER B 2 7   ? -75.719 40.773 -157.769 1.00 65.02  ? 7   SER L CA  1 
ATOM   1738 C C   . SER B 2 7   ? -74.591 41.005 -158.757 1.00 64.87  ? 7   SER L C   1 
ATOM   1739 O O   . SER B 2 7   ? -74.770 41.691 -159.767 1.00 68.34  ? 7   SER L O   1 
ATOM   1740 C CB  . SER B 2 7   ? -76.829 39.903 -158.370 1.00 68.52  ? 7   SER L CB  1 
ATOM   1741 O OG  . SER B 2 7   ? -76.352 39.024 -159.372 1.00 80.02  ? 7   SER L OG  1 
ATOM   1742 N N   . PRO B 2 8   ? -73.408 40.470 -158.448 1.00 58.52  ? 8   PRO L N   1 
ATOM   1743 C CA  . PRO B 2 8   ? -73.131 39.741 -157.213 1.00 63.62  ? 8   PRO L CA  1 
ATOM   1744 C C   . PRO B 2 8   ? -72.800 40.681 -156.051 1.00 67.27  ? 8   PRO L C   1 
ATOM   1745 O O   . PRO B 2 8   ? -72.761 41.903 -156.220 1.00 61.92  ? 8   PRO L O   1 
ATOM   1746 C CB  . PRO B 2 8   ? -71.885 38.960 -157.597 1.00 60.47  ? 8   PRO L CB  1 
ATOM   1747 C CG  . PRO B 2 8   ? -71.136 39.962 -158.413 1.00 54.18  ? 8   PRO L CG  1 
ATOM   1748 C CD  . PRO B 2 8   ? -72.224 40.488 -159.322 1.00 53.76  ? 8   PRO L CD  1 
ATOM   1749 N N   . ASP B 2 9   ? -72.561 40.109 -154.876 1.00 69.96  ? 9   ASP L N   1 
ATOM   1750 C CA  . ASP B 2 9   ? -72.159 40.908 -153.726 1.00 70.91  ? 9   ASP L CA  1 
ATOM   1751 C C   . ASP B 2 9   ? -70.766 41.444 -153.963 1.00 68.66  ? 9   ASP L C   1 
ATOM   1752 O O   . ASP B 2 9   ? -70.419 42.558 -153.562 1.00 70.32  ? 9   ASP L O   1 
ATOM   1753 C CB  . ASP B 2 9   ? -72.173 40.068 -152.453 1.00 75.43  ? 9   ASP L CB  1 
ATOM   1754 C CG  . ASP B 2 9   ? -73.566 39.903 -151.884 1.00 87.56  ? 9   ASP L CG  1 
ATOM   1755 O OD1 . ASP B 2 9   ? -74.523 40.445 -152.480 1.00 85.11  ? 9   ASP L OD1 1 
ATOM   1756 O OD2 . ASP B 2 9   ? -73.706 39.236 -150.837 1.00 98.06  ? 9   ASP L OD2 1 
ATOM   1757 N N   . SER B 2 10  ? -69.975 40.638 -154.643 1.00 66.26  ? 10  SER L N   1 
ATOM   1758 C CA  . SER B 2 10  ? -68.581 40.944 -154.823 1.00 66.52  ? 10  SER L CA  1 
ATOM   1759 C C   . SER B 2 10  ? -68.117 40.454 -156.185 1.00 67.02  ? 10  SER L C   1 
ATOM   1760 O O   . SER B 2 10  ? -68.571 39.426 -156.689 1.00 72.84  ? 10  SER L O   1 
ATOM   1761 C CB  . SER B 2 10  ? -67.772 40.278 -153.722 1.00 70.59  ? 10  SER L CB  1 
ATOM   1762 O OG  . SER B 2 10  ? -66.524 40.916 -153.574 1.00 78.16  ? 10  SER L OG  1 
ATOM   1763 N N   . LEU B 2 11  ? -67.200 41.205 -156.773 1.00 60.80  ? 11  LEU L N   1 
ATOM   1764 C CA  . LEU B 2 11  ? -66.713 40.930 -158.105 1.00 59.24  ? 11  LEU L CA  1 
ATOM   1765 C C   . LEU B 2 11  ? -65.225 41.268 -158.160 1.00 64.33  ? 11  LEU L C   1 
ATOM   1766 O O   . LEU B 2 11  ? -64.785 42.271 -157.594 1.00 67.96  ? 11  LEU L O   1 
ATOM   1767 C CB  . LEU B 2 11  ? -67.482 41.798 -159.094 1.00 61.84  ? 11  LEU L CB  1 
ATOM   1768 C CG  . LEU B 2 11  ? -67.188 41.638 -160.578 1.00 66.48  ? 11  LEU L CG  1 
ATOM   1769 C CD1 . LEU B 2 11  ? -67.654 40.279 -161.050 1.00 71.53  ? 11  LEU L CD1 1 
ATOM   1770 C CD2 . LEU B 2 11  ? -67.890 42.734 -161.336 1.00 62.30  ? 11  LEU L CD2 1 
ATOM   1771 N N   . ALA B 2 12  ? -64.449 40.418 -158.823 1.00 65.86  ? 12  ALA L N   1 
ATOM   1772 C CA  . ALA B 2 12  ? -63.024 40.664 -159.020 1.00 58.52  ? 12  ALA L CA  1 
ATOM   1773 C C   . ALA B 2 12  ? -62.696 40.462 -160.489 1.00 62.22  ? 12  ALA L C   1 
ATOM   1774 O O   . ALA B 2 12  ? -63.011 39.428 -161.070 1.00 59.23  ? 12  ALA L O   1 
ATOM   1775 C CB  . ALA B 2 12  ? -62.204 39.741 -158.176 1.00 48.64  ? 12  ALA L CB  1 
ATOM   1776 N N   . VAL B 2 13  ? -62.041 41.453 -161.074 1.00 66.01  ? 13  VAL L N   1 
ATOM   1777 C CA  . VAL B 2 13  ? -61.819 41.482 -162.507 1.00 68.63  ? 13  VAL L CA  1 
ATOM   1778 C C   . VAL B 2 13  ? -60.382 41.883 -162.832 1.00 65.67  ? 13  VAL L C   1 
ATOM   1779 O O   . VAL B 2 13  ? -59.797 42.714 -162.147 1.00 64.85  ? 13  VAL L O   1 
ATOM   1780 C CB  . VAL B 2 13  ? -62.821 42.452 -163.160 1.00 71.03  ? 13  VAL L CB  1 
ATOM   1781 C CG1 . VAL B 2 13  ? -62.335 42.912 -164.508 1.00 74.38  ? 13  VAL L CG1 1 
ATOM   1782 C CG2 . VAL B 2 13  ? -64.171 41.782 -163.272 1.00 70.15  ? 13  VAL L CG2 1 
ATOM   1783 N N   . SER B 2 14  ? -59.800 41.283 -163.862 1.00 66.84  ? 14  SER L N   1 
ATOM   1784 C CA  . SER B 2 14  ? -58.436 41.642 -164.229 1.00 69.43  ? 14  SER L CA  1 
ATOM   1785 C C   . SER B 2 14  ? -58.411 43.061 -164.765 1.00 69.86  ? 14  SER L C   1 
ATOM   1786 O O   . SER B 2 14  ? -59.407 43.546 -165.301 1.00 67.31  ? 14  SER L O   1 
ATOM   1787 C CB  . SER B 2 14  ? -57.868 40.663 -165.243 1.00 67.86  ? 14  SER L CB  1 
ATOM   1788 O OG  . SER B 2 14  ? -57.887 39.352 -164.707 1.00 72.15  ? 14  SER L OG  1 
ATOM   1789 N N   . LEU B 2 15  ? -57.288 43.744 -164.589 1.00 67.79  ? 15  LEU L N   1 
ATOM   1790 C CA  . LEU B 2 15  ? -57.192 45.122 -165.037 1.00 66.95  ? 15  LEU L CA  1 
ATOM   1791 C C   . LEU B 2 15  ? -57.547 45.182 -166.527 1.00 74.23  ? 15  LEU L C   1 
ATOM   1792 O O   . LEU B 2 15  ? -57.278 44.241 -167.269 1.00 77.06  ? 15  LEU L O   1 
ATOM   1793 C CB  . LEU B 2 15  ? -55.791 45.652 -164.776 1.00 67.23  ? 15  LEU L CB  1 
ATOM   1794 C CG  . LEU B 2 15  ? -55.536 47.152 -164.868 1.00 72.41  ? 15  LEU L CG  1 
ATOM   1795 C CD1 . LEU B 2 15  ? -56.161 47.897 -163.703 1.00 70.98  ? 15  LEU L CD1 1 
ATOM   1796 C CD2 . LEU B 2 15  ? -54.036 47.395 -164.895 1.00 73.69  ? 15  LEU L CD2 1 
ATOM   1797 N N   . GLY B 2 16  ? -58.195 46.262 -166.954 1.00 83.11  ? 16  GLY L N   1 
ATOM   1798 C CA  . GLY B 2 16  ? -58.547 46.446 -168.353 1.00 70.98  ? 16  GLY L CA  1 
ATOM   1799 C C   . GLY B 2 16  ? -59.644 45.539 -168.889 1.00 74.61  ? 16  GLY L C   1 
ATOM   1800 O O   . GLY B 2 16  ? -60.117 45.736 -170.010 1.00 76.14  ? 16  GLY L O   1 
ATOM   1801 N N   . GLU B 2 17  ? -60.041 44.534 -168.111 1.00 76.20  ? 17  GLU L N   1 
ATOM   1802 C CA  . GLU B 2 17  ? -61.137 43.649 -168.507 1.00 79.09  ? 17  GLU L CA  1 
ATOM   1803 C C   . GLU B 2 17  ? -62.494 44.254 -168.153 1.00 78.45  ? 17  GLU L C   1 
ATOM   1804 O O   . GLU B 2 17  ? -62.581 45.388 -167.671 1.00 76.03  ? 17  GLU L O   1 
ATOM   1805 C CB  . GLU B 2 17  ? -61.007 42.271 -167.860 1.00 88.45  ? 17  GLU L CB  1 
ATOM   1806 C CG  . GLU B 2 17  ? -60.233 41.238 -168.666 1.00 104.89 ? 17  GLU L CG  1 
ATOM   1807 C CD  . GLU B 2 17  ? -60.073 39.916 -167.911 1.00 119.35 ? 17  GLU L CD  1 
ATOM   1808 O OE1 . GLU B 2 17  ? -60.452 39.851 -166.716 1.00 122.17 ? 17  GLU L OE1 1 
ATOM   1809 O OE2 . GLU B 2 17  ? -59.566 38.941 -168.509 1.00 123.91 ? 17  GLU L OE2 1 
ATOM   1810 N N   . ARG B 2 18  ? -63.551 43.479 -168.372 1.00 78.40  ? 18  ARG L N   1 
ATOM   1811 C CA  . ARG B 2 18  ? -64.908 44.003 -168.291 1.00 76.93  ? 18  ARG L CA  1 
ATOM   1812 C C   . ARG B 2 18  ? -65.627 43.588 -167.019 1.00 73.47  ? 18  ARG L C   1 
ATOM   1813 O O   . ARG B 2 18  ? -65.686 42.405 -166.683 1.00 78.21  ? 18  ARG L O   1 
ATOM   1814 C CB  . ARG B 2 18  ? -65.705 43.563 -169.518 1.00 81.81  ? 18  ARG L CB  1 
ATOM   1815 C CG  . ARG B 2 18  ? -67.185 43.881 -169.480 1.00 83.62  ? 18  ARG L CG  1 
ATOM   1816 C CD  . ARG B 2 18  ? -67.788 43.662 -170.855 1.00 94.72  ? 18  ARG L CD  1 
ATOM   1817 N NE  . ARG B 2 18  ? -69.161 43.168 -170.777 1.00 105.22 ? 18  ARG L NE  1 
ATOM   1818 C CZ  . ARG B 2 18  ? -69.506 41.889 -170.910 1.00 109.79 ? 18  ARG L CZ  1 
ATOM   1819 N NH1 . ARG B 2 18  ? -68.574 40.962 -171.134 1.00 108.86 ? 18  ARG L NH1 1 
ATOM   1820 N NH2 . ARG B 2 18  ? -70.786 41.536 -170.824 1.00 106.97 ? 18  ARG L NH2 1 
ATOM   1821 N N   . ALA B 2 19  ? -66.179 44.572 -166.319 1.00 66.32  ? 19  ALA L N   1 
ATOM   1822 C CA  . ALA B 2 19  ? -66.904 44.324 -165.077 1.00 66.46  ? 19  ALA L CA  1 
ATOM   1823 C C   . ALA B 2 19  ? -68.368 44.663 -165.275 1.00 66.49  ? 19  ALA L C   1 
ATOM   1824 O O   . ALA B 2 19  ? -68.681 45.779 -165.677 1.00 70.27  ? 19  ALA L O   1 
ATOM   1825 C CB  . ALA B 2 19  ? -66.320 45.168 -163.945 1.00 64.05  ? 19  ALA L CB  1 
ATOM   1826 N N   . THR B 2 20  ? -69.254 43.703 -165.008 1.00 63.63  ? 20  THR L N   1 
ATOM   1827 C CA  . THR B 2 20  ? -70.698 43.945 -165.081 1.00 67.93  ? 20  THR L CA  1 
ATOM   1828 C C   . THR B 2 20  ? -71.386 43.619 -163.755 1.00 67.60  ? 20  THR L C   1 
ATOM   1829 O O   . THR B 2 20  ? -71.177 42.547 -163.187 1.00 64.44  ? 20  THR L O   1 
ATOM   1830 C CB  . THR B 2 20  ? -71.400 43.163 -166.238 1.00 76.50  ? 20  THR L CB  1 
ATOM   1831 O OG1 . THR B 2 20  ? -70.833 41.856 -166.355 1.00 86.48  ? 20  THR L OG1 1 
ATOM   1832 C CG2 . THR B 2 20  ? -71.247 43.876 -167.570 1.00 74.52  ? 20  THR L CG2 1 
ATOM   1833 N N   . ILE B 2 21  ? -72.206 44.561 -163.287 1.00 66.53  ? 21  ILE L N   1 
ATOM   1834 C CA  . ILE B 2 21  ? -72.979 44.442 -162.056 1.00 62.66  ? 21  ILE L CA  1 
ATOM   1835 C C   . ILE B 2 21  ? -74.458 44.488 -162.370 1.00 56.60  ? 21  ILE L C   1 
ATOM   1836 O O   . ILE B 2 21  ? -74.873 45.192 -163.281 1.00 54.57  ? 21  ILE L O   1 
ATOM   1837 C CB  . ILE B 2 21  ? -72.730 45.644 -161.134 1.00 62.20  ? 21  ILE L CB  1 
ATOM   1838 C CG1 . ILE B 2 21  ? -71.253 45.808 -160.845 1.00 56.67  ? 21  ILE L CG1 1 
ATOM   1839 C CG2 . ILE B 2 21  ? -73.553 45.540 -159.829 1.00 59.18  ? 21  ILE L CG2 1 
ATOM   1840 C CD1 . ILE B 2 21  ? -70.974 47.182 -160.323 1.00 65.93  ? 21  ILE L CD1 1 
ATOM   1841 N N   . ASN B 2 22  ? -75.258 43.790 -161.575 1.00 61.70  ? 22  ASN L N   1 
ATOM   1842 C CA  . ASN B 2 22  ? -76.695 43.748 -161.797 1.00 66.65  ? 22  ASN L CA  1 
ATOM   1843 C C   . ASN B 2 22  ? -77.534 44.377 -160.697 1.00 67.72  ? 22  ASN L C   1 
ATOM   1844 O O   . ASN B 2 22  ? -77.153 44.365 -159.531 1.00 70.42  ? 22  ASN L O   1 
ATOM   1845 C CB  . ASN B 2 22  ? -77.123 42.307 -162.011 1.00 71.94  ? 22  ASN L CB  1 
ATOM   1846 C CG  . ASN B 2 22  ? -76.330 41.647 -163.100 1.00 77.30  ? 22  ASN L CG  1 
ATOM   1847 O OD1 . ASN B 2 22  ? -76.382 42.068 -164.255 1.00 80.00  ? 22  ASN L OD1 1 
ATOM   1848 N ND2 . ASN B 2 22  ? -75.566 40.625 -162.741 1.00 78.56  ? 22  ASN L ND2 1 
ATOM   1849 N N   . CYS B 2 23  ? -78.685 44.916 -161.096 1.00 68.10  ? 23  CYS L N   1 
ATOM   1850 C CA  . CYS B 2 23  ? -79.682 45.480 -160.185 1.00 66.77  ? 23  CYS L CA  1 
ATOM   1851 C C   . CYS B 2 23  ? -81.073 44.987 -160.580 1.00 68.09  ? 23  CYS L C   1 
ATOM   1852 O O   . CYS B 2 23  ? -81.512 45.156 -161.725 1.00 60.54  ? 23  CYS L O   1 
ATOM   1853 C CB  . CYS B 2 23  ? -79.660 47.008 -160.247 1.00 59.44  ? 23  CYS L CB  1 
ATOM   1854 S SG  . CYS B 2 23  ? -80.451 47.816 -158.869 1.00 84.56  ? 23  CYS L SG  1 
ATOM   1855 N N   . LYS B 2 24  ? -81.760 44.360 -159.638 1.00 69.78  ? 24  LYS L N   1 
ATOM   1856 C CA  . LYS B 2 24  ? -83.123 43.923 -159.876 1.00 69.53  ? 24  LYS L CA  1 
ATOM   1857 C C   . LYS B 2 24  ? -84.029 44.558 -158.826 1.00 70.86  ? 24  LYS L C   1 
ATOM   1858 O O   . LYS B 2 24  ? -83.794 44.404 -157.624 1.00 73.76  ? 24  LYS L O   1 
ATOM   1859 C CB  . LYS B 2 24  ? -83.206 42.398 -159.823 1.00 66.90  ? 24  LYS L CB  1 
ATOM   1860 C CG  . LYS B 2 24  ? -84.577 41.853 -160.154 1.00 83.85  ? 24  LYS L CG  1 
ATOM   1861 C CD  . LYS B 2 24  ? -84.491 40.489 -160.838 1.00 95.55  ? 24  LYS L CD  1 
ATOM   1862 C CE  . LYS B 2 24  ? -83.616 39.530 -160.056 1.00 100.46 ? 24  LYS L CE  1 
ATOM   1863 N NZ  . LYS B 2 24  ? -84.035 39.456 -158.627 1.00 104.35 ? 24  LYS L NZ  1 
ATOM   1864 N N   . SER B 2 25  ? -85.044 45.293 -159.273 1.00 62.03  ? 25  SER L N   1 
ATOM   1865 C CA  . SER B 2 25  ? -86.000 45.904 -158.341 1.00 59.63  ? 25  SER L CA  1 
ATOM   1866 C C   . SER B 2 25  ? -87.298 45.107 -158.200 1.00 62.24  ? 25  SER L C   1 
ATOM   1867 O O   . SER B 2 25  ? -87.757 44.456 -159.145 1.00 65.13  ? 25  SER L O   1 
ATOM   1868 C CB  . SER B 2 25  ? -86.327 47.333 -158.755 1.00 56.80  ? 25  SER L CB  1 
ATOM   1869 O OG  . SER B 2 25  ? -86.945 47.350 -160.020 1.00 59.99  ? 25  SER L OG  1 
ATOM   1870 N N   . SER B 2 26  ? -87.890 45.164 -157.014 1.00 60.26  ? 26  SER L N   1 
ATOM   1871 C CA  . SER B 2 26  ? -89.093 44.394 -156.735 1.00 64.29  ? 26  SER L CA  1 
ATOM   1872 C C   . SER B 2 26  ? -90.261 44.811 -157.639 1.00 70.66  ? 26  SER L C   1 
ATOM   1873 O O   . SER B 2 26  ? -91.159 44.010 -157.917 1.00 72.49  ? 26  SER L O   1 
ATOM   1874 C CB  . SER B 2 26  ? -89.469 44.497 -155.256 1.00 65.64  ? 26  SER L CB  1 
ATOM   1875 O OG  . SER B 2 26  ? -89.533 45.849 -154.841 1.00 72.12  ? 26  SER L OG  1 
ATOM   1876 N N   . GLN B 2 27  ? -90.236 46.058 -158.103 1.00 71.34  ? 27  GLN L N   1 
ATOM   1877 C CA  . GLN B 2 27  ? -91.220 46.543 -159.069 1.00 72.70  ? 27  GLN L CA  1 
ATOM   1878 C C   . GLN B 2 27  ? -90.551 47.321 -160.191 1.00 68.10  ? 27  GLN L C   1 
ATOM   1879 O O   . GLN B 2 27  ? -89.395 47.709 -160.084 1.00 73.65  ? 27  GLN L O   1 
ATOM   1880 C CB  . GLN B 2 27  ? -92.244 47.438 -158.388 1.00 80.75  ? 27  GLN L CB  1 
ATOM   1881 C CG  . GLN B 2 27  ? -93.111 46.732 -157.377 1.00 94.57  ? 27  GLN L CG  1 
ATOM   1882 C CD  . GLN B 2 27  ? -93.820 47.716 -156.475 1.00 108.33 ? 27  GLN L CD  1 
ATOM   1883 O OE1 . GLN B 2 27  ? -94.540 48.601 -156.944 1.00 110.09 ? 27  GLN L OE1 1 
ATOM   1884 N NE2 . GLN B 2 27  ? -93.609 47.577 -155.168 1.00 113.14 ? 27  GLN L NE2 1 
ATOM   1885 N N   . SER B 2 28  A -91.293 47.571 -161.257 1.00 63.06  ? 27  SER L N   1 
ATOM   1886 C CA  . SER B 2 28  A -90.761 48.286 -162.410 1.00 65.90  ? 27  SER L CA  1 
ATOM   1887 C C   . SER B 2 28  A -90.556 49.762 -162.090 1.00 67.53  ? 27  SER L C   1 
ATOM   1888 O O   . SER B 2 28  A -91.391 50.380 -161.437 1.00 63.91  ? 27  SER L O   1 
ATOM   1889 C CB  . SER B 2 28  A -91.715 48.142 -163.600 1.00 67.30  ? 27  SER L CB  1 
ATOM   1890 O OG  . SER B 2 28  A -91.451 49.106 -164.604 1.00 70.49  ? 27  SER L OG  1 
ATOM   1891 N N   . VAL B 2 29  B -89.449 50.333 -162.548 1.00 58.39  ? 27  VAL L N   1 
ATOM   1892 C CA  . VAL B 2 29  B -89.223 51.750 -162.305 1.00 67.93  ? 27  VAL L CA  1 
ATOM   1893 C C   . VAL B 2 29  B -89.359 52.528 -163.598 1.00 65.58  ? 27  VAL L C   1 
ATOM   1894 O O   . VAL B 2 29  B -88.955 53.686 -163.693 1.00 70.36  ? 27  VAL L O   1 
ATOM   1895 C CB  . VAL B 2 29  B -87.874 52.039 -161.573 1.00 62.43  ? 27  VAL L CB  1 
ATOM   1896 C CG1 . VAL B 2 29  B -87.820 51.268 -160.275 1.00 61.30  ? 27  VAL L CG1 1 
ATOM   1897 C CG2 . VAL B 2 29  B -86.674 51.699 -162.445 1.00 58.44  ? 27  VAL L CG2 1 
ATOM   1898 N N   . LEU B 2 30  C -89.954 51.875 -164.589 1.00 64.36  ? 27  LEU L N   1 
ATOM   1899 C CA  . LEU B 2 30  C -90.199 52.489 -165.884 1.00 64.15  ? 27  LEU L CA  1 
ATOM   1900 C C   . LEU B 2 30  C -91.463 53.325 -165.811 1.00 64.41  ? 27  LEU L C   1 
ATOM   1901 O O   . LEU B 2 30  C -92.543 52.790 -165.596 1.00 70.23  ? 27  LEU L O   1 
ATOM   1902 C CB  . LEU B 2 30  C -90.362 51.414 -166.956 1.00 62.27  ? 27  LEU L CB  1 
ATOM   1903 C CG  . LEU B 2 30  C -90.009 51.791 -168.394 1.00 62.42  ? 27  LEU L CG  1 
ATOM   1904 C CD1 . LEU B 2 30  C -90.882 50.993 -169.332 1.00 62.37  ? 27  LEU L CD1 1 
ATOM   1905 C CD2 . LEU B 2 30  C -90.176 53.281 -168.656 1.00 60.59  ? 27  LEU L CD2 1 
ATOM   1906 N N   . TYR B 2 31  D -91.303 54.633 -165.997 1.00 60.50  ? 27  TYR L N   1 
ATOM   1907 C CA  . TYR B 2 31  D -92.383 55.616 -165.956 1.00 67.22  ? 27  TYR L CA  1 
ATOM   1908 C C   . TYR B 2 31  D -92.966 55.851 -167.359 1.00 68.99  ? 27  TYR L C   1 
ATOM   1909 O O   . TYR B 2 31  D -92.298 56.439 -168.203 1.00 75.80  ? 27  TYR L O   1 
ATOM   1910 C CB  . TYR B 2 31  D -91.788 56.930 -165.440 1.00 65.37  ? 27  TYR L CB  1 
ATOM   1911 C CG  . TYR B 2 31  D -92.756 57.956 -164.879 1.00 71.16  ? 27  TYR L CG  1 
ATOM   1912 C CD1 . TYR B 2 31  D -93.644 57.630 -163.854 1.00 72.08  ? 27  TYR L CD1 1 
ATOM   1913 C CD2 . TYR B 2 31  D -92.734 59.272 -165.326 1.00 73.46  ? 27  TYR L CD2 1 
ATOM   1914 C CE1 . TYR B 2 31  D -94.516 58.581 -163.323 1.00 70.90  ? 27  TYR L CE1 1 
ATOM   1915 C CE2 . TYR B 2 31  D -93.597 60.227 -164.799 1.00 76.29  ? 27  TYR L CE2 1 
ATOM   1916 C CZ  . TYR B 2 31  D -94.485 59.876 -163.800 1.00 74.70  ? 27  TYR L CZ  1 
ATOM   1917 O OH  . TYR B 2 31  D -95.336 60.825 -163.276 1.00 75.41  ? 27  TYR L OH  1 
ATOM   1918 N N   . SER B 2 32  E -94.189 55.393 -167.628 1.00 65.46  ? 27  SER L N   1 
ATOM   1919 C CA  . SER B 2 32  E -94.851 55.739 -168.897 1.00 67.09  ? 27  SER L CA  1 
ATOM   1920 C C   . SER B 2 32  E -94.882 57.251 -168.985 1.00 70.08  ? 27  SER L C   1 
ATOM   1921 O O   . SER B 2 32  E -95.006 57.920 -167.969 1.00 78.91  ? 27  SER L O   1 
ATOM   1922 C CB  . SER B 2 32  E -96.282 55.218 -168.941 1.00 71.96  ? 27  SER L CB  1 
ATOM   1923 O OG  . SER B 2 32  E -96.396 54.001 -168.235 1.00 77.25  ? 27  SER L OG  1 
ATOM   1924 N N   . SER B 2 33  F -94.777 57.798 -170.185 1.00 69.01  ? 27  SER L N   1 
ATOM   1925 C CA  . SER B 2 33  F -94.576 59.241 -170.334 1.00 71.24  ? 27  SER L CA  1 
ATOM   1926 C C   . SER B 2 33  F -93.157 59.546 -169.898 1.00 77.15  ? 27  SER L C   1 
ATOM   1927 O O   . SER B 2 33  F -92.723 59.147 -168.828 1.00 75.34  ? 27  SER L O   1 
ATOM   1928 C CB  . SER B 2 33  F -95.601 60.058 -169.540 1.00 65.34  ? 27  SER L CB  1 
ATOM   1929 O OG  . SER B 2 33  F -95.201 60.290 -168.203 1.00 64.13  ? 27  SER L OG  1 
ATOM   1930 N N   . ASN B 2 34  ? -92.434 60.248 -170.754 1.00 85.18  ? 28  ASN L N   1 
ATOM   1931 C CA  . ASN B 2 34  ? -90.973 60.269 -170.724 1.00 75.85  ? 28  ASN L CA  1 
ATOM   1932 C C   . ASN B 2 34  ? -90.308 58.890 -170.912 1.00 78.34  ? 28  ASN L C   1 
ATOM   1933 O O   . ASN B 2 34  ? -89.147 58.814 -171.312 1.00 83.02  ? 28  ASN L O   1 
ATOM   1934 C CB  . ASN B 2 34  ? -90.414 61.114 -169.558 1.00 67.11  ? 28  ASN L CB  1 
ATOM   1935 C CG  . ASN B 2 34  ? -90.207 60.331 -168.272 1.00 64.82  ? 28  ASN L CG  1 
ATOM   1936 O OD1 . ASN B 2 34  ? -90.356 59.114 -168.212 1.00 58.86  ? 28  ASN L OD1 1 
ATOM   1937 N ND2 . ASN B 2 34  ? -89.847 61.051 -167.225 1.00 57.30  ? 28  ASN L ND2 1 
ATOM   1938 N N   . ASN B 2 35  ? -91.065 57.816 -170.689 1.00 61.41  ? 29  ASN L N   1 
ATOM   1939 C CA  . ASN B 2 35  ? -90.559 56.440 -170.835 1.00 72.05  ? 29  ASN L CA  1 
ATOM   1940 C C   . ASN B 2 35  ? -89.165 56.158 -170.231 1.00 76.94  ? 29  ASN L C   1 
ATOM   1941 O O   . ASN B 2 35  ? -88.491 55.212 -170.636 1.00 77.20  ? 29  ASN L O   1 
ATOM   1942 C CB  . ASN B 2 35  ? -90.569 56.006 -172.300 1.00 79.58  ? 29  ASN L CB  1 
ATOM   1943 C CG  . ASN B 2 35  ? -90.443 54.501 -172.467 1.00 93.24  ? 29  ASN L CG  1 
ATOM   1944 O OD1 . ASN B 2 35  ? -91.343 53.746 -172.095 1.00 99.94  ? 29  ASN L OD1 1 
ATOM   1945 N ND2 . ASN B 2 35  ? -89.326 54.057 -173.034 1.00 95.02  ? 29  ASN L ND2 1 
ATOM   1946 N N   . LYS B 2 36  ? -88.748 56.974 -169.264 1.00 69.58  ? 30  LYS L N   1 
ATOM   1947 C CA  . LYS B 2 36  ? -87.471 56.806 -168.582 1.00 68.38  ? 30  LYS L CA  1 
ATOM   1948 C C   . LYS B 2 36  ? -87.582 55.807 -167.422 1.00 66.28  ? 30  LYS L C   1 
ATOM   1949 O O   . LYS B 2 36  ? -88.628 55.686 -166.793 1.00 61.56  ? 30  LYS L O   1 
ATOM   1950 C CB  . LYS B 2 36  ? -86.978 58.165 -168.067 1.00 66.97  ? 30  LYS L CB  1 
ATOM   1951 C CG  . LYS B 2 36  ? -86.741 59.200 -169.168 1.00 68.51  ? 30  LYS L CG  1 
ATOM   1952 C CD  . LYS B 2 36  ? -85.546 58.811 -170.034 1.00 79.10  ? 30  LYS L CD  1 
ATOM   1953 C CE  . LYS B 2 36  ? -85.511 59.575 -171.369 1.00 91.59  ? 30  LYS L CE  1 
ATOM   1954 N NZ  . LYS B 2 36  ? -84.543 60.715 -171.412 1.00 93.94  ? 30  LYS L NZ  1 
ATOM   1955 N N   . SER B 2 37  ? -86.509 55.073 -167.151 1.00 67.96  ? 31  SER L N   1 
ATOM   1956 C CA  . SER B 2 37  ? -86.468 54.246 -165.949 1.00 61.58  ? 31  SER L CA  1 
ATOM   1957 C C   . SER B 2 37  ? -85.782 55.045 -164.836 1.00 62.74  ? 31  SER L C   1 
ATOM   1958 O O   . SER B 2 37  ? -84.667 55.534 -164.998 1.00 66.70  ? 31  SER L O   1 
ATOM   1959 C CB  . SER B 2 37  ? -85.754 52.919 -166.215 1.00 64.81  ? 31  SER L CB  1 
ATOM   1960 O OG  . SER B 2 37  ? -86.258 52.275 -167.385 1.00 75.89  ? 31  SER L OG  1 
ATOM   1961 N N   . TYR B 2 38  ? -86.456 55.211 -163.711 1.00 61.32  ? 32  TYR L N   1 
ATOM   1962 C CA  . TYR B 2 38  ? -85.905 56.038 -162.653 1.00 60.01  ? 32  TYR L CA  1 
ATOM   1963 C C   . TYR B 2 38  ? -84.898 55.271 -161.788 1.00 57.60  ? 32  TYR L C   1 
ATOM   1964 O O   . TYR B 2 38  ? -85.139 54.966 -160.615 1.00 54.48  ? 32  TYR L O   1 
ATOM   1965 C CB  . TYR B 2 38  ? -87.026 56.678 -161.832 1.00 67.53  ? 32  TYR L CB  1 
ATOM   1966 C CG  . TYR B 2 38  ? -87.606 57.913 -162.493 1.00 67.91  ? 32  TYR L CG  1 
ATOM   1967 C CD1 . TYR B 2 38  ? -88.166 57.848 -163.759 1.00 65.98  ? 32  TYR L CD1 1 
ATOM   1968 C CD2 . TYR B 2 38  ? -87.588 59.143 -161.849 1.00 66.69  ? 32  TYR L CD2 1 
ATOM   1969 C CE1 . TYR B 2 38  ? -88.688 58.973 -164.364 1.00 67.99  ? 32  TYR L CE1 1 
ATOM   1970 C CE2 . TYR B 2 38  ? -88.111 60.272 -162.445 1.00 66.05  ? 32  TYR L CE2 1 
ATOM   1971 C CZ  . TYR B 2 38  ? -88.658 60.182 -163.703 1.00 68.00  ? 32  TYR L CZ  1 
ATOM   1972 O OH  . TYR B 2 38  ? -89.177 61.308 -164.301 1.00 65.93  ? 32  TYR L OH  1 
ATOM   1973 N N   . LEU B 2 39  ? -83.750 54.983 -162.391 1.00 57.92  ? 33  LEU L N   1 
ATOM   1974 C CA  . LEU B 2 39  ? -82.712 54.217 -161.737 1.00 57.21  ? 33  LEU L CA  1 
ATOM   1975 C C   . LEU B 2 39  ? -81.363 54.893 -161.908 1.00 51.75  ? 33  LEU L C   1 
ATOM   1976 O O   . LEU B 2 39  ? -81.042 55.378 -162.991 1.00 54.95  ? 33  LEU L O   1 
ATOM   1977 C CB  . LEU B 2 39  ? -82.654 52.828 -162.347 1.00 63.05  ? 33  LEU L CB  1 
ATOM   1978 C CG  . LEU B 2 39  ? -81.796 51.917 -161.489 1.00 63.08  ? 33  LEU L CG  1 
ATOM   1979 C CD1 . LEU B 2 39  ? -82.663 51.229 -160.461 1.00 55.20  ? 33  LEU L CD1 1 
ATOM   1980 C CD2 . LEU B 2 39  ? -81.090 50.917 -162.355 1.00 67.60  ? 33  LEU L CD2 1 
ATOM   1981 N N   . ALA B 2 40  ? -80.568 54.901 -160.844 1.00 49.10  ? 34  ALA L N   1 
ATOM   1982 C CA  . ALA B 2 40  ? -79.253 55.555 -160.835 1.00 51.12  ? 34  ALA L CA  1 
ATOM   1983 C C   . ALA B 2 40  ? -78.176 54.646 -160.275 1.00 52.90  ? 34  ALA L C   1 
ATOM   1984 O O   . ALA B 2 40  ? -78.460 53.757 -159.471 1.00 57.03  ? 34  ALA L O   1 
ATOM   1985 C CB  . ALA B 2 40  ? -79.304 56.832 -160.011 1.00 49.97  ? 34  ALA L CB  1 
ATOM   1986 N N   . TRP B 2 41  ? -76.935 54.888 -160.679 1.00 49.28  ? 35  TRP L N   1 
ATOM   1987 C CA  . TRP B 2 41  ? -75.797 54.169 -160.111 1.00 54.06  ? 35  TRP L CA  1 
ATOM   1988 C C   . TRP B 2 41  ? -74.845 55.125 -159.418 1.00 53.23  ? 35  TRP L C   1 
ATOM   1989 O O   . TRP B 2 41  ? -74.554 56.208 -159.939 1.00 56.31  ? 35  TRP L O   1 
ATOM   1990 C CB  . TRP B 2 41  ? -75.024 53.418 -161.191 1.00 54.95  ? 35  TRP L CB  1 
ATOM   1991 C CG  . TRP B 2 41  ? -75.749 52.258 -161.741 1.00 56.38  ? 35  TRP L CG  1 
ATOM   1992 C CD1 . TRP B 2 41  ? -76.511 52.231 -162.866 1.00 53.31  ? 35  TRP L CD1 1 
ATOM   1993 C CD2 . TRP B 2 41  ? -75.782 50.937 -161.200 1.00 55.25  ? 35  TRP L CD2 1 
ATOM   1994 N NE1 . TRP B 2 41  ? -77.018 50.974 -163.064 1.00 50.98  ? 35  TRP L NE1 1 
ATOM   1995 C CE2 . TRP B 2 41  ? -76.589 50.158 -162.055 1.00 54.01  ? 35  TRP L CE2 1 
ATOM   1996 C CE3 . TRP B 2 41  ? -75.208 50.332 -160.080 1.00 52.09  ? 35  TRP L CE3 1 
ATOM   1997 C CZ2 . TRP B 2 41  ? -76.844 48.806 -161.822 1.00 55.81  ? 35  TRP L CZ2 1 
ATOM   1998 C CZ3 . TRP B 2 41  ? -75.462 48.983 -159.847 1.00 50.33  ? 35  TRP L CZ3 1 
ATOM   1999 C CH2 . TRP B 2 41  ? -76.271 48.236 -160.716 1.00 50.92  ? 35  TRP L CH2 1 
ATOM   2000 N N   . TYR B 2 42  ? -74.347 54.719 -158.254 1.00 46.13  ? 36  TYR L N   1 
ATOM   2001 C CA  . TYR B 2 42  ? -73.339 55.505 -157.560 1.00 45.82  ? 36  TYR L CA  1 
ATOM   2002 C C   . TYR B 2 42  ? -72.086 54.702 -157.312 1.00 52.48  ? 36  TYR L C   1 
ATOM   2003 O O   . TYR B 2 42  ? -72.122 53.470 -157.231 1.00 54.83  ? 36  TYR L O   1 
ATOM   2004 C CB  . TYR B 2 42  ? -73.852 56.034 -156.232 1.00 41.22  ? 36  TYR L CB  1 
ATOM   2005 C CG  . TYR B 2 42  ? -75.085 56.897 -156.324 1.00 45.80  ? 36  TYR L CG  1 
ATOM   2006 C CD1 . TYR B 2 42  ? -76.347 56.321 -156.412 1.00 48.05  ? 36  TYR L CD1 1 
ATOM   2007 C CD2 . TYR B 2 42  ? -74.996 58.279 -156.278 1.00 47.93  ? 36  TYR L CD2 1 
ATOM   2008 C CE1 . TYR B 2 42  ? -77.481 57.091 -156.470 1.00 51.44  ? 36  TYR L CE1 1 
ATOM   2009 C CE2 . TYR B 2 42  ? -76.132 59.064 -156.329 1.00 54.22  ? 36  TYR L CE2 1 
ATOM   2010 C CZ  . TYR B 2 42  ? -77.375 58.461 -156.430 1.00 55.30  ? 36  TYR L CZ  1 
ATOM   2011 O OH  . TYR B 2 42  ? -78.518 59.217 -156.488 1.00 53.63  ? 36  TYR L OH  1 
ATOM   2012 N N   . GLN B 2 43  ? -70.978 55.422 -157.185 1.00 49.93  ? 37  GLN L N   1 
ATOM   2013 C CA  . GLN B 2 43  ? -69.699 54.828 -156.852 1.00 47.18  ? 37  GLN L CA  1 
ATOM   2014 C C   . GLN B 2 43  ? -69.254 55.275 -155.463 1.00 50.54  ? 37  GLN L C   1 
ATOM   2015 O O   . GLN B 2 43  ? -69.223 56.468 -155.173 1.00 53.43  ? 37  GLN L O   1 
ATOM   2016 C CB  . GLN B 2 43  ? -68.668 55.267 -157.877 1.00 47.42  ? 37  GLN L CB  1 
ATOM   2017 C CG  . GLN B 2 43  ? -67.259 54.830 -157.571 1.00 46.75  ? 37  GLN L CG  1 
ATOM   2018 C CD  . GLN B 2 43  ? -66.291 55.390 -158.580 1.00 53.28  ? 37  GLN L CD  1 
ATOM   2019 O OE1 . GLN B 2 43  ? -66.186 56.602 -158.743 1.00 60.09  ? 37  GLN L OE1 1 
ATOM   2020 N NE2 . GLN B 2 43  ? -65.591 54.512 -159.282 1.00 50.40  ? 37  GLN L NE2 1 
ATOM   2021 N N   . GLN B 2 44  ? -68.906 54.336 -154.591 1.00 50.35  ? 38  GLN L N   1 
ATOM   2022 C CA  . GLN B 2 44  ? -68.349 54.747 -153.311 1.00 47.95  ? 38  GLN L CA  1 
ATOM   2023 C C   . GLN B 2 44  ? -66.985 54.160 -153.011 1.00 50.09  ? 38  GLN L C   1 
ATOM   2024 O O   . GLN B 2 44  ? -66.819 52.952 -152.876 1.00 55.47  ? 38  GLN L O   1 
ATOM   2025 C CB  . GLN B 2 44  ? -69.299 54.467 -152.156 1.00 49.48  ? 38  GLN L CB  1 
ATOM   2026 C CG  . GLN B 2 44  ? -68.857 55.145 -150.874 1.00 46.13  ? 38  GLN L CG  1 
ATOM   2027 C CD  . GLN B 2 44  ? -69.829 54.909 -149.752 1.00 54.32  ? 38  GLN L CD  1 
ATOM   2028 O OE1 . GLN B 2 44  ? -70.372 53.814 -149.611 1.00 63.46  ? 38  GLN L OE1 1 
ATOM   2029 N NE2 . GLN B 2 44  ? -70.062 55.934 -148.945 1.00 54.79  ? 38  GLN L NE2 1 
ATOM   2030 N N   . LYS B 2 45  ? -66.014 55.050 -152.899 1.00 49.03  ? 39  LYS L N   1 
ATOM   2031 C CA  . LYS B 2 45  ? -64.648 54.689 -152.578 1.00 51.36  ? 39  LYS L CA  1 
ATOM   2032 C C   . LYS B 2 45  ? -64.401 54.888 -151.099 1.00 55.69  ? 39  LYS L C   1 
ATOM   2033 O O   . LYS B 2 45  ? -64.891 55.848 -150.499 1.00 56.70  ? 39  LYS L O   1 
ATOM   2034 C CB  . LYS B 2 45  ? -63.694 55.583 -153.356 1.00 50.01  ? 39  LYS L CB  1 
ATOM   2035 C CG  . LYS B 2 45  ? -63.525 55.202 -154.797 1.00 48.84  ? 39  LYS L CG  1 
ATOM   2036 C CD  . LYS B 2 45  ? -62.900 56.351 -155.528 1.00 56.66  ? 39  LYS L CD  1 
ATOM   2037 C CE  . LYS B 2 45  ? -62.623 55.987 -156.961 1.00 69.19  ? 39  LYS L CE  1 
ATOM   2038 N NZ  . LYS B 2 45  ? -62.212 57.186 -157.723 1.00 77.26  ? 39  LYS L NZ  1 
ATOM   2039 N N   . PRO B 2 46  ? -63.609 53.999 -150.504 1.00 57.55  ? 40  PRO L N   1 
ATOM   2040 C CA  . PRO B 2 46  ? -63.367 54.034 -149.051 1.00 60.23  ? 40  PRO L CA  1 
ATOM   2041 C C   . PRO B 2 46  ? -63.253 55.449 -148.486 1.00 62.70  ? 40  PRO L C   1 
ATOM   2042 O O   . PRO B 2 46  ? -62.448 56.250 -148.963 1.00 64.72  ? 40  PRO L O   1 
ATOM   2043 C CB  . PRO B 2 46  ? -62.035 53.298 -148.905 1.00 58.13  ? 40  PRO L CB  1 
ATOM   2044 C CG  . PRO B 2 46  ? -62.031 52.326 -150.044 1.00 59.51  ? 40  PRO L CG  1 
ATOM   2045 C CD  . PRO B 2 46  ? -62.789 52.990 -151.192 1.00 56.15  ? 40  PRO L CD  1 
ATOM   2046 N N   . GLY B 2 47  ? -64.070 55.757 -147.485 1.00 63.24  ? 41  GLY L N   1 
ATOM   2047 C CA  . GLY B 2 47  ? -63.967 57.033 -146.796 1.00 60.62  ? 41  GLY L CA  1 
ATOM   2048 C C   . GLY B 2 47  ? -64.443 58.222 -147.608 1.00 65.68  ? 41  GLY L C   1 
ATOM   2049 O O   . GLY B 2 47  ? -64.020 59.350 -147.383 1.00 63.60  ? 41  GLY L O   1 
ATOM   2050 N N   . GLN B 2 48  ? -65.331 57.978 -148.562 1.00 66.35  ? 42  GLN L N   1 
ATOM   2051 C CA  . GLN B 2 48  ? -65.865 59.069 -149.356 1.00 60.27  ? 42  GLN L CA  1 
ATOM   2052 C C   . GLN B 2 48  ? -67.365 58.905 -149.489 1.00 53.75  ? 42  GLN L C   1 
ATOM   2053 O O   . GLN B 2 48  ? -67.891 57.813 -149.327 1.00 58.05  ? 42  GLN L O   1 
ATOM   2054 C CB  . GLN B 2 48  ? -65.229 59.092 -150.747 1.00 66.26  ? 42  GLN L CB  1 
ATOM   2055 C CG  . GLN B 2 48  ? -63.728 59.350 -150.788 1.00 66.29  ? 42  GLN L CG  1 
ATOM   2056 C CD  . GLN B 2 48  ? -63.221 59.567 -152.211 1.00 73.08  ? 42  GLN L CD  1 
ATOM   2057 O OE1 . GLN B 2 48  ? -63.997 59.551 -153.172 1.00 75.79  ? 42  GLN L OE1 1 
ATOM   2058 N NE2 . GLN B 2 48  ? -61.914 59.771 -152.352 1.00 76.04  ? 42  GLN L NE2 1 
ATOM   2059 N N   . PRO B 2 49  ? -68.062 60.004 -149.766 1.00 48.09  ? 43  PRO L N   1 
ATOM   2060 C CA  . PRO B 2 49  ? -69.481 59.955 -150.107 1.00 45.78  ? 43  PRO L CA  1 
ATOM   2061 C C   . PRO B 2 49  ? -69.668 59.314 -151.470 1.00 51.46  ? 43  PRO L C   1 
ATOM   2062 O O   . PRO B 2 49  ? -68.753 59.345 -152.291 1.00 54.70  ? 43  PRO L O   1 
ATOM   2063 C CB  . PRO B 2 49  ? -69.858 61.428 -150.206 1.00 47.57  ? 43  PRO L CB  1 
ATOM   2064 C CG  . PRO B 2 49  ? -68.580 62.121 -150.462 1.00 47.61  ? 43  PRO L CG  1 
ATOM   2065 C CD  . PRO B 2 49  ? -67.579 61.389 -149.655 1.00 41.63  ? 43  PRO L CD  1 
ATOM   2066 N N   . PRO B 2 50  ? -70.842 58.726 -151.710 1.00 47.09  ? 44  PRO L N   1 
ATOM   2067 C CA  . PRO B 2 50  ? -71.114 58.140 -153.021 1.00 44.90  ? 44  PRO L CA  1 
ATOM   2068 C C   . PRO B 2 50  ? -70.992 59.216 -154.086 1.00 50.09  ? 44  PRO L C   1 
ATOM   2069 O O   . PRO B 2 50  ? -71.337 60.367 -153.833 1.00 51.89  ? 44  PRO L O   1 
ATOM   2070 C CB  . PRO B 2 50  ? -72.574 57.688 -152.913 1.00 44.79  ? 44  PRO L CB  1 
ATOM   2071 C CG  . PRO B 2 50  ? -72.857 57.610 -151.475 1.00 46.81  ? 44  PRO L CG  1 
ATOM   2072 C CD  . PRO B 2 50  ? -71.979 58.606 -150.789 1.00 41.20  ? 44  PRO L CD  1 
ATOM   2073 N N   . LYS B 2 51  ? -70.491 58.845 -155.257 1.00 56.99  ? 45  LYS L N   1 
ATOM   2074 C CA  . LYS B 2 51  ? -70.455 59.745 -156.404 1.00 59.16  ? 45  LYS L CA  1 
ATOM   2075 C C   . LYS B 2 51  ? -71.451 59.254 -157.452 1.00 57.87  ? 45  LYS L C   1 
ATOM   2076 O O   . LYS B 2 51  ? -71.522 58.052 -157.732 1.00 55.72  ? 45  LYS L O   1 
ATOM   2077 C CB  . LYS B 2 51  ? -69.047 59.804 -157.001 1.00 58.81  ? 45  LYS L CB  1 
ATOM   2078 C CG  . LYS B 2 51  ? -68.921 60.799 -158.144 1.00 67.59  ? 45  LYS L CG  1 
ATOM   2079 C CD  . LYS B 2 51  ? -67.476 61.027 -158.559 1.00 71.05  ? 45  LYS L CD  1 
ATOM   2080 C CE  . LYS B 2 51  ? -67.062 60.077 -159.665 1.00 71.98  ? 45  LYS L CE  1 
ATOM   2081 N NZ  . LYS B 2 51  ? -65.802 60.524 -160.299 1.00 72.14  ? 45  LYS L NZ  1 
ATOM   2082 N N   . LEU B 2 52  ? -72.226 60.174 -158.020 1.00 55.13  ? 46  LEU L N   1 
ATOM   2083 C CA  . LEU B 2 52  ? -73.186 59.808 -159.060 1.00 54.28  ? 46  LEU L CA  1 
ATOM   2084 C C   . LEU B 2 52  ? -72.468 59.477 -160.368 1.00 59.45  ? 46  LEU L C   1 
ATOM   2085 O O   . LEU B 2 52  ? -71.592 60.221 -160.805 1.00 59.28  ? 46  LEU L O   1 
ATOM   2086 C CB  . LEU B 2 52  ? -74.222 60.920 -159.289 1.00 48.58  ? 46  LEU L CB  1 
ATOM   2087 C CG  . LEU B 2 52  ? -75.210 60.668 -160.441 1.00 52.57  ? 46  LEU L CG  1 
ATOM   2088 C CD1 . LEU B 2 52  ? -76.132 59.509 -160.130 1.00 52.06  ? 46  LEU L CD1 1 
ATOM   2089 C CD2 . LEU B 2 52  ? -76.025 61.907 -160.763 1.00 50.74  ? 46  LEU L CD2 1 
ATOM   2090 N N   . LEU B 2 53  ? -72.847 58.356 -160.979 1.00 61.91  ? 47  LEU L N   1 
ATOM   2091 C CA  . LEU B 2 53  ? -72.277 57.917 -162.256 1.00 61.76  ? 47  LEU L CA  1 
ATOM   2092 C C   . LEU B 2 53  ? -73.317 57.995 -163.370 1.00 64.08  ? 47  LEU L C   1 
ATOM   2093 O O   . LEU B 2 53  ? -73.100 58.625 -164.401 1.00 66.22  ? 47  LEU L O   1 
ATOM   2094 C CB  . LEU B 2 53  ? -71.795 56.463 -162.165 1.00 47.74  ? 47  LEU L CB  1 
ATOM   2095 C CG  . LEU B 2 53  ? -70.630 56.103 -161.264 1.00 46.59  ? 47  LEU L CG  1 
ATOM   2096 C CD1 . LEU B 2 53  ? -70.532 54.607 -161.182 1.00 58.74  ? 47  LEU L CD1 1 
ATOM   2097 C CD2 . LEU B 2 53  ? -69.338 56.675 -161.790 1.00 43.51  ? 47  LEU L CD2 1 
ATOM   2098 N N   . ILE B 2 54  ? -74.445 57.330 -163.143 1.00 58.75  ? 48  ILE L N   1 
ATOM   2099 C CA  . ILE B 2 54  ? -75.480 57.162 -164.147 1.00 54.78  ? 48  ILE L CA  1 
ATOM   2100 C C   . ILE B 2 54  ? -76.843 57.569 -163.602 1.00 55.10  ? 48  ILE L C   1 
ATOM   2101 O O   . ILE B 2 54  ? -77.183 57.284 -162.445 1.00 56.88  ? 48  ILE L O   1 
ATOM   2102 C CB  . ILE B 2 54  ? -75.596 55.688 -164.553 1.00 59.86  ? 48  ILE L CB  1 
ATOM   2103 C CG1 . ILE B 2 54  ? -74.225 55.113 -164.942 1.00 55.37  ? 48  ILE L CG1 1 
ATOM   2104 C CG2 . ILE B 2 54  ? -76.632 55.522 -165.669 1.00 64.72  ? 48  ILE L CG2 1 
ATOM   2105 C CD1 . ILE B 2 54  ? -73.772 55.455 -166.327 1.00 49.17  ? 48  ILE L CD1 1 
ATOM   2106 N N   . TYR B 2 55  ? -77.638 58.228 -164.429 1.00 54.57  ? 49  TYR L N   1 
ATOM   2107 C CA  . TYR B 2 55  ? -79.030 58.456 -164.062 1.00 55.03  ? 49  TYR L CA  1 
ATOM   2108 C C   . TYR B 2 55  ? -79.969 58.020 -165.177 1.00 60.32  ? 49  TYR L C   1 
ATOM   2109 O O   . TYR B 2 55  ? -79.563 57.870 -166.334 1.00 58.49  ? 49  TYR L O   1 
ATOM   2110 C CB  . TYR B 2 55  ? -79.276 59.904 -163.661 1.00 50.80  ? 49  TYR L CB  1 
ATOM   2111 C CG  . TYR B 2 55  ? -78.990 60.901 -164.741 1.00 60.17  ? 49  TYR L CG  1 
ATOM   2112 C CD1 . TYR B 2 55  ? -79.985 61.303 -165.618 1.00 68.62  ? 49  TYR L CD1 1 
ATOM   2113 C CD2 . TYR B 2 55  ? -77.726 61.447 -164.885 1.00 68.83  ? 49  TYR L CD2 1 
ATOM   2114 C CE1 . TYR B 2 55  ? -79.732 62.221 -166.606 1.00 77.82  ? 49  TYR L CE1 1 
ATOM   2115 C CE2 . TYR B 2 55  ? -77.460 62.366 -165.872 1.00 76.26  ? 49  TYR L CE2 1 
ATOM   2116 C CZ  . TYR B 2 55  ? -78.465 62.752 -166.731 1.00 81.09  ? 49  TYR L CZ  1 
ATOM   2117 O OH  . TYR B 2 55  ? -78.204 63.671 -167.720 1.00 86.18  ? 49  TYR L OH  1 
ATOM   2118 N N   . TRP B 2 56  ? -81.229 57.808 -164.820 1.00 65.75  ? 50  TRP L N   1 
ATOM   2119 C CA  . TRP B 2 56  ? -82.197 57.285 -165.770 1.00 67.06  ? 50  TRP L CA  1 
ATOM   2120 C C   . TRP B 2 56  ? -81.642 56.047 -166.446 1.00 71.22  ? 50  TRP L C   1 
ATOM   2121 O O   . TRP B 2 56  ? -81.795 55.865 -167.655 1.00 72.63  ? 50  TRP L O   1 
ATOM   2122 C CB  . TRP B 2 56  ? -82.586 58.337 -166.802 1.00 65.77  ? 50  TRP L CB  1 
ATOM   2123 C CG  . TRP B 2 56  ? -83.640 59.274 -166.296 1.00 76.37  ? 50  TRP L CG  1 
ATOM   2124 C CD1 . TRP B 2 56  ? -84.503 59.062 -165.248 1.00 78.93  ? 50  TRP L CD1 1 
ATOM   2125 C CD2 . TRP B 2 56  ? -83.965 60.554 -166.827 1.00 78.28  ? 50  TRP L CD2 1 
ATOM   2126 N NE1 . TRP B 2 56  ? -85.337 60.144 -165.093 1.00 77.30  ? 50  TRP L NE1 1 
ATOM   2127 C CE2 . TRP B 2 56  ? -85.028 61.074 -166.049 1.00 79.89  ? 50  TRP L CE2 1 
ATOM   2128 C CE3 . TRP B 2 56  ? -83.458 61.320 -167.875 1.00 80.90  ? 50  TRP L CE3 1 
ATOM   2129 C CZ2 . TRP B 2 56  ? -85.588 62.317 -166.295 1.00 84.36  ? 50  TRP L CZ2 1 
ATOM   2130 C CZ3 . TRP B 2 56  ? -84.014 62.549 -168.120 1.00 90.11  ? 50  TRP L CZ3 1 
ATOM   2131 C CH2 . TRP B 2 56  ? -85.071 63.041 -167.333 1.00 92.20  ? 50  TRP L CH2 1 
ATOM   2132 N N   . ALA B 2 57  ? -80.984 55.208 -165.648 1.00 68.25  ? 51  ALA L N   1 
ATOM   2133 C CA  . ALA B 2 57  ? -80.560 53.884 -166.084 1.00 66.12  ? 51  ALA L CA  1 
ATOM   2134 C C   . ALA B 2 57  ? -79.352 53.872 -167.008 1.00 60.93  ? 51  ALA L C   1 
ATOM   2135 O O   . ALA B 2 57  ? -78.515 52.971 -166.909 1.00 64.96  ? 51  ALA L O   1 
ATOM   2136 C CB  . ALA B 2 57  ? -81.720 53.135 -166.736 1.00 71.41  ? 51  ALA L CB  1 
ATOM   2137 N N   . SER B 2 58  ? -79.259 54.854 -167.900 1.00 50.68  ? 52  SER L N   1 
ATOM   2138 C CA  . SER B 2 58  ? -78.246 54.783 -168.946 1.00 58.53  ? 52  SER L CA  1 
ATOM   2139 C C   . SER B 2 58  ? -77.546 56.086 -169.342 1.00 65.17  ? 52  SER L C   1 
ATOM   2140 O O   . SER B 2 58  ? -76.712 56.068 -170.237 1.00 70.98  ? 52  SER L O   1 
ATOM   2141 C CB  . SER B 2 58  ? -78.803 54.089 -170.199 1.00 65.81  ? 52  SER L CB  1 
ATOM   2142 O OG  . SER B 2 58  ? -79.941 54.764 -170.729 1.00 72.74  ? 52  SER L OG  1 
ATOM   2143 N N   . THR B 2 59  ? -77.852 57.205 -168.696 1.00 60.33  ? 53  THR L N   1 
ATOM   2144 C CA  . THR B 2 59  ? -77.151 58.449 -169.027 1.00 63.99  ? 53  THR L CA  1 
ATOM   2145 C C   . THR B 2 59  ? -75.956 58.693 -168.098 1.00 70.24  ? 53  THR L C   1 
ATOM   2146 O O   . THR B 2 59  ? -76.114 58.710 -166.876 1.00 73.98  ? 53  THR L O   1 
ATOM   2147 C CB  . THR B 2 59  ? -78.090 59.673 -168.954 1.00 68.00  ? 53  THR L CB  1 
ATOM   2148 O OG1 . THR B 2 59  ? -79.164 59.528 -169.895 1.00 73.34  ? 53  THR L OG1 1 
ATOM   2149 C CG2 . THR B 2 59  ? -77.326 60.949 -169.254 1.00 62.38  ? 53  THR L CG2 1 
ATOM   2150 N N   . ARG B 2 60  ? -74.766 58.886 -168.669 1.00 72.08  ? 54  ARG L N   1 
ATOM   2151 C CA  . ARG B 2 60  ? -73.585 59.239 -167.876 1.00 67.48  ? 54  ARG L CA  1 
ATOM   2152 C C   . ARG B 2 60  ? -73.693 60.658 -167.316 1.00 68.08  ? 54  ARG L C   1 
ATOM   2153 O O   . ARG B 2 60  ? -74.078 61.594 -168.026 1.00 69.69  ? 54  ARG L O   1 
ATOM   2154 C CB  . ARG B 2 60  ? -72.302 59.140 -168.710 1.00 67.19  ? 54  ARG L CB  1 
ATOM   2155 C CG  . ARG B 2 60  ? -71.671 57.762 -168.813 1.00 69.36  ? 54  ARG L CG  1 
ATOM   2156 C CD  . ARG B 2 60  ? -70.461 57.770 -169.770 1.00 81.03  ? 54  ARG L CD  1 
ATOM   2157 N NE  . ARG B 2 60  ? -70.855 57.900 -171.172 1.00 92.25  ? 54  ARG L NE  1 
ATOM   2158 C CZ  . ARG B 2 60  ? -71.310 56.891 -171.915 1.00 103.69 ? 54  ARG L CZ  1 
ATOM   2159 N NH1 . ARG B 2 60  ? -71.422 55.679 -171.385 1.00 104.61 ? 54  ARG L NH1 1 
ATOM   2160 N NH2 . ARG B 2 60  ? -71.660 57.086 -173.185 1.00 107.04 ? 54  ARG L NH2 1 
ATOM   2161 N N   . GLU B 2 61  ? -73.361 60.818 -166.039 1.00 63.52  ? 55  GLU L N   1 
ATOM   2162 C CA  . GLU B 2 61  ? -73.188 62.150 -165.483 1.00 62.75  ? 55  GLU L CA  1 
ATOM   2163 C C   . GLU B 2 61  ? -72.053 62.902 -166.167 1.00 65.64  ? 55  GLU L C   1 
ATOM   2164 O O   . GLU B 2 61  ? -71.088 62.311 -166.661 1.00 64.10  ? 55  GLU L O   1 
ATOM   2165 C CB  . GLU B 2 61  ? -72.923 62.089 -163.984 1.00 64.33  ? 55  GLU L CB  1 
ATOM   2166 C CG  . GLU B 2 61  ? -74.053 62.684 -163.156 1.00 81.15  ? 55  GLU L CG  1 
ATOM   2167 C CD  . GLU B 2 61  ? -74.113 64.201 -163.234 1.00 89.83  ? 55  GLU L CD  1 
ATOM   2168 O OE1 . GLU B 2 61  ? -75.228 64.765 -163.340 1.00 89.16  ? 55  GLU L OE1 1 
ATOM   2169 O OE2 . GLU B 2 61  ? -73.039 64.830 -163.188 1.00 96.05  ? 55  GLU L OE2 1 
ATOM   2170 N N   . SER B 2 62  ? -72.171 64.220 -166.179 1.00 70.68  ? 56  SER L N   1 
ATOM   2171 C CA  . SER B 2 62  ? -71.105 65.070 -166.684 1.00 79.45  ? 56  SER L CA  1 
ATOM   2172 C C   . SER B 2 62  ? -69.763 64.708 -166.029 1.00 75.54  ? 56  SER L C   1 
ATOM   2173 O O   . SER B 2 62  ? -69.621 64.750 -164.808 1.00 75.50  ? 56  SER L O   1 
ATOM   2174 C CB  . SER B 2 62  ? -71.453 66.541 -166.419 1.00 85.18  ? 56  SER L CB  1 
ATOM   2175 O OG  . SER B 2 62  ? -70.520 67.416 -167.026 1.00 93.86  ? 56  SER L OG  1 
ATOM   2176 N N   . GLY B 2 63  ? -68.784 64.343 -166.840 1.00 73.18  ? 57  GLY L N   1 
ATOM   2177 C CA  . GLY B 2 63  ? -67.447 64.133 -166.325 1.00 78.07  ? 57  GLY L CA  1 
ATOM   2178 C C   . GLY B 2 63  ? -67.117 62.692 -165.992 1.00 78.64  ? 57  GLY L C   1 
ATOM   2179 O O   . GLY B 2 63  ? -65.982 62.375 -165.657 1.00 83.70  ? 57  GLY L O   1 
ATOM   2180 N N   . VAL B 2 64  ? -68.103 61.813 -166.087 1.00 71.96  ? 58  VAL L N   1 
ATOM   2181 C CA  . VAL B 2 64  ? -67.862 60.396 -165.873 1.00 67.72  ? 58  VAL L CA  1 
ATOM   2182 C C   . VAL B 2 64  ? -67.318 59.737 -167.134 1.00 71.07  ? 58  VAL L C   1 
ATOM   2183 O O   . VAL B 2 64  ? -67.971 59.758 -168.171 1.00 75.73  ? 58  VAL L O   1 
ATOM   2184 C CB  . VAL B 2 64  ? -69.154 59.700 -165.487 1.00 65.25  ? 58  VAL L CB  1 
ATOM   2185 C CG1 . VAL B 2 64  ? -68.931 58.195 -165.386 1.00 66.09  ? 58  VAL L CG1 1 
ATOM   2186 C CG2 . VAL B 2 64  ? -69.680 60.286 -164.184 1.00 59.95  ? 58  VAL L CG2 1 
ATOM   2187 N N   . PRO B 2 65  ? -66.118 59.141 -167.049 1.00 74.39  ? 59  PRO L N   1 
ATOM   2188 C CA  . PRO B 2 65  ? -65.425 58.531 -168.200 1.00 70.23  ? 59  PRO L CA  1 
ATOM   2189 C C   . PRO B 2 65  ? -66.295 57.500 -168.918 1.00 75.02  ? 59  PRO L C   1 
ATOM   2190 O O   . PRO B 2 65  ? -67.038 56.759 -168.274 1.00 77.30  ? 59  PRO L O   1 
ATOM   2191 C CB  . PRO B 2 65  ? -64.202 57.858 -167.556 1.00 61.01  ? 59  PRO L CB  1 
ATOM   2192 C CG  . PRO B 2 65  ? -64.538 57.749 -166.124 1.00 64.52  ? 59  PRO L CG  1 
ATOM   2193 C CD  . PRO B 2 65  ? -65.332 58.988 -165.817 1.00 69.36  ? 59  PRO L CD  1 
ATOM   2194 N N   . ASP B 2 66  ? -66.192 57.442 -170.239 1.00 81.24  ? 60  ASP L N   1 
ATOM   2195 C CA  . ASP B 2 66  ? -67.168 56.698 -171.035 1.00 85.99  ? 60  ASP L CA  1 
ATOM   2196 C C   . ASP B 2 66  ? -67.078 55.180 -170.916 1.00 80.27  ? 60  ASP L C   1 
ATOM   2197 O O   . ASP B 2 66  ? -67.888 54.468 -171.505 1.00 78.17  ? 60  ASP L O   1 
ATOM   2198 C CB  . ASP B 2 66  ? -67.131 57.130 -172.502 1.00 96.95  ? 60  ASP L CB  1 
ATOM   2199 C CG  . ASP B 2 66  ? -65.775 57.650 -172.922 1.00 108.17 ? 60  ASP L CG  1 
ATOM   2200 O OD1 . ASP B 2 66  ? -65.166 58.427 -172.148 1.00 111.43 ? 60  ASP L OD1 1 
ATOM   2201 O OD2 . ASP B 2 66  ? -65.321 57.292 -174.033 1.00 111.61 ? 60  ASP L OD2 1 
ATOM   2202 N N   . ARG B 2 67  ? -66.112 54.687 -170.145 1.00 76.67  ? 61  ARG L N   1 
ATOM   2203 C CA  . ARG B 2 67  ? -65.995 53.251 -169.916 1.00 68.24  ? 61  ARG L CA  1 
ATOM   2204 C C   . ARG B 2 67  ? -67.111 52.789 -168.996 1.00 66.38  ? 61  ARG L C   1 
ATOM   2205 O O   . ARG B 2 67  ? -67.384 51.593 -168.884 1.00 68.93  ? 61  ARG L O   1 
ATOM   2206 C CB  . ARG B 2 67  ? -64.617 52.880 -169.356 1.00 72.01  ? 61  ARG L CB  1 
ATOM   2207 C CG  . ARG B 2 67  ? -64.290 53.437 -167.976 1.00 73.10  ? 61  ARG L CG  1 
ATOM   2208 C CD  . ARG B 2 67  ? -62.818 53.189 -167.647 1.00 73.62  ? 61  ARG L CD  1 
ATOM   2209 N NE  . ARG B 2 67  ? -62.417 53.773 -166.372 1.00 72.58  ? 61  ARG L NE  1 
ATOM   2210 C CZ  . ARG B 2 67  ? -61.821 54.954 -166.245 1.00 77.27  ? 61  ARG L CZ  1 
ATOM   2211 N NH1 . ARG B 2 67  ? -61.554 55.681 -167.320 1.00 75.38  ? 61  ARG L NH1 1 
ATOM   2212 N NH2 . ARG B 2 67  ? -61.495 55.412 -165.041 1.00 80.56  ? 61  ARG L NH2 1 
ATOM   2213 N N   . PHE B 2 68  ? -67.751 53.754 -168.344 1.00 65.34  ? 62  PHE L N   1 
ATOM   2214 C CA  . PHE B 2 68  ? -68.898 53.487 -167.480 1.00 69.69  ? 62  PHE L CA  1 
ATOM   2215 C C   . PHE B 2 68  ? -70.182 53.611 -168.277 1.00 74.19  ? 62  PHE L C   1 
ATOM   2216 O O   . PHE B 2 68  ? -70.407 54.617 -168.946 1.00 79.21  ? 62  PHE L O   1 
ATOM   2217 C CB  . PHE B 2 68  ? -68.953 54.490 -166.327 1.00 65.33  ? 62  PHE L CB  1 
ATOM   2218 C CG  . PHE B 2 68  ? -67.872 54.305 -165.305 1.00 62.46  ? 62  PHE L CG  1 
ATOM   2219 C CD1 . PHE B 2 68  ? -66.699 55.038 -165.379 1.00 62.86  ? 62  PHE L CD1 1 
ATOM   2220 C CD2 . PHE B 2 68  ? -68.037 53.402 -164.256 1.00 57.03  ? 62  PHE L CD2 1 
ATOM   2221 C CE1 . PHE B 2 68  ? -65.704 54.864 -164.430 1.00 64.56  ? 62  PHE L CE1 1 
ATOM   2222 C CE2 . PHE B 2 68  ? -67.057 53.231 -163.308 1.00 54.12  ? 62  PHE L CE2 1 
ATOM   2223 C CZ  . PHE B 2 68  ? -65.887 53.960 -163.393 1.00 58.41  ? 62  PHE L CZ  1 
ATOM   2224 N N   . SER B 2 69  ? -71.034 52.600 -168.204 1.00 70.11  ? 63  SER L N   1 
ATOM   2225 C CA  . SER B 2 69  ? -72.304 52.672 -168.904 1.00 69.27  ? 63  SER L CA  1 
ATOM   2226 C C   . SER B 2 69  ? -73.354 51.775 -168.269 1.00 70.76  ? 63  SER L C   1 
ATOM   2227 O O   . SER B 2 69  ? -73.060 50.671 -167.811 1.00 72.50  ? 63  SER L O   1 
ATOM   2228 C CB  . SER B 2 69  ? -72.131 52.327 -170.386 1.00 70.01  ? 63  SER L CB  1 
ATOM   2229 O OG  . SER B 2 69  ? -72.145 50.926 -170.582 1.00 69.04  ? 63  SER L OG  1 
ATOM   2230 N N   . GLY B 2 70  ? -74.587 52.263 -168.251 1.00 73.36  ? 64  GLY L N   1 
ATOM   2231 C CA  . GLY B 2 70  ? -75.677 51.524 -167.653 1.00 71.81  ? 64  GLY L CA  1 
ATOM   2232 C C   . GLY B 2 70  ? -76.689 51.136 -168.699 1.00 71.11  ? 64  GLY L C   1 
ATOM   2233 O O   . GLY B 2 70  ? -76.959 51.893 -169.620 1.00 76.14  ? 64  GLY L O   1 
ATOM   2234 N N   . SER B 2 71  ? -77.250 49.948 -168.564 1.00 66.45  ? 65  SER L N   1 
ATOM   2235 C CA  . SER B 2 71  ? -78.336 49.558 -169.437 1.00 68.10  ? 65  SER L CA  1 
ATOM   2236 C C   . SER B 2 71  ? -79.517 49.039 -168.634 1.00 69.61  ? 65  SER L C   1 
ATOM   2237 O O   . SER B 2 71  ? -79.441 48.873 -167.409 1.00 69.42  ? 65  SER L O   1 
ATOM   2238 C CB  . SER B 2 71  ? -77.881 48.474 -170.405 1.00 71.05  ? 65  SER L CB  1 
ATOM   2239 O OG  . SER B 2 71  ? -77.935 47.204 -169.777 1.00 80.10  ? 65  SER L OG  1 
ATOM   2240 N N   . GLY B 2 72  ? -80.610 48.786 -169.344 1.00 74.52  ? 66  GLY L N   1 
ATOM   2241 C CA  . GLY B 2 72  ? -81.752 48.105 -168.776 1.00 74.70  ? 66  GLY L CA  1 
ATOM   2242 C C   . GLY B 2 72  ? -82.996 48.950 -168.778 1.00 79.33  ? 66  GLY L C   1 
ATOM   2243 O O   . GLY B 2 72  ? -82.985 50.118 -169.183 1.00 77.80  ? 66  GLY L O   1 
ATOM   2244 N N   . SER B 2 73  ? -84.078 48.348 -168.301 1.00 85.81  ? 67  SER L N   1 
ATOM   2245 C CA  . SER B 2 73  ? -85.375 48.995 -168.310 1.00 82.52  ? 67  SER L CA  1 
ATOM   2246 C C   . SER B 2 73  ? -86.333 48.231 -167.412 1.00 77.35  ? 67  SER L C   1 
ATOM   2247 O O   . SER B 2 73  ? -86.293 46.993 -167.344 1.00 73.69  ? 67  SER L O   1 
ATOM   2248 C CB  . SER B 2 73  ? -85.923 49.034 -169.734 1.00 83.37  ? 67  SER L CB  1 
ATOM   2249 O OG  . SER B 2 73  ? -86.894 50.051 -169.857 1.00 93.82  ? 67  SER L OG  1 
ATOM   2250 N N   . GLY B 2 74  ? -87.190 48.975 -166.718 1.00 73.60  ? 68  GLY L N   1 
ATOM   2251 C CA  . GLY B 2 74  ? -88.218 48.373 -165.890 1.00 68.14  ? 68  GLY L CA  1 
ATOM   2252 C C   . GLY B 2 74  ? -87.669 47.752 -164.627 1.00 69.05  ? 68  GLY L C   1 
ATOM   2253 O O   . GLY B 2 74  ? -87.522 48.440 -163.627 1.00 67.86  ? 68  GLY L O   1 
ATOM   2254 N N   . THR B 2 75  ? -87.348 46.459 -164.671 1.00 75.45  ? 69  THR L N   1 
ATOM   2255 C CA  . THR B 2 75  ? -86.940 45.738 -163.463 1.00 79.69  ? 69  THR L CA  1 
ATOM   2256 C C   . THR B 2 75  ? -85.460 45.329 -163.395 1.00 77.43  ? 69  THR L C   1 
ATOM   2257 O O   . THR B 2 75  ? -84.881 45.255 -162.307 1.00 74.92  ? 69  THR L O   1 
ATOM   2258 C CB  . THR B 2 75  ? -87.835 44.500 -163.225 1.00 87.17  ? 69  THR L CB  1 
ATOM   2259 O OG1 . THR B 2 75  ? -89.096 44.935 -162.708 1.00 90.44  ? 69  THR L OG1 1 
ATOM   2260 C CG2 . THR B 2 75  ? -87.206 43.557 -162.211 1.00 90.31  ? 69  THR L CG2 1 
ATOM   2261 N N   . ASP B 2 76  ? -84.859 45.055 -164.547 1.00 79.65  ? 70  ASP L N   1 
ATOM   2262 C CA  . ASP B 2 76  ? -83.488 44.558 -164.587 1.00 83.22  ? 70  ASP L CA  1 
ATOM   2263 C C   . ASP B 2 76  ? -82.542 45.578 -165.196 1.00 82.13  ? 70  ASP L C   1 
ATOM   2264 O O   . ASP B 2 76  ? -82.818 46.142 -166.253 1.00 86.32  ? 70  ASP L O   1 
ATOM   2265 C CB  . ASP B 2 76  ? -83.397 43.247 -165.366 1.00 87.67  ? 70  ASP L CB  1 
ATOM   2266 C CG  . ASP B 2 76  ? -83.947 42.062 -164.590 1.00 99.30  ? 70  ASP L CG  1 
ATOM   2267 O OD1 . ASP B 2 76  ? -84.690 42.266 -163.609 1.00 99.11  ? 70  ASP L OD1 1 
ATOM   2268 O OD2 . ASP B 2 76  ? -83.634 40.914 -164.969 1.00 110.46 ? 70  ASP L OD2 1 
ATOM   2269 N N   . PHE B 2 77  ? -81.425 45.811 -164.519 1.00 72.04  ? 71  PHE L N   1 
ATOM   2270 C CA  . PHE B 2 77  ? -80.445 46.767 -164.988 1.00 66.50  ? 71  PHE L CA  1 
ATOM   2271 C C   . PHE B 2 77  ? -79.068 46.204 -164.748 1.00 65.89  ? 71  PHE L C   1 
ATOM   2272 O O   . PHE B 2 77  ? -78.898 45.262 -163.979 1.00 67.79  ? 71  PHE L O   1 
ATOM   2273 C CB  . PHE B 2 77  ? -80.615 48.090 -164.252 1.00 64.72  ? 71  PHE L CB  1 
ATOM   2274 C CG  . PHE B 2 77  ? -82.029 48.561 -164.215 1.00 63.71  ? 71  PHE L CG  1 
ATOM   2275 C CD1 . PHE B 2 77  ? -82.540 49.341 -165.244 1.00 60.57  ? 71  PHE L CD1 1 
ATOM   2276 C CD2 . PHE B 2 77  ? -82.863 48.197 -163.177 1.00 64.31  ? 71  PHE L CD2 1 
ATOM   2277 C CE1 . PHE B 2 77  ? -83.850 49.763 -165.226 1.00 56.79  ? 71  PHE L CE1 1 
ATOM   2278 C CE2 . PHE B 2 77  ? -84.188 48.620 -163.157 1.00 64.23  ? 71  PHE L CE2 1 
ATOM   2279 C CZ  . PHE B 2 77  ? -84.679 49.403 -164.187 1.00 54.89  ? 71  PHE L CZ  1 
ATOM   2280 N N   . THR B 2 78  ? -78.085 46.765 -165.432 1.00 64.99  ? 72  THR L N   1 
ATOM   2281 C CA  . THR B 2 78  ? -76.707 46.387 -165.195 1.00 65.08  ? 72  THR L CA  1 
ATOM   2282 C C   . THR B 2 78  ? -75.851 47.617 -165.328 1.00 61.38  ? 72  THR L C   1 
ATOM   2283 O O   . THR B 2 78  ? -76.113 48.476 -166.174 1.00 65.05  ? 72  THR L O   1 
ATOM   2284 C CB  . THR B 2 78  ? -76.192 45.357 -166.224 1.00 66.25  ? 72  THR L CB  1 
ATOM   2285 O OG1 . THR B 2 78  ? -75.889 46.026 -167.455 1.00 66.19  ? 72  THR L OG1 1 
ATOM   2286 C CG2 . THR B 2 78  ? -77.224 44.265 -166.455 1.00 61.82  ? 72  THR L CG2 1 
ATOM   2287 N N   . LEU B 2 79  ? -74.838 47.707 -164.480 1.00 54.89  ? 73  LEU L N   1 
ATOM   2288 C CA  . LEU B 2 79  ? -73.760 48.643 -164.713 1.00 58.76  ? 73  LEU L CA  1 
ATOM   2289 C C   . LEU B 2 79  ? -72.599 47.861 -165.345 1.00 68.20  ? 73  LEU L C   1 
ATOM   2290 O O   . LEU B 2 79  ? -72.264 46.761 -164.900 1.00 69.68  ? 73  LEU L O   1 
ATOM   2291 C CB  . LEU B 2 79  ? -73.336 49.282 -163.402 1.00 54.69  ? 73  LEU L CB  1 
ATOM   2292 C CG  . LEU B 2 79  ? -72.190 50.290 -163.469 1.00 57.23  ? 73  LEU L CG  1 
ATOM   2293 C CD1 . LEU B 2 79  ? -72.584 51.472 -164.335 1.00 62.28  ? 73  LEU L CD1 1 
ATOM   2294 C CD2 . LEU B 2 79  ? -71.834 50.742 -162.067 1.00 53.61  ? 73  LEU L CD2 1 
ATOM   2295 N N   . THR B 2 80  ? -72.006 48.383 -166.410 1.00 66.80  ? 74  THR L N   1 
ATOM   2296 C CA  . THR B 2 80  ? -70.803 47.741 -166.910 1.00 64.14  ? 74  THR L CA  1 
ATOM   2297 C C   . THR B 2 80  ? -69.685 48.748 -167.080 1.00 69.52  ? 74  THR L C   1 
ATOM   2298 O O   . THR B 2 80  ? -69.892 49.868 -167.541 1.00 73.78  ? 74  THR L O   1 
ATOM   2299 C CB  . THR B 2 80  ? -71.023 46.956 -168.218 1.00 66.32  ? 74  THR L CB  1 
ATOM   2300 O OG1 . THR B 2 80  ? -70.402 47.647 -169.309 1.00 65.74  ? 74  THR L OG1 1 
ATOM   2301 C CG2 . THR B 2 80  ? -72.515 46.760 -168.479 1.00 70.87  ? 74  THR L CG2 1 
ATOM   2302 N N   . ILE B 2 81  ? -68.501 48.332 -166.657 1.00 72.43  ? 75  ILE L N   1 
ATOM   2303 C CA  . ILE B 2 81  ? -67.287 49.090 -166.841 1.00 73.22  ? 75  ILE L CA  1 
ATOM   2304 C C   . ILE B 2 81  ? -66.512 48.298 -167.868 1.00 72.67  ? 75  ILE L C   1 
ATOM   2305 O O   . ILE B 2 81  ? -66.067 47.186 -167.585 1.00 72.47  ? 75  ILE L O   1 
ATOM   2306 C CB  . ILE B 2 81  ? -66.503 49.165 -165.524 1.00 69.32  ? 75  ILE L CB  1 
ATOM   2307 C CG1 . ILE B 2 81  ? -67.453 49.556 -164.386 1.00 62.96  ? 75  ILE L CG1 1 
ATOM   2308 C CG2 . ILE B 2 81  ? -65.354 50.151 -165.646 1.00 73.08  ? 75  ILE L CG2 1 
ATOM   2309 C CD1 . ILE B 2 81  ? -66.785 49.777 -163.055 1.00 60.99  ? 75  ILE L CD1 1 
ATOM   2310 N N   . SER B 2 82  ? -66.388 48.844 -169.071 1.00 72.88  ? 76  SER L N   1 
ATOM   2311 C CA  . SER B 2 82  ? -65.833 48.072 -170.173 1.00 80.03  ? 76  SER L CA  1 
ATOM   2312 C C   . SER B 2 82  ? -64.366 47.704 -169.940 1.00 93.25  ? 76  SER L C   1 
ATOM   2313 O O   . SER B 2 82  ? -63.998 46.537 -170.053 1.00 100.87 ? 76  SER L O   1 
ATOM   2314 C CB  . SER B 2 82  ? -66.007 48.806 -171.496 1.00 78.37  ? 76  SER L CB  1 
ATOM   2315 O OG  . SER B 2 82  ? -65.472 50.110 -171.411 1.00 85.09  ? 76  SER L OG  1 
ATOM   2316 N N   . SER B 2 83  ? -63.526 48.683 -169.615 1.00 90.08  ? 77  SER L N   1 
ATOM   2317 C CA  . SER B 2 83  ? -62.147 48.359 -169.255 1.00 84.34  ? 77  SER L CA  1 
ATOM   2318 C C   . SER B 2 83  ? -61.797 48.870 -167.855 1.00 76.93  ? 77  SER L C   1 
ATOM   2319 O O   . SER B 2 83  ? -61.538 50.053 -167.644 1.00 80.19  ? 77  SER L O   1 
ATOM   2320 C CB  . SER B 2 83  ? -61.145 48.834 -170.319 1.00 82.46  ? 77  SER L CB  1 
ATOM   2321 O OG  . SER B 2 83  ? -60.683 50.149 -170.070 1.00 82.48  ? 77  SER L OG  1 
ATOM   2322 N N   . LEU B 2 84  ? -61.804 47.950 -166.902 1.00 65.63  ? 78  LEU L N   1 
ATOM   2323 C CA  . LEU B 2 84  ? -61.548 48.275 -165.510 1.00 65.00  ? 78  LEU L CA  1 
ATOM   2324 C C   . LEU B 2 84  ? -60.164 48.873 -165.261 1.00 69.35  ? 78  LEU L C   1 
ATOM   2325 O O   . LEU B 2 84  ? -59.159 48.346 -165.730 1.00 71.40  ? 78  LEU L O   1 
ATOM   2326 C CB  . LEU B 2 84  ? -61.711 47.020 -164.661 1.00 60.11  ? 78  LEU L CB  1 
ATOM   2327 C CG  . LEU B 2 84  ? -61.984 47.258 -163.184 1.00 58.47  ? 78  LEU L CG  1 
ATOM   2328 C CD1 . LEU B 2 84  ? -63.310 48.003 -163.007 1.00 59.65  ? 78  LEU L CD1 1 
ATOM   2329 C CD2 . LEU B 2 84  ? -62.009 45.918 -162.483 1.00 58.55  ? 78  LEU L CD2 1 
ATOM   2330 N N   . GLN B 2 85  ? -60.122 49.966 -164.502 1.00 67.22  ? 79  GLN L N   1 
ATOM   2331 C CA  . GLN B 2 85  ? -58.862 50.581 -164.111 1.00 61.56  ? 79  GLN L CA  1 
ATOM   2332 C C   . GLN B 2 85  ? -58.636 50.395 -162.621 1.00 63.04  ? 79  GLN L C   1 
ATOM   2333 O O   . GLN B 2 85  ? -59.592 50.213 -161.853 1.00 60.10  ? 79  GLN L O   1 
ATOM   2334 C CB  . GLN B 2 85  ? -58.871 52.067 -164.418 1.00 62.54  ? 79  GLN L CB  1 
ATOM   2335 C CG  . GLN B 2 85  ? -59.503 52.425 -165.730 1.00 74.72  ? 79  GLN L CG  1 
ATOM   2336 C CD  . GLN B 2 85  ? -58.535 52.343 -166.872 1.00 90.47  ? 79  GLN L CD  1 
ATOM   2337 O OE1 . GLN B 2 85  ? -58.039 51.266 -167.206 1.00 95.10  ? 79  GLN L OE1 1 
ATOM   2338 N NE2 . GLN B 2 85  ? -58.261 53.486 -167.493 1.00 100.02 ? 79  GLN L NE2 1 
ATOM   2339 N N   . ALA B 2 86  ? -57.369 50.464 -162.215 1.00 60.13  ? 80  ALA L N   1 
ATOM   2340 C CA  . ALA B 2 86  ? -57.003 50.269 -160.820 1.00 55.43  ? 80  ALA L CA  1 
ATOM   2341 C C   . ALA B 2 86  ? -57.814 51.169 -159.888 1.00 55.27  ? 80  ALA L C   1 
ATOM   2342 O O   . ALA B 2 86  ? -58.123 50.780 -158.764 1.00 59.62  ? 80  ALA L O   1 
ATOM   2343 C CB  . ALA B 2 86  ? -55.513 50.497 -160.611 1.00 55.65  ? 80  ALA L CB  1 
ATOM   2344 N N   . GLU B 2 87  ? -58.137 52.367 -160.362 1.00 56.59  ? 81  GLU L N   1 
ATOM   2345 C CA  . GLU B 2 87  ? -58.828 53.373 -159.562 1.00 56.83  ? 81  GLU L CA  1 
ATOM   2346 C C   . GLU B 2 87  ? -60.326 53.190 -159.595 1.00 56.09  ? 81  GLU L C   1 
ATOM   2347 O O   . GLU B 2 87  ? -61.047 53.967 -158.996 1.00 63.76  ? 81  GLU L O   1 
ATOM   2348 C CB  . GLU B 2 87  ? -58.505 54.795 -160.035 1.00 66.51  ? 81  GLU L CB  1 
ATOM   2349 C CG  . GLU B 2 87  ? -58.709 55.039 -161.536 1.00 79.96  ? 81  GLU L CG  1 
ATOM   2350 C CD  . GLU B 2 87  ? -57.426 54.817 -162.351 1.00 97.21  ? 81  GLU L CD  1 
ATOM   2351 O OE1 . GLU B 2 87  ? -56.523 54.070 -161.894 1.00 97.53  ? 81  GLU L OE1 1 
ATOM   2352 O OE2 . GLU B 2 87  ? -57.315 55.397 -163.455 1.00 106.00 ? 81  GLU L OE2 1 
ATOM   2353 N N   . ASP B 2 88  ? -60.809 52.172 -160.288 1.00 55.50  ? 82  ASP L N   1 
ATOM   2354 C CA  . ASP B 2 88  ? -62.252 51.970 -160.332 1.00 60.11  ? 82  ASP L CA  1 
ATOM   2355 C C   . ASP B 2 88  ? -62.717 51.035 -159.224 1.00 57.60  ? 82  ASP L C   1 
ATOM   2356 O O   . ASP B 2 88  ? -63.878 50.642 -159.181 1.00 62.56  ? 82  ASP L O   1 
ATOM   2357 C CB  . ASP B 2 88  ? -62.698 51.467 -161.713 1.00 63.03  ? 82  ASP L CB  1 
ATOM   2358 C CG  . ASP B 2 88  ? -62.452 52.492 -162.813 1.00 69.69  ? 82  ASP L CG  1 
ATOM   2359 O OD1 . ASP B 2 88  ? -62.345 52.094 -163.992 1.00 71.09  ? 82  ASP L OD1 1 
ATOM   2360 O OD2 . ASP B 2 88  ? -62.368 53.699 -162.501 1.00 72.94  ? 82  ASP L OD2 1 
ATOM   2361 N N   . VAL B 2 89  ? -61.810 50.669 -158.326 1.00 57.48  ? 83  VAL L N   1 
ATOM   2362 C CA  . VAL B 2 89  ? -62.195 49.765 -157.252 1.00 53.93  ? 83  VAL L CA  1 
ATOM   2363 C C   . VAL B 2 89  ? -63.009 50.542 -156.248 1.00 51.31  ? 83  VAL L C   1 
ATOM   2364 O O   . VAL B 2 89  ? -62.587 51.593 -155.765 1.00 58.11  ? 83  VAL L O   1 
ATOM   2365 C CB  . VAL B 2 89  ? -60.993 49.073 -156.566 1.00 51.99  ? 83  VAL L CB  1 
ATOM   2366 C CG1 . VAL B 2 89  ? -60.314 48.119 -157.527 1.00 54.97  ? 83  VAL L CG1 1 
ATOM   2367 C CG2 . VAL B 2 89  ? -60.020 50.084 -156.033 1.00 47.62  ? 83  VAL L CG2 1 
ATOM   2368 N N   . ALA B 2 90  ? -64.198 50.039 -155.959 1.00 47.75  ? 84  ALA L N   1 
ATOM   2369 C CA  . ALA B 2 90  ? -65.112 50.752 -155.087 1.00 44.18  ? 84  ALA L CA  1 
ATOM   2370 C C   . ALA B 2 90  ? -66.284 49.864 -154.798 1.00 49.53  ? 84  ALA L C   1 
ATOM   2371 O O   . ALA B 2 90  ? -66.348 48.732 -155.286 1.00 54.34  ? 84  ALA L O   1 
ATOM   2372 C CB  . ALA B 2 90  ? -65.586 52.024 -155.765 1.00 43.19  ? 84  ALA L CB  1 
ATOM   2373 N N   . VAL B 2 91  ? -67.217 50.376 -154.007 1.00 46.71  ? 85  VAL L N   1 
ATOM   2374 C CA  . VAL B 2 91  ? -68.505 49.729 -153.872 1.00 45.74  ? 85  VAL L CA  1 
ATOM   2375 C C   . VAL B 2 91  ? -69.459 50.472 -154.768 1.00 49.28  ? 85  VAL L C   1 
ATOM   2376 O O   . VAL B 2 91  ? -69.491 51.700 -154.755 1.00 49.77  ? 85  VAL L O   1 
ATOM   2377 C CB  . VAL B 2 91  ? -69.015 49.791 -152.446 1.00 46.92  ? 85  VAL L CB  1 
ATOM   2378 C CG1 . VAL B 2 91  ? -70.419 49.203 -152.364 1.00 46.26  ? 85  VAL L CG1 1 
ATOM   2379 C CG2 . VAL B 2 91  ? -68.059 49.056 -151.541 1.00 35.31  ? 85  VAL L CG2 1 
ATOM   2380 N N   . TYR B 2 92  ? -70.223 49.728 -155.557 1.00 50.98  ? 86  TYR L N   1 
ATOM   2381 C CA  . TYR B 2 92  ? -71.173 50.327 -156.491 1.00 51.26  ? 86  TYR L CA  1 
ATOM   2382 C C   . TYR B 2 92  ? -72.592 50.110 -156.010 1.00 48.82  ? 86  TYR L C   1 
ATOM   2383 O O   . TYR B 2 92  ? -72.961 49.001 -155.644 1.00 50.41  ? 86  TYR L O   1 
ATOM   2384 C CB  . TYR B 2 92  ? -70.960 49.781 -157.919 1.00 49.59  ? 86  TYR L CB  1 
ATOM   2385 C CG  . TYR B 2 92  ? -69.691 50.317 -158.534 1.00 47.65  ? 86  TYR L CG  1 
ATOM   2386 C CD1 . TYR B 2 92  ? -69.702 51.472 -159.309 1.00 46.91  ? 86  TYR L CD1 1 
ATOM   2387 C CD2 . TYR B 2 92  ? -68.472 49.698 -158.293 1.00 48.03  ? 86  TYR L CD2 1 
ATOM   2388 C CE1 . TYR B 2 92  ? -68.538 51.981 -159.845 1.00 47.47  ? 86  TYR L CE1 1 
ATOM   2389 C CE2 . TYR B 2 92  ? -67.305 50.197 -158.824 1.00 48.25  ? 86  TYR L CE2 1 
ATOM   2390 C CZ  . TYR B 2 92  ? -67.343 51.339 -159.593 1.00 49.90  ? 86  TYR L CZ  1 
ATOM   2391 O OH  . TYR B 2 92  ? -66.178 51.830 -160.120 1.00 51.59  ? 86  TYR L OH  1 
ATOM   2392 N N   . TYR B 2 93  ? -73.374 51.185 -155.999 1.00 52.86  ? 87  TYR L N   1 
ATOM   2393 C CA  . TYR B 2 93  ? -74.750 51.163 -155.490 1.00 48.78  ? 87  TYR L CA  1 
ATOM   2394 C C   . TYR B 2 93  ? -75.718 51.552 -156.589 1.00 49.72  ? 87  TYR L C   1 
ATOM   2395 O O   . TYR B 2 93  ? -75.532 52.569 -157.247 1.00 56.81  ? 87  TYR L O   1 
ATOM   2396 C CB  . TYR B 2 93  ? -74.916 52.161 -154.336 1.00 43.83  ? 87  TYR L CB  1 
ATOM   2397 C CG  . TYR B 2 93  ? -74.277 51.728 -153.044 1.00 45.35  ? 87  TYR L CG  1 
ATOM   2398 C CD1 . TYR B 2 93  ? -73.066 52.266 -152.624 1.00 44.32  ? 87  TYR L CD1 1 
ATOM   2399 C CD2 . TYR B 2 93  ? -74.886 50.774 -152.236 1.00 46.49  ? 87  TYR L CD2 1 
ATOM   2400 C CE1 . TYR B 2 93  ? -72.478 51.860 -151.426 1.00 44.27  ? 87  TYR L CE1 1 
ATOM   2401 C CE2 . TYR B 2 93  ? -74.311 50.366 -151.049 1.00 47.18  ? 87  TYR L CE2 1 
ATOM   2402 C CZ  . TYR B 2 93  ? -73.106 50.906 -150.647 1.00 48.21  ? 87  TYR L CZ  1 
ATOM   2403 O OH  . TYR B 2 93  ? -72.543 50.483 -149.461 1.00 49.82  ? 87  TYR L OH  1 
ATOM   2404 N N   . CYS B 2 94  ? -76.750 50.749 -156.800 1.00 50.03  ? 88  CYS L N   1 
ATOM   2405 C CA  . CYS B 2 94  ? -77.873 51.213 -157.602 1.00 50.86  ? 88  CYS L CA  1 
ATOM   2406 C C   . CYS B 2 94  ? -78.906 51.827 -156.666 1.00 52.63  ? 88  CYS L C   1 
ATOM   2407 O O   . CYS B 2 94  ? -78.952 51.504 -155.475 1.00 57.12  ? 88  CYS L O   1 
ATOM   2408 C CB  . CYS B 2 94  ? -78.487 50.076 -158.407 1.00 55.13  ? 88  CYS L CB  1 
ATOM   2409 S SG  . CYS B 2 94  ? -79.334 48.811 -157.448 1.00 73.95  ? 88  CYS L SG  1 
ATOM   2410 N N   . GLN B 2 95  ? -79.717 52.737 -157.184 1.00 50.79  ? 89  GLN L N   1 
ATOM   2411 C CA  . GLN B 2 95  ? -80.769 53.332 -156.368 1.00 51.31  ? 89  GLN L CA  1 
ATOM   2412 C C   . GLN B 2 95  ? -81.979 53.591 -157.240 1.00 51.87  ? 89  GLN L C   1 
ATOM   2413 O O   . GLN B 2 95  ? -81.835 54.088 -158.348 1.00 62.89  ? 89  GLN L O   1 
ATOM   2414 C CB  . GLN B 2 95  ? -80.289 54.638 -155.731 1.00 52.93  ? 89  GLN L CB  1 
ATOM   2415 C CG  . GLN B 2 95  ? -81.331 55.369 -154.880 1.00 56.82  ? 89  GLN L CG  1 
ATOM   2416 C CD  . GLN B 2 95  ? -81.389 56.867 -155.197 1.00 66.23  ? 89  GLN L CD  1 
ATOM   2417 O OE1 . GLN B 2 95  ? -80.480 57.415 -155.827 1.00 69.61  ? 89  GLN L OE1 1 
ATOM   2418 N NE2 . GLN B 2 95  ? -82.464 57.530 -154.770 1.00 64.97  ? 89  GLN L NE2 1 
ATOM   2419 N N   . GLN B 2 96  ? -83.168 53.251 -156.756 1.00 56.06  ? 90  GLN L N   1 
ATOM   2420 C CA  . GLN B 2 96  ? -84.376 53.620 -157.476 1.00 54.93  ? 90  GLN L CA  1 
ATOM   2421 C C   . GLN B 2 96  ? -84.839 54.964 -156.943 1.00 58.24  ? 90  GLN L C   1 
ATOM   2422 O O   . GLN B 2 96  ? -84.902 55.166 -155.735 1.00 58.53  ? 90  GLN L O   1 
ATOM   2423 C CB  . GLN B 2 96  ? -85.463 52.543 -157.348 1.00 51.57  ? 90  GLN L CB  1 
ATOM   2424 C CG  . GLN B 2 96  ? -86.011 52.323 -155.958 1.00 51.09  ? 90  GLN L CG  1 
ATOM   2425 C CD  . GLN B 2 96  ? -87.117 53.316 -155.606 1.00 53.41  ? 90  GLN L CD  1 
ATOM   2426 O OE1 . GLN B 2 96  ? -87.656 54.000 -156.476 1.00 53.05  ? 90  GLN L OE1 1 
ATOM   2427 N NE2 . GLN B 2 96  ? -87.457 53.395 -154.327 1.00 51.46  ? 90  GLN L NE2 1 
ATOM   2428 N N   . TYR B 2 97  ? -85.112 55.908 -157.834 1.00 57.63  ? 91  TYR L N   1 
ATOM   2429 C CA  . TYR B 2 97  ? -85.699 57.160 -157.383 1.00 57.97  ? 91  TYR L CA  1 
ATOM   2430 C C   . TYR B 2 97  ? -87.058 57.356 -158.024 1.00 59.27  ? 91  TYR L C   1 
ATOM   2431 O O   . TYR B 2 97  ? -87.414 58.456 -158.442 1.00 59.84  ? 91  TYR L O   1 
ATOM   2432 C CB  . TYR B 2 97  ? -84.768 58.365 -157.594 1.00 56.57  ? 91  TYR L CB  1 
ATOM   2433 C CG  . TYR B 2 97  ? -84.263 58.601 -159.000 1.00 58.48  ? 91  TYR L CG  1 
ATOM   2434 C CD1 . TYR B 2 97  ? -84.718 59.688 -159.749 1.00 56.76  ? 91  TYR L CD1 1 
ATOM   2435 C CD2 . TYR B 2 97  ? -83.303 57.765 -159.568 1.00 59.98  ? 91  TYR L CD2 1 
ATOM   2436 C CE1 . TYR B 2 97  ? -84.252 59.919 -161.033 1.00 57.43  ? 91  TYR L CE1 1 
ATOM   2437 C CE2 . TYR B 2 97  ? -82.820 57.989 -160.863 1.00 60.92  ? 91  TYR L CE2 1 
ATOM   2438 C CZ  . TYR B 2 97  ? -83.299 59.069 -161.591 1.00 61.94  ? 91  TYR L CZ  1 
ATOM   2439 O OH  . TYR B 2 97  ? -82.827 59.305 -162.871 1.00 59.42  ? 91  TYR L OH  1 
ATOM   2440 N N   . TYR B 2 98  ? -87.809 56.260 -158.063 1.00 58.46  ? 92  TYR L N   1 
ATOM   2441 C CA  . TYR B 2 98  ? -89.096 56.177 -158.736 1.00 62.52  ? 92  TYR L CA  1 
ATOM   2442 C C   . TYR B 2 98  ? -90.242 56.488 -157.756 1.00 65.42  ? 92  TYR L C   1 
ATOM   2443 O O   . TYR B 2 98  ? -91.001 57.450 -157.941 1.00 60.17  ? 92  TYR L O   1 
ATOM   2444 C CB  . TYR B 2 98  ? -89.223 54.778 -159.336 1.00 66.69  ? 92  TYR L CB  1 
ATOM   2445 C CG  . TYR B 2 98  ? -90.474 54.504 -160.132 1.00 73.87  ? 92  TYR L CG  1 
ATOM   2446 C CD1 . TYR B 2 98  ? -90.567 54.870 -161.466 1.00 75.78  ? 92  TYR L CD1 1 
ATOM   2447 C CD2 . TYR B 2 98  ? -91.546 53.840 -159.560 1.00 71.28  ? 92  TYR L CD2 1 
ATOM   2448 C CE1 . TYR B 2 98  ? -91.703 54.604 -162.196 1.00 78.13  ? 92  TYR L CE1 1 
ATOM   2449 C CE2 . TYR B 2 98  ? -92.677 53.571 -160.280 1.00 72.80  ? 92  TYR L CE2 1 
ATOM   2450 C CZ  . TYR B 2 98  ? -92.757 53.954 -161.597 1.00 79.38  ? 92  TYR L CZ  1 
ATOM   2451 O OH  . TYR B 2 98  ? -93.901 53.683 -162.313 1.00 86.69  ? 92  TYR L OH  1 
ATOM   2452 N N   . SER B 2 99  ? -90.339 55.701 -156.692 1.00 64.34  ? 93  SER L N   1 
ATOM   2453 C CA  . SER B 2 99  ? -91.347 55.956 -155.677 1.00 64.46  ? 93  SER L CA  1 
ATOM   2454 C C   . SER B 2 99  ? -90.743 56.047 -154.276 1.00 66.01  ? 93  SER L C   1 
ATOM   2455 O O   . SER B 2 99  ? -89.730 55.421 -153.973 1.00 76.92  ? 93  SER L O   1 
ATOM   2456 C CB  . SER B 2 99  ? -92.429 54.882 -155.721 1.00 68.95  ? 93  SER L CB  1 
ATOM   2457 O OG  . SER B 2 99  ? -92.108 53.811 -154.862 1.00 74.17  ? 93  SER L OG  1 
ATOM   2458 N N   . ALA B 2 100 ? -91.369 56.840 -153.421 1.00 60.10  ? 94  ALA L N   1 
ATOM   2459 C CA  . ALA B 2 100 ? -90.878 57.034 -152.061 1.00 57.90  ? 94  ALA L CA  1 
ATOM   2460 C C   . ALA B 2 100 ? -91.315 55.905 -151.135 1.00 60.17  ? 94  ALA L C   1 
ATOM   2461 O O   . ALA B 2 100 ? -92.429 55.400 -151.250 1.00 56.76  ? 94  ALA L O   1 
ATOM   2462 C CB  . ALA B 2 100 ? -91.357 58.364 -151.523 1.00 48.12  ? 94  ALA L CB  1 
ATOM   2463 N N   . PRO B 2 101 ? -90.447 55.530 -150.188 1.00 59.86  ? 95  PRO L N   1 
ATOM   2464 C CA  . PRO B 2 101 ? -89.158 56.174 -149.935 1.00 55.19  ? 95  PRO L CA  1 
ATOM   2465 C C   . PRO B 2 101 ? -88.095 55.701 -150.907 1.00 59.06  ? 95  PRO L C   1 
ATOM   2466 O O   . PRO B 2 101 ? -88.133 54.536 -151.309 1.00 59.85  ? 95  PRO L O   1 
ATOM   2467 C CB  . PRO B 2 101 ? -88.825 55.660 -148.537 1.00 54.58  ? 95  PRO L CB  1 
ATOM   2468 C CG  . PRO B 2 101 ? -89.321 54.240 -148.601 1.00 53.83  ? 95  PRO L CG  1 
ATOM   2469 C CD  . PRO B 2 101 ? -90.678 54.418 -149.246 1.00 50.88  ? 95  PRO L CD  1 
ATOM   2470 N N   . LEU B 2 102 ? -87.165 56.585 -151.270 1.00 58.85  ? 96  LEU L N   1 
ATOM   2471 C CA  . LEU B 2 102 ? -86.073 56.215 -152.168 1.00 53.54  ? 96  LEU L CA  1 
ATOM   2472 C C   . LEU B 2 102 ? -85.223 55.174 -151.489 1.00 55.22  ? 96  LEU L C   1 
ATOM   2473 O O   . LEU B 2 102 ? -84.951 55.283 -150.296 1.00 59.72  ? 96  LEU L O   1 
ATOM   2474 C CB  . LEU B 2 102 ? -85.210 57.419 -152.535 1.00 52.54  ? 96  LEU L CB  1 
ATOM   2475 C CG  . LEU B 2 102 ? -85.951 58.645 -153.067 1.00 60.76  ? 96  LEU L CG  1 
ATOM   2476 C CD1 . LEU B 2 102 ? -85.009 59.576 -153.796 1.00 61.66  ? 96  LEU L CD1 1 
ATOM   2477 C CD2 . LEU B 2 102 ? -87.083 58.229 -153.973 1.00 59.75  ? 96  LEU L CD2 1 
ATOM   2478 N N   . THR B 2 103 ? -84.795 54.167 -152.242 1.00 51.20  ? 97  THR L N   1 
ATOM   2479 C CA  . THR B 2 103 ? -84.047 53.068 -151.649 1.00 55.69  ? 97  THR L CA  1 
ATOM   2480 C C   . THR B 2 103 ? -82.840 52.675 -152.476 1.00 58.38  ? 97  THR L C   1 
ATOM   2481 O O   . THR B 2 103 ? -82.797 52.921 -153.685 1.00 60.53  ? 97  THR L O   1 
ATOM   2482 C CB  . THR B 2 103 ? -84.942 51.854 -151.410 1.00 56.10  ? 97  THR L CB  1 
ATOM   2483 O OG1 . THR B 2 103 ? -85.591 51.485 -152.633 1.00 59.27  ? 97  THR L OG1 1 
ATOM   2484 C CG2 . THR B 2 103 ? -85.992 52.204 -150.400 1.00 53.51  ? 97  THR L CG2 1 
ATOM   2485 N N   . PHE B 2 104 ? -81.862 52.069 -151.805 1.00 54.34  ? 98  PHE L N   1 
ATOM   2486 C CA  . PHE B 2 104 ? -80.585 51.707 -152.421 1.00 47.82  ? 98  PHE L CA  1 
ATOM   2487 C C   . PHE B 2 104 ? -80.424 50.195 -152.410 1.00 53.32  ? 98  PHE L C   1 
ATOM   2488 O O   . PHE B 2 104 ? -80.921 49.508 -151.513 1.00 51.76  ? 98  PHE L O   1 
ATOM   2489 C CB  . PHE B 2 104 ? -79.411 52.311 -151.635 1.00 45.37  ? 98  PHE L CB  1 
ATOM   2490 C CG  . PHE B 2 104 ? -79.296 53.805 -151.732 1.00 47.25  ? 98  PHE L CG  1 
ATOM   2491 C CD1 . PHE B 2 104 ? -80.022 54.632 -150.881 1.00 53.15  ? 98  PHE L CD1 1 
ATOM   2492 C CD2 . PHE B 2 104 ? -78.439 54.385 -152.648 1.00 44.86  ? 98  PHE L CD2 1 
ATOM   2493 C CE1 . PHE B 2 104 ? -79.910 56.009 -150.966 1.00 53.02  ? 98  PHE L CE1 1 
ATOM   2494 C CE2 . PHE B 2 104 ? -78.329 55.761 -152.743 1.00 53.83  ? 98  PHE L CE2 1 
ATOM   2495 C CZ  . PHE B 2 104 ? -79.068 56.575 -151.902 1.00 55.49  ? 98  PHE L CZ  1 
ATOM   2496 N N   . GLY B 2 105 ? -79.710 49.675 -153.399 1.00 56.24  ? 99  GLY L N   1 
ATOM   2497 C CA  . GLY B 2 105 ? -79.326 48.279 -153.378 1.00 50.31  ? 99  GLY L CA  1 
ATOM   2498 C C   . GLY B 2 105 ? -78.263 48.125 -152.324 1.00 46.80  ? 99  GLY L C   1 
ATOM   2499 O O   . GLY B 2 105 ? -77.727 49.114 -151.844 1.00 49.70  ? 99  GLY L O   1 
ATOM   2500 N N   . GLY B 2 106 ? -77.945 46.891 -151.968 1.00 46.78  ? 100 GLY L N   1 
ATOM   2501 C CA  . GLY B 2 106 ? -77.001 46.645 -150.900 1.00 46.81  ? 100 GLY L CA  1 
ATOM   2502 C C   . GLY B 2 106 ? -75.542 46.877 -151.254 1.00 51.39  ? 100 GLY L C   1 
ATOM   2503 O O   . GLY B 2 106 ? -74.656 46.671 -150.415 1.00 48.21  ? 100 GLY L O   1 
ATOM   2504 N N   . GLY B 2 107 ? -75.292 47.301 -152.490 1.00 43.15  ? 101 GLY L N   1 
ATOM   2505 C CA  . GLY B 2 107 ? -73.938 47.552 -152.946 1.00 44.44  ? 101 GLY L CA  1 
ATOM   2506 C C   . GLY B 2 107 ? -73.169 46.318 -153.393 1.00 42.95  ? 101 GLY L C   1 
ATOM   2507 O O   . GLY B 2 107 ? -73.278 45.248 -152.808 1.00 44.48  ? 101 GLY L O   1 
ATOM   2508 N N   . THR B 2 108 ? -72.385 46.488 -154.449 1.00 52.57  ? 102 THR L N   1 
ATOM   2509 C CA  . THR B 2 108 ? -71.501 45.449 -154.965 1.00 53.75  ? 102 THR L CA  1 
ATOM   2510 C C   . THR B 2 108 ? -70.049 45.918 -154.878 1.00 57.13  ? 102 THR L C   1 
ATOM   2511 O O   . THR B 2 108 ? -69.730 47.033 -155.276 1.00 56.00  ? 102 THR L O   1 
ATOM   2512 C CB  . THR B 2 108 ? -71.854 45.130 -156.423 1.00 55.05  ? 102 THR L CB  1 
ATOM   2513 O OG1 . THR B 2 108 ? -73.064 44.364 -156.456 1.00 63.27  ? 102 THR L OG1 1 
ATOM   2514 C CG2 . THR B 2 108 ? -70.764 44.333 -157.084 1.00 50.98  ? 102 THR L CG2 1 
ATOM   2515 N N   . LYS B 2 109 ? -69.169 45.086 -154.329 1.00 62.86  ? 103 LYS L N   1 
ATOM   2516 C CA  . LYS B 2 109 ? -67.769 45.481 -154.195 1.00 55.74  ? 103 LYS L CA  1 
ATOM   2517 C C   . LYS B 2 109 ? -66.964 45.038 -155.411 1.00 56.18  ? 103 LYS L C   1 
ATOM   2518 O O   . LYS B 2 109 ? -66.873 43.847 -155.715 1.00 53.69  ? 103 LYS L O   1 
ATOM   2519 C CB  . LYS B 2 109 ? -67.142 44.936 -152.906 1.00 52.14  ? 103 LYS L CB  1 
ATOM   2520 C CG  . LYS B 2 109 ? -65.712 45.440 -152.689 1.00 64.90  ? 103 LYS L CG  1 
ATOM   2521 C CD  . LYS B 2 109 ? -64.905 44.539 -151.755 1.00 72.87  ? 103 LYS L CD  1 
ATOM   2522 C CE  . LYS B 2 109 ? -64.874 45.058 -150.326 1.00 76.86  ? 103 LYS L CE  1 
ATOM   2523 N NZ  . LYS B 2 109 ? -64.216 44.076 -149.404 1.00 83.66  ? 103 LYS L NZ  1 
ATOM   2524 N N   . VAL B 2 110 ? -66.384 46.005 -156.109 1.00 55.58  ? 104 VAL L N   1 
ATOM   2525 C CA  . VAL B 2 110 ? -65.587 45.708 -157.289 1.00 59.87  ? 104 VAL L CA  1 
ATOM   2526 C C   . VAL B 2 110 ? -64.080 45.784 -156.990 1.00 60.54  ? 104 VAL L C   1 
ATOM   2527 O O   . VAL B 2 110 ? -63.541 46.858 -156.719 1.00 58.59  ? 104 VAL L O   1 
ATOM   2528 C CB  . VAL B 2 110 ? -65.972 46.638 -158.469 1.00 57.02  ? 104 VAL L CB  1 
ATOM   2529 C CG1 . VAL B 2 110 ? -65.094 46.363 -159.691 1.00 53.60  ? 104 VAL L CG1 1 
ATOM   2530 C CG2 . VAL B 2 110 ? -67.459 46.483 -158.815 1.00 51.02  ? 104 VAL L CG2 1 
ATOM   2531 N N   . GLU B 2 111 ? -63.413 44.633 -157.031 1.00 61.18  ? 105 GLU L N   1 
ATOM   2532 C CA  . GLU B 2 111 ? -61.972 44.560 -156.806 1.00 60.58  ? 105 GLU L CA  1 
ATOM   2533 C C   . GLU B 2 111 ? -61.208 44.196 -158.090 1.00 66.06  ? 105 GLU L C   1 
ATOM   2534 O O   . GLU B 2 111 ? -61.786 43.724 -159.069 1.00 60.31  ? 105 GLU L O   1 
ATOM   2535 C CB  . GLU B 2 111 ? -61.640 43.557 -155.688 1.00 62.94  ? 105 GLU L CB  1 
ATOM   2536 C CG  . GLU B 2 111 ? -62.539 43.657 -154.454 1.00 82.24  ? 105 GLU L CG  1 
ATOM   2537 C CD  . GLU B 2 111 ? -61.786 43.528 -153.118 1.00 91.93  ? 105 GLU L CD  1 
ATOM   2538 O OE1 . GLU B 2 111 ? -61.316 44.562 -152.573 1.00 90.39  ? 105 GLU L OE1 1 
ATOM   2539 O OE2 . GLU B 2 111 ? -61.697 42.393 -152.600 1.00 94.07  ? 105 GLU L OE2 1 
ATOM   2540 N N   . ILE B 2 112 ? -59.899 44.412 -158.077 1.00 59.87  ? 106 ILE L N   1 
ATOM   2541 C CA  . ILE B 2 112 ? -59.053 44.024 -159.197 1.00 59.96  ? 106 ILE L CA  1 
ATOM   2542 C C   . ILE B 2 112 ? -58.431 42.641 -158.970 1.00 64.97  ? 106 ILE L C   1 
ATOM   2543 O O   . ILE B 2 112 ? -58.161 42.253 -157.831 1.00 64.91  ? 106 ILE L O   1 
ATOM   2544 C CB  . ILE B 2 112 ? -57.945 45.062 -159.410 1.00 56.71  ? 106 ILE L CB  1 
ATOM   2545 C CG1 . ILE B 2 112 ? -58.545 46.396 -159.854 1.00 51.60  ? 106 ILE L CG1 1 
ATOM   2546 C CG2 . ILE B 2 112 ? -56.955 44.582 -160.429 1.00 57.56  ? 106 ILE L CG2 1 
ATOM   2547 C CD1 . ILE B 2 112 ? -58.546 46.595 -161.340 1.00 53.95  ? 106 ILE L CD1 1 
ATOM   2548 N N   . LYS B 2 113 ? -58.250 41.891 -160.058 1.00 69.95  ? 107 LYS L N   1 
ATOM   2549 C CA  . LYS B 2 113 ? -57.486 40.638 -160.054 1.00 68.38  ? 107 LYS L CA  1 
ATOM   2550 C C   . LYS B 2 113 ? -56.093 40.885 -160.594 1.00 66.72  ? 107 LYS L C   1 
ATOM   2551 O O   . LYS B 2 113 ? -55.913 41.180 -161.773 1.00 73.70  ? 107 LYS L O   1 
ATOM   2552 C CB  . LYS B 2 113 ? -58.138 39.592 -160.942 1.00 70.31  ? 107 LYS L CB  1 
ATOM   2553 C CG  . LYS B 2 113 ? -58.911 38.544 -160.217 1.00 72.82  ? 107 LYS L CG  1 
ATOM   2554 C CD  . LYS B 2 113 ? -59.273 37.444 -161.193 1.00 73.50  ? 107 LYS L CD  1 
ATOM   2555 C CE  . LYS B 2 113 ? -59.761 38.020 -162.507 1.00 71.06  ? 107 LYS L CE  1 
ATOM   2556 N NZ  . LYS B 2 113 ? -59.580 37.040 -163.617 1.00 72.10  ? 107 LYS L NZ  1 
ATOM   2557 N N   . ARG B 2 114 ? -55.117 40.755 -159.713 1.00 62.02  ? 108 ARG L N   1 
ATOM   2558 C CA  . ARG B 2 114 ? -53.724 40.979 -160.014 1.00 55.82  ? 108 ARG L CA  1 
ATOM   2559 C C   . ARG B 2 114 ? -53.057 39.640 -159.990 1.00 54.01  ? 108 ARG L C   1 
ATOM   2560 O O   . ARG B 2 114 ? -53.624 38.671 -159.499 1.00 57.75  ? 108 ARG L O   1 
ATOM   2561 C CB  . ARG B 2 114 ? -53.090 41.655 -158.834 1.00 62.71  ? 108 ARG L CB  1 
ATOM   2562 C CG  . ARG B 2 114 ? -53.344 43.082 -158.604 1.00 63.75  ? 108 ARG L CG  1 
ATOM   2563 C CD  . ARG B 2 114 ? -52.226 43.446 -157.675 1.00 58.00  ? 108 ARG L CD  1 
ATOM   2564 N NE  . ARG B 2 114 ? -51.093 42.578 -158.008 1.00 51.46  ? 108 ARG L NE  1 
ATOM   2565 C CZ  . ARG B 2 114 ? -49.855 43.000 -158.210 1.00 46.24  ? 108 ARG L CZ  1 
ATOM   2566 N NH1 . ARG B 2 114 ? -48.907 42.135 -158.512 1.00 44.22  ? 108 ARG L NH1 1 
ATOM   2567 N NH2 . ARG B 2 114 ? -49.562 44.284 -158.077 1.00 50.08  ? 108 ARG L NH2 1 
ATOM   2568 N N   . THR B 2 115 ? -51.810 39.592 -160.427 1.00 49.78  ? 109 THR L N   1 
ATOM   2569 C CA  . THR B 2 115 ? -51.003 38.428 -160.130 1.00 53.80  ? 109 THR L CA  1 
ATOM   2570 C C   . THR B 2 115 ? -50.575 38.482 -158.678 1.00 56.48  ? 109 THR L C   1 
ATOM   2571 O O   . THR B 2 115 ? -50.483 39.553 -158.078 1.00 56.96  ? 109 THR L O   1 
ATOM   2572 C CB  . THR B 2 115 ? -49.762 38.392 -160.979 1.00 57.20  ? 109 THR L CB  1 
ATOM   2573 O OG1 . THR B 2 115 ? -49.263 39.724 -161.100 1.00 58.29  ? 109 THR L OG1 1 
ATOM   2574 C CG2 . THR B 2 115 ? -50.106 37.865 -162.351 1.00 59.57  ? 109 THR L CG2 1 
ATOM   2575 N N   . VAL B 2 116 ? -50.318 37.314 -158.117 1.00 52.73  ? 110 VAL L N   1 
ATOM   2576 C CA  . VAL B 2 116 ? -49.830 37.221 -156.759 1.00 52.22  ? 110 VAL L CA  1 
ATOM   2577 C C   . VAL B 2 116 ? -48.580 38.096 -156.532 1.00 58.20  ? 110 VAL L C   1 
ATOM   2578 O O   . VAL B 2 116 ? -47.677 38.161 -157.389 1.00 56.71  ? 110 VAL L O   1 
ATOM   2579 C CB  . VAL B 2 116 ? -49.525 35.754 -156.402 1.00 52.69  ? 110 VAL L CB  1 
ATOM   2580 C CG1 . VAL B 2 116 ? -48.504 35.143 -157.390 1.00 38.32  ? 110 VAL L CG1 1 
ATOM   2581 C CG2 . VAL B 2 116 ? -49.039 35.660 -154.975 1.00 54.68  ? 110 VAL L CG2 1 
ATOM   2582 N N   . ALA B 2 117 ? -48.549 38.766 -155.380 1.00 55.69  ? 111 ALA L N   1 
ATOM   2583 C CA  . ALA B 2 117 ? -47.422 39.607 -154.978 1.00 52.80  ? 111 ALA L CA  1 
ATOM   2584 C C   . ALA B 2 117 ? -47.079 39.386 -153.514 1.00 52.27  ? 111 ALA L C   1 
ATOM   2585 O O   . ALA B 2 117 ? -47.954 39.447 -152.659 1.00 49.51  ? 111 ALA L O   1 
ATOM   2586 C CB  . ALA B 2 117 ? -47.746 41.061 -155.207 1.00 44.93  ? 111 ALA L CB  1 
ATOM   2587 N N   . ALA B 2 118 ? -45.799 39.157 -153.229 1.00 57.06  ? 112 ALA L N   1 
ATOM   2588 C CA  . ALA B 2 118 ? -45.326 38.913 -151.858 1.00 53.34  ? 112 ALA L CA  1 
ATOM   2589 C C   . ALA B 2 118 ? -45.272 40.163 -150.974 1.00 54.08  ? 112 ALA L C   1 
ATOM   2590 O O   . ALA B 2 118 ? -44.899 41.240 -151.422 1.00 58.96  ? 112 ALA L O   1 
ATOM   2591 C CB  . ALA B 2 118 ? -43.976 38.249 -151.891 1.00 45.29  ? 112 ALA L CB  1 
ATOM   2592 N N   . PRO B 2 119 ? -45.632 40.014 -149.700 1.00 56.61  ? 113 PRO L N   1 
ATOM   2593 C CA  . PRO B 2 119 ? -45.610 41.136 -148.761 1.00 54.52  ? 113 PRO L CA  1 
ATOM   2594 C C   . PRO B 2 119 ? -44.197 41.463 -148.309 1.00 59.45  ? 113 PRO L C   1 
ATOM   2595 O O   . PRO B 2 119 ? -43.372 40.563 -148.187 1.00 57.04  ? 113 PRO L O   1 
ATOM   2596 C CB  . PRO B 2 119 ? -46.386 40.575 -147.575 1.00 49.79  ? 113 PRO L CB  1 
ATOM   2597 C CG  . PRO B 2 119 ? -45.932 39.144 -147.562 1.00 55.74  ? 113 PRO L CG  1 
ATOM   2598 C CD  . PRO B 2 119 ? -46.041 38.768 -149.027 1.00 60.21  ? 113 PRO L CD  1 
ATOM   2599 N N   . SER B 2 120 ? -43.925 42.744 -148.090 1.00 61.72  ? 114 SER L N   1 
ATOM   2600 C CA  . SER B 2 120 ? -42.739 43.174 -147.372 1.00 58.74  ? 114 SER L CA  1 
ATOM   2601 C C   . SER B 2 120 ? -43.120 43.145 -145.902 1.00 57.38  ? 114 SER L C   1 
ATOM   2602 O O   . SER B 2 120 ? -44.163 43.684 -145.514 1.00 51.47  ? 114 SER L O   1 
ATOM   2603 C CB  . SER B 2 120 ? -42.360 44.608 -147.756 1.00 64.54  ? 114 SER L CB  1 
ATOM   2604 O OG  . SER B 2 120 ? -41.806 44.684 -149.055 1.00 66.61  ? 114 SER L OG  1 
ATOM   2605 N N   . VAL B 2 121 ? -42.279 42.535 -145.079 1.00 55.44  ? 115 VAL L N   1 
ATOM   2606 C CA  . VAL B 2 121 ? -42.604 42.378 -143.670 1.00 50.89  ? 115 VAL L CA  1 
ATOM   2607 C C   . VAL B 2 121 ? -41.713 43.199 -142.747 1.00 53.36  ? 115 VAL L C   1 
ATOM   2608 O O   . VAL B 2 121 ? -40.499 43.056 -142.749 1.00 53.14  ? 115 VAL L O   1 
ATOM   2609 C CB  . VAL B 2 121 ? -42.509 40.918 -143.266 1.00 50.27  ? 115 VAL L CB  1 
ATOM   2610 C CG1 . VAL B 2 121 ? -42.883 40.763 -141.807 1.00 54.58  ? 115 VAL L CG1 1 
ATOM   2611 C CG2 . VAL B 2 121 ? -43.411 40.078 -144.169 1.00 44.89  ? 115 VAL L CG2 1 
ATOM   2612 N N   . PHE B 2 122 ? -42.329 44.046 -141.938 1.00 52.55  ? 116 PHE L N   1 
ATOM   2613 C CA  . PHE B 2 122 ? -41.583 44.875 -141.009 1.00 53.55  ? 116 PHE L CA  1 
ATOM   2614 C C   . PHE B 2 122 ? -42.076 44.668 -139.588 1.00 57.39  ? 116 PHE L C   1 
ATOM   2615 O O   . PHE B 2 122 ? -43.270 44.447 -139.366 1.00 58.20  ? 116 PHE L O   1 
ATOM   2616 C CB  . PHE B 2 122 ? -41.754 46.334 -141.393 1.00 52.56  ? 116 PHE L CB  1 
ATOM   2617 C CG  . PHE B 2 122 ? -41.418 46.613 -142.813 1.00 61.18  ? 116 PHE L CG  1 
ATOM   2618 C CD1 . PHE B 2 122 ? -42.373 47.071 -143.684 1.00 61.37  ? 116 PHE L CD1 1 
ATOM   2619 C CD2 . PHE B 2 122 ? -40.142 46.391 -143.285 1.00 72.19  ? 116 PHE L CD2 1 
ATOM   2620 C CE1 . PHE B 2 122 ? -42.061 47.317 -144.997 1.00 65.84  ? 116 PHE L CE1 1 
ATOM   2621 C CE2 . PHE B 2 122 ? -39.830 46.635 -144.599 1.00 71.45  ? 116 PHE L CE2 1 
ATOM   2622 C CZ  . PHE B 2 122 ? -40.795 47.097 -145.453 1.00 65.77  ? 116 PHE L CZ  1 
ATOM   2623 N N   . ILE B 2 123 ? -41.165 44.743 -138.621 1.00 53.60  ? 117 ILE L N   1 
ATOM   2624 C CA  . ILE B 2 123 ? -41.575 44.645 -137.227 1.00 57.37  ? 117 ILE L CA  1 
ATOM   2625 C C   . ILE B 2 123 ? -41.156 45.888 -136.434 1.00 59.27  ? 117 ILE L C   1 
ATOM   2626 O O   . ILE B 2 123 ? -40.086 46.454 -136.682 1.00 57.58  ? 117 ILE L O   1 
ATOM   2627 C CB  . ILE B 2 123 ? -41.107 43.318 -136.573 1.00 53.24  ? 117 ILE L CB  1 
ATOM   2628 C CG1 . ILE B 2 123 ? -41.904 43.055 -135.295 1.00 60.24  ? 117 ILE L CG1 1 
ATOM   2629 C CG2 . ILE B 2 123 ? -39.628 43.344 -136.277 1.00 49.76  ? 117 ILE L CG2 1 
ATOM   2630 C CD1 . ILE B 2 123 ? -41.869 41.624 -134.838 1.00 59.12  ? 117 ILE L CD1 1 
ATOM   2631 N N   . PHE B 2 124 ? -42.025 46.333 -135.522 1.00 57.61  ? 118 PHE L N   1 
ATOM   2632 C CA  . PHE B 2 124 ? -41.746 47.491 -134.662 1.00 57.06  ? 118 PHE L CA  1 
ATOM   2633 C C   . PHE B 2 124 ? -41.878 47.188 -133.161 1.00 60.23  ? 118 PHE L C   1 
ATOM   2634 O O   . PHE B 2 124 ? -42.980 46.923 -132.667 1.00 63.66  ? 118 PHE L O   1 
ATOM   2635 C CB  . PHE B 2 124 ? -42.711 48.630 -134.957 1.00 49.84  ? 118 PHE L CB  1 
ATOM   2636 C CG  . PHE B 2 124 ? -42.771 49.045 -136.392 1.00 59.46  ? 118 PHE L CG  1 
ATOM   2637 C CD1 . PHE B 2 124 ? -42.089 50.177 -136.826 1.00 64.64  ? 118 PHE L CD1 1 
ATOM   2638 C CD2 . PHE B 2 124 ? -43.555 48.347 -137.299 1.00 57.50  ? 118 PHE L CD2 1 
ATOM   2639 C CE1 . PHE B 2 124 ? -42.165 50.587 -138.148 1.00 64.62  ? 118 PHE L CE1 1 
ATOM   2640 C CE2 . PHE B 2 124 ? -43.635 48.755 -138.619 1.00 56.23  ? 118 PHE L CE2 1 
ATOM   2641 C CZ  . PHE B 2 124 ? -42.941 49.878 -139.044 1.00 58.28  ? 118 PHE L CZ  1 
ATOM   2642 N N   . PRO B 2 125 ? -40.766 47.231 -132.423 1.00 53.88  ? 119 PRO L N   1 
ATOM   2643 C CA  . PRO B 2 125 ? -40.901 47.098 -130.970 1.00 57.15  ? 119 PRO L CA  1 
ATOM   2644 C C   . PRO B 2 125 ? -41.657 48.269 -130.365 1.00 60.52  ? 119 PRO L C   1 
ATOM   2645 O O   . PRO B 2 125 ? -41.764 49.316 -130.996 1.00 60.72  ? 119 PRO L O   1 
ATOM   2646 C CB  . PRO B 2 125 ? -39.442 47.107 -130.479 1.00 54.17  ? 119 PRO L CB  1 
ATOM   2647 C CG  . PRO B 2 125 ? -38.639 47.568 -131.650 1.00 51.78  ? 119 PRO L CG  1 
ATOM   2648 C CD  . PRO B 2 125 ? -39.372 47.037 -132.838 1.00 54.35  ? 119 PRO L CD  1 
ATOM   2649 N N   . PRO B 2 126 ? -42.179 48.091 -129.146 1.00 63.20  ? 120 PRO L N   1 
ATOM   2650 C CA  . PRO B 2 126 ? -42.946 49.131 -128.452 1.00 58.61  ? 120 PRO L CA  1 
ATOM   2651 C C   . PRO B 2 126 ? -42.112 50.381 -128.207 1.00 60.13  ? 120 PRO L C   1 
ATOM   2652 O O   . PRO B 2 126 ? -40.907 50.280 -128.065 1.00 59.97  ? 120 PRO L O   1 
ATOM   2653 C CB  . PRO B 2 126 ? -43.308 48.460 -127.119 1.00 55.12  ? 120 PRO L CB  1 
ATOM   2654 C CG  . PRO B 2 126 ? -42.346 47.315 -126.999 1.00 61.71  ? 120 PRO L CG  1 
ATOM   2655 C CD  . PRO B 2 126 ? -42.186 46.828 -128.389 1.00 63.70  ? 120 PRO L CD  1 
ATOM   2656 N N   . SER B 2 127 ? -42.751 51.543 -128.162 1.00 62.37  ? 121 SER L N   1 
ATOM   2657 C CA  . SER B 2 127 ? -42.043 52.787 -127.907 1.00 70.51  ? 121 SER L CA  1 
ATOM   2658 C C   . SER B 2 127 ? -41.696 52.948 -126.428 1.00 75.93  ? 121 SER L C   1 
ATOM   2659 O O   . SER B 2 127 ? -42.324 52.339 -125.556 1.00 71.34  ? 121 SER L O   1 
ATOM   2660 C CB  . SER B 2 127 ? -42.894 53.970 -128.352 1.00 74.43  ? 121 SER L CB  1 
ATOM   2661 O OG  . SER B 2 127 ? -44.095 54.006 -127.613 1.00 76.82  ? 121 SER L OG  1 
ATOM   2662 N N   . ASP B 2 128 ? -40.686 53.764 -126.145 1.00 79.86  ? 122 ASP L N   1 
ATOM   2663 C CA  . ASP B 2 128 ? -40.369 54.062 -124.761 1.00 80.19  ? 122 ASP L CA  1 
ATOM   2664 C C   . ASP B 2 128 ? -41.562 54.809 -124.176 1.00 79.69  ? 122 ASP L C   1 
ATOM   2665 O O   . ASP B 2 128 ? -41.994 54.517 -123.069 1.00 86.12  ? 122 ASP L O   1 
ATOM   2666 C CB  . ASP B 2 128 ? -39.067 54.869 -124.643 1.00 80.53  ? 122 ASP L CB  1 
ATOM   2667 N N   . GLU B 2 129 ? -42.125 55.738 -124.944 1.00 73.40  ? 123 GLU L N   1 
ATOM   2668 C CA  . GLU B 2 129 ? -43.302 56.481 -124.504 1.00 70.34  ? 123 GLU L CA  1 
ATOM   2669 C C   . GLU B 2 129 ? -44.419 55.566 -123.976 1.00 75.50  ? 123 GLU L C   1 
ATOM   2670 O O   . GLU B 2 129 ? -45.041 55.870 -122.961 1.00 76.87  ? 123 GLU L O   1 
ATOM   2671 C CB  . GLU B 2 129 ? -43.826 57.391 -125.632 1.00 64.89  ? 123 GLU L CB  1 
ATOM   2672 N N   . GLN B 2 130 ? -44.671 54.447 -124.653 1.00 71.99  ? 124 GLN L N   1 
ATOM   2673 C CA  . GLN B 2 130 ? -45.760 53.558 -124.254 1.00 66.29  ? 124 GLN L CA  1 
ATOM   2674 C C   . GLN B 2 130 ? -45.390 52.628 -123.113 1.00 68.75  ? 124 GLN L C   1 
ATOM   2675 O O   . GLN B 2 130 ? -46.230 52.298 -122.273 1.00 67.60  ? 124 GLN L O   1 
ATOM   2676 C CB  . GLN B 2 130 ? -46.253 52.728 -125.432 1.00 64.69  ? 124 GLN L CB  1 
ATOM   2677 C CG  . GLN B 2 130 ? -47.349 51.731 -125.074 1.00 62.53  ? 124 GLN L CG  1 
ATOM   2678 C CD  . GLN B 2 130 ? -47.562 50.702 -126.167 1.00 62.87  ? 124 GLN L CD  1 
ATOM   2679 O OE1 . GLN B 2 130 ? -46.669 50.460 -126.986 1.00 66.33  ? 124 GLN L OE1 1 
ATOM   2680 N NE2 . GLN B 2 130 ? -48.745 50.094 -126.190 1.00 52.23  ? 124 GLN L NE2 1 
ATOM   2681 N N   . LEU B 2 131 ? -44.141 52.181 -123.098 1.00 68.14  ? 125 LEU L N   1 
ATOM   2682 C CA  . LEU B 2 131 ? -43.658 51.342 -122.008 1.00 72.86  ? 125 LEU L CA  1 
ATOM   2683 C C   . LEU B 2 131 ? -43.734 52.089 -120.678 1.00 80.49  ? 125 LEU L C   1 
ATOM   2684 O O   . LEU B 2 131 ? -44.020 51.494 -119.636 1.00 76.05  ? 125 LEU L O   1 
ATOM   2685 C CB  . LEU B 2 131 ? -42.233 50.881 -122.281 1.00 67.97  ? 125 LEU L CB  1 
ATOM   2686 C CG  . LEU B 2 131 ? -42.151 49.694 -123.236 1.00 71.50  ? 125 LEU L CG  1 
ATOM   2687 C CD1 . LEU B 2 131 ? -40.734 49.476 -123.716 1.00 67.48  ? 125 LEU L CD1 1 
ATOM   2688 C CD2 . LEU B 2 131 ? -42.683 48.443 -122.560 1.00 74.20  ? 125 LEU L CD2 1 
ATOM   2689 N N   . LYS B 2 132 ? -43.497 53.400 -120.726 1.00 86.44  ? 126 LYS L N   1 
ATOM   2690 C CA  . LYS B 2 132 ? -43.527 54.234 -119.525 1.00 87.89  ? 126 LYS L CA  1 
ATOM   2691 C C   . LYS B 2 132 ? -44.888 54.164 -118.871 1.00 83.41  ? 126 LYS L C   1 
ATOM   2692 O O   . LYS B 2 132 ? -45.072 54.658 -117.769 1.00 84.06  ? 126 LYS L O   1 
ATOM   2693 C CB  . LYS B 2 132 ? -43.203 55.701 -119.837 1.00 93.15  ? 126 LYS L CB  1 
ATOM   2694 C CG  . LYS B 2 132 ? -41.854 55.943 -120.505 1.00 100.22 ? 126 LYS L CG  1 
ATOM   2695 C CD  . LYS B 2 132 ? -40.702 55.290 -119.751 1.00 105.64 ? 126 LYS L CD  1 
ATOM   2696 C CE  . LYS B 2 132 ? -39.484 55.100 -120.657 1.00 110.84 ? 126 LYS L CE  1 
ATOM   2697 N NZ  . LYS B 2 132 ? -38.909 56.389 -121.135 1.00 113.98 ? 126 LYS L NZ  1 
ATOM   2698 N N   . SER B 2 133 ? -45.848 53.552 -119.547 1.00 80.27  ? 127 SER L N   1 
ATOM   2699 C CA  . SER B 2 133 ? -47.197 53.502 -119.010 1.00 79.90  ? 127 SER L CA  1 
ATOM   2700 C C   . SER B 2 133 ? -47.757 52.087 -118.897 1.00 78.13  ? 127 SER L C   1 
ATOM   2701 O O   . SER B 2 133 ? -48.968 51.898 -118.897 1.00 79.03  ? 127 SER L O   1 
ATOM   2702 C CB  . SER B 2 133 ? -48.124 54.387 -119.834 1.00 80.51  ? 127 SER L CB  1 
ATOM   2703 O OG  . SER B 2 133 ? -48.004 54.093 -121.215 1.00 80.76  ? 127 SER L OG  1 
ATOM   2704 N N   . GLY B 2 134 ? -46.877 51.095 -118.805 1.00 77.94  ? 128 GLY L N   1 
ATOM   2705 C CA  . GLY B 2 134 ? -47.286 49.753 -118.421 1.00 81.84  ? 128 GLY L CA  1 
ATOM   2706 C C   . GLY B 2 134 ? -47.792 48.854 -119.531 1.00 84.59  ? 128 GLY L C   1 
ATOM   2707 O O   . GLY B 2 134 ? -48.110 47.682 -119.301 1.00 87.71  ? 128 GLY L O   1 
ATOM   2708 N N   . THR B 2 135 ? -47.864 49.393 -120.741 1.00 78.60  ? 129 THR L N   1 
ATOM   2709 C CA  . THR B 2 135 ? -48.334 48.611 -121.869 1.00 69.83  ? 129 THR L CA  1 
ATOM   2710 C C   . THR B 2 135 ? -47.251 48.453 -122.909 1.00 65.96  ? 129 THR L C   1 
ATOM   2711 O O   . THR B 2 135 ? -46.376 49.310 -123.052 1.00 70.23  ? 129 THR L O   1 
ATOM   2712 C CB  . THR B 2 135 ? -49.556 49.244 -122.502 1.00 72.48  ? 129 THR L CB  1 
ATOM   2713 O OG1 . THR B 2 135 ? -50.591 49.308 -121.519 1.00 75.18  ? 129 THR L OG1 1 
ATOM   2714 C CG2 . THR B 2 135 ? -50.037 48.410 -123.668 1.00 76.52  ? 129 THR L CG2 1 
ATOM   2715 N N   . ALA B 2 136 ? -47.308 47.338 -123.620 1.00 58.22  ? 130 ALA L N   1 
ATOM   2716 C CA  . ALA B 2 136 ? -46.346 47.063 -124.663 1.00 63.78  ? 130 ALA L CA  1 
ATOM   2717 C C   . ALA B 2 136 ? -47.044 46.545 -125.915 1.00 60.31  ? 130 ALA L C   1 
ATOM   2718 O O   . ALA B 2 136 ? -47.505 45.408 -125.945 1.00 58.22  ? 130 ALA L O   1 
ATOM   2719 C CB  . ALA B 2 136 ? -45.301 46.061 -124.167 1.00 66.15  ? 130 ALA L CB  1 
ATOM   2720 N N   . SER B 2 137 ? -47.125 47.386 -126.942 1.00 60.59  ? 131 SER L N   1 
ATOM   2721 C CA  . SER B 2 137 ? -47.649 46.966 -128.245 1.00 57.37  ? 131 SER L CA  1 
ATOM   2722 C C   . SER B 2 137 ? -46.521 46.657 -129.225 1.00 54.81  ? 131 SER L C   1 
ATOM   2723 O O   . SER B 2 137 ? -45.619 47.482 -129.420 1.00 60.93  ? 131 SER L O   1 
ATOM   2724 C CB  . SER B 2 137 ? -48.554 48.043 -128.830 1.00 53.37  ? 131 SER L CB  1 
ATOM   2725 O OG  . SER B 2 137 ? -49.807 48.058 -128.172 1.00 56.64  ? 131 SER L OG  1 
ATOM   2726 N N   . VAL B 2 138 ? -46.548 45.470 -129.826 1.00 41.12  ? 132 VAL L N   1 
ATOM   2727 C CA  . VAL B 2 138 ? -45.602 45.190 -130.901 1.00 45.69  ? 132 VAL L CA  1 
ATOM   2728 C C   . VAL B 2 138 ? -46.345 45.147 -132.235 1.00 56.18  ? 132 VAL L C   1 
ATOM   2729 O O   . VAL B 2 138 ? -47.323 44.398 -132.383 1.00 61.06  ? 132 VAL L O   1 
ATOM   2730 C CB  . VAL B 2 138 ? -44.845 43.865 -130.710 1.00 45.73  ? 132 VAL L CB  1 
ATOM   2731 C CG1 . VAL B 2 138 ? -43.723 43.772 -131.730 1.00 39.09  ? 132 VAL L CG1 1 
ATOM   2732 C CG2 . VAL B 2 138 ? -44.295 43.752 -129.313 1.00 46.07  ? 132 VAL L CG2 1 
ATOM   2733 N N   . VAL B 2 139 ? -45.886 45.946 -133.198 1.00 50.23  ? 133 VAL L N   1 
ATOM   2734 C CA  . VAL B 2 139 ? -46.564 46.031 -134.491 1.00 48.93  ? 133 VAL L CA  1 
ATOM   2735 C C   . VAL B 2 139 ? -45.826 45.321 -135.637 1.00 54.68  ? 133 VAL L C   1 
ATOM   2736 O O   . VAL B 2 139 ? -44.624 45.523 -135.872 1.00 53.78  ? 133 VAL L O   1 
ATOM   2737 C CB  . VAL B 2 139 ? -46.857 47.485 -134.910 1.00 45.80  ? 133 VAL L CB  1 
ATOM   2738 C CG1 . VAL B 2 139 ? -47.411 47.503 -136.320 1.00 44.57  ? 133 VAL L CG1 1 
ATOM   2739 C CG2 . VAL B 2 139 ? -47.825 48.153 -133.947 1.00 29.53  ? 133 VAL L CG2 1 
ATOM   2740 N N   . CYS B 2 140 ? -46.574 44.484 -136.346 1.00 53.78  ? 134 CYS L N   1 
ATOM   2741 C CA  . CYS B 2 140 ? -46.068 43.801 -137.521 1.00 54.78  ? 134 CYS L CA  1 
ATOM   2742 C C   . CYS B 2 140 ? -46.780 44.345 -138.733 1.00 55.89  ? 134 CYS L C   1 
ATOM   2743 O O   . CYS B 2 140 ? -48.007 44.462 -138.733 1.00 58.21  ? 134 CYS L O   1 
ATOM   2744 C CB  . CYS B 2 140 ? -46.350 42.312 -137.422 1.00 61.06  ? 134 CYS L CB  1 
ATOM   2745 S SG  . CYS B 2 140 ? -45.407 41.333 -138.587 1.00 81.71  ? 134 CYS L SG  1 
ATOM   2746 N N   . LEU B 2 141 ? -46.010 44.681 -139.762 1.00 56.75  ? 135 LEU L N   1 
ATOM   2747 C CA  . LEU B 2 141 ? -46.563 45.258 -140.983 1.00 48.76  ? 135 LEU L CA  1 
ATOM   2748 C C   . LEU B 2 141 ? -46.269 44.399 -142.210 1.00 47.70  ? 135 LEU L C   1 
ATOM   2749 O O   . LEU B 2 141 ? -45.128 44.042 -142.469 1.00 54.71  ? 135 LEU L O   1 
ATOM   2750 C CB  . LEU B 2 141 ? -46.013 46.658 -141.197 1.00 46.98  ? 135 LEU L CB  1 
ATOM   2751 C CG  . LEU B 2 141 ? -46.410 47.291 -142.524 1.00 53.39  ? 135 LEU L CG  1 
ATOM   2752 C CD1 . LEU B 2 141 ? -47.860 47.742 -142.468 1.00 50.36  ? 135 LEU L CD1 1 
ATOM   2753 C CD2 . LEU B 2 141 ? -45.492 48.465 -142.852 1.00 57.11  ? 135 LEU L CD2 1 
ATOM   2754 N N   . LEU B 2 142 ? -47.321 44.052 -142.940 1.00 45.14  ? 136 LEU L N   1 
ATOM   2755 C CA  . LEU B 2 142 ? -47.210 43.396 -144.232 1.00 43.63  ? 136 LEU L CA  1 
ATOM   2756 C C   . LEU B 2 142 ? -47.593 44.421 -145.294 1.00 50.56  ? 136 LEU L C   1 
ATOM   2757 O O   . LEU B 2 142 ? -48.738 44.862 -145.355 1.00 56.42  ? 136 LEU L O   1 
ATOM   2758 C CB  . LEU B 2 142 ? -48.160 42.201 -144.315 1.00 42.24  ? 136 LEU L CB  1 
ATOM   2759 C CG  . LEU B 2 142 ? -47.817 40.899 -143.599 1.00 41.01  ? 136 LEU L CG  1 
ATOM   2760 C CD1 . LEU B 2 142 ? -47.594 41.117 -142.117 1.00 42.33  ? 136 LEU L CD1 1 
ATOM   2761 C CD2 . LEU B 2 142 ? -48.939 39.914 -143.800 1.00 43.35  ? 136 LEU L CD2 1 
ATOM   2762 N N   . ASN B 2 143 ? -46.632 44.803 -146.124 1.00 49.43  ? 137 ASN L N   1 
ATOM   2763 C CA  . ASN B 2 143 ? -46.824 45.899 -147.063 1.00 54.70  ? 137 ASN L CA  1 
ATOM   2764 C C   . ASN B 2 143 ? -46.988 45.430 -148.522 1.00 53.35  ? 137 ASN L C   1 
ATOM   2765 O O   . ASN B 2 143 ? -46.218 44.607 -149.013 1.00 55.70  ? 137 ASN L O   1 
ATOM   2766 C CB  . ASN B 2 143 ? -45.662 46.900 -146.932 1.00 61.61  ? 137 ASN L CB  1 
ATOM   2767 C CG  . ASN B 2 143 ? -46.054 48.315 -147.327 1.00 67.20  ? 137 ASN L CG  1 
ATOM   2768 O OD1 . ASN B 2 143 ? -47.157 48.771 -147.034 1.00 70.81  ? 137 ASN L OD1 1 
ATOM   2769 N ND2 . ASN B 2 143 ? -45.145 49.019 -147.985 1.00 68.74  ? 137 ASN L ND2 1 
ATOM   2770 N N   . ASN B 2 144 ? -48.014 45.944 -149.193 1.00 47.61  ? 138 ASN L N   1 
ATOM   2771 C CA  . ASN B 2 144 ? -48.224 45.694 -150.613 1.00 53.85  ? 138 ASN L CA  1 
ATOM   2772 C C   . ASN B 2 144 ? -48.137 44.237 -151.048 1.00 55.52  ? 138 ASN L C   1 
ATOM   2773 O O   . ASN B 2 144 ? -47.205 43.846 -151.745 1.00 61.73  ? 138 ASN L O   1 
ATOM   2774 C CB  . ASN B 2 144 ? -47.254 46.528 -151.439 1.00 56.19  ? 138 ASN L CB  1 
ATOM   2775 C CG  . ASN B 2 144 ? -47.105 47.927 -150.907 1.00 67.98  ? 138 ASN L CG  1 
ATOM   2776 O OD1 . ASN B 2 144 ? -48.086 48.562 -150.505 1.00 74.88  ? 138 ASN L OD1 1 
ATOM   2777 N ND2 . ASN B 2 144 ? -45.873 48.424 -150.894 1.00 66.54  ? 138 ASN L ND2 1 
ATOM   2778 N N   . PHE B 2 145 ? -49.121 43.441 -150.658 1.00 54.63  ? 139 PHE L N   1 
ATOM   2779 C CA  . PHE B 2 145 ? -49.209 42.067 -151.134 1.00 52.98  ? 139 PHE L CA  1 
ATOM   2780 C C   . PHE B 2 145 ? -50.514 41.811 -151.872 1.00 53.28  ? 139 PHE L C   1 
ATOM   2781 O O   . PHE B 2 145 ? -51.376 42.683 -151.943 1.00 57.41  ? 139 PHE L O   1 
ATOM   2782 C CB  . PHE B 2 145 ? -49.057 41.080 -149.984 1.00 48.68  ? 139 PHE L CB  1 
ATOM   2783 C CG  . PHE B 2 145 ? -50.044 41.287 -148.866 1.00 48.23  ? 139 PHE L CG  1 
ATOM   2784 C CD1 . PHE B 2 145 ? -51.207 40.541 -148.802 1.00 51.44  ? 139 PHE L CD1 1 
ATOM   2785 C CD2 . PHE B 2 145 ? -49.796 42.206 -147.868 1.00 45.67  ? 139 PHE L CD2 1 
ATOM   2786 C CE1 . PHE B 2 145 ? -52.102 40.713 -147.777 1.00 48.68  ? 139 PHE L CE1 1 
ATOM   2787 C CE2 . PHE B 2 145 ? -50.686 42.380 -146.836 1.00 48.14  ? 139 PHE L CE2 1 
ATOM   2788 C CZ  . PHE B 2 145 ? -51.835 41.631 -146.788 1.00 50.91  ? 139 PHE L CZ  1 
ATOM   2789 N N   . TYR B 2 146 ? -50.628 40.613 -152.437 1.00 52.93  ? 140 TYR L N   1 
ATOM   2790 C CA  . TYR B 2 146 ? -51.835 40.144 -153.112 1.00 50.68  ? 140 TYR L CA  1 
ATOM   2791 C C   . TYR B 2 146 ? -51.721 38.645 -153.245 1.00 50.86  ? 140 TYR L C   1 
ATOM   2792 O O   . TYR B 2 146 ? -50.654 38.138 -153.583 1.00 56.17  ? 140 TYR L O   1 
ATOM   2793 C CB  . TYR B 2 146 ? -51.994 40.751 -154.510 1.00 43.24  ? 140 TYR L CB  1 
ATOM   2794 C CG  . TYR B 2 146 ? -53.331 40.403 -155.105 1.00 50.73  ? 140 TYR L CG  1 
ATOM   2795 C CD1 . TYR B 2 146 ? -53.559 39.156 -155.670 1.00 56.59  ? 140 TYR L CD1 1 
ATOM   2796 C CD2 . TYR B 2 146 ? -54.384 41.307 -155.070 1.00 56.18  ? 140 TYR L CD2 1 
ATOM   2797 C CE1 . TYR B 2 146 ? -54.796 38.822 -156.198 1.00 56.92  ? 140 TYR L CE1 1 
ATOM   2798 C CE2 . TYR B 2 146 ? -55.625 40.984 -155.591 1.00 57.25  ? 140 TYR L CE2 1 
ATOM   2799 C CZ  . TYR B 2 146 ? -55.825 39.741 -156.153 1.00 55.46  ? 140 TYR L CZ  1 
ATOM   2800 O OH  . TYR B 2 146 ? -57.055 39.421 -156.670 1.00 56.04  ? 140 TYR L OH  1 
ATOM   2801 N N   . PRO B 2 147 ? -52.813 37.919 -152.999 1.00 47.24  ? 141 PRO L N   1 
ATOM   2802 C CA  . PRO B 2 147 ? -54.175 38.341 -152.657 1.00 48.13  ? 141 PRO L CA  1 
ATOM   2803 C C   . PRO B 2 147 ? -54.304 38.871 -151.216 1.00 51.30  ? 141 PRO L C   1 
ATOM   2804 O O   . PRO B 2 147 ? -53.316 38.981 -150.519 1.00 47.52  ? 141 PRO L O   1 
ATOM   2805 C CB  . PRO B 2 147 ? -54.960 37.033 -152.798 1.00 44.96  ? 141 PRO L CB  1 
ATOM   2806 C CG  . PRO B 2 147 ? -53.956 35.993 -152.421 1.00 42.99  ? 141 PRO L CG  1 
ATOM   2807 C CD  . PRO B 2 147 ? -52.728 36.455 -153.139 1.00 45.89  ? 141 PRO L CD  1 
ATOM   2808 N N   . ARG B 2 148 ? -55.521 39.190 -150.785 1.00 57.64  ? 142 ARG L N   1 
ATOM   2809 C CA  . ARG B 2 148 ? -55.745 39.760 -149.465 1.00 59.01  ? 142 ARG L CA  1 
ATOM   2810 C C   . ARG B 2 148 ? -55.364 38.776 -148.363 1.00 54.95  ? 142 ARG L C   1 
ATOM   2811 O O   . ARG B 2 148 ? -54.715 39.137 -147.396 1.00 58.55  ? 142 ARG L O   1 
ATOM   2812 C CB  . ARG B 2 148 ? -57.209 40.187 -149.297 1.00 67.49  ? 142 ARG L CB  1 
ATOM   2813 C CG  . ARG B 2 148 ? -57.549 40.711 -147.899 1.00 76.63  ? 142 ARG L CG  1 
ATOM   2814 C CD  . ARG B 2 148 ? -59.055 40.828 -147.653 1.00 85.31  ? 142 ARG L CD  1 
ATOM   2815 N NE  . ARG B 2 148 ? -59.699 41.737 -148.597 1.00 99.29  ? 142 ARG L NE  1 
ATOM   2816 C CZ  . ARG B 2 148 ? -61.010 41.964 -148.657 1.00 113.95 ? 142 ARG L CZ  1 
ATOM   2817 N NH1 . ARG B 2 148 ? -61.839 41.349 -147.819 1.00 117.59 ? 142 ARG L NH1 1 
ATOM   2818 N NH2 . ARG B 2 148 ? -61.498 42.808 -149.562 1.00 117.90 ? 142 ARG L NH2 1 
ATOM   2819 N N   . GLU B 2 149 ? -55.768 37.527 -148.516 1.00 50.36  ? 143 GLU L N   1 
ATOM   2820 C CA  . GLU B 2 149 ? -55.587 36.536 -147.464 1.00 51.72  ? 143 GLU L CA  1 
ATOM   2821 C C   . GLU B 2 149 ? -54.116 36.274 -147.130 1.00 53.36  ? 143 GLU L C   1 
ATOM   2822 O O   . GLU B 2 149 ? -53.335 35.874 -147.982 1.00 57.32  ? 143 GLU L O   1 
ATOM   2823 C CB  . GLU B 2 149 ? -56.327 35.239 -147.819 1.00 49.49  ? 143 GLU L CB  1 
ATOM   2824 C CG  . GLU B 2 149 ? -56.652 35.096 -149.300 1.00 66.09  ? 143 GLU L CG  1 
ATOM   2825 C CD  . GLU B 2 149 ? -57.730 36.076 -149.791 1.00 76.84  ? 143 GLU L CD  1 
ATOM   2826 O OE1 . GLU B 2 149 ? -57.454 36.837 -150.750 1.00 78.48  ? 143 GLU L OE1 1 
ATOM   2827 O OE2 . GLU B 2 149 ? -58.849 36.090 -149.225 1.00 78.44  ? 143 GLU L OE2 1 
ATOM   2828 N N   . ALA B 2 150 ? -53.762 36.522 -145.875 1.00 55.02  ? 144 ALA L N   1 
ATOM   2829 C CA  . ALA B 2 150 ? -52.418 36.298 -145.348 1.00 57.73  ? 144 ALA L CA  1 
ATOM   2830 C C   . ALA B 2 150 ? -52.576 35.853 -143.909 1.00 62.16  ? 144 ALA L C   1 
ATOM   2831 O O   . ALA B 2 150 ? -53.485 36.307 -143.222 1.00 67.78  ? 144 ALA L O   1 
ATOM   2832 C CB  . ALA B 2 150 ? -51.612 37.572 -145.401 1.00 53.08  ? 144 ALA L CB  1 
ATOM   2833 N N   . LYS B 2 151 ? -51.708 34.964 -143.443 1.00 63.13  ? 145 LYS L N   1 
ATOM   2834 C CA  . LYS B 2 151 ? -51.781 34.518 -142.052 1.00 61.94  ? 145 LYS L CA  1 
ATOM   2835 C C   . LYS B 2 151 ? -50.651 35.098 -141.202 1.00 62.23  ? 145 LYS L C   1 
ATOM   2836 O O   . LYS B 2 151 ? -49.473 34.807 -141.423 1.00 62.03  ? 145 LYS L O   1 
ATOM   2837 C CB  . LYS B 2 151 ? -51.776 32.994 -141.964 1.00 60.99  ? 145 LYS L CB  1 
ATOM   2838 C CG  . LYS B 2 151 ? -52.053 32.473 -140.563 1.00 68.03  ? 145 LYS L CG  1 
ATOM   2839 C CD  . LYS B 2 151 ? -52.443 30.991 -140.563 1.00 74.91  ? 145 LYS L CD  1 
ATOM   2840 C CE  . LYS B 2 151 ? -51.302 30.082 -140.113 1.00 82.07  ? 145 LYS L CE  1 
ATOM   2841 N NZ  . LYS B 2 151 ? -50.065 30.220 -140.939 1.00 88.32  ? 145 LYS L NZ  1 
ATOM   2842 N N   . VAL B 2 152 ? -51.008 35.932 -140.233 1.00 61.27  ? 146 VAL L N   1 
ATOM   2843 C CA  . VAL B 2 152 ? -50.005 36.472 -139.325 1.00 59.26  ? 146 VAL L CA  1 
ATOM   2844 C C   . VAL B 2 152 ? -50.071 35.807 -137.957 1.00 65.96  ? 146 VAL L C   1 
ATOM   2845 O O   . VAL B 2 152 ? -51.098 35.835 -137.271 1.00 70.95  ? 146 VAL L O   1 
ATOM   2846 C CB  . VAL B 2 152 ? -50.105 37.993 -139.187 1.00 55.12  ? 146 VAL L CB  1 
ATOM   2847 C CG1 . VAL B 2 152 ? -49.129 38.472 -138.159 1.00 51.60  ? 146 VAL L CG1 1 
ATOM   2848 C CG2 . VAL B 2 152 ? -49.815 38.660 -140.528 1.00 65.00  ? 146 VAL L CG2 1 
ATOM   2849 N N   . GLN B 2 153 ? -48.955 35.210 -137.567 1.00 68.24  ? 147 GLN L N   1 
ATOM   2850 C CA  . GLN B 2 153 ? -48.870 34.468 -136.325 1.00 66.47  ? 147 GLN L CA  1 
ATOM   2851 C C   . GLN B 2 153 ? -47.721 34.996 -135.469 1.00 70.52  ? 147 GLN L C   1 
ATOM   2852 O O   . GLN B 2 153 ? -46.567 34.987 -135.897 1.00 75.92  ? 147 GLN L O   1 
ATOM   2853 C CB  . GLN B 2 153 ? -48.635 33.008 -136.649 1.00 65.67  ? 147 GLN L CB  1 
ATOM   2854 C CG  . GLN B 2 153 ? -49.254 32.057 -135.691 1.00 77.83  ? 147 GLN L CG  1 
ATOM   2855 C CD  . GLN B 2 153 ? -49.482 30.704 -136.322 1.00 85.25  ? 147 GLN L CD  1 
ATOM   2856 O OE1 . GLN B 2 153 ? -49.100 30.474 -137.468 1.00 81.67  ? 147 GLN L OE1 1 
ATOM   2857 N NE2 . GLN B 2 153 ? -50.115 29.799 -135.580 1.00 89.62  ? 147 GLN L NE2 1 
ATOM   2858 N N   . TRP B 2 154 ? -48.041 35.458 -134.263 1.00 68.77  ? 148 TRP L N   1 
ATOM   2859 C CA  . TRP B 2 154 ? -47.042 35.939 -133.313 1.00 62.23  ? 148 TRP L CA  1 
ATOM   2860 C C   . TRP B 2 154 ? -46.495 34.824 -132.438 1.00 68.38  ? 148 TRP L C   1 
ATOM   2861 O O   . TRP B 2 154 ? -47.266 34.079 -131.834 1.00 70.49  ? 148 TRP L O   1 
ATOM   2862 C CB  . TRP B 2 154 ? -47.679 36.951 -132.391 1.00 56.90  ? 148 TRP L CB  1 
ATOM   2863 C CG  . TRP B 2 154 ? -47.962 38.253 -133.019 1.00 59.69  ? 148 TRP L CG  1 
ATOM   2864 C CD1 . TRP B 2 154 ? -49.167 38.700 -133.471 1.00 57.63  ? 148 TRP L CD1 1 
ATOM   2865 C CD2 . TRP B 2 154 ? -47.028 39.311 -133.240 1.00 57.02  ? 148 TRP L CD2 1 
ATOM   2866 N NE1 . TRP B 2 154 ? -49.042 39.971 -133.963 1.00 59.85  ? 148 TRP L NE1 1 
ATOM   2867 C CE2 . TRP B 2 154 ? -47.737 40.372 -133.835 1.00 57.82  ? 148 TRP L CE2 1 
ATOM   2868 C CE3 . TRP B 2 154 ? -45.659 39.465 -132.989 1.00 54.11  ? 148 TRP L CE3 1 
ATOM   2869 C CZ2 . TRP B 2 154 ? -47.126 41.572 -134.193 1.00 61.99  ? 148 TRP L CZ2 1 
ATOM   2870 C CZ3 . TRP B 2 154 ? -45.049 40.656 -133.347 1.00 59.82  ? 148 TRP L CZ3 1 
ATOM   2871 C CH2 . TRP B 2 154 ? -45.783 41.694 -133.943 1.00 65.51  ? 148 TRP L CH2 1 
ATOM   2872 N N   . LYS B 2 155 ? -45.171 34.718 -132.355 1.00 69.36  ? 149 LYS L N   1 
ATOM   2873 C CA  . LYS B 2 155 ? -44.538 33.790 -131.420 1.00 68.36  ? 149 LYS L CA  1 
ATOM   2874 C C   . LYS B 2 155 ? -43.604 34.515 -130.450 1.00 71.11  ? 149 LYS L C   1 
ATOM   2875 O O   . LYS B 2 155 ? -42.512 34.933 -130.833 1.00 84.90  ? 149 LYS L O   1 
ATOM   2876 C CB  . LYS B 2 155 ? -43.768 32.697 -132.167 1.00 64.19  ? 149 LYS L CB  1 
ATOM   2877 C CG  . LYS B 2 155 ? -44.637 31.809 -133.046 1.00 73.90  ? 149 LYS L CG  1 
ATOM   2878 C CD  . LYS B 2 155 ? -43.823 30.691 -133.700 1.00 81.81  ? 149 LYS L CD  1 
ATOM   2879 C CE  . LYS B 2 155 ? -44.223 30.484 -135.168 1.00 82.53  ? 149 LYS L CE  1 
ATOM   2880 N NZ  . LYS B 2 155 ? -43.400 29.451 -135.873 1.00 80.14  ? 149 LYS L NZ  1 
ATOM   2881 N N   . VAL B 2 156 ? -44.035 34.657 -129.199 1.00 80.67  ? 150 VAL L N   1 
ATOM   2882 C CA  . VAL B 2 156 ? -43.190 35.204 -128.133 1.00 80.61  ? 150 VAL L CA  1 
ATOM   2883 C C   . VAL B 2 156 ? -42.305 34.086 -127.579 1.00 79.99  ? 150 VAL L C   1 
ATOM   2884 O O   . VAL B 2 156 ? -42.809 33.041 -127.172 1.00 80.23  ? 150 VAL L O   1 
ATOM   2885 C CB  . VAL B 2 156 ? -44.035 35.803 -126.970 1.00 71.58  ? 150 VAL L CB  1 
ATOM   2886 C CG1 . VAL B 2 156 ? -43.147 36.501 -125.957 1.00 77.87  ? 150 VAL L CG1 1 
ATOM   2887 C CG2 . VAL B 2 156 ? -45.071 36.776 -127.488 1.00 68.02  ? 150 VAL L CG2 1 
ATOM   2888 N N   . ASP B 2 157 ? -40.991 34.303 -127.564 1.00 79.65  ? 151 ASP L N   1 
ATOM   2889 C CA  . ASP B 2 157 ? -40.045 33.253 -127.176 1.00 84.52  ? 151 ASP L CA  1 
ATOM   2890 C C   . ASP B 2 157 ? -40.453 31.906 -127.747 1.00 84.96  ? 151 ASP L C   1 
ATOM   2891 O O   . ASP B 2 157 ? -40.475 30.911 -127.033 1.00 84.27  ? 151 ASP L O   1 
ATOM   2892 C CB  . ASP B 2 157 ? -39.927 33.139 -125.653 1.00 86.13  ? 151 ASP L CB  1 
ATOM   2893 C CG  . ASP B 2 157 ? -38.882 34.073 -125.074 1.00 90.03  ? 151 ASP L CG  1 
ATOM   2894 O OD1 . ASP B 2 157 ? -37.891 34.377 -125.773 1.00 85.37  ? 151 ASP L OD1 1 
ATOM   2895 O OD2 . ASP B 2 157 ? -39.053 34.503 -123.912 1.00 96.73  ? 151 ASP L OD2 1 
ATOM   2896 N N   . ASN B 2 158 ? -40.790 31.882 -129.031 1.00 86.98  ? 152 ASN L N   1 
ATOM   2897 C CA  . ASN B 2 158 ? -41.194 30.645 -129.689 1.00 89.29  ? 152 ASN L CA  1 
ATOM   2898 C C   . ASN B 2 158 ? -42.557 30.131 -129.268 1.00 84.22  ? 152 ASN L C   1 
ATOM   2899 O O   . ASN B 2 158 ? -43.029 29.118 -129.788 1.00 84.54  ? 152 ASN L O   1 
ATOM   2900 C CB  . ASN B 2 158 ? -40.153 29.555 -129.462 1.00 93.31  ? 152 ASN L CB  1 
ATOM   2901 C CG  . ASN B 2 158 ? -38.958 29.728 -130.338 1.00 99.17  ? 152 ASN L CG  1 
ATOM   2902 O OD1 . ASN B 2 158 ? -39.091 29.868 -131.554 1.00 100.23 ? 152 ASN L OD1 1 
ATOM   2903 N ND2 . ASN B 2 158 ? -37.774 29.733 -129.734 1.00 101.96 ? 152 ASN L ND2 1 
ATOM   2904 N N   . ALA B 2 159 ? -43.188 30.817 -128.324 1.00 78.77  ? 153 ALA L N   1 
ATOM   2905 C CA  . ALA B 2 159 ? -44.506 30.398 -127.866 1.00 82.01  ? 153 ALA L CA  1 
ATOM   2906 C C   . ALA B 2 159 ? -45.592 30.998 -128.745 1.00 81.35  ? 153 ALA L C   1 
ATOM   2907 O O   . ALA B 2 159 ? -45.805 32.210 -128.745 1.00 83.37  ? 153 ALA L O   1 
ATOM   2908 C CB  . ALA B 2 159 ? -44.719 30.788 -126.420 1.00 81.51  ? 153 ALA L CB  1 
ATOM   2909 N N   . LEU B 2 160 ? -46.271 30.147 -129.502 1.00 74.67  ? 154 LEU L N   1 
ATOM   2910 C CA  . LEU B 2 160 ? -47.353 30.602 -130.356 1.00 77.87  ? 154 LEU L CA  1 
ATOM   2911 C C   . LEU B 2 160 ? -48.442 31.342 -129.567 1.00 77.67  ? 154 LEU L C   1 
ATOM   2912 O O   . LEU B 2 160 ? -49.076 30.764 -128.695 1.00 80.44  ? 154 LEU L O   1 
ATOM   2913 C CB  . LEU B 2 160 ? -47.953 29.419 -131.094 1.00 85.46  ? 154 LEU L CB  1 
ATOM   2914 C CG  . LEU B 2 160 ? -49.254 29.767 -131.800 1.00 95.39  ? 154 LEU L CG  1 
ATOM   2915 C CD1 . LEU B 2 160 ? -49.051 30.989 -132.680 1.00 95.60  ? 154 LEU L CD1 1 
ATOM   2916 C CD2 . LEU B 2 160 ? -49.727 28.578 -132.610 1.00 102.49 ? 154 LEU L CD2 1 
ATOM   2917 N N   . GLN B 2 161 ? -48.658 32.616 -129.889 1.00 72.14  ? 155 GLN L N   1 
ATOM   2918 C CA  . GLN B 2 161 ? -49.606 33.462 -129.166 1.00 64.92  ? 155 GLN L CA  1 
ATOM   2919 C C   . GLN B 2 161 ? -51.022 33.321 -129.675 1.00 68.97  ? 155 GLN L C   1 
ATOM   2920 O O   . GLN B 2 161 ? -51.262 32.752 -130.732 1.00 72.70  ? 155 GLN L O   1 
ATOM   2921 C CB  . GLN B 2 161 ? -49.220 34.930 -129.297 1.00 61.93  ? 155 GLN L CB  1 
ATOM   2922 C CG  . GLN B 2 161 ? -47.869 35.267 -128.728 1.00 67.27  ? 155 GLN L CG  1 
ATOM   2923 C CD  . GLN B 2 161 ? -47.740 34.859 -127.278 1.00 66.17  ? 155 GLN L CD  1 
ATOM   2924 O OE1 . GLN B 2 161 ? -48.588 35.194 -126.444 1.00 62.09  ? 155 GLN L OE1 1 
ATOM   2925 N NE2 . GLN B 2 161 ? -46.674 34.133 -126.967 1.00 63.93  ? 155 GLN L NE2 1 
ATOM   2926 N N   . SER B 2 162 ? -51.959 33.874 -128.919 1.00 72.58  ? 156 SER L N   1 
ATOM   2927 C CA  . SER B 2 162 ? -53.348 33.961 -129.355 1.00 79.25  ? 156 SER L CA  1 
ATOM   2928 C C   . SER B 2 162 ? -54.142 34.817 -128.368 1.00 73.53  ? 156 SER L C   1 
ATOM   2929 O O   . SER B 2 162 ? -53.709 35.021 -127.236 1.00 73.81  ? 156 SER L O   1 
ATOM   2930 C CB  . SER B 2 162 ? -53.970 32.567 -129.503 1.00 82.17  ? 156 SER L CB  1 
ATOM   2931 O OG  . SER B 2 162 ? -53.799 31.792 -128.329 1.00 83.11  ? 156 SER L OG  1 
ATOM   2932 N N   . GLY B 2 163 ? -55.281 35.339 -128.809 1.00 63.42  ? 157 GLY L N   1 
ATOM   2933 C CA  . GLY B 2 163 ? -56.132 36.144 -127.955 1.00 61.86  ? 157 GLY L CA  1 
ATOM   2934 C C   . GLY B 2 163 ? -55.544 37.483 -127.533 1.00 71.71  ? 157 GLY L C   1 
ATOM   2935 O O   . GLY B 2 163 ? -56.205 38.266 -126.836 1.00 80.62  ? 157 GLY L O   1 
ATOM   2936 N N   . ASN B 2 164 ? -54.313 37.762 -127.950 1.00 66.89  ? 158 ASN L N   1 
ATOM   2937 C CA  . ASN B 2 164 ? -53.654 39.006 -127.560 1.00 66.29  ? 158 ASN L CA  1 
ATOM   2938 C C   . ASN B 2 164 ? -53.254 39.870 -128.750 1.00 70.18  ? 158 ASN L C   1 
ATOM   2939 O O   . ASN B 2 164 ? -52.398 40.751 -128.622 1.00 73.70  ? 158 ASN L O   1 
ATOM   2940 C CB  . ASN B 2 164 ? -52.423 38.717 -126.699 1.00 59.11  ? 158 ASN L CB  1 
ATOM   2941 C CG  . ASN B 2 164 ? -51.519 37.672 -127.320 1.00 65.71  ? 158 ASN L CG  1 
ATOM   2942 O OD1 . ASN B 2 164 ? -51.867 37.057 -128.329 1.00 73.05  ? 158 ASN L OD1 1 
ATOM   2943 N ND2 . ASN B 2 164 ? -50.357 37.457 -126.718 1.00 65.60  ? 158 ASN L ND2 1 
ATOM   2944 N N   . SER B 2 165 ? -53.871 39.622 -129.901 1.00 69.62  ? 159 SER L N   1 
ATOM   2945 C CA  . SER B 2 165 ? -53.558 40.391 -131.107 1.00 69.88  ? 159 SER L CA  1 
ATOM   2946 C C   . SER B 2 165 ? -54.780 40.803 -131.905 1.00 73.29  ? 159 SER L C   1 
ATOM   2947 O O   . SER B 2 165 ? -55.821 40.136 -131.880 1.00 76.39  ? 159 SER L O   1 
ATOM   2948 C CB  . SER B 2 165 ? -52.607 39.613 -132.013 1.00 66.30  ? 159 SER L CB  1 
ATOM   2949 O OG  . SER B 2 165 ? -52.877 38.224 -131.940 1.00 70.04  ? 159 SER L OG  1 
ATOM   2950 N N   . GLN B 2 166 ? -54.637 41.917 -132.614 1.00 72.49  ? 160 GLN L N   1 
ATOM   2951 C CA  . GLN B 2 166 ? -55.639 42.369 -133.565 1.00 68.03  ? 160 GLN L CA  1 
ATOM   2952 C C   . GLN B 2 166 ? -54.922 42.606 -134.884 1.00 65.88  ? 160 GLN L C   1 
ATOM   2953 O O   . GLN B 2 166 ? -53.748 42.988 -134.895 1.00 63.59  ? 160 GLN L O   1 
ATOM   2954 C CB  . GLN B 2 166 ? -56.301 43.669 -133.086 1.00 63.69  ? 160 GLN L CB  1 
ATOM   2955 C CG  . GLN B 2 166 ? -56.912 43.611 -131.694 1.00 67.66  ? 160 GLN L CG  1 
ATOM   2956 C CD  . GLN B 2 166 ? -58.241 42.856 -131.659 1.00 84.18  ? 160 GLN L CD  1 
ATOM   2957 O OE1 . GLN B 2 166 ? -58.738 42.395 -132.687 1.00 90.28  ? 160 GLN L OE1 1 
ATOM   2958 N NE2 . GLN B 2 166 ? -58.824 42.736 -130.470 1.00 89.53  ? 160 GLN L NE2 1 
ATOM   2959 N N   . GLU B 2 167 ? -55.611 42.362 -135.994 1.00 64.17  ? 161 GLU L N   1 
ATOM   2960 C CA  . GLU B 2 167 ? -55.097 42.789 -137.284 1.00 55.67  ? 161 GLU L CA  1 
ATOM   2961 C C   . GLU B 2 167 ? -56.092 43.633 -138.052 1.00 55.71  ? 161 GLU L C   1 
ATOM   2962 O O   . GLU B 2 167 ? -57.278 43.666 -137.740 1.00 56.41  ? 161 GLU L O   1 
ATOM   2963 C CB  . GLU B 2 167 ? -54.582 41.617 -138.126 1.00 62.88  ? 161 GLU L CB  1 
ATOM   2964 C CG  . GLU B 2 167 ? -55.589 40.550 -138.493 1.00 69.29  ? 161 GLU L CG  1 
ATOM   2965 C CD  . GLU B 2 167 ? -54.949 39.439 -139.342 1.00 83.21  ? 161 GLU L CD  1 
ATOM   2966 O OE1 . GLU B 2 167 ? -53.844 38.962 -138.985 1.00 84.92  ? 161 GLU L OE1 1 
ATOM   2967 O OE2 . GLU B 2 167 ? -55.544 39.042 -140.368 1.00 85.87  ? 161 GLU L OE2 1 
ATOM   2968 N N   . SER B 2 168 ? -55.582 44.343 -139.048 1.00 62.51  ? 162 SER L N   1 
ATOM   2969 C CA  . SER B 2 168 ? -56.401 45.174 -139.912 1.00 59.83  ? 162 SER L CA  1 
ATOM   2970 C C   . SER B 2 168 ? -55.780 45.196 -141.309 1.00 61.52  ? 162 SER L C   1 
ATOM   2971 O O   . SER B 2 168 ? -54.557 45.225 -141.458 1.00 63.51  ? 162 SER L O   1 
ATOM   2972 C CB  . SER B 2 168 ? -56.484 46.586 -139.343 1.00 58.58  ? 162 SER L CB  1 
ATOM   2973 O OG  . SER B 2 168 ? -57.502 47.337 -139.976 1.00 58.90  ? 162 SER L OG  1 
ATOM   2974 N N   . VAL B 2 169 ? -56.632 45.178 -142.327 1.00 51.68  ? 163 VAL L N   1 
ATOM   2975 C CA  . VAL B 2 169 ? -56.200 45.163 -143.711 1.00 52.30  ? 163 VAL L CA  1 
ATOM   2976 C C   . VAL B 2 169 ? -56.741 46.390 -144.415 1.00 53.74  ? 163 VAL L C   1 
ATOM   2977 O O   . VAL B 2 169 ? -57.883 46.778 -144.202 1.00 56.82  ? 163 VAL L O   1 
ATOM   2978 C CB  . VAL B 2 169 ? -56.745 43.932 -144.441 1.00 54.83  ? 163 VAL L CB  1 
ATOM   2979 C CG1 . VAL B 2 169 ? -56.268 43.924 -145.882 1.00 51.89  ? 163 VAL L CG1 1 
ATOM   2980 C CG2 . VAL B 2 169 ? -56.309 42.665 -143.726 1.00 56.73  ? 163 VAL L CG2 1 
ATOM   2981 N N   . THR B 2 170 ? -55.925 47.005 -145.257 1.00 51.04  ? 164 THR L N   1 
ATOM   2982 C CA  . THR B 2 170 ? -56.378 48.170 -145.999 1.00 53.28  ? 164 THR L CA  1 
ATOM   2983 C C   . THR B 2 170 ? -57.370 47.786 -147.105 1.00 58.80  ? 164 THR L C   1 
ATOM   2984 O O   . THR B 2 170 ? -57.645 46.605 -147.336 1.00 58.67  ? 164 THR L O   1 
ATOM   2985 C CB  . THR B 2 170 ? -55.191 48.909 -146.631 1.00 56.25  ? 164 THR L CB  1 
ATOM   2986 O OG1 . THR B 2 170 ? -54.413 47.984 -147.391 1.00 56.66  ? 164 THR L OG1 1 
ATOM   2987 C CG2 . THR B 2 170 ? -54.314 49.489 -145.565 1.00 60.07  ? 164 THR L CG2 1 
ATOM   2988 N N   . GLU B 2 171 ? -57.916 48.791 -147.782 1.00 56.33  ? 165 GLU L N   1 
ATOM   2989 C CA  . GLU B 2 171 ? -58.684 48.541 -148.980 1.00 56.18  ? 165 GLU L CA  1 
ATOM   2990 C C   . GLU B 2 171 ? -57.720 48.446 -150.159 1.00 62.97  ? 165 GLU L C   1 
ATOM   2991 O O   . GLU B 2 171 ? -56.572 48.876 -150.058 1.00 62.39  ? 165 GLU L O   1 
ATOM   2992 C CB  . GLU B 2 171 ? -59.720 49.630 -149.184 1.00 64.78  ? 165 GLU L CB  1 
ATOM   2993 C CG  . GLU B 2 171 ? -61.022 49.360 -148.426 1.00 82.53  ? 165 GLU L CG  1 
ATOM   2994 C CD  . GLU B 2 171 ? -61.712 48.067 -148.864 1.00 95.00  ? 165 GLU L CD  1 
ATOM   2995 O OE1 . GLU B 2 171 ? -61.236 47.411 -149.827 1.00 104.41 ? 165 GLU L OE1 1 
ATOM   2996 O OE2 . GLU B 2 171 ? -62.736 47.706 -148.245 1.00 91.86  ? 165 GLU L OE2 1 
ATOM   2997 N N   . GLN B 2 172 ? -58.164 47.857 -151.261 1.00 63.26  ? 166 GLN L N   1 
ATOM   2998 C CA  . GLN B 2 172 ? -57.246 47.589 -152.360 1.00 57.53  ? 166 GLN L CA  1 
ATOM   2999 C C   . GLN B 2 172 ? -56.668 48.898 -152.838 1.00 58.18  ? 166 GLN L C   1 
ATOM   3000 O O   . GLN B 2 172 ? -57.401 49.855 -153.065 1.00 54.38  ? 166 GLN L O   1 
ATOM   3001 C CB  . GLN B 2 172 ? -57.946 46.876 -153.510 1.00 49.94  ? 166 GLN L CB  1 
ATOM   3002 C CG  . GLN B 2 172 ? -56.988 46.235 -154.460 1.00 51.99  ? 166 GLN L CG  1 
ATOM   3003 C CD  . GLN B 2 172 ? -57.685 45.339 -155.452 1.00 55.74  ? 166 GLN L CD  1 
ATOM   3004 O OE1 . GLN B 2 172 ? -58.887 45.474 -155.679 1.00 50.72  ? 166 GLN L OE1 1 
ATOM   3005 N NE2 . GLN B 2 172 ? -56.934 44.404 -156.044 1.00 51.11  ? 166 GLN L NE2 1 
ATOM   3006 N N   . ASP B 2 173 ? -55.349 48.937 -152.968 1.00 57.98  ? 167 ASP L N   1 
ATOM   3007 C CA  . ASP B 2 173 ? -54.652 50.144 -153.380 1.00 64.10  ? 167 ASP L CA  1 
ATOM   3008 C C   . ASP B 2 173 ? -55.138 50.557 -154.755 1.00 63.32  ? 167 ASP L C   1 
ATOM   3009 O O   . ASP B 2 173 ? -55.257 49.717 -155.649 1.00 66.44  ? 167 ASP L O   1 
ATOM   3010 C CB  . ASP B 2 173 ? -53.142 49.877 -153.420 1.00 76.88  ? 167 ASP L CB  1 
ATOM   3011 C CG  . ASP B 2 173 ? -52.327 51.125 -153.724 1.00 86.81  ? 167 ASP L CG  1 
ATOM   3012 O OD1 . ASP B 2 173 ? -51.712 51.188 -154.812 1.00 87.06  ? 167 ASP L OD1 1 
ATOM   3013 O OD2 . ASP B 2 173 ? -52.295 52.039 -152.869 1.00 94.13  ? 167 ASP L OD2 1 
ATOM   3014 N N   . SER B 2 174 ? -55.396 51.850 -154.930 1.00 65.13  ? 168 SER L N   1 
ATOM   3015 C CA  . SER B 2 174 ? -55.925 52.376 -156.196 1.00 60.70  ? 168 SER L CA  1 
ATOM   3016 C C   . SER B 2 174 ? -54.889 52.552 -157.313 1.00 59.76  ? 168 SER L C   1 
ATOM   3017 O O   . SER B 2 174 ? -55.243 52.980 -158.408 1.00 61.62  ? 168 SER L O   1 
ATOM   3018 C CB  . SER B 2 174 ? -56.611 53.713 -155.965 1.00 62.10  ? 168 SER L CB  1 
ATOM   3019 O OG  . SER B 2 174 ? -55.631 54.703 -155.713 1.00 67.61  ? 168 SER L OG  1 
ATOM   3020 N N   . LYS B 2 175 ? -53.619 52.239 -157.052 1.00 62.94  ? 169 LYS L N   1 
ATOM   3021 C CA  . LYS B 2 175 ? -52.617 52.237 -158.127 1.00 61.45  ? 169 LYS L CA  1 
ATOM   3022 C C   . LYS B 2 175 ? -52.081 50.849 -158.449 1.00 59.31  ? 169 LYS L C   1 
ATOM   3023 O O   . LYS B 2 175 ? -52.249 50.380 -159.561 1.00 62.54  ? 169 LYS L O   1 
ATOM   3024 C CB  . LYS B 2 175 ? -51.480 53.220 -157.852 1.00 66.70  ? 169 LYS L CB  1 
ATOM   3025 C CG  . LYS B 2 175 ? -51.922 54.674 -157.975 1.00 80.90  ? 169 LYS L CG  1 
ATOM   3026 C CD  . LYS B 2 175 ? -50.825 55.673 -157.612 1.00 89.94  ? 169 LYS L CD  1 
ATOM   3027 C CE  . LYS B 2 175 ? -51.437 56.989 -157.117 1.00 98.93  ? 169 LYS L CE  1 
ATOM   3028 N NZ  . LYS B 2 175 ? -50.436 57.975 -156.599 1.00 103.31 ? 169 LYS L NZ  1 
ATOM   3029 N N   . ASP B 2 176 ? -51.462 50.183 -157.477 1.00 59.36  ? 170 ASP L N   1 
ATOM   3030 C CA  . ASP B 2 176 ? -50.852 48.868 -157.717 1.00 53.88  ? 170 ASP L CA  1 
ATOM   3031 C C   . ASP B 2 176 ? -51.759 47.687 -157.354 1.00 55.51  ? 170 ASP L C   1 
ATOM   3032 O O   . ASP B 2 176 ? -51.351 46.525 -157.449 1.00 53.81  ? 170 ASP L O   1 
ATOM   3033 C CB  . ASP B 2 176 ? -49.507 48.736 -156.988 1.00 55.28  ? 170 ASP L CB  1 
ATOM   3034 C CG  . ASP B 2 176 ? -49.636 48.860 -155.478 1.00 74.40  ? 170 ASP L CG  1 
ATOM   3035 O OD1 . ASP B 2 176 ? -48.673 49.325 -154.833 1.00 81.60  ? 170 ASP L OD1 1 
ATOM   3036 O OD2 . ASP B 2 176 ? -50.697 48.498 -154.928 1.00 82.81  ? 170 ASP L OD2 1 
ATOM   3037 N N   . SER B 2 177 ? -52.976 47.991 -156.915 1.00 51.41  ? 171 SER L N   1 
ATOM   3038 C CA  . SER B 2 177 ? -53.973 46.962 -156.650 1.00 50.38  ? 171 SER L CA  1 
ATOM   3039 C C   . SER B 2 177 ? -53.577 45.961 -155.565 1.00 47.56  ? 171 SER L C   1 
ATOM   3040 O O   . SER B 2 177 ? -54.041 44.824 -155.567 1.00 55.39  ? 171 SER L O   1 
ATOM   3041 C CB  . SER B 2 177 ? -54.345 46.232 -157.954 1.00 52.60  ? 171 SER L CB  1 
ATOM   3042 O OG  . SER B 2 177 ? -54.998 47.100 -158.875 1.00 50.53  ? 171 SER L OG  1 
ATOM   3043 N N   . THR B 2 178 ? -52.737 46.377 -154.624 1.00 44.25  ? 172 THR L N   1 
ATOM   3044 C CA  . THR B 2 178 ? -52.343 45.480 -153.541 1.00 40.96  ? 172 THR L CA  1 
ATOM   3045 C C   . THR B 2 178 ? -53.025 45.816 -152.209 1.00 54.59  ? 172 THR L C   1 
ATOM   3046 O O   . THR B 2 178 ? -53.777 46.796 -152.099 1.00 58.25  ? 172 THR L O   1 
ATOM   3047 C CB  . THR B 2 178 ? -50.804 45.444 -153.324 1.00 53.59  ? 172 THR L CB  1 
ATOM   3048 O OG1 . THR B 2 178 ? -50.305 46.766 -153.133 1.00 57.28  ? 172 THR L OG1 1 
ATOM   3049 C CG2 . THR B 2 178 ? -50.087 44.822 -154.501 1.00 52.50  ? 172 THR L CG2 1 
ATOM   3050 N N   . TYR B 2 179 ? -52.755 44.984 -151.203 1.00 48.18  ? 173 TYR L N   1 
ATOM   3051 C CA  . TYR B 2 179 ? -53.251 45.209 -149.861 1.00 39.59  ? 173 TYR L CA  1 
ATOM   3052 C C   . TYR B 2 179 ? -52.087 45.352 -148.905 1.00 48.59  ? 173 TYR L C   1 
ATOM   3053 O O   . TYR B 2 179 ? -50.962 44.972 -149.221 1.00 49.70  ? 173 TYR L O   1 
ATOM   3054 C CB  . TYR B 2 179 ? -54.119 44.040 -149.414 1.00 41.50  ? 173 TYR L CB  1 
ATOM   3055 C CG  . TYR B 2 179 ? -55.271 43.766 -150.336 1.00 48.21  ? 173 TYR L CG  1 
ATOM   3056 C CD1 . TYR B 2 179 ? -55.148 42.852 -151.370 1.00 51.64  ? 173 TYR L CD1 1 
ATOM   3057 C CD2 . TYR B 2 179 ? -56.478 44.441 -150.194 1.00 51.09  ? 173 TYR L CD2 1 
ATOM   3058 C CE1 . TYR B 2 179 ? -56.206 42.599 -152.227 1.00 59.21  ? 173 TYR L CE1 1 
ATOM   3059 C CE2 . TYR B 2 179 ? -57.544 44.197 -151.055 1.00 54.41  ? 173 TYR L CE2 1 
ATOM   3060 C CZ  . TYR B 2 179 ? -57.403 43.271 -152.065 1.00 59.22  ? 173 TYR L CZ  1 
ATOM   3061 O OH  . TYR B 2 179 ? -58.446 43.015 -152.924 1.00 62.38  ? 173 TYR L OH  1 
ATOM   3062 N N   . SER B 2 180 ? -52.366 45.912 -147.733 1.00 52.16  ? 174 SER L N   1 
ATOM   3063 C CA  . SER B 2 180 ? -51.398 45.979 -146.644 1.00 49.64  ? 174 SER L CA  1 
ATOM   3064 C C   . SER B 2 180 ? -52.113 45.588 -145.372 1.00 53.45  ? 174 SER L C   1 
ATOM   3065 O O   . SER B 2 180 ? -53.331 45.785 -145.236 1.00 59.87  ? 174 SER L O   1 
ATOM   3066 C CB  . SER B 2 180 ? -50.810 47.383 -146.490 1.00 48.60  ? 174 SER L CB  1 
ATOM   3067 O OG  . SER B 2 180 ? -49.738 47.602 -147.382 1.00 47.60  ? 174 SER L OG  1 
ATOM   3068 N N   . LEU B 2 181 ? -51.352 45.048 -144.434 1.00 47.92  ? 175 LEU L N   1 
ATOM   3069 C CA  . LEU B 2 181 ? -51.941 44.475 -143.243 1.00 51.94  ? 175 LEU L CA  1 
ATOM   3070 C C   . LEU B 2 181 ? -51.125 44.860 -142.028 1.00 56.06  ? 175 LEU L C   1 
ATOM   3071 O O   . LEU B 2 181 ? -49.900 44.846 -142.055 1.00 52.49  ? 175 LEU L O   1 
ATOM   3072 C CB  . LEU B 2 181 ? -52.036 42.951 -143.380 1.00 44.04  ? 175 LEU L CB  1 
ATOM   3073 C CG  . LEU B 2 181 ? -52.679 42.178 -142.238 1.00 46.72  ? 175 LEU L CG  1 
ATOM   3074 C CD1 . LEU B 2 181 ? -53.343 40.929 -142.765 1.00 45.37  ? 175 LEU L CD1 1 
ATOM   3075 C CD2 . LEU B 2 181 ? -51.655 41.843 -141.161 1.00 52.58  ? 175 LEU L CD2 1 
ATOM   3076 N N   . SER B 2 182 ? -51.821 45.202 -140.958 1.00 59.85  ? 176 SER L N   1 
ATOM   3077 C CA  . SER B 2 182 ? -51.165 45.625 -139.745 1.00 60.55  ? 176 SER L CA  1 
ATOM   3078 C C   . SER B 2 182 ? -51.652 44.750 -138.610 1.00 59.83  ? 176 SER L C   1 
ATOM   3079 O O   . SER B 2 182 ? -52.844 44.701 -138.336 1.00 61.96  ? 176 SER L O   1 
ATOM   3080 C CB  . SER B 2 182 ? -51.492 47.092 -139.469 1.00 64.74  ? 176 SER L CB  1 
ATOM   3081 O OG  . SER B 2 182 ? -51.008 47.491 -138.202 1.00 75.78  ? 176 SER L OG  1 
ATOM   3082 N N   . SER B 2 183 ? -50.728 44.048 -137.963 1.00 62.06  ? 177 SER L N   1 
ATOM   3083 C CA  . SER B 2 183 ? -51.063 43.199 -136.823 1.00 63.25  ? 177 SER L CA  1 
ATOM   3084 C C   . SER B 2 183 ? -50.381 43.700 -135.548 1.00 60.95  ? 177 SER L C   1 
ATOM   3085 O O   . SER B 2 183 ? -49.170 43.921 -135.521 1.00 60.10  ? 177 SER L O   1 
ATOM   3086 C CB  . SER B 2 183 ? -50.671 41.746 -137.095 1.00 63.18  ? 177 SER L CB  1 
ATOM   3087 O OG  . SER B 2 183 ? -51.118 40.906 -136.046 1.00 66.19  ? 177 SER L OG  1 
ATOM   3088 N N   . THR B 2 184 ? -51.170 43.875 -134.494 1.00 55.16  ? 178 THR L N   1 
ATOM   3089 C CA  . THR B 2 184 ? -50.666 44.418 -133.242 1.00 51.52  ? 178 THR L CA  1 
ATOM   3090 C C   . THR B 2 184 ? -50.733 43.416 -132.088 1.00 56.31  ? 178 THR L C   1 
ATOM   3091 O O   . THR B 2 184 ? -51.818 42.997 -131.687 1.00 53.49  ? 178 THR L O   1 
ATOM   3092 C CB  . THR B 2 184 ? -51.458 45.666 -132.842 1.00 49.72  ? 178 THR L CB  1 
ATOM   3093 O OG1 . THR B 2 184 ? -51.173 46.718 -133.763 1.00 53.47  ? 178 THR L OG1 1 
ATOM   3094 C CG2 . THR B 2 184 ? -51.078 46.120 -131.446 1.00 41.41  ? 178 THR L CG2 1 
ATOM   3095 N N   . LEU B 2 185 ? -49.569 43.046 -131.554 1.00 59.37  ? 179 LEU L N   1 
ATOM   3096 C CA  . LEU B 2 185 ? -49.492 42.240 -130.330 1.00 61.75  ? 179 LEU L CA  1 
ATOM   3097 C C   . LEU B 2 185 ? -49.428 43.118 -129.080 1.00 59.80  ? 179 LEU L C   1 
ATOM   3098 O O   . LEU B 2 185 ? -48.494 43.909 -128.932 1.00 61.06  ? 179 LEU L O   1 
ATOM   3099 C CB  . LEU B 2 185 ? -48.249 41.354 -130.357 1.00 63.19  ? 179 LEU L CB  1 
ATOM   3100 C CG  . LEU B 2 185 ? -48.152 40.382 -129.185 1.00 59.97  ? 179 LEU L CG  1 
ATOM   3101 C CD1 . LEU B 2 185 ? -49.372 39.469 -129.202 1.00 51.45  ? 179 LEU L CD1 1 
ATOM   3102 C CD2 . LEU B 2 185 ? -46.850 39.583 -129.244 1.00 53.77  ? 179 LEU L CD2 1 
ATOM   3103 N N   . THR B 2 186 ? -50.403 42.981 -128.181 1.00 55.46  ? 180 THR L N   1 
ATOM   3104 C CA  . THR B 2 186 ? -50.377 43.757 -126.937 1.00 59.18  ? 180 THR L CA  1 
ATOM   3105 C C   . THR B 2 186 ? -50.155 42.934 -125.663 1.00 65.30  ? 180 THR L C   1 
ATOM   3106 O O   . THR B 2 186 ? -50.818 41.925 -125.420 1.00 62.44  ? 180 THR L O   1 
ATOM   3107 C CB  . THR B 2 186 ? -51.632 44.624 -126.727 1.00 64.80  ? 180 THR L CB  1 
ATOM   3108 O OG1 . THR B 2 186 ? -51.914 45.385 -127.906 1.00 66.82  ? 180 THR L OG1 1 
ATOM   3109 C CG2 . THR B 2 186 ? -51.397 45.584 -125.572 1.00 66.87  ? 180 THR L CG2 1 
ATOM   3110 N N   . LEU B 2 187 ? -49.220 43.415 -124.851 1.00 72.39  ? 181 LEU L N   1 
ATOM   3111 C CA  . LEU B 2 187 ? -48.837 42.800 -123.593 1.00 72.01  ? 181 LEU L CA  1 
ATOM   3112 C C   . LEU B 2 187 ? -48.747 43.871 -122.523 1.00 73.52  ? 181 LEU L C   1 
ATOM   3113 O O   . LEU B 2 187 ? -48.514 45.038 -122.825 1.00 80.13  ? 181 LEU L O   1 
ATOM   3114 C CB  . LEU B 2 187 ? -47.459 42.159 -123.736 1.00 66.86  ? 181 LEU L CB  1 
ATOM   3115 C CG  . LEU B 2 187 ? -47.339 40.978 -124.691 1.00 64.48  ? 181 LEU L CG  1 
ATOM   3116 C CD1 . LEU B 2 187 ? -45.968 40.347 -124.548 1.00 63.35  ? 181 LEU L CD1 1 
ATOM   3117 C CD2 . LEU B 2 187 ? -48.455 39.964 -124.434 1.00 67.78  ? 181 LEU L CD2 1 
ATOM   3118 N N   . SER B 2 188 ? -48.923 43.477 -121.270 1.00 70.53  ? 182 SER L N   1 
ATOM   3119 C CA  . SER B 2 188 ? -48.610 44.367 -120.161 1.00 75.15  ? 182 SER L CA  1 
ATOM   3120 C C   . SER B 2 188 ? -47.096 44.467 -120.063 1.00 79.13  ? 182 SER L C   1 
ATOM   3121 O O   . SER B 2 188 ? -46.395 43.481 -120.281 1.00 85.00  ? 182 SER L O   1 
ATOM   3122 C CB  . SER B 2 188 ? -49.158 43.795 -118.863 1.00 81.10  ? 182 SER L CB  1 
ATOM   3123 O OG  . SER B 2 188 ? -48.451 42.620 -118.495 1.00 84.76  ? 182 SER L OG  1 
ATOM   3124 N N   . LYS B 2 189 ? -46.584 45.647 -119.741 1.00 76.33  ? 183 LYS L N   1 
ATOM   3125 C CA  . LYS B 2 189 ? -45.140 45.829 -119.611 1.00 76.39  ? 183 LYS L CA  1 
ATOM   3126 C C   . LYS B 2 189 ? -44.506 44.661 -118.851 1.00 75.26  ? 183 LYS L C   1 
ATOM   3127 O O   . LYS B 2 189 ? -43.405 44.211 -119.174 1.00 73.42  ? 183 LYS L O   1 
ATOM   3128 C CB  . LYS B 2 189 ? -44.843 47.149 -118.903 1.00 79.00  ? 183 LYS L CB  1 
ATOM   3129 C CG  . LYS B 2 189 ? -43.373 47.491 -118.735 1.00 80.19  ? 183 LYS L CG  1 
ATOM   3130 C CD  . LYS B 2 189 ? -43.254 48.836 -118.030 1.00 87.07  ? 183 LYS L CD  1 
ATOM   3131 C CE  . LYS B 2 189 ? -41.819 49.299 -117.889 1.00 92.53  ? 183 LYS L CE  1 
ATOM   3132 N NZ  . LYS B 2 189 ? -41.780 50.747 -117.536 1.00 97.57  ? 183 LYS L NZ  1 
ATOM   3133 N N   . ALA B 2 190 ? -45.224 44.175 -117.845 1.00 76.18  ? 184 ALA L N   1 
ATOM   3134 C CA  . ALA B 2 190 ? -44.790 43.040 -117.042 1.00 73.73  ? 184 ALA L CA  1 
ATOM   3135 C C   . ALA B 2 190 ? -44.531 41.817 -117.909 1.00 74.56  ? 184 ALA L C   1 
ATOM   3136 O O   . ALA B 2 190 ? -43.429 41.281 -117.919 1.00 75.46  ? 184 ALA L O   1 
ATOM   3137 C CB  . ALA B 2 190 ? -45.832 42.723 -115.977 1.00 68.98  ? 184 ALA L CB  1 
ATOM   3138 N N   . ASP B 2 191 ? -45.547 41.375 -118.638 1.00 87.50  ? 185 ASP L N   1 
ATOM   3139 C CA  . ASP B 2 191 ? -45.399 40.209 -119.499 1.00 90.93  ? 185 ASP L CA  1 
ATOM   3140 C C   . ASP B 2 191 ? -44.355 40.428 -120.587 1.00 89.60  ? 185 ASP L C   1 
ATOM   3141 O O   . ASP B 2 191 ? -43.697 39.486 -121.026 1.00 96.79  ? 185 ASP L O   1 
ATOM   3142 C CB  . ASP B 2 191 ? -46.736 39.833 -120.136 1.00 95.70  ? 185 ASP L CB  1 
ATOM   3143 C CG  . ASP B 2 191 ? -47.664 39.146 -119.168 1.00 105.55 ? 185 ASP L CG  1 
ATOM   3144 O OD1 . ASP B 2 191 ? -47.716 39.564 -117.991 1.00 107.81 ? 185 ASP L OD1 1 
ATOM   3145 O OD2 . ASP B 2 191 ? -48.341 38.183 -119.585 1.00 109.51 ? 185 ASP L OD2 1 
ATOM   3146 N N   . TYR B 2 192 ? -44.210 41.670 -121.028 1.00 81.44  ? 186 TYR L N   1 
ATOM   3147 C CA  . TYR B 2 192 ? -43.279 41.973 -122.103 1.00 79.44  ? 186 TYR L CA  1 
ATOM   3148 C C   . TYR B 2 192 ? -41.835 41.784 -121.658 1.00 83.68  ? 186 TYR L C   1 
ATOM   3149 O O   . TYR B 2 192 ? -40.972 41.403 -122.451 1.00 85.55  ? 186 TYR L O   1 
ATOM   3150 C CB  . TYR B 2 192 ? -43.492 43.399 -122.614 1.00 75.54  ? 186 TYR L CB  1 
ATOM   3151 C CG  . TYR B 2 192 ? -42.522 43.818 -123.699 1.00 65.77  ? 186 TYR L CG  1 
ATOM   3152 C CD1 . TYR B 2 192 ? -42.489 43.160 -124.925 1.00 62.35  ? 186 TYR L CD1 1 
ATOM   3153 C CD2 . TYR B 2 192 ? -41.645 44.878 -123.498 1.00 58.51  ? 186 TYR L CD2 1 
ATOM   3154 C CE1 . TYR B 2 192 ? -41.602 43.539 -125.919 1.00 60.57  ? 186 TYR L CE1 1 
ATOM   3155 C CE2 . TYR B 2 192 ? -40.761 45.273 -124.487 1.00 54.78  ? 186 TYR L CE2 1 
ATOM   3156 C CZ  . TYR B 2 192 ? -40.743 44.601 -125.693 1.00 61.41  ? 186 TYR L CZ  1 
ATOM   3157 O OH  . TYR B 2 192 ? -39.860 44.993 -126.673 1.00 68.56  ? 186 TYR L OH  1 
ATOM   3158 N N   . GLU B 2 193 ? -41.568 42.043 -120.386 1.00 85.42  ? 187 GLU L N   1 
ATOM   3159 C CA  . GLU B 2 193 ? -40.198 41.950 -119.901 1.00 88.32  ? 187 GLU L CA  1 
ATOM   3160 C C   . GLU B 2 193 ? -39.813 40.531 -119.470 1.00 84.94  ? 187 GLU L C   1 
ATOM   3161 O O   . GLU B 2 193 ? -38.634 40.205 -119.392 1.00 86.73  ? 187 GLU L O   1 
ATOM   3162 C CB  . GLU B 2 193 ? -39.927 43.007 -118.826 1.00 91.36  ? 187 GLU L CB  1 
ATOM   3163 C CG  . GLU B 2 193 ? -39.901 44.417 -119.419 1.00 98.35  ? 187 GLU L CG  1 
ATOM   3164 C CD  . GLU B 2 193 ? -39.829 45.531 -118.385 1.00 110.37 ? 187 GLU L CD  1 
ATOM   3165 O OE1 . GLU B 2 193 ? -39.656 46.700 -118.806 1.00 115.11 ? 187 GLU L OE1 1 
ATOM   3166 O OE2 . GLU B 2 193 ? -39.945 45.253 -117.166 1.00 109.81 ? 187 GLU L OE2 1 
ATOM   3167 N N   . LYS B 2 194 ? -40.810 39.680 -119.239 1.00 81.66  ? 188 LYS L N   1 
ATOM   3168 C CA  . LYS B 2 194 ? -40.564 38.269 -118.938 1.00 82.67  ? 188 LYS L CA  1 
ATOM   3169 C C   . LYS B 2 194 ? -40.171 37.413 -120.168 1.00 91.27  ? 188 LYS L C   1 
ATOM   3170 O O   . LYS B 2 194 ? -40.184 36.183 -120.091 1.00 93.39  ? 188 LYS L O   1 
ATOM   3171 C CB  . LYS B 2 194 ? -41.777 37.662 -118.227 1.00 75.78  ? 188 LYS L CB  1 
ATOM   3172 N N   . HIS B 2 195 ? -39.826 38.059 -121.289 1.00 89.93  ? 189 HIS L N   1 
ATOM   3173 C CA  . HIS B 2 195 ? -39.432 37.352 -122.519 1.00 80.49  ? 189 HIS L CA  1 
ATOM   3174 C C   . HIS B 2 195 ? -38.465 38.141 -123.403 1.00 79.52  ? 189 HIS L C   1 
ATOM   3175 O O   . HIS B 2 195 ? -38.364 39.369 -123.291 1.00 80.00  ? 189 HIS L O   1 
ATOM   3176 C CB  . HIS B 2 195 ? -40.647 36.992 -123.348 1.00 82.03  ? 189 HIS L CB  1 
ATOM   3177 C CG  . HIS B 2 195 ? -41.626 36.112 -122.642 1.00 88.57  ? 189 HIS L CG  1 
ATOM   3178 N ND1 . HIS B 2 195 ? -41.354 34.797 -122.333 1.00 91.78  ? 189 HIS L ND1 1 
ATOM   3179 C CD2 . HIS B 2 195 ? -42.884 36.353 -122.205 1.00 87.71  ? 189 HIS L CD2 1 
ATOM   3180 C CE1 . HIS B 2 195 ? -42.402 34.268 -121.728 1.00 94.28  ? 189 HIS L CE1 1 
ATOM   3181 N NE2 . HIS B 2 195 ? -43.344 35.191 -121.639 1.00 91.00  ? 189 HIS L NE2 1 
ATOM   3182 N N   . LYS B 2 196 ? -37.781 37.427 -124.300 1.00 78.71  ? 190 LYS L N   1 
ATOM   3183 C CA  . LYS B 2 196 ? -36.702 38.006 -125.103 1.00 78.56  ? 190 LYS L CA  1 
ATOM   3184 C C   . LYS B 2 196 ? -37.041 38.111 -126.588 1.00 78.95  ? 190 LYS L C   1 
ATOM   3185 O O   . LYS B 2 196 ? -36.859 39.162 -127.196 1.00 79.41  ? 190 LYS L O   1 
ATOM   3186 C CB  . LYS B 2 196 ? -35.410 37.190 -124.947 1.00 82.40  ? 190 LYS L CB  1 
ATOM   3187 C CG  . LYS B 2 196 ? -34.121 38.017 -124.929 1.00 87.49  ? 190 LYS L CG  1 
ATOM   3188 C CD  . LYS B 2 196 ? -33.959 38.740 -123.576 1.00 95.37  ? 190 LYS L CD  1 
ATOM   3189 C CE  . LYS B 2 196 ? -32.504 39.102 -123.254 1.00 99.13  ? 190 LYS L CE  1 
ATOM   3190 N NZ  . LYS B 2 196 ? -32.314 39.540 -121.831 1.00 101.37 ? 190 LYS L NZ  1 
ATOM   3191 N N   . VAL B 2 197 ? -37.527 37.023 -127.175 1.00 77.45  ? 191 VAL L N   1 
ATOM   3192 C CA  . VAL B 2 197 ? -37.661 36.962 -128.628 1.00 77.82  ? 191 VAL L CA  1 
ATOM   3193 C C   . VAL B 2 197 ? -39.078 37.165 -129.143 1.00 78.47  ? 191 VAL L C   1 
ATOM   3194 O O   . VAL B 2 197 ? -39.904 36.252 -129.106 1.00 82.51  ? 191 VAL L O   1 
ATOM   3195 C CB  . VAL B 2 197 ? -37.135 35.628 -129.189 1.00 78.72  ? 191 VAL L CB  1 
ATOM   3196 C CG1 . VAL B 2 197 ? -37.383 35.557 -130.678 1.00 75.34  ? 191 VAL L CG1 1 
ATOM   3197 C CG2 . VAL B 2 197 ? -35.655 35.468 -128.885 1.00 84.68  ? 191 VAL L CG2 1 
ATOM   3198 N N   . TYR B 2 198 ? -39.347 38.359 -129.650 1.00 72.12  ? 192 TYR L N   1 
ATOM   3199 C CA  . TYR B 2 198 ? -40.636 38.632 -130.264 1.00 67.35  ? 192 TYR L CA  1 
ATOM   3200 C C   . TYR B 2 198 ? -40.613 38.390 -131.763 1.00 71.94  ? 192 TYR L C   1 
ATOM   3201 O O   . TYR B 2 198 ? -39.703 38.836 -132.459 1.00 77.26  ? 192 TYR L O   1 
ATOM   3202 C CB  . TYR B 2 198 ? -41.087 40.041 -129.928 1.00 56.68  ? 192 TYR L CB  1 
ATOM   3203 C CG  . TYR B 2 198 ? -41.427 40.119 -128.474 1.00 60.49  ? 192 TYR L CG  1 
ATOM   3204 C CD1 . TYR B 2 198 ? -42.710 39.840 -128.030 1.00 52.64  ? 192 TYR L CD1 1 
ATOM   3205 C CD2 . TYR B 2 198 ? -40.446 40.398 -127.533 1.00 63.79  ? 192 TYR L CD2 1 
ATOM   3206 C CE1 . TYR B 2 198 ? -43.016 39.885 -126.703 1.00 61.04  ? 192 TYR L CE1 1 
ATOM   3207 C CE2 . TYR B 2 198 ? -40.746 40.442 -126.192 1.00 63.44  ? 192 TYR L CE2 1 
ATOM   3208 C CZ  . TYR B 2 198 ? -42.030 40.185 -125.785 1.00 68.63  ? 192 TYR L CZ  1 
ATOM   3209 O OH  . TYR B 2 198 ? -42.330 40.226 -124.449 1.00 78.68  ? 192 TYR L OH  1 
ATOM   3210 N N   . ALA B 2 199 ? -41.615 37.672 -132.256 1.00 64.70  ? 193 ALA L N   1 
ATOM   3211 C CA  . ALA B 2 199 ? -41.594 37.254 -133.644 1.00 64.23  ? 193 ALA L CA  1 
ATOM   3212 C C   . ALA B 2 199 ? -42.956 37.254 -134.338 1.00 66.24  ? 193 ALA L C   1 
ATOM   3213 O O   . ALA B 2 199 ? -43.994 36.907 -133.766 1.00 68.03  ? 193 ALA L O   1 
ATOM   3214 C CB  . ALA B 2 199 ? -40.908 35.893 -133.789 1.00 57.47  ? 193 ALA L CB  1 
ATOM   3215 N N   . CYS B 2 200 ? -42.904 37.656 -135.597 1.00 61.08  ? 194 CYS L N   1 
ATOM   3216 C CA  . CYS B 2 200 ? -44.036 37.694 -136.487 1.00 60.26  ? 194 CYS L CA  1 
ATOM   3217 C C   . CYS B 2 200 ? -43.777 36.639 -137.555 1.00 62.47  ? 194 CYS L C   1 
ATOM   3218 O O   . CYS B 2 200 ? -42.740 36.659 -138.211 1.00 63.61  ? 194 CYS L O   1 
ATOM   3219 C CB  . CYS B 2 200 ? -44.084 39.076 -137.131 1.00 59.83  ? 194 CYS L CB  1 
ATOM   3220 S SG  . CYS B 2 200 ? -45.511 39.369 -138.108 1.00 109.57 ? 194 CYS L SG  1 
ATOM   3221 N N   . GLU B 2 201 ? -44.698 35.700 -137.716 1.00 64.67  ? 195 GLU L N   1 
ATOM   3222 C CA  . GLU B 2 201 ? -44.556 34.695 -138.765 1.00 67.22  ? 195 GLU L CA  1 
ATOM   3223 C C   . GLU B 2 201 ? -45.667 34.819 -139.799 1.00 62.50  ? 195 GLU L C   1 
ATOM   3224 O O   . GLU B 2 201 ? -46.838 34.606 -139.501 1.00 67.73  ? 195 GLU L O   1 
ATOM   3225 C CB  . GLU B 2 201 ? -44.527 33.281 -138.183 1.00 78.29  ? 195 GLU L CB  1 
ATOM   3226 C CG  . GLU B 2 201 ? -44.750 32.202 -139.230 1.00 88.24  ? 195 GLU L CG  1 
ATOM   3227 C CD  . GLU B 2 201 ? -44.581 30.793 -138.698 1.00 94.31  ? 195 GLU L CD  1 
ATOM   3228 O OE1 . GLU B 2 201 ? -43.472 30.460 -138.227 1.00 98.70  ? 195 GLU L OE1 1 
ATOM   3229 O OE2 . GLU B 2 201 ? -45.554 30.013 -138.778 1.00 94.65  ? 195 GLU L OE2 1 
ATOM   3230 N N   . VAL B 2 202 ? -45.284 35.145 -141.023 1.00 56.62  ? 196 VAL L N   1 
ATOM   3231 C CA  . VAL B 2 202 ? -46.241 35.420 -142.072 1.00 55.84  ? 196 VAL L CA  1 
ATOM   3232 C C   . VAL B 2 202 ? -46.296 34.302 -143.098 1.00 61.53  ? 196 VAL L C   1 
ATOM   3233 O O   . VAL B 2 202 ? -45.269 33.816 -143.551 1.00 66.85  ? 196 VAL L O   1 
ATOM   3234 C CB  . VAL B 2 202 ? -45.889 36.713 -142.800 1.00 56.12  ? 196 VAL L CB  1 
ATOM   3235 C CG1 . VAL B 2 202 ? -46.976 37.054 -143.782 1.00 52.74  ? 196 VAL L CG1 1 
ATOM   3236 C CG2 . VAL B 2 202 ? -45.688 37.844 -141.797 1.00 58.23  ? 196 VAL L CG2 1 
ATOM   3237 N N   . THR B 2 203 ? -47.513 33.907 -143.458 1.00 63.82  ? 197 THR L N   1 
ATOM   3238 C CA  . THR B 2 203 ? -47.751 32.889 -144.472 1.00 59.12  ? 197 THR L CA  1 
ATOM   3239 C C   . THR B 2 203 ? -48.655 33.462 -145.565 1.00 55.57  ? 197 THR L C   1 
ATOM   3240 O O   . THR B 2 203 ? -49.681 34.097 -145.282 1.00 50.50  ? 197 THR L O   1 
ATOM   3241 C CB  . THR B 2 203 ? -48.404 31.645 -143.858 1.00 59.00  ? 197 THR L CB  1 
ATOM   3242 O OG1 . THR B 2 203 ? -47.437 30.931 -143.070 1.00 58.62  ? 197 THR L OG1 1 
ATOM   3243 C CG2 . THR B 2 203 ? -48.931 30.742 -144.957 1.00 59.14  ? 197 THR L CG2 1 
ATOM   3244 N N   . HIS B 2 204 ? -48.269 33.240 -146.815 1.00 54.29  ? 198 HIS L N   1 
ATOM   3245 C CA  . HIS B 2 204 ? -48.915 33.909 -147.943 1.00 50.72  ? 198 HIS L CA  1 
ATOM   3246 C C   . HIS B 2 204 ? -48.508 33.288 -149.284 1.00 55.45  ? 198 HIS L C   1 
ATOM   3247 O O   . HIS B 2 204 ? -47.342 32.944 -149.480 1.00 66.15  ? 198 HIS L O   1 
ATOM   3248 C CB  . HIS B 2 204 ? -48.570 35.397 -147.925 1.00 44.45  ? 198 HIS L CB  1 
ATOM   3249 C CG  . HIS B 2 204 ? -49.228 36.172 -149.018 1.00 51.97  ? 198 HIS L CG  1 
ATOM   3250 N ND1 . HIS B 2 204 ? -48.726 36.209 -150.304 1.00 55.31  ? 198 HIS L ND1 1 
ATOM   3251 C CD2 . HIS B 2 204 ? -50.356 36.914 -149.027 1.00 52.59  ? 198 HIS L CD2 1 
ATOM   3252 C CE1 . HIS B 2 204 ? -49.519 36.958 -151.053 1.00 55.25  ? 198 HIS L CE1 1 
ATOM   3253 N NE2 . HIS B 2 204 ? -50.513 37.397 -150.303 1.00 55.33  ? 198 HIS L NE2 1 
ATOM   3254 N N   . GLN B 2 205 ? -49.454 33.166 -150.212 1.00 52.68  ? 199 GLN L N   1 
ATOM   3255 C CA  . GLN B 2 205 ? -49.204 32.450 -151.477 1.00 60.23  ? 199 GLN L CA  1 
ATOM   3256 C C   . GLN B 2 205 ? -48.067 33.041 -152.307 1.00 57.88  ? 199 GLN L C   1 
ATOM   3257 O O   . GLN B 2 205 ? -47.571 32.405 -153.225 1.00 65.16  ? 199 GLN L O   1 
ATOM   3258 C CB  . GLN B 2 205 ? -50.485 32.332 -152.319 1.00 62.66  ? 199 GLN L CB  1 
ATOM   3259 C CG  . GLN B 2 205 ? -51.665 31.814 -151.520 1.00 77.32  ? 199 GLN L CG  1 
ATOM   3260 C CD  . GLN B 2 205 ? -52.956 31.799 -152.303 1.00 91.32  ? 199 GLN L CD  1 
ATOM   3261 O OE1 . GLN B 2 205 ? -52.982 31.351 -153.446 1.00 103.37 ? 199 GLN L OE1 1 
ATOM   3262 N NE2 . GLN B 2 205 ? -54.044 32.281 -151.689 1.00 88.39  ? 199 GLN L NE2 1 
ATOM   3263 N N   . GLY B 2 206 ? -47.652 34.255 -151.978 1.00 54.28  ? 200 GLY L N   1 
ATOM   3264 C CA  . GLY B 2 206 ? -46.537 34.877 -152.666 1.00 53.92  ? 200 GLY L CA  1 
ATOM   3265 C C   . GLY B 2 206 ? -45.199 34.457 -152.094 1.00 53.54  ? 200 GLY L C   1 
ATOM   3266 O O   . GLY B 2 206 ? -44.168 34.767 -152.662 1.00 54.34  ? 200 GLY L O   1 
ATOM   3267 N N   . LEU B 2 207 ? -45.219 33.750 -150.967 1.00 54.36  ? 201 LEU L N   1 
ATOM   3268 C CA  . LEU B 2 207 ? -43.996 33.321 -150.298 1.00 55.15  ? 201 LEU L CA  1 
ATOM   3269 C C   . LEU B 2 207 ? -43.742 31.830 -150.482 1.00 64.08  ? 201 LEU L C   1 
ATOM   3270 O O   . LEU B 2 207 ? -44.642 31.012 -150.294 1.00 62.75  ? 201 LEU L O   1 
ATOM   3271 C CB  . LEU B 2 207 ? -44.065 33.657 -148.807 1.00 54.52  ? 201 LEU L CB  1 
ATOM   3272 C CG  . LEU B 2 207 ? -44.226 35.149 -148.501 1.00 58.42  ? 201 LEU L CG  1 
ATOM   3273 C CD1 . LEU B 2 207 ? -44.422 35.416 -147.019 1.00 47.48  ? 201 LEU L CD1 1 
ATOM   3274 C CD2 . LEU B 2 207 ? -43.032 35.926 -149.035 1.00 48.91  ? 201 LEU L CD2 1 
ATOM   3275 N N   . ARG B 2 208 ? -42.505 31.485 -150.835 1.00 74.59  ? 202 ARG L N   1 
ATOM   3276 C CA  . ARG B 2 208 ? -42.115 30.100 -151.050 1.00 71.88  ? 202 ARG L CA  1 
ATOM   3277 C C   . ARG B 2 208 ? -42.330 29.296 -149.779 1.00 73.23  ? 202 ARG L C   1 
ATOM   3278 O O   . ARG B 2 208 ? -42.683 28.123 -149.832 1.00 74.74  ? 202 ARG L O   1 
ATOM   3279 C CB  . ARG B 2 208 ? -40.662 30.025 -151.495 1.00 86.47  ? 202 ARG L CB  1 
ATOM   3280 C CG  . ARG B 2 208 ? -40.211 28.620 -151.849 1.00 110.80 ? 202 ARG L CG  1 
ATOM   3281 C CD  . ARG B 2 208 ? -39.160 28.605 -152.971 1.00 125.32 ? 202 ARG L CD  1 
ATOM   3282 N NE  . ARG B 2 208 ? -38.573 27.275 -153.157 1.00 130.72 ? 202 ARG L NE  1 
ATOM   3283 C CZ  . ARG B 2 208 ? -37.952 26.877 -154.263 1.00 131.83 ? 202 ARG L CZ  1 
ATOM   3284 N NH1 . ARG B 2 208 ? -37.842 27.704 -155.295 1.00 131.97 ? 202 ARG L NH1 1 
ATOM   3285 N NH2 . ARG B 2 208 ? -37.448 25.652 -154.342 1.00 131.67 ? 202 ARG L NH2 1 
ATOM   3286 N N   . SER B 2 209 ? -42.116 29.935 -148.632 1.00 72.84  ? 203 SER L N   1 
ATOM   3287 C CA  . SER B 2 209 ? -42.422 29.330 -147.336 1.00 75.12  ? 203 SER L CA  1 
ATOM   3288 C C   . SER B 2 209 ? -42.618 30.435 -146.302 1.00 73.92  ? 203 SER L C   1 
ATOM   3289 O O   . SER B 2 209 ? -42.270 31.581 -146.567 1.00 78.04  ? 203 SER L O   1 
ATOM   3290 C CB  . SER B 2 209 ? -41.300 28.398 -146.898 1.00 80.21  ? 203 SER L CB  1 
ATOM   3291 O OG  . SER B 2 209 ? -40.228 29.139 -146.352 1.00 83.42  ? 203 SER L OG  1 
ATOM   3292 N N   . PRO B 2 210 ? -43.170 30.103 -145.122 1.00 73.97  ? 204 PRO L N   1 
ATOM   3293 C CA  . PRO B 2 210 ? -43.458 31.168 -144.158 1.00 64.61  ? 204 PRO L CA  1 
ATOM   3294 C C   . PRO B 2 210 ? -42.234 32.018 -143.935 1.00 63.32  ? 204 PRO L C   1 
ATOM   3295 O O   . PRO B 2 210 ? -41.111 31.545 -144.094 1.00 65.41  ? 204 PRO L O   1 
ATOM   3296 C CB  . PRO B 2 210 ? -43.805 30.409 -142.881 1.00 65.09  ? 204 PRO L CB  1 
ATOM   3297 C CG  . PRO B 2 210 ? -44.285 29.103 -143.342 1.00 76.25  ? 204 PRO L CG  1 
ATOM   3298 C CD  . PRO B 2 210 ? -43.513 28.776 -144.586 1.00 81.84  ? 204 PRO L CD  1 
ATOM   3299 N N   . VAL B 2 211 ? -42.460 33.275 -143.590 1.00 60.40  ? 205 VAL L N   1 
ATOM   3300 C CA  . VAL B 2 211 ? -41.379 34.202 -143.346 1.00 61.93  ? 205 VAL L CA  1 
ATOM   3301 C C   . VAL B 2 211 ? -41.500 34.734 -141.936 1.00 66.06  ? 205 VAL L C   1 
ATOM   3302 O O   . VAL B 2 211 ? -42.600 34.904 -141.422 1.00 65.48  ? 205 VAL L O   1 
ATOM   3303 C CB  . VAL B 2 211 ? -41.427 35.355 -144.336 1.00 62.35  ? 205 VAL L CB  1 
ATOM   3304 C CG1 . VAL B 2 211 ? -40.760 36.592 -143.762 1.00 54.36  ? 205 VAL L CG1 1 
ATOM   3305 C CG2 . VAL B 2 211 ? -40.768 34.933 -145.625 1.00 70.63  ? 205 VAL L CG2 1 
ATOM   3306 N N   . THR B 2 212 ? -40.364 34.991 -141.306 1.00 65.77  ? 206 THR L N   1 
ATOM   3307 C CA  . THR B 2 212 ? -40.362 35.371 -139.910 1.00 65.46  ? 206 THR L CA  1 
ATOM   3308 C C   . THR B 2 212 ? -39.561 36.645 -139.745 1.00 62.32  ? 206 THR L C   1 
ATOM   3309 O O   . THR B 2 212 ? -38.432 36.732 -140.201 1.00 62.36  ? 206 THR L O   1 
ATOM   3310 C CB  . THR B 2 212 ? -39.760 34.237 -139.026 1.00 67.04  ? 206 THR L CB  1 
ATOM   3311 O OG1 . THR B 2 212 ? -40.187 32.958 -139.520 1.00 75.94  ? 206 THR L OG1 1 
ATOM   3312 C CG2 . THR B 2 212 ? -40.211 34.370 -137.604 1.00 57.12  ? 206 THR L CG2 1 
ATOM   3313 N N   . LYS B 2 213 ? -40.160 37.647 -139.119 1.00 61.69  ? 207 LYS L N   1 
ATOM   3314 C CA  . LYS B 2 213 ? -39.412 38.824 -138.702 1.00 67.88  ? 207 LYS L CA  1 
ATOM   3315 C C   . LYS B 2 213 ? -39.372 38.852 -137.180 1.00 72.68  ? 207 LYS L C   1 
ATOM   3316 O O   . LYS B 2 213 ? -40.384 38.592 -136.527 1.00 82.40  ? 207 LYS L O   1 
ATOM   3317 C CB  . LYS B 2 213 ? -40.059 40.097 -139.247 1.00 65.84  ? 207 LYS L CB  1 
ATOM   3318 C CG  . LYS B 2 213 ? -39.435 40.628 -140.518 1.00 68.98  ? 207 LYS L CG  1 
ATOM   3319 C CD  . LYS B 2 213 ? -38.309 41.609 -140.215 1.00 74.87  ? 207 LYS L CD  1 
ATOM   3320 C CE  . LYS B 2 213 ? -37.750 42.235 -141.496 1.00 80.58  ? 207 LYS L CE  1 
ATOM   3321 N NZ  . LYS B 2 213 ? -37.528 41.226 -142.587 1.00 82.81  ? 207 LYS L NZ  1 
ATOM   3322 N N   . SER B 2 214 ? -38.222 39.156 -136.596 1.00 64.18  ? 208 SER L N   1 
ATOM   3323 C CA  . SER B 2 214 ? -38.193 39.241 -135.145 1.00 65.42  ? 208 SER L CA  1 
ATOM   3324 C C   . SER B 2 214 ? -37.148 40.190 -134.581 1.00 70.10  ? 208 SER L C   1 
ATOM   3325 O O   . SER B 2 214 ? -36.454 40.885 -135.320 1.00 74.11  ? 208 SER L O   1 
ATOM   3326 C CB  . SER B 2 214 ? -38.043 37.854 -134.540 1.00 62.34  ? 208 SER L CB  1 
ATOM   3327 O OG  . SER B 2 214 ? -36.867 37.242 -135.008 1.00 67.23  ? 208 SER L OG  1 
ATOM   3328 N N   . PHE B 2 215 ? -37.074 40.228 -133.256 1.00 67.55  ? 209 PHE L N   1 
ATOM   3329 C CA  . PHE B 2 215 ? -36.087 41.025 -132.541 1.00 66.90  ? 209 PHE L CA  1 
ATOM   3330 C C   . PHE B 2 215 ? -36.016 40.545 -131.102 1.00 71.16  ? 209 PHE L C   1 
ATOM   3331 O O   . PHE B 2 215 ? -36.841 39.728 -130.681 1.00 68.37  ? 209 PHE L O   1 
ATOM   3332 C CB  . PHE B 2 215 ? -36.449 42.510 -132.586 1.00 65.08  ? 209 PHE L CB  1 
ATOM   3333 C CG  . PHE B 2 215 ? -37.681 42.873 -131.790 1.00 68.24  ? 209 PHE L CG  1 
ATOM   3334 C CD1 . PHE B 2 215 ? -38.932 42.913 -132.395 1.00 72.98  ? 209 PHE L CD1 1 
ATOM   3335 C CD2 . PHE B 2 215 ? -37.587 43.205 -130.449 1.00 64.94  ? 209 PHE L CD2 1 
ATOM   3336 C CE1 . PHE B 2 215 ? -40.066 43.265 -131.668 1.00 69.17  ? 209 PHE L CE1 1 
ATOM   3337 C CE2 . PHE B 2 215 ? -38.713 43.556 -129.722 1.00 65.96  ? 209 PHE L CE2 1 
ATOM   3338 C CZ  . PHE B 2 215 ? -39.953 43.589 -130.333 1.00 66.91  ? 209 PHE L CZ  1 
ATOM   3339 N N   . ASN B 2 216 ? -35.041 41.047 -130.346 1.00 73.96  ? 210 ASN L N   1 
ATOM   3340 C CA  . ASN B 2 216 ? -34.914 40.690 -128.935 1.00 72.94  ? 210 ASN L CA  1 
ATOM   3341 C C   . ASN B 2 216 ? -35.113 41.875 -127.996 1.00 76.11  ? 210 ASN L C   1 
ATOM   3342 O O   . ASN B 2 216 ? -34.623 42.960 -128.287 1.00 74.26  ? 210 ASN L O   1 
ATOM   3343 C CB  . ASN B 2 216 ? -33.546 40.065 -128.678 1.00 78.47  ? 210 ASN L CB  1 
ATOM   3344 C CG  . ASN B 2 216 ? -33.279 38.863 -129.562 1.00 85.74  ? 210 ASN L CG  1 
ATOM   3345 O OD1 . ASN B 2 216 ? -34.207 38.183 -129.996 1.00 88.63  ? 210 ASN L OD1 1 
ATOM   3346 N ND2 . ASN B 2 216 ? -32.005 38.589 -129.826 1.00 87.27  ? 210 ASN L ND2 1 
ATOM   3347 N N   . ARG B 2 217 ? -35.819 41.658 -126.876 1.00 82.05  ? 211 ARG L N   1 
ATOM   3348 C CA  . ARG B 2 217 ? -35.894 42.642 -125.788 1.00 88.74  ? 211 ARG L CA  1 
ATOM   3349 C C   . ARG B 2 217 ? -37.079 42.471 -124.812 1.00 101.32 ? 211 ARG L C   1 
ATOM   3350 O O   . ARG B 2 217 ? -36.990 42.126 -123.623 1.00 99.29  ? 211 ARG L O   1 
ATOM   3351 C CB  . ARG B 2 217 ? -35.957 44.047 -126.370 1.00 84.22  ? 211 ARG L CB  1 
ATOM   3352 C CG  . ARG B 2 217 ? -35.145 45.028 -125.597 1.00 81.13  ? 211 ARG L CG  1 
ATOM   3353 C CD  . ARG B 2 217 ? -33.713 44.582 -125.568 1.00 78.61  ? 211 ARG L CD  1 
ATOM   3354 N NE  . ARG B 2 217 ? -33.120 44.642 -126.893 1.00 84.02  ? 211 ARG L NE  1 
ATOM   3355 C CZ  . ARG B 2 217 ? -31.915 45.142 -127.137 1.00 86.63  ? 211 ARG L CZ  1 
ATOM   3356 N NH1 . ARG B 2 217 ? -31.431 45.166 -128.379 1.00 81.55  ? 211 ARG L NH1 1 
ATOM   3357 N NH2 . ARG B 2 217 ? -31.200 45.632 -126.130 1.00 85.23  ? 211 ARG L NH2 1 
ATOM   3358 O OXT . ARG B 2 217 ? -38.215 42.723 -125.193 1.00 110.83 ? 211 ARG L OXT 1 
ATOM   3359 N N   . GLU C 1 1   ? -33.048 23.700 -191.221 1.00 92.36  ? 1   GLU M N   1 
ATOM   3360 C CA  . GLU C 1 1   ? -33.602 24.956 -191.718 1.00 100.23 ? 1   GLU M CA  1 
ATOM   3361 C C   . GLU C 1 1   ? -32.961 26.152 -191.003 1.00 91.87  ? 1   GLU M C   1 
ATOM   3362 O O   . GLU C 1 1   ? -32.202 25.975 -190.056 1.00 91.67  ? 1   GLU M O   1 
ATOM   3363 C CB  . GLU C 1 1   ? -35.131 24.965 -191.553 1.00 111.09 ? 1   GLU M CB  1 
ATOM   3364 C CG  . GLU C 1 1   ? -35.844 26.229 -192.054 1.00 121.38 ? 1   GLU M CG  1 
ATOM   3365 C CD  . GLU C 1 1   ? -35.725 26.434 -193.560 1.00 131.72 ? 1   GLU M CD  1 
ATOM   3366 O OE1 . GLU C 1 1   ? -35.692 25.427 -194.303 1.00 136.15 ? 1   GLU M OE1 1 
ATOM   3367 O OE2 . GLU C 1 1   ? -35.677 27.607 -193.998 1.00 131.15 ? 1   GLU M OE2 1 
ATOM   3368 N N   . VAL C 1 2   ? -33.257 27.359 -191.477 1.00 81.06  ? 2   VAL M N   1 
ATOM   3369 C CA  . VAL C 1 2   ? -32.777 28.590 -190.858 1.00 76.40  ? 2   VAL M CA  1 
ATOM   3370 C C   . VAL C 1 2   ? -33.596 28.951 -189.627 1.00 68.51  ? 2   VAL M C   1 
ATOM   3371 O O   . VAL C 1 2   ? -34.816 29.057 -189.707 1.00 69.13  ? 2   VAL M O   1 
ATOM   3372 C CB  . VAL C 1 2   ? -32.909 29.764 -191.833 1.00 74.97  ? 2   VAL M CB  1 
ATOM   3373 C CG1 . VAL C 1 2   ? -32.597 31.086 -191.136 1.00 70.95  ? 2   VAL M CG1 1 
ATOM   3374 C CG2 . VAL C 1 2   ? -32.021 29.548 -193.023 1.00 73.32  ? 2   VAL M CG2 1 
ATOM   3375 N N   . GLN C 1 3   ? -32.947 29.163 -188.489 1.00 63.15  ? 3   GLN M N   1 
ATOM   3376 C CA  . GLN C 1 3   ? -33.727 29.496 -187.311 1.00 66.19  ? 3   GLN M CA  1 
ATOM   3377 C C   . GLN C 1 3   ? -32.973 30.040 -186.112 1.00 67.12  ? 3   GLN M C   1 
ATOM   3378 O O   . GLN C 1 3   ? -31.741 30.028 -186.055 1.00 65.04  ? 3   GLN M O   1 
ATOM   3379 C CB  . GLN C 1 3   ? -34.492 28.276 -186.863 1.00 70.57  ? 3   GLN M CB  1 
ATOM   3380 C CG  . GLN C 1 3   ? -33.605 27.292 -186.205 1.00 77.42  ? 3   GLN M CG  1 
ATOM   3381 C CD  . GLN C 1 3   ? -34.265 25.968 -186.136 1.00 90.11  ? 3   GLN M CD  1 
ATOM   3382 O OE1 . GLN C 1 3   ? -35.243 25.768 -187.007 1.00 98.38  ? 3   GLN M OE1 1 
ATOM   3383 N NE2 . GLN C 1 3   ? -33.922 25.123 -185.308 1.00 92.52  ? 3   GLN M NE2 1 
ATOM   3384 N N   . LEU C 1 4   ? -33.762 30.502 -185.144 1.00 63.57  ? 4   LEU M N   1 
ATOM   3385 C CA  . LEU C 1 4   ? -33.252 31.072 -183.911 1.00 55.50  ? 4   LEU M CA  1 
ATOM   3386 C C   . LEU C 1 4   ? -33.797 30.286 -182.714 1.00 58.47  ? 4   LEU M C   1 
ATOM   3387 O O   . LEU C 1 4   ? -35.012 30.136 -182.577 1.00 60.92  ? 4   LEU M O   1 
ATOM   3388 C CB  . LEU C 1 4   ? -33.687 32.533 -183.831 1.00 46.73  ? 4   LEU M CB  1 
ATOM   3389 C CG  . LEU C 1 4   ? -33.078 33.493 -184.864 1.00 47.22  ? 4   LEU M CG  1 
ATOM   3390 C CD1 . LEU C 1 4   ? -33.931 34.746 -185.036 1.00 45.05  ? 4   LEU M CD1 1 
ATOM   3391 C CD2 . LEU C 1 4   ? -31.659 33.871 -184.485 1.00 44.90  ? 4   LEU M CD2 1 
ATOM   3392 N N   . LEU C 1 5   ? -32.916 29.758 -181.864 1.00 53.60  ? 5   LEU M N   1 
ATOM   3393 C CA  . LEU C 1 5   ? -33.377 29.046 -180.670 1.00 52.44  ? 5   LEU M CA  1 
ATOM   3394 C C   . LEU C 1 5   ? -33.058 29.897 -179.471 1.00 55.68  ? 5   LEU M C   1 
ATOM   3395 O O   . LEU C 1 5   ? -31.906 30.302 -179.270 1.00 59.27  ? 5   LEU M O   1 
ATOM   3396 C CB  . LEU C 1 5   ? -32.717 27.678 -180.494 1.00 48.67  ? 5   LEU M CB  1 
ATOM   3397 C CG  . LEU C 1 5   ? -31.945 27.204 -181.721 1.00 71.52  ? 5   LEU M CG  1 
ATOM   3398 C CD1 . LEU C 1 5   ? -30.935 26.074 -181.384 1.00 131.71 ? 5   LEU M CD1 1 
ATOM   3399 C CD2 . LEU C 1 5   ? -32.909 26.801 -182.832 1.00 78.38  ? 5   LEU M CD2 1 
ATOM   3400 N N   . GLU C 1 6   ? -34.086 30.147 -178.669 1.00 49.59  ? 6   GLU M N   1 
ATOM   3401 C CA  . GLU C 1 6   ? -33.976 31.024 -177.524 1.00 50.63  ? 6   GLU M CA  1 
ATOM   3402 C C   . GLU C 1 6   ? -33.797 30.255 -176.215 1.00 55.97  ? 6   GLU M C   1 
ATOM   3403 O O   . GLU C 1 6   ? -34.248 29.116 -176.068 1.00 53.91  ? 6   GLU M O   1 
ATOM   3404 C CB  . GLU C 1 6   ? -35.213 31.920 -177.450 1.00 39.24  ? 6   GLU M CB  1 
ATOM   3405 C CG  . GLU C 1 6   ? -35.303 32.911 -178.583 1.00 47.60  ? 6   GLU M CG  1 
ATOM   3406 C CD  . GLU C 1 6   ? -36.422 33.926 -178.397 1.00 50.06  ? 6   GLU M CD  1 
ATOM   3407 O OE1 . GLU C 1 6   ? -37.294 34.012 -179.285 1.00 48.78  ? 6   GLU M OE1 1 
ATOM   3408 O OE2 . GLU C 1 6   ? -36.425 34.636 -177.367 1.00 44.34  ? 6   GLU M OE2 1 
ATOM   3409 N N   . SER C 1 7   ? -33.131 30.890 -175.262 1.00 58.25  ? 7   SER M N   1 
ATOM   3410 C CA  . SER C 1 7   ? -33.075 30.364 -173.908 1.00 56.17  ? 7   SER M CA  1 
ATOM   3411 C C   . SER C 1 7   ? -33.123 31.526 -172.930 1.00 54.13  ? 7   SER M C   1 
ATOM   3412 O O   . SER C 1 7   ? -33.121 32.687 -173.339 1.00 55.64  ? 7   SER M O   1 
ATOM   3413 C CB  . SER C 1 7   ? -31.825 29.521 -173.722 1.00 56.41  ? 7   SER M CB  1 
ATOM   3414 O OG  . SER C 1 7   ? -30.911 29.796 -174.761 1.00 66.06  ? 7   SER M OG  1 
ATOM   3415 N N   . GLY C 1 8   ? -33.188 31.220 -171.642 1.00 53.47  ? 8   GLY M N   1 
ATOM   3416 C CA  . GLY C 1 8   ? -33.356 32.254 -170.632 1.00 58.89  ? 8   GLY M CA  1 
ATOM   3417 C C   . GLY C 1 8   ? -34.822 32.589 -170.361 1.00 60.13  ? 8   GLY M C   1 
ATOM   3418 O O   . GLY C 1 8   ? -35.733 31.874 -170.782 1.00 61.92  ? 8   GLY M O   1 
ATOM   3419 N N   . GLY C 1 9   ? -35.054 33.690 -169.661 1.00 57.66  ? 9   GLY M N   1 
ATOM   3420 C CA  . GLY C 1 9   ? -36.405 34.096 -169.333 1.00 57.88  ? 9   GLY M CA  1 
ATOM   3421 C C   . GLY C 1 9   ? -36.857 33.431 -168.053 1.00 57.10  ? 9   GLY M C   1 
ATOM   3422 O O   . GLY C 1 9   ? -36.102 32.695 -167.436 1.00 56.17  ? 9   GLY M O   1 
ATOM   3423 N N   . GLY C 1 10  ? -38.096 33.678 -167.659 1.00 52.84  ? 10  GLY M N   1 
ATOM   3424 C CA  . GLY C 1 10  ? -38.590 33.141 -166.410 1.00 47.09  ? 10  GLY M CA  1 
ATOM   3425 C C   . GLY C 1 10  ? -38.912 34.246 -165.429 1.00 51.04  ? 10  GLY M C   1 
ATOM   3426 O O   . GLY C 1 10  ? -39.216 35.374 -165.822 1.00 54.62  ? 10  GLY M O   1 
ATOM   3427 N N   . LEU C 1 11  ? -38.829 33.919 -164.146 1.00 47.93  ? 11  LEU M N   1 
ATOM   3428 C CA  . LEU C 1 11  ? -39.280 34.804 -163.088 1.00 44.64  ? 11  LEU M CA  1 
ATOM   3429 C C   . LEU C 1 11  ? -38.114 35.654 -162.606 1.00 48.63  ? 11  LEU M C   1 
ATOM   3430 O O   . LEU C 1 11  ? -36.979 35.211 -162.615 1.00 45.65  ? 11  LEU M O   1 
ATOM   3431 C CB  . LEU C 1 11  ? -39.818 33.949 -161.953 1.00 45.11  ? 11  LEU M CB  1 
ATOM   3432 C CG  . LEU C 1 11  ? -40.365 34.615 -160.701 1.00 44.80  ? 11  LEU M CG  1 
ATOM   3433 C CD1 . LEU C 1 11  ? -41.441 35.580 -161.105 1.00 43.22  ? 11  LEU M CD1 1 
ATOM   3434 C CD2 . LEU C 1 11  ? -40.913 33.548 -159.772 1.00 48.79  ? 11  LEU M CD2 1 
ATOM   3435 N N   . VAL C 1 12  ? -38.385 36.877 -162.181 1.00 47.83  ? 12  VAL M N   1 
ATOM   3436 C CA  . VAL C 1 12  ? -37.302 37.782 -161.819 1.00 40.79  ? 12  VAL M CA  1 
ATOM   3437 C C   . VAL C 1 12  ? -37.875 38.942 -161.025 1.00 43.33  ? 12  VAL M C   1 
ATOM   3438 O O   . VAL C 1 12  ? -38.865 39.540 -161.424 1.00 47.36  ? 12  VAL M O   1 
ATOM   3439 C CB  . VAL C 1 12  ? -36.556 38.308 -163.083 1.00 45.38  ? 12  VAL M CB  1 
ATOM   3440 C CG1 . VAL C 1 12  ? -37.535 38.960 -164.050 1.00 49.50  ? 12  VAL M CG1 1 
ATOM   3441 C CG2 . VAL C 1 12  ? -35.470 39.296 -162.714 1.00 43.64  ? 12  VAL M CG2 1 
ATOM   3442 N N   . LYS C 1 13  ? -37.245 39.249 -159.899 1.00 46.70  ? 13  LYS M N   1 
ATOM   3443 C CA  . LYS C 1 13  ? -37.732 40.284 -159.002 1.00 51.49  ? 13  LYS M CA  1 
ATOM   3444 C C   . LYS C 1 13  ? -37.587 41.659 -159.627 1.00 55.17  ? 13  LYS M C   1 
ATOM   3445 O O   . LYS C 1 13  ? -36.717 41.881 -160.460 1.00 56.23  ? 13  LYS M O   1 
ATOM   3446 C CB  . LYS C 1 13  ? -36.989 40.216 -157.664 1.00 49.37  ? 13  LYS M CB  1 
ATOM   3447 C CG  . LYS C 1 13  ? -36.969 38.825 -157.066 1.00 49.56  ? 13  LYS M CG  1 
ATOM   3448 C CD  . LYS C 1 13  ? -36.744 38.846 -155.576 1.00 60.80  ? 13  LYS M CD  1 
ATOM   3449 C CE  . LYS C 1 13  ? -37.010 37.474 -154.941 1.00 75.75  ? 13  LYS M CE  1 
ATOM   3450 N NZ  . LYS C 1 13  ? -38.456 37.055 -154.960 1.00 80.72  ? 13  LYS M NZ  1 
ATOM   3451 N N   . PRO C 1 14  ? -38.455 42.591 -159.232 1.00 56.55  ? 14  PRO M N   1 
ATOM   3452 C CA  . PRO C 1 14  ? -38.368 43.969 -159.724 1.00 52.70  ? 14  PRO M CA  1 
ATOM   3453 C C   . PRO C 1 14  ? -37.040 44.574 -159.281 1.00 56.56  ? 14  PRO M C   1 
ATOM   3454 O O   . PRO C 1 14  ? -36.620 44.323 -158.155 1.00 51.62  ? 14  PRO M O   1 
ATOM   3455 C CB  . PRO C 1 14  ? -39.530 44.666 -159.023 1.00 45.78  ? 14  PRO M CB  1 
ATOM   3456 C CG  . PRO C 1 14  ? -40.425 43.571 -158.597 1.00 54.67  ? 14  PRO M CG  1 
ATOM   3457 C CD  . PRO C 1 14  ? -39.558 42.407 -158.282 1.00 52.01  ? 14  PRO M CD  1 
ATOM   3458 N N   . GLY C 1 15  ? -36.390 45.341 -160.156 1.00 63.34  ? 15  GLY M N   1 
ATOM   3459 C CA  . GLY C 1 15  ? -35.053 45.851 -159.895 1.00 61.75  ? 15  GLY M CA  1 
ATOM   3460 C C   . GLY C 1 15  ? -33.976 44.859 -160.306 1.00 61.31  ? 15  GLY M C   1 
ATOM   3461 O O   . GLY C 1 15  ? -32.814 45.228 -160.505 1.00 60.50  ? 15  GLY M O   1 
ATOM   3462 N N   . GLY C 1 16  ? -34.377 43.596 -160.449 1.00 55.44  ? 16  GLY M N   1 
ATOM   3463 C CA  . GLY C 1 16  ? -33.479 42.519 -160.818 1.00 42.56  ? 16  GLY M CA  1 
ATOM   3464 C C   . GLY C 1 16  ? -33.098 42.421 -162.290 1.00 50.35  ? 16  GLY M C   1 
ATOM   3465 O O   . GLY C 1 16  ? -33.529 43.221 -163.143 1.00 45.53  ? 16  GLY M O   1 
ATOM   3466 N N   . SER C 1 17  ? -32.275 41.415 -162.582 1.00 57.42  ? 17  SER M N   1 
ATOM   3467 C CA  . SER C 1 17  ? -31.678 41.253 -163.901 1.00 57.16  ? 17  SER M CA  1 
ATOM   3468 C C   . SER C 1 17  ? -31.840 39.859 -164.444 1.00 52.09  ? 17  SER M C   1 
ATOM   3469 O O   . SER C 1 17  ? -31.912 38.883 -163.706 1.00 50.42  ? 17  SER M O   1 
ATOM   3470 C CB  . SER C 1 17  ? -30.188 41.600 -163.883 1.00 64.45  ? 17  SER M CB  1 
ATOM   3471 O OG  . SER C 1 17  ? -29.993 42.988 -164.059 1.00 76.52  ? 17  SER M OG  1 
ATOM   3472 N N   . LEU C 1 18  ? -31.848 39.789 -165.763 1.00 55.17  ? 18  LEU M N   1 
ATOM   3473 C CA  . LEU C 1 18  ? -32.095 38.567 -166.486 1.00 55.36  ? 18  LEU M CA  1 
ATOM   3474 C C   . LEU C 1 18  ? -31.270 38.687 -167.731 1.00 49.32  ? 18  LEU M C   1 
ATOM   3475 O O   . LEU C 1 18  ? -31.157 39.763 -168.282 1.00 45.10  ? 18  LEU M O   1 
ATOM   3476 C CB  . LEU C 1 18  ? -33.553 38.532 -166.916 1.00 58.06  ? 18  LEU M CB  1 
ATOM   3477 C CG  . LEU C 1 18  ? -34.142 37.153 -166.803 1.00 60.51  ? 18  LEU M CG  1 
ATOM   3478 C CD1 . LEU C 1 18  ? -33.683 36.615 -165.484 1.00 61.94  ? 18  LEU M CD1 1 
ATOM   3479 C CD2 . LEU C 1 18  ? -35.628 37.273 -166.841 1.00 61.76  ? 18  LEU M CD2 1 
ATOM   3480 N N   . ARG C 1 19  ? -30.707 37.593 -168.198 1.00 46.99  ? 19  ARG M N   1 
ATOM   3481 C CA  . ARG C 1 19  ? -30.048 37.637 -169.481 1.00 47.33  ? 19  ARG M CA  1 
ATOM   3482 C C   . ARG C 1 19  ? -30.672 36.625 -170.431 1.00 49.75  ? 19  ARG M C   1 
ATOM   3483 O O   . ARG C 1 19  ? -30.677 35.427 -170.158 1.00 58.42  ? 19  ARG M O   1 
ATOM   3484 C CB  . ARG C 1 19  ? -28.554 37.396 -169.292 1.00 51.58  ? 19  ARG M CB  1 
ATOM   3485 C CG  . ARG C 1 19  ? -27.721 37.466 -170.545 1.00 57.48  ? 19  ARG M CG  1 
ATOM   3486 C CD  . ARG C 1 19  ? -27.311 36.085 -170.905 1.00 62.39  ? 19  ARG M CD  1 
ATOM   3487 N NE  . ARG C 1 19  ? -25.907 36.021 -171.271 1.00 66.92  ? 19  ARG M NE  1 
ATOM   3488 C CZ  . ARG C 1 19  ? -25.202 34.900 -171.249 1.00 70.47  ? 19  ARG M CZ  1 
ATOM   3489 N NH1 . ARG C 1 19  ? -23.926 34.917 -171.601 1.00 80.52  ? 19  ARG M NH1 1 
ATOM   3490 N NH2 . ARG C 1 19  ? -25.778 33.763 -170.873 1.00 63.08  ? 19  ARG M NH2 1 
ATOM   3491 N N   . LEU C 1 20  ? -31.218 37.110 -171.539 1.00 47.07  ? 20  LEU M N   1 
ATOM   3492 C CA  . LEU C 1 20  ? -31.793 36.234 -172.554 1.00 44.84  ? 20  LEU M CA  1 
ATOM   3493 C C   . LEU C 1 20  ? -30.747 35.836 -173.574 1.00 51.07  ? 20  LEU M C   1 
ATOM   3494 O O   . LEU C 1 20  ? -29.820 36.610 -173.842 1.00 57.07  ? 20  LEU M O   1 
ATOM   3495 C CB  . LEU C 1 20  ? -32.914 36.952 -173.278 1.00 42.54  ? 20  LEU M CB  1 
ATOM   3496 C CG  . LEU C 1 20  ? -34.028 37.409 -172.368 1.00 39.71  ? 20  LEU M CG  1 
ATOM   3497 C CD1 . LEU C 1 20  ? -35.135 38.005 -173.195 1.00 38.54  ? 20  LEU M CD1 1 
ATOM   3498 C CD2 . LEU C 1 20  ? -34.526 36.222 -171.597 1.00 45.24  ? 20  LEU M CD2 1 
ATOM   3499 N N   . SER C 1 21  ? -30.910 34.647 -174.158 1.00 45.64  ? 21  SER M N   1 
ATOM   3500 C CA  . SER C 1 21  ? -29.998 34.159 -175.198 1.00 47.55  ? 21  SER M CA  1 
ATOM   3501 C C   . SER C 1 21  ? -30.715 33.753 -176.468 1.00 50.96  ? 21  SER M C   1 
ATOM   3502 O O   . SER C 1 21  ? -31.873 33.344 -176.443 1.00 52.70  ? 21  SER M O   1 
ATOM   3503 C CB  . SER C 1 21  ? -29.186 32.958 -174.710 1.00 47.13  ? 21  SER M CB  1 
ATOM   3504 O OG  . SER C 1 21  ? -28.351 33.315 -173.627 1.00 62.93  ? 21  SER M OG  1 
ATOM   3505 N N   . CYS C 1 22  ? -29.994 33.837 -177.578 1.00 46.58  ? 22  CYS M N   1 
ATOM   3506 C CA  . CYS C 1 22  ? -30.501 33.377 -178.848 1.00 48.66  ? 22  CYS M CA  1 
ATOM   3507 C C   . CYS C 1 22  ? -29.375 32.757 -179.658 1.00 55.89  ? 22  CYS M C   1 
ATOM   3508 O O   . CYS C 1 22  ? -28.303 33.341 -179.789 1.00 56.66  ? 22  CYS M O   1 
ATOM   3509 C CB  . CYS C 1 22  ? -31.069 34.547 -179.617 1.00 54.14  ? 22  CYS M CB  1 
ATOM   3510 S SG  . CYS C 1 22  ? -32.007 34.056 -181.044 1.00 99.60  ? 22  CYS M SG  1 
ATOM   3511 N N   . ALA C 1 23  ? -29.622 31.575 -180.209 1.00 51.72  ? 23  ALA M N   1 
ATOM   3512 C CA  . ALA C 1 23  ? -28.632 30.901 -181.049 1.00 53.34  ? 23  ALA M CA  1 
ATOM   3513 C C   . ALA C 1 23  ? -29.145 30.756 -182.479 1.00 59.30  ? 23  ALA M C   1 
ATOM   3514 O O   . ALA C 1 23  ? -30.267 30.299 -182.704 1.00 66.31  ? 23  ALA M O   1 
ATOM   3515 C CB  . ALA C 1 23  ? -28.295 29.537 -180.475 1.00 49.49  ? 23  ALA M CB  1 
ATOM   3516 N N   . ALA C 1 24  ? -28.326 31.149 -183.444 1.00 56.61  ? 24  ALA M N   1 
ATOM   3517 C CA  . ALA C 1 24  ? -28.693 30.991 -184.843 1.00 55.87  ? 24  ALA M CA  1 
ATOM   3518 C C   . ALA C 1 24  ? -28.247 29.627 -185.341 1.00 58.30  ? 24  ALA M C   1 
ATOM   3519 O O   . ALA C 1 24  ? -27.162 29.157 -184.996 1.00 63.48  ? 24  ALA M O   1 
ATOM   3520 C CB  . ALA C 1 24  ? -28.068 32.088 -185.681 1.00 57.30  ? 24  ALA M CB  1 
ATOM   3521 N N   . SER C 1 25  ? -29.090 28.985 -186.141 1.00 55.08  ? 25  SER M N   1 
ATOM   3522 C CA  . SER C 1 25  ? -28.687 27.771 -186.829 1.00 64.14  ? 25  SER M CA  1 
ATOM   3523 C C   . SER C 1 25  ? -29.195 27.837 -188.256 1.00 68.67  ? 25  SER M C   1 
ATOM   3524 O O   . SER C 1 25  ? -30.341 28.219 -188.487 1.00 70.69  ? 25  SER M O   1 
ATOM   3525 C CB  . SER C 1 25  ? -29.222 26.529 -186.120 1.00 75.33  ? 25  SER M CB  1 
ATOM   3526 O OG  . SER C 1 25  ? -30.634 26.546 -186.065 1.00 86.35  ? 25  SER M OG  1 
ATOM   3527 N N   . GLY C 1 26  ? -28.333 27.488 -189.211 1.00 66.17  ? 26  GLY M N   1 
ATOM   3528 C CA  . GLY C 1 26  ? -28.701 27.515 -190.615 1.00 61.49  ? 26  GLY M CA  1 
ATOM   3529 C C   . GLY C 1 26  ? -28.349 28.823 -191.306 1.00 68.47  ? 26  GLY M C   1 
ATOM   3530 O O   . GLY C 1 26  ? -28.717 29.056 -192.466 1.00 73.07  ? 26  GLY M O   1 
ATOM   3531 N N   . PHE C 1 27  ? -27.650 29.690 -190.582 1.00 61.21  ? 27  PHE M N   1 
ATOM   3532 C CA  . PHE C 1 27  ? -27.136 30.930 -191.138 1.00 60.33  ? 27  PHE M CA  1 
ATOM   3533 C C   . PHE C 1 27  ? -26.110 31.458 -190.147 1.00 64.30  ? 27  PHE M C   1 
ATOM   3534 O O   . PHE C 1 27  ? -25.946 30.882 -189.074 1.00 68.94  ? 27  PHE M O   1 
ATOM   3535 C CB  . PHE C 1 27  ? -28.267 31.936 -191.440 1.00 61.93  ? 27  PHE M CB  1 
ATOM   3536 C CG  . PHE C 1 27  ? -28.854 32.612 -190.219 1.00 60.81  ? 27  PHE M CG  1 
ATOM   3537 C CD1 . PHE C 1 27  ? -28.441 33.880 -189.848 1.00 59.87  ? 27  PHE M CD1 1 
ATOM   3538 C CD2 . PHE C 1 27  ? -29.831 31.990 -189.462 1.00 56.09  ? 27  PHE M CD2 1 
ATOM   3539 C CE1 . PHE C 1 27  ? -28.978 34.511 -188.733 1.00 53.50  ? 27  PHE M CE1 1 
ATOM   3540 C CE2 . PHE C 1 27  ? -30.365 32.611 -188.354 1.00 54.57  ? 27  PHE M CE2 1 
ATOM   3541 C CZ  . PHE C 1 27  ? -29.936 33.880 -187.989 1.00 51.62  ? 27  PHE M CZ  1 
ATOM   3542 N N   . THR C 1 28  ? -25.399 32.520 -190.496 1.00 63.28  ? 28  THR M N   1 
ATOM   3543 C CA  . THR C 1 28  ? -24.335 32.990 -189.620 1.00 69.13  ? 28  THR M CA  1 
ATOM   3544 C C   . THR C 1 28  ? -24.590 34.409 -189.154 1.00 67.16  ? 28  THR M C   1 
ATOM   3545 O O   . THR C 1 28  ? -24.712 35.327 -189.964 1.00 75.68  ? 28  THR M O   1 
ATOM   3546 C CB  . THR C 1 28  ? -22.952 32.882 -190.291 1.00 79.11  ? 28  THR M CB  1 
ATOM   3547 O OG1 . THR C 1 28  ? -23.038 33.378 -191.628 1.00 83.52  ? 28  THR M OG1 1 
ATOM   3548 C CG2 . THR C 1 28  ? -22.496 31.429 -190.332 1.00 83.12  ? 28  THR M CG2 1 
ATOM   3549 N N   . LEU C 1 29  ? -24.672 34.580 -187.841 1.00 60.74  ? 29  LEU M N   1 
ATOM   3550 C CA  . LEU C 1 29  ? -25.041 35.863 -187.253 1.00 60.31  ? 29  LEU M CA  1 
ATOM   3551 C C   . LEU C 1 29  ? -24.225 37.034 -187.817 1.00 67.43  ? 29  LEU M C   1 
ATOM   3552 O O   . LEU C 1 29  ? -24.709 38.165 -187.880 1.00 72.85  ? 29  LEU M O   1 
ATOM   3553 C CB  . LEU C 1 29  ? -24.865 35.806 -185.741 1.00 52.62  ? 29  LEU M CB  1 
ATOM   3554 C CG  . LEU C 1 29  ? -26.022 36.399 -184.959 1.00 54.88  ? 29  LEU M CG  1 
ATOM   3555 C CD1 . LEU C 1 29  ? -27.197 35.460 -185.047 1.00 48.15  ? 29  LEU M CD1 1 
ATOM   3556 C CD2 . LEU C 1 29  ? -25.621 36.612 -183.517 1.00 60.12  ? 29  LEU M CD2 1 
ATOM   3557 N N   . ILE C 1 30  ? -22.987 36.758 -188.220 1.00 58.92  ? 30  ILE M N   1 
ATOM   3558 C CA  . ILE C 1 30  ? -22.072 37.807 -188.646 1.00 58.38  ? 30  ILE M CA  1 
ATOM   3559 C C   . ILE C 1 30  ? -22.647 38.659 -189.778 1.00 60.07  ? 30  ILE M C   1 
ATOM   3560 O O   . ILE C 1 30  ? -22.301 39.821 -189.940 1.00 58.36  ? 30  ILE M O   1 
ATOM   3561 C CB  . ILE C 1 30  ? -20.750 37.200 -189.115 1.00 59.88  ? 30  ILE M CB  1 
ATOM   3562 C CG1 . ILE C 1 30  ? -19.747 38.293 -189.474 1.00 57.74  ? 30  ILE M CG1 1 
ATOM   3563 C CG2 . ILE C 1 30  ? -20.987 36.292 -190.302 1.00 65.04  ? 30  ILE M CG2 1 
ATOM   3564 C CD1 . ILE C 1 30  ? -18.865 38.732 -188.329 1.00 54.46  ? 30  ILE M CD1 1 
ATOM   3565 N N   . ASN C 1 31  ? -23.537 38.088 -190.567 1.00 59.26  ? 31  ASN M N   1 
ATOM   3566 C CA  . ASN C 1 31  ? -24.041 38.816 -191.719 1.00 71.44  ? 31  ASN M CA  1 
ATOM   3567 C C   . ASN C 1 31  ? -25.163 39.815 -191.428 1.00 76.39  ? 31  ASN M C   1 
ATOM   3568 O O   . ASN C 1 31  ? -25.324 40.813 -192.142 1.00 79.13  ? 31  ASN M O   1 
ATOM   3569 C CB  . ASN C 1 31  ? -24.484 37.828 -192.787 1.00 77.73  ? 31  ASN M CB  1 
ATOM   3570 C CG  . ASN C 1 31  ? -23.333 37.005 -193.320 1.00 87.24  ? 31  ASN M CG  1 
ATOM   3571 O OD1 . ASN C 1 31  ? -22.218 37.510 -193.513 1.00 90.04  ? 31  ASN M OD1 1 
ATOM   3572 N ND2 . ASN C 1 31  ? -23.592 35.729 -193.567 1.00 90.74  ? 31  ASN M ND2 1 
ATOM   3573 N N   . TYR C 1 32  ? -25.930 39.558 -190.375 1.00 65.43  ? 32  TYR M N   1 
ATOM   3574 C CA  . TYR C 1 32  ? -27.171 40.286 -190.180 1.00 56.01  ? 32  TYR M CA  1 
ATOM   3575 C C   . TYR C 1 32  ? -27.177 41.206 -188.971 1.00 57.37  ? 32  TYR M C   1 
ATOM   3576 O O   . TYR C 1 32  ? -26.459 40.990 -187.996 1.00 60.89  ? 32  TYR M O   1 
ATOM   3577 C CB  . TYR C 1 32  ? -28.328 39.300 -190.065 1.00 50.99  ? 32  TYR M CB  1 
ATOM   3578 C CG  . TYR C 1 32  ? -28.414 38.321 -191.203 1.00 58.39  ? 32  TYR M CG  1 
ATOM   3579 C CD1 . TYR C 1 32  ? -27.676 37.141 -191.189 1.00 61.90  ? 32  TYR M CD1 1 
ATOM   3580 C CD2 . TYR C 1 32  ? -29.236 38.571 -192.299 1.00 55.66  ? 32  TYR M CD2 1 
ATOM   3581 C CE1 . TYR C 1 32  ? -27.755 36.239 -192.239 1.00 59.93  ? 32  TYR M CE1 1 
ATOM   3582 C CE2 . TYR C 1 32  ? -29.325 37.679 -193.345 1.00 54.88  ? 32  TYR M CE2 1 
ATOM   3583 C CZ  . TYR C 1 32  ? -28.585 36.513 -193.314 1.00 59.26  ? 32  TYR M CZ  1 
ATOM   3584 O OH  . TYR C 1 32  ? -28.676 35.623 -194.364 1.00 62.78  ? 32  TYR M OH  1 
ATOM   3585 N N   . ARG C 1 33  ? -28.005 42.238 -189.051 1.00 53.89  ? 33  ARG M N   1 
ATOM   3586 C CA  . ARG C 1 33  ? -28.307 43.072 -187.908 1.00 50.68  ? 33  ARG M CA  1 
ATOM   3587 C C   . ARG C 1 33  ? -29.412 42.372 -187.120 1.00 57.23  ? 33  ARG M C   1 
ATOM   3588 O O   . ARG C 1 33  ? -30.424 41.972 -187.697 1.00 58.34  ? 33  ARG M O   1 
ATOM   3589 C CB  . ARG C 1 33  ? -28.780 44.437 -188.379 1.00 51.09  ? 33  ARG M CB  1 
ATOM   3590 C CG  . ARG C 1 33  ? -28.983 45.417 -187.264 1.00 60.67  ? 33  ARG M CG  1 
ATOM   3591 C CD  . ARG C 1 33  ? -28.860 46.825 -187.805 1.00 65.79  ? 33  ARG M CD  1 
ATOM   3592 N NE  . ARG C 1 33  ? -30.104 47.293 -188.400 1.00 64.59  ? 33  ARG M NE  1 
ATOM   3593 C CZ  . ARG C 1 33  ? -30.204 48.391 -189.138 1.00 66.35  ? 33  ARG M CZ  1 
ATOM   3594 N NH1 . ARG C 1 33  ? -29.132 49.124 -189.382 1.00 69.20  ? 33  ARG M NH1 1 
ATOM   3595 N NH2 . ARG C 1 33  ? -31.375 48.756 -189.640 1.00 69.48  ? 33  ARG M NH2 1 
ATOM   3596 N N   . MET C 1 34  ? -29.213 42.222 -185.811 1.00 54.89  ? 34  MET M N   1 
ATOM   3597 C CA  . MET C 1 34  ? -30.091 41.421 -184.961 1.00 50.77  ? 34  MET M CA  1 
ATOM   3598 C C   . MET C 1 34  ? -30.948 42.303 -184.053 1.00 51.24  ? 34  MET M C   1 
ATOM   3599 O O   . MET C 1 34  ? -30.540 43.410 -183.722 1.00 50.61  ? 34  MET M O   1 
ATOM   3600 C CB  . MET C 1 34  ? -29.247 40.470 -184.111 1.00 47.59  ? 34  MET M CB  1 
ATOM   3601 C CG  . MET C 1 34  ? -28.563 39.361 -184.895 1.00 44.31  ? 34  MET M CG  1 
ATOM   3602 S SD  . MET C 1 34  ? -29.737 38.242 -185.680 1.00 54.24  ? 34  MET M SD  1 
ATOM   3603 C CE  . MET C 1 34  ? -29.989 39.150 -187.184 1.00 131.60 ? 34  MET M CE  1 
ATOM   3604 N N   . ASN C 1 35  ? -32.124 41.814 -183.647 1.00 49.12  ? 35  ASN M N   1 
ATOM   3605 C CA  . ASN C 1 35  ? -33.046 42.612 -182.830 1.00 42.59  ? 35  ASN M CA  1 
ATOM   3606 C C   . ASN C 1 35  ? -33.785 41.818 -181.781 1.00 43.50  ? 35  ASN M C   1 
ATOM   3607 O O   . ASN C 1 35  ? -33.841 40.587 -181.833 1.00 43.74  ? 35  ASN M O   1 
ATOM   3608 C CB  . ASN C 1 35  ? -34.119 43.273 -183.700 1.00 47.58  ? 35  ASN M CB  1 
ATOM   3609 C CG  . ASN C 1 35  ? -33.549 44.175 -184.765 1.00 51.35  ? 35  ASN M CG  1 
ATOM   3610 O OD1 . ASN C 1 35  ? -33.775 45.387 -184.751 1.00 55.83  ? 35  ASN M OD1 1 
ATOM   3611 N ND2 . ASN C 1 35  ? -32.820 43.591 -185.710 1.00 46.16  ? 35  ASN M ND2 1 
ATOM   3612 N N   . TRP C 1 36  ? -34.384 42.547 -180.843 1.00 40.89  ? 36  TRP M N   1 
ATOM   3613 C CA  . TRP C 1 36  ? -35.347 41.987 -179.902 1.00 38.59  ? 36  TRP M CA  1 
ATOM   3614 C C   . TRP C 1 36  ? -36.685 42.707 -180.034 1.00 42.82  ? 36  TRP M C   1 
ATOM   3615 O O   . TRP C 1 36  ? -36.741 43.921 -180.203 1.00 47.88  ? 36  TRP M O   1 
ATOM   3616 C CB  . TRP C 1 36  ? -34.836 42.101 -178.471 1.00 43.23  ? 36  TRP M CB  1 
ATOM   3617 C CG  . TRP C 1 36  ? -33.663 41.247 -178.232 1.00 46.55  ? 36  TRP M CG  1 
ATOM   3618 C CD1 . TRP C 1 36  ? -32.358 41.593 -178.383 1.00 44.93  ? 36  TRP M CD1 1 
ATOM   3619 C CD2 . TRP C 1 36  ? -33.673 39.876 -177.829 1.00 45.11  ? 36  TRP M CD2 1 
ATOM   3620 N NE1 . TRP C 1 36  ? -31.552 40.525 -178.092 1.00 44.29  ? 36  TRP M NE1 1 
ATOM   3621 C CE2 . TRP C 1 36  ? -32.336 39.459 -177.744 1.00 41.56  ? 36  TRP M CE2 1 
ATOM   3622 C CE3 . TRP C 1 36  ? -34.685 38.965 -177.521 1.00 44.25  ? 36  TRP M CE3 1 
ATOM   3623 C CZ2 . TRP C 1 36  ? -31.980 38.166 -177.376 1.00 42.43  ? 36  TRP M CZ2 1 
ATOM   3624 C CZ3 . TRP C 1 36  ? -34.333 37.694 -177.155 1.00 39.61  ? 36  TRP M CZ3 1 
ATOM   3625 C CH2 . TRP C 1 36  ? -32.994 37.300 -177.085 1.00 37.31  ? 36  TRP M CH2 1 
ATOM   3626 N N   . VAL C 1 37  ? -37.763 41.939 -179.969 1.00 43.29  ? 37  VAL M N   1 
ATOM   3627 C CA  . VAL C 1 37  ? -39.118 42.471 -180.037 1.00 37.86  ? 37  VAL M CA  1 
ATOM   3628 C C   . VAL C 1 37  ? -39.896 41.818 -178.916 1.00 39.23  ? 37  VAL M C   1 
ATOM   3629 O O   . VAL C 1 37  ? -39.723 40.631 -178.636 1.00 42.14  ? 37  VAL M O   1 
ATOM   3630 C CB  . VAL C 1 37  ? -39.776 42.130 -181.391 1.00 42.47  ? 37  VAL M CB  1 
ATOM   3631 C CG1 . VAL C 1 37  ? -41.241 42.506 -181.398 1.00 42.81  ? 37  VAL M CG1 1 
ATOM   3632 C CG2 . VAL C 1 37  ? -39.043 42.820 -182.516 1.00 38.75  ? 37  VAL M CG2 1 
ATOM   3633 N N   . ARG C 1 38  ? -40.744 42.577 -178.244 1.00 44.02  ? 38  ARG M N   1 
ATOM   3634 C CA  . ARG C 1 38  ? -41.468 41.994 -177.123 1.00 43.15  ? 38  ARG M CA  1 
ATOM   3635 C C   . ARG C 1 38  ? -42.952 42.178 -177.290 1.00 42.90  ? 38  ARG M C   1 
ATOM   3636 O O   . ARG C 1 38  ? -43.413 43.040 -178.044 1.00 50.12  ? 38  ARG M O   1 
ATOM   3637 C CB  . ARG C 1 38  ? -41.000 42.582 -175.792 1.00 45.21  ? 38  ARG M CB  1 
ATOM   3638 C CG  . ARG C 1 38  ? -41.579 43.943 -175.468 1.00 43.88  ? 38  ARG M CG  1 
ATOM   3639 C CD  . ARG C 1 38  ? -40.998 44.444 -174.182 1.00 43.47  ? 38  ARG M CD  1 
ATOM   3640 N NE  . ARG C 1 38  ? -41.336 45.839 -173.946 1.00 47.12  ? 38  ARG M NE  1 
ATOM   3641 C CZ  . ARG C 1 38  ? -40.930 46.532 -172.885 1.00 49.12  ? 38  ARG M CZ  1 
ATOM   3642 N NH1 . ARG C 1 38  ? -40.166 45.957 -171.966 1.00 41.43  ? 38  ARG M NH1 1 
ATOM   3643 N NH2 . ARG C 1 38  ? -41.295 47.798 -172.740 1.00 51.70  ? 38  ARG M NH2 1 
ATOM   3644 N N   . GLN C 1 39  ? -43.701 41.353 -176.583 1.00 42.34  ? 39  GLN M N   1 
ATOM   3645 C CA  . GLN C 1 39  ? -45.149 41.370 -176.684 1.00 42.17  ? 39  GLN M CA  1 
ATOM   3646 C C   . GLN C 1 39  ? -45.745 41.018 -175.334 1.00 42.22  ? 39  GLN M C   1 
ATOM   3647 O O   . GLN C 1 39  ? -45.652 39.881 -174.877 1.00 50.43  ? 39  GLN M O   1 
ATOM   3648 C CB  . GLN C 1 39  ? -45.627 40.372 -177.747 1.00 38.42  ? 39  GLN M CB  1 
ATOM   3649 C CG  . GLN C 1 39  ? -47.126 40.429 -178.023 1.00 39.69  ? 39  GLN M CG  1 
ATOM   3650 C CD  . GLN C 1 39  ? -47.560 39.505 -179.169 1.00 42.98  ? 39  GLN M CD  1 
ATOM   3651 O OE1 . GLN C 1 39  ? -47.081 38.379 -179.294 1.00 41.20  ? 39  GLN M OE1 1 
ATOM   3652 N NE2 . GLN C 1 39  ? -48.468 39.987 -180.002 1.00 40.49  ? 39  GLN M NE2 1 
ATOM   3653 N N   . ALA C 1 40  ? -46.350 41.999 -174.688 1.00 42.68  ? 40  ALA M N   1 
ATOM   3654 C CA  . ALA C 1 40  ? -47.057 41.735 -173.453 1.00 46.38  ? 40  ALA M CA  1 
ATOM   3655 C C   . ALA C 1 40  ? -48.257 40.852 -173.735 1.00 53.75  ? 40  ALA M C   1 
ATOM   3656 O O   . ALA C 1 40  ? -48.909 40.989 -174.763 1.00 55.89  ? 40  ALA M O   1 
ATOM   3657 C CB  . ALA C 1 40  ? -47.494 43.022 -172.831 1.00 45.78  ? 40  ALA M CB  1 
ATOM   3658 N N   . PRO C 1 41  ? -48.555 39.931 -172.820 1.00 62.13  ? 41  PRO M N   1 
ATOM   3659 C CA  . PRO C 1 41  ? -49.732 39.083 -173.019 1.00 57.08  ? 41  PRO M CA  1 
ATOM   3660 C C   . PRO C 1 41  ? -50.955 39.916 -173.385 1.00 61.22  ? 41  PRO M C   1 
ATOM   3661 O O   . PRO C 1 41  ? -51.258 40.890 -172.699 1.00 62.72  ? 41  PRO M O   1 
ATOM   3662 C CB  . PRO C 1 41  ? -49.917 38.433 -171.651 1.00 58.66  ? 41  PRO M CB  1 
ATOM   3663 C CG  . PRO C 1 41  ? -48.531 38.340 -171.114 1.00 65.45  ? 41  PRO M CG  1 
ATOM   3664 C CD  . PRO C 1 41  ? -47.832 39.600 -171.582 1.00 64.78  ? 41  PRO M CD  1 
ATOM   3665 N N   . GLY C 1 42  ? -51.627 39.537 -174.470 1.00 57.91  ? 42  GLY M N   1 
ATOM   3666 C CA  . GLY C 1 42  ? -52.849 40.184 -174.902 1.00 54.82  ? 42  GLY M CA  1 
ATOM   3667 C C   . GLY C 1 42  ? -52.628 41.412 -175.762 1.00 58.29  ? 42  GLY M C   1 
ATOM   3668 O O   . GLY C 1 42  ? -53.591 42.023 -176.236 1.00 61.32  ? 42  GLY M O   1 
ATOM   3669 N N   . LYS C 1 43  ? -51.364 41.758 -175.986 1.00 55.39  ? 43  LYS M N   1 
ATOM   3670 C CA  . LYS C 1 43  ? -51.028 43.059 -176.559 1.00 61.14  ? 43  LYS M CA  1 
ATOM   3671 C C   . LYS C 1 43  ? -50.285 43.025 -177.891 1.00 59.13  ? 43  LYS M C   1 
ATOM   3672 O O   . LYS C 1 43  ? -49.997 41.962 -178.448 1.00 48.38  ? 43  LYS M O   1 
ATOM   3673 C CB  . LYS C 1 43  ? -50.187 43.867 -175.568 1.00 64.48  ? 43  LYS M CB  1 
ATOM   3674 C CG  . LYS C 1 43  ? -50.767 43.943 -174.184 1.00 67.69  ? 43  LYS M CG  1 
ATOM   3675 C CD  . LYS C 1 43  ? -52.120 44.605 -174.188 1.00 78.24  ? 43  LYS M CD  1 
ATOM   3676 C CE  . LYS C 1 43  ? -52.472 45.038 -172.786 1.00 88.04  ? 43  LYS M CE  1 
ATOM   3677 N NZ  . LYS C 1 43  ? -51.221 45.530 -172.117 1.00 85.73  ? 43  LYS M NZ  1 
ATOM   3678 N N   . GLY C 1 44  ? -49.955 44.224 -178.366 1.00 59.71  ? 44  GLY M N   1 
ATOM   3679 C CA  . GLY C 1 44  ? -49.267 44.408 -179.624 1.00 48.16  ? 44  GLY M CA  1 
ATOM   3680 C C   . GLY C 1 44  ? -47.809 44.039 -179.557 1.00 47.02  ? 44  GLY M C   1 
ATOM   3681 O O   . GLY C 1 44  ? -47.344 43.472 -178.571 1.00 48.80  ? 44  GLY M O   1 
ATOM   3682 N N   . LEU C 1 45  ? -47.096 44.345 -180.634 1.00 49.35  ? 45  LEU M N   1 
ATOM   3683 C CA  . LEU C 1 45  ? -45.670 44.084 -180.727 1.00 45.41  ? 45  LEU M CA  1 
ATOM   3684 C C   . LEU C 1 45  ? -44.948 45.384 -180.482 1.00 52.99  ? 45  LEU M C   1 
ATOM   3685 O O   . LEU C 1 45  ? -45.395 46.443 -180.928 1.00 59.90  ? 45  LEU M O   1 
ATOM   3686 C CB  . LEU C 1 45  ? -45.317 43.572 -182.116 1.00 40.86  ? 45  LEU M CB  1 
ATOM   3687 C CG  . LEU C 1 45  ? -46.024 42.272 -182.489 1.00 45.23  ? 45  LEU M CG  1 
ATOM   3688 C CD1 . LEU C 1 45  ? -45.919 42.012 -183.968 1.00 46.28  ? 45  LEU M CD1 1 
ATOM   3689 C CD2 . LEU C 1 45  ? -45.434 41.125 -181.699 1.00 41.90  ? 45  LEU M CD2 1 
ATOM   3690 N N   . GLU C 1 46  ? -43.838 45.307 -179.759 1.00 51.32  ? 46  GLU M N   1 
ATOM   3691 C CA  . GLU C 1 46  ? -43.016 46.481 -179.502 1.00 50.92  ? 46  GLU M CA  1 
ATOM   3692 C C   . GLU C 1 46  ? -41.540 46.159 -179.711 1.00 48.30  ? 46  GLU M C   1 
ATOM   3693 O O   . GLU C 1 46  ? -40.971 45.288 -179.050 1.00 50.63  ? 46  GLU M O   1 
ATOM   3694 C CB  . GLU C 1 46  ? -43.267 47.011 -178.089 1.00 51.56  ? 46  GLU M CB  1 
ATOM   3695 C CG  . GLU C 1 46  ? -42.362 48.155 -177.688 1.00 62.20  ? 46  GLU M CG  1 
ATOM   3696 C CD  . GLU C 1 46  ? -42.515 48.549 -176.226 1.00 68.77  ? 46  GLU M CD  1 
ATOM   3697 O OE1 . GLU C 1 46  ? -42.651 47.656 -175.363 1.00 66.81  ? 46  GLU M OE1 1 
ATOM   3698 O OE2 . GLU C 1 46  ? -42.491 49.760 -175.943 1.00 74.39  ? 46  GLU M OE2 1 
ATOM   3699 N N   . TRP C 1 47  ? -40.927 46.857 -180.652 1.00 43.18  ? 47  TRP M N   1 
ATOM   3700 C CA  . TRP C 1 47  ? -39.500 46.715 -180.870 1.00 41.77  ? 47  TRP M CA  1 
ATOM   3701 C C   . TRP C 1 47  ? -38.747 47.237 -179.640 1.00 44.34  ? 47  TRP M C   1 
ATOM   3702 O O   . TRP C 1 47  ? -39.112 48.262 -179.067 1.00 45.89  ? 47  TRP M O   1 
ATOM   3703 C CB  . TRP C 1 47  ? -39.074 47.461 -182.139 1.00 37.10  ? 47  TRP M CB  1 
ATOM   3704 C CG  . TRP C 1 47  ? -37.599 47.557 -182.295 1.00 47.77  ? 47  TRP M CG  1 
ATOM   3705 C CD1 . TRP C 1 47  ? -36.747 46.582 -182.738 1.00 48.88  ? 47  TRP M CD1 1 
ATOM   3706 C CD2 . TRP C 1 47  ? -36.786 48.690 -181.980 1.00 57.28  ? 47  TRP M CD2 1 
ATOM   3707 N NE1 . TRP C 1 47  ? -35.449 47.045 -182.725 1.00 52.86  ? 47  TRP M NE1 1 
ATOM   3708 C CE2 . TRP C 1 47  ? -35.447 48.335 -182.259 1.00 57.08  ? 47  TRP M CE2 1 
ATOM   3709 C CE3 . TRP C 1 47  ? -37.057 49.971 -181.485 1.00 54.05  ? 47  TRP M CE3 1 
ATOM   3710 C CZ2 . TRP C 1 47  ? -34.395 49.212 -182.063 1.00 55.83  ? 47  TRP M CZ2 1 
ATOM   3711 C CZ3 . TRP C 1 47  ? -36.018 50.836 -181.296 1.00 56.24  ? 47  TRP M CZ3 1 
ATOM   3712 C CH2 . TRP C 1 47  ? -34.701 50.460 -181.586 1.00 59.44  ? 47  TRP M CH2 1 
ATOM   3713 N N   . VAL C 1 48  ? -37.697 46.526 -179.257 1.00 36.67  ? 48  VAL M N   1 
ATOM   3714 C CA  . VAL C 1 48  ? -36.986 46.791 -178.019 1.00 45.47  ? 48  VAL M CA  1 
ATOM   3715 C C   . VAL C 1 48  ? -35.558 47.270 -178.285 1.00 54.21  ? 48  VAL M C   1 
ATOM   3716 O O   . VAL C 1 48  ? -35.113 48.279 -177.732 1.00 53.80  ? 48  VAL M O   1 
ATOM   3717 C CB  . VAL C 1 48  ? -36.931 45.520 -177.129 1.00 44.37  ? 48  VAL M CB  1 
ATOM   3718 C CG1 . VAL C 1 48  ? -35.970 45.710 -175.995 1.00 52.78  ? 48  VAL M CG1 1 
ATOM   3719 C CG2 . VAL C 1 48  ? -38.283 45.221 -176.570 1.00 55.00  ? 48  VAL M CG2 1 
ATOM   3720 N N   . SER C 1 49  ? -34.833 46.542 -179.125 1.00 52.07  ? 49  SER M N   1 
ATOM   3721 C CA  . SER C 1 49  ? -33.436 46.867 -179.344 1.00 54.08  ? 49  SER M CA  1 
ATOM   3722 C C   . SER C 1 49  ? -32.854 46.217 -180.595 1.00 54.56  ? 49  SER M C   1 
ATOM   3723 O O   . SER C 1 49  ? -33.311 45.154 -181.024 1.00 56.97  ? 49  SER M O   1 
ATOM   3724 C CB  . SER C 1 49  ? -32.612 46.473 -178.124 1.00 52.52  ? 49  SER M CB  1 
ATOM   3725 O OG  . SER C 1 49  ? -31.230 46.573 -178.416 1.00 56.90  ? 49  SER M OG  1 
ATOM   3726 N N   . SER C 1 50  ? -31.844 46.867 -181.173 1.00 49.65  ? 50  SER M N   1 
ATOM   3727 C CA  . SER C 1 50  ? -31.127 46.312 -182.320 1.00 49.12  ? 50  SER M CA  1 
ATOM   3728 C C   . SER C 1 50  ? -29.617 46.508 -182.220 1.00 45.95  ? 50  SER M C   1 
ATOM   3729 O O   . SER C 1 50  ? -29.135 47.472 -181.646 1.00 49.34  ? 50  SER M O   1 
ATOM   3730 C CB  . SER C 1 50  ? -31.631 46.916 -183.625 1.00 53.41  ? 50  SER M CB  1 
ATOM   3731 O OG  . SER C 1 50  ? -31.027 48.171 -183.841 1.00 68.80  ? 50  SER M OG  1 
ATOM   3732 N N   . ILE C 1 51  ? -28.874 45.579 -182.795 1.00 43.77  ? 51  ILE M N   1 
ATOM   3733 C CA  . ILE C 1 51  ? -27.432 45.678 -182.818 1.00 49.63  ? 51  ILE M CA  1 
ATOM   3734 C C   . ILE C 1 51  ? -26.891 45.275 -184.196 1.00 48.77  ? 51  ILE M C   1 
ATOM   3735 O O   . ILE C 1 51  ? -27.238 44.231 -184.729 1.00 49.50  ? 51  ILE M O   1 
ATOM   3736 C CB  . ILE C 1 51  ? -26.823 44.808 -181.710 1.00 53.99  ? 51  ILE M CB  1 
ATOM   3737 C CG1 . ILE C 1 51  ? -25.298 44.886 -181.741 1.00 58.17  ? 51  ILE M CG1 1 
ATOM   3738 C CG2 . ILE C 1 51  ? -27.293 43.368 -181.842 1.00 47.24  ? 51  ILE M CG2 1 
ATOM   3739 C CD1 . ILE C 1 51  ? -24.649 44.274 -180.522 1.00 57.12  ? 51  ILE M CD1 1 
ATOM   3740 N N   . SER C 1 52  ? -26.059 46.123 -184.781 1.00 50.37  ? 52  SER M N   1 
ATOM   3741 C CA  . SER C 1 52  ? -25.432 45.795 -186.056 1.00 49.32  ? 52  SER M CA  1 
ATOM   3742 C C   . SER C 1 52  ? -24.409 44.680 -185.857 1.00 51.30  ? 52  SER M C   1 
ATOM   3743 O O   . SER C 1 52  ? -24.001 44.393 -184.740 1.00 54.31  ? 52  SER M O   1 
ATOM   3744 C CB  . SER C 1 52  ? -24.756 47.020 -186.665 1.00 49.79  ? 52  SER M CB  1 
ATOM   3745 O OG  . SER C 1 52  ? -23.552 47.339 -185.975 1.00 56.78  ? 52  SER M OG  1 
ATOM   3746 N N   . SER C 1 53  A -24.004 44.052 -186.948 1.00 54.77  ? 52  SER M N   1 
ATOM   3747 C CA  . SER C 1 53  A -23.075 42.938 -186.898 1.00 56.05  ? 52  SER M CA  1 
ATOM   3748 C C   . SER C 1 53  A -21.797 43.258 -186.132 1.00 58.31  ? 52  SER M C   1 
ATOM   3749 O O   . SER C 1 53  A -21.321 42.440 -185.346 1.00 60.02  ? 52  SER M O   1 
ATOM   3750 C CB  . SER C 1 53  A -22.728 42.491 -188.319 1.00 60.38  ? 52  SER M CB  1 
ATOM   3751 O OG  . SER C 1 53  A -21.811 41.413 -188.300 1.00 67.98  ? 52  SER M OG  1 
ATOM   3752 N N   . SER C 1 54  ? -21.236 44.438 -186.373 1.00 61.27  ? 53  SER M N   1 
ATOM   3753 C CA  . SER C 1 54  ? -19.982 44.867 -185.733 1.00 61.31  ? 53  SER M CA  1 
ATOM   3754 C C   . SER C 1 54  ? -20.189 45.337 -184.293 1.00 57.08  ? 53  SER M C   1 
ATOM   3755 O O   . SER C 1 54  ? -19.241 45.699 -183.604 1.00 57.65  ? 53  SER M O   1 
ATOM   3756 C CB  . SER C 1 54  ? -19.388 46.022 -186.521 1.00 65.25  ? 53  SER M CB  1 
ATOM   3757 O OG  . SER C 1 54  ? -20.314 47.102 -186.558 1.00 68.61  ? 53  SER M OG  1 
ATOM   3758 N N   . SER C 1 55  ? -21.442 45.357 -183.862 1.00 50.42  ? 54  SER M N   1 
ATOM   3759 C CA  . SER C 1 55  ? -21.832 45.890 -182.562 1.00 48.32  ? 54  SER M CA  1 
ATOM   3760 C C   . SER C 1 55  ? -21.672 47.399 -182.454 1.00 51.50  ? 54  SER M C   1 
ATOM   3761 O O   . SER C 1 55  ? -21.768 47.944 -181.361 1.00 55.94  ? 54  SER M O   1 
ATOM   3762 C CB  . SER C 1 55  ? -21.096 45.187 -181.426 1.00 45.91  ? 54  SER M CB  1 
ATOM   3763 O OG  . SER C 1 55  ? -21.509 43.846 -181.314 1.00 53.46  ? 54  SER M OG  1 
ATOM   3764 N N   . SER C 1 56  ? -21.474 48.066 -183.589 1.00 56.65  ? 55  SER M N   1 
ATOM   3765 C CA  . SER C 1 56  ? -21.161 49.499 -183.616 1.00 59.55  ? 55  SER M CA  1 
ATOM   3766 C C   . SER C 1 56  ? -22.386 50.389 -183.632 1.00 57.76  ? 55  SER M C   1 
ATOM   3767 O O   . SER C 1 56  ? -22.398 51.454 -183.019 1.00 55.49  ? 55  SER M O   1 
ATOM   3768 C CB  . SER C 1 56  ? -20.282 49.841 -184.809 1.00 62.17  ? 55  SER M CB  1 
ATOM   3769 O OG  . SER C 1 56  ? -18.929 49.557 -184.520 1.00 72.26  ? 55  SER M OG  1 
ATOM   3770 N N   . TYR C 1 57  ? -23.412 49.964 -184.352 1.00 56.83  ? 56  TYR M N   1 
ATOM   3771 C CA  . TYR C 1 57  ? -24.684 50.656 -184.278 1.00 59.06  ? 56  TYR M CA  1 
ATOM   3772 C C   . TYR C 1 57  ? -25.550 49.891 -183.297 1.00 52.77  ? 56  TYR M C   1 
ATOM   3773 O O   . TYR C 1 57  ? -25.851 48.719 -183.504 1.00 57.79  ? 56  TYR M O   1 
ATOM   3774 C CB  . TYR C 1 57  ? -25.356 50.758 -185.654 1.00 70.62  ? 56  TYR M CB  1 
ATOM   3775 C CG  . TYR C 1 57  ? -26.847 51.041 -185.585 1.00 84.39  ? 56  TYR M CG  1 
ATOM   3776 C CD1 . TYR C 1 57  ? -27.328 52.217 -185.016 1.00 87.72  ? 56  TYR M CD1 1 
ATOM   3777 C CD2 . TYR C 1 57  ? -27.774 50.127 -186.075 1.00 87.11  ? 56  TYR M CD2 1 
ATOM   3778 C CE1 . TYR C 1 57  ? -28.686 52.474 -184.939 1.00 84.70  ? 56  TYR M CE1 1 
ATOM   3779 C CE2 . TYR C 1 57  ? -29.131 50.379 -186.007 1.00 83.55  ? 56  TYR M CE2 1 
ATOM   3780 C CZ  . TYR C 1 57  ? -29.580 51.553 -185.439 1.00 83.48  ? 56  TYR M CZ  1 
ATOM   3781 O OH  . TYR C 1 57  ? -30.929 51.803 -185.367 1.00 84.26  ? 56  TYR M OH  1 
ATOM   3782 N N   . ILE C 1 58  ? -25.927 50.559 -182.217 1.00 48.57  ? 57  ILE M N   1 
ATOM   3783 C CA  . ILE C 1 58  ? -26.786 49.971 -181.198 1.00 53.01  ? 57  ILE M CA  1 
ATOM   3784 C C   . ILE C 1 58  ? -27.909 50.934 -180.911 1.00 59.04  ? 57  ILE M C   1 
ATOM   3785 O O   . ILE C 1 58  ? -27.703 52.148 -180.894 1.00 64.60  ? 57  ILE M O   1 
ATOM   3786 C CB  . ILE C 1 58  ? -26.050 49.744 -179.892 1.00 53.51  ? 57  ILE M CB  1 
ATOM   3787 C CG1 . ILE C 1 58  ? -24.948 48.702 -180.082 1.00 56.34  ? 57  ILE M CG1 1 
ATOM   3788 C CG2 . ILE C 1 58  ? -27.038 49.329 -178.815 1.00 49.82  ? 57  ILE M CG2 1 
ATOM   3789 C CD1 . ILE C 1 58  ? -24.005 48.606 -178.907 1.00 52.23  ? 57  ILE M CD1 1 
ATOM   3790 N N   . HIS C 1 59  ? -29.100 50.401 -180.685 1.00 55.91  ? 58  HIS M N   1 
ATOM   3791 C CA  . HIS C 1 59  ? -30.261 51.260 -180.561 1.00 57.34  ? 58  HIS M CA  1 
ATOM   3792 C C   . HIS C 1 59  ? -31.317 50.635 -179.670 1.00 54.09  ? 58  HIS M C   1 
ATOM   3793 O O   . HIS C 1 59  ? -31.572 49.431 -179.741 1.00 57.68  ? 58  HIS M O   1 
ATOM   3794 C CB  . HIS C 1 59  ? -30.825 51.585 -181.943 1.00 65.01  ? 58  HIS M CB  1 
ATOM   3795 C CG  . HIS C 1 59  ? -31.473 52.930 -182.025 1.00 80.09  ? 58  HIS M CG  1 
ATOM   3796 N ND1 . HIS C 1 59  ? -31.278 53.786 -183.086 1.00 89.99  ? 58  HIS M ND1 1 
ATOM   3797 C CD2 . HIS C 1 59  ? -32.302 53.573 -181.168 1.00 86.76  ? 58  HIS M CD2 1 
ATOM   3798 C CE1 . HIS C 1 59  ? -31.974 54.893 -182.888 1.00 94.54  ? 58  HIS M CE1 1 
ATOM   3799 N NE2 . HIS C 1 59  ? -32.601 54.790 -181.729 1.00 90.77  ? 58  HIS M NE2 1 
ATOM   3800 N N   . TYR C 1 60  ? -31.917 51.467 -178.823 1.00 50.26  ? 59  TYR M N   1 
ATOM   3801 C CA  . TYR C 1 60  ? -32.908 51.016 -177.856 1.00 47.56  ? 59  TYR M CA  1 
ATOM   3802 C C   . TYR C 1 60  ? -34.216 51.784 -178.001 1.00 49.64  ? 59  TYR M C   1 
ATOM   3803 O O   . TYR C 1 60  ? -34.245 52.901 -178.506 1.00 55.19  ? 59  TYR M O   1 
ATOM   3804 C CB  . TYR C 1 60  ? -32.367 51.170 -176.437 1.00 43.79  ? 59  TYR M CB  1 
ATOM   3805 C CG  . TYR C 1 60  ? -31.150 50.326 -176.157 1.00 42.22  ? 59  TYR M CG  1 
ATOM   3806 C CD1 . TYR C 1 60  ? -29.881 50.873 -176.187 1.00 37.78  ? 59  TYR M CD1 1 
ATOM   3807 C CD2 . TYR C 1 60  ? -31.270 48.978 -175.868 1.00 40.18  ? 59  TYR M CD2 1 
ATOM   3808 C CE1 . TYR C 1 60  ? -28.762 50.106 -175.924 1.00 37.07  ? 59  TYR M CE1 1 
ATOM   3809 C CE2 . TYR C 1 60  ? -30.158 48.203 -175.609 1.00 41.23  ? 59  TYR M CE2 1 
ATOM   3810 C CZ  . TYR C 1 60  ? -28.909 48.776 -175.641 1.00 46.31  ? 59  TYR M CZ  1 
ATOM   3811 O OH  . TYR C 1 60  ? -27.804 48.015 -175.392 1.00 49.92  ? 59  TYR M OH  1 
ATOM   3812 N N   . ALA C 1 61  ? -35.307 51.173 -177.569 1.00 51.78  ? 60  ALA M N   1 
ATOM   3813 C CA  . ALA C 1 61  ? -36.576 51.882 -177.496 1.00 54.86  ? 60  ALA M CA  1 
ATOM   3814 C C   . ALA C 1 61  ? -36.602 52.699 -176.206 1.00 58.33  ? 60  ALA M C   1 
ATOM   3815 O O   . ALA C 1 61  ? -36.094 52.259 -175.171 1.00 51.95  ? 60  ALA M O   1 
ATOM   3816 C CB  . ALA C 1 61  ? -37.737 50.908 -177.539 1.00 42.86  ? 60  ALA M CB  1 
ATOM   3817 N N   . ASP C 1 62  ? -37.189 53.887 -176.271 1.00 62.37  ? 61  ASP M N   1 
ATOM   3818 C CA  . ASP C 1 62  ? -37.201 54.789 -175.126 1.00 64.77  ? 61  ASP M CA  1 
ATOM   3819 C C   . ASP C 1 62  ? -37.703 54.119 -173.857 1.00 65.55  ? 61  ASP M C   1 
ATOM   3820 O O   . ASP C 1 62  ? -37.252 54.436 -172.761 1.00 70.67  ? 61  ASP M O   1 
ATOM   3821 C CB  . ASP C 1 62  ? -38.034 56.034 -175.429 1.00 72.95  ? 61  ASP M CB  1 
ATOM   3822 C CG  . ASP C 1 62  ? -37.290 57.040 -176.300 1.00 83.61  ? 61  ASP M CG  1 
ATOM   3823 O OD1 . ASP C 1 62  ? -37.876 58.099 -176.616 1.00 86.31  ? 61  ASP M OD1 1 
ATOM   3824 O OD2 . ASP C 1 62  ? -36.121 56.775 -176.668 1.00 87.40  ? 61  ASP M OD2 1 
ATOM   3825 N N   . SER C 1 63  ? -38.639 53.191 -174.006 1.00 61.13  ? 62  SER M N   1 
ATOM   3826 C CA  . SER C 1 63  ? -39.181 52.480 -172.855 1.00 58.33  ? 62  SER M CA  1 
ATOM   3827 C C   . SER C 1 63  ? -38.136 51.635 -172.137 1.00 59.51  ? 62  SER M C   1 
ATOM   3828 O O   . SER C 1 63  ? -38.266 51.378 -170.948 1.00 63.13  ? 62  SER M O   1 
ATOM   3829 C CB  . SER C 1 63  ? -40.386 51.620 -173.256 1.00 67.33  ? 62  SER M CB  1 
ATOM   3830 O OG  . SER C 1 63  ? -40.289 51.166 -174.596 1.00 74.90  ? 62  SER M OG  1 
ATOM   3831 N N   . VAL C 1 64  ? -37.091 51.210 -172.845 1.00 59.67  ? 63  VAL M N   1 
ATOM   3832 C CA  . VAL C 1 64  ? -36.063 50.378 -172.216 1.00 56.64  ? 63  VAL M CA  1 
ATOM   3833 C C   . VAL C 1 64  ? -34.693 51.041 -172.091 1.00 51.00  ? 63  VAL M C   1 
ATOM   3834 O O   . VAL C 1 64  ? -33.810 50.500 -171.441 1.00 50.40  ? 63  VAL M O   1 
ATOM   3835 C CB  . VAL C 1 64  ? -35.905 48.998 -172.907 1.00 57.98  ? 63  VAL M CB  1 
ATOM   3836 C CG1 . VAL C 1 64  ? -37.188 48.199 -172.796 1.00 55.04  ? 63  VAL M CG1 1 
ATOM   3837 C CG2 . VAL C 1 64  ? -35.494 49.173 -174.357 1.00 54.12  ? 63  VAL M CG2 1 
ATOM   3838 N N   . LYS C 1 65  ? -34.502 52.197 -172.712 1.00 55.67  ? 64  LYS M N   1 
ATOM   3839 C CA  . LYS C 1 65  ? -33.231 52.901 -172.562 1.00 56.03  ? 64  LYS M CA  1 
ATOM   3840 C C   . LYS C 1 65  ? -32.825 52.915 -171.091 1.00 56.99  ? 64  LYS M C   1 
ATOM   3841 O O   . LYS C 1 65  ? -33.624 53.256 -170.225 1.00 63.29  ? 64  LYS M O   1 
ATOM   3842 C CB  . LYS C 1 65  ? -33.336 54.335 -173.075 1.00 56.25  ? 64  LYS M CB  1 
ATOM   3843 C CG  . LYS C 1 65  ? -32.604 54.602 -174.368 1.00 60.91  ? 64  LYS M CG  1 
ATOM   3844 C CD  . LYS C 1 65  ? -32.122 56.051 -174.413 1.00 70.30  ? 64  LYS M CD  1 
ATOM   3845 C CE  . LYS C 1 65  ? -31.822 56.505 -175.835 1.00 81.21  ? 64  LYS M CE  1 
ATOM   3846 N NZ  . LYS C 1 65  ? -33.011 56.364 -176.748 1.00 85.04  ? 64  LYS M NZ  1 
ATOM   3847 N N   . GLY C 1 66  ? -31.591 52.525 -170.810 1.00 55.45  ? 65  GLY M N   1 
ATOM   3848 C CA  . GLY C 1 66  ? -31.056 52.616 -169.465 1.00 43.05  ? 65  GLY M CA  1 
ATOM   3849 C C   . GLY C 1 66  ? -31.147 51.316 -168.696 1.00 52.61  ? 65  GLY M C   1 
ATOM   3850 O O   . GLY C 1 66  ? -30.507 51.150 -167.661 1.00 58.41  ? 65  GLY M O   1 
ATOM   3851 N N   . ARG C 1 67  ? -31.928 50.377 -169.204 1.00 51.13  ? 66  ARG M N   1 
ATOM   3852 C CA  . ARG C 1 67  ? -32.239 49.184 -168.432 1.00 50.17  ? 66  ARG M CA  1 
ATOM   3853 C C   . ARG C 1 67  ? -31.934 47.893 -169.178 1.00 48.91  ? 66  ARG M C   1 
ATOM   3854 O O   . ARG C 1 67  ? -31.694 46.865 -168.567 1.00 57.33  ? 66  ARG M O   1 
ATOM   3855 C CB  . ARG C 1 67  ? -33.703 49.223 -167.965 1.00 48.54  ? 66  ARG M CB  1 
ATOM   3856 C CG  . ARG C 1 67  ? -33.960 50.330 -166.939 1.00 52.29  ? 66  ARG M CG  1 
ATOM   3857 C CD  . ARG C 1 67  ? -35.427 50.460 -166.528 1.00 55.02  ? 66  ARG M CD  1 
ATOM   3858 N NE  . ARG C 1 67  ? -36.304 50.563 -167.689 1.00 54.22  ? 66  ARG M NE  1 
ATOM   3859 C CZ  . ARG C 1 67  ? -37.193 49.637 -168.010 1.00 53.68  ? 66  ARG M CZ  1 
ATOM   3860 N NH1 . ARG C 1 67  ? -37.324 48.568 -167.245 1.00 53.61  ? 66  ARG M NH1 1 
ATOM   3861 N NH2 . ARG C 1 67  ? -37.942 49.776 -169.086 1.00 53.08  ? 66  ARG M NH2 1 
ATOM   3862 N N   . PHE C 1 68  ? -31.944 47.938 -170.499 1.00 39.57  ? 67  PHE M N   1 
ATOM   3863 C CA  . PHE C 1 68  ? -31.633 46.747 -171.266 1.00 44.64  ? 67  PHE M CA  1 
ATOM   3864 C C   . PHE C 1 68  ? -30.316 46.996 -172.002 1.00 46.63  ? 67  PHE M C   1 
ATOM   3865 O O   . PHE C 1 68  ? -30.030 48.114 -172.425 1.00 50.56  ? 67  PHE M O   1 
ATOM   3866 C CB  . PHE C 1 68  ? -32.753 46.417 -172.274 1.00 49.76  ? 67  PHE M CB  1 
ATOM   3867 C CG  . PHE C 1 68  ? -34.064 45.978 -171.646 1.00 55.85  ? 67  PHE M CG  1 
ATOM   3868 C CD1 . PHE C 1 68  ? -34.362 46.251 -170.320 1.00 59.42  ? 67  PHE M CD1 1 
ATOM   3869 C CD2 . PHE C 1 68  ? -35.022 45.319 -172.409 1.00 56.02  ? 67  PHE M CD2 1 
ATOM   3870 C CE1 . PHE C 1 68  ? -35.585 45.849 -169.760 1.00 53.33  ? 67  PHE M CE1 1 
ATOM   3871 C CE2 . PHE C 1 68  ? -36.241 44.919 -171.858 1.00 49.20  ? 67  PHE M CE2 1 
ATOM   3872 C CZ  . PHE C 1 68  ? -36.520 45.187 -170.534 1.00 46.88  ? 67  PHE M CZ  1 
ATOM   3873 N N   . THR C 1 69  ? -29.519 45.952 -172.158 1.00 43.35  ? 68  THR M N   1 
ATOM   3874 C CA  . THR C 1 69  ? -28.274 46.070 -172.888 1.00 46.94  ? 68  THR M CA  1 
ATOM   3875 C C   . THR C 1 69  ? -28.134 44.930 -173.879 1.00 47.54  ? 68  THR M C   1 
ATOM   3876 O O   . THR C 1 69  ? -27.946 43.778 -173.505 1.00 51.81  ? 68  THR M O   1 
ATOM   3877 C CB  . THR C 1 69  ? -27.073 46.089 -171.930 1.00 45.26  ? 68  THR M CB  1 
ATOM   3878 O OG1 . THR C 1 69  ? -27.073 47.323 -171.215 1.00 53.53  ? 68  THR M OG1 1 
ATOM   3879 C CG2 . THR C 1 69  ? -25.790 45.992 -172.688 1.00 39.03  ? 68  THR M CG2 1 
ATOM   3880 N N   . ILE C 1 70  ? -28.238 45.258 -175.155 1.00 52.43  ? 69  ILE M N   1 
ATOM   3881 C CA  . ILE C 1 70  ? -28.179 44.241 -176.188 1.00 51.36  ? 69  ILE M CA  1 
ATOM   3882 C C   . ILE C 1 70  ? -26.727 43.942 -176.509 1.00 48.94  ? 69  ILE M C   1 
ATOM   3883 O O   . ILE C 1 70  ? -25.851 44.789 -176.354 1.00 50.56  ? 69  ILE M O   1 
ATOM   3884 C CB  . ILE C 1 70  ? -28.914 44.691 -177.438 1.00 49.00  ? 69  ILE M CB  1 
ATOM   3885 C CG1 . ILE C 1 70  ? -29.090 43.519 -178.402 1.00 49.84  ? 69  ILE M CG1 1 
ATOM   3886 C CG2 . ILE C 1 70  ? -28.164 45.819 -178.081 1.00 48.95  ? 69  ILE M CG2 1 
ATOM   3887 C CD1 . ILE C 1 70  ? -29.857 43.888 -179.642 1.00 49.48  ? 69  ILE M CD1 1 
ATOM   3888 N N   . SER C 1 71  ? -26.476 42.726 -176.955 1.00 44.25  ? 70  SER M N   1 
ATOM   3889 C CA  . SER C 1 71  ? -25.129 42.214 -176.974 1.00 47.01  ? 70  SER M CA  1 
ATOM   3890 C C   . SER C 1 71  ? -25.061 41.105 -177.999 1.00 49.29  ? 70  SER M C   1 
ATOM   3891 O O   . SER C 1 71  ? -26.072 40.525 -178.368 1.00 48.50  ? 70  SER M O   1 
ATOM   3892 C CB  . SER C 1 71  ? -24.816 41.652 -175.592 1.00 54.30  ? 70  SER M CB  1 
ATOM   3893 O OG  . SER C 1 71  ? -23.438 41.442 -175.434 1.00 58.40  ? 70  SER M OG  1 
ATOM   3894 N N   . ARG C 1 72  ? -23.861 40.777 -178.436 1.00 50.49  ? 71  ARG M N   1 
ATOM   3895 C CA  . ARG C 1 72  ? -23.715 39.895 -179.573 1.00 50.01  ? 71  ARG M CA  1 
ATOM   3896 C C   . ARG C 1 72  ? -22.376 39.173 -179.503 1.00 53.45  ? 71  ARG M C   1 
ATOM   3897 O O   . ARG C 1 72  ? -21.400 39.717 -178.987 1.00 61.84  ? 71  ARG M O   1 
ATOM   3898 C CB  . ARG C 1 72  ? -23.796 40.751 -180.830 1.00 53.82  ? 71  ARG M CB  1 
ATOM   3899 C CG  . ARG C 1 72  ? -23.596 40.017 -182.101 1.00 56.98  ? 71  ARG M CG  1 
ATOM   3900 C CD  . ARG C 1 72  ? -23.257 40.988 -183.191 1.00 50.06  ? 71  ARG M CD  1 
ATOM   3901 N NE  . ARG C 1 72  ? -24.436 41.506 -183.862 1.00 54.24  ? 71  ARG M NE  1 
ATOM   3902 C CZ  . ARG C 1 72  ? -24.956 40.997 -184.975 1.00 50.14  ? 71  ARG M CZ  1 
ATOM   3903 N NH1 . ARG C 1 72  ? -26.026 41.563 -185.502 1.00 51.87  ? 71  ARG M NH1 1 
ATOM   3904 N NH2 . ARG C 1 72  ? -24.419 39.936 -185.561 1.00 44.32  ? 71  ARG M NH2 1 
ATOM   3905 N N   . ASP C 1 73  ? -22.332 37.942 -179.997 1.00 49.14  ? 72  ASP M N   1 
ATOM   3906 C CA  . ASP C 1 73  ? -21.082 37.185 -180.065 1.00 48.91  ? 72  ASP M CA  1 
ATOM   3907 C C   . ASP C 1 73  ? -21.045 36.431 -181.387 1.00 59.44  ? 72  ASP M C   1 
ATOM   3908 O O   . ASP C 1 73  ? -21.462 35.273 -181.474 1.00 61.84  ? 72  ASP M O   1 
ATOM   3909 C CB  . ASP C 1 73  ? -20.989 36.203 -178.902 1.00 56.93  ? 72  ASP M CB  1 
ATOM   3910 C CG  . ASP C 1 73  ? -19.683 35.397 -178.898 1.00 72.46  ? 72  ASP M CG  1 
ATOM   3911 O OD1 . ASP C 1 73  ? -18.903 35.437 -179.881 1.00 75.13  ? 72  ASP M OD1 1 
ATOM   3912 O OD2 . ASP C 1 73  ? -19.442 34.705 -177.892 1.00 78.92  ? 72  ASP M OD2 1 
ATOM   3913 N N   . ASN C 1 74  ? -20.551 37.089 -182.425 1.00 62.71  ? 73  ASN M N   1 
ATOM   3914 C CA  . ASN C 1 74  ? -20.643 36.519 -183.756 1.00 62.69  ? 73  ASN M CA  1 
ATOM   3915 C C   . ASN C 1 74  ? -19.949 35.173 -183.842 1.00 59.76  ? 73  ASN M C   1 
ATOM   3916 O O   . ASN C 1 74  ? -20.470 34.230 -184.423 1.00 60.16  ? 73  ASN M O   1 
ATOM   3917 C CB  . ASN C 1 74  ? -20.100 37.494 -184.804 1.00 65.41  ? 73  ASN M CB  1 
ATOM   3918 C CG  . ASN C 1 74  ? -21.032 38.665 -185.037 1.00 62.53  ? 73  ASN M CG  1 
ATOM   3919 O OD1 . ASN C 1 74  ? -22.221 38.593 -184.727 1.00 60.01  ? 73  ASN M OD1 1 
ATOM   3920 N ND2 . ASN C 1 74  ? -20.498 39.751 -185.579 1.00 58.90  ? 73  ASN M ND2 1 
ATOM   3921 N N   . ALA C 1 75  ? -18.768 35.083 -183.257 1.00 58.81  ? 74  ALA M N   1 
ATOM   3922 C CA  . ALA C 1 75  ? -18.007 33.846 -183.312 1.00 69.16  ? 74  ALA M CA  1 
ATOM   3923 C C   . ALA C 1 75  ? -18.824 32.669 -182.789 1.00 67.37  ? 74  ALA M C   1 
ATOM   3924 O O   . ALA C 1 75  ? -18.579 31.526 -183.158 1.00 66.80  ? 74  ALA M O   1 
ATOM   3925 C CB  . ALA C 1 75  ? -16.716 33.990 -182.522 1.00 76.32  ? 74  ALA M CB  1 
ATOM   3926 N N   . GLU C 1 76  ? -19.795 32.949 -181.929 1.00 69.04  ? 75  GLU M N   1 
ATOM   3927 C CA  . GLU C 1 76  ? -20.615 31.885 -181.356 1.00 74.93  ? 75  GLU M CA  1 
ATOM   3928 C C   . GLU C 1 76  ? -22.046 31.892 -181.880 1.00 67.72  ? 75  GLU M C   1 
ATOM   3929 O O   . GLU C 1 76  ? -22.912 31.170 -181.388 1.00 65.88  ? 75  GLU M O   1 
ATOM   3930 C CB  . GLU C 1 76  ? -20.594 31.945 -179.831 1.00 81.76  ? 75  GLU M CB  1 
ATOM   3931 C CG  . GLU C 1 76  ? -19.200 31.843 -179.278 1.00 99.82  ? 75  GLU M CG  1 
ATOM   3932 C CD  . GLU C 1 76  ? -19.080 30.784 -178.209 1.00 114.53 ? 75  GLU M CD  1 
ATOM   3933 O OE1 . GLU C 1 76  ? -18.312 31.006 -177.246 1.00 121.46 ? 75  GLU M OE1 1 
ATOM   3934 O OE2 . GLU C 1 76  ? -19.753 29.734 -178.335 1.00 115.66 ? 75  GLU M OE2 1 
ATOM   3935 N N   . ASN C 1 77  ? -22.288 32.716 -182.885 1.00 63.78  ? 76  ASN M N   1 
ATOM   3936 C CA  . ASN C 1 77  ? -23.579 32.741 -183.538 1.00 63.71  ? 76  ASN M CA  1 
ATOM   3937 C C   . ASN C 1 77  ? -24.688 32.969 -182.532 1.00 64.92  ? 76  ASN M C   1 
ATOM   3938 O O   . ASN C 1 77  ? -25.757 32.378 -182.632 1.00 70.96  ? 76  ASN M O   1 
ATOM   3939 C CB  . ASN C 1 77  ? -23.810 31.428 -184.272 1.00 67.79  ? 76  ASN M CB  1 
ATOM   3940 C CG  . ASN C 1 77  ? -24.117 31.637 -185.732 1.00 76.36  ? 76  ASN M CG  1 
ATOM   3941 O OD1 . ASN C 1 77  ? -23.446 32.422 -186.411 1.00 77.00  ? 76  ASN M OD1 1 
ATOM   3942 N ND2 . ASN C 1 77  ? -25.135 30.942 -186.231 1.00 78.19  ? 76  ASN M ND2 1 
ATOM   3943 N N   . SER C 1 78  ? -24.424 33.835 -181.562 1.00 62.37  ? 77  SER M N   1 
ATOM   3944 C CA  . SER C 1 78  ? -25.332 34.031 -180.450 1.00 63.11  ? 77  SER M CA  1 
ATOM   3945 C C   . SER C 1 78  ? -25.653 35.492 -180.217 1.00 63.35  ? 77  SER M C   1 
ATOM   3946 O O   . SER C 1 78  ? -24.806 36.368 -180.432 1.00 66.08  ? 77  SER M O   1 
ATOM   3947 C CB  . SER C 1 78  ? -24.748 33.427 -179.177 1.00 71.04  ? 77  SER M CB  1 
ATOM   3948 O OG  . SER C 1 78  ? -24.881 32.019 -179.205 1.00 81.75  ? 77  SER M OG  1 
ATOM   3949 N N   . LEU C 1 79  ? -26.883 35.734 -179.767 1.00 54.94  ? 78  LEU M N   1 
ATOM   3950 C CA  . LEU C 1 79  ? -27.355 37.066 -179.453 1.00 43.47  ? 78  LEU M CA  1 
ATOM   3951 C C   . LEU C 1 79  ? -27.883 37.119 -178.008 1.00 44.65  ? 78  LEU M C   1 
ATOM   3952 O O   . LEU C 1 79  ? -28.412 36.136 -177.489 1.00 48.68  ? 78  LEU M O   1 
ATOM   3953 C CB  . LEU C 1 79  ? -28.404 37.500 -180.471 1.00 36.02  ? 78  LEU M CB  1 
ATOM   3954 C CG  . LEU C 1 79  ? -29.130 38.819 -180.184 1.00 47.02  ? 78  LEU M CG  1 
ATOM   3955 C CD1 . LEU C 1 79  ? -28.289 40.023 -180.562 1.00 46.03  ? 78  LEU M CD1 1 
ATOM   3956 C CD2 . LEU C 1 79  ? -30.471 38.855 -180.920 1.00 48.69  ? 78  LEU M CD2 1 
ATOM   3957 N N   . TYR C 1 80  ? -27.715 38.267 -177.362 1.00 40.24  ? 79  TYR M N   1 
ATOM   3958 C CA  . TYR C 1 80  ? -28.028 38.412 -175.946 1.00 39.27  ? 79  TYR M CA  1 
ATOM   3959 C C   . TYR C 1 80  ? -28.789 39.691 -175.674 1.00 45.69  ? 79  TYR M C   1 
ATOM   3960 O O   . TYR C 1 80  ? -28.606 40.704 -176.350 1.00 52.09  ? 79  TYR M O   1 
ATOM   3961 C CB  . TYR C 1 80  ? -26.753 38.402 -175.101 1.00 44.37  ? 79  TYR M CB  1 
ATOM   3962 C CG  . TYR C 1 80  ? -25.848 37.226 -175.387 1.00 57.61  ? 79  TYR M CG  1 
ATOM   3963 C CD1 . TYR C 1 80  ? -24.813 37.336 -176.305 1.00 63.10  ? 79  TYR M CD1 1 
ATOM   3964 C CD2 . TYR C 1 80  ? -26.037 36.000 -174.756 1.00 58.51  ? 79  TYR M CD2 1 
ATOM   3965 C CE1 . TYR C 1 80  ? -23.989 36.261 -176.586 1.00 67.21  ? 79  TYR M CE1 1 
ATOM   3966 C CE2 . TYR C 1 80  ? -25.210 34.920 -175.030 1.00 61.75  ? 79  TYR M CE2 1 
ATOM   3967 C CZ  . TYR C 1 80  ? -24.194 35.057 -175.952 1.00 66.49  ? 79  TYR M CZ  1 
ATOM   3968 O OH  . TYR C 1 80  ? -23.370 33.997 -176.247 1.00 73.61  ? 79  TYR M OH  1 
ATOM   3969 N N   . LEU C 1 81  ? -29.664 39.628 -174.683 1.00 48.00  ? 80  LEU M N   1 
ATOM   3970 C CA  . LEU C 1 81  ? -30.299 40.818 -174.155 1.00 48.97  ? 80  LEU M CA  1 
ATOM   3971 C C   . LEU C 1 81  ? -30.162 40.733 -172.640 1.00 51.72  ? 80  LEU M C   1 
ATOM   3972 O O   . LEU C 1 81  ? -30.646 39.784 -172.036 1.00 51.58  ? 80  LEU M O   1 
ATOM   3973 C CB  . LEU C 1 81  ? -31.768 40.886 -174.567 1.00 42.36  ? 80  LEU M CB  1 
ATOM   3974 C CG  . LEU C 1 81  ? -32.466 42.161 -174.090 1.00 40.49  ? 80  LEU M CG  1 
ATOM   3975 C CD1 . LEU C 1 81  ? -31.698 43.359 -174.584 1.00 41.00  ? 80  LEU M CD1 1 
ATOM   3976 C CD2 . LEU C 1 81  ? -33.908 42.234 -174.572 1.00 37.74  ? 80  LEU M CD2 1 
ATOM   3977 N N   . GLN C 1 82  ? -29.450 41.687 -172.040 1.00 51.61  ? 81  GLN M N   1 
ATOM   3978 C CA  . GLN C 1 82  ? -29.286 41.722 -170.592 1.00 42.56  ? 81  GLN M CA  1 
ATOM   3979 C C   . GLN C 1 82  ? -30.252 42.748 -170.055 1.00 45.30  ? 81  GLN M C   1 
ATOM   3980 O O   . GLN C 1 82  ? -30.125 43.936 -170.321 1.00 56.90  ? 81  GLN M O   1 
ATOM   3981 C CB  . GLN C 1 82  ? -27.870 42.096 -170.203 1.00 36.85  ? 81  GLN M CB  1 
ATOM   3982 C CG  . GLN C 1 82  ? -27.618 42.097 -168.709 1.00 43.70  ? 81  GLN M CG  1 
ATOM   3983 C CD  . GLN C 1 82  ? -26.311 42.766 -168.326 1.00 48.30  ? 81  GLN M CD  1 
ATOM   3984 O OE1 . GLN C 1 82  ? -26.205 43.999 -168.301 1.00 50.17  ? 81  GLN M OE1 1 
ATOM   3985 N NE2 . GLN C 1 82  ? -25.312 41.957 -168.006 1.00 49.11  ? 81  GLN M NE2 1 
ATOM   3986 N N   . MET C 1 83  ? -31.229 42.264 -169.317 1.00 43.27  ? 82  MET M N   1 
ATOM   3987 C CA  . MET C 1 83  ? -32.313 43.071 -168.800 1.00 54.14  ? 82  MET M CA  1 
ATOM   3988 C C   . MET C 1 83  ? -32.051 43.415 -167.343 1.00 58.01  ? 82  MET M C   1 
ATOM   3989 O O   . MET C 1 83  ? -31.945 42.510 -166.514 1.00 68.50  ? 82  MET M O   1 
ATOM   3990 C CB  . MET C 1 83  ? -33.602 42.263 -168.899 1.00 55.27  ? 82  MET M CB  1 
ATOM   3991 C CG  . MET C 1 83  ? -34.317 42.411 -170.210 1.00 61.22  ? 82  MET M CG  1 
ATOM   3992 S SD  . MET C 1 83  ? -35.773 41.363 -170.298 1.00 63.92  ? 82  MET M SD  1 
ATOM   3993 C CE  . MET C 1 83  ? -34.909 39.942 -170.814 1.00 30.52  ? 82  MET M CE  1 
ATOM   3994 N N   . ASN C 1 84  A -31.965 44.709 -167.026 1.00 47.91  ? 82  ASN M N   1 
ATOM   3995 C CA  . ASN C 1 84  A -31.597 45.159 -165.669 1.00 43.89  ? 82  ASN M CA  1 
ATOM   3996 C C   . ASN C 1 84  A -32.618 46.106 -165.079 1.00 48.33  ? 82  ASN M C   1 
ATOM   3997 O O   . ASN C 1 84  A -33.377 46.732 -165.813 1.00 51.95  ? 82  ASN M O   1 
ATOM   3998 C CB  . ASN C 1 84  A -30.257 45.878 -165.687 1.00 49.35  ? 82  ASN M CB  1 
ATOM   3999 C CG  . ASN C 1 84  A -29.226 45.156 -166.507 1.00 61.21  ? 82  ASN M CG  1 
ATOM   4000 O OD1 . ASN C 1 84  A -28.995 43.957 -166.307 1.00 63.54  ? 82  ASN M OD1 1 
ATOM   4001 N ND2 . ASN C 1 84  A -28.589 45.879 -167.445 1.00 58.82  ? 82  ASN M ND2 1 
ATOM   4002 N N   . SER C 1 85  B -32.618 46.241 -163.756 1.00 53.68  ? 82  SER M N   1 
ATOM   4003 C CA  . SER C 1 85  B -33.582 47.112 -163.100 1.00 54.85  ? 82  SER M CA  1 
ATOM   4004 C C   . SER C 1 85  B -34.960 46.896 -163.725 1.00 57.59  ? 82  SER M C   1 
ATOM   4005 O O   . SER C 1 85  B -35.622 47.851 -164.149 1.00 59.32  ? 82  SER M O   1 
ATOM   4006 C CB  . SER C 1 85  B -33.175 48.581 -163.262 1.00 57.48  ? 82  SER M CB  1 
ATOM   4007 O OG  . SER C 1 85  B -31.780 48.785 -163.065 1.00 56.16  ? 82  SER M OG  1 
ATOM   4008 N N   . LEU C 1 86  C -35.373 45.637 -163.814 1.00 54.06  ? 82  LEU M N   1 
ATOM   4009 C CA  . LEU C 1 86  C -36.632 45.310 -164.470 1.00 53.43  ? 82  LEU M CA  1 
ATOM   4010 C C   . LEU C 1 86  C -37.814 45.825 -163.671 1.00 53.05  ? 82  LEU M C   1 
ATOM   4011 O O   . LEU C 1 86  C -37.746 45.956 -162.452 1.00 57.95  ? 82  LEU M O   1 
ATOM   4012 C CB  . LEU C 1 86  C -36.763 43.804 -164.673 1.00 48.07  ? 82  LEU M CB  1 
ATOM   4013 C CG  . LEU C 1 86  C -35.756 43.219 -165.660 1.00 43.84  ? 82  LEU M CG  1 
ATOM   4014 C CD1 . LEU C 1 86  C -35.613 41.732 -165.448 1.00 45.11  ? 82  LEU M CD1 1 
ATOM   4015 C CD2 . LEU C 1 86  C -36.198 43.500 -167.063 1.00 41.93  ? 82  LEU M CD2 1 
ATOM   4016 N N   . ARG C 1 87  ? -38.897 46.123 -164.370 1.00 50.17  ? 83  ARG M N   1 
ATOM   4017 C CA  . ARG C 1 87  ? -40.134 46.498 -163.720 1.00 50.78  ? 83  ARG M CA  1 
ATOM   4018 C C   . ARG C 1 87  ? -41.330 45.699 -164.246 1.00 53.16  ? 83  ARG M C   1 
ATOM   4019 O O   . ARG C 1 87  ? -41.251 45.047 -165.286 1.00 47.33  ? 83  ARG M O   1 
ATOM   4020 C CB  . ARG C 1 87  ? -40.359 48.007 -163.811 1.00 56.54  ? 83  ARG M CB  1 
ATOM   4021 C CG  . ARG C 1 87  ? -39.638 48.723 -164.931 1.00 60.26  ? 83  ARG M CG  1 
ATOM   4022 C CD  . ARG C 1 87  ? -39.197 50.100 -164.457 1.00 69.22  ? 83  ARG M CD  1 
ATOM   4023 N NE  . ARG C 1 87  ? -39.098 51.102 -165.518 1.00 78.14  ? 83  ARG M NE  1 
ATOM   4024 C CZ  . ARG C 1 87  ? -38.481 52.277 -165.380 1.00 84.10  ? 83  ARG M CZ  1 
ATOM   4025 N NH1 . ARG C 1 87  ? -38.447 53.138 -166.394 1.00 81.57  ? 83  ARG M NH1 1 
ATOM   4026 N NH2 . ARG C 1 87  ? -37.892 52.592 -164.226 1.00 84.27  ? 83  ARG M NH2 1 
ATOM   4027 N N   . ALA C 1 88  ? -42.435 45.740 -163.509 1.00 50.46  ? 84  ALA M N   1 
ATOM   4028 C CA  . ALA C 1 88  ? -43.627 44.993 -163.894 1.00 49.11  ? 84  ALA M CA  1 
ATOM   4029 C C   . ALA C 1 88  ? -43.945 45.166 -165.377 1.00 50.48  ? 84  ALA M C   1 
ATOM   4030 O O   . ALA C 1 88  ? -44.250 44.201 -166.060 1.00 62.21  ? 84  ALA M O   1 
ATOM   4031 C CB  . ALA C 1 88  ? -44.813 45.406 -163.035 1.00 46.90  ? 84  ALA M CB  1 
ATOM   4032 N N   . GLU C 1 89  ? -43.850 46.395 -165.874 1.00 51.66  ? 85  GLU M N   1 
ATOM   4033 C CA  . GLU C 1 89  ? -44.127 46.697 -167.281 1.00 56.43  ? 85  GLU M CA  1 
ATOM   4034 C C   . GLU C 1 89  ? -43.226 45.958 -168.276 1.00 55.02  ? 85  GLU M C   1 
ATOM   4035 O O   . GLU C 1 89  ? -43.498 45.958 -169.477 1.00 58.37  ? 85  GLU M O   1 
ATOM   4036 C CB  . GLU C 1 89  ? -44.010 48.199 -167.543 1.00 64.44  ? 85  GLU M CB  1 
ATOM   4037 C CG  . GLU C 1 89  ? -44.585 49.064 -166.443 1.00 83.98  ? 85  GLU M CG  1 
ATOM   4038 C CD  . GLU C 1 89  ? -43.678 49.132 -165.230 1.00 96.80  ? 85  GLU M CD  1 
ATOM   4039 O OE1 . GLU C 1 89  ? -42.477 49.421 -165.412 1.00 100.82 ? 85  GLU M OE1 1 
ATOM   4040 O OE2 . GLU C 1 89  ? -44.164 48.900 -164.100 1.00 101.48 ? 85  GLU M OE2 1 
ATOM   4041 N N   . ASP C 1 90  ? -42.146 45.353 -167.788 1.00 48.80  ? 86  ASP M N   1 
ATOM   4042 C CA  . ASP C 1 90  ? -41.249 44.615 -168.667 1.00 50.88  ? 86  ASP M CA  1 
ATOM   4043 C C   . ASP C 1 90  ? -41.728 43.189 -168.876 1.00 48.89  ? 86  ASP M C   1 
ATOM   4044 O O   . ASP C 1 90  ? -41.143 42.436 -169.653 1.00 45.56  ? 86  ASP M O   1 
ATOM   4045 C CB  . ASP C 1 90  ? -39.838 44.593 -168.103 1.00 52.35  ? 86  ASP M CB  1 
ATOM   4046 C CG  . ASP C 1 90  ? -39.215 45.951 -168.078 1.00 59.81  ? 86  ASP M CG  1 
ATOM   4047 O OD1 . ASP C 1 90  ? -39.497 46.747 -169.001 1.00 63.68  ? 86  ASP M OD1 1 
ATOM   4048 O OD2 . ASP C 1 90  ? -38.443 46.215 -167.137 1.00 59.99  ? 86  ASP M OD2 1 
ATOM   4049 N N   . THR C 1 91  ? -42.792 42.818 -168.176 1.00 44.33  ? 87  THR M N   1 
ATOM   4050 C CA  . THR C 1 91  ? -43.322 41.472 -168.289 1.00 43.82  ? 87  THR M CA  1 
ATOM   4051 C C   . THR C 1 91  ? -43.859 41.229 -169.700 1.00 43.96  ? 87  THR M C   1 
ATOM   4052 O O   . THR C 1 91  ? -44.725 41.959 -170.168 1.00 46.51  ? 87  THR M O   1 
ATOM   4053 C CB  . THR C 1 91  ? -44.423 41.261 -167.263 1.00 48.10  ? 87  THR M CB  1 
ATOM   4054 O OG1 . THR C 1 91  ? -43.840 41.252 -165.955 1.00 52.87  ? 87  THR M OG1 1 
ATOM   4055 C CG2 . THR C 1 91  ? -45.170 39.949 -167.524 1.00 42.61  ? 87  THR M CG2 1 
ATOM   4056 N N   . ALA C 1 92  ? -43.341 40.218 -170.388 1.00 44.70  ? 88  ALA M N   1 
ATOM   4057 C CA  . ALA C 1 92  ? -43.751 39.998 -171.776 1.00 45.48  ? 88  ALA M CA  1 
ATOM   4058 C C   . ALA C 1 92  ? -43.105 38.767 -172.377 1.00 44.61  ? 88  ALA M C   1 
ATOM   4059 O O   . ALA C 1 92  ? -42.227 38.164 -171.776 1.00 46.16  ? 88  ALA M O   1 
ATOM   4060 C CB  . ALA C 1 92  ? -43.407 41.219 -172.623 1.00 33.72  ? 88  ALA M CB  1 
ATOM   4061 N N   . VAL C 1 93  ? -43.543 38.399 -173.574 1.00 46.75  ? 89  VAL M N   1 
ATOM   4062 C CA  . VAL C 1 93  ? -42.785 37.464 -174.394 1.00 46.51  ? 89  VAL M CA  1 
ATOM   4063 C C   . VAL C 1 93  ? -41.727 38.231 -175.173 1.00 45.81  ? 89  VAL M C   1 
ATOM   4064 O O   . VAL C 1 93  ? -42.042 39.235 -175.812 1.00 53.13  ? 89  VAL M O   1 
ATOM   4065 C CB  . VAL C 1 93  ? -43.692 36.742 -175.381 1.00 43.04  ? 89  VAL M CB  1 
ATOM   4066 C CG1 . VAL C 1 93  ? -42.865 35.959 -176.383 1.00 36.13  ? 89  VAL M CG1 1 
ATOM   4067 C CG2 . VAL C 1 93  ? -44.598 35.829 -174.631 1.00 39.25  ? 89  VAL M CG2 1 
ATOM   4068 N N   . TYR C 1 94  ? -40.480 37.772 -175.102 1.00 41.53  ? 90  TYR M N   1 
ATOM   4069 C CA  . TYR C 1 94  ? -39.372 38.405 -175.830 1.00 38.22  ? 90  TYR M CA  1 
ATOM   4070 C C   . TYR C 1 94  ? -38.910 37.592 -177.030 1.00 43.78  ? 90  TYR M C   1 
ATOM   4071 O O   . TYR C 1 94  ? -38.528 36.436 -176.904 1.00 46.80  ? 90  TYR M O   1 
ATOM   4072 C CB  . TYR C 1 94  ? -38.188 38.676 -174.901 1.00 36.82  ? 90  TYR M CB  1 
ATOM   4073 C CG  . TYR C 1 94  ? -38.464 39.832 -173.989 1.00 44.08  ? 90  TYR M CG  1 
ATOM   4074 C CD1 . TYR C 1 94  ? -39.312 39.684 -172.904 1.00 42.47  ? 90  TYR M CD1 1 
ATOM   4075 C CD2 . TYR C 1 94  ? -37.918 41.090 -174.234 1.00 43.05  ? 90  TYR M CD2 1 
ATOM   4076 C CE1 . TYR C 1 94  ? -39.596 40.741 -172.077 1.00 43.70  ? 90  TYR M CE1 1 
ATOM   4077 C CE2 . TYR C 1 94  ? -38.215 42.165 -173.415 1.00 43.21  ? 90  TYR M CE2 1 
ATOM   4078 C CZ  . TYR C 1 94  ? -39.057 41.978 -172.338 1.00 41.27  ? 90  TYR M CZ  1 
ATOM   4079 O OH  . TYR C 1 94  ? -39.369 43.019 -171.508 1.00 40.93  ? 90  TYR M OH  1 
ATOM   4080 N N   . TYR C 1 95  ? -38.937 38.207 -178.201 1.00 45.91  ? 91  TYR M N   1 
ATOM   4081 C CA  . TYR C 1 95  ? -38.516 37.512 -179.409 1.00 47.28  ? 91  TYR M CA  1 
ATOM   4082 C C   . TYR C 1 95  ? -37.164 38.021 -179.872 1.00 44.19  ? 91  TYR M C   1 
ATOM   4083 O O   . TYR C 1 95  ? -36.936 39.225 -179.912 1.00 46.45  ? 91  TYR M O   1 
ATOM   4084 C CB  . TYR C 1 95  ? -39.536 37.734 -180.534 1.00 46.85  ? 91  TYR M CB  1 
ATOM   4085 C CG  . TYR C 1 95  ? -40.915 37.170 -180.271 1.00 46.77  ? 91  TYR M CG  1 
ATOM   4086 C CD1 . TYR C 1 95  ? -41.160 35.813 -180.395 1.00 47.81  ? 91  TYR M CD1 1 
ATOM   4087 C CD2 . TYR C 1 95  ? -41.970 37.998 -179.910 1.00 46.62  ? 91  TYR M CD2 1 
ATOM   4088 C CE1 . TYR C 1 95  ? -42.412 35.287 -180.167 1.00 50.24  ? 91  TYR M CE1 1 
ATOM   4089 C CE2 . TYR C 1 95  ? -43.226 37.485 -179.677 1.00 48.37  ? 91  TYR M CE2 1 
ATOM   4090 C CZ  . TYR C 1 95  ? -43.443 36.124 -179.812 1.00 53.25  ? 91  TYR M CZ  1 
ATOM   4091 O OH  . TYR C 1 95  ? -44.686 35.587 -179.579 1.00 55.69  ? 91  TYR M OH  1 
ATOM   4092 N N   . CYS C 1 96  ? -36.260 37.119 -180.219 1.00 40.78  ? 92  CYS M N   1 
ATOM   4093 C CA  . CYS C 1 96  ? -35.152 37.560 -181.050 1.00 50.27  ? 92  CYS M CA  1 
ATOM   4094 C C   . CYS C 1 96  ? -35.541 37.480 -182.516 1.00 46.31  ? 92  CYS M C   1 
ATOM   4095 O O   . CYS C 1 96  ? -36.207 36.554 -182.964 1.00 49.45  ? 92  CYS M O   1 
ATOM   4096 C CB  . CYS C 1 96  ? -33.816 36.858 -180.762 1.00 50.46  ? 92  CYS M CB  1 
ATOM   4097 S SG  . CYS C 1 96  ? -33.737 35.130 -181.081 1.00 97.19  ? 92  CYS M SG  1 
ATOM   4098 N N   . VAL C 1 97  ? -35.122 38.497 -183.245 1.00 43.60  ? 93  VAL M N   1 
ATOM   4099 C CA  . VAL C 1 97  ? -35.533 38.693 -184.598 1.00 49.61  ? 93  VAL M CA  1 
ATOM   4100 C C   . VAL C 1 97  ? -34.320 39.023 -185.448 1.00 54.37  ? 93  VAL M C   1 
ATOM   4101 O O   . VAL C 1 97  ? -33.503 39.881 -185.094 1.00 64.52  ? 93  VAL M O   1 
ATOM   4102 C CB  . VAL C 1 97  ? -36.515 39.860 -184.678 1.00 58.57  ? 93  VAL M CB  1 
ATOM   4103 C CG1 . VAL C 1 97  ? -37.290 39.786 -185.958 1.00 68.72  ? 93  VAL M CG1 1 
ATOM   4104 C CG2 . VAL C 1 97  ? -37.467 39.800 -183.526 1.00 60.01  ? 93  VAL M CG2 1 
ATOM   4105 N N   . ARG C 1 98  ? -34.208 38.349 -186.584 1.00 70.24  ? 94  ARG M N   1 
ATOM   4106 C CA  . ARG C 1 98  ? -33.199 38.706 -187.557 1.00 50.09  ? 94  ARG M CA  1 
ATOM   4107 C C   . ARG C 1 98  ? -33.760 39.748 -188.512 1.00 51.83  ? 94  ARG M C   1 
ATOM   4108 O O   . ARG C 1 98  ? -34.889 39.637 -188.977 1.00 57.67  ? 94  ARG M O   1 
ATOM   4109 C CB  . ARG C 1 98  ? -32.743 37.474 -188.325 1.00 52.85  ? 94  ARG M CB  1 
ATOM   4110 C CG  . ARG C 1 98  ? -31.623 37.758 -189.291 1.00 54.44  ? 94  ARG M CG  1 
ATOM   4111 C CD  . ARG C 1 98  ? -31.246 36.548 -190.088 1.00 55.85  ? 94  ARG M CD  1 
ATOM   4112 N NE  . ARG C 1 98  ? -32.056 36.461 -191.294 1.00 60.27  ? 94  ARG M NE  1 
ATOM   4113 C CZ  . ARG C 1 98  ? -31.913 35.514 -192.210 1.00 57.22  ? 94  ARG M CZ  1 
ATOM   4114 N NH1 . ARG C 1 98  ? -30.993 34.574 -192.063 1.00 56.30  ? 94  ARG M NH1 1 
ATOM   4115 N NH2 . ARG C 1 98  ? -32.692 35.509 -193.271 1.00 51.33  ? 94  ARG M NH2 1 
ATOM   4116 N N   . GLU C 1 99  ? -32.978 40.779 -188.788 1.00 49.65  ? 95  GLU M N   1 
ATOM   4117 C CA  . GLU C 1 99  ? -33.364 41.761 -189.784 1.00 56.00  ? 95  GLU M CA  1 
ATOM   4118 C C   . GLU C 1 99  ? -32.894 41.268 -191.161 1.00 56.32  ? 95  GLU M C   1 
ATOM   4119 O O   . GLU C 1 99  ? -31.854 40.627 -191.277 1.00 59.96  ? 95  GLU M O   1 
ATOM   4120 C CB  . GLU C 1 99  ? -32.768 43.124 -189.435 1.00 56.99  ? 95  GLU M CB  1 
ATOM   4121 C CG  . GLU C 1 99  ? -33.686 44.290 -189.748 1.00 65.18  ? 95  GLU M CG  1 
ATOM   4122 C CD  . GLU C 1 99  ? -33.159 45.627 -189.241 1.00 75.11  ? 95  GLU M CD  1 
ATOM   4123 O OE1 . GLU C 1 99  ? -32.879 45.761 -188.024 1.00 76.72  ? 95  GLU M OE1 1 
ATOM   4124 O OE2 . GLU C 1 99  ? -33.042 46.555 -190.071 1.00 77.07  ? 95  GLU M OE2 1 
ATOM   4125 N N   . GLY C 1 100 ? -33.676 41.531 -192.199 1.00 55.17  ? 96  GLY M N   1 
ATOM   4126 C CA  . GLY C 1 100 ? -33.324 41.082 -193.532 1.00 53.80  ? 96  GLY M CA  1 
ATOM   4127 C C   . GLY C 1 100 ? -31.962 41.574 -193.990 1.00 60.30  ? 96  GLY M C   1 
ATOM   4128 O O   . GLY C 1 100 ? -31.409 42.504 -193.415 1.00 63.14  ? 96  GLY M O   1 
ATOM   4129 N N   . PRO C 1 101 ? -31.424 40.961 -195.054 1.00 62.55  ? 97  PRO M N   1 
ATOM   4130 C CA  . PRO C 1 101 ? -30.035 41.157 -195.474 1.00 61.84  ? 97  PRO M CA  1 
ATOM   4131 C C   . PRO C 1 101 ? -29.736 42.567 -195.991 1.00 63.60  ? 97  PRO M C   1 
ATOM   4132 O O   . PRO C 1 101 ? -28.576 42.968 -195.985 1.00 62.94  ? 97  PRO M O   1 
ATOM   4133 C CB  . PRO C 1 101 ? -29.877 40.135 -196.599 1.00 55.06  ? 97  PRO M CB  1 
ATOM   4134 C CG  . PRO C 1 101 ? -31.237 40.008 -197.143 1.00 57.09  ? 97  PRO M CG  1 
ATOM   4135 C CD  . PRO C 1 101 ? -32.112 40.005 -195.934 1.00 61.18  ? 97  PRO M CD  1 
ATOM   4136 N N   . ARG C 1 102 ? -30.745 43.320 -196.410 1.00 60.92  ? 98  ARG M N   1 
ATOM   4137 C CA  . ARG C 1 102 ? -30.474 44.666 -196.911 1.00 68.35  ? 98  ARG M CA  1 
ATOM   4138 C C   . ARG C 1 102 ? -30.130 45.666 -195.792 1.00 69.09  ? 98  ARG M C   1 
ATOM   4139 O O   . ARG C 1 102 ? -30.052 46.872 -196.030 1.00 64.75  ? 98  ARG M O   1 
ATOM   4140 C CB  . ARG C 1 102 ? -31.645 45.180 -197.753 1.00 69.84  ? 98  ARG M CB  1 
ATOM   4141 C CG  . ARG C 1 102 ? -31.866 44.440 -199.059 1.00 74.55  ? 98  ARG M CG  1 
ATOM   4142 C CD  . ARG C 1 102 ? -33.066 45.025 -199.789 1.00 85.50  ? 98  ARG M CD  1 
ATOM   4143 N NE  . ARG C 1 102 ? -33.142 44.645 -201.201 1.00 95.53  ? 98  ARG M NE  1 
ATOM   4144 C CZ  . ARG C 1 102 ? -33.942 43.692 -201.673 1.00 99.03  ? 98  ARG M CZ  1 
ATOM   4145 N NH1 . ARG C 1 102 ? -34.728 43.012 -200.841 1.00 97.93  ? 98  ARG M NH1 1 
ATOM   4146 N NH2 . ARG C 1 102 ? -33.956 43.415 -202.972 1.00 97.54  ? 98  ARG M NH2 1 
ATOM   4147 N N   . ALA C 1 103 ? -29.929 45.154 -194.580 1.00 74.25  ? 99  ALA M N   1 
ATOM   4148 C CA  . ALA C 1 103 ? -29.613 45.977 -193.406 1.00 68.58  ? 99  ALA M CA  1 
ATOM   4149 C C   . ALA C 1 103 ? -28.179 45.763 -192.947 1.00 65.98  ? 99  ALA M C   1 
ATOM   4150 O O   . ALA C 1 103 ? -27.830 44.678 -192.487 1.00 71.45  ? 99  ALA M O   1 
ATOM   4151 C CB  . ALA C 1 103 ? -30.571 45.653 -192.257 1.00 60.04  ? 99  ALA M CB  1 
ATOM   4152 N N   . THR C 1 104 ? -27.355 46.800 -193.049 1.00 62.39  ? 100 THR M N   1 
ATOM   4153 C CA  . THR C 1 104 ? -25.957 46.707 -192.629 1.00 64.62  ? 100 THR M CA  1 
ATOM   4154 C C   . THR C 1 104 ? -25.604 47.903 -191.777 1.00 66.40  ? 100 THR M C   1 
ATOM   4155 O O   . THR C 1 104 ? -26.125 48.991 -191.995 1.00 70.60  ? 100 THR M O   1 
ATOM   4156 C CB  . THR C 1 104 ? -24.980 46.706 -193.829 1.00 68.58  ? 100 THR M CB  1 
ATOM   4157 O OG1 . THR C 1 104 ? -25.541 45.970 -194.920 1.00 70.28  ? 100 THR M OG1 1 
ATOM   4158 C CG2 . THR C 1 104 ? -23.626 46.090 -193.438 1.00 69.59  ? 100 THR M CG2 1 
ATOM   4159 N N   . GLY C 1 105 A -24.702 47.703 -190.824 1.00 67.49  ? 100 GLY M N   1 
ATOM   4160 C CA  . GLY C 1 105 A -24.231 48.787 -189.986 1.00 73.03  ? 100 GLY M CA  1 
ATOM   4161 C C   . GLY C 1 105 A -25.321 49.786 -189.641 1.00 80.56  ? 100 GLY M C   1 
ATOM   4162 O O   . GLY C 1 105 A -26.260 49.456 -188.911 1.00 81.04  ? 100 GLY M O   1 
ATOM   4163 N N   . TYR C 1 106 B -25.208 51.001 -190.184 1.00 79.42  ? 100 TYR M N   1 
ATOM   4164 C CA  . TYR C 1 106 B -26.101 52.101 -189.820 1.00 75.73  ? 100 TYR M CA  1 
ATOM   4165 C C   . TYR C 1 106 B -27.202 52.378 -190.844 1.00 76.94  ? 100 TYR M C   1 
ATOM   4166 O O   . TYR C 1 106 B -27.865 53.409 -190.788 1.00 82.32  ? 100 TYR M O   1 
ATOM   4167 C CB  . TYR C 1 106 B -25.288 53.375 -189.613 1.00 73.74  ? 100 TYR M CB  1 
ATOM   4168 C CG  . TYR C 1 106 B -24.336 53.322 -188.437 1.00 79.03  ? 100 TYR M CG  1 
ATOM   4169 C CD1 . TYR C 1 106 B -23.065 52.783 -188.573 1.00 77.16  ? 100 TYR M CD1 1 
ATOM   4170 C CD2 . TYR C 1 106 B -24.703 53.827 -187.194 1.00 75.60  ? 100 TYR M CD2 1 
ATOM   4171 C CE1 . TYR C 1 106 B -22.202 52.734 -187.516 1.00 74.66  ? 100 TYR M CE1 1 
ATOM   4172 C CE2 . TYR C 1 106 B -23.839 53.786 -186.131 1.00 71.95  ? 100 TYR M CE2 1 
ATOM   4173 C CZ  . TYR C 1 106 B -22.593 53.236 -186.297 1.00 77.63  ? 100 TYR M CZ  1 
ATOM   4174 O OH  . TYR C 1 106 B -21.721 53.191 -185.239 1.00 90.72  ? 100 TYR M OH  1 
ATOM   4175 N N   . SER C 1 107 C -27.400 51.461 -191.777 1.00 72.02  ? 100 SER M N   1 
ATOM   4176 C CA  . SER C 1 107 C -28.290 51.713 -192.900 1.00 71.25  ? 100 SER M CA  1 
ATOM   4177 C C   . SER C 1 107 C -29.777 51.766 -192.537 1.00 74.41  ? 100 SER M C   1 
ATOM   4178 O O   . SER C 1 107 C -30.182 51.513 -191.391 1.00 69.22  ? 100 SER M O   1 
ATOM   4179 C CB  . SER C 1 107 C -28.081 50.653 -193.980 1.00 67.07  ? 100 SER M CB  1 
ATOM   4180 O OG  . SER C 1 107 C -28.546 49.386 -193.542 1.00 67.79  ? 100 SER M OG  1 
ATOM   4181 N N   . MET C 1 108 D -30.576 52.122 -193.541 1.00 75.64  ? 100 MET M N   1 
ATOM   4182 C CA  . MET C 1 108 D -32.015 51.963 -193.488 1.00 69.52  ? 100 MET M CA  1 
ATOM   4183 C C   . MET C 1 108 D -32.289 50.530 -193.049 1.00 69.58  ? 100 MET M C   1 
ATOM   4184 O O   . MET C 1 108 D -31.502 49.619 -193.349 1.00 66.27  ? 100 MET M O   1 
ATOM   4185 C CB  . MET C 1 108 D -32.614 52.199 -194.875 1.00 65.13  ? 100 MET M CB  1 
ATOM   4186 C CG  . MET C 1 108 D -32.791 53.659 -195.271 1.00 67.52  ? 100 MET M CG  1 
ATOM   4187 S SD  . MET C 1 108 D -34.277 54.454 -194.593 1.00 88.76  ? 100 MET M SD  1 
ATOM   4188 C CE  . MET C 1 108 D -33.594 55.209 -193.118 1.00 72.16  ? 100 MET M CE  1 
ATOM   4189 N N   . ALA C 1 109 E -33.402 50.329 -192.348 1.00 66.04  ? 100 ALA M N   1 
ATOM   4190 C CA  . ALA C 1 109 E -33.757 49.006 -191.844 1.00 61.45  ? 100 ALA M CA  1 
ATOM   4191 C C   . ALA C 1 109 E -34.245 48.064 -192.944 1.00 60.39  ? 100 ALA M C   1 
ATOM   4192 O O   . ALA C 1 109 E -34.538 48.491 -194.064 1.00 58.59  ? 100 ALA M O   1 
ATOM   4193 C CB  . ALA C 1 109 E -34.805 49.127 -190.762 1.00 60.40  ? 100 ALA M CB  1 
ATOM   4194 N N   . ASP C 1 110 F -34.307 46.777 -192.613 1.00 57.24  ? 100 ASP M N   1 
ATOM   4195 C CA  . ASP C 1 110 F -34.963 45.781 -193.448 1.00 51.14  ? 100 ASP M CA  1 
ATOM   4196 C C   . ASP C 1 110 F -36.045 45.139 -192.584 1.00 55.27  ? 100 ASP M C   1 
ATOM   4197 O O   . ASP C 1 110 F -36.179 45.477 -191.405 1.00 53.40  ? 100 ASP M O   1 
ATOM   4198 C CB  . ASP C 1 110 F -33.966 44.740 -193.935 1.00 51.65  ? 100 ASP M CB  1 
ATOM   4199 C CG  . ASP C 1 110 F -34.431 44.029 -195.202 1.00 64.69  ? 100 ASP M CG  1 
ATOM   4200 O OD1 . ASP C 1 110 F -33.588 43.354 -195.849 1.00 66.87  ? 100 ASP M OD1 1 
ATOM   4201 O OD2 . ASP C 1 110 F -35.635 44.147 -195.551 1.00 65.53  ? 100 ASP M OD2 1 
ATOM   4202 N N   . VAL C 1 111 G -36.823 44.227 -193.156 1.00 54.07  ? 100 VAL M N   1 
ATOM   4203 C CA  . VAL C 1 111 G -37.917 43.616 -192.412 1.00 50.61  ? 100 VAL M CA  1 
ATOM   4204 C C   . VAL C 1 111 G -37.394 42.549 -191.486 1.00 52.94  ? 100 VAL M C   1 
ATOM   4205 O O   . VAL C 1 111 G -36.250 42.114 -191.615 1.00 54.09  ? 100 VAL M O   1 
ATOM   4206 C CB  . VAL C 1 111 G -38.925 42.965 -193.339 1.00 49.71  ? 100 VAL M CB  1 
ATOM   4207 C CG1 . VAL C 1 111 G -39.620 44.018 -194.152 1.00 51.03  ? 100 VAL M CG1 1 
ATOM   4208 C CG2 . VAL C 1 111 G -38.212 41.967 -194.248 1.00 48.21  ? 100 VAL M CG2 1 
ATOM   4209 N N   . PHE C 1 112 H -38.253 42.127 -190.562 1.00 51.17  ? 100 PHE M N   1 
ATOM   4210 C CA  . PHE C 1 112 H -37.950 41.068 -189.602 1.00 47.48  ? 100 PHE M CA  1 
ATOM   4211 C C   . PHE C 1 112 H -38.297 39.705 -190.194 1.00 50.24  ? 100 PHE M C   1 
ATOM   4212 O O   . PHE C 1 112 H -39.451 39.270 -190.141 1.00 50.97  ? 100 PHE M O   1 
ATOM   4213 C CB  . PHE C 1 112 H -38.754 41.300 -188.327 1.00 46.14  ? 100 PHE M CB  1 
ATOM   4214 C CG  . PHE C 1 112 H -38.332 42.530 -187.554 1.00 55.11  ? 100 PHE M CG  1 
ATOM   4215 C CD1 . PHE C 1 112 H -39.258 43.280 -186.855 1.00 52.54  ? 100 PHE M CD1 1 
ATOM   4216 C CD2 . PHE C 1 112 H -37.011 42.936 -187.536 1.00 58.55  ? 100 PHE M CD2 1 
ATOM   4217 C CE1 . PHE C 1 112 H -38.872 44.392 -186.143 1.00 48.98  ? 100 PHE M CE1 1 
ATOM   4218 C CE2 . PHE C 1 112 H -36.627 44.050 -186.830 1.00 56.77  ? 100 PHE M CE2 1 
ATOM   4219 C CZ  . PHE C 1 112 H -37.562 44.776 -186.129 1.00 52.92  ? 100 PHE M CZ  1 
ATOM   4220 N N   . ASP C 1 113 ? -37.304 39.029 -190.766 1.00 50.09  ? 101 ASP M N   1 
ATOM   4221 C CA  . ASP C 1 113 ? -37.588 37.848 -191.587 1.00 56.42  ? 101 ASP M CA  1 
ATOM   4222 C C   . ASP C 1 113 ? -37.521 36.490 -190.871 1.00 55.95  ? 101 ASP M C   1 
ATOM   4223 O O   . ASP C 1 113 ? -38.093 35.512 -191.343 1.00 58.26  ? 101 ASP M O   1 
ATOM   4224 C CB  . ASP C 1 113 ? -36.711 37.834 -192.845 1.00 55.23  ? 101 ASP M CB  1 
ATOM   4225 C CG  . ASP C 1 113 ? -35.245 37.620 -192.534 1.00 64.42  ? 101 ASP M CG  1 
ATOM   4226 O OD1 . ASP C 1 113 ? -34.848 37.780 -191.359 1.00 68.85  ? 101 ASP M OD1 1 
ATOM   4227 O OD2 . ASP C 1 113 ? -34.483 37.294 -193.468 1.00 66.98  ? 101 ASP M OD2 1 
ATOM   4228 N N   . ILE C 1 114 ? -36.822 36.432 -189.747 1.00 45.94  ? 102 ILE M N   1 
ATOM   4229 C CA  . ILE C 1 114 ? -36.760 35.223 -188.938 1.00 51.21  ? 102 ILE M CA  1 
ATOM   4230 C C   . ILE C 1 114 ? -37.039 35.564 -187.481 1.00 60.54  ? 102 ILE M C   1 
ATOM   4231 O O   . ILE C 1 114 ? -36.416 36.472 -186.928 1.00 62.33  ? 102 ILE M O   1 
ATOM   4232 C CB  . ILE C 1 114 ? -35.367 34.602 -188.988 1.00 57.00  ? 102 ILE M CB  1 
ATOM   4233 C CG1 . ILE C 1 114 ? -34.914 34.400 -190.433 1.00 60.14  ? 102 ILE M CG1 1 
ATOM   4234 C CG2 . ILE C 1 114 ? -35.344 33.308 -188.214 1.00 48.78  ? 102 ILE M CG2 1 
ATOM   4235 C CD1 . ILE C 1 114 ? -35.719 33.381 -191.179 1.00 59.53  ? 102 ILE M CD1 1 
ATOM   4236 N N   . TRP C 1 115 ? -37.961 34.838 -186.855 1.00 56.67  ? 103 TRP M N   1 
ATOM   4237 C CA  . TRP C 1 115 ? -38.225 35.022 -185.426 1.00 49.50  ? 103 TRP M CA  1 
ATOM   4238 C C   . TRP C 1 115 ? -37.885 33.802 -184.583 1.00 48.79  ? 103 TRP M C   1 
ATOM   4239 O O   . TRP C 1 115 ? -38.096 32.671 -185.007 1.00 50.28  ? 103 TRP M O   1 
ATOM   4240 C CB  . TRP C 1 115 ? -39.687 35.356 -185.200 1.00 41.59  ? 103 TRP M CB  1 
ATOM   4241 C CG  . TRP C 1 115 ? -40.115 36.573 -185.917 1.00 45.32  ? 103 TRP M CG  1 
ATOM   4242 C CD1 . TRP C 1 115 ? -40.089 36.771 -187.262 1.00 35.20  ? 103 TRP M CD1 1 
ATOM   4243 C CD2 . TRP C 1 115 ? -40.649 37.777 -185.336 1.00 40.67  ? 103 TRP M CD2 1 
ATOM   4244 N NE1 . TRP C 1 115 ? -40.579 38.023 -187.559 1.00 39.21  ? 103 TRP M NE1 1 
ATOM   4245 C CE2 . TRP C 1 115 ? -40.923 38.663 -186.392 1.00 37.95  ? 103 TRP M CE2 1 
ATOM   4246 C CE3 . TRP C 1 115 ? -40.914 38.188 -184.027 1.00 42.60  ? 103 TRP M CE3 1 
ATOM   4247 C CZ2 . TRP C 1 115 ? -41.443 39.942 -186.186 1.00 36.17  ? 103 TRP M CZ2 1 
ATOM   4248 C CZ3 . TRP C 1 115 ? -41.437 39.458 -183.823 1.00 47.49  ? 103 TRP M CZ3 1 
ATOM   4249 C CH2 . TRP C 1 115 ? -41.699 40.317 -184.896 1.00 40.50  ? 103 TRP M CH2 1 
ATOM   4250 N N   . GLY C 1 116 ? -37.379 34.028 -183.375 1.00 46.14  ? 104 GLY M N   1 
ATOM   4251 C CA  . GLY C 1 116 ? -37.307 32.954 -182.402 1.00 45.94  ? 104 GLY M CA  1 
ATOM   4252 C C   . GLY C 1 116 ? -38.711 32.613 -181.923 1.00 47.05  ? 104 GLY M C   1 
ATOM   4253 O O   . GLY C 1 116 ? -39.664 33.306 -182.252 1.00 48.06  ? 104 GLY M O   1 
ATOM   4254 N N   . GLN C 1 117 ? -38.838 31.556 -181.131 1.00 46.80  ? 105 GLN M N   1 
ATOM   4255 C CA  . GLN C 1 117 ? -40.136 31.125 -180.621 1.00 47.82  ? 105 GLN M CA  1 
ATOM   4256 C C   . GLN C 1 117 ? -40.628 31.981 -179.463 1.00 51.27  ? 105 GLN M C   1 
ATOM   4257 O O   . GLN C 1 117 ? -41.790 31.915 -179.089 1.00 55.19  ? 105 GLN M O   1 
ATOM   4258 C CB  . GLN C 1 117 ? -40.034 29.696 -180.140 1.00 52.49  ? 105 GLN M CB  1 
ATOM   4259 C CG  . GLN C 1 117 ? -38.719 29.043 -180.527 1.00 75.83  ? 105 GLN M CG  1 
ATOM   4260 C CD  . GLN C 1 117 ? -37.528 29.485 -179.654 1.00 83.94  ? 105 GLN M CD  1 
ATOM   4261 O OE1 . GLN C 1 117 ? -36.465 29.850 -180.174 1.00 81.43  ? 105 GLN M OE1 1 
ATOM   4262 N NE2 . GLN C 1 117 ? -37.700 29.430 -178.327 1.00 81.59  ? 105 GLN M NE2 1 
ATOM   4263 N N   . GLY C 1 118 ? -39.739 32.764 -178.864 1.00 47.03  ? 106 GLY M N   1 
ATOM   4264 C CA  . GLY C 1 118 ? -40.138 33.578 -177.734 1.00 43.16  ? 106 GLY M CA  1 
ATOM   4265 C C   . GLY C 1 118 ? -39.847 32.978 -176.363 1.00 45.33  ? 106 GLY M C   1 
ATOM   4266 O O   . GLY C 1 118 ? -39.802 31.761 -176.173 1.00 45.94  ? 106 GLY M O   1 
ATOM   4267 N N   . THR C 1 119 ? -39.660 33.873 -175.405 1.00 45.23  ? 107 THR M N   1 
ATOM   4268 C CA  . THR C 1 119 ? -39.364 33.556 -174.026 1.00 50.56  ? 107 THR M CA  1 
ATOM   4269 C C   . THR C 1 119 ? -40.221 34.470 -173.166 1.00 51.75  ? 107 THR M C   1 
ATOM   4270 O O   . THR C 1 119 ? -40.199 35.695 -173.341 1.00 47.69  ? 107 THR M O   1 
ATOM   4271 C CB  . THR C 1 119 ? -37.913 33.894 -173.692 1.00 56.93  ? 107 THR M CB  1 
ATOM   4272 O OG1 . THR C 1 119 ? -37.039 32.995 -174.375 1.00 67.98  ? 107 THR M OG1 1 
ATOM   4273 C CG2 . THR C 1 119 ? -37.690 33.735 -172.226 1.00 60.94  ? 107 THR M CG2 1 
ATOM   4274 N N   . MET C 1 120 ? -40.982 33.886 -172.246 1.00 48.00  ? 108 MET M N   1 
ATOM   4275 C CA  . MET C 1 120 ? -41.784 34.675 -171.322 1.00 41.45  ? 108 MET M CA  1 
ATOM   4276 C C   . MET C 1 120 ? -40.873 35.212 -170.202 1.00 42.67  ? 108 MET M C   1 
ATOM   4277 O O   . MET C 1 120 ? -40.111 34.459 -169.584 1.00 49.86  ? 108 MET M O   1 
ATOM   4278 C CB  . MET C 1 120 ? -42.942 33.818 -170.776 1.00 46.14  ? 108 MET M CB  1 
ATOM   4279 C CG  . MET C 1 120 ? -43.924 34.530 -169.846 1.00 48.45  ? 108 MET M CG  1 
ATOM   4280 S SD  . MET C 1 120 ? -44.721 35.940 -170.636 1.00 57.38  ? 108 MET M SD  1 
ATOM   4281 C CE  . MET C 1 120 ? -45.664 36.670 -169.296 1.00 55.43  ? 108 MET M CE  1 
ATOM   4282 N N   . VAL C 1 121 ? -40.903 36.521 -169.981 1.00 42.34  ? 109 VAL M N   1 
ATOM   4283 C CA  . VAL C 1 121 ? -40.257 37.108 -168.809 1.00 43.44  ? 109 VAL M CA  1 
ATOM   4284 C C   . VAL C 1 121 ? -41.295 37.766 -167.892 1.00 40.88  ? 109 VAL M C   1 
ATOM   4285 O O   . VAL C 1 121 ? -42.095 38.587 -168.324 1.00 41.76  ? 109 VAL M O   1 
ATOM   4286 C CB  . VAL C 1 121 ? -39.180 38.128 -169.179 1.00 42.88  ? 109 VAL M CB  1 
ATOM   4287 C CG1 . VAL C 1 121 ? -38.617 38.732 -167.916 1.00 35.46  ? 109 VAL M CG1 1 
ATOM   4288 C CG2 . VAL C 1 121 ? -38.067 37.478 -169.993 1.00 41.65  ? 109 VAL M CG2 1 
ATOM   4289 N N   . THR C 1 122 ? -41.275 37.388 -166.623 1.00 45.81  ? 110 THR M N   1 
ATOM   4290 C CA  . THR C 1 122 ? -42.250 37.867 -165.650 1.00 45.64  ? 110 THR M CA  1 
ATOM   4291 C C   . THR C 1 122 ? -41.546 38.518 -164.467 1.00 44.58  ? 110 THR M C   1 
ATOM   4292 O O   . THR C 1 122 ? -40.888 37.852 -163.666 1.00 53.77  ? 110 THR M O   1 
ATOM   4293 C CB  . THR C 1 122 ? -43.126 36.717 -165.117 1.00 48.92  ? 110 THR M CB  1 
ATOM   4294 O OG1 . THR C 1 122 ? -43.770 36.052 -166.208 1.00 54.20  ? 110 THR M OG1 1 
ATOM   4295 C CG2 . THR C 1 122 ? -44.173 37.250 -164.181 1.00 44.85  ? 110 THR M CG2 1 
ATOM   4296 N N   . VAL C 1 123 ? -41.696 39.827 -164.361 1.00 42.54  ? 111 VAL M N   1 
ATOM   4297 C CA  . VAL C 1 123 ? -41.118 40.592 -163.266 1.00 44.34  ? 111 VAL M CA  1 
ATOM   4298 C C   . VAL C 1 123 ? -42.113 40.611 -162.104 1.00 47.45  ? 111 VAL M C   1 
ATOM   4299 O O   . VAL C 1 123 ? -43.207 41.151 -162.228 1.00 52.91  ? 111 VAL M O   1 
ATOM   4300 C CB  . VAL C 1 123 ? -40.785 42.033 -163.744 1.00 46.32  ? 111 VAL M CB  1 
ATOM   4301 C CG1 . VAL C 1 123 ? -39.924 42.755 -162.746 1.00 43.38  ? 111 VAL M CG1 1 
ATOM   4302 C CG2 . VAL C 1 123 ? -40.093 41.987 -165.109 1.00 37.11  ? 111 VAL M CG2 1 
ATOM   4303 N N   . SER C 1 124 ? -41.732 40.014 -160.980 1.00 46.81  ? 112 SER M N   1 
ATOM   4304 C CA  . SER C 1 124 ? -42.644 39.840 -159.855 1.00 44.61  ? 112 SER M CA  1 
ATOM   4305 C C   . SER C 1 124 ? -41.910 39.562 -158.530 1.00 52.07  ? 112 SER M C   1 
ATOM   4306 O O   . SER C 1 124 ? -40.826 38.977 -158.521 1.00 55.94  ? 112 SER M O   1 
ATOM   4307 C CB  . SER C 1 124 ? -43.607 38.695 -160.173 1.00 44.34  ? 112 SER M CB  1 
ATOM   4308 O OG  . SER C 1 124 ? -44.203 38.141 -159.014 1.00 48.93  ? 112 SER M OG  1 
ATOM   4309 N N   . SER C 1 125 ? -42.512 39.970 -157.413 1.00 46.76  ? 113 SER M N   1 
ATOM   4310 C CA  . SER C 1 125 ? -41.948 39.724 -156.086 1.00 44.31  ? 113 SER M CA  1 
ATOM   4311 C C   . SER C 1 125 ? -42.314 38.350 -155.562 1.00 44.63  ? 113 SER M C   1 
ATOM   4312 O O   . SER C 1 125 ? -41.798 37.906 -154.536 1.00 48.75  ? 113 SER M O   1 
ATOM   4313 C CB  . SER C 1 125 ? -42.455 40.765 -155.085 1.00 48.05  ? 113 SER M CB  1 
ATOM   4314 O OG  . SER C 1 125 ? -43.815 40.536 -154.743 1.00 51.00  ? 113 SER M OG  1 
ATOM   4315 N N   . ALA C 1 126 ? -43.231 37.691 -156.257 1.00 43.25  ? 114 ALA M N   1 
ATOM   4316 C CA  . ALA C 1 126 ? -43.783 36.431 -155.786 1.00 48.44  ? 114 ALA M CA  1 
ATOM   4317 C C   . ALA C 1 126 ? -42.839 35.310 -156.125 1.00 50.41  ? 114 ALA M C   1 
ATOM   4318 O O   . ALA C 1 126 ? -42.206 35.313 -157.182 1.00 57.77  ? 114 ALA M O   1 
ATOM   4319 C CB  . ALA C 1 126 ? -45.175 36.172 -156.399 1.00 48.85  ? 114 ALA M CB  1 
ATOM   4320 N N   . SER C 1 127 ? -42.751 34.337 -155.237 1.00 48.92  ? 115 SER M N   1 
ATOM   4321 C CA  . SER C 1 127 ? -41.935 33.185 -155.534 1.00 57.77  ? 115 SER M CA  1 
ATOM   4322 C C   . SER C 1 127 ? -42.725 32.294 -156.483 1.00 59.67  ? 115 SER M C   1 
ATOM   4323 O O   . SER C 1 127 ? -43.946 32.418 -156.615 1.00 57.56  ? 115 SER M O   1 
ATOM   4324 C CB  . SER C 1 127 ? -41.524 32.446 -154.259 1.00 61.83  ? 115 SER M CB  1 
ATOM   4325 O OG  . SER C 1 127 ? -42.564 31.609 -153.817 1.00 71.70  ? 115 SER M OG  1 
ATOM   4326 N N   . THR C 1 128 ? -42.016 31.415 -157.167 1.00 59.00  ? 116 THR M N   1 
ATOM   4327 C CA  . THR C 1 128 ? -42.625 30.588 -158.178 1.00 55.38  ? 116 THR M CA  1 
ATOM   4328 C C   . THR C 1 128 ? -43.439 29.490 -157.511 1.00 52.93  ? 116 THR M C   1 
ATOM   4329 O O   . THR C 1 128 ? -43.131 29.068 -156.394 1.00 52.75  ? 116 THR M O   1 
ATOM   4330 C CB  . THR C 1 128 ? -41.544 29.979 -159.080 1.00 57.98  ? 116 THR M CB  1 
ATOM   4331 O OG1 . THR C 1 128 ? -42.152 29.094 -160.023 1.00 65.46  ? 116 THR M OG1 1 
ATOM   4332 C CG2 . THR C 1 128 ? -40.534 29.208 -158.249 1.00 52.42  ? 116 THR M CG2 1 
ATOM   4333 N N   . LYS C 1 129 ? -44.485 29.036 -158.193 1.00 50.64  ? 117 LYS M N   1 
ATOM   4334 C CA  . LYS C 1 129 ? -45.318 27.954 -157.681 1.00 59.79  ? 117 LYS M CA  1 
ATOM   4335 C C   . LYS C 1 129 ? -45.726 27.014 -158.801 1.00 61.21  ? 117 LYS M C   1 
ATOM   4336 O O   . LYS C 1 129 ? -46.318 27.439 -159.799 1.00 54.31  ? 117 LYS M O   1 
ATOM   4337 C CB  . LYS C 1 129 ? -46.582 28.503 -157.008 1.00 60.40  ? 117 LYS M CB  1 
ATOM   4338 C CG  . LYS C 1 129 ? -47.291 27.481 -156.167 1.00 60.57  ? 117 LYS M CG  1 
ATOM   4339 C CD  . LYS C 1 129 ? -48.633 27.976 -155.693 1.00 72.46  ? 117 LYS M CD  1 
ATOM   4340 C CE  . LYS C 1 129 ? -49.382 26.820 -155.060 1.00 85.35  ? 117 LYS M CE  1 
ATOM   4341 N NZ  . LYS C 1 129 ? -48.515 26.132 -154.042 1.00 92.33  ? 117 LYS M NZ  1 
ATOM   4342 N N   . GLY C 1 130 ? -45.433 25.731 -158.625 1.00 56.26  ? 118 GLY M N   1 
ATOM   4343 C CA  . GLY C 1 130 ? -45.767 24.753 -159.639 1.00 55.74  ? 118 GLY M CA  1 
ATOM   4344 C C   . GLY C 1 130 ? -47.194 24.277 -159.517 1.00 60.98  ? 118 GLY M C   1 
ATOM   4345 O O   . GLY C 1 130 ? -47.757 24.250 -158.418 1.00 68.71  ? 118 GLY M O   1 
ATOM   4346 N N   . PRO C 1 131 ? -47.788 23.879 -160.647 1.00 60.93  ? 119 PRO M N   1 
ATOM   4347 C CA  . PRO C 1 131 ? -49.217 23.549 -160.693 1.00 59.38  ? 119 PRO M CA  1 
ATOM   4348 C C   . PRO C 1 131 ? -49.549 22.262 -159.968 1.00 62.58  ? 119 PRO M C   1 
ATOM   4349 O O   . PRO C 1 131 ? -48.672 21.413 -159.747 1.00 62.45  ? 119 PRO M O   1 
ATOM   4350 C CB  . PRO C 1 131 ? -49.475 23.343 -162.186 1.00 57.07  ? 119 PRO M CB  1 
ATOM   4351 C CG  . PRO C 1 131 ? -48.171 22.906 -162.735 1.00 57.37  ? 119 PRO M CG  1 
ATOM   4352 C CD  . PRO C 1 131 ? -47.115 23.629 -161.933 1.00 59.79  ? 119 PRO M CD  1 
ATOM   4353 N N   . SER C 1 132 ? -50.816 22.133 -159.595 1.00 65.16  ? 120 SER M N   1 
ATOM   4354 C CA  . SER C 1 132 ? -51.378 20.835 -159.268 1.00 74.98  ? 120 SER M CA  1 
ATOM   4355 C C   . SER C 1 132 ? -52.126 20.395 -160.515 1.00 76.27  ? 120 SER M C   1 
ATOM   4356 O O   . SER C 1 132 ? -52.872 21.176 -161.098 1.00 77.99  ? 120 SER M O   1 
ATOM   4357 C CB  . SER C 1 132 ? -52.335 20.924 -158.080 1.00 77.02  ? 120 SER M CB  1 
ATOM   4358 O OG  . SER C 1 132 ? -51.721 21.554 -156.973 1.00 80.32  ? 120 SER M OG  1 
ATOM   4359 N N   . VAL C 1 133 ? -51.905 19.155 -160.935 1.00 74.58  ? 121 VAL M N   1 
ATOM   4360 C CA  . VAL C 1 133 ? -52.567 18.619 -162.109 1.00 75.79  ? 121 VAL M CA  1 
ATOM   4361 C C   . VAL C 1 133 ? -53.663 17.637 -161.705 1.00 84.81  ? 121 VAL M C   1 
ATOM   4362 O O   . VAL C 1 133 ? -53.374 16.504 -161.321 1.00 90.06  ? 121 VAL M O   1 
ATOM   4363 C CB  . VAL C 1 133 ? -51.565 17.898 -163.011 1.00 73.17  ? 121 VAL M CB  1 
ATOM   4364 C CG1 . VAL C 1 133 ? -52.255 17.418 -164.278 1.00 74.48  ? 121 VAL M CG1 1 
ATOM   4365 C CG2 . VAL C 1 133 ? -50.405 18.823 -163.342 1.00 70.84  ? 121 VAL M CG2 1 
ATOM   4366 N N   . PHE C 1 134 ? -54.920 18.067 -161.785 1.00 81.12  ? 122 PHE M N   1 
ATOM   4367 C CA  . PHE C 1 134 ? -56.032 17.178 -161.463 1.00 81.84  ? 122 PHE M CA  1 
ATOM   4368 C C   . PHE C 1 134 ? -56.703 16.642 -162.718 1.00 85.71  ? 122 PHE M C   1 
ATOM   4369 O O   . PHE C 1 134 ? -56.866 17.351 -163.711 1.00 75.87  ? 122 PHE M O   1 
ATOM   4370 C CB  . PHE C 1 134 ? -57.097 17.888 -160.631 1.00 82.66  ? 122 PHE M CB  1 
ATOM   4371 C CG  . PHE C 1 134 ? -56.572 18.571 -159.421 1.00 79.52  ? 122 PHE M CG  1 
ATOM   4372 C CD1 . PHE C 1 134 ? -56.715 19.939 -159.273 1.00 77.50  ? 122 PHE M CD1 1 
ATOM   4373 C CD2 . PHE C 1 134 ? -55.953 17.852 -158.423 1.00 80.14  ? 122 PHE M CD2 1 
ATOM   4374 C CE1 . PHE C 1 134 ? -56.241 20.582 -158.157 1.00 79.62  ? 122 PHE M CE1 1 
ATOM   4375 C CE2 . PHE C 1 134 ? -55.472 18.488 -157.304 1.00 81.05  ? 122 PHE M CE2 1 
ATOM   4376 C CZ  . PHE C 1 134 ? -55.613 19.858 -157.170 1.00 79.75  ? 122 PHE M CZ  1 
ATOM   4377 N N   . PRO C 1 135 ? -57.151 15.387 -162.657 1.00 95.19  ? 123 PRO M N   1 
ATOM   4378 C CA  . PRO C 1 135 ? -57.844 14.782 -163.796 1.00 93.16  ? 123 PRO M CA  1 
ATOM   4379 C C   . PRO C 1 135 ? -59.207 15.414 -163.996 1.00 89.71  ? 123 PRO M C   1 
ATOM   4380 O O   . PRO C 1 135 ? -59.787 15.923 -163.043 1.00 89.05  ? 123 PRO M O   1 
ATOM   4381 C CB  . PRO C 1 135 ? -58.018 13.329 -163.361 1.00 89.99  ? 123 PRO M CB  1 
ATOM   4382 C CG  . PRO C 1 135 ? -58.050 13.386 -161.883 1.00 89.36  ? 123 PRO M CG  1 
ATOM   4383 C CD  . PRO C 1 135 ? -57.201 14.541 -161.453 1.00 90.38  ? 123 PRO M CD  1 
ATOM   4384 N N   . LEU C 1 136 ? -59.687 15.402 -165.233 1.00 88.59  ? 124 LEU M N   1 
ATOM   4385 C CA  . LEU C 1 136 ? -61.079 15.693 -165.530 1.00 91.05  ? 124 LEU M CA  1 
ATOM   4386 C C   . LEU C 1 136 ? -61.656 14.400 -166.100 1.00 97.44  ? 124 LEU M C   1 
ATOM   4387 O O   . LEU C 1 136 ? -61.484 14.097 -167.282 1.00 97.95  ? 124 LEU M O   1 
ATOM   4388 C CB  . LEU C 1 136 ? -61.215 16.860 -166.516 1.00 89.19  ? 124 LEU M CB  1 
ATOM   4389 C CG  . LEU C 1 136 ? -60.978 18.283 -165.978 1.00 84.29  ? 124 LEU M CG  1 
ATOM   4390 C CD1 . LEU C 1 136 ? -60.468 19.187 -167.071 1.00 77.82  ? 124 LEU M CD1 1 
ATOM   4391 C CD2 . LEU C 1 136 ? -62.224 18.885 -165.359 1.00 86.17  ? 124 LEU M CD2 1 
ATOM   4392 N N   . ALA C 1 137 ? -62.313 13.637 -165.228 1.00 102.87 ? 125 ALA M N   1 
ATOM   4393 C CA  . ALA C 1 137 ? -62.812 12.294 -165.523 1.00 103.25 ? 125 ALA M CA  1 
ATOM   4394 C C   . ALA C 1 137 ? -63.712 12.194 -166.756 1.00 109.57 ? 125 ALA M C   1 
ATOM   4395 O O   . ALA C 1 137 ? -64.763 12.831 -166.817 1.00 111.65 ? 125 ALA M O   1 
ATOM   4396 C CB  . ALA C 1 137 ? -63.534 11.751 -164.312 1.00 102.31 ? 125 ALA M CB  1 
ATOM   4397 N N   . PRO C 1 138 ? -63.300 11.374 -167.737 1.00 115.90 ? 126 PRO M N   1 
ATOM   4398 C CA  . PRO C 1 138 ? -64.023 11.062 -168.978 1.00 118.64 ? 126 PRO M CA  1 
ATOM   4399 C C   . PRO C 1 138 ? -65.221 10.163 -168.718 1.00 122.34 ? 126 PRO M C   1 
ATOM   4400 O O   . PRO C 1 138 ? -65.143 8.965  -168.979 1.00 129.43 ? 126 PRO M O   1 
ATOM   4401 C CB  . PRO C 1 138 ? -62.985 10.271 -169.781 1.00 119.38 ? 126 PRO M CB  1 
ATOM   4402 C CG  . PRO C 1 138 ? -62.128 9.659  -168.735 1.00 121.94 ? 126 PRO M CG  1 
ATOM   4403 C CD  . PRO C 1 138 ? -61.960 10.768 -167.746 1.00 118.29 ? 126 PRO M CD  1 
ATOM   4404 N N   . SER C 1 139 ? -66.315 10.731 -168.229 1.00 160.66 ? 127 SER M N   1 
ATOM   4405 C CA  . SER C 1 139 ? -67.458 9.937  -167.793 1.00 154.03 ? 127 SER M CA  1 
ATOM   4406 C C   . SER C 1 139 ? -68.350 9.457  -168.936 1.00 151.99 ? 127 SER M C   1 
ATOM   4407 O O   . SER C 1 139 ? -68.114 9.763  -170.106 1.00 151.43 ? 127 SER M O   1 
ATOM   4408 C CB  . SER C 1 139 ? -68.296 10.755 -166.815 1.00 150.54 ? 127 SER M CB  1 
ATOM   4409 O OG  . SER C 1 139 ? -68.608 12.018 -167.378 1.00 149.87 ? 127 SER M OG  1 
ATOM   4410 N N   . SER C 1 140 ? -69.375 8.689  -168.584 1.00 149.68 ? 128 SER M N   1 
ATOM   4411 C CA  . SER C 1 140 ? -70.469 8.431  -169.505 1.00 145.26 ? 128 SER M CA  1 
ATOM   4412 C C   . SER C 1 140 ? -71.273 9.723  -169.607 1.00 143.70 ? 128 SER M C   1 
ATOM   4413 O O   . SER C 1 140 ? -72.130 9.874  -170.479 1.00 141.99 ? 128 SER M O   1 
ATOM   4414 C CB  . SER C 1 140 ? -71.343 7.278  -169.001 1.00 138.59 ? 128 SER M CB  1 
ATOM   4415 O OG  . SER C 1 140 ? -71.571 7.369  -167.606 1.00 133.23 ? 128 SER M OG  1 
ATOM   4416 N N   . LYS C 1 141 ? -70.965 10.653 -168.702 1.00 143.56 ? 129 LYS M N   1 
ATOM   4417 C CA  . LYS C 1 141 ? -71.633 11.949 -168.611 1.00 144.92 ? 129 LYS M CA  1 
ATOM   4418 C C   . LYS C 1 141 ? -70.970 12.947 -169.569 1.00 154.92 ? 129 LYS M C   1 
ATOM   4419 O O   . LYS C 1 141 ? -71.292 14.144 -169.583 1.00 155.82 ? 129 LYS M O   1 
ATOM   4420 C CB  . LYS C 1 141 ? -71.560 12.469 -167.171 1.00 136.17 ? 129 LYS M CB  1 
ATOM   4421 C CG  . LYS C 1 141 ? -72.878 12.978 -166.599 1.00 133.08 ? 129 LYS M CG  1 
ATOM   4422 C CD  . LYS C 1 141 ? -72.679 13.621 -165.226 1.00 133.30 ? 129 LYS M CD  1 
ATOM   4423 C CE  . LYS C 1 141 ? -73.955 13.573 -164.403 1.00 133.70 ? 129 LYS M CE  1 
ATOM   4424 N NZ  . LYS C 1 141 ? -75.147 13.909 -165.229 1.00 115.42 ? 129 LYS M NZ  1 
ATOM   4425 N N   . SER C 1 142 ? -70.041 12.433 -170.370 1.00 159.16 ? 130 SER M N   1 
ATOM   4426 C CA  . SER C 1 142 ? -69.316 13.236 -171.345 1.00 159.78 ? 130 SER M CA  1 
ATOM   4427 C C   . SER C 1 142 ? -69.221 12.500 -172.683 1.00 164.47 ? 130 SER M C   1 
ATOM   4428 O O   . SER C 1 142 ? -68.178 12.523 -173.333 1.00 165.24 ? 130 SER M O   1 
ATOM   4429 C CB  . SER C 1 142 ? -67.912 13.560 -170.825 1.00 155.67 ? 130 SER M CB  1 
ATOM   4430 O OG  . SER C 1 142 ? -67.962 14.069 -169.503 1.00 152.86 ? 130 SER M OG  1 
ATOM   4431 N N   . THR C 1 143 ? -70.316 11.855 -173.086 1.00 166.86 ? 131 THR M N   1 
ATOM   4432 C CA  . THR C 1 143 ? -70.350 11.046 -174.306 1.00 168.43 ? 131 THR M CA  1 
ATOM   4433 C C   . THR C 1 143 ? -71.417 11.524 -175.293 1.00 170.28 ? 131 THR M C   1 
ATOM   4434 O O   . THR C 1 143 ? -72.597 11.204 -175.141 1.00 170.95 ? 131 THR M O   1 
ATOM   4435 C CB  . THR C 1 143 ? -70.621 9.559  -173.983 1.00 167.25 ? 131 THR M CB  1 
ATOM   4436 O OG1 . THR C 1 143 ? -69.512 9.009  -173.260 1.00 167.40 ? 131 THR M OG1 1 
ATOM   4437 C CG2 . THR C 1 143 ? -70.836 8.763  -175.262 1.00 167.88 ? 131 THR M CG2 1 
ATOM   4438 N N   . SER C 1 144 ? -70.999 12.283 -176.304 1.00 171.47 ? 132 SER M N   1 
ATOM   4439 C CA  . SER C 1 144 ? -71.915 12.774 -177.336 1.00 172.06 ? 132 SER M CA  1 
ATOM   4440 C C   . SER C 1 144 ? -71.722 12.019 -178.649 1.00 180.42 ? 132 SER M C   1 
ATOM   4441 O O   . SER C 1 144 ? -70.649 12.071 -179.250 1.00 181.98 ? 132 SER M O   1 
ATOM   4442 C CB  . SER C 1 144 ? -71.723 14.278 -177.565 1.00 167.13 ? 132 SER M CB  1 
ATOM   4443 O OG  . SER C 1 144 ? -72.498 14.736 -178.662 1.00 162.87 ? 132 SER M OG  1 
ATOM   4444 N N   . GLY C 1 145 ? -72.767 11.325 -179.092 1.00 118.58 ? 133 GLY M N   1 
ATOM   4445 C CA  . GLY C 1 145 ? -72.690 10.510 -180.293 1.00 121.06 ? 133 GLY M CA  1 
ATOM   4446 C C   . GLY C 1 145 ? -71.659 9.413  -180.117 1.00 126.09 ? 133 GLY M C   1 
ATOM   4447 O O   . GLY C 1 145 ? -71.809 8.540  -179.262 1.00 133.10 ? 133 GLY M O   1 
ATOM   4448 N N   . GLY C 1 146 ? -70.599 9.462  -180.912 1.00 122.09 ? 134 GLY M N   1 
ATOM   4449 C CA  . GLY C 1 146 ? -69.530 8.492  -180.787 1.00 123.73 ? 134 GLY M CA  1 
ATOM   4450 C C   . GLY C 1 146 ? -68.255 9.050  -180.182 1.00 126.80 ? 134 GLY M C   1 
ATOM   4451 O O   . GLY C 1 146 ? -67.187 8.463  -180.363 1.00 129.02 ? 134 GLY M O   1 
ATOM   4452 N N   . THR C 1 147 ? -68.357 10.174 -179.465 1.00 128.00 ? 137 THR M N   1 
ATOM   4453 C CA  . THR C 1 147 ? -67.187 10.808 -178.830 1.00 124.54 ? 137 THR M CA  1 
ATOM   4454 C C   . THR C 1 147 ? -67.412 11.283 -177.383 1.00 116.11 ? 137 THR M C   1 
ATOM   4455 O O   . THR C 1 147 ? -68.503 11.724 -177.013 1.00 107.86 ? 137 THR M O   1 
ATOM   4456 C CB  . THR C 1 147 ? -66.642 11.996 -179.665 1.00 102.82 ? 137 THR M CB  1 
ATOM   4457 O OG1 . THR C 1 147 ? -67.710 12.895 -179.979 1.00 94.40  ? 137 THR M OG1 1 
ATOM   4458 C CG2 . THR C 1 147 ? -65.995 11.503 -180.957 1.00 104.88 ? 137 THR M CG2 1 
ATOM   4459 N N   . ALA C 1 148 ? -66.352 11.197 -176.581 1.00 118.28 ? 138 ALA M N   1 
ATOM   4460 C CA  . ALA C 1 148 ? -66.368 11.621 -175.180 1.00 114.81 ? 138 ALA M CA  1 
ATOM   4461 C C   . ALA C 1 148 ? -65.275 12.651 -174.888 1.00 106.48 ? 138 ALA M C   1 
ATOM   4462 O O   . ALA C 1 148 ? -64.356 12.833 -175.680 1.00 107.09 ? 138 ALA M O   1 
ATOM   4463 C CB  . ALA C 1 148 ? -66.215 10.418 -174.266 1.00 118.39 ? 138 ALA M CB  1 
ATOM   4464 N N   . ALA C 1 149 ? -65.364 13.321 -173.747 1.00 99.57  ? 139 ALA M N   1 
ATOM   4465 C CA  . ALA C 1 149 ? -64.392 14.364 -173.440 1.00 93.30  ? 139 ALA M CA  1 
ATOM   4466 C C   . ALA C 1 149 ? -63.738 14.128 -172.094 1.00 94.28  ? 139 ALA M C   1 
ATOM   4467 O O   . ALA C 1 149 ? -64.422 13.901 -171.102 1.00 96.57  ? 139 ALA M O   1 
ATOM   4468 C CB  . ALA C 1 149 ? -65.045 15.744 -173.482 1.00 84.26  ? 139 ALA M CB  1 
ATOM   4469 N N   . LEU C 1 150 ? -62.409 14.180 -172.080 1.00 94.31  ? 140 LEU M N   1 
ATOM   4470 C CA  . LEU C 1 150 ? -61.613 14.060 -170.861 1.00 94.99  ? 140 LEU M CA  1 
ATOM   4471 C C   . LEU C 1 150 ? -60.583 15.179 -170.870 1.00 90.00  ? 140 LEU M C   1 
ATOM   4472 O O   . LEU C 1 150 ? -60.363 15.803 -171.908 1.00 83.25  ? 140 LEU M O   1 
ATOM   4473 C CB  . LEU C 1 150 ? -60.888 12.709 -170.815 1.00 94.30  ? 140 LEU M CB  1 
ATOM   4474 C CG  . LEU C 1 150 ? -59.961 12.459 -172.005 1.00 89.58  ? 140 LEU M CG  1 
ATOM   4475 C CD1 . LEU C 1 150 ? -58.972 11.381 -171.710 1.00 88.39  ? 140 LEU M CD1 1 
ATOM   4476 C CD2 . LEU C 1 150 ? -60.758 12.104 -173.234 1.00 89.99  ? 140 LEU M CD2 1 
ATOM   4477 N N   . GLY C 1 151 ? -59.940 15.430 -169.732 1.00 89.15  ? 141 GLY M N   1 
ATOM   4478 C CA  . GLY C 1 151 ? -58.922 16.463 -169.696 1.00 84.88  ? 141 GLY M CA  1 
ATOM   4479 C C   . GLY C 1 151 ? -58.170 16.645 -168.399 1.00 81.28  ? 141 GLY M C   1 
ATOM   4480 O O   . GLY C 1 151 ? -58.392 15.915 -167.437 1.00 83.33  ? 141 GLY M O   1 
ATOM   4481 N N   . CYS C 1 152 ? -57.269 17.628 -168.388 1.00 76.51  ? 142 CYS M N   1 
ATOM   4482 C CA  . CYS C 1 152 ? -56.461 17.945 -167.208 1.00 72.05  ? 142 CYS M CA  1 
ATOM   4483 C C   . CYS C 1 152 ? -56.686 19.357 -166.726 1.00 66.70  ? 142 CYS M C   1 
ATOM   4484 O O   . CYS C 1 152 ? -56.607 20.295 -167.501 1.00 69.47  ? 142 CYS M O   1 
ATOM   4485 C CB  . CYS C 1 152 ? -54.979 17.750 -167.500 1.00 64.20  ? 142 CYS M CB  1 
ATOM   4486 S SG  . CYS C 1 152 ? -54.420 16.120 -167.019 1.00 147.52 ? 142 CYS M SG  1 
ATOM   4487 N N   . LEU C 1 153 ? -56.981 19.501 -165.443 1.00 63.44  ? 143 LEU M N   1 
ATOM   4488 C CA  . LEU C 1 153 ? -57.145 20.815 -164.844 1.00 64.05  ? 143 LEU M CA  1 
ATOM   4489 C C   . LEU C 1 153 ? -55.820 21.178 -164.195 1.00 66.80  ? 143 LEU M C   1 
ATOM   4490 O O   . LEU C 1 153 ? -55.484 20.664 -163.135 1.00 74.80  ? 143 LEU M O   1 
ATOM   4491 C CB  . LEU C 1 153 ? -58.268 20.791 -163.802 1.00 68.44  ? 143 LEU M CB  1 
ATOM   4492 C CG  . LEU C 1 153 ? -58.523 22.036 -162.949 1.00 71.73  ? 143 LEU M CG  1 
ATOM   4493 C CD1 . LEU C 1 153 ? -59.004 23.196 -163.803 1.00 73.04  ? 143 LEU M CD1 1 
ATOM   4494 C CD2 . LEU C 1 153 ? -59.525 21.735 -161.851 1.00 70.48  ? 143 LEU M CD2 1 
ATOM   4495 N N   . VAL C 1 154 ? -55.054 22.039 -164.851 1.00 60.39  ? 144 VAL M N   1 
ATOM   4496 C CA  . VAL C 1 154 ? -53.739 22.431 -164.361 1.00 61.66  ? 144 VAL M CA  1 
ATOM   4497 C C   . VAL C 1 154 ? -53.909 23.709 -163.539 1.00 65.23  ? 144 VAL M C   1 
ATOM   4498 O O   . VAL C 1 154 ? -54.205 24.773 -164.085 1.00 68.95  ? 144 VAL M O   1 
ATOM   4499 C CB  . VAL C 1 154 ? -52.769 22.629 -165.545 1.00 54.99  ? 144 VAL M CB  1 
ATOM   4500 C CG1 . VAL C 1 154 ? -51.402 23.046 -165.077 1.00 49.19  ? 144 VAL M CG1 1 
ATOM   4501 C CG2 . VAL C 1 154 ? -52.685 21.360 -166.365 1.00 52.20  ? 144 VAL M CG2 1 
ATOM   4502 N N   . LYS C 1 155 ? -53.722 23.604 -162.226 1.00 65.02  ? 145 LYS M N   1 
ATOM   4503 C CA  . LYS C 1 155 ? -54.236 24.626 -161.317 1.00 62.86  ? 145 LYS M CA  1 
ATOM   4504 C C   . LYS C 1 155 ? -53.220 25.281 -160.394 1.00 61.80  ? 145 LYS M C   1 
ATOM   4505 O O   . LYS C 1 155 ? -52.368 24.613 -159.799 1.00 60.18  ? 145 LYS M O   1 
ATOM   4506 C CB  . LYS C 1 155 ? -55.377 24.045 -160.469 1.00 71.75  ? 145 LYS M CB  1 
ATOM   4507 C CG  . LYS C 1 155 ? -56.232 25.100 -159.792 1.00 75.60  ? 145 LYS M CG  1 
ATOM   4508 C CD  . LYS C 1 155 ? -57.431 24.495 -159.095 1.00 81.34  ? 145 LYS M CD  1 
ATOM   4509 C CE  . LYS C 1 155 ? -58.547 25.525 -158.924 1.00 84.07  ? 145 LYS M CE  1 
ATOM   4510 N NZ  . LYS C 1 155 ? -58.195 26.646 -158.003 1.00 79.33  ? 145 LYS M NZ  1 
ATOM   4511 N N   . ASP C 1 156 ? -53.338 26.600 -160.270 1.00 60.55  ? 146 ASP M N   1 
ATOM   4512 C CA  . ASP C 1 156 ? -52.636 27.350 -159.233 1.00 60.56  ? 146 ASP M CA  1 
ATOM   4513 C C   . ASP C 1 156 ? -51.127 27.386 -159.435 1.00 57.61  ? 146 ASP M C   1 
ATOM   4514 O O   . ASP C 1 156 ? -50.367 26.980 -158.560 1.00 61.52  ? 146 ASP M O   1 
ATOM   4515 C CB  . ASP C 1 156 ? -52.936 26.760 -157.852 1.00 66.30  ? 146 ASP M CB  1 
ATOM   4516 C CG  . ASP C 1 156 ? -54.343 27.065 -157.358 1.00 72.04  ? 146 ASP M CG  1 
ATOM   4517 O OD1 . ASP C 1 156 ? -54.931 28.107 -157.731 1.00 68.10  ? 146 ASP M OD1 1 
ATOM   4518 O OD2 . ASP C 1 156 ? -54.853 26.250 -156.561 1.00 80.88  ? 146 ASP M OD2 1 
ATOM   4519 N N   . TYR C 1 157 ? -50.689 27.885 -160.582 1.00 56.93  ? 147 TYR M N   1 
ATOM   4520 C CA  . TYR C 1 157 ? -49.262 27.993 -160.844 1.00 53.48  ? 147 TYR M CA  1 
ATOM   4521 C C   . TYR C 1 157 ? -48.839 29.430 -161.151 1.00 50.58  ? 147 TYR M C   1 
ATOM   4522 O O   . TYR C 1 157 ? -49.662 30.252 -161.528 1.00 51.68  ? 147 TYR M O   1 
ATOM   4523 C CB  . TYR C 1 157 ? -48.875 27.075 -161.992 1.00 47.53  ? 147 TYR M CB  1 
ATOM   4524 C CG  . TYR C 1 157 ? -49.484 27.464 -163.321 1.00 47.28  ? 147 TYR M CG  1 
ATOM   4525 C CD1 . TYR C 1 157 ? -50.740 27.004 -163.699 1.00 47.95  ? 147 TYR M CD1 1 
ATOM   4526 C CD2 . TYR C 1 157 ? -48.792 28.263 -164.207 1.00 43.48  ? 147 TYR M CD2 1 
ATOM   4527 C CE1 . TYR C 1 157 ? -51.281 27.331 -164.915 1.00 41.89  ? 147 TYR M CE1 1 
ATOM   4528 C CE2 . TYR C 1 157 ? -49.323 28.591 -165.421 1.00 44.04  ? 147 TYR M CE2 1 
ATOM   4529 C CZ  . TYR C 1 157 ? -50.569 28.130 -165.768 1.00 42.10  ? 147 TYR M CZ  1 
ATOM   4530 O OH  . TYR C 1 157 ? -51.095 28.486 -166.981 1.00 44.22  ? 147 TYR M OH  1 
ATOM   4531 N N   . PHE C 1 158 ? -47.554 29.721 -160.982 1.00 46.86  ? 148 PHE M N   1 
ATOM   4532 C CA  . PHE C 1 158 ? -47.025 31.046 -161.252 1.00 43.59  ? 148 PHE M CA  1 
ATOM   4533 C C   . PHE C 1 158 ? -45.518 30.966 -161.414 1.00 48.53  ? 148 PHE M C   1 
ATOM   4534 O O   . PHE C 1 158 ? -44.869 30.234 -160.679 1.00 50.31  ? 148 PHE M O   1 
ATOM   4535 C CB  . PHE C 1 158 ? -47.343 32.003 -160.108 1.00 43.17  ? 148 PHE M CB  1 
ATOM   4536 C CG  . PHE C 1 158 ? -46.926 33.409 -160.385 1.00 48.33  ? 148 PHE M CG  1 
ATOM   4537 C CD1 . PHE C 1 158 ? -47.707 34.229 -161.197 1.00 45.74  ? 148 PHE M CD1 1 
ATOM   4538 C CD2 . PHE C 1 158 ? -45.734 33.906 -159.879 1.00 50.52  ? 148 PHE M CD2 1 
ATOM   4539 C CE1 . PHE C 1 158 ? -47.317 35.527 -161.473 1.00 46.50  ? 148 PHE M CE1 1 
ATOM   4540 C CE2 . PHE C 1 158 ? -45.326 35.205 -160.154 1.00 49.38  ? 148 PHE M CE2 1 
ATOM   4541 C CZ  . PHE C 1 158 ? -46.112 36.017 -160.954 1.00 50.64  ? 148 PHE M CZ  1 
ATOM   4542 N N   . PRO C 1 159 ? -44.960 31.698 -162.399 1.00 50.75  ? 149 PRO M N   1 
ATOM   4543 C CA  . PRO C 1 159 ? -45.693 32.507 -163.372 1.00 50.74  ? 149 PRO M CA  1 
ATOM   4544 C C   . PRO C 1 159 ? -46.072 31.654 -164.579 1.00 50.37  ? 149 PRO M C   1 
ATOM   4545 O O   . PRO C 1 159 ? -46.057 30.425 -164.492 1.00 56.45  ? 149 PRO M O   1 
ATOM   4546 C CB  . PRO C 1 159 ? -44.635 33.520 -163.785 1.00 51.26  ? 149 PRO M CB  1 
ATOM   4547 C CG  . PRO C 1 159 ? -43.427 32.672 -163.909 1.00 40.09  ? 149 PRO M CG  1 
ATOM   4548 C CD  . PRO C 1 159 ? -43.530 31.662 -162.752 1.00 56.43  ? 149 PRO M CD  1 
ATOM   4549 N N   . GLU C 1 160 ? -46.398 32.294 -165.694 1.00 46.34  ? 150 GLU M N   1 
ATOM   4550 C CA  . GLU C 1 160 ? -46.580 31.566 -166.948 1.00 42.66  ? 150 GLU M CA  1 
ATOM   4551 C C   . GLU C 1 160 ? -45.226 31.307 -167.581 1.00 40.47  ? 150 GLU M C   1 
ATOM   4552 O O   . GLU C 1 160 ? -44.238 31.933 -167.221 1.00 54.61  ? 150 GLU M O   1 
ATOM   4553 C CB  . GLU C 1 160 ? -47.457 32.362 -167.905 1.00 45.12  ? 150 GLU M CB  1 
ATOM   4554 C CG  . GLU C 1 160 ? -48.841 32.631 -167.373 1.00 57.53  ? 150 GLU M CG  1 
ATOM   4555 C CD  . GLU C 1 160 ? -49.780 33.100 -168.462 1.00 69.31  ? 150 GLU M CD  1 
ATOM   4556 O OE1 . GLU C 1 160 ? -49.778 34.315 -168.756 1.00 73.51  ? 150 GLU M OE1 1 
ATOM   4557 O OE2 . GLU C 1 160 ? -50.517 32.256 -169.024 1.00 69.08  ? 150 GLU M OE2 1 
ATOM   4558 N N   . PRO C 1 161 ? -45.166 30.380 -168.536 1.00 41.85  ? 151 PRO M N   1 
ATOM   4559 C CA  . PRO C 1 161 ? -46.268 29.556 -169.007 1.00 41.28  ? 151 PRO M CA  1 
ATOM   4560 C C   . PRO C 1 161 ? -46.174 28.123 -168.516 1.00 51.04  ? 151 PRO M C   1 
ATOM   4561 O O   . PRO C 1 161 ? -45.279 27.722 -167.770 1.00 52.26  ? 151 PRO M O   1 
ATOM   4562 C CB  . PRO C 1 161 ? -46.017 29.543 -170.499 1.00 35.64  ? 151 PRO M CB  1 
ATOM   4563 C CG  . PRO C 1 161 ? -44.513 29.378 -170.567 1.00 33.01  ? 151 PRO M CG  1 
ATOM   4564 C CD  . PRO C 1 161 ? -43.981 30.203 -169.395 1.00 47.71  ? 151 PRO M CD  1 
ATOM   4565 N N   . VAL C 1 162 ? -47.133 27.351 -168.993 1.00 54.70  ? 152 VAL M N   1 
ATOM   4566 C CA  . VAL C 1 162 ? -47.207 25.941 -168.746 1.00 57.28  ? 152 VAL M CA  1 
ATOM   4567 C C   . VAL C 1 162 ? -47.445 25.336 -170.122 1.00 54.42  ? 152 VAL M C   1 
ATOM   4568 O O   . VAL C 1 162 ? -48.158 25.899 -170.926 1.00 56.03  ? 152 VAL M O   1 
ATOM   4569 C CB  . VAL C 1 162 ? -48.380 25.646 -167.800 1.00 61.90  ? 152 VAL M CB  1 
ATOM   4570 C CG1 . VAL C 1 162 ? -49.333 24.621 -168.396 1.00 67.88  ? 152 VAL M CG1 1 
ATOM   4571 C CG2 . VAL C 1 162 ? -47.867 25.204 -166.459 1.00 57.92  ? 152 VAL M CG2 1 
ATOM   4572 N N   . THR C 1 163 ? -46.823 24.209 -170.417 1.00 56.72  ? 153 THR M N   1 
ATOM   4573 C CA  . THR C 1 163 ? -47.120 23.531 -171.661 1.00 62.64  ? 153 THR M CA  1 
ATOM   4574 C C   . THR C 1 163 ? -47.839 22.222 -171.373 1.00 66.21  ? 153 THR M C   1 
ATOM   4575 O O   . THR C 1 163 ? -47.580 21.560 -170.362 1.00 62.62  ? 153 THR M O   1 
ATOM   4576 C CB  . THR C 1 163 ? -45.857 23.243 -172.440 1.00 68.68  ? 153 THR M CB  1 
ATOM   4577 O OG1 . THR C 1 163 ? -44.982 22.453 -171.626 1.00 76.52  ? 153 THR M OG1 1 
ATOM   4578 C CG2 . THR C 1 163 ? -45.169 24.548 -172.807 1.00 68.06  ? 153 THR M CG2 1 
ATOM   4579 N N   . VAL C 1 164 ? -48.763 21.866 -172.255 1.00 64.24  ? 154 VAL M N   1 
ATOM   4580 C CA  . VAL C 1 164 ? -49.493 20.624 -172.106 1.00 63.90  ? 154 VAL M CA  1 
ATOM   4581 C C   . VAL C 1 164 ? -49.456 19.825 -173.392 1.00 69.27  ? 154 VAL M C   1 
ATOM   4582 O O   . VAL C 1 164 ? -49.447 20.379 -174.492 1.00 70.95  ? 154 VAL M O   1 
ATOM   4583 C CB  . VAL C 1 164 ? -50.942 20.863 -171.699 1.00 61.70  ? 154 VAL M CB  1 
ATOM   4584 C CG1 . VAL C 1 164 ? -51.607 19.534 -171.353 1.00 65.99  ? 154 VAL M CG1 1 
ATOM   4585 C CG2 . VAL C 1 164 ? -50.993 21.812 -170.521 1.00 54.56  ? 154 VAL M CG2 1 
ATOM   4586 N N   . SER C 1 165 ? -49.411 18.513 -173.240 1.00 71.04  ? 156 SER M N   1 
ATOM   4587 C CA  . SER C 1 165 ? -49.402 17.623 -174.375 1.00 75.27  ? 156 SER M CA  1 
ATOM   4588 C C   . SER C 1 165 ? -50.121 16.379 -173.918 1.00 81.57  ? 156 SER M C   1 
ATOM   4589 O O   . SER C 1 165 ? -50.205 16.123 -172.719 1.00 78.93  ? 156 SER M O   1 
ATOM   4590 C CB  . SER C 1 165 ? -47.974 17.258 -174.732 1.00 74.10  ? 156 SER M CB  1 
ATOM   4591 O OG  . SER C 1 165 ? -47.514 16.225 -173.876 1.00 77.65  ? 156 SER M OG  1 
ATOM   4592 N N   . TRP C 1 166 ? -50.639 15.602 -174.861 1.00 83.81  ? 157 TRP M N   1 
ATOM   4593 C CA  . TRP C 1 166 ? -51.285 14.347 -174.507 1.00 83.21  ? 157 TRP M CA  1 
ATOM   4594 C C   . TRP C 1 166 ? -50.528 13.162 -175.084 1.00 92.14  ? 157 TRP M C   1 
ATOM   4595 O O   . TRP C 1 166 ? -50.071 13.197 -176.231 1.00 93.83  ? 157 TRP M O   1 
ATOM   4596 C CB  . TRP C 1 166 ? -52.736 14.335 -174.967 1.00 76.56  ? 157 TRP M CB  1 
ATOM   4597 C CG  . TRP C 1 166 ? -53.567 15.275 -174.195 1.00 73.29  ? 157 TRP M CG  1 
ATOM   4598 C CD1 . TRP C 1 166 ? -53.743 16.596 -174.448 1.00 71.12  ? 157 TRP M CD1 1 
ATOM   4599 C CD2 . TRP C 1 166 ? -54.334 14.981 -173.020 1.00 75.53  ? 157 TRP M CD2 1 
ATOM   4600 N NE1 . TRP C 1 166 ? -54.579 17.149 -173.510 1.00 74.98  ? 157 TRP M NE1 1 
ATOM   4601 C CE2 . TRP C 1 166 ? -54.956 16.177 -172.622 1.00 73.93  ? 157 TRP M CE2 1 
ATOM   4602 C CE3 . TRP C 1 166 ? -54.557 13.823 -172.271 1.00 76.92  ? 157 TRP M CE3 1 
ATOM   4603 C CZ2 . TRP C 1 166 ? -55.791 16.251 -171.505 1.00 72.50  ? 157 TRP M CZ2 1 
ATOM   4604 C CZ3 . TRP C 1 166 ? -55.385 13.898 -171.164 1.00 78.93  ? 157 TRP M CZ3 1 
ATOM   4605 C CH2 . TRP C 1 166 ? -55.993 15.103 -170.792 1.00 78.05  ? 157 TRP M CH2 1 
ATOM   4606 N N   . ASN C 1 167 ? -50.397 12.114 -174.277 1.00 92.91  ? 162 ASN M N   1 
ATOM   4607 C CA  . ASN C 1 167 ? -49.664 10.930 -174.688 1.00 91.41  ? 162 ASN M CA  1 
ATOM   4608 C C   . ASN C 1 167 ? -48.385 11.351 -175.402 1.00 93.31  ? 162 ASN M C   1 
ATOM   4609 O O   . ASN C 1 167 ? -48.113 10.953 -176.536 1.00 91.11  ? 162 ASN M O   1 
ATOM   4610 C CB  . ASN C 1 167 ? -50.550 10.025 -175.551 1.00 88.91  ? 162 ASN M CB  1 
ATOM   4611 C CG  . ASN C 1 167 ? -51.792 9.542  -174.799 1.00 87.03  ? 162 ASN M CG  1 
ATOM   4612 O OD1 . ASN C 1 167 ? -51.838 9.582  -173.565 1.00 87.29  ? 162 ASN M OD1 1 
ATOM   4613 N ND2 . ASN C 1 167 ? -52.805 9.102  -175.540 1.00 83.36  ? 162 ASN M ND2 1 
ATOM   4614 N N   . SER C 1 168 ? -47.639 12.219 -174.724 1.00 95.85  ? 163 SER M N   1 
ATOM   4615 C CA  . SER C 1 168 ? -46.282 12.583 -175.111 1.00 95.20  ? 163 SER M CA  1 
ATOM   4616 C C   . SER C 1 168 ? -46.129 12.997 -176.577 1.00 89.25  ? 163 SER M C   1 
ATOM   4617 O O   . SER C 1 168 ? -45.156 12.640 -177.237 1.00 88.07  ? 163 SER M O   1 
ATOM   4618 C CB  . SER C 1 168 ? -45.342 11.430 -174.771 1.00 95.53  ? 163 SER M CB  1 
ATOM   4619 O OG  . SER C 1 168 ? -45.751 10.825 -173.556 1.00 91.86  ? 163 SER M OG  1 
ATOM   4620 N N   . GLY C 1 169 ? -47.087 13.763 -177.077 1.00 81.89  ? 164 GLY M N   1 
ATOM   4621 C CA  . GLY C 1 169 ? -46.987 14.279 -178.423 1.00 82.94  ? 164 GLY M CA  1 
ATOM   4622 C C   . GLY C 1 169 ? -47.907 13.546 -179.367 1.00 96.72  ? 164 GLY M C   1 
ATOM   4623 O O   . GLY C 1 169 ? -48.390 14.126 -180.339 1.00 102.07 ? 164 GLY M O   1 
ATOM   4624 N N   . ALA C 1 170 ? -48.148 12.269 -179.081 1.00 101.54 ? 165 ALA M N   1 
ATOM   4625 C CA  . ALA C 1 170 ? -49.032 11.444 -179.905 1.00 102.89 ? 165 ALA M CA  1 
ATOM   4626 C C   . ALA C 1 170 ? -50.356 12.141 -180.212 1.00 103.96 ? 165 ALA M C   1 
ATOM   4627 O O   . ALA C 1 170 ? -50.572 12.621 -181.324 1.00 109.53 ? 165 ALA M O   1 
ATOM   4628 C CB  . ALA C 1 170 ? -49.295 10.118 -179.225 1.00 101.08 ? 165 ALA M CB  1 
ATOM   4629 N N   . LEU C 1 171 ? -51.230 12.192 -179.209 1.00 98.03  ? 166 LEU M N   1 
ATOM   4630 C CA  . LEU C 1 171 ? -52.587 12.713 -179.347 1.00 91.28  ? 166 LEU M CA  1 
ATOM   4631 C C   . LEU C 1 171 ? -52.628 14.223 -179.597 1.00 94.11  ? 166 LEU M C   1 
ATOM   4632 O O   . LEU C 1 171 ? -52.254 15.012 -178.731 1.00 95.60  ? 166 LEU M O   1 
ATOM   4633 C CB  . LEU C 1 171 ? -53.397 12.347 -178.101 1.00 85.61  ? 166 LEU M CB  1 
ATOM   4634 C CG  . LEU C 1 171 ? -54.906 12.581 -178.127 1.00 93.09  ? 166 LEU M CG  1 
ATOM   4635 C CD1 . LEU C 1 171 ? -55.445 12.632 -179.552 1.00 95.31  ? 166 LEU M CD1 1 
ATOM   4636 C CD2 . LEU C 1 171 ? -55.615 11.505 -177.311 1.00 97.72  ? 166 LEU M CD2 1 
ATOM   4637 N N   . THR C 1 172 ? -53.091 14.612 -180.785 1.00 96.39  ? 167 THR M N   1 
ATOM   4638 C CA  . THR C 1 172 ? -53.173 16.019 -181.178 1.00 91.00  ? 167 THR M CA  1 
ATOM   4639 C C   . THR C 1 172 ? -54.579 16.369 -181.651 1.00 94.02  ? 167 THR M C   1 
ATOM   4640 O O   . THR C 1 172 ? -55.142 17.396 -181.273 1.00 94.14  ? 167 THR M O   1 
ATOM   4641 C CB  . THR C 1 172 ? -52.229 16.322 -182.342 1.00 91.95  ? 167 THR M CB  1 
ATOM   4642 O OG1 . THR C 1 172 ? -52.651 15.582 -183.493 1.00 103.61 ? 167 THR M OG1 1 
ATOM   4643 C CG2 . THR C 1 172 ? -50.820 15.919 -182.002 1.00 92.98  ? 167 THR M CG2 1 
ATOM   4644 N N   . SER C 1 173 ? -55.129 15.516 -182.505 1.00 93.92  ? 168 SER M N   1 
ATOM   4645 C CA  . SER C 1 173 ? -56.485 15.691 -182.986 1.00 90.59  ? 168 SER M CA  1 
ATOM   4646 C C   . SER C 1 173 ? -57.463 15.829 -181.839 1.00 87.90  ? 168 SER M C   1 
ATOM   4647 O O   . SER C 1 173 ? -57.467 15.015 -180.910 1.00 91.59  ? 168 SER M O   1 
ATOM   4648 C CB  . SER C 1 173 ? -56.904 14.502 -183.845 1.00 94.45  ? 168 SER M CB  1 
ATOM   4649 O OG  . SER C 1 173 ? -56.577 14.729 -185.200 1.00 100.54 ? 168 SER M OG  1 
ATOM   4650 N N   . GLY C 1 174 ? -58.298 16.859 -181.919 1.00 79.41  ? 169 GLY M N   1 
ATOM   4651 C CA  . GLY C 1 174 ? -59.401 17.023 -180.995 1.00 77.24  ? 169 GLY M CA  1 
ATOM   4652 C C   . GLY C 1 174 ? -58.963 17.589 -179.666 1.00 78.71  ? 169 GLY M C   1 
ATOM   4653 O O   . GLY C 1 174 ? -59.721 17.577 -178.698 1.00 85.60  ? 169 GLY M O   1 
ATOM   4654 N N   . VAL C 1 175 ? -57.732 18.082 -179.622 1.00 69.88  ? 171 VAL M N   1 
ATOM   4655 C CA  . VAL C 1 175 ? -57.195 18.665 -178.407 1.00 66.85  ? 171 VAL M CA  1 
ATOM   4656 C C   . VAL C 1 175 ? -57.431 20.166 -178.359 1.00 68.61  ? 171 VAL M C   1 
ATOM   4657 O O   . VAL C 1 175 ? -57.158 20.883 -179.323 1.00 71.10  ? 171 VAL M O   1 
ATOM   4658 C CB  . VAL C 1 175 ? -55.696 18.404 -178.282 1.00 64.39  ? 171 VAL M CB  1 
ATOM   4659 C CG1 . VAL C 1 175 ? -55.081 19.408 -177.353 1.00 58.31  ? 171 VAL M CG1 1 
ATOM   4660 C CG2 . VAL C 1 175 ? -55.446 16.987 -177.788 1.00 72.79  ? 171 VAL M CG2 1 
ATOM   4661 N N   . HIS C 1 176 ? -57.957 20.630 -177.231 1.00 64.75  ? 172 HIS M N   1 
ATOM   4662 C CA  . HIS C 1 176 ? -58.117 22.051 -176.976 1.00 55.50  ? 172 HIS M CA  1 
ATOM   4663 C C   . HIS C 1 176 ? -57.478 22.365 -175.653 1.00 58.29  ? 172 HIS M C   1 
ATOM   4664 O O   . HIS C 1 176 ? -57.984 21.977 -174.607 1.00 64.30  ? 172 HIS M O   1 
ATOM   4665 C CB  . HIS C 1 176 ? -59.587 22.435 -176.914 1.00 49.44  ? 172 HIS M CB  1 
ATOM   4666 C CG  . HIS C 1 176 ? -60.256 22.467 -178.250 1.00 55.77  ? 172 HIS M CG  1 
ATOM   4667 N ND1 . HIS C 1 176 ? -61.226 21.562 -178.618 1.00 64.81  ? 172 HIS M ND1 1 
ATOM   4668 C CD2 . HIS C 1 176 ? -60.083 23.291 -179.309 1.00 58.56  ? 172 HIS M CD2 1 
ATOM   4669 C CE1 . HIS C 1 176 ? -61.628 21.826 -179.849 1.00 65.33  ? 172 HIS M CE1 1 
ATOM   4670 N NE2 . HIS C 1 176 ? -60.948 22.867 -180.291 1.00 65.41  ? 172 HIS M NE2 1 
ATOM   4671 N N   . THR C 1 177 ? -56.351 23.057 -175.695 1.00 57.27  ? 173 THR M N   1 
ATOM   4672 C CA  . THR C 1 177 ? -55.720 23.510 -174.467 1.00 54.61  ? 173 THR M CA  1 
ATOM   4673 C C   . THR C 1 177 ? -56.101 24.966 -174.254 1.00 51.68  ? 173 THR M C   1 
ATOM   4674 O O   . THR C 1 177 ? -55.781 25.820 -175.065 1.00 50.71  ? 173 THR M O   1 
ATOM   4675 C CB  . THR C 1 177 ? -54.197 23.322 -174.515 1.00 56.79  ? 173 THR M CB  1 
ATOM   4676 O OG1 . THR C 1 177 ? -53.892 21.938 -174.759 1.00 69.09  ? 173 THR M OG1 1 
ATOM   4677 C CG2 . THR C 1 177 ? -53.571 23.722 -173.202 1.00 56.61  ? 173 THR M CG2 1 
ATOM   4678 N N   . PHE C 1 178 ? -56.821 25.258 -173.179 1.00 48.69  ? 174 PHE M N   1 
ATOM   4679 C CA  . PHE C 1 178 ? -57.369 26.599 -173.040 1.00 44.43  ? 174 PHE M CA  1 
ATOM   4680 C C   . PHE C 1 178 ? -56.353 27.635 -172.622 1.00 46.43  ? 174 PHE M C   1 
ATOM   4681 O O   . PHE C 1 178 ? -55.344 27.332 -171.995 1.00 46.96  ? 174 PHE M O   1 
ATOM   4682 C CB  . PHE C 1 178 ? -58.582 26.607 -172.115 1.00 46.98  ? 174 PHE M CB  1 
ATOM   4683 C CG  . PHE C 1 178 ? -59.776 25.927 -172.705 1.00 48.13  ? 174 PHE M CG  1 
ATOM   4684 C CD1 . PHE C 1 178 ? -60.671 26.632 -173.491 1.00 49.62  ? 174 PHE M CD1 1 
ATOM   4685 C CD2 . PHE C 1 178 ? -59.984 24.576 -172.513 1.00 49.91  ? 174 PHE M CD2 1 
ATOM   4686 C CE1 . PHE C 1 178 ? -61.764 26.011 -174.052 1.00 47.00  ? 174 PHE M CE1 1 
ATOM   4687 C CE2 . PHE C 1 178 ? -61.078 23.949 -173.076 1.00 52.83  ? 174 PHE M CE2 1 
ATOM   4688 C CZ  . PHE C 1 178 ? -61.966 24.672 -173.844 1.00 49.41  ? 174 PHE M CZ  1 
ATOM   4689 N N   . PRO C 1 179 ? -56.598 28.878 -173.014 1.00 48.13  ? 175 PRO M N   1 
ATOM   4690 C CA  . PRO C 1 179 ? -55.747 29.950 -172.493 1.00 41.62  ? 175 PRO M CA  1 
ATOM   4691 C C   . PRO C 1 179 ? -55.787 29.901 -170.980 1.00 44.27  ? 175 PRO M C   1 
ATOM   4692 O O   . PRO C 1 179 ? -56.821 29.567 -170.407 1.00 49.48  ? 175 PRO M O   1 
ATOM   4693 C CB  . PRO C 1 179 ? -56.439 31.219 -172.991 1.00 37.31  ? 175 PRO M CB  1 
ATOM   4694 C CG  . PRO C 1 179 ? -57.219 30.776 -174.220 1.00 37.46  ? 175 PRO M CG  1 
ATOM   4695 C CD  . PRO C 1 179 ? -57.589 29.341 -174.005 1.00 42.78  ? 175 PRO M CD  1 
ATOM   4696 N N   . ALA C 1 180 ? -54.675 30.219 -170.334 1.00 47.23  ? 176 ALA M N   1 
ATOM   4697 C CA  . ALA C 1 180 ? -54.656 30.303 -168.882 1.00 45.38  ? 176 ALA M CA  1 
ATOM   4698 C C   . ALA C 1 180 ? -55.567 31.436 -168.430 1.00 47.95  ? 176 ALA M C   1 
ATOM   4699 O O   . ALA C 1 180 ? -55.738 32.410 -169.155 1.00 58.83  ? 176 ALA M O   1 
ATOM   4700 C CB  . ALA C 1 180 ? -53.266 30.559 -168.424 1.00 49.29  ? 176 ALA M CB  1 
ATOM   4701 N N   . VAL C 1 181 ? -56.162 31.309 -167.249 1.00 45.59  ? 177 VAL M N   1 
ATOM   4702 C CA  . VAL C 1 181 ? -56.877 32.434 -166.634 1.00 47.06  ? 177 VAL M CA  1 
ATOM   4703 C C   . VAL C 1 181 ? -56.282 32.820 -165.286 1.00 52.03  ? 177 VAL M C   1 
ATOM   4704 O O   . VAL C 1 181 ? -55.900 31.971 -164.477 1.00 53.66  ? 177 VAL M O   1 
ATOM   4705 C CB  . VAL C 1 181 ? -58.378 32.157 -166.432 1.00 50.71  ? 177 VAL M CB  1 
ATOM   4706 C CG1 . VAL C 1 181 ? -59.086 32.131 -167.766 1.00 50.89  ? 177 VAL M CG1 1 
ATOM   4707 C CG2 . VAL C 1 181 ? -58.592 30.847 -165.682 1.00 49.52  ? 177 VAL M CG2 1 
ATOM   4708 N N   . LEU C 1 182 ? -56.199 34.119 -165.053 1.00 53.08  ? 178 LEU M N   1 
ATOM   4709 C CA  . LEU C 1 182 ? -55.745 34.617 -163.772 1.00 50.56  ? 178 LEU M CA  1 
ATOM   4710 C C   . LEU C 1 182 ? -56.855 34.427 -162.750 1.00 55.05  ? 178 LEU M C   1 
ATOM   4711 O O   . LEU C 1 182 ? -57.951 34.974 -162.911 1.00 56.58  ? 178 LEU M O   1 
ATOM   4712 C CB  . LEU C 1 182 ? -55.401 36.091 -163.883 1.00 44.19  ? 178 LEU M CB  1 
ATOM   4713 C CG  . LEU C 1 182 ? -54.880 36.691 -162.585 1.00 46.69  ? 178 LEU M CG  1 
ATOM   4714 C CD1 . LEU C 1 182 ? -53.608 35.987 -162.188 1.00 44.99  ? 178 LEU M CD1 1 
ATOM   4715 C CD2 . LEU C 1 182 ? -54.645 38.175 -162.766 1.00 43.44  ? 178 LEU M CD2 1 
ATOM   4716 N N   . GLN C 1 183 ? -56.580 33.650 -161.708 1.00 51.58  ? 179 GLN M N   1 
ATOM   4717 C CA  . GLN C 1 183 ? -57.552 33.435 -160.640 1.00 56.79  ? 179 GLN M CA  1 
ATOM   4718 C C   . GLN C 1 183 ? -57.588 34.573 -159.610 1.00 68.21  ? 179 GLN M C   1 
ATOM   4719 O O   . GLN C 1 183 ? -56.728 35.451 -159.608 1.00 69.49  ? 179 GLN M O   1 
ATOM   4720 C CB  . GLN C 1 183 ? -57.273 32.113 -159.949 1.00 53.12  ? 179 GLN M CB  1 
ATOM   4721 C CG  . GLN C 1 183 ? -57.585 30.939 -160.830 1.00 57.02  ? 179 GLN M CG  1 
ATOM   4722 C CD  . GLN C 1 183 ? -57.022 29.642 -160.298 1.00 63.15  ? 179 GLN M CD  1 
ATOM   4723 O OE1 . GLN C 1 183 ? -57.765 28.700 -160.014 1.00 70.91  ? 179 GLN M OE1 1 
ATOM   4724 N NE2 . GLN C 1 183 ? -55.702 29.581 -160.167 1.00 59.18  ? 179 GLN M NE2 1 
ATOM   4725 N N   . SER C 1 184 ? -58.599 34.555 -158.746 1.00 72.35  ? 180 SER M N   1 
ATOM   4726 C CA  . SER C 1 184 ? -58.720 35.537 -157.672 1.00 67.91  ? 180 SER M CA  1 
ATOM   4727 C C   . SER C 1 184 ? -57.513 35.518 -156.752 1.00 65.00  ? 180 SER M C   1 
ATOM   4728 O O   . SER C 1 184 ? -57.193 36.518 -156.117 1.00 67.14  ? 180 SER M O   1 
ATOM   4729 C CB  . SER C 1 184 ? -59.959 35.246 -156.837 1.00 72.58  ? 180 SER M CB  1 
ATOM   4730 O OG  . SER C 1 184 ? -61.109 35.829 -157.410 1.00 88.12  ? 180 SER M OG  1 
ATOM   4731 N N   . SER C 1 185 ? -56.865 34.360 -156.672 1.00 61.55  ? 182 SER M N   1 
ATOM   4732 C CA  . SER C 1 185 ? -55.743 34.147 -155.774 1.00 64.65  ? 182 SER M CA  1 
ATOM   4733 C C   . SER C 1 185 ? -54.432 34.666 -156.359 1.00 65.29  ? 182 SER M C   1 
ATOM   4734 O O   . SER C 1 185 ? -53.397 34.611 -155.705 1.00 70.94  ? 182 SER M O   1 
ATOM   4735 C CB  . SER C 1 185 ? -55.601 32.656 -155.457 1.00 68.43  ? 182 SER M CB  1 
ATOM   4736 O OG  . SER C 1 185 ? -55.528 31.889 -156.650 1.00 71.99  ? 182 SER M OG  1 
ATOM   4737 N N   . GLY C 1 186 ? -54.474 35.160 -157.591 1.00 55.57  ? 183 GLY M N   1 
ATOM   4738 C CA  . GLY C 1 186 ? -53.288 35.695 -158.237 1.00 49.21  ? 183 GLY M CA  1 
ATOM   4739 C C   . GLY C 1 186 ? -52.433 34.611 -158.860 1.00 52.72  ? 183 GLY M C   1 
ATOM   4740 O O   . GLY C 1 186 ? -51.354 34.876 -159.398 1.00 56.83  ? 183 GLY M O   1 
ATOM   4741 N N   . LEU C 1 187 ? -52.911 33.377 -158.774 1.00 50.83  ? 184 LEU M N   1 
ATOM   4742 C CA  . LEU C 1 187 ? -52.264 32.271 -159.457 1.00 49.83  ? 184 LEU M CA  1 
ATOM   4743 C C   . LEU C 1 187 ? -53.011 31.931 -160.753 1.00 49.03  ? 184 LEU M C   1 
ATOM   4744 O O   . LEU C 1 187 ? -54.173 32.299 -160.929 1.00 48.63  ? 184 LEU M O   1 
ATOM   4745 C CB  . LEU C 1 187 ? -52.211 31.055 -158.542 1.00 48.89  ? 184 LEU M CB  1 
ATOM   4746 C CG  . LEU C 1 187 ? -51.572 31.291 -157.178 1.00 53.47  ? 184 LEU M CG  1 
ATOM   4747 C CD1 . LEU C 1 187 ? -51.746 30.038 -156.336 1.00 54.18  ? 184 LEU M CD1 1 
ATOM   4748 C CD2 . LEU C 1 187 ? -50.088 31.677 -157.301 1.00 44.99  ? 184 LEU M CD2 1 
ATOM   4749 N N   . TYR C 1 188 ? -52.344 31.223 -161.657 1.00 43.64  ? 185 TYR M N   1 
ATOM   4750 C CA  . TYR C 1 188 ? -52.953 30.870 -162.931 1.00 46.21  ? 185 TYR M CA  1 
ATOM   4751 C C   . TYR C 1 188 ? -53.567 29.497 -162.914 1.00 42.40  ? 185 TYR M C   1 
ATOM   4752 O O   . TYR C 1 188 ? -53.184 28.637 -162.129 1.00 49.21  ? 185 TYR M O   1 
ATOM   4753 C CB  . TYR C 1 188 ? -51.927 30.945 -164.062 1.00 41.72  ? 185 TYR M CB  1 
ATOM   4754 C CG  . TYR C 1 188 ? -51.511 32.348 -164.370 1.00 43.69  ? 185 TYR M CG  1 
ATOM   4755 C CD1 . TYR C 1 188 ? -50.396 32.903 -163.775 1.00 47.40  ? 185 TYR M CD1 1 
ATOM   4756 C CD2 . TYR C 1 188 ? -52.247 33.134 -165.241 1.00 46.11  ? 185 TYR M CD2 1 
ATOM   4757 C CE1 . TYR C 1 188 ? -50.009 34.195 -164.048 1.00 48.27  ? 185 TYR M CE1 1 
ATOM   4758 C CE2 . TYR C 1 188 ? -51.864 34.424 -165.521 1.00 46.11  ? 185 TYR M CE2 1 
ATOM   4759 C CZ  . TYR C 1 188 ? -50.746 34.950 -164.924 1.00 49.00  ? 185 TYR M CZ  1 
ATOM   4760 O OH  . TYR C 1 188 ? -50.361 36.238 -165.200 1.00 51.21  ? 185 TYR M OH  1 
ATOM   4761 N N   . SER C 1 189 ? -54.519 29.308 -163.809 1.00 42.40  ? 186 SER M N   1 
ATOM   4762 C CA  . SER C 1 189 ? -55.148 28.015 -164.034 1.00 53.85  ? 186 SER M CA  1 
ATOM   4763 C C   . SER C 1 189 ? -55.446 27.879 -165.500 1.00 54.72  ? 186 SER M C   1 
ATOM   4764 O O   . SER C 1 189 ? -55.777 28.857 -166.183 1.00 49.70  ? 186 SER M O   1 
ATOM   4765 C CB  . SER C 1 189 ? -56.455 27.867 -163.260 1.00 66.15  ? 186 SER M CB  1 
ATOM   4766 O OG  . SER C 1 189 ? -56.261 27.083 -162.104 1.00 81.65  ? 186 SER M OG  1 
ATOM   4767 N N   . LEU C 1 190 ? -55.357 26.645 -165.962 1.00 55.28  ? 187 LEU M N   1 
ATOM   4768 C CA  . LEU C 1 190 ? -55.466 26.333 -167.360 1.00 58.83  ? 187 LEU M CA  1 
ATOM   4769 C C   . LEU C 1 190 ? -55.930 24.899 -167.423 1.00 66.78  ? 187 LEU M C   1 
ATOM   4770 O O   . LEU C 1 190 ? -55.371 24.040 -166.741 1.00 69.31  ? 187 LEU M O   1 
ATOM   4771 C CB  . LEU C 1 190 ? -54.080 26.450 -167.981 1.00 53.90  ? 187 LEU M CB  1 
ATOM   4772 C CG  . LEU C 1 190 ? -53.787 25.830 -169.335 1.00 53.38  ? 187 LEU M CG  1 
ATOM   4773 C CD1 . LEU C 1 190 ? -52.461 26.352 -169.780 1.00 47.15  ? 187 LEU M CD1 1 
ATOM   4774 C CD2 . LEU C 1 190 ? -53.748 24.310 -169.268 1.00 57.55  ? 187 LEU M CD2 1 
ATOM   4775 N N   . SER C 1 191 ? -56.947 24.625 -168.227 1.00 59.56  ? 188 SER M N   1 
ATOM   4776 C CA  . SER C 1 191 ? -57.320 23.241 -168.461 1.00 57.16  ? 188 SER M CA  1 
ATOM   4777 C C   . SER C 1 191 ? -57.076 22.871 -169.909 1.00 57.49  ? 188 SER M C   1 
ATOM   4778 O O   . SER C 1 191 ? -57.146 23.716 -170.800 1.00 58.06  ? 188 SER M O   1 
ATOM   4779 C CB  . SER C 1 191 ? -58.772 22.979 -168.071 1.00 59.52  ? 188 SER M CB  1 
ATOM   4780 O OG  . SER C 1 191 ? -59.616 23.954 -168.643 1.00 63.18  ? 188 SER M OG  1 
ATOM   4781 N N   . SER C 1 192 ? -56.759 21.601 -170.128 1.00 55.88  ? 189 SER M N   1 
ATOM   4782 C CA  . SER C 1 192 ? -56.622 21.047 -171.461 1.00 57.40  ? 189 SER M CA  1 
ATOM   4783 C C   . SER C 1 192 ? -57.601 19.880 -171.591 1.00 65.18  ? 189 SER M C   1 
ATOM   4784 O O   . SER C 1 192 ? -57.684 19.036 -170.702 1.00 69.61  ? 189 SER M O   1 
ATOM   4785 C CB  . SER C 1 192 ? -55.192 20.564 -171.684 1.00 53.51  ? 189 SER M CB  1 
ATOM   4786 O OG  . SER C 1 192 ? -55.038 20.020 -172.983 1.00 61.91  ? 189 SER M OG  1 
ATOM   4787 N N   . VAL C 1 193 ? -58.353 19.840 -172.685 1.00 61.56  ? 190 VAL M N   1 
ATOM   4788 C CA  . VAL C 1 193 ? -59.317 18.765 -172.895 1.00 64.27  ? 190 VAL M CA  1 
ATOM   4789 C C   . VAL C 1 193 ? -59.110 18.109 -174.238 1.00 65.22  ? 190 VAL M C   1 
ATOM   4790 O O   . VAL C 1 193 ? -58.523 18.688 -175.144 1.00 68.74  ? 190 VAL M O   1 
ATOM   4791 C CB  . VAL C 1 193 ? -60.770 19.264 -172.862 1.00 63.72  ? 190 VAL M CB  1 
ATOM   4792 C CG1 . VAL C 1 193 ? -61.018 20.113 -171.627 1.00 63.58  ? 190 VAL M CG1 1 
ATOM   4793 C CG2 . VAL C 1 193 ? -61.085 20.039 -174.127 1.00 60.31  ? 190 VAL M CG2 1 
ATOM   4794 N N   . VAL C 1 194 ? -59.599 16.888 -174.367 1.00 67.51  ? 191 VAL M N   1 
ATOM   4795 C CA  . VAL C 1 194 ? -59.586 16.235 -175.660 1.00 75.06  ? 191 VAL M CA  1 
ATOM   4796 C C   . VAL C 1 194 ? -60.813 15.340 -175.851 1.00 75.05  ? 191 VAL M C   1 
ATOM   4797 O O   . VAL C 1 194 ? -61.231 14.631 -174.929 1.00 76.09  ? 191 VAL M O   1 
ATOM   4798 C CB  . VAL C 1 194 ? -58.303 15.446 -175.858 1.00 74.75  ? 191 VAL M CB  1 
ATOM   4799 C CG1 . VAL C 1 194 ? -58.072 14.549 -174.668 1.00 80.42  ? 191 VAL M CG1 1 
ATOM   4800 C CG2 . VAL C 1 194 ? -58.379 14.660 -177.155 1.00 79.45  ? 191 VAL M CG2 1 
ATOM   4801 N N   . THR C 1 195 ? -61.411 15.408 -177.037 1.00 71.29  ? 192 THR M N   1 
ATOM   4802 C CA  . THR C 1 195 ? -62.522 14.518 -177.348 1.00 82.88  ? 192 THR M CA  1 
ATOM   4803 C C   . THR C 1 195 ? -62.007 13.209 -177.934 1.00 89.24  ? 192 THR M C   1 
ATOM   4804 O O   . THR C 1 195 ? -61.096 13.189 -178.766 1.00 92.32  ? 192 THR M O   1 
ATOM   4805 C CB  . THR C 1 195 ? -63.526 15.137 -178.330 1.00 82.04  ? 192 THR M CB  1 
ATOM   4806 O OG1 . THR C 1 195 ? -62.895 15.305 -179.600 1.00 89.84  ? 192 THR M OG1 1 
ATOM   4807 C CG2 . THR C 1 195 ? -64.032 16.480 -177.826 1.00 71.82  ? 192 THR M CG2 1 
ATOM   4808 N N   . VAL C 1 196 ? -62.594 12.111 -177.489 1.00 92.30  ? 193 VAL M N   1 
ATOM   4809 C CA  . VAL C 1 196 ? -62.174 10.806 -177.954 1.00 104.49 ? 193 VAL M CA  1 
ATOM   4810 C C   . VAL C 1 196 ? -63.374 9.880  -178.168 1.00 114.89 ? 193 VAL M C   1 
ATOM   4811 O O   . VAL C 1 196 ? -64.425 10.073 -177.559 1.00 114.49 ? 193 VAL M O   1 
ATOM   4812 C CB  . VAL C 1 196 ? -61.201 10.177 -176.957 1.00 104.19 ? 193 VAL M CB  1 
ATOM   4813 C CG1 . VAL C 1 196 ? -59.897 10.949 -176.943 1.00 103.81 ? 193 VAL M CG1 1 
ATOM   4814 C CG2 . VAL C 1 196 ? -61.823 10.154 -175.580 1.00 102.97 ? 193 VAL M CG2 1 
ATOM   4815 N N   . PRO C 1 197 ? -63.216 8.878  -179.052 1.00 118.55 ? 194 PRO M N   1 
ATOM   4816 C CA  . PRO C 1 197 ? -64.215 7.836  -179.306 1.00 117.45 ? 194 PRO M CA  1 
ATOM   4817 C C   . PRO C 1 197 ? -64.729 7.198  -178.021 1.00 117.61 ? 194 PRO M C   1 
ATOM   4818 O O   . PRO C 1 197 ? -63.944 6.637  -177.257 1.00 117.15 ? 194 PRO M O   1 
ATOM   4819 C CB  . PRO C 1 197 ? -63.426 6.798  -180.102 1.00 122.24 ? 194 PRO M CB  1 
ATOM   4820 C CG  . PRO C 1 197 ? -62.384 7.575  -180.811 1.00 118.50 ? 194 PRO M CG  1 
ATOM   4821 C CD  . PRO C 1 197 ? -62.048 8.753  -179.945 1.00 117.13 ? 194 PRO M CD  1 
ATOM   4822 N N   . SER C 1 198 ? -66.034 7.278  -177.790 1.00 120.87 ? 195 SER M N   1 
ATOM   4823 C CA  . SER C 1 198 ? -66.646 6.591  -176.662 1.00 131.16 ? 195 SER M CA  1 
ATOM   4824 C C   . SER C 1 198 ? -66.049 5.190  -176.550 1.00 139.62 ? 195 SER M C   1 
ATOM   4825 O O   . SER C 1 198 ? -65.768 4.698  -175.453 1.00 138.15 ? 195 SER M O   1 
ATOM   4826 C CB  . SER C 1 198 ? -68.161 6.501  -176.860 1.00 137.13 ? 195 SER M CB  1 
ATOM   4827 O OG  . SER C 1 198 ? -68.722 7.775  -177.132 1.00 133.39 ? 195 SER M OG  1 
ATOM   4828 N N   . SER C 1 199 ? -65.851 4.567  -177.710 1.00 144.44 ? 196 SER M N   1 
ATOM   4829 C CA  . SER C 1 199 ? -65.285 3.226  -177.819 1.00 144.33 ? 196 SER M CA  1 
ATOM   4830 C C   . SER C 1 199 ? -64.021 3.041  -176.992 1.00 138.79 ? 196 SER M C   1 
ATOM   4831 O O   . SER C 1 199 ? -63.940 2.125  -176.178 1.00 141.30 ? 196 SER M O   1 
ATOM   4832 C CB  . SER C 1 199 ? -64.956 2.921  -179.281 1.00 144.43 ? 196 SER M CB  1 
ATOM   4833 O OG  . SER C 1 199 ? -63.633 3.329  -179.602 1.00 140.00 ? 196 SER M OG  1 
ATOM   4834 N N   . SER C 1 200 ? -63.045 3.920  -177.210 1.00 104.12 ? 197 SER M N   1 
ATOM   4835 C CA  . SER C 1 200 ? -61.692 3.757  -176.669 1.00 108.14 ? 197 SER M CA  1 
ATOM   4836 C C   . SER C 1 200 ? -61.552 4.069  -175.178 1.00 109.42 ? 197 SER M C   1 
ATOM   4837 O O   . SER C 1 200 ? -60.548 3.715  -174.560 1.00 109.42 ? 197 SER M O   1 
ATOM   4838 C CB  . SER C 1 200 ? -60.709 4.621  -177.455 1.00 101.81 ? 197 SER M CB  1 
ATOM   4839 O OG  . SER C 1 200 ? -61.018 5.991  -177.283 1.00 94.41  ? 197 SER M OG  1 
ATOM   4840 N N   . LEU C 1 201 ? -62.561 4.727  -174.616 1.00 110.50 ? 198 LEU M N   1 
ATOM   4841 C CA  . LEU C 1 201 ? -62.546 5.184  -173.222 1.00 114.75 ? 198 LEU M CA  1 
ATOM   4842 C C   . LEU C 1 201 ? -61.930 4.231  -172.190 1.00 111.89 ? 198 LEU M C   1 
ATOM   4843 O O   . LEU C 1 201 ? -61.352 4.672  -171.196 1.00 113.49 ? 198 LEU M O   1 
ATOM   4844 C CB  . LEU C 1 201 ? -63.961 5.566  -172.783 1.00 121.25 ? 198 LEU M CB  1 
ATOM   4845 C CG  . LEU C 1 201 ? -64.458 6.900  -173.331 1.00 124.61 ? 198 LEU M CG  1 
ATOM   4846 C CD1 . LEU C 1 201 ? -65.970 7.028  -173.164 1.00 127.33 ? 198 LEU M CD1 1 
ATOM   4847 C CD2 . LEU C 1 201 ? -63.717 8.045  -172.651 1.00 120.96 ? 198 LEU M CD2 1 
ATOM   4848 N N   . GLY C 1 202 ? -62.068 2.932  -172.405 1.00 107.56 ? 199 GLY M N   1 
ATOM   4849 C CA  . GLY C 1 202 ? -61.525 1.976  -171.462 1.00 105.67 ? 199 GLY M CA  1 
ATOM   4850 C C   . GLY C 1 202 ? -60.518 1.068  -172.123 1.00 107.73 ? 199 GLY M C   1 
ATOM   4851 O O   . GLY C 1 202 ? -60.097 0.073  -171.543 1.00 113.03 ? 199 GLY M O   1 
ATOM   4852 N N   . THR C 1 203 ? -60.130 1.415  -173.344 1.00 107.99 ? 200 THR M N   1 
ATOM   4853 C CA  . THR C 1 203 ? -59.274 0.546  -174.143 1.00 114.86 ? 200 THR M CA  1 
ATOM   4854 C C   . THR C 1 203 ? -57.930 1.204  -174.432 1.00 113.84 ? 200 THR M C   1 
ATOM   4855 O O   . THR C 1 203 ? -56.953 0.524  -174.740 1.00 110.27 ? 200 THR M O   1 
ATOM   4856 C CB  . THR C 1 203 ? -59.958 0.122  -175.472 1.00 104.96 ? 200 THR M CB  1 
ATOM   4857 O OG1 . THR C 1 203 ? -60.261 1.287  -176.253 1.00 106.76 ? 200 THR M OG1 1 
ATOM   4858 C CG2 . THR C 1 203 ? -61.246 -0.654 -175.206 1.00 95.36  ? 200 THR M CG2 1 
ATOM   4859 N N   . GLN C 1 204 ? -57.879 2.530  -174.339 1.00 117.31 ? 203 GLN M N   1 
ATOM   4860 C CA  . GLN C 1 204 ? -56.602 3.223  -174.503 1.00 117.77 ? 203 GLN M CA  1 
ATOM   4861 C C   . GLN C 1 204 ? -56.257 4.188  -173.375 1.00 108.76 ? 203 GLN M C   1 
ATOM   4862 O O   . GLN C 1 204 ? -57.136 4.820  -172.797 1.00 98.09  ? 203 GLN M O   1 
ATOM   4863 C CB  . GLN C 1 204 ? -56.513 3.941  -175.846 1.00 116.40 ? 203 GLN M CB  1 
ATOM   4864 C CG  . GLN C 1 204 ? -55.093 4.377  -176.147 1.00 119.60 ? 203 GLN M CG  1 
ATOM   4865 C CD  . GLN C 1 204 ? -54.908 4.786  -177.578 1.00 123.26 ? 203 GLN M CD  1 
ATOM   4866 O OE1 . GLN C 1 204 ? -55.704 5.554  -178.119 1.00 127.08 ? 203 GLN M OE1 1 
ATOM   4867 N NE2 . GLN C 1 204 ? -53.849 4.284  -178.206 1.00 122.37 ? 203 GLN M NE2 1 
ATOM   4868 N N   . THR C 1 205 ? -54.960 4.288  -173.085 1.00 113.19 ? 205 THR M N   1 
ATOM   4869 C CA  . THR C 1 205 ? -54.437 5.139  -172.019 1.00 113.39 ? 205 THR M CA  1 
ATOM   4870 C C   . THR C 1 205 ? -54.420 6.601  -172.421 1.00 105.49 ? 205 THR M C   1 
ATOM   4871 O O   . THR C 1 205 ? -53.915 6.955  -173.486 1.00 103.15 ? 205 THR M O   1 
ATOM   4872 C CB  . THR C 1 205 ? -52.987 4.753  -171.652 1.00 121.88 ? 205 THR M CB  1 
ATOM   4873 O OG1 . THR C 1 205 ? -52.172 4.774  -172.832 1.00 125.48 ? 205 THR M OG1 1 
ATOM   4874 C CG2 . THR C 1 205 ? -52.932 3.362  -171.025 1.00 125.84 ? 205 THR M CG2 1 
ATOM   4875 N N   . TYR C 1 206 ? -54.966 7.452  -171.561 1.00 105.80 ? 206 TYR M N   1 
ATOM   4876 C CA  . TYR C 1 206 ? -54.871 8.896  -171.762 1.00 103.66 ? 206 TYR M CA  1 
ATOM   4877 C C   . TYR C 1 206 ? -54.186 9.588  -170.583 1.00 98.75  ? 206 TYR M C   1 
ATOM   4878 O O   . TYR C 1 206 ? -54.677 9.568  -169.450 1.00 94.60  ? 206 TYR M O   1 
ATOM   4879 C CB  . TYR C 1 206 ? -56.245 9.507  -172.044 1.00 101.14 ? 206 TYR M CB  1 
ATOM   4880 C CG  . TYR C 1 206 ? -56.872 8.993  -173.321 1.00 102.77 ? 206 TYR M CG  1 
ATOM   4881 C CD1 . TYR C 1 206 ? -58.081 8.303  -173.301 1.00 102.94 ? 206 TYR M CD1 1 
ATOM   4882 C CD2 . TYR C 1 206 ? -56.243 9.179  -174.546 1.00 103.99 ? 206 TYR M CD2 1 
ATOM   4883 C CE1 . TYR C 1 206 ? -58.653 7.826  -174.473 1.00 105.37 ? 206 TYR M CE1 1 
ATOM   4884 C CE2 . TYR C 1 206 ? -56.802 8.706  -175.719 1.00 106.84 ? 206 TYR M CE2 1 
ATOM   4885 C CZ  . TYR C 1 206 ? -58.007 8.031  -175.678 1.00 106.98 ? 206 TYR M CZ  1 
ATOM   4886 O OH  . TYR C 1 206 ? -58.561 7.561  -176.848 1.00 105.47 ? 206 TYR M OH  1 
ATOM   4887 N N   . ILE C 1 207 ? -53.027 10.174 -170.862 1.00 96.26  ? 207 ILE M N   1 
ATOM   4888 C CA  . ILE C 1 207 ? -52.267 10.888 -169.849 1.00 95.49  ? 207 ILE M CA  1 
ATOM   4889 C C   . ILE C 1 207 ? -51.731 12.199 -170.410 1.00 90.99  ? 207 ILE M C   1 
ATOM   4890 O O   . ILE C 1 207 ? -51.095 12.221 -171.462 1.00 91.32  ? 207 ILE M O   1 
ATOM   4891 C CB  . ILE C 1 207 ? -51.104 10.039 -169.315 1.00 94.55  ? 207 ILE M CB  1 
ATOM   4892 C CG1 . ILE C 1 207 ? -51.646 8.769  -168.666 1.00 99.73  ? 207 ILE M CG1 1 
ATOM   4893 C CG2 . ILE C 1 207 ? -50.292 10.833 -168.315 1.00 90.67  ? 207 ILE M CG2 1 
ATOM   4894 C CD1 . ILE C 1 207 ? -50.612 8.001  -167.879 1.00 107.50 ? 207 ILE M CD1 1 
ATOM   4895 N N   . CYS C 1 208 ? -51.998 13.297 -169.713 1.00 85.63  ? 208 CYS M N   1 
ATOM   4896 C CA  . CYS C 1 208 ? -51.512 14.584 -170.181 1.00 81.72  ? 208 CYS M CA  1 
ATOM   4897 C C   . CYS C 1 208 ? -50.189 14.965 -169.528 1.00 81.32  ? 208 CYS M C   1 
ATOM   4898 O O   . CYS C 1 208 ? -50.019 14.859 -168.311 1.00 79.19  ? 208 CYS M O   1 
ATOM   4899 C CB  . CYS C 1 208 ? -52.569 15.684 -170.033 1.00 79.72  ? 208 CYS M CB  1 
ATOM   4900 S SG  . CYS C 1 208 ? -52.911 16.216 -168.365 1.00 98.15  ? 208 CYS M SG  1 
ATOM   4901 N N   . ASN C 1 209 ? -49.247 15.372 -170.374 1.00 83.10  ? 209 ASN M N   1 
ATOM   4902 C CA  . ASN C 1 209 ? -47.918 15.782 -169.952 1.00 79.19  ? 209 ASN M CA  1 
ATOM   4903 C C   . ASN C 1 209 ? -47.888 17.276 -169.682 1.00 72.13  ? 209 ASN M C   1 
ATOM   4904 O O   . ASN C 1 209 ? -47.886 18.086 -170.606 1.00 72.15  ? 209 ASN M O   1 
ATOM   4905 C CB  . ASN C 1 209 ? -46.888 15.440 -171.031 1.00 81.31  ? 209 ASN M CB  1 
ATOM   4906 C CG  . ASN C 1 209 ? -46.965 13.988 -171.484 1.00 86.34  ? 209 ASN M CG  1 
ATOM   4907 O OD1 . ASN C 1 209 ? -47.981 13.548 -172.027 1.00 77.82  ? 209 ASN M OD1 1 
ATOM   4908 N ND2 . ASN C 1 209 ? -45.875 13.240 -171.274 1.00 91.34  ? 209 ASN M ND2 1 
ATOM   4909 N N   . VAL C 1 210 ? -47.882 17.644 -168.411 1.00 67.25  ? 210 VAL M N   1 
ATOM   4910 C CA  . VAL C 1 210 ? -47.815 19.044 -168.053 1.00 64.00  ? 210 VAL M CA  1 
ATOM   4911 C C   . VAL C 1 210 ? -46.399 19.415 -167.654 1.00 71.24  ? 210 VAL M C   1 
ATOM   4912 O O   . VAL C 1 210 ? -45.741 18.708 -166.895 1.00 82.75  ? 210 VAL M O   1 
ATOM   4913 C CB  . VAL C 1 210 ? -48.790 19.377 -166.923 1.00 62.08  ? 210 VAL M CB  1 
ATOM   4914 C CG1 . VAL C 1 210 ? -48.595 20.798 -166.459 1.00 58.29  ? 210 VAL M CG1 1 
ATOM   4915 C CG2 . VAL C 1 210 ? -50.213 19.159 -167.389 1.00 61.78  ? 210 VAL M CG2 1 
ATOM   4916 N N   . ASN C 1 211 ? -45.932 20.534 -168.177 1.00 67.79  ? 211 ASN M N   1 
ATOM   4917 C CA  . ASN C 1 211 ? -44.574 20.969 -167.950 1.00 64.38  ? 211 ASN M CA  1 
ATOM   4918 C C   . ASN C 1 211 ? -44.569 22.448 -167.563 1.00 59.53  ? 211 ASN M C   1 
ATOM   4919 O O   . ASN C 1 211 ? -44.999 23.300 -168.352 1.00 61.26  ? 211 ASN M O   1 
ATOM   4920 C CB  . ASN C 1 211 ? -43.761 20.735 -169.222 1.00 72.55  ? 211 ASN M CB  1 
ATOM   4921 C CG  . ASN C 1 211 ? -42.273 20.921 -169.013 1.00 86.34  ? 211 ASN M CG  1 
ATOM   4922 O OD1 . ASN C 1 211 ? -41.803 21.076 -167.884 1.00 91.21  ? 211 ASN M OD1 1 
ATOM   4923 N ND2 . ASN C 1 211 ? -41.518 20.902 -170.107 1.00 89.01  ? 211 ASN M ND2 1 
ATOM   4924 N N   . HIS C 1 212 ? -44.112 22.745 -166.344 1.00 52.11  ? 212 HIS M N   1 
ATOM   4925 C CA  . HIS C 1 212 ? -43.972 24.120 -165.869 1.00 53.60  ? 212 HIS M CA  1 
ATOM   4926 C C   . HIS C 1 212 ? -42.522 24.388 -165.507 1.00 55.89  ? 212 HIS M C   1 
ATOM   4927 O O   . HIS C 1 212 ? -42.115 24.096 -164.386 1.00 59.66  ? 212 HIS M O   1 
ATOM   4928 C CB  . HIS C 1 212 ? -44.854 24.350 -164.640 1.00 59.65  ? 212 HIS M CB  1 
ATOM   4929 C CG  . HIS C 1 212 ? -44.837 25.763 -164.132 1.00 63.72  ? 212 HIS M CG  1 
ATOM   4930 N ND1 . HIS C 1 212 ? -44.423 26.093 -162.858 1.00 63.47  ? 212 HIS M ND1 1 
ATOM   4931 C CD2 . HIS C 1 212 ? -45.180 26.928 -164.732 1.00 60.65  ? 212 HIS M CD2 1 
ATOM   4932 C CE1 . HIS C 1 212 ? -44.520 27.401 -162.693 1.00 60.03  ? 212 HIS M CE1 1 
ATOM   4933 N NE2 . HIS C 1 212 ? -44.979 27.930 -163.814 1.00 58.78  ? 212 HIS M NE2 1 
ATOM   4934 N N   . LYS C 1 213 ? -41.753 24.945 -166.446 1.00 52.65  ? 213 LYS M N   1 
ATOM   4935 C CA  . LYS C 1 213 ? -40.304 25.105 -166.272 1.00 51.43  ? 213 LYS M CA  1 
ATOM   4936 C C   . LYS C 1 213 ? -39.901 25.987 -165.097 1.00 55.83  ? 213 LYS M C   1 
ATOM   4937 O O   . LYS C 1 213 ? -38.987 25.636 -164.352 1.00 58.01  ? 213 LYS M O   1 
ATOM   4938 C CB  . LYS C 1 213 ? -39.629 25.625 -167.538 1.00 56.16  ? 213 LYS M CB  1 
ATOM   4939 C CG  . LYS C 1 213 ? -39.687 24.692 -168.734 1.00 65.81  ? 213 LYS M CG  1 
ATOM   4940 C CD  . LYS C 1 213 ? -38.811 25.222 -169.856 1.00 73.84  ? 213 LYS M CD  1 
ATOM   4941 C CE  . LYS C 1 213 ? -39.036 24.481 -171.160 1.00 83.53  ? 213 LYS M CE  1 
ATOM   4942 N NZ  . LYS C 1 213 ? -37.908 24.733 -172.105 1.00 92.03  ? 213 LYS M NZ  1 
ATOM   4943 N N   . PRO C 1 214 ? -40.569 27.136 -164.920 1.00 54.08  ? 214 PRO M N   1 
ATOM   4944 C CA  . PRO C 1 214 ? -40.143 28.008 -163.820 1.00 51.40  ? 214 PRO M CA  1 
ATOM   4945 C C   . PRO C 1 214 ? -40.075 27.312 -162.455 1.00 56.35  ? 214 PRO M C   1 
ATOM   4946 O O   . PRO C 1 214 ? -39.285 27.718 -161.606 1.00 60.41  ? 214 PRO M O   1 
ATOM   4947 C CB  . PRO C 1 214 ? -41.204 29.100 -163.823 1.00 44.77  ? 214 PRO M CB  1 
ATOM   4948 C CG  . PRO C 1 214 ? -41.609 29.203 -165.254 1.00 47.40  ? 214 PRO M CG  1 
ATOM   4949 C CD  . PRO C 1 214 ? -41.579 27.784 -165.771 1.00 52.98  ? 214 PRO M CD  1 
ATOM   4950 N N   . SER C 1 215 ? -40.884 26.283 -162.239 1.00 53.79  ? 215 SER M N   1 
ATOM   4951 C CA  . SER C 1 215 ? -40.837 25.564 -160.978 1.00 53.15  ? 215 SER M CA  1 
ATOM   4952 C C   . SER C 1 215 ? -40.219 24.198 -161.206 1.00 61.97  ? 215 SER M C   1 
ATOM   4953 O O   . SER C 1 215 ? -40.307 23.304 -160.358 1.00 57.72  ? 215 SER M O   1 
ATOM   4954 C CB  . SER C 1 215 ? -42.236 25.404 -160.403 1.00 51.54  ? 215 SER M CB  1 
ATOM   4955 O OG  . SER C 1 215 ? -42.979 24.489 -161.180 1.00 57.57  ? 215 SER M OG  1 
ATOM   4956 N N   . ASN C 1 216 ? -39.601 24.037 -162.369 1.00 65.05  ? 216 ASN M N   1 
ATOM   4957 C CA  . ASN C 1 216 ? -39.005 22.763 -162.727 1.00 75.83  ? 216 ASN M CA  1 
ATOM   4958 C C   . ASN C 1 216 ? -39.967 21.593 -162.463 1.00 75.93  ? 216 ASN M C   1 
ATOM   4959 O O   . ASN C 1 216 ? -39.595 20.583 -161.889 1.00 77.10  ? 216 ASN M O   1 
ATOM   4960 C CB  . ASN C 1 216 ? -37.683 22.577 -161.980 1.00 81.71  ? 216 ASN M CB  1 
ATOM   4961 C CG  . ASN C 1 216 ? -37.013 21.266 -162.314 1.00 100.73 ? 216 ASN M CG  1 
ATOM   4962 O OD1 . ASN C 1 216 ? -37.073 20.798 -163.455 1.00 106.37 ? 216 ASN M OD1 1 
ATOM   4963 N ND2 . ASN C 1 216 ? -36.378 20.653 -161.318 1.00 109.37 ? 216 ASN M ND2 1 
ATOM   4964 N N   . THR C 1 217 ? -41.210 21.743 -162.898 1.00 79.31  ? 217 THR M N   1 
ATOM   4965 C CA  . THR C 1 217 ? -42.246 20.739 -162.661 1.00 80.03  ? 217 THR M CA  1 
ATOM   4966 C C   . THR C 1 217 ? -42.590 19.962 -163.929 1.00 78.33  ? 217 THR M C   1 
ATOM   4967 O O   . THR C 1 217 ? -42.872 20.546 -164.971 1.00 73.94  ? 217 THR M O   1 
ATOM   4968 C CB  . THR C 1 217 ? -43.534 21.398 -162.118 1.00 74.32  ? 217 THR M CB  1 
ATOM   4969 O OG1 . THR C 1 217 ? -43.298 21.880 -160.792 1.00 70.66  ? 217 THR M OG1 1 
ATOM   4970 C CG2 . THR C 1 217 ? -44.682 20.403 -162.096 1.00 73.93  ? 217 THR M CG2 1 
ATOM   4971 N N   . LYS C 1 218 ? -42.556 18.642 -163.840 1.00 82.70  ? 218 LYS M N   1 
ATOM   4972 C CA  . LYS C 1 218 ? -43.011 17.804 -164.937 1.00 88.79  ? 218 LYS M CA  1 
ATOM   4973 C C   . LYS C 1 218 ? -43.980 16.775 -164.385 1.00 89.96  ? 218 LYS M C   1 
ATOM   4974 O O   . LYS C 1 218 ? -43.622 15.977 -163.527 1.00 92.73  ? 218 LYS M O   1 
ATOM   4975 C CB  . LYS C 1 218 ? -41.834 17.133 -165.641 1.00 93.99  ? 218 LYS M CB  1 
ATOM   4976 C CG  . LYS C 1 218 ? -40.899 18.123 -166.318 1.00 100.48 ? 218 LYS M CG  1 
ATOM   4977 C CD  . LYS C 1 218 ? -39.898 17.436 -167.237 1.00 108.70 ? 218 LYS M CD  1 
ATOM   4978 C CE  . LYS C 1 218 ? -38.957 18.455 -167.874 1.00 110.31 ? 218 LYS M CE  1 
ATOM   4979 N NZ  . LYS C 1 218 ? -38.059 17.840 -168.893 1.00 113.91 ? 218 LYS M NZ  1 
ATOM   4980 N N   . VAL C 1 219 ? -45.217 16.811 -164.861 1.00 84.81  ? 219 VAL M N   1 
ATOM   4981 C CA  . VAL C 1 219 ? -46.242 15.927 -164.333 1.00 84.42  ? 219 VAL M CA  1 
ATOM   4982 C C   . VAL C 1 219 ? -46.888 15.120 -165.457 1.00 88.48  ? 219 VAL M C   1 
ATOM   4983 O O   . VAL C 1 219 ? -46.966 15.574 -166.596 1.00 87.44  ? 219 VAL M O   1 
ATOM   4984 C CB  . VAL C 1 219 ? -47.303 16.731 -163.552 1.00 82.06  ? 219 VAL M CB  1 
ATOM   4985 C CG1 . VAL C 1 219 ? -48.507 15.873 -163.231 1.00 85.79  ? 219 VAL M CG1 1 
ATOM   4986 C CG2 . VAL C 1 219 ? -46.704 17.311 -162.282 1.00 76.47  ? 219 VAL M CG2 1 
ATOM   4987 N N   . ASP C 1 220 ? -47.330 13.910 -165.140 1.00 98.09  ? 220 ASP M N   1 
ATOM   4988 C CA  . ASP C 1 220 ? -48.026 13.076 -166.113 1.00 107.43 ? 220 ASP M CA  1 
ATOM   4989 C C   . ASP C 1 220 ? -49.257 12.436 -165.489 1.00 109.75 ? 220 ASP M C   1 
ATOM   4990 O O   . ASP C 1 220 ? -49.280 11.230 -165.259 1.00 117.71 ? 220 ASP M O   1 
ATOM   4991 C CB  . ASP C 1 220 ? -47.095 11.996 -166.668 1.00 110.63 ? 220 ASP M CB  1 
ATOM   4992 C CG  . ASP C 1 220 ? -45.880 12.578 -167.354 1.00 111.38 ? 220 ASP M CG  1 
ATOM   4993 O OD1 . ASP C 1 220 ? -45.018 13.138 -166.648 1.00 112.36 ? 220 ASP M OD1 1 
ATOM   4994 O OD2 . ASP C 1 220 ? -45.787 12.481 -168.596 1.00 110.56 ? 220 ASP M OD2 1 
ATOM   4995 N N   . LYS C 1 221 ? -50.275 13.247 -165.217 1.00 102.20 ? 221 LYS M N   1 
ATOM   4996 C CA  . LYS C 1 221 ? -51.484 12.752 -164.573 1.00 99.19  ? 221 LYS M CA  1 
ATOM   4997 C C   . LYS C 1 221 ? -52.249 11.821 -165.496 1.00 97.72  ? 221 LYS M C   1 
ATOM   4998 O O   . LYS C 1 221 ? -52.458 12.127 -166.668 1.00 90.19  ? 221 LYS M O   1 
ATOM   4999 C CB  . LYS C 1 221 ? -52.381 13.904 -164.128 1.00 97.97  ? 221 LYS M CB  1 
ATOM   5000 C CG  . LYS C 1 221 ? -53.663 13.454 -163.450 1.00 101.45 ? 221 LYS M CG  1 
ATOM   5001 C CD  . LYS C 1 221 ? -53.362 12.570 -162.251 1.00 109.52 ? 221 LYS M CD  1 
ATOM   5002 C CE  . LYS C 1 221 ? -52.415 13.257 -161.273 1.00 107.48 ? 221 LYS M CE  1 
ATOM   5003 N NZ  . LYS C 1 221 ? -52.326 12.520 -159.982 1.00 108.82 ? 221 LYS M NZ  1 
ATOM   5004 N N   . LYS C 1 222 ? -52.659 10.681 -164.952 1.00 102.79 ? 222 LYS M N   1 
ATOM   5005 C CA  . LYS C 1 222 ? -53.373 9.672  -165.717 1.00 111.69 ? 222 LYS M CA  1 
ATOM   5006 C C   . LYS C 1 222 ? -54.877 9.917  -165.686 1.00 111.51 ? 222 LYS M C   1 
ATOM   5007 O O   . LYS C 1 222 ? -55.547 9.646  -164.694 1.00 113.47 ? 222 LYS M O   1 
ATOM   5008 C CB  . LYS C 1 222 ? -53.038 8.263  -165.196 1.00 124.66 ? 222 LYS M CB  1 
ATOM   5009 C CG  . LYS C 1 222 ? -53.416 7.983  -163.729 1.00 128.71 ? 222 LYS M CG  1 
ATOM   5010 C CD  . LYS C 1 222 ? -52.698 8.899  -162.727 1.00 127.36 ? 222 LYS M CD  1 
ATOM   5011 C CE  . LYS C 1 222 ? -51.202 8.618  -162.657 1.00 126.50 ? 222 LYS M CE  1 
ATOM   5012 N NZ  . LYS C 1 222 ? -50.548 9.359  -161.544 1.00 121.96 ? 222 LYS M NZ  1 
ATOM   5013 N N   . VAL C 1 223 ? -55.413 10.452 -166.771 1.00 113.40 ? 225 VAL M N   1 
ATOM   5014 C CA  . VAL C 1 223 ? -56.853 10.627 -166.846 1.00 114.08 ? 225 VAL M CA  1 
ATOM   5015 C C   . VAL C 1 223 ? -57.491 9.297  -167.235 1.00 117.30 ? 225 VAL M C   1 
ATOM   5016 O O   . VAL C 1 223 ? -57.214 8.739  -168.302 1.00 115.68 ? 225 VAL M O   1 
ATOM   5017 C CB  . VAL C 1 223 ? -57.268 11.781 -167.797 1.00 78.58  ? 225 VAL M CB  1 
ATOM   5018 C CG1 . VAL C 1 223 ? -58.668 11.573 -168.325 1.00 72.51  ? 225 VAL M CG1 1 
ATOM   5019 C CG2 . VAL C 1 223 ? -57.189 13.108 -167.071 1.00 81.80  ? 225 VAL M CG2 1 
ATOM   5020 N N   . GLU C 1 224 ? -58.325 8.783  -166.339 1.00 118.38 ? 226 GLU M N   1 
ATOM   5021 C CA  . GLU C 1 224 ? -59.008 7.521  -166.565 1.00 120.42 ? 226 GLU M CA  1 
ATOM   5022 C C   . GLU C 1 224 ? -60.437 7.614  -166.062 1.00 122.28 ? 226 GLU M C   1 
ATOM   5023 O O   . GLU C 1 224 ? -60.713 8.332  -165.101 1.00 119.84 ? 226 GLU M O   1 
ATOM   5024 C CB  . GLU C 1 224 ? -58.275 6.401  -165.840 1.00 120.99 ? 226 GLU M CB  1 
ATOM   5025 C CG  . GLU C 1 224 ? -57.765 6.819  -164.486 1.00 121.05 ? 226 GLU M CG  1 
ATOM   5026 C CD  . GLU C 1 224 ? -57.192 5.664  -163.712 1.00 130.13 ? 226 GLU M CD  1 
ATOM   5027 O OE1 . GLU C 1 224 ? -57.791 4.568  -163.761 1.00 134.15 ? 226 GLU M OE1 1 
ATOM   5028 O OE2 . GLU C 1 224 ? -56.147 5.851  -163.052 1.00 133.38 ? 226 GLU M OE2 1 
ATOM   5029 N N   . PRO C 1 225 ? -61.349 6.872  -166.706 1.00 125.71 ? 227 PRO M N   1 
ATOM   5030 C CA  . PRO C 1 225 ? -62.786 6.935  -166.410 1.00 125.55 ? 227 PRO M CA  1 
ATOM   5031 C C   . PRO C 1 225 ? -63.092 6.897  -164.911 1.00 125.98 ? 227 PRO M C   1 
ATOM   5032 O O   . PRO C 1 225 ? -62.355 6.315  -164.115 1.00 126.84 ? 227 PRO M O   1 
ATOM   5033 C CB  . PRO C 1 225 ? -63.331 5.690  -167.106 1.00 124.49 ? 227 PRO M CB  1 
ATOM   5034 C CG  . PRO C 1 225 ? -62.396 5.482  -168.255 1.00 123.24 ? 227 PRO M CG  1 
ATOM   5035 C CD  . PRO C 1 225 ? -61.041 5.872  -167.744 1.00 124.14 ? 227 PRO M CD  1 
ATOM   5036 N N   . GLU D 2 1   ? -41.694 60.071 -184.146 1.00 87.10  ? 1   GLU N N   1 
ATOM   5037 C CA  . GLU D 2 1   ? -41.964 58.645 -183.936 1.00 85.16  ? 1   GLU N CA  1 
ATOM   5038 C C   . GLU D 2 1   ? -43.202 58.194 -184.691 1.00 77.76  ? 1   GLU N C   1 
ATOM   5039 O O   . GLU D 2 1   ? -44.320 58.381 -184.218 1.00 83.56  ? 1   GLU N O   1 
ATOM   5040 C CB  . GLU D 2 1   ? -42.168 58.346 -182.456 1.00 84.49  ? 1   GLU N CB  1 
ATOM   5041 C CG  . GLU D 2 1   ? -42.571 56.906 -182.197 1.00 90.43  ? 1   GLU N CG  1 
ATOM   5042 C CD  . GLU D 2 1   ? -43.790 56.803 -181.302 1.00 98.71  ? 1   GLU N CD  1 
ATOM   5043 O OE1 . GLU D 2 1   ? -44.643 57.716 -181.362 1.00 102.06 ? 1   GLU N OE1 1 
ATOM   5044 O OE2 . GLU D 2 1   ? -43.901 55.813 -180.544 1.00 99.55  ? 1   GLU N OE2 1 
ATOM   5045 N N   . LEU D 2 2   ? -43.012 57.582 -185.852 1.00 67.75  ? 2   LEU N N   1 
ATOM   5046 C CA  . LEU D 2 2   ? -44.145 57.266 -186.713 1.00 68.95  ? 2   LEU N CA  1 
ATOM   5047 C C   . LEU D 2 2   ? -45.214 56.440 -186.004 1.00 71.03  ? 2   LEU N C   1 
ATOM   5048 O O   . LEU D 2 2   ? -44.920 55.552 -185.208 1.00 75.16  ? 2   LEU N O   1 
ATOM   5049 C CB  . LEU D 2 2   ? -43.688 56.562 -187.989 1.00 69.51  ? 2   LEU N CB  1 
ATOM   5050 C CG  . LEU D 2 2   ? -42.891 57.460 -188.927 1.00 68.71  ? 2   LEU N CG  1 
ATOM   5051 C CD1 . LEU D 2 2   ? -41.513 57.666 -188.352 1.00 71.15  ? 2   LEU N CD1 1 
ATOM   5052 C CD2 . LEU D 2 2   ? -42.792 56.843 -190.305 1.00 70.13  ? 2   LEU N CD2 1 
ATOM   5053 N N   . VAL D 2 3   ? -46.467 56.746 -186.294 1.00 69.10  ? 3   VAL N N   1 
ATOM   5054 C CA  . VAL D 2 3   ? -47.556 55.992 -185.715 1.00 66.18  ? 3   VAL N CA  1 
ATOM   5055 C C   . VAL D 2 3   ? -48.317 55.241 -186.790 1.00 72.82  ? 3   VAL N C   1 
ATOM   5056 O O   . VAL D 2 3   ? -48.830 55.834 -187.740 1.00 77.51  ? 3   VAL N O   1 
ATOM   5057 C CB  . VAL D 2 3   ? -48.513 56.892 -184.952 1.00 59.44  ? 3   VAL N CB  1 
ATOM   5058 C CG1 . VAL D 2 3   ? -49.725 56.091 -184.499 1.00 56.69  ? 3   VAL N CG1 1 
ATOM   5059 C CG2 . VAL D 2 3   ? -47.786 57.520 -183.778 1.00 51.54  ? 3   VAL N CG2 1 
ATOM   5060 N N   . MET D 2 4   ? -48.371 53.923 -186.635 1.00 72.16  ? 4   MET N N   1 
ATOM   5061 C CA  . MET D 2 4   ? -49.102 53.068 -187.550 1.00 63.94  ? 4   MET N CA  1 
ATOM   5062 C C   . MET D 2 4   ? -50.482 52.804 -186.979 1.00 66.02  ? 4   MET N C   1 
ATOM   5063 O O   . MET D 2 4   ? -50.622 52.445 -185.810 1.00 69.57  ? 4   MET N O   1 
ATOM   5064 C CB  . MET D 2 4   ? -48.356 51.754 -187.757 1.00 62.38  ? 4   MET N CB  1 
ATOM   5065 C CG  . MET D 2 4   ? -46.888 51.926 -188.060 1.00 60.60  ? 4   MET N CG  1 
ATOM   5066 S SD  . MET D 2 4   ? -46.646 52.867 -189.555 1.00 63.13  ? 4   MET N SD  1 
ATOM   5067 C CE  . MET D 2 4   ? -47.171 51.678 -190.762 1.00 46.58  ? 4   MET N CE  1 
ATOM   5068 N N   . THR D 2 5   ? -51.497 53.003 -187.812 1.00 67.21  ? 5   THR N N   1 
ATOM   5069 C CA  . THR D 2 5   ? -52.884 52.817 -187.420 1.00 62.51  ? 5   THR N CA  1 
ATOM   5070 C C   . THR D 2 5   ? -53.550 51.855 -188.386 1.00 63.61  ? 5   THR N C   1 
ATOM   5071 O O   . THR D 2 5   ? -53.602 52.100 -189.586 1.00 71.64  ? 5   THR N O   1 
ATOM   5072 C CB  . THR D 2 5   ? -53.646 54.155 -187.412 1.00 60.97  ? 5   THR N CB  1 
ATOM   5073 O OG1 . THR D 2 5   ? -53.087 55.011 -186.409 1.00 67.04  ? 5   THR N OG1 1 
ATOM   5074 C CG2 . THR D 2 5   ? -55.114 53.932 -187.108 1.00 55.20  ? 5   THR N CG2 1 
ATOM   5075 N N   . GLN D 2 6   ? -54.040 50.745 -187.855 1.00 61.47  ? 6   GLN N N   1 
ATOM   5076 C CA  . GLN D 2 6   ? -54.743 49.764 -188.664 1.00 59.69  ? 6   GLN N CA  1 
ATOM   5077 C C   . GLN D 2 6   ? -56.232 49.887 -188.455 1.00 62.51  ? 6   GLN N C   1 
ATOM   5078 O O   . GLN D 2 6   ? -56.696 50.310 -187.400 1.00 66.68  ? 6   GLN N O   1 
ATOM   5079 C CB  . GLN D 2 6   ? -54.315 48.343 -188.295 1.00 55.66  ? 6   GLN N CB  1 
ATOM   5080 C CG  . GLN D 2 6   ? -52.848 48.115 -188.432 1.00 53.49  ? 6   GLN N CG  1 
ATOM   5081 C CD  . GLN D 2 6   ? -52.432 46.723 -188.047 1.00 55.35  ? 6   GLN N CD  1 
ATOM   5082 O OE1 . GLN D 2 6   ? -51.336 46.529 -187.521 1.00 59.60  ? 6   GLN N OE1 1 
ATOM   5083 N NE2 . GLN D 2 6   ? -53.291 45.735 -188.322 1.00 47.17  ? 6   GLN N NE2 1 
ATOM   5084 N N   . SER D 2 7   ? -56.983 49.504 -189.472 1.00 62.70  ? 7   SER N N   1 
ATOM   5085 C CA  . SER D 2 7   ? -58.417 49.392 -189.328 1.00 63.69  ? 7   SER N CA  1 
ATOM   5086 C C   . SER D 2 7   ? -58.910 48.434 -190.387 1.00 59.42  ? 7   SER N C   1 
ATOM   5087 O O   . SER D 2 7   ? -58.368 48.379 -191.487 1.00 60.08  ? 7   SER N O   1 
ATOM   5088 C CB  . SER D 2 7   ? -59.079 50.747 -189.500 1.00 64.36  ? 7   SER N CB  1 
ATOM   5089 O OG  . SER D 2 7   ? -58.836 51.195 -190.809 1.00 67.35  ? 7   SER N OG  1 
ATOM   5090 N N   . PRO D 2 8   ? -59.944 47.670 -190.049 1.00 57.87  ? 8   PRO N N   1 
ATOM   5091 C CA  . PRO D 2 8   ? -60.589 47.773 -188.732 1.00 58.27  ? 8   PRO N CA  1 
ATOM   5092 C C   . PRO D 2 8   ? -59.802 47.005 -187.674 1.00 55.57  ? 8   PRO N C   1 
ATOM   5093 O O   . PRO D 2 8   ? -58.750 46.461 -187.983 1.00 57.89  ? 8   PRO N O   1 
ATOM   5094 C CB  . PRO D 2 8   ? -61.935 47.087 -188.975 1.00 56.53  ? 8   PRO N CB  1 
ATOM   5095 C CG  . PRO D 2 8   ? -61.607 46.070 -190.042 1.00 53.12  ? 8   PRO N CG  1 
ATOM   5096 C CD  . PRO D 2 8   ? -60.698 46.802 -190.967 1.00 50.65  ? 8   PRO N CD  1 
ATOM   5097 N N   . ASP D 2 9   ? -60.305 46.948 -186.448 1.00 68.86  ? 9   ASP N N   1 
ATOM   5098 C CA  . ASP D 2 9   ? -59.657 46.149 -185.409 1.00 69.08  ? 9   ASP N CA  1 
ATOM   5099 C C   . ASP D 2 9   ? -59.972 44.673 -185.579 1.00 69.59  ? 9   ASP N C   1 
ATOM   5100 O O   . ASP D 2 9   ? -59.121 43.814 -185.359 1.00 71.73  ? 9   ASP N O   1 
ATOM   5101 C CB  . ASP D 2 9   ? -60.109 46.599 -184.028 1.00 72.65  ? 9   ASP N CB  1 
ATOM   5102 C CG  . ASP D 2 9   ? -59.734 48.032 -183.735 1.00 84.95  ? 9   ASP N CG  1 
ATOM   5103 O OD1 . ASP D 2 9   ? -60.598 48.765 -183.209 1.00 91.71  ? 9   ASP N OD1 1 
ATOM   5104 O OD2 . ASP D 2 9   ? -58.582 48.424 -184.034 1.00 84.54  ? 9   ASP N OD2 1 
ATOM   5105 N N   . SER D 2 10  ? -61.212 44.384 -185.948 1.00 65.98  ? 10  SER N N   1 
ATOM   5106 C CA  . SER D 2 10  ? -61.633 43.017 -186.185 1.00 60.13  ? 10  SER N CA  1 
ATOM   5107 C C   . SER D 2 10  ? -62.314 42.991 -187.521 1.00 62.86  ? 10  SER N C   1 
ATOM   5108 O O   . SER D 2 10  ? -62.732 44.020 -188.044 1.00 70.49  ? 10  SER N O   1 
ATOM   5109 C CB  . SER D 2 10  ? -62.616 42.545 -185.125 1.00 55.55  ? 10  SER N CB  1 
ATOM   5110 O OG  . SER D 2 10  ? -62.531 43.363 -183.977 1.00 70.92  ? 10  SER N OG  1 
ATOM   5111 N N   . LEU D 2 11  ? -62.455 41.798 -188.060 1.00 56.07  ? 11  LEU N N   1 
ATOM   5112 C CA  . LEU D 2 11  ? -63.000 41.649 -189.378 1.00 56.43  ? 11  LEU N CA  1 
ATOM   5113 C C   . LEU D 2 11  ? -63.413 40.206 -189.521 1.00 58.32  ? 11  LEU N C   1 
ATOM   5114 O O   . LEU D 2 11  ? -62.634 39.286 -189.246 1.00 59.06  ? 11  LEU N O   1 
ATOM   5115 C CB  . LEU D 2 11  ? -61.927 42.009 -190.388 1.00 61.11  ? 11  LEU N CB  1 
ATOM   5116 C CG  . LEU D 2 11  ? -62.066 41.471 -191.794 1.00 68.60  ? 11  LEU N CG  1 
ATOM   5117 C CD1 . LEU D 2 11  ? -63.347 42.007 -192.390 1.00 77.76  ? 11  LEU N CD1 1 
ATOM   5118 C CD2 . LEU D 2 11  ? -60.860 41.932 -192.575 1.00 70.28  ? 11  LEU N CD2 1 
ATOM   5119 N N   . ALA D 2 12  ? -64.655 39.999 -189.919 1.00 55.66  ? 12  ALA N N   1 
ATOM   5120 C CA  . ALA D 2 12  ? -65.137 38.650 -190.098 1.00 50.75  ? 12  ALA N CA  1 
ATOM   5121 C C   . ALA D 2 12  ? -65.617 38.477 -191.523 1.00 57.69  ? 12  ALA N C   1 
ATOM   5122 O O   . ALA D 2 12  ? -66.415 39.265 -192.038 1.00 61.32  ? 12  ALA N O   1 
ATOM   5123 C CB  . ALA D 2 12  ? -66.237 38.342 -189.114 1.00 52.02  ? 12  ALA N CB  1 
ATOM   5124 N N   . VAL D 2 13  ? -65.127 37.427 -192.158 1.00 56.96  ? 13  VAL N N   1 
ATOM   5125 C CA  . VAL D 2 13  ? -65.405 37.200 -193.558 1.00 61.13  ? 13  VAL N CA  1 
ATOM   5126 C C   . VAL D 2 13  ? -65.755 35.737 -193.832 1.00 58.90  ? 13  VAL N C   1 
ATOM   5127 O O   . VAL D 2 13  ? -65.134 34.838 -193.267 1.00 59.37  ? 13  VAL N O   1 
ATOM   5128 C CB  . VAL D 2 13  ? -64.195 37.652 -194.380 1.00 57.23  ? 13  VAL N CB  1 
ATOM   5129 C CG1 . VAL D 2 13  ? -64.050 36.821 -195.623 1.00 62.97  ? 13  VAL N CG1 1 
ATOM   5130 C CG2 . VAL D 2 13  ? -64.342 39.113 -194.720 1.00 56.02  ? 13  VAL N CG2 1 
ATOM   5131 N N   . SER D 2 14  ? -66.747 35.495 -194.688 1.00 55.92  ? 14  SER N N   1 
ATOM   5132 C CA  . SER D 2 14  ? -67.118 34.119 -195.030 1.00 57.62  ? 14  SER N CA  1 
ATOM   5133 C C   . SER D 2 14  ? -65.983 33.446 -195.761 1.00 56.47  ? 14  SER N C   1 
ATOM   5134 O O   . SER D 2 14  ? -65.162 34.113 -196.379 1.00 49.18  ? 14  SER N O   1 
ATOM   5135 C CB  . SER D 2 14  ? -68.373 34.063 -195.891 1.00 61.94  ? 14  SER N CB  1 
ATOM   5136 O OG  . SER D 2 14  ? -69.483 34.583 -195.191 1.00 70.64  ? 14  SER N OG  1 
ATOM   5137 N N   . LEU D 2 15  ? -65.943 32.121 -195.686 1.00 55.49  ? 15  LEU N N   1 
ATOM   5138 C CA  . LEU D 2 15  ? -64.873 31.354 -196.304 1.00 56.29  ? 15  LEU N CA  1 
ATOM   5139 C C   . LEU D 2 15  ? -64.795 31.683 -197.777 1.00 58.52  ? 15  LEU N C   1 
ATOM   5140 O O   . LEU D 2 15  ? -65.793 31.626 -198.480 1.00 66.96  ? 15  LEU N O   1 
ATOM   5141 C CB  . LEU D 2 15  ? -65.126 29.860 -196.122 1.00 61.28  ? 15  LEU N CB  1 
ATOM   5142 C CG  . LEU D 2 15  ? -63.962 28.907 -196.393 1.00 66.21  ? 15  LEU N CG  1 
ATOM   5143 C CD1 . LEU D 2 15  ? -62.746 29.288 -195.566 1.00 67.04  ? 15  LEU N CD1 1 
ATOM   5144 C CD2 . LEU D 2 15  ? -64.379 27.470 -196.089 1.00 66.14  ? 15  LEU N CD2 1 
ATOM   5145 N N   . GLY D 2 16  ? -63.613 32.049 -198.251 1.00 58.11  ? 16  GLY N N   1 
ATOM   5146 C CA  . GLY D 2 16  ? -63.434 32.281 -199.668 1.00 54.13  ? 16  GLY N CA  1 
ATOM   5147 C C   . GLY D 2 16  ? -63.762 33.698 -200.079 1.00 60.68  ? 16  GLY N C   1 
ATOM   5148 O O   . GLY D 2 16  ? -63.388 34.112 -201.167 1.00 66.44  ? 16  GLY N O   1 
ATOM   5149 N N   . GLU D 2 17  ? -64.463 34.445 -199.231 1.00 59.99  ? 17  GLU N N   1 
ATOM   5150 C CA  . GLU D 2 17  ? -64.678 35.861 -199.503 1.00 63.92  ? 17  GLU N CA  1 
ATOM   5151 C C   . GLU D 2 17  ? -63.351 36.608 -199.354 1.00 60.89  ? 17  GLU N C   1 
ATOM   5152 O O   . GLU D 2 17  ? -62.370 36.054 -198.877 1.00 59.47  ? 17  GLU N O   1 
ATOM   5153 C CB  . GLU D 2 17  ? -65.745 36.463 -198.582 1.00 76.91  ? 17  GLU N CB  1 
ATOM   5154 C CG  . GLU D 2 17  ? -67.193 36.261 -199.038 1.00 90.95  ? 17  GLU N CG  1 
ATOM   5155 C CD  . GLU D 2 17  ? -68.214 36.758 -198.004 1.00 102.61 ? 17  GLU N CD  1 
ATOM   5156 O OE1 . GLU D 2 17  ? -67.797 37.344 -196.974 1.00 100.97 ? 17  GLU N OE1 1 
ATOM   5157 O OE2 . GLU D 2 17  ? -69.435 36.561 -198.220 1.00 106.46 ? 17  GLU N OE2 1 
ATOM   5158 N N   . ARG D 2 18  ? -63.327 37.865 -199.774 1.00 60.23  ? 18  ARG N N   1 
ATOM   5159 C CA  . ARG D 2 18  ? -62.115 38.656 -199.767 1.00 51.76  ? 18  ARG N CA  1 
ATOM   5160 C C   . ARG D 2 18  ? -61.988 39.368 -198.425 1.00 58.16  ? 18  ARG N C   1 
ATOM   5161 O O   . ARG D 2 18  ? -62.990 39.735 -197.814 1.00 62.74  ? 18  ARG N O   1 
ATOM   5162 C CB  . ARG D 2 18  ? -62.157 39.689 -200.900 1.00 49.56  ? 18  ARG N CB  1 
ATOM   5163 C CG  . ARG D 2 18  ? -60.845 40.441 -201.090 1.00 66.47  ? 18  ARG N CG  1 
ATOM   5164 C CD  . ARG D 2 18  ? -61.029 41.928 -201.409 1.00 78.28  ? 18  ARG N CD  1 
ATOM   5165 N NE  . ARG D 2 18  ? -62.114 42.149 -202.346 1.00 92.55  ? 18  ARG N NE  1 
ATOM   5166 C CZ  . ARG D 2 18  ? -62.088 41.747 -203.609 1.00 104.07 ? 18  ARG N CZ  1 
ATOM   5167 N NH1 . ARG D 2 18  ? -63.133 41.975 -204.403 1.00 109.18 ? 18  ARG N NH1 1 
ATOM   5168 N NH2 . ARG D 2 18  ? -61.019 41.106 -204.071 1.00 102.40 ? 18  ARG N NH2 1 
ATOM   5169 N N   . ALA D 2 19  ? -60.755 39.562 -197.969 1.00 56.46  ? 19  ALA N N   1 
ATOM   5170 C CA  . ALA D 2 19  ? -60.516 40.288 -196.732 1.00 52.49  ? 19  ALA N CA  1 
ATOM   5171 C C   . ALA D 2 19  ? -59.527 41.407 -196.973 1.00 52.15  ? 19  ALA N C   1 
ATOM   5172 O O   . ALA D 2 19  ? -58.501 41.203 -197.614 1.00 59.11  ? 19  ALA N O   1 
ATOM   5173 C CB  . ALA D 2 19  ? -60.003 39.361 -195.680 1.00 44.77  ? 19  ALA N CB  1 
ATOM   5174 N N   . THR D 2 20  ? -59.835 42.593 -196.468 1.00 47.58  ? 20  THR N N   1 
ATOM   5175 C CA  . THR D 2 20  ? -58.948 43.726 -196.667 1.00 56.78  ? 20  THR N CA  1 
ATOM   5176 C C   . THR D 2 20  ? -58.754 44.459 -195.372 1.00 58.51  ? 20  THR N C   1 
ATOM   5177 O O   . THR D 2 20  ? -59.692 44.613 -194.589 1.00 64.70  ? 20  THR N O   1 
ATOM   5178 C CB  . THR D 2 20  ? -59.449 44.721 -197.741 1.00 64.80  ? 20  THR N CB  1 
ATOM   5179 O OG1 . THR D 2 20  ? -60.840 44.990 -197.541 1.00 76.91  ? 20  THR N OG1 1 
ATOM   5180 C CG2 . THR D 2 20  ? -59.239 44.154 -199.142 1.00 65.14  ? 20  THR N CG2 1 
ATOM   5181 N N   . ILE D 2 21  ? -57.519 44.901 -195.168 1.00 54.14  ? 21  ILE N N   1 
ATOM   5182 C CA  . ILE D 2 21  ? -57.096 45.551 -193.947 1.00 52.55  ? 21  ILE N CA  1 
ATOM   5183 C C   . ILE D 2 21  ? -56.262 46.741 -194.329 1.00 53.12  ? 21  ILE N C   1 
ATOM   5184 O O   . ILE D 2 21  ? -55.441 46.650 -195.236 1.00 54.87  ? 21  ILE N O   1 
ATOM   5185 C CB  . ILE D 2 21  ? -56.190 44.627 -193.141 1.00 51.07  ? 21  ILE N CB  1 
ATOM   5186 C CG1 . ILE D 2 21  ? -56.916 43.322 -192.821 1.00 49.41  ? 21  ILE N CG1 1 
ATOM   5187 C CG2 . ILE D 2 21  ? -55.696 45.338 -191.886 1.00 52.54  ? 21  ILE N CG2 1 
ATOM   5188 C CD1 . ILE D 2 21  ? -56.085 42.393 -191.985 1.00 59.19  ? 21  ILE N CD1 1 
ATOM   5189 N N   . ASN D 2 22  ? -56.445 47.850 -193.625 1.00 58.34  ? 22  ASN N N   1 
ATOM   5190 C CA  . ASN D 2 22  ? -55.693 49.056 -193.934 1.00 66.67  ? 22  ASN N CA  1 
ATOM   5191 C C   . ASN D 2 22  ? -54.676 49.434 -192.864 1.00 67.47  ? 22  ASN N C   1 
ATOM   5192 O O   . ASN D 2 22  ? -54.846 49.128 -191.688 1.00 66.27  ? 22  ASN N O   1 
ATOM   5193 C CB  . ASN D 2 22  ? -56.654 50.213 -194.201 1.00 79.34  ? 22  ASN N CB  1 
ATOM   5194 C CG  . ASN D 2 22  ? -57.802 49.807 -195.112 1.00 88.31  ? 22  ASN N CG  1 
ATOM   5195 O OD1 . ASN D 2 22  ? -57.477 49.430 -196.348 1.00 95.13  ? 22  ASN N OD1 1 
ATOM   5196 N ND2 . ASN D 2 22  ? -58.965 49.812 -194.704 1.00 82.02  ? 22  ASN N ND2 1 
ATOM   5197 N N   . CYS D 2 23  ? -53.610 50.090 -193.307 1.00 66.85  ? 23  CYS N N   1 
ATOM   5198 C CA  . CYS D 2 23  ? -52.573 50.621 -192.441 1.00 62.60  ? 23  CYS N CA  1 
ATOM   5199 C C   . CYS D 2 23  ? -52.376 52.059 -192.848 1.00 67.70  ? 23  CYS N C   1 
ATOM   5200 O O   . CYS D 2 23  ? -52.280 52.363 -194.035 1.00 70.51  ? 23  CYS N O   1 
ATOM   5201 C CB  . CYS D 2 23  ? -51.256 49.886 -192.675 1.00 58.25  ? 23  CYS N CB  1 
ATOM   5202 S SG  . CYS D 2 23  ? -50.007 50.154 -191.401 1.00 95.78  ? 23  CYS N SG  1 
ATOM   5203 N N   . LYS D 2 24  ? -52.310 52.954 -191.878 1.00 67.71  ? 24  LYS N N   1 
ATOM   5204 C CA  . LYS D 2 24  ? -52.025 54.331 -192.200 1.00 66.88  ? 24  LYS N CA  1 
ATOM   5205 C C   . LYS D 2 24  ? -50.841 54.802 -191.357 1.00 70.11  ? 24  LYS N C   1 
ATOM   5206 O O   . LYS D 2 24  ? -50.818 54.611 -190.141 1.00 70.18  ? 24  LYS N O   1 
ATOM   5207 C CB  . LYS D 2 24  ? -53.264 55.189 -191.962 1.00 74.74  ? 24  LYS N CB  1 
ATOM   5208 C CG  . LYS D 2 24  ? -53.388 56.366 -192.906 1.00 88.03  ? 24  LYS N CG  1 
ATOM   5209 C CD  . LYS D 2 24  ? -54.622 57.201 -192.597 1.00 100.04 ? 24  LYS N CD  1 
ATOM   5210 C CE  . LYS D 2 24  ? -54.595 57.738 -191.166 1.00 104.39 ? 24  LYS N CE  1 
ATOM   5211 N NZ  . LYS D 2 24  ? -55.733 58.663 -190.884 1.00 107.62 ? 24  LYS N NZ  1 
ATOM   5212 N N   . SER D 2 25  ? -49.844 55.389 -192.012 1.00 71.38  ? 25  SER N N   1 
ATOM   5213 C CA  . SER D 2 25  ? -48.699 55.951 -191.304 1.00 75.78  ? 25  SER N CA  1 
ATOM   5214 C C   . SER D 2 25  ? -48.851 57.455 -191.182 1.00 78.46  ? 25  SER N C   1 
ATOM   5215 O O   . SER D 2 25  ? -49.271 58.125 -192.126 1.00 80.42  ? 25  SER N O   1 
ATOM   5216 C CB  . SER D 2 25  ? -47.392 55.620 -192.019 1.00 79.12  ? 25  SER N CB  1 
ATOM   5217 O OG  . SER D 2 25  ? -47.445 56.031 -193.374 1.00 84.69  ? 25  SER N OG  1 
ATOM   5218 N N   . SER D 2 26  ? -48.504 57.978 -190.013 1.00 61.45  ? 26  SER N N   1 
ATOM   5219 C CA  . SER D 2 26  ? -48.602 59.404 -189.731 1.00 67.12  ? 26  SER N CA  1 
ATOM   5220 C C   . SER D 2 26  ? -47.678 60.213 -190.623 1.00 75.11  ? 26  SER N C   1 
ATOM   5221 O O   . SER D 2 26  ? -47.759 61.433 -190.660 1.00 86.31  ? 26  SER N O   1 
ATOM   5222 C CB  . SER D 2 26  ? -48.234 59.664 -188.271 1.00 71.06  ? 26  SER N CB  1 
ATOM   5223 O OG  . SER D 2 26  ? -46.881 59.321 -188.023 1.00 72.43  ? 26  SER N OG  1 
ATOM   5224 N N   . GLN D 2 27  ? -46.780 59.529 -191.319 1.00 72.78  ? 27  GLN N N   1 
ATOM   5225 C CA  . GLN D 2 27  ? -45.862 60.172 -192.239 1.00 72.65  ? 27  GLN N CA  1 
ATOM   5226 C C   . GLN D 2 27  ? -45.403 59.176 -193.283 1.00 74.78  ? 27  GLN N C   1 
ATOM   5227 O O   . GLN D 2 27  ? -45.379 57.979 -193.029 1.00 80.13  ? 27  GLN N O   1 
ATOM   5228 C CB  . GLN D 2 27  ? -44.663 60.729 -191.486 1.00 79.37  ? 27  GLN N CB  1 
ATOM   5229 C CG  . GLN D 2 27  ? -44.967 62.027 -190.775 1.00 92.04  ? 27  GLN N CG  1 
ATOM   5230 C CD  . GLN D 2 27  ? -44.355 62.074 -189.402 1.00 105.46 ? 27  GLN N CD  1 
ATOM   5231 O OE1 . GLN D 2 27  ? -43.128 62.117 -189.255 1.00 110.48 ? 27  GLN N OE1 1 
ATOM   5232 N NE2 . GLN D 2 27  ? -45.206 62.057 -188.377 1.00 106.98 ? 27  GLN N NE2 1 
ATOM   5233 N N   . SER D 2 28  A -45.041 59.672 -194.461 1.00 74.86  ? 27  SER N N   1 
ATOM   5234 C CA  . SER D 2 28  A -44.624 58.804 -195.550 1.00 70.51  ? 27  SER N CA  1 
ATOM   5235 C C   . SER D 2 28  A -43.423 57.956 -195.174 1.00 71.23  ? 27  SER N C   1 
ATOM   5236 O O   . SER D 2 28  A -42.470 58.433 -194.557 1.00 72.76  ? 27  SER N O   1 
ATOM   5237 C CB  . SER D 2 28  A -44.306 59.609 -196.808 1.00 71.17  ? 27  SER N CB  1 
ATOM   5238 O OG  . SER D 2 28  A -43.908 58.755 -197.874 1.00 69.74  ? 27  SER N OG  1 
ATOM   5239 N N   . VAL D 2 29  B -43.490 56.689 -195.560 1.00 68.85  ? 27  VAL N N   1 
ATOM   5240 C CA  . VAL D 2 29  B -42.410 55.744 -195.352 1.00 65.86  ? 27  VAL N CA  1 
ATOM   5241 C C   . VAL D 2 29  B -41.841 55.409 -196.724 1.00 67.89  ? 27  VAL N C   1 
ATOM   5242 O O   . VAL D 2 29  B -41.110 54.437 -196.890 1.00 72.21  ? 27  VAL N O   1 
ATOM   5243 C CB  . VAL D 2 29  B -42.919 54.457 -194.642 1.00 59.95  ? 27  VAL N CB  1 
ATOM   5244 C CG1 . VAL D 2 29  B -43.604 54.802 -193.334 1.00 49.83  ? 27  VAL N CG1 1 
ATOM   5245 C CG2 . VAL D 2 29  B -43.880 53.685 -195.538 1.00 57.55  ? 27  VAL N CG2 1 
ATOM   5246 N N   . LEU D 2 30  C -42.208 56.224 -197.709 1.00 71.03  ? 27  LEU N N   1 
ATOM   5247 C CA  . LEU D 2 30  C -41.659 56.139 -199.060 1.00 74.09  ? 27  LEU N CA  1 
ATOM   5248 C C   . LEU D 2 30  C -40.272 56.773 -199.143 1.00 78.03  ? 27  LEU N C   1 
ATOM   5249 O O   . LEU D 2 30  C -40.089 57.959 -198.851 1.00 75.78  ? 27  LEU N O   1 
ATOM   5250 C CB  . LEU D 2 30  C -42.585 56.838 -200.047 1.00 78.15  ? 27  LEU N CB  1 
ATOM   5251 C CG  . LEU D 2 30  C -42.069 56.913 -201.482 1.00 83.05  ? 27  LEU N CG  1 
ATOM   5252 C CD1 . LEU D 2 30  C -41.569 55.560 -201.959 1.00 85.44  ? 27  LEU N CD1 1 
ATOM   5253 C CD2 . LEU D 2 30  C -43.165 57.424 -202.386 1.00 81.76  ? 27  LEU N CD2 1 
ATOM   5254 N N   . TYR D 2 31  D -39.301 55.967 -199.551 1.00 79.43  ? 27  TYR N N   1 
ATOM   5255 C CA  . TYR D 2 31  D -37.910 56.385 -199.599 1.00 82.96  ? 27  TYR N CA  1 
ATOM   5256 C C   . TYR D 2 31  D -37.577 56.932 -200.986 1.00 89.35  ? 27  TYR N C   1 
ATOM   5257 O O   . TYR D 2 31  D -37.731 56.232 -201.988 1.00 91.95  ? 27  TYR N O   1 
ATOM   5258 C CB  . TYR D 2 31  D -37.032 55.179 -199.281 1.00 78.18  ? 27  TYR N CB  1 
ATOM   5259 C CG  . TYR D 2 31  D -35.597 55.486 -198.916 1.00 86.36  ? 27  TYR N CG  1 
ATOM   5260 C CD1 . TYR D 2 31  D -35.287 56.369 -197.888 1.00 92.17  ? 27  TYR N CD1 1 
ATOM   5261 C CD2 . TYR D 2 31  D -34.548 54.854 -199.572 1.00 85.60  ? 27  TYR N CD2 1 
ATOM   5262 C CE1 . TYR D 2 31  D -33.960 56.631 -197.542 1.00 91.29  ? 27  TYR N CE1 1 
ATOM   5263 C CE2 . TYR D 2 31  D -33.229 55.107 -199.235 1.00 86.02  ? 27  TYR N CE2 1 
ATOM   5264 C CZ  . TYR D 2 31  D -32.938 55.993 -198.221 1.00 86.87  ? 27  TYR N CZ  1 
ATOM   5265 O OH  . TYR D 2 31  D -31.619 56.235 -197.893 1.00 82.58  ? 27  TYR N OH  1 
ATOM   5266 N N   . SER D 2 32  E -37.134 58.182 -201.056 1.00 91.64  ? 27  SER N N   1 
ATOM   5267 C CA  . SER D 2 32  E -36.713 58.742 -202.337 1.00 92.52  ? 27  SER N CA  1 
ATOM   5268 C C   . SER D 2 32  E -35.377 58.106 -202.718 1.00 96.29  ? 27  SER N C   1 
ATOM   5269 O O   . SER D 2 32  E -34.448 58.082 -201.914 1.00 100.06 ? 27  SER N O   1 
ATOM   5270 C CB  . SER D 2 32  E -36.588 60.254 -202.245 1.00 93.43  ? 27  SER N CB  1 
ATOM   5271 O OG  . SER D 2 32  E -35.536 60.612 -201.368 1.00 100.19 ? 27  SER N OG  1 
ATOM   5272 N N   . SER D 2 33  F -35.291 57.610 -203.948 1.00 93.55  ? 27  SER N N   1 
ATOM   5273 C CA  . SER D 2 33  F -34.250 56.668 -204.368 1.00 87.96  ? 27  SER N CA  1 
ATOM   5274 C C   . SER D 2 33  F -34.777 55.292 -204.034 1.00 90.82  ? 27  SER N C   1 
ATOM   5275 O O   . SER D 2 33  F -35.545 55.142 -203.091 1.00 89.03  ? 27  SER N O   1 
ATOM   5276 C CB  . SER D 2 33  F -32.916 56.909 -203.673 1.00 78.18  ? 27  SER N CB  1 
ATOM   5277 O OG  . SER D 2 33  F -32.886 56.290 -202.408 1.00 74.24  ? 27  SER N OG  1 
ATOM   5278 N N   . ASN D 2 34  ? -34.367 54.293 -204.808 1.00 92.15  ? 28  ASN N N   1 
ATOM   5279 C CA  . ASN D 2 34  ? -35.055 52.999 -204.845 1.00 83.42  ? 28  ASN N CA  1 
ATOM   5280 C C   . ASN D 2 34  ? -36.579 53.078 -205.033 1.00 77.05  ? 28  ASN N C   1 
ATOM   5281 O O   . ASN D 2 34  ? -37.175 52.164 -205.596 1.00 82.06  ? 28  ASN N O   1 
ATOM   5282 C CB  . ASN D 2 34  ? -34.645 52.071 -203.677 1.00 83.52  ? 28  ASN N CB  1 
ATOM   5283 C CG  . ASN D 2 34  ? -35.348 52.397 -202.349 1.00 80.72  ? 28  ASN N CG  1 
ATOM   5284 O OD1 . ASN D 2 34  ? -36.472 52.902 -202.312 1.00 77.12  ? 28  ASN N OD1 1 
ATOM   5285 N ND2 . ASN D 2 34  ? -34.678 52.073 -201.247 1.00 76.97  ? 28  ASN N ND2 1 
ATOM   5286 N N   . ASN D 2 35  ? -37.198 54.169 -204.579 1.00 71.20  ? 29  ASN N N   1 
ATOM   5287 C CA  . ASN D 2 35  ? -38.651 54.365 -204.689 1.00 76.99  ? 29  ASN N CA  1 
ATOM   5288 C C   . ASN D 2 35  ? -39.527 53.283 -204.015 1.00 78.06  ? 29  ASN N C   1 
ATOM   5289 O O   . ASN D 2 35  ? -40.613 52.945 -204.500 1.00 74.02  ? 29  ASN N O   1 
ATOM   5290 C CB  . ASN D 2 35  ? -39.062 54.539 -206.153 1.00 86.29  ? 29  ASN N CB  1 
ATOM   5291 C CG  . ASN D 2 35  ? -40.424 55.171 -206.295 1.00 95.14  ? 29  ASN N CG  1 
ATOM   5292 O OD1 . ASN D 2 35  ? -40.637 56.313 -205.879 1.00 98.44  ? 29  ASN N OD1 1 
ATOM   5293 N ND2 . ASN D 2 35  ? -41.364 54.432 -206.875 1.00 96.28  ? 29  ASN N ND2 1 
ATOM   5294 N N   . LYS D 2 36  ? -39.047 52.759 -202.890 1.00 78.90  ? 30  LYS N N   1 
ATOM   5295 C CA  . LYS D 2 36  ? -39.742 51.721 -202.143 1.00 76.24  ? 30  LYS N CA  1 
ATOM   5296 C C   . LYS D 2 36  ? -40.389 52.315 -200.906 1.00 76.30  ? 30  LYS N C   1 
ATOM   5297 O O   . LYS D 2 36  ? -39.801 53.165 -200.239 1.00 82.49  ? 30  LYS N O   1 
ATOM   5298 C CB  . LYS D 2 36  ? -38.757 50.630 -201.704 1.00 72.98  ? 30  LYS N CB  1 
ATOM   5299 C CG  . LYS D 2 36  ? -38.058 49.897 -202.846 1.00 76.72  ? 30  LYS N CG  1 
ATOM   5300 C CD  . LYS D 2 36  ? -39.063 49.206 -203.744 1.00 80.86  ? 30  LYS N CD  1 
ATOM   5301 C CE  . LYS D 2 36  ? -38.384 48.252 -204.697 1.00 85.97  ? 30  LYS N CE  1 
ATOM   5302 N NZ  . LYS D 2 36  ? -39.397 47.536 -205.523 1.00 91.28  ? 30  LYS N NZ  1 
ATOM   5303 N N   . SER D 2 37  ? -41.601 51.872 -200.597 1.00 71.69  ? 31  SER N N   1 
ATOM   5304 C CA  . SER D 2 37  ? -42.208 52.210 -199.319 1.00 68.11  ? 31  SER N CA  1 
ATOM   5305 C C   . SER D 2 37  ? -41.777 51.143 -198.303 1.00 69.70  ? 31  SER N C   1 
ATOM   5306 O O   . SER D 2 37  ? -41.970 49.946 -198.530 1.00 71.40  ? 31  SER N O   1 
ATOM   5307 C CB  . SER D 2 37  ? -43.724 52.275 -199.446 1.00 60.24  ? 31  SER N CB  1 
ATOM   5308 O OG  . SER D 2 37  ? -44.087 52.822 -200.700 1.00 66.93  ? 31  SER N OG  1 
ATOM   5309 N N   . TYR D 2 38  ? -41.170 51.578 -197.201 1.00 59.72  ? 32  TYR N N   1 
ATOM   5310 C CA  . TYR D 2 38  ? -40.632 50.658 -196.207 1.00 57.12  ? 32  TYR N CA  1 
ATOM   5311 C C   . TYR D 2 38  ? -41.699 50.171 -195.243 1.00 58.72  ? 32  TYR N C   1 
ATOM   5312 O O   . TYR D 2 38  ? -41.813 50.637 -194.114 1.00 62.38  ? 32  TYR N O   1 
ATOM   5313 C CB  . TYR D 2 38  ? -39.466 51.306 -195.463 1.00 63.07  ? 32  TYR N CB  1 
ATOM   5314 C CG  . TYR D 2 38  ? -38.199 51.251 -196.273 1.00 64.38  ? 32  TYR N CG  1 
ATOM   5315 C CD1 . TYR D 2 38  ? -38.164 51.754 -197.579 1.00 63.41  ? 32  TYR N CD1 1 
ATOM   5316 C CD2 . TYR D 2 38  ? -37.044 50.682 -195.752 1.00 60.15  ? 32  TYR N CD2 1 
ATOM   5317 C CE1 . TYR D 2 38  ? -37.008 51.694 -198.338 1.00 59.43  ? 32  TYR N CE1 1 
ATOM   5318 C CE2 . TYR D 2 38  ? -35.887 50.625 -196.501 1.00 67.30  ? 32  TYR N CE2 1 
ATOM   5319 C CZ  . TYR D 2 38  ? -35.879 51.132 -197.791 1.00 62.94  ? 32  TYR N CZ  1 
ATOM   5320 O OH  . TYR D 2 38  ? -34.734 51.060 -198.522 1.00 60.86  ? 32  TYR N OH  1 
ATOM   5321 N N   . LEU D 2 39  ? -42.476 49.205 -195.697 1.00 62.40  ? 33  LEU N N   1 
ATOM   5322 C CA  . LEU D 2 39  ? -43.649 48.792 -194.957 1.00 61.18  ? 33  LEU N CA  1 
ATOM   5323 C C   . LEU D 2 39  ? -43.855 47.292 -195.076 1.00 59.41  ? 33  LEU N C   1 
ATOM   5324 O O   . LEU D 2 39  ? -43.836 46.740 -196.181 1.00 62.83  ? 33  LEU N O   1 
ATOM   5325 C CB  . LEU D 2 39  ? -44.871 49.537 -195.485 1.00 53.97  ? 33  LEU N CB  1 
ATOM   5326 C CG  . LEU D 2 39  ? -46.067 49.168 -194.630 1.00 52.85  ? 33  LEU N CG  1 
ATOM   5327 C CD1 . LEU D 2 39  ? -46.639 50.391 -194.001 1.00 54.06  ? 33  LEU N CD1 1 
ATOM   5328 C CD2 . LEU D 2 39  ? -47.090 48.418 -195.435 1.00 52.26  ? 33  LEU N CD2 1 
ATOM   5329 N N   . ALA D 2 40  ? -44.045 46.629 -193.941 1.00 50.81  ? 34  ALA N N   1 
ATOM   5330 C CA  . ALA D 2 40  ? -44.240 45.178 -193.949 1.00 51.56  ? 34  ALA N CA  1 
ATOM   5331 C C   . ALA D 2 40  ? -45.560 44.762 -193.320 1.00 48.63  ? 34  ALA N C   1 
ATOM   5332 O O   . ALA D 2 40  ? -46.109 45.487 -192.477 1.00 47.61  ? 34  ALA N O   1 
ATOM   5333 C CB  . ALA D 2 40  ? -43.079 44.470 -193.259 1.00 35.85  ? 34  ALA N CB  1 
ATOM   5334 N N   . TRP D 2 41  ? -46.061 43.600 -193.741 1.00 43.68  ? 35  TRP N N   1 
ATOM   5335 C CA  . TRP D 2 41  ? -47.185 42.953 -193.062 1.00 45.93  ? 35  TRP N CA  1 
ATOM   5336 C C   . TRP D 2 41  ? -46.765 41.620 -192.474 1.00 46.77  ? 35  TRP N C   1 
ATOM   5337 O O   . TRP D 2 41  ? -46.065 40.852 -193.117 1.00 53.00  ? 35  TRP N O   1 
ATOM   5338 C CB  . TRP D 2 41  ? -48.364 42.713 -193.997 1.00 38.62  ? 35  TRP N CB  1 
ATOM   5339 C CG  . TRP D 2 41  ? -49.030 43.945 -194.477 1.00 51.37  ? 35  TRP N CG  1 
ATOM   5340 C CD1 . TRP D 2 41  ? -48.745 44.630 -195.625 1.00 55.65  ? 35  TRP N CD1 1 
ATOM   5341 C CD2 . TRP D 2 41  ? -50.111 44.647 -193.849 1.00 51.93  ? 35  TRP N CD2 1 
ATOM   5342 N NE1 . TRP D 2 41  ? -49.578 45.714 -195.748 1.00 57.10  ? 35  TRP N NE1 1 
ATOM   5343 C CE2 . TRP D 2 41  ? -50.427 45.750 -194.673 1.00 56.54  ? 35  TRP N CE2 1 
ATOM   5344 C CE3 . TRP D 2 41  ? -50.838 44.456 -192.674 1.00 47.38  ? 35  TRP N CE3 1 
ATOM   5345 C CZ2 . TRP D 2 41  ? -51.430 46.662 -194.353 1.00 52.81  ? 35  TRP N CZ2 1 
ATOM   5346 C CZ3 . TRP D 2 41  ? -51.837 45.352 -192.361 1.00 49.91  ? 35  TRP N CZ3 1 
ATOM   5347 C CH2 . TRP D 2 41  ? -52.124 46.446 -193.197 1.00 52.80  ? 35  TRP N CH2 1 
ATOM   5348 N N   . TYR D 2 42  ? -47.223 41.352 -191.256 1.00 41.68  ? 36  TYR N N   1 
ATOM   5349 C CA  . TYR D 2 42  ? -46.946 40.102 -190.574 1.00 40.24  ? 36  TYR N CA  1 
ATOM   5350 C C   . TYR D 2 42  ? -48.244 39.433 -190.174 1.00 39.44  ? 36  TYR N C   1 
ATOM   5351 O O   . TYR D 2 42  ? -49.214 40.095 -189.822 1.00 44.52  ? 36  TYR N O   1 
ATOM   5352 C CB  . TYR D 2 42  ? -46.147 40.354 -189.292 1.00 39.10  ? 36  TYR N CB  1 
ATOM   5353 C CG  . TYR D 2 42  ? -44.797 40.963 -189.506 1.00 41.48  ? 36  TYR N CG  1 
ATOM   5354 C CD1 . TYR D 2 42  ? -44.644 42.339 -189.547 1.00 44.01  ? 36  TYR N CD1 1 
ATOM   5355 C CD2 . TYR D 2 42  ? -43.667 40.168 -189.645 1.00 43.89  ? 36  TYR N CD2 1 
ATOM   5356 C CE1 . TYR D 2 42  ? -43.407 42.920 -189.739 1.00 46.48  ? 36  TYR N CE1 1 
ATOM   5357 C CE2 . TYR D 2 42  ? -42.418 40.734 -189.834 1.00 49.88  ? 36  TYR N CE2 1 
ATOM   5358 C CZ  . TYR D 2 42  ? -42.299 42.118 -189.880 1.00 51.81  ? 36  TYR N CZ  1 
ATOM   5359 O OH  . TYR D 2 42  ? -41.078 42.706 -190.062 1.00 50.07  ? 36  TYR N OH  1 
ATOM   5360 N N   . GLN D 2 43  ? -48.232 38.109 -190.181 1.00 40.77  ? 37  GLN N N   1 
ATOM   5361 C CA  . GLN D 2 43  ? -49.344 37.310 -189.690 1.00 39.68  ? 37  GLN N CA  1 
ATOM   5362 C C   . GLN D 2 43  ? -48.898 36.650 -188.409 1.00 44.22  ? 37  GLN N C   1 
ATOM   5363 O O   . GLN D 2 43  ? -47.796 36.109 -188.350 1.00 50.09  ? 37  GLN N O   1 
ATOM   5364 C CB  . GLN D 2 43  ? -49.674 36.227 -190.716 1.00 40.98  ? 37  GLN N CB  1 
ATOM   5365 C CG  . GLN D 2 43  ? -50.760 35.272 -190.308 1.00 38.32  ? 37  GLN N CG  1 
ATOM   5366 C CD  . GLN D 2 43  ? -50.863 34.100 -191.248 1.00 46.31  ? 37  GLN N CD  1 
ATOM   5367 O OE1 . GLN D 2 43  ? -49.925 33.315 -191.384 1.00 55.86  ? 37  GLN N OE1 1 
ATOM   5368 N NE2 . GLN D 2 43  ? -52.008 33.966 -191.901 1.00 50.34  ? 37  GLN N NE2 1 
ATOM   5369 N N   . GLN D 2 44  ? -49.734 36.682 -187.379 1.00 44.50  ? 38  GLN N N   1 
ATOM   5370 C CA  . GLN D 2 44  ? -49.412 35.967 -186.146 1.00 42.56  ? 38  GLN N CA  1 
ATOM   5371 C C   . GLN D 2 44  ? -50.580 35.113 -185.698 1.00 43.49  ? 38  GLN N C   1 
ATOM   5372 O O   . GLN D 2 44  ? -51.673 35.610 -185.484 1.00 48.09  ? 38  GLN N O   1 
ATOM   5373 C CB  . GLN D 2 44  ? -49.014 36.936 -185.023 1.00 44.19  ? 38  GLN N CB  1 
ATOM   5374 C CG  . GLN D 2 44  ? -48.808 36.272 -183.656 1.00 42.39  ? 38  GLN N CG  1 
ATOM   5375 C CD  . GLN D 2 44  ? -48.342 37.262 -182.599 1.00 45.54  ? 38  GLN N CD  1 
ATOM   5376 O OE1 . GLN D 2 44  ? -48.926 38.329 -182.435 1.00 53.65  ? 38  GLN N OE1 1 
ATOM   5377 N NE2 . GLN D 2 44  ? -47.293 36.909 -181.879 1.00 39.72  ? 38  GLN N NE2 1 
ATOM   5378 N N   . LYS D 2 45  ? -50.338 33.822 -185.557 1.00 41.64  ? 39  LYS N N   1 
ATOM   5379 C CA  . LYS D 2 45  ? -51.359 32.902 -185.091 1.00 39.39  ? 39  LYS N CA  1 
ATOM   5380 C C   . LYS D 2 45  ? -51.130 32.587 -183.629 1.00 46.07  ? 39  LYS N C   1 
ATOM   5381 O O   . LYS D 2 45  ? -49.989 32.572 -183.155 1.00 49.71  ? 39  LYS N O   1 
ATOM   5382 C CB  . LYS D 2 45  ? -51.308 31.610 -185.903 1.00 42.13  ? 39  LYS N CB  1 
ATOM   5383 C CG  . LYS D 2 45  ? -51.677 31.786 -187.355 1.00 44.32  ? 39  LYS N CG  1 
ATOM   5384 C CD  . LYS D 2 45  ? -51.507 30.489 -188.130 1.00 48.24  ? 39  LYS N CD  1 
ATOM   5385 C CE  . LYS D 2 45  ? -51.685 30.728 -189.620 1.00 54.37  ? 39  LYS N CE  1 
ATOM   5386 N NZ  . LYS D 2 45  ? -51.440 29.510 -190.420 1.00 63.10  ? 39  LYS N NZ  1 
ATOM   5387 N N   . PRO D 2 46  ? -52.213 32.310 -182.904 1.00 46.06  ? 40  PRO N N   1 
ATOM   5388 C CA  . PRO D 2 46  ? -52.127 32.016 -181.467 1.00 47.89  ? 40  PRO N CA  1 
ATOM   5389 C C   . PRO D 2 46  ? -50.989 31.055 -181.147 1.00 56.71  ? 40  PRO N C   1 
ATOM   5390 O O   . PRO D 2 46  ? -50.942 29.954 -181.703 1.00 57.97  ? 40  PRO N O   1 
ATOM   5391 C CB  . PRO D 2 46  ? -53.445 31.320 -181.174 1.00 45.12  ? 40  PRO N CB  1 
ATOM   5392 C CG  . PRO D 2 46  ? -54.380 31.835 -182.215 1.00 48.48  ? 40  PRO N CG  1 
ATOM   5393 C CD  . PRO D 2 46  ? -53.575 32.161 -183.438 1.00 46.86  ? 40  PRO N CD  1 
ATOM   5394 N N   . GLY D 2 47  ? -50.080 31.481 -180.273 1.00 53.43  ? 41  GLY N N   1 
ATOM   5395 C CA  . GLY D 2 47  ? -49.041 30.615 -179.760 1.00 43.21  ? 41  GLY N CA  1 
ATOM   5396 C C   . GLY D 2 47  ? -47.753 30.672 -180.549 1.00 57.81  ? 41  GLY N C   1 
ATOM   5397 O O   . GLY D 2 47  ? -46.837 29.892 -180.277 1.00 67.66  ? 41  GLY N O   1 
ATOM   5398 N N   . GLN D 2 48  ? -47.670 31.585 -181.519 1.00 54.56  ? 42  GLN N N   1 
ATOM   5399 C CA  . GLN D 2 48  ? -46.513 31.625 -182.410 1.00 50.83  ? 42  GLN N CA  1 
ATOM   5400 C C   . GLN D 2 48  ? -45.979 33.021 -182.632 1.00 44.87  ? 42  GLN N C   1 
ATOM   5401 O O   . GLN D 2 48  ? -46.669 34.016 -182.426 1.00 46.14  ? 42  GLN N O   1 
ATOM   5402 C CB  . GLN D 2 48  ? -46.846 31.025 -183.770 1.00 53.57  ? 42  GLN N CB  1 
ATOM   5403 C CG  . GLN D 2 48  ? -47.854 29.913 -183.734 1.00 56.98  ? 42  GLN N CG  1 
ATOM   5404 C CD  . GLN D 2 48  ? -48.040 29.271 -185.087 1.00 63.64  ? 42  GLN N CD  1 
ATOM   5405 O OE1 . GLN D 2 48  ? -47.699 29.848 -186.122 1.00 64.23  ? 42  GLN N OE1 1 
ATOM   5406 N NE2 . GLN D 2 48  ? -48.587 28.066 -185.087 1.00 68.88  ? 42  GLN N NE2 1 
ATOM   5407 N N   . PRO D 2 49  ? -44.725 33.106 -183.055 1.00 42.72  ? 43  PRO N N   1 
ATOM   5408 C CA  . PRO D 2 49  ? -44.266 34.467 -183.299 1.00 46.80  ? 43  PRO N CA  1 
ATOM   5409 C C   . PRO D 2 49  ? -44.873 34.923 -184.601 1.00 45.48  ? 43  PRO N C   1 
ATOM   5410 O O   . PRO D 2 49  ? -45.351 34.110 -185.391 1.00 42.06  ? 43  PRO N O   1 
ATOM   5411 C CB  . PRO D 2 49  ? -42.754 34.295 -183.456 1.00 48.04  ? 43  PRO N CB  1 
ATOM   5412 C CG  . PRO D 2 49  ? -42.592 32.872 -183.879 1.00 46.42  ? 43  PRO N CG  1 
ATOM   5413 C CD  . PRO D 2 49  ? -43.625 32.132 -183.106 1.00 39.50  ? 43  PRO N CD  1 
ATOM   5414 N N   . PRO D 2 50  ? -44.863 36.227 -184.821 1.00 44.20  ? 44  PRO N N   1 
ATOM   5415 C CA  . PRO D 2 50  ? -45.333 36.764 -186.086 1.00 42.21  ? 44  PRO N CA  1 
ATOM   5416 C C   . PRO D 2 50  ? -44.578 36.100 -187.226 1.00 49.91  ? 44  PRO N C   1 
ATOM   5417 O O   . PRO D 2 50  ? -43.436 35.662 -187.058 1.00 51.69  ? 44  PRO N O   1 
ATOM   5418 C CB  . PRO D 2 50  ? -44.955 38.238 -185.985 1.00 45.41  ? 44  PRO N CB  1 
ATOM   5419 C CG  . PRO D 2 50  ? -44.924 38.513 -184.519 1.00 47.01  ? 44  PRO N CG  1 
ATOM   5420 C CD  . PRO D 2 50  ? -44.424 37.271 -183.884 1.00 43.89  ? 44  PRO N CD  1 
ATOM   5421 N N   . LYS D 2 51  ? -45.228 36.020 -188.380 1.00 51.52  ? 45  LYS N N   1 
ATOM   5422 C CA  . LYS D 2 51  ? -44.625 35.467 -189.580 1.00 45.88  ? 45  LYS N CA  1 
ATOM   5423 C C   . LYS D 2 51  ? -44.700 36.546 -190.655 1.00 47.75  ? 45  LYS N C   1 
ATOM   5424 O O   . LYS D 2 51  ? -45.754 37.151 -190.862 1.00 49.35  ? 45  LYS N O   1 
ATOM   5425 C CB  . LYS D 2 51  ? -45.395 34.226 -190.002 1.00 46.11  ? 45  LYS N CB  1 
ATOM   5426 C CG  . LYS D 2 51  ? -44.857 33.553 -191.224 1.00 55.20  ? 45  LYS N CG  1 
ATOM   5427 C CD  . LYS D 2 51  ? -45.978 32.929 -192.034 1.00 55.62  ? 45  LYS N CD  1 
ATOM   5428 C CE  . LYS D 2 51  ? -45.508 31.672 -192.736 1.00 55.50  ? 45  LYS N CE  1 
ATOM   5429 N NZ  . LYS D 2 51  ? -46.504 31.202 -193.714 1.00 61.36  ? 45  LYS N NZ  1 
ATOM   5430 N N   . LEU D 2 52  ? -43.575 36.823 -191.306 1.00 44.66  ? 46  LEU N N   1 
ATOM   5431 C CA  . LEU D 2 52  ? -43.526 37.874 -192.325 1.00 48.09  ? 46  LEU N CA  1 
ATOM   5432 C C   . LEU D 2 52  ? -44.265 37.453 -193.597 1.00 50.32  ? 46  LEU N C   1 
ATOM   5433 O O   . LEU D 2 52  ? -44.006 36.379 -194.134 1.00 49.22  ? 46  LEU N O   1 
ATOM   5434 C CB  . LEU D 2 52  ? -42.078 38.218 -192.674 1.00 47.33  ? 46  LEU N CB  1 
ATOM   5435 C CG  . LEU D 2 52  ? -41.913 39.058 -193.942 1.00 50.07  ? 46  LEU N CG  1 
ATOM   5436 C CD1 . LEU D 2 52  ? -42.472 40.443 -193.717 1.00 49.13  ? 46  LEU N CD1 1 
ATOM   5437 C CD2 . LEU D 2 52  ? -40.460 39.133 -194.380 1.00 48.96  ? 46  LEU N CD2 1 
ATOM   5438 N N   . LEU D 2 53  ? -45.164 38.312 -194.075 1.00 47.31  ? 47  LEU N N   1 
ATOM   5439 C CA  . LEU D 2 53  ? -45.964 38.041 -195.273 1.00 48.38  ? 47  LEU N CA  1 
ATOM   5440 C C   . LEU D 2 53  ? -45.487 38.852 -196.459 1.00 51.68  ? 47  LEU N C   1 
ATOM   5441 O O   . LEU D 2 53  ? -45.345 38.333 -197.557 1.00 52.61  ? 47  LEU N O   1 
ATOM   5442 C CB  . LEU D 2 53  ? -47.438 38.392 -195.039 1.00 45.74  ? 47  LEU N CB  1 
ATOM   5443 C CG  . LEU D 2 53  ? -48.230 37.452 -194.138 1.00 48.74  ? 47  LEU N CG  1 
ATOM   5444 C CD1 . LEU D 2 53  ? -49.688 37.842 -194.145 1.00 52.95  ? 47  LEU N CD1 1 
ATOM   5445 C CD2 . LEU D 2 53  ? -48.053 36.003 -194.582 1.00 46.22  ? 47  LEU N CD2 1 
ATOM   5446 N N   . ILE D 2 54  ? -45.243 40.135 -196.217 1.00 55.24  ? 48  ILE N N   1 
ATOM   5447 C CA  . ILE D 2 54  ? -45.056 41.116 -197.279 1.00 56.58  ? 48  ILE N CA  1 
ATOM   5448 C C   . ILE D 2 54  ? -44.065 42.210 -196.858 1.00 58.96  ? 48  ILE N C   1 
ATOM   5449 O O   . ILE D 2 54  ? -44.180 42.788 -195.769 1.00 57.57  ? 48  ILE N O   1 
ATOM   5450 C CB  . ILE D 2 54  ? -46.422 41.745 -197.654 1.00 53.16  ? 48  ILE N CB  1 
ATOM   5451 C CG1 . ILE D 2 54  ? -47.209 40.774 -198.516 1.00 55.19  ? 48  ILE N CG1 1 
ATOM   5452 C CG2 . ILE D 2 54  ? -46.246 43.055 -198.399 1.00 51.09  ? 48  ILE N CG2 1 
ATOM   5453 C CD1 . ILE D 2 54  ? -48.586 41.227 -198.776 1.00 63.92  ? 48  ILE N CD1 1 
ATOM   5454 N N   . TYR D 2 55  ? -43.076 42.476 -197.708 1.00 56.12  ? 49  TYR N N   1 
ATOM   5455 C CA  . TYR D 2 55  ? -42.140 43.569 -197.452 1.00 58.82  ? 49  TYR N CA  1 
ATOM   5456 C C   . TYR D 2 55  ? -42.167 44.576 -198.596 1.00 64.10  ? 49  TYR N C   1 
ATOM   5457 O O   . TYR D 2 55  ? -42.690 44.293 -199.683 1.00 65.54  ? 49  TYR N O   1 
ATOM   5458 C CB  . TYR D 2 55  ? -40.713 43.056 -197.192 1.00 54.12  ? 49  TYR N CB  1 
ATOM   5459 C CG  . TYR D 2 55  ? -40.107 42.294 -198.342 1.00 51.26  ? 49  TYR N CG  1 
ATOM   5460 C CD1 . TYR D 2 55  ? -39.205 42.901 -199.202 1.00 56.09  ? 49  TYR N CD1 1 
ATOM   5461 C CD2 . TYR D 2 55  ? -40.443 40.966 -198.574 1.00 52.94  ? 49  TYR N CD2 1 
ATOM   5462 C CE1 . TYR D 2 55  ? -38.655 42.211 -200.268 1.00 62.48  ? 49  TYR N CE1 1 
ATOM   5463 C CE2 . TYR D 2 55  ? -39.901 40.265 -199.625 1.00 59.44  ? 49  TYR N CE2 1 
ATOM   5464 C CZ  . TYR D 2 55  ? -39.008 40.891 -200.471 1.00 68.61  ? 49  TYR N CZ  1 
ATOM   5465 O OH  . TYR D 2 55  ? -38.464 40.191 -201.520 1.00 75.45  ? 49  TYR N OH  1 
ATOM   5466 N N   . TRP D 2 56  ? -41.604 45.751 -198.344 1.00 60.36  ? 50  TRP N N   1 
ATOM   5467 C CA  . TRP D 2 56  ? -41.720 46.868 -199.271 1.00 60.52  ? 50  TRP N CA  1 
ATOM   5468 C C   . TRP D 2 56  ? -43.143 47.072 -199.781 1.00 57.15  ? 50  TRP N C   1 
ATOM   5469 O O   . TRP D 2 56  ? -43.357 47.245 -200.983 1.00 60.98  ? 50  TRP N O   1 
ATOM   5470 C CB  . TRP D 2 56  ? -40.740 46.732 -200.442 1.00 63.98  ? 50  TRP N CB  1 
ATOM   5471 C CG  . TRP D 2 56  ? -39.376 47.238 -200.096 1.00 68.99  ? 50  TRP N CG  1 
ATOM   5472 C CD1 . TRP D 2 56  ? -39.059 48.143 -199.116 1.00 69.47  ? 50  TRP N CD1 1 
ATOM   5473 C CD2 . TRP D 2 56  ? -38.148 46.889 -200.731 1.00 70.58  ? 50  TRP N CD2 1 
ATOM   5474 N NE1 . TRP D 2 56  ? -37.702 48.364 -199.099 1.00 67.75  ? 50  TRP N NE1 1 
ATOM   5475 C CE2 . TRP D 2 56  ? -37.121 47.607 -200.080 1.00 70.40  ? 50  TRP N CE2 1 
ATOM   5476 C CE3 . TRP D 2 56  ? -37.812 46.040 -201.784 1.00 76.59  ? 50  TRP N CE3 1 
ATOM   5477 C CZ2 . TRP D 2 56  ? -35.792 47.501 -200.454 1.00 73.63  ? 50  TRP N CZ2 1 
ATOM   5478 C CZ3 . TRP D 2 56  ? -36.493 45.936 -202.153 1.00 82.07  ? 50  TRP N CZ3 1 
ATOM   5479 C CH2 . TRP D 2 56  ? -35.497 46.660 -201.490 1.00 80.91  ? 50  TRP N CH2 1 
ATOM   5480 N N   . ALA D 2 57  ? -44.102 47.045 -198.855 1.00 60.75  ? 51  ALA N N   1 
ATOM   5481 C CA  . ALA D 2 57  ? -45.505 47.345 -199.145 1.00 57.59  ? 51  ALA N CA  1 
ATOM   5482 C C   . ALA D 2 57  ? -46.235 46.329 -200.016 1.00 61.80  ? 51  ALA N C   1 
ATOM   5483 O O   . ALA D 2 57  ? -47.420 46.069 -199.791 1.00 66.30  ? 51  ALA N O   1 
ATOM   5484 C CB  . ALA D 2 57  ? -45.642 48.735 -199.753 1.00 55.31  ? 51  ALA N CB  1 
ATOM   5485 N N   . SER D 2 58  ? -45.557 45.772 -201.017 1.00 59.49  ? 52  SER N N   1 
ATOM   5486 C CA  . SER D 2 58  ? -46.262 44.933 -201.990 1.00 64.44  ? 52  SER N CA  1 
ATOM   5487 C C   . SER D 2 58  ? -45.544 43.651 -202.405 1.00 64.84  ? 52  SER N C   1 
ATOM   5488 O O   . SER D 2 58  ? -46.030 42.924 -203.259 1.00 56.59  ? 52  SER N O   1 
ATOM   5489 C CB  . SER D 2 58  ? -46.671 45.742 -203.235 1.00 63.49  ? 52  SER N CB  1 
ATOM   5490 O OG  . SER D 2 58  ? -45.565 46.074 -204.055 1.00 59.16  ? 52  SER N OG  1 
ATOM   5491 N N   . THR D 2 59  ? -44.411 43.350 -201.789 1.00 62.74  ? 53  THR N N   1 
ATOM   5492 C CA  . THR D 2 59  ? -43.660 42.168 -202.207 1.00 66.04  ? 53  THR N CA  1 
ATOM   5493 C C   . THR D 2 59  ? -43.838 40.969 -201.280 1.00 67.12  ? 53  THR N C   1 
ATOM   5494 O O   . THR D 2 59  ? -43.475 41.010 -200.105 1.00 68.84  ? 53  THR N O   1 
ATOM   5495 C CB  . THR D 2 59  ? -42.163 42.478 -202.389 1.00 66.44  ? 53  THR N CB  1 
ATOM   5496 O OG1 . THR D 2 59  ? -42.015 43.491 -203.390 1.00 65.20  ? 53  THR N OG1 1 
ATOM   5497 C CG2 . THR D 2 59  ? -41.413 41.237 -202.818 1.00 55.87  ? 53  THR N CG2 1 
ATOM   5498 N N   . ARG D 2 60  ? -44.392 39.899 -201.833 1.00 54.31  ? 54  ARG N N   1 
ATOM   5499 C CA  . ARG D 2 60  ? -44.651 38.687 -201.074 1.00 59.43  ? 54  ARG N CA  1 
ATOM   5500 C C   . ARG D 2 60  ? -43.368 38.018 -200.630 1.00 57.96  ? 54  ARG N C   1 
ATOM   5501 O O   . ARG D 2 60  ? -42.440 37.849 -201.413 1.00 58.91  ? 54  ARG N O   1 
ATOM   5502 C CB  . ARG D 2 60  ? -45.475 37.696 -201.894 1.00 54.74  ? 54  ARG N CB  1 
ATOM   5503 C CG  . ARG D 2 60  ? -46.945 37.704 -201.590 1.00 64.14  ? 54  ARG N CG  1 
ATOM   5504 C CD  . ARG D 2 60  ? -47.597 36.493 -202.215 1.00 71.49  ? 54  ARG N CD  1 
ATOM   5505 N NE  . ARG D 2 60  ? -47.205 36.379 -203.613 1.00 80.44  ? 54  ARG N NE  1 
ATOM   5506 C CZ  . ARG D 2 60  ? -47.735 37.112 -204.585 1.00 86.56  ? 54  ARG N CZ  1 
ATOM   5507 N NH1 . ARG D 2 60  ? -48.689 37.997 -204.302 1.00 83.21  ? 54  ARG N NH1 1 
ATOM   5508 N NH2 . ARG D 2 60  ? -47.317 36.960 -205.835 1.00 87.75  ? 54  ARG N NH2 1 
ATOM   5509 N N   . GLU D 2 61  ? -43.326 37.628 -199.364 1.00 63.21  ? 55  GLU N N   1 
ATOM   5510 C CA  . GLU D 2 61  ? -42.198 36.873 -198.864 1.00 69.16  ? 55  GLU N CA  1 
ATOM   5511 C C   . GLU D 2 61  ? -42.175 35.539 -199.593 1.00 67.77  ? 55  GLU N C   1 
ATOM   5512 O O   . GLU D 2 61  ? -43.210 35.049 -200.031 1.00 69.86  ? 55  GLU N O   1 
ATOM   5513 C CB  . GLU D 2 61  ? -42.333 36.648 -197.363 1.00 69.85  ? 55  GLU N CB  1 
ATOM   5514 C CG  . GLU D 2 61  ? -41.089 37.028 -196.586 1.00 80.87  ? 55  GLU N CG  1 
ATOM   5515 C CD  . GLU D 2 61  ? -39.892 36.184 -196.943 1.00 86.02  ? 55  GLU N CD  1 
ATOM   5516 O OE1 . GLU D 2 61  ? -38.761 36.727 -196.988 1.00 84.02  ? 55  GLU N OE1 1 
ATOM   5517 O OE2 . GLU D 2 61  ? -40.093 34.974 -197.179 1.00 88.72  ? 55  GLU N OE2 1 
ATOM   5518 N N   . SER D 2 62  ? -40.992 34.960 -199.725 1.00 61.10  ? 56  SER N N   1 
ATOM   5519 C CA  . SER D 2 62  ? -40.847 33.669 -200.364 1.00 66.09  ? 56  SER N CA  1 
ATOM   5520 C C   . SER D 2 62  ? -41.716 32.649 -199.650 1.00 66.95  ? 56  SER N C   1 
ATOM   5521 O O   . SER D 2 62  ? -41.658 32.542 -198.435 1.00 70.66  ? 56  SER N O   1 
ATOM   5522 C CB  . SER D 2 62  ? -39.386 33.236 -200.310 1.00 76.99  ? 56  SER N CB  1 
ATOM   5523 O OG  . SER D 2 62  ? -39.121 32.234 -201.270 1.00 90.72  ? 56  SER N OG  1 
ATOM   5524 N N   . GLY D 2 63  ? -42.536 31.914 -200.399 1.00 66.50  ? 57  GLY N N   1 
ATOM   5525 C CA  . GLY D 2 63  ? -43.359 30.871 -199.814 1.00 58.84  ? 57  GLY N CA  1 
ATOM   5526 C C   . GLY D 2 63  ? -44.743 31.301 -199.359 1.00 60.12  ? 57  GLY N C   1 
ATOM   5527 O O   . GLY D 2 63  ? -45.607 30.457 -199.108 1.00 59.30  ? 57  GLY N O   1 
ATOM   5528 N N   . VAL D 2 64  ? -44.964 32.606 -199.234 1.00 58.63  ? 58  VAL N N   1 
ATOM   5529 C CA  . VAL D 2 64  ? -46.295 33.106 -198.912 1.00 58.51  ? 58  VAL N CA  1 
ATOM   5530 C C   . VAL D 2 64  ? -47.238 32.894 -200.096 1.00 62.75  ? 58  VAL N C   1 
ATOM   5531 O O   . VAL D 2 64  ? -46.905 33.236 -201.227 1.00 64.75  ? 58  VAL N O   1 
ATOM   5532 C CB  . VAL D 2 64  ? -46.261 34.589 -198.550 1.00 57.44  ? 58  VAL N CB  1 
ATOM   5533 C CG1 . VAL D 2 64  ? -47.667 35.137 -198.383 1.00 49.83  ? 58  VAL N CG1 1 
ATOM   5534 C CG2 . VAL D 2 64  ? -45.473 34.787 -197.289 1.00 56.10  ? 58  VAL N CG2 1 
ATOM   5535 N N   . PRO D 2 65  ? -48.413 32.306 -199.839 1.00 60.96  ? 59  PRO N N   1 
ATOM   5536 C CA  . PRO D 2 65  ? -49.388 32.012 -200.894 1.00 63.33  ? 59  PRO N CA  1 
ATOM   5537 C C   . PRO D 2 65  ? -49.890 33.231 -201.662 1.00 63.58  ? 59  PRO N C   1 
ATOM   5538 O O   . PRO D 2 65  ? -49.990 34.330 -201.126 1.00 60.06  ? 59  PRO N O   1 
ATOM   5539 C CB  . PRO D 2 65  ? -50.540 31.339 -200.130 1.00 53.85  ? 59  PRO N CB  1 
ATOM   5540 C CG  . PRO D 2 65  ? -50.244 31.596 -198.681 1.00 71.03  ? 59  PRO N CG  1 
ATOM   5541 C CD  . PRO D 2 65  ? -48.770 31.620 -198.591 1.00 62.38  ? 59  PRO N CD  1 
ATOM   5542 N N   . ASP D 2 66  ? -50.189 32.998 -202.935 1.00 69.53  ? 60  ASP N N   1 
ATOM   5543 C CA  . ASP D 2 66  ? -50.774 33.974 -203.847 1.00 73.23  ? 60  ASP N CA  1 
ATOM   5544 C C   . ASP D 2 66  ? -51.881 34.856 -203.288 1.00 68.70  ? 60  ASP N C   1 
ATOM   5545 O O   . ASP D 2 66  ? -51.980 36.019 -203.664 1.00 67.38  ? 60  ASP N O   1 
ATOM   5546 C CB  . ASP D 2 66  ? -51.358 33.236 -205.050 1.00 86.14  ? 60  ASP N CB  1 
ATOM   5547 C CG  . ASP D 2 66  ? -50.396 33.149 -206.200 1.00 96.80  ? 60  ASP N CG  1 
ATOM   5548 O OD1 . ASP D 2 66  ? -49.287 33.713 -206.078 1.00 100.77 ? 60  ASP N OD1 1 
ATOM   5549 O OD2 . ASP D 2 66  ? -50.756 32.527 -207.227 1.00 98.93  ? 60  ASP N OD2 1 
ATOM   5550 N N   . ARG D 2 67  ? -52.744 34.303 -202.437 1.00 66.41  ? 61  ARG N N   1 
ATOM   5551 C CA  . ARG D 2 67  ? -53.926 35.046 -202.001 1.00 58.68  ? 61  ARG N CA  1 
ATOM   5552 C C   . ARG D 2 67  ? -53.566 36.301 -201.219 1.00 56.73  ? 61  ARG N C   1 
ATOM   5553 O O   . ARG D 2 67  ? -54.349 37.243 -201.167 1.00 64.25  ? 61  ARG N O   1 
ATOM   5554 C CB  . ARG D 2 67  ? -54.924 34.165 -201.235 1.00 57.05  ? 61  ARG N CB  1 
ATOM   5555 C CG  . ARG D 2 67  ? -54.325 33.328 -200.115 1.00 60.44  ? 61  ARG N CG  1 
ATOM   5556 C CD  . ARG D 2 67  ? -55.333 32.322 -199.563 1.00 59.07  ? 61  ARG N CD  1 
ATOM   5557 N NE  . ARG D 2 67  ? -54.873 31.725 -198.316 1.00 58.65  ? 61  ARG N NE  1 
ATOM   5558 C CZ  . ARG D 2 67  ? -54.090 30.654 -198.236 1.00 60.79  ? 61  ARG N CZ  1 
ATOM   5559 N NH1 . ARG D 2 67  ? -53.674 30.055 -199.338 1.00 60.56  ? 61  ARG N NH1 1 
ATOM   5560 N NH2 . ARG D 2 67  ? -53.708 30.186 -197.052 1.00 61.01  ? 61  ARG N NH2 1 
ATOM   5561 N N   . PHE D 2 68  ? -52.376 36.324 -200.630 1.00 52.98  ? 62  PHE N N   1 
ATOM   5562 C CA  . PHE D 2 68  ? -51.927 37.499 -199.890 1.00 57.81  ? 62  PHE N CA  1 
ATOM   5563 C C   . PHE D 2 68  ? -51.272 38.495 -200.840 1.00 60.13  ? 62  PHE N C   1 
ATOM   5564 O O   . PHE D 2 68  ? -50.459 38.117 -201.675 1.00 60.86  ? 62  PHE N O   1 
ATOM   5565 C CB  . PHE D 2 68  ? -50.953 37.109 -198.764 1.00 52.17  ? 62  PHE N CB  1 
ATOM   5566 C CG  . PHE D 2 68  ? -51.552 36.181 -197.737 1.00 57.58  ? 62  PHE N CG  1 
ATOM   5567 C CD1 . PHE D 2 68  ? -51.416 34.810 -197.858 1.00 62.01  ? 62  PHE N CD1 1 
ATOM   5568 C CD2 . PHE D 2 68  ? -52.254 36.683 -196.656 1.00 56.65  ? 62  PHE N CD2 1 
ATOM   5569 C CE1 . PHE D 2 68  ? -51.971 33.961 -196.919 1.00 65.07  ? 62  PHE N CE1 1 
ATOM   5570 C CE2 . PHE D 2 68  ? -52.810 35.838 -195.725 1.00 55.43  ? 62  PHE N CE2 1 
ATOM   5571 C CZ  . PHE D 2 68  ? -52.671 34.480 -195.852 1.00 57.60  ? 62  PHE N CZ  1 
ATOM   5572 N N   . SER D 2 69  ? -51.634 39.766 -200.716 1.00 59.36  ? 63  SER N N   1 
ATOM   5573 C CA  . SER D 2 69  ? -50.996 40.819 -201.497 1.00 58.63  ? 63  SER N CA  1 
ATOM   5574 C C   . SER D 2 69  ? -51.232 42.151 -200.822 1.00 59.16  ? 63  SER N C   1 
ATOM   5575 O O   . SER D 2 69  ? -52.293 42.379 -200.248 1.00 63.88  ? 63  SER N O   1 
ATOM   5576 C CB  . SER D 2 69  ? -51.573 40.873 -202.905 1.00 65.16  ? 63  SER N CB  1 
ATOM   5577 O OG  . SER D 2 69  ? -52.880 41.427 -202.897 1.00 64.98  ? 63  SER N OG  1 
ATOM   5578 N N   . GLY D 2 70  ? -50.246 43.035 -200.892 1.00 56.77  ? 64  GLY N N   1 
ATOM   5579 C CA  . GLY D 2 70  ? -50.373 44.346 -200.279 1.00 56.16  ? 64  GLY N CA  1 
ATOM   5580 C C   . GLY D 2 70  ? -50.185 45.417 -201.327 1.00 64.24  ? 64  GLY N C   1 
ATOM   5581 O O   . GLY D 2 70  ? -49.537 45.174 -202.351 1.00 59.40  ? 64  GLY N O   1 
ATOM   5582 N N   . SER D 2 71  ? -50.756 46.595 -201.079 1.00 68.12  ? 65  SER N N   1 
ATOM   5583 C CA  . SER D 2 71  ? -50.668 47.711 -202.017 1.00 65.54  ? 65  SER N CA  1 
ATOM   5584 C C   . SER D 2 71  ? -50.508 49.014 -201.260 1.00 68.00  ? 65  SER N C   1 
ATOM   5585 O O   . SER D 2 71  ? -50.570 49.028 -200.034 1.00 77.51  ? 65  SER N O   1 
ATOM   5586 C CB  . SER D 2 71  ? -51.920 47.785 -202.872 1.00 65.22  ? 65  SER N CB  1 
ATOM   5587 O OG  . SER D 2 71  ? -53.018 48.159 -202.068 1.00 71.39  ? 65  SER N OG  1 
ATOM   5588 N N   . GLY D 2 72  ? -50.301 50.107 -201.991 1.00 64.58  ? 66  GLY N N   1 
ATOM   5589 C CA  . GLY D 2 72  ? -50.174 51.416 -201.378 1.00 63.12  ? 66  GLY N CA  1 
ATOM   5590 C C   . GLY D 2 72  ? -48.784 52.031 -201.434 1.00 70.71  ? 66  GLY N C   1 
ATOM   5591 O O   . GLY D 2 72  ? -47.798 51.378 -201.778 1.00 67.30  ? 66  GLY N O   1 
ATOM   5592 N N   . SER D 2 73  ? -48.712 53.309 -201.083 1.00 77.69  ? 67  SER N N   1 
ATOM   5593 C CA  . SER D 2 73  ? -47.473 54.058 -201.174 1.00 79.62  ? 67  SER N CA  1 
ATOM   5594 C C   . SER D 2 73  ? -47.475 55.225 -200.211 1.00 79.86  ? 67  SER N C   1 
ATOM   5595 O O   . SER D 2 73  ? -48.479 55.927 -200.061 1.00 79.94  ? 67  SER N O   1 
ATOM   5596 C CB  . SER D 2 73  ? -47.284 54.604 -202.588 1.00 85.02  ? 67  SER N CB  1 
ATOM   5597 O OG  . SER D 2 73  ? -46.936 53.576 -203.491 1.00 92.86  ? 67  SER N OG  1 
ATOM   5598 N N   . GLY D 2 74  ? -46.335 55.434 -199.568 1.00 79.32  ? 68  GLY N N   1 
ATOM   5599 C CA  . GLY D 2 74  ? -46.132 56.614 -198.757 1.00 81.86  ? 68  GLY N CA  1 
ATOM   5600 C C   . GLY D 2 74  ? -46.829 56.572 -197.418 1.00 82.80  ? 68  GLY N C   1 
ATOM   5601 O O   . GLY D 2 74  ? -46.181 56.400 -196.385 1.00 83.02  ? 68  GLY N O   1 
ATOM   5602 N N   . THR D 2 75  ? -48.150 56.721 -197.428 1.00 79.72  ? 69  THR N N   1 
ATOM   5603 C CA  . THR D 2 75  ? -48.877 56.867 -196.175 1.00 76.74  ? 69  THR N CA  1 
ATOM   5604 C C   . THR D 2 75  ? -49.996 55.856 -195.947 1.00 76.70  ? 69  THR N C   1 
ATOM   5605 O O   . THR D 2 75  ? -50.230 55.450 -194.817 1.00 79.37  ? 69  THR N O   1 
ATOM   5606 C CB  . THR D 2 75  ? -49.405 58.303 -196.013 1.00 79.65  ? 69  THR N CB  1 
ATOM   5607 O OG1 . THR D 2 75  ? -48.485 59.041 -195.201 1.00 81.50  ? 69  THR N OG1 1 
ATOM   5608 C CG2 . THR D 2 75  ? -50.759 58.316 -195.338 1.00 81.69  ? 69  THR N CG2 1 
ATOM   5609 N N   . ASP D 2 76  ? -50.687 55.457 -197.008 1.00 79.09  ? 70  ASP N N   1 
ATOM   5610 C CA  . ASP D 2 76  ? -51.835 54.564 -196.876 1.00 77.24  ? 70  ASP N CA  1 
ATOM   5611 C C   . ASP D 2 76  ? -51.548 53.206 -197.494 1.00 71.23  ? 70  ASP N C   1 
ATOM   5612 O O   . ASP D 2 76  ? -51.170 53.112 -198.660 1.00 70.87  ? 70  ASP N O   1 
ATOM   5613 C CB  . ASP D 2 76  ? -53.088 55.179 -197.516 1.00 84.13  ? 70  ASP N CB  1 
ATOM   5614 C CG  . ASP D 2 76  ? -53.798 56.170 -196.599 1.00 95.25  ? 70  ASP N CG  1 
ATOM   5615 O OD1 . ASP D 2 76  ? -53.119 56.870 -195.822 1.00 101.29 ? 70  ASP N OD1 1 
ATOM   5616 O OD2 . ASP D 2 76  ? -55.042 56.254 -196.653 1.00 98.69  ? 70  ASP N OD2 1 
ATOM   5617 N N   . PHE D 2 77  ? -51.733 52.149 -196.713 1.00 67.03  ? 71  PHE N N   1 
ATOM   5618 C CA  . PHE D 2 77  ? -51.449 50.812 -197.212 1.00 62.27  ? 71  PHE N CA  1 
ATOM   5619 C C   . PHE D 2 77  ? -52.577 49.829 -196.948 1.00 62.85  ? 71  PHE N C   1 
ATOM   5620 O O   . PHE D 2 77  ? -53.410 50.029 -196.062 1.00 62.91  ? 71  PHE N O   1 
ATOM   5621 C CB  . PHE D 2 77  ? -50.125 50.309 -196.646 1.00 60.30  ? 71  PHE N CB  1 
ATOM   5622 C CG  . PHE D 2 77  ? -48.988 51.242 -196.900 1.00 63.86  ? 71  PHE N CG  1 
ATOM   5623 C CD1 . PHE D 2 77  ? -48.212 51.115 -198.038 1.00 69.66  ? 71  PHE N CD1 1 
ATOM   5624 C CD2 . PHE D 2 77  ? -48.719 52.273 -196.028 1.00 63.88  ? 71  PHE N CD2 1 
ATOM   5625 C CE1 . PHE D 2 77  ? -47.173 51.989 -198.286 1.00 70.63  ? 71  PHE N CE1 1 
ATOM   5626 C CE2 . PHE D 2 77  ? -47.679 53.150 -196.271 1.00 66.88  ? 71  PHE N CE2 1 
ATOM   5627 C CZ  . PHE D 2 77  ? -46.908 53.007 -197.402 1.00 69.44  ? 71  PHE N CZ  1 
ATOM   5628 N N   . THR D 2 78  ? -52.605 48.767 -197.744 1.00 67.80  ? 72  THR N N   1 
ATOM   5629 C CA  . THR D 2 78  ? -53.642 47.758 -197.625 1.00 63.17  ? 72  THR N CA  1 
ATOM   5630 C C   . THR D 2 78  ? -53.094 46.358 -197.810 1.00 65.86  ? 72  THR N C   1 
ATOM   5631 O O   . THR D 2 78  ? -52.355 46.085 -198.762 1.00 72.97  ? 72  THR N O   1 
ATOM   5632 C CB  . THR D 2 78  ? -54.734 47.982 -198.664 1.00 63.53  ? 72  THR N CB  1 
ATOM   5633 O OG1 . THR D 2 78  ? -55.445 49.179 -198.338 1.00 68.55  ? 72  THR N OG1 1 
ATOM   5634 C CG2 . THR D 2 78  ? -55.704 46.820 -198.666 1.00 60.63  ? 72  THR N CG2 1 
ATOM   5635 N N   . LEU D 2 79  ? -53.451 45.476 -196.885 1.00 61.35  ? 73  LEU N N   1 
ATOM   5636 C CA  . LEU D 2 79  ? -53.239 44.056 -197.076 1.00 56.68  ? 73  LEU N CA  1 
ATOM   5637 C C   . LEU D 2 79  ? -54.556 43.462 -197.535 1.00 59.81  ? 73  LEU N C   1 
ATOM   5638 O O   . LEU D 2 79  ? -55.610 43.829 -197.022 1.00 64.10  ? 73  LEU N O   1 
ATOM   5639 C CB  . LEU D 2 79  ? -52.797 43.391 -195.781 1.00 53.84  ? 73  LEU N CB  1 
ATOM   5640 C CG  . LEU D 2 79  ? -52.696 41.879 -195.926 1.00 52.25  ? 73  LEU N CG  1 
ATOM   5641 C CD1 . LEU D 2 79  ? -51.647 41.537 -196.984 1.00 51.89  ? 73  LEU N CD1 1 
ATOM   5642 C CD2 . LEU D 2 79  ? -52.363 41.241 -194.604 1.00 52.15  ? 73  LEU N CD2 1 
ATOM   5643 N N   . THR D 2 80  ? -54.492 42.553 -198.504 1.00 60.73  ? 74  THR N N   1 
ATOM   5644 C CA  . THR D 2 80  ? -55.677 41.918 -199.072 1.00 53.30  ? 74  THR N CA  1 
ATOM   5645 C C   . THR D 2 80  ? -55.467 40.423 -199.168 1.00 55.84  ? 74  THR N C   1 
ATOM   5646 O O   . THR D 2 80  ? -54.401 39.958 -199.563 1.00 55.21  ? 74  THR N O   1 
ATOM   5647 C CB  . THR D 2 80  ? -55.980 42.452 -200.490 1.00 64.44  ? 74  THR N CB  1 
ATOM   5648 O OG1 . THR D 2 80  ? -56.285 43.849 -200.425 1.00 71.55  ? 74  THR N OG1 1 
ATOM   5649 C CG2 . THR D 2 80  ? -57.153 41.729 -201.107 1.00 53.75  ? 74  THR N CG2 1 
ATOM   5650 N N   . ILE D 2 81  ? -56.493 39.673 -198.786 1.00 51.89  ? 75  ILE N N   1 
ATOM   5651 C CA  . ILE D 2 81  ? -56.482 38.226 -198.885 1.00 57.09  ? 75  ILE N CA  1 
ATOM   5652 C C   . ILE D 2 81  ? -57.571 37.883 -199.894 1.00 60.68  ? 75  ILE N C   1 
ATOM   5653 O O   . ILE D 2 81  ? -58.755 38.025 -199.595 1.00 61.42  ? 75  ILE N O   1 
ATOM   5654 C CB  . ILE D 2 81  ? -56.754 37.564 -197.498 1.00 46.33  ? 75  ILE N CB  1 
ATOM   5655 C CG1 . ILE D 2 81  ? -55.842 38.166 -196.427 1.00 44.53  ? 75  ILE N CG1 1 
ATOM   5656 C CG2 . ILE D 2 81  ? -56.563 36.048 -197.557 1.00 45.32  ? 75  ILE N CG2 1 
ATOM   5657 C CD1 . ILE D 2 81  ? -55.954 37.518 -195.058 1.00 39.87  ? 75  ILE N CD1 1 
ATOM   5658 N N   . SER D 2 82  ? -57.167 37.476 -201.098 1.00 65.78  ? 76  SER N N   1 
ATOM   5659 C CA  . SER D 2 82  ? -58.108 37.242 -202.197 1.00 67.71  ? 76  SER N CA  1 
ATOM   5660 C C   . SER D 2 82  ? -59.321 36.512 -201.680 1.00 74.07  ? 76  SER N C   1 
ATOM   5661 O O   . SER D 2 82  ? -60.428 37.040 -201.703 1.00 80.37  ? 76  SER N O   1 
ATOM   5662 C CB  . SER D 2 82  ? -57.491 36.382 -203.294 1.00 66.50  ? 76  SER N CB  1 
ATOM   5663 O OG  . SER D 2 82  ? -56.164 36.767 -203.569 1.00 79.94  ? 76  SER N OG  1 
ATOM   5664 N N   . SER D 2 83  ? -59.102 35.281 -201.230 1.00 70.04  ? 77  SER N N   1 
ATOM   5665 C CA  . SER D 2 83  ? -60.178 34.466 -200.698 1.00 67.98  ? 77  SER N CA  1 
ATOM   5666 C C   . SER D 2 83  ? -59.751 33.804 -199.395 1.00 63.46  ? 77  SER N C   1 
ATOM   5667 O O   . SER D 2 83  ? -58.857 32.961 -199.360 1.00 67.56  ? 77  SER N O   1 
ATOM   5668 C CB  . SER D 2 83  ? -60.661 33.436 -201.729 1.00 73.80  ? 77  SER N CB  1 
ATOM   5669 O OG  . SER D 2 83  ? -59.711 32.407 -201.931 1.00 79.47  ? 77  SER N OG  1 
ATOM   5670 N N   . LEU D 2 84  ? -60.406 34.206 -198.319 1.00 60.79  ? 78  LEU N N   1 
ATOM   5671 C CA  . LEU D 2 84  ? -60.030 33.766 -196.995 1.00 57.90  ? 78  LEU N CA  1 
ATOM   5672 C C   . LEU D 2 84  ? -60.169 32.266 -196.809 1.00 60.62  ? 78  LEU N C   1 
ATOM   5673 O O   . LEU D 2 84  ? -61.178 31.671 -197.165 1.00 64.43  ? 78  LEU N O   1 
ATOM   5674 C CB  . LEU D 2 84  ? -60.869 34.482 -195.958 1.00 56.42  ? 78  LEU N CB  1 
ATOM   5675 C CG  . LEU D 2 84  ? -60.167 34.573 -194.616 1.00 56.63  ? 78  LEU N CG  1 
ATOM   5676 C CD1 . LEU D 2 84  ? -58.863 35.316 -194.812 1.00 57.80  ? 78  LEU N CD1 1 
ATOM   5677 C CD2 . LEU D 2 84  ? -61.070 35.296 -193.652 1.00 56.64  ? 78  LEU N CD2 1 
ATOM   5678 N N   . GLN D 2 85  ? -59.133 31.672 -196.239 1.00 55.29  ? 79  GLN N N   1 
ATOM   5679 C CA  . GLN D 2 85  ? -59.129 30.277 -195.874 1.00 52.80  ? 79  GLN N CA  1 
ATOM   5680 C C   . GLN D 2 85  ? -59.277 30.139 -194.370 1.00 55.72  ? 79  GLN N C   1 
ATOM   5681 O O   . GLN D 2 85  ? -58.880 31.022 -193.611 1.00 58.29  ? 79  GLN N O   1 
ATOM   5682 C CB  . GLN D 2 85  ? -57.795 29.661 -196.266 1.00 62.90  ? 79  GLN N CB  1 
ATOM   5683 C CG  . GLN D 2 85  ? -57.347 30.009 -197.647 1.00 71.12  ? 79  GLN N CG  1 
ATOM   5684 C CD  . GLN D 2 85  ? -58.153 29.287 -198.692 1.00 75.81  ? 79  GLN N CD  1 
ATOM   5685 O OE1 . GLN D 2 85  ? -59.383 29.366 -198.707 1.00 75.23  ? 79  GLN N OE1 1 
ATOM   5686 N NE2 . GLN D 2 85  ? -57.465 28.574 -199.581 1.00 77.85  ? 79  GLN N NE2 1 
ATOM   5687 N N   . ALA D 2 86  ? -59.803 29.002 -193.942 1.00 57.03  ? 80  ALA N N   1 
ATOM   5688 C CA  . ALA D 2 86  ? -59.986 28.727 -192.530 1.00 49.77  ? 80  ALA N CA  1 
ATOM   5689 C C   . ALA D 2 86  ? -58.698 28.935 -191.737 1.00 50.80  ? 80  ALA N C   1 
ATOM   5690 O O   . ALA D 2 86  ? -58.727 29.373 -190.590 1.00 61.79  ? 80  ALA N O   1 
ATOM   5691 C CB  . ALA D 2 86  ? -60.496 27.307 -192.354 1.00 47.03  ? 80  ALA N CB  1 
ATOM   5692 N N   . GLU D 2 87  ? -57.570 28.627 -192.363 1.00 50.41  ? 81  GLU N N   1 
ATOM   5693 C CA  . GLU D 2 87  ? -56.281 28.590 -191.684 1.00 48.73  ? 81  GLU N CA  1 
ATOM   5694 C C   . GLU D 2 87  ? -55.607 29.944 -191.647 1.00 48.77  ? 81  GLU N C   1 
ATOM   5695 O O   . GLU D 2 87  ? -54.499 30.068 -191.114 1.00 50.48  ? 81  GLU N O   1 
ATOM   5696 C CB  . GLU D 2 87  ? -55.337 27.584 -192.342 1.00 59.71  ? 81  GLU N CB  1 
ATOM   5697 C CG  . GLU D 2 87  ? -55.070 27.816 -193.832 1.00 69.13  ? 81  GLU N CG  1 
ATOM   5698 C CD  . GLU D 2 87  ? -56.043 27.052 -194.767 1.00 83.70  ? 81  GLU N CD  1 
ATOM   5699 O OE1 . GLU D 2 87  ? -57.191 26.700 -194.355 1.00 70.12  ? 81  GLU N OE1 1 
ATOM   5700 O OE2 . GLU D 2 87  ? -55.646 26.822 -195.936 1.00 86.18  ? 81  GLU N OE2 1 
ATOM   5701 N N   . ASP D 2 88  ? -56.288 30.947 -192.199 1.00 46.71  ? 82  ASP N N   1 
ATOM   5702 C CA  . ASP D 2 88  ? -55.744 32.296 -192.317 1.00 46.08  ? 82  ASP N CA  1 
ATOM   5703 C C   . ASP D 2 88  ? -56.206 33.182 -191.186 1.00 49.56  ? 82  ASP N C   1 
ATOM   5704 O O   . ASP D 2 88  ? -55.905 34.374 -191.168 1.00 51.08  ? 82  ASP N O   1 
ATOM   5705 C CB  . ASP D 2 88  ? -56.177 32.932 -193.637 1.00 50.55  ? 82  ASP N CB  1 
ATOM   5706 C CG  . ASP D 2 88  ? -55.579 32.233 -194.856 1.00 61.45  ? 82  ASP N CG  1 
ATOM   5707 O OD1 . ASP D 2 88  ? -56.071 32.471 -195.976 1.00 59.74  ? 82  ASP N OD1 1 
ATOM   5708 O OD2 . ASP D 2 88  ? -54.616 31.452 -194.702 1.00 70.32  ? 82  ASP N OD2 1 
ATOM   5709 N N   . VAL D 2 89  ? -56.965 32.611 -190.254 1.00 48.44  ? 83  VAL N N   1 
ATOM   5710 C CA  . VAL D 2 89  ? -57.454 33.392 -189.127 1.00 39.99  ? 83  VAL N CA  1 
ATOM   5711 C C   . VAL D 2 89  ? -56.315 33.677 -188.187 1.00 42.88  ? 83  VAL N C   1 
ATOM   5712 O O   . VAL D 2 89  ? -55.607 32.773 -187.737 1.00 45.06  ? 83  VAL N O   1 
ATOM   5713 C CB  . VAL D 2 89  ? -58.655 32.735 -188.406 1.00 42.79  ? 83  VAL N CB  1 
ATOM   5714 C CG1 . VAL D 2 89  ? -59.796 32.566 -189.408 1.00 41.90  ? 83  VAL N CG1 1 
ATOM   5715 C CG2 . VAL D 2 89  ? -58.283 31.414 -187.795 1.00 40.97  ? 83  VAL N CG2 1 
ATOM   5716 N N   . ALA D 2 90  ? -56.118 34.957 -187.918 1.00 38.79  ? 84  ALA N N   1 
ATOM   5717 C CA  . ALA D 2 90  ? -54.966 35.369 -187.152 1.00 38.14  ? 84  ALA N CA  1 
ATOM   5718 C C   . ALA D 2 90  ? -55.088 36.835 -186.824 1.00 43.55  ? 84  ALA N C   1 
ATOM   5719 O O   . ALA D 2 90  ? -56.087 37.479 -187.161 1.00 43.63  ? 84  ALA N O   1 
ATOM   5720 C CB  . ALA D 2 90  ? -53.719 35.129 -187.949 1.00 42.75  ? 84  ALA N CB  1 
ATOM   5721 N N   . VAL D 2 91  ? -54.065 37.363 -186.166 1.00 39.11  ? 85  VAL N N   1 
ATOM   5722 C CA  . VAL D 2 91  ? -53.939 38.800 -186.048 1.00 40.24  ? 85  VAL N CA  1 
ATOM   5723 C C   . VAL D 2 91  ? -52.897 39.257 -187.035 1.00 44.21  ? 85  VAL N C   1 
ATOM   5724 O O   . VAL D 2 91  ? -51.838 38.636 -187.148 1.00 47.66  ? 85  VAL N O   1 
ATOM   5725 C CB  . VAL D 2 91  ? -53.522 39.206 -184.655 1.00 42.06  ? 85  VAL N CB  1 
ATOM   5726 C CG1 . VAL D 2 91  ? -53.400 40.699 -184.579 1.00 37.93  ? 85  VAL N CG1 1 
ATOM   5727 C CG2 . VAL D 2 91  ? -54.539 38.685 -183.659 1.00 33.88  ? 85  VAL N CG2 1 
ATOM   5728 N N   . TYR D 2 92  ? -53.208 40.324 -187.766 1.00 42.29  ? 86  TYR N N   1 
ATOM   5729 C CA  . TYR D 2 92  ? -52.298 40.847 -188.782 1.00 38.02  ? 86  TYR N CA  1 
ATOM   5730 C C   . TYR D 2 92  ? -51.732 42.194 -188.370 1.00 48.86  ? 86  TYR N C   1 
ATOM   5731 O O   . TYR D 2 92  ? -52.471 43.089 -187.933 1.00 51.47  ? 86  TYR N O   1 
ATOM   5732 C CB  . TYR D 2 92  ? -52.998 40.948 -190.136 1.00 39.21  ? 86  TYR N CB  1 
ATOM   5733 C CG  . TYR D 2 92  ? -53.290 39.602 -190.748 1.00 40.18  ? 86  TYR N CG  1 
ATOM   5734 C CD1 . TYR D 2 92  ? -52.408 39.012 -191.636 1.00 36.78  ? 86  TYR N CD1 1 
ATOM   5735 C CD2 . TYR D 2 92  ? -54.436 38.903 -190.400 1.00 40.30  ? 86  TYR N CD2 1 
ATOM   5736 C CE1 . TYR D 2 92  ? -52.679 37.771 -192.179 1.00 40.71  ? 86  TYR N CE1 1 
ATOM   5737 C CE2 . TYR D 2 92  ? -54.709 37.674 -190.935 1.00 38.67  ? 86  TYR N CE2 1 
ATOM   5738 C CZ  . TYR D 2 92  ? -53.836 37.111 -191.820 1.00 38.62  ? 86  TYR N CZ  1 
ATOM   5739 O OH  . TYR D 2 92  ? -54.130 35.873 -192.329 1.00 40.17  ? 86  TYR N OH  1 
ATOM   5740 N N   . TYR D 2 93  ? -50.414 42.335 -188.494 1.00 48.46  ? 87  TYR N N   1 
ATOM   5741 C CA  . TYR D 2 93  ? -49.772 43.591 -188.141 1.00 45.36  ? 87  TYR N CA  1 
ATOM   5742 C C   . TYR D 2 93  ? -49.081 44.219 -189.332 1.00 49.52  ? 87  TYR N C   1 
ATOM   5743 O O   . TYR D 2 93  ? -48.399 43.541 -190.101 1.00 55.65  ? 87  TYR N O   1 
ATOM   5744 C CB  . TYR D 2 93  ? -48.745 43.395 -187.024 1.00 41.66  ? 87  TYR N CB  1 
ATOM   5745 C CG  . TYR D 2 93  ? -49.301 42.889 -185.710 1.00 48.45  ? 87  TYR N CG  1 
ATOM   5746 C CD1 . TYR D 2 93  ? -49.313 41.530 -185.420 1.00 47.79  ? 87  TYR N CD1 1 
ATOM   5747 C CD2 . TYR D 2 93  ? -49.789 43.767 -184.747 1.00 48.82  ? 87  TYR N CD2 1 
ATOM   5748 C CE1 . TYR D 2 93  ? -49.801 41.057 -184.224 1.00 47.55  ? 87  TYR N CE1 1 
ATOM   5749 C CE2 . TYR D 2 93  ? -50.277 43.296 -183.532 1.00 44.57  ? 87  TYR N CE2 1 
ATOM   5750 C CZ  . TYR D 2 93  ? -50.281 41.940 -183.283 1.00 47.94  ? 87  TYR N CZ  1 
ATOM   5751 O OH  . TYR D 2 93  ? -50.755 41.447 -182.090 1.00 52.24  ? 87  TYR N OH  1 
ATOM   5752 N N   . CYS D 2 94  ? -49.255 45.522 -189.482 1.00 44.00  ? 88  CYS N N   1 
ATOM   5753 C CA  . CYS D 2 94  ? -48.364 46.269 -190.344 1.00 51.80  ? 88  CYS N CA  1 
ATOM   5754 C C   . CYS D 2 94  ? -47.232 46.865 -189.502 1.00 55.35  ? 88  CYS N C   1 
ATOM   5755 O O   . CYS D 2 94  ? -47.387 47.130 -188.312 1.00 60.71  ? 88  CYS N O   1 
ATOM   5756 C CB  . CYS D 2 94  ? -49.119 47.368 -191.077 1.00 49.96  ? 88  CYS N CB  1 
ATOM   5757 S SG  . CYS D 2 94  ? -49.806 48.651 -190.008 1.00 73.87  ? 88  CYS N SG  1 
ATOM   5758 N N   . GLN D 2 95  ? -46.088 47.068 -190.125 1.00 54.13  ? 89  GLN N N   1 
ATOM   5759 C CA  . GLN D 2 95  ? -44.961 47.670 -189.447 1.00 53.12  ? 89  GLN N CA  1 
ATOM   5760 C C   . GLN D 2 95  ? -44.240 48.609 -190.408 1.00 57.23  ? 89  GLN N C   1 
ATOM   5761 O O   . GLN D 2 95  ? -43.987 48.255 -191.565 1.00 60.66  ? 89  GLN N O   1 
ATOM   5762 C CB  . GLN D 2 95  ? -43.992 46.584 -188.974 1.00 49.71  ? 89  GLN N CB  1 
ATOM   5763 C CG  . GLN D 2 95  ? -42.680 47.124 -188.446 1.00 48.49  ? 89  GLN N CG  1 
ATOM   5764 C CD  . GLN D 2 95  ? -41.529 46.203 -188.745 1.00 57.40  ? 89  GLN N CD  1 
ATOM   5765 O OE1 . GLN D 2 95  ? -41.726 45.017 -188.979 1.00 70.40  ? 89  GLN N OE1 1 
ATOM   5766 N NE2 . GLN D 2 95  ? -40.318 46.739 -188.745 1.00 56.64  ? 89  GLN N NE2 1 
ATOM   5767 N N   . GLN D 2 96  ? -43.913 49.808 -189.943 1.00 54.79  ? 90  GLN N N   1 
ATOM   5768 C CA  . GLN D 2 96  ? -43.005 50.646 -190.711 1.00 51.48  ? 90  GLN N CA  1 
ATOM   5769 C C   . GLN D 2 96  ? -41.559 50.369 -190.291 1.00 53.30  ? 90  GLN N C   1 
ATOM   5770 O O   . GLN D 2 96  ? -41.256 50.255 -189.111 1.00 57.81  ? 90  GLN N O   1 
ATOM   5771 C CB  . GLN D 2 96  ? -43.364 52.126 -190.590 1.00 42.16  ? 90  GLN N CB  1 
ATOM   5772 C CG  . GLN D 2 96  ? -43.145 52.718 -189.224 1.00 49.79  ? 90  GLN N CG  1 
ATOM   5773 C CD  . GLN D 2 96  ? -41.704 53.114 -188.982 1.00 53.33  ? 90  GLN N CD  1 
ATOM   5774 O OE1 . GLN D 2 96  ? -40.881 53.104 -189.900 1.00 52.26  ? 90  GLN N OE1 1 
ATOM   5775 N NE2 . GLN D 2 96  ? -41.387 53.453 -187.738 1.00 54.03  ? 90  GLN N NE2 1 
ATOM   5776 N N   . TYR D 2 97  ? -40.677 50.211 -191.264 1.00 51.46  ? 91  TYR N N   1 
ATOM   5777 C CA  . TYR D 2 97  ? -39.265 50.135 -190.968 1.00 55.40  ? 91  TYR N CA  1 
ATOM   5778 C C   . TYR D 2 97  ? -38.538 51.184 -191.778 1.00 61.62  ? 91  TYR N C   1 
ATOM   5779 O O   . TYR D 2 97  ? -37.500 50.919 -192.371 1.00 64.69  ? 91  TYR N O   1 
ATOM   5780 C CB  . TYR D 2 97  ? -38.702 48.737 -191.214 1.00 60.77  ? 91  TYR N CB  1 
ATOM   5781 C CG  . TYR D 2 97  ? -38.919 48.154 -192.597 1.00 62.65  ? 91  TYR N CG  1 
ATOM   5782 C CD1 . TYR D 2 97  ? -37.841 47.886 -193.437 1.00 62.45  ? 91  TYR N CD1 1 
ATOM   5783 C CD2 . TYR D 2 97  ? -40.189 47.826 -193.043 1.00 58.24  ? 91  TYR N CD2 1 
ATOM   5784 C CE1 . TYR D 2 97  ? -38.030 47.328 -194.686 1.00 56.15  ? 91  TYR N CE1 1 
ATOM   5785 C CE2 . TYR D 2 97  ? -40.384 47.272 -194.285 1.00 61.14  ? 91  TYR N CE2 1 
ATOM   5786 C CZ  . TYR D 2 97  ? -39.303 47.027 -195.104 1.00 58.96  ? 91  TYR N CZ  1 
ATOM   5787 O OH  . TYR D 2 97  ? -39.510 46.476 -196.346 1.00 59.22  ? 91  TYR N OH  1 
ATOM   5788 N N   . TYR D 2 98  ? -39.108 52.385 -191.784 1.00 67.57  ? 92  TYR N N   1 
ATOM   5789 C CA  . TYR D 2 98  ? -38.554 53.524 -192.498 1.00 67.14  ? 92  TYR N CA  1 
ATOM   5790 C C   . TYR D 2 98  ? -37.564 54.315 -191.642 1.00 76.90  ? 92  TYR N C   1 
ATOM   5791 O O   . TYR D 2 98  ? -36.571 54.835 -192.151 1.00 83.00  ? 92  TYR N O   1 
ATOM   5792 C CB  . TYR D 2 98  ? -39.681 54.437 -192.936 1.00 64.90  ? 92  TYR N CB  1 
ATOM   5793 C CG  . TYR D 2 98  ? -39.224 55.669 -193.681 1.00 73.94  ? 92  TYR N CG  1 
ATOM   5794 C CD1 . TYR D 2 98  ? -38.888 55.603 -195.027 1.00 74.08  ? 92  TYR N CD1 1 
ATOM   5795 C CD2 . TYR D 2 98  ? -39.152 56.904 -193.047 1.00 71.96  ? 92  TYR N CD2 1 
ATOM   5796 C CE1 . TYR D 2 98  ? -38.485 56.728 -195.720 1.00 74.40  ? 92  TYR N CE1 1 
ATOM   5797 C CE2 . TYR D 2 98  ? -38.763 58.034 -193.734 1.00 72.50  ? 92  TYR N CE2 1 
ATOM   5798 C CZ  . TYR D 2 98  ? -38.428 57.941 -195.070 1.00 78.06  ? 92  TYR N CZ  1 
ATOM   5799 O OH  . TYR D 2 98  ? -38.024 59.062 -195.763 1.00 87.55  ? 92  TYR N OH  1 
ATOM   5800 N N   . SER D 2 99  ? -37.842 54.399 -190.344 1.00 73.41  ? 93  SER N N   1 
ATOM   5801 C CA  . SER D 2 99  ? -37.016 55.163 -189.432 1.00 74.42  ? 93  SER N CA  1 
ATOM   5802 C C   . SER D 2 99  ? -37.206 54.658 -188.014 1.00 73.83  ? 93  SER N C   1 
ATOM   5803 O O   . SER D 2 99  ? -38.293 54.221 -187.649 1.00 74.21  ? 93  SER N O   1 
ATOM   5804 C CB  . SER D 2 99  ? -37.411 56.634 -189.488 1.00 87.44  ? 93  SER N CB  1 
ATOM   5805 O OG  . SER D 2 99  ? -38.537 56.878 -188.661 1.00 93.66  ? 93  SER N OG  1 
ATOM   5806 N N   . ALA D 2 100 ? -36.153 54.735 -187.205 1.00 73.22  ? 94  ALA N N   1 
ATOM   5807 C CA  . ALA D 2 100 ? -36.223 54.258 -185.828 1.00 64.50  ? 94  ALA N CA  1 
ATOM   5808 C C   . ALA D 2 100 ? -37.012 55.232 -184.978 1.00 64.70  ? 94  ALA N C   1 
ATOM   5809 O O   . ALA D 2 100 ? -36.981 56.441 -185.226 1.00 70.63  ? 94  ALA N O   1 
ATOM   5810 C CB  . ALA D 2 100 ? -34.830 54.067 -185.258 1.00 56.75  ? 94  ALA N CB  1 
ATOM   5811 N N   . PRO D 2 101 ? -37.740 54.713 -183.979 1.00 58.86  ? 95  PRO N N   1 
ATOM   5812 C CA  . PRO D 2 101 ? -37.895 53.278 -183.685 1.00 56.83  ? 95  PRO N CA  1 
ATOM   5813 C C   . PRO D 2 101 ? -38.835 52.591 -184.662 1.00 59.64  ? 95  PRO N C   1 
ATOM   5814 O O   . PRO D 2 101 ? -39.892 53.150 -184.961 1.00 61.50  ? 95  PRO N O   1 
ATOM   5815 C CB  . PRO D 2 101 ? -38.574 53.289 -182.310 1.00 56.42  ? 95  PRO N CB  1 
ATOM   5816 C CG  . PRO D 2 101 ? -39.324 54.610 -182.275 1.00 54.82  ? 95  PRO N CG  1 
ATOM   5817 C CD  . PRO D 2 101 ? -38.358 55.554 -182.934 1.00 53.39  ? 95  PRO N CD  1 
ATOM   5818 N N   . LEU D 2 102 ? -38.481 51.403 -185.144 1.00 58.31  ? 96  LEU N N   1 
ATOM   5819 C CA  . LEU D 2 102 ? -39.425 50.637 -185.945 1.00 51.82  ? 96  LEU N CA  1 
ATOM   5820 C C   . LEU D 2 102 ? -40.677 50.480 -185.109 1.00 56.18  ? 96  LEU N C   1 
ATOM   5821 O O   . LEU D 2 102 ? -40.586 50.244 -183.897 1.00 59.95  ? 96  LEU N O   1 
ATOM   5822 C CB  . LEU D 2 102 ? -38.873 49.267 -186.275 1.00 47.63  ? 96  LEU N CB  1 
ATOM   5823 C CG  . LEU D 2 102 ? -37.462 49.293 -186.827 1.00 52.79  ? 96  LEU N CG  1 
ATOM   5824 C CD1 . LEU D 2 102 ? -37.030 47.901 -187.204 1.00 61.77  ? 96  LEU N CD1 1 
ATOM   5825 C CD2 . LEU D 2 102 ? -37.426 50.198 -188.016 1.00 49.94  ? 96  LEU N CD2 1 
ATOM   5826 N N   . THR D 2 103 ? -41.842 50.626 -185.738 1.00 47.27  ? 97  THR N N   1 
ATOM   5827 C CA  . THR D 2 103 ? -43.097 50.598 -184.993 1.00 49.89  ? 97  THR N CA  1 
ATOM   5828 C C   . THR D 2 103 ? -44.162 49.792 -185.708 1.00 54.56  ? 97  THR N C   1 
ATOM   5829 O O   . THR D 2 103 ? -44.166 49.696 -186.937 1.00 56.98  ? 97  THR N O   1 
ATOM   5830 C CB  . THR D 2 103 ? -43.627 52.013 -184.706 1.00 52.40  ? 97  THR N CB  1 
ATOM   5831 O OG1 . THR D 2 103 ? -43.476 52.829 -185.873 1.00 53.27  ? 97  THR N OG1 1 
ATOM   5832 C CG2 . THR D 2 103 ? -42.862 52.643 -183.555 1.00 50.44  ? 97  THR N CG2 1 
ATOM   5833 N N   . PHE D 2 104 ? -45.065 49.224 -184.918 1.00 51.26  ? 98  PHE N N   1 
ATOM   5834 C CA  . PHE D 2 104 ? -46.094 48.322 -185.417 1.00 47.73  ? 98  PHE N CA  1 
ATOM   5835 C C   . PHE D 2 104 ? -47.477 48.929 -185.237 1.00 49.63  ? 98  PHE N C   1 
ATOM   5836 O O   . PHE D 2 104 ? -47.735 49.637 -184.256 1.00 47.40  ? 98  PHE N O   1 
ATOM   5837 C CB  . PHE D 2 104 ? -46.073 47.010 -184.623 1.00 52.54  ? 98  PHE N CB  1 
ATOM   5838 C CG  . PHE D 2 104 ? -44.838 46.169 -184.827 1.00 47.58  ? 98  PHE N CG  1 
ATOM   5839 C CD1 . PHE D 2 104 ? -43.717 46.353 -184.034 1.00 48.11  ? 98  PHE N CD1 1 
ATOM   5840 C CD2 . PHE D 2 104 ? -44.822 45.157 -185.777 1.00 39.81  ? 98  PHE N CD2 1 
ATOM   5841 C CE1 . PHE D 2 104 ? -42.585 45.569 -184.215 1.00 46.89  ? 98  PHE N CE1 1 
ATOM   5842 C CE2 . PHE D 2 104 ? -43.698 44.369 -185.961 1.00 43.10  ? 98  PHE N CE2 1 
ATOM   5843 C CZ  . PHE D 2 104 ? -42.579 44.573 -185.180 1.00 44.17  ? 98  PHE N CZ  1 
ATOM   5844 N N   . GLY D 2 105 ? -48.381 48.637 -186.164 1.00 47.10  ? 99  GLY N N   1 
ATOM   5845 C CA  . GLY D 2 105 ? -49.784 48.911 -185.917 1.00 46.56  ? 99  GLY N CA  1 
ATOM   5846 C C   . GLY D 2 105 ? -50.318 48.044 -184.778 1.00 49.00  ? 99  GLY N C   1 
ATOM   5847 O O   . GLY D 2 105 ? -49.648 47.141 -184.287 1.00 53.49  ? 99  GLY N O   1 
ATOM   5848 N N   . GLY D 2 106 ? -51.539 48.314 -184.355 1.00 45.93  ? 100 GLY N N   1 
ATOM   5849 C CA  . GLY D 2 106 ? -52.115 47.605 -183.239 1.00 47.16  ? 100 GLY N CA  1 
ATOM   5850 C C   . GLY D 2 106 ? -52.644 46.233 -183.597 1.00 49.82  ? 100 GLY N C   1 
ATOM   5851 O O   . GLY D 2 106 ? -53.165 45.519 -182.743 1.00 51.96  ? 100 GLY N O   1 
ATOM   5852 N N   . GLY D 2 107 ? -52.509 45.856 -184.859 1.00 42.92  ? 101 GLY N N   1 
ATOM   5853 C CA  . GLY D 2 107 ? -52.992 44.564 -185.297 1.00 45.80  ? 101 GLY N CA  1 
ATOM   5854 C C   . GLY D 2 107 ? -54.464 44.536 -185.644 1.00 45.84  ? 101 GLY N C   1 
ATOM   5855 O O   . GLY D 2 107 ? -55.274 45.280 -185.094 1.00 52.88  ? 101 GLY N O   1 
ATOM   5856 N N   . THR D 2 108 ? -54.805 43.668 -186.585 1.00 44.68  ? 102 THR N N   1 
ATOM   5857 C CA  . THR D 2 108 ? -56.185 43.454 -186.989 1.00 44.21  ? 102 THR N CA  1 
ATOM   5858 C C   . THR D 2 108 ? -56.468 41.960 -186.892 1.00 45.00  ? 102 THR N C   1 
ATOM   5859 O O   . THR D 2 108 ? -55.686 41.140 -187.351 1.00 51.10  ? 102 THR N O   1 
ATOM   5860 C CB  . THR D 2 108 ? -56.423 43.905 -188.448 1.00 47.63  ? 102 THR N CB  1 
ATOM   5861 O OG1 . THR D 2 108 ? -56.063 45.290 -188.611 1.00 56.54  ? 102 THR N OG1 1 
ATOM   5862 C CG2 . THR D 2 108 ? -57.887 43.694 -188.838 1.00 44.02  ? 102 THR N CG2 1 
ATOM   5863 N N   . LYS D 2 109 ? -57.589 41.609 -186.288 1.00 48.24  ? 103 LYS N N   1 
ATOM   5864 C CA  . LYS D 2 109 ? -57.934 40.216 -186.071 1.00 47.32  ? 103 LYS N CA  1 
ATOM   5865 C C   . LYS D 2 109 ? -58.847 39.755 -187.197 1.00 47.12  ? 103 LYS N C   1 
ATOM   5866 O O   . LYS D 2 109 ? -59.880 40.354 -187.442 1.00 51.92  ? 103 LYS N O   1 
ATOM   5867 C CB  . LYS D 2 109 ? -58.649 40.071 -184.725 1.00 44.92  ? 103 LYS N CB  1 
ATOM   5868 C CG  . LYS D 2 109 ? -58.746 38.652 -184.213 1.00 54.20  ? 103 LYS N CG  1 
ATOM   5869 C CD  . LYS D 2 109 ? -59.675 38.568 -183.017 1.00 72.04  ? 103 LYS N CD  1 
ATOM   5870 C CE  . LYS D 2 109 ? -59.186 37.534 -182.008 1.00 88.21  ? 103 LYS N CE  1 
ATOM   5871 N NZ  . LYS D 2 109 ? -60.058 37.495 -180.788 1.00 101.17 ? 103 LYS N NZ  1 
ATOM   5872 N N   . VAL D 2 110 ? -58.466 38.688 -187.883 1.00 49.08  ? 104 VAL N N   1 
ATOM   5873 C CA  . VAL D 2 110 ? -59.291 38.147 -188.957 1.00 49.67  ? 104 VAL N CA  1 
ATOM   5874 C C   . VAL D 2 110 ? -59.952 36.839 -188.527 1.00 48.88  ? 104 VAL N C   1 
ATOM   5875 O O   . VAL D 2 110 ? -59.268 35.871 -188.180 1.00 50.56  ? 104 VAL N O   1 
ATOM   5876 C CB  . VAL D 2 110 ? -58.468 37.918 -190.249 1.00 45.84  ? 104 VAL N CB  1 
ATOM   5877 C CG1 . VAL D 2 110 ? -59.370 37.463 -191.380 1.00 42.33  ? 104 VAL N CG1 1 
ATOM   5878 C CG2 . VAL D 2 110 ? -57.753 39.185 -190.642 1.00 44.50  ? 104 VAL N CG2 1 
ATOM   5879 N N   . GLU D 2 111 ? -61.280 36.822 -188.546 1.00 47.53  ? 105 GLU N N   1 
ATOM   5880 C CA  . GLU D 2 111 ? -62.045 35.630 -188.195 1.00 52.26  ? 105 GLU N CA  1 
ATOM   5881 C C   . GLU D 2 111 ? -62.938 35.218 -189.355 1.00 52.21  ? 105 GLU N C   1 
ATOM   5882 O O   . GLU D 2 111 ? -63.193 36.005 -190.257 1.00 49.78  ? 105 GLU N O   1 
ATOM   5883 C CB  . GLU D 2 111 ? -62.895 35.895 -186.955 1.00 63.69  ? 105 GLU N CB  1 
ATOM   5884 C CG  . GLU D 2 111 ? -62.124 36.560 -185.832 1.00 79.97  ? 105 GLU N CG  1 
ATOM   5885 C CD  . GLU D 2 111 ? -62.760 36.391 -184.459 1.00 88.29  ? 105 GLU N CD  1 
ATOM   5886 O OE1 . GLU D 2 111 ? -62.328 35.488 -183.702 1.00 79.66  ? 105 GLU N OE1 1 
ATOM   5887 O OE2 . GLU D 2 111 ? -63.686 37.169 -184.142 1.00 95.59  ? 105 GLU N OE2 1 
ATOM   5888 N N   . ILE D 2 112 ? -63.409 33.980 -189.330 1.00 45.25  ? 106 ILE N N   1 
ATOM   5889 C CA  . ILE D 2 112 ? -64.272 33.465 -190.381 1.00 43.22  ? 106 ILE N CA  1 
ATOM   5890 C C   . ILE D 2 112 ? -65.743 33.612 -190.001 1.00 44.82  ? 106 ILE N C   1 
ATOM   5891 O O   . ILE D 2 112 ? -66.143 33.210 -188.918 1.00 45.53  ? 106 ILE N O   1 
ATOM   5892 C CB  . ILE D 2 112 ? -63.983 31.975 -190.619 1.00 49.44  ? 106 ILE N CB  1 
ATOM   5893 C CG1 . ILE D 2 112 ? -62.578 31.782 -191.216 1.00 46.64  ? 106 ILE N CG1 1 
ATOM   5894 C CG2 . ILE D 2 112 ? -65.049 31.359 -191.511 1.00 50.09  ? 106 ILE N CG2 1 
ATOM   5895 C CD1 . ILE D 2 112 ? -62.464 32.158 -192.667 1.00 44.58  ? 106 ILE N CD1 1 
ATOM   5896 N N   . LYS D 2 113 ? -66.549 34.202 -190.878 1.00 49.79  ? 107 LYS N N   1 
ATOM   5897 C CA  . LYS D 2 113 ? -68.000 34.115 -190.739 1.00 49.50  ? 107 LYS N CA  1 
ATOM   5898 C C   . LYS D 2 113 ? -68.406 32.709 -191.148 1.00 47.82  ? 107 LYS N C   1 
ATOM   5899 O O   . LYS D 2 113 ? -68.050 32.247 -192.235 1.00 44.95  ? 107 LYS N O   1 
ATOM   5900 C CB  . LYS D 2 113 ? -68.719 35.139 -191.626 1.00 56.22  ? 107 LYS N CB  1 
ATOM   5901 C CG  . LYS D 2 113 ? -69.158 36.401 -190.905 1.00 62.44  ? 107 LYS N CG  1 
ATOM   5902 C CD  . LYS D 2 113 ? -70.443 37.014 -191.479 1.00 62.86  ? 107 LYS N CD  1 
ATOM   5903 C CE  . LYS D 2 113 ? -70.193 37.828 -192.736 1.00 66.17  ? 107 LYS N CE  1 
ATOM   5904 N NZ  . LYS D 2 113 ? -70.345 37.021 -193.983 1.00 66.65  ? 107 LYS N NZ  1 
ATOM   5905 N N   . ARG D 2 114 ? -69.182 32.056 -190.290 1.00 48.64  ? 108 ARG N N   1 
ATOM   5906 C CA  . ARG D 2 114 ? -69.464 30.624 -190.381 1.00 46.33  ? 108 ARG N CA  1 
ATOM   5907 C C   . ARG D 2 114 ? -70.939 30.435 -190.062 1.00 49.20  ? 108 ARG N C   1 
ATOM   5908 O O   . ARG D 2 114 ? -71.577 31.347 -189.555 1.00 50.72  ? 108 ARG N O   1 
ATOM   5909 C CB  . ARG D 2 114 ? -68.682 29.953 -189.279 1.00 46.74  ? 108 ARG N CB  1 
ATOM   5910 C CG  . ARG D 2 114 ? -68.203 28.608 -189.550 1.00 43.68  ? 108 ARG N CG  1 
ATOM   5911 C CD  . ARG D 2 114 ? -68.321 27.807 -188.287 1.00 37.89  ? 108 ARG N CD  1 
ATOM   5912 N NE  . ARG D 2 114 ? -69.535 27.026 -188.399 1.00 43.01  ? 108 ARG N NE  1 
ATOM   5913 C CZ  . ARG D 2 114 ? -69.559 25.709 -188.474 1.00 41.34  ? 108 ARG N CZ  1 
ATOM   5914 N NH1 . ARG D 2 114 ? -70.715 25.082 -188.599 1.00 46.75  ? 108 ARG N NH1 1 
ATOM   5915 N NH2 . ARG D 2 114 ? -68.427 25.026 -188.387 1.00 39.73  ? 108 ARG N NH2 1 
ATOM   5916 N N   . THR D 2 115 ? -71.495 29.259 -190.318 1.00 47.69  ? 109 THR N N   1 
ATOM   5917 C CA  . THR D 2 115 ? -72.867 29.026 -189.886 1.00 43.49  ? 109 THR N CA  1 
ATOM   5918 C C   . THR D 2 115 ? -72.944 28.719 -188.396 1.00 47.21  ? 109 THR N C   1 
ATOM   5919 O O   . THR D 2 115 ? -72.014 28.149 -187.810 1.00 46.40  ? 109 THR N O   1 
ATOM   5920 C CB  . THR D 2 115 ? -73.544 27.897 -190.657 1.00 43.80  ? 109 THR N CB  1 
ATOM   5921 O OG1 . THR D 2 115 ? -72.781 26.701 -190.509 1.00 42.92  ? 109 THR N OG1 1 
ATOM   5922 C CG2 . THR D 2 115 ? -73.646 28.250 -192.123 1.00 44.37  ? 109 THR N CG2 1 
ATOM   5923 N N   . VAL D 2 116 ? -74.059 29.108 -187.781 1.00 41.93  ? 110 VAL N N   1 
ATOM   5924 C CA  . VAL D 2 116 ? -74.294 28.786 -186.378 1.00 37.48  ? 110 VAL N CA  1 
ATOM   5925 C C   . VAL D 2 116 ? -74.026 27.293 -186.131 1.00 37.40  ? 110 VAL N C   1 
ATOM   5926 O O   . VAL D 2 116 ? -74.341 26.449 -186.958 1.00 38.18  ? 110 VAL N O   1 
ATOM   5927 C CB  . VAL D 2 116 ? -75.743 29.145 -185.941 1.00 36.74  ? 110 VAL N CB  1 
ATOM   5928 C CG1 . VAL D 2 116 ? -76.772 28.414 -186.804 1.00 33.13  ? 110 VAL N CG1 1 
ATOM   5929 C CG2 . VAL D 2 116 ? -75.964 28.824 -184.465 1.00 42.04  ? 110 VAL N CG2 1 
ATOM   5930 N N   . ALA D 2 117 ? -73.439 26.968 -184.992 1.00 40.19  ? 111 ALA N N   1 
ATOM   5931 C CA  . ALA D 2 117 ? -73.215 25.577 -184.629 1.00 39.95  ? 111 ALA N CA  1 
ATOM   5932 C C   . ALA D 2 117 ? -73.310 25.495 -183.131 1.00 43.86  ? 111 ALA N C   1 
ATOM   5933 O O   . ALA D 2 117 ? -72.710 26.305 -182.434 1.00 46.73  ? 111 ALA N O   1 
ATOM   5934 C CB  . ALA D 2 117 ? -71.862 25.127 -185.074 1.00 37.00  ? 111 ALA N CB  1 
ATOM   5935 N N   . ALA D 2 118 ? -74.051 24.506 -182.645 1.00 44.14  ? 112 ALA N N   1 
ATOM   5936 C CA  . ALA D 2 118 ? -74.358 24.384 -181.230 1.00 44.84  ? 112 ALA N CA  1 
ATOM   5937 C C   . ALA D 2 118 ? -73.235 23.717 -180.456 1.00 52.49  ? 112 ALA N C   1 
ATOM   5938 O O   . ALA D 2 118 ? -72.586 22.807 -180.949 1.00 60.18  ? 112 ALA N O   1 
ATOM   5939 C CB  . ALA D 2 118 ? -75.652 23.630 -181.039 1.00 41.21  ? 112 ALA N CB  1 
ATOM   5940 N N   . PRO D 2 119 ? -72.999 24.176 -179.229 1.00 53.70  ? 113 PRO N N   1 
ATOM   5941 C CA  . PRO D 2 119 ? -71.957 23.554 -178.405 1.00 46.50  ? 113 PRO N CA  1 
ATOM   5942 C C   . PRO D 2 119 ? -72.356 22.160 -177.945 1.00 47.06  ? 113 PRO N C   1 
ATOM   5943 O O   . PRO D 2 119 ? -73.534 21.899 -177.760 1.00 48.38  ? 113 PRO N O   1 
ATOM   5944 C CB  . PRO D 2 119 ? -71.873 24.481 -177.193 1.00 43.66  ? 113 PRO N CB  1 
ATOM   5945 C CG  . PRO D 2 119 ? -73.185 25.144 -177.125 1.00 50.73  ? 113 PRO N CG  1 
ATOM   5946 C CD  . PRO D 2 119 ? -73.661 25.299 -178.548 1.00 52.10  ? 113 PRO N CD  1 
ATOM   5947 N N   . SER D 2 120 ? -71.376 21.274 -177.787 1.00 56.87  ? 114 SER N N   1 
ATOM   5948 C CA  . SER D 2 120 ? -71.567 20.025 -177.053 1.00 59.32  ? 114 SER N CA  1 
ATOM   5949 C C   . SER D 2 120 ? -71.142 20.330 -175.636 1.00 62.38  ? 114 SER N C   1 
ATOM   5950 O O   . SER D 2 120 ? -70.039 20.841 -175.422 1.00 56.42  ? 114 SER N O   1 
ATOM   5951 C CB  . SER D 2 120 ? -70.674 18.920 -177.601 1.00 57.21  ? 114 SER N CB  1 
ATOM   5952 O OG  . SER D 2 120 ? -70.542 19.024 -179.003 1.00 63.14  ? 114 SER N OG  1 
ATOM   5953 N N   . VAL D 2 121 ? -72.011 20.022 -174.677 1.00 61.61  ? 115 VAL N N   1 
ATOM   5954 C CA  . VAL D 2 121 ? -71.775 20.393 -173.292 1.00 56.56  ? 115 VAL N CA  1 
ATOM   5955 C C   . VAL D 2 121 ? -71.418 19.211 -172.404 1.00 66.83  ? 115 VAL N C   1 
ATOM   5956 O O   . VAL D 2 121 ? -72.105 18.193 -172.389 1.00 74.60  ? 115 VAL N O   1 
ATOM   5957 C CB  . VAL D 2 121 ? -72.983 21.132 -172.711 1.00 57.53  ? 115 VAL N CB  1 
ATOM   5958 C CG1 . VAL D 2 121 ? -72.623 21.753 -171.373 1.00 59.60  ? 115 VAL N CG1 1 
ATOM   5959 C CG2 . VAL D 2 121 ? -73.463 22.211 -173.682 1.00 51.11  ? 115 VAL N CG2 1 
ATOM   5960 N N   . PHE D 2 122 ? -70.336 19.374 -171.653 1.00 72.59  ? 116 PHE N N   1 
ATOM   5961 C CA  . PHE D 2 122 ? -69.853 18.366 -170.727 1.00 72.16  ? 116 PHE N CA  1 
ATOM   5962 C C   . PHE D 2 122 ? -69.638 18.974 -169.347 1.00 79.27  ? 116 PHE N C   1 
ATOM   5963 O O   . PHE D 2 122 ? -69.119 20.077 -169.222 1.00 80.16  ? 116 PHE N O   1 
ATOM   5964 C CB  . PHE D 2 122 ? -68.546 17.795 -171.253 1.00 70.40  ? 116 PHE N CB  1 
ATOM   5965 C CG  . PHE D 2 122 ? -68.643 17.301 -172.659 1.00 73.46  ? 116 PHE N CG  1 
ATOM   5966 C CD1 . PHE D 2 122 ? -68.083 18.011 -173.697 1.00 77.04  ? 116 PHE N CD1 1 
ATOM   5967 C CD2 . PHE D 2 122 ? -69.325 16.137 -172.949 1.00 70.15  ? 116 PHE N CD2 1 
ATOM   5968 C CE1 . PHE D 2 122 ? -68.185 17.555 -174.999 1.00 75.19  ? 116 PHE N CE1 1 
ATOM   5969 C CE2 . PHE D 2 122 ? -69.424 15.682 -174.244 1.00 69.36  ? 116 PHE N CE2 1 
ATOM   5970 C CZ  . PHE D 2 122 ? -68.855 16.392 -175.267 1.00 70.25  ? 116 PHE N CZ  1 
ATOM   5971 N N   . ILE D 2 123 ? -70.048 18.247 -168.314 1.00 84.33  ? 117 ILE N N   1 
ATOM   5972 C CA  . ILE D 2 123 ? -69.915 18.702 -166.939 1.00 80.36  ? 117 ILE N CA  1 
ATOM   5973 C C   . ILE D 2 123 ? -68.882 17.799 -166.283 1.00 83.85  ? 117 ILE N C   1 
ATOM   5974 O O   . ILE D 2 123 ? -68.790 16.618 -166.624 1.00 86.57  ? 117 ILE N O   1 
ATOM   5975 C CB  . ILE D 2 123 ? -71.273 18.595 -166.207 1.00 82.61  ? 117 ILE N CB  1 
ATOM   5976 C CG1 . ILE D 2 123 ? -71.649 19.907 -165.498 1.00 79.53  ? 117 ILE N CG1 1 
ATOM   5977 C CG2 . ILE D 2 123 ? -71.303 17.394 -165.291 1.00 89.13  ? 117 ILE N CG2 1 
ATOM   5978 C CD1 . ILE D 2 123 ? -71.004 20.137 -164.158 1.00 68.74  ? 117 ILE N CD1 1 
ATOM   5979 N N   . PHE D 2 124 ? -68.091 18.354 -165.367 1.00 84.19  ? 118 PHE N N   1 
ATOM   5980 C CA  . PHE D 2 124 ? -67.047 17.597 -164.666 1.00 85.16  ? 118 PHE N CA  1 
ATOM   5981 C C   . PHE D 2 124 ? -67.033 17.886 -163.173 1.00 88.36  ? 118 PHE N C   1 
ATOM   5982 O O   . PHE D 2 124 ? -66.746 19.010 -162.756 1.00 86.29  ? 118 PHE N O   1 
ATOM   5983 C CB  . PHE D 2 124 ? -65.660 17.955 -165.180 1.00 85.87  ? 118 PHE N CB  1 
ATOM   5984 C CG  . PHE D 2 124 ? -65.361 17.472 -166.563 1.00 88.03  ? 118 PHE N CG  1 
ATOM   5985 C CD1 . PHE D 2 124 ? -64.908 16.183 -166.775 1.00 90.19  ? 118 PHE N CD1 1 
ATOM   5986 C CD2 . PHE D 2 124 ? -65.470 18.329 -167.648 1.00 77.96  ? 118 PHE N CD2 1 
ATOM   5987 C CE1 . PHE D 2 124 ? -64.593 15.750 -168.054 1.00 87.43  ? 118 PHE N CE1 1 
ATOM   5988 C CE2 . PHE D 2 124 ? -65.163 17.898 -168.923 1.00 71.84  ? 118 PHE N CE2 1 
ATOM   5989 C CZ  . PHE D 2 124 ? -64.722 16.614 -169.129 1.00 74.91  ? 118 PHE N CZ  1 
ATOM   5990 N N   . PRO D 2 125 ? -67.308 16.864 -162.355 1.00 93.42  ? 119 PRO N N   1 
ATOM   5991 C CA  . PRO D 2 125 ? -67.204 17.030 -160.906 1.00 95.71  ? 119 PRO N CA  1 
ATOM   5992 C C   . PRO D 2 125 ? -65.745 17.000 -160.461 1.00 97.95  ? 119 PRO N C   1 
ATOM   5993 O O   . PRO D 2 125 ? -64.914 16.394 -161.142 1.00 92.17  ? 119 PRO N O   1 
ATOM   5994 C CB  . PRO D 2 125 ? -67.947 15.804 -160.363 1.00 96.05  ? 119 PRO N CB  1 
ATOM   5995 C CG  . PRO D 2 125 ? -68.725 15.256 -161.535 1.00 94.88  ? 119 PRO N CG  1 
ATOM   5996 C CD  . PRO D 2 125 ? -67.861 15.549 -162.709 1.00 92.47  ? 119 PRO N CD  1 
ATOM   5997 N N   . PRO D 2 126 ? -65.439 17.644 -159.324 1.00 103.75 ? 120 PRO N N   1 
ATOM   5998 C CA  . PRO D 2 126 ? -64.079 17.689 -158.777 1.00 101.11 ? 120 PRO N CA  1 
ATOM   5999 C C   . PRO D 2 126 ? -63.563 16.273 -158.573 1.00 98.02  ? 120 PRO N C   1 
ATOM   6000 O O   . PRO D 2 126 ? -64.348 15.372 -158.281 1.00 94.78  ? 120 PRO N O   1 
ATOM   6001 C CB  . PRO D 2 126 ? -64.277 18.388 -157.426 1.00 103.48 ? 120 PRO N CB  1 
ATOM   6002 C CG  . PRO D 2 126 ? -65.739 18.137 -157.096 1.00 105.94 ? 120 PRO N CG  1 
ATOM   6003 C CD  . PRO D 2 126 ? -66.397 18.302 -158.422 1.00 106.04 ? 120 PRO N CD  1 
ATOM   6004 N N   . SER D 2 127 ? -62.257 16.090 -158.725 1.00 101.05 ? 121 SER N N   1 
ATOM   6005 C CA  . SER D 2 127 ? -61.636 14.770 -158.699 1.00 109.80 ? 121 SER N CA  1 
ATOM   6006 C C   . SER D 2 127 ? -61.282 14.285 -157.293 1.00 113.91 ? 121 SER N C   1 
ATOM   6007 O O   . SER D 2 127 ? -61.253 15.062 -156.337 1.00 113.04 ? 121 SER N O   1 
ATOM   6008 C CB  . SER D 2 127 ? -60.354 14.798 -159.525 1.00 109.09 ? 121 SER N CB  1 
ATOM   6009 O OG  . SER D 2 127 ? -59.331 15.474 -158.812 1.00 109.02 ? 121 SER N OG  1 
ATOM   6010 N N   . ASP D 2 128 ? -60.991 12.992 -157.185 1.00 113.33 ? 122 ASP N N   1 
ATOM   6011 C CA  . ASP D 2 128 ? -60.521 12.426 -155.933 1.00 112.86 ? 122 ASP N CA  1 
ATOM   6012 C C   . ASP D 2 128 ? -59.350 13.250 -155.404 1.00 111.02 ? 122 ASP N C   1 
ATOM   6013 O O   . ASP D 2 128 ? -59.390 13.758 -154.283 1.00 109.27 ? 122 ASP N O   1 
ATOM   6014 C CB  . ASP D 2 128 ? -60.115 10.969 -156.130 1.00 112.73 ? 122 ASP N CB  1 
ATOM   6015 N N   . GLU D 2 129 ? -58.315 13.399 -156.226 1.00 109.10 ? 123 GLU N N   1 
ATOM   6016 C CA  . GLU D 2 129 ? -57.103 14.095 -155.803 1.00 103.87 ? 123 GLU N CA  1 
ATOM   6017 C C   . GLU D 2 129 ? -57.395 15.503 -155.280 1.00 107.75 ? 123 GLU N C   1 
ATOM   6018 O O   . GLU D 2 129 ? -56.968 15.864 -154.191 1.00 102.67 ? 123 GLU N O   1 
ATOM   6019 C CB  . GLU D 2 129 ? -56.077 14.132 -156.937 1.00 92.84  ? 123 GLU N CB  1 
ATOM   6020 N N   . GLN D 2 130 ? -58.135 16.293 -156.054 1.00 114.80 ? 124 GLN N N   1 
ATOM   6021 C CA  . GLN D 2 130 ? -58.404 17.687 -155.693 1.00 109.75 ? 124 GLN N CA  1 
ATOM   6022 C C   . GLN D 2 130 ? -59.235 17.828 -154.414 1.00 109.44 ? 124 GLN N C   1 
ATOM   6023 O O   . GLN D 2 130 ? -59.135 18.829 -153.702 1.00 102.52 ? 124 GLN N O   1 
ATOM   6024 C CB  . GLN D 2 130 ? -59.079 18.424 -156.852 1.00 102.51 ? 124 GLN N CB  1 
ATOM   6025 C CG  . GLN D 2 130 ? -59.364 19.876 -156.554 1.00 96.53  ? 124 GLN N CG  1 
ATOM   6026 C CD  . GLN D 2 130 ? -60.160 20.551 -157.639 1.00 91.56  ? 124 GLN N CD  1 
ATOM   6027 O OE1 . GLN D 2 130 ? -60.172 21.780 -157.725 1.00 91.99  ? 124 GLN N OE1 1 
ATOM   6028 N NE2 . GLN D 2 130 ? -60.832 19.756 -158.479 1.00 80.55  ? 124 GLN N NE2 1 
ATOM   6029 N N   . LEU D 2 131 ? -60.059 16.825 -154.133 1.00 116.38 ? 125 LEU N N   1 
ATOM   6030 C CA  . LEU D 2 131 ? -60.829 16.796 -152.894 1.00 123.76 ? 125 LEU N CA  1 
ATOM   6031 C C   . LEU D 2 131 ? -59.913 16.840 -151.663 1.00 126.70 ? 125 LEU N C   1 
ATOM   6032 O O   . LEU D 2 131 ? -60.252 17.457 -150.653 1.00 126.76 ? 125 LEU N O   1 
ATOM   6033 C CB  . LEU D 2 131 ? -61.712 15.553 -152.857 1.00 124.89 ? 125 LEU N CB  1 
ATOM   6034 C CG  . LEU D 2 131 ? -62.676 15.411 -154.033 1.00 121.31 ? 125 LEU N CG  1 
ATOM   6035 C CD1 . LEU D 2 131 ? -63.193 13.979 -154.136 1.00 123.98 ? 125 LEU N CD1 1 
ATOM   6036 C CD2 . LEU D 2 131 ? -63.825 16.408 -153.928 1.00 118.79 ? 125 LEU N CD2 1 
ATOM   6037 N N   . LYS D 2 132 ? -58.758 16.182 -151.752 1.00 125.17 ? 126 LYS N N   1 
ATOM   6038 C CA  . LYS D 2 132 ? -57.729 16.287 -150.718 1.00 127.05 ? 126 LYS N CA  1 
ATOM   6039 C C   . LYS D 2 132 ? -57.048 17.670 -150.771 1.00 125.39 ? 126 LYS N C   1 
ATOM   6040 O O   . LYS D 2 132 ? -55.949 17.852 -151.322 1.00 109.81 ? 126 LYS N O   1 
ATOM   6041 C CB  . LYS D 2 132 ? -56.715 15.142 -150.832 1.00 128.23 ? 126 LYS N CB  1 
ATOM   6042 C CG  . LYS D 2 132 ? -57.333 13.748 -150.742 1.00 136.32 ? 126 LYS N CG  1 
ATOM   6043 C CD  . LYS D 2 132 ? -57.937 13.476 -149.358 1.00 149.25 ? 126 LYS N CD  1 
ATOM   6044 C CE  . LYS D 2 132 ? -58.860 12.244 -149.362 1.00 153.48 ? 126 LYS N CE  1 
ATOM   6045 N NZ  . LYS D 2 132 ? -59.365 11.850 -148.004 1.00 153.17 ? 126 LYS N NZ  1 
ATOM   6046 N N   . SER D 2 133 ? -57.741 18.635 -150.175 1.00 132.37 ? 127 SER N N   1 
ATOM   6047 C CA  . SER D 2 133 ? -57.376 20.046 -150.177 1.00 130.67 ? 127 SER N CA  1 
ATOM   6048 C C   . SER D 2 133 ? -58.700 20.779 -150.006 1.00 132.66 ? 127 SER N C   1 
ATOM   6049 O O   . SER D 2 133 ? -59.751 20.288 -150.440 1.00 134.20 ? 127 SER N O   1 
ATOM   6050 C CB  . SER D 2 133 ? -56.709 20.460 -151.485 1.00 129.45 ? 127 SER N CB  1 
ATOM   6051 O OG  . SER D 2 133 ? -57.671 20.670 -152.511 1.00 132.23 ? 127 SER N OG  1 
ATOM   6052 N N   . GLY D 2 134 ? -58.665 21.944 -149.372 1.00 129.79 ? 128 GLY N N   1 
ATOM   6053 C CA  . GLY D 2 134 ? -59.894 22.627 -149.016 1.00 128.83 ? 128 GLY N CA  1 
ATOM   6054 C C   . GLY D 2 134 ? -60.677 23.220 -150.173 1.00 124.42 ? 128 GLY N C   1 
ATOM   6055 O O   . GLY D 2 134 ? -61.457 24.148 -149.969 1.00 124.30 ? 128 GLY N O   1 
ATOM   6056 N N   . THR D 2 135 ? -60.493 22.687 -151.379 1.00 121.27 ? 129 THR N N   1 
ATOM   6057 C CA  . THR D 2 135 ? -61.099 23.295 -152.568 1.00 113.52 ? 129 THR N CA  1 
ATOM   6058 C C   . THR D 2 135 ? -61.839 22.323 -153.492 1.00 106.14 ? 129 THR N C   1 
ATOM   6059 O O   . THR D 2 135 ? -61.448 21.166 -153.643 1.00 112.40 ? 129 THR N O   1 
ATOM   6060 C CB  . THR D 2 135 ? -60.047 24.066 -153.384 1.00 102.50 ? 129 THR N CB  1 
ATOM   6061 O OG1 . THR D 2 135 ? -59.238 24.840 -152.492 1.00 96.66  ? 129 THR N OG1 1 
ATOM   6062 C CG2 . THR D 2 135 ? -60.726 24.990 -154.393 1.00 100.34 ? 129 THR N CG2 1 
ATOM   6063 N N   . ALA D 2 136 ? -62.913 22.809 -154.104 1.00 93.28  ? 130 ALA N N   1 
ATOM   6064 C CA  . ALA D 2 136 ? -63.619 22.054 -155.135 1.00 91.74  ? 130 ALA N CA  1 
ATOM   6065 C C   . ALA D 2 136 ? -63.713 22.865 -156.437 1.00 91.69  ? 130 ALA N C   1 
ATOM   6066 O O   . ALA D 2 136 ? -64.121 24.030 -156.420 1.00 89.85  ? 130 ALA N O   1 
ATOM   6067 C CB  . ALA D 2 136 ? -65.004 21.665 -154.645 1.00 87.09  ? 130 ALA N CB  1 
ATOM   6068 N N   . SER D 2 137 ? -63.327 22.260 -157.560 1.00 90.36  ? 131 SER N N   1 
ATOM   6069 C CA  . SER D 2 137 ? -63.471 22.926 -158.864 1.00 81.37  ? 131 SER N CA  1 
ATOM   6070 C C   . SER D 2 137 ? -64.365 22.145 -159.811 1.00 79.88  ? 131 SER N C   1 
ATOM   6071 O O   . SER D 2 137 ? -64.015 21.054 -160.269 1.00 84.71  ? 131 SER N O   1 
ATOM   6072 C CB  . SER D 2 137 ? -62.114 23.189 -159.520 1.00 73.87  ? 131 SER N CB  1 
ATOM   6073 O OG  . SER D 2 137 ? -61.502 24.339 -158.967 1.00 76.86  ? 131 SER N OG  1 
ATOM   6074 N N   . VAL D 2 138 ? -65.533 22.704 -160.093 1.00 76.50  ? 132 VAL N N   1 
ATOM   6075 C CA  . VAL D 2 138 ? -66.443 22.088 -161.043 1.00 78.08  ? 132 VAL N CA  1 
ATOM   6076 C C   . VAL D 2 138 ? -66.131 22.680 -162.416 1.00 81.71  ? 132 VAL N C   1 
ATOM   6077 O O   . VAL D 2 138 ? -65.911 23.890 -162.542 1.00 86.06  ? 132 VAL N O   1 
ATOM   6078 C CB  . VAL D 2 138 ? -67.930 22.328 -160.670 1.00 74.10  ? 132 VAL N CB  1 
ATOM   6079 C CG1 . VAL D 2 138 ? -68.816 21.313 -161.357 1.00 77.61  ? 132 VAL N CG1 1 
ATOM   6080 C CG2 . VAL D 2 138 ? -68.139 22.237 -159.171 1.00 71.18  ? 132 VAL N CG2 1 
ATOM   6081 N N   . VAL D 2 139 ? -66.080 21.832 -163.437 1.00 73.32  ? 133 VAL N N   1 
ATOM   6082 C CA  . VAL D 2 139 ? -65.761 22.316 -164.766 1.00 65.33  ? 133 VAL N CA  1 
ATOM   6083 C C   . VAL D 2 139 ? -66.835 22.000 -165.787 1.00 68.82  ? 133 VAL N C   1 
ATOM   6084 O O   . VAL D 2 139 ? -67.377 20.904 -165.831 1.00 76.73  ? 133 VAL N O   1 
ATOM   6085 C CB  . VAL D 2 139 ? -64.386 21.828 -165.259 1.00 65.98  ? 133 VAL N CB  1 
ATOM   6086 C CG1 . VAL D 2 139 ? -64.131 22.325 -166.656 1.00 64.24  ? 133 VAL N CG1 1 
ATOM   6087 C CG2 . VAL D 2 139 ? -63.299 22.343 -164.341 1.00 70.85  ? 133 VAL N CG2 1 
ATOM   6088 N N   . CYS D 2 140 ? -67.142 22.999 -166.600 1.00 69.67  ? 134 CYS N N   1 
ATOM   6089 C CA  . CYS D 2 140 ? -68.089 22.861 -167.684 1.00 70.84  ? 134 CYS N CA  1 
ATOM   6090 C C   . CYS D 2 140 ? -67.388 23.148 -168.997 1.00 71.29  ? 134 CYS N C   1 
ATOM   6091 O O   . CYS D 2 140 ? -66.787 24.205 -169.157 1.00 70.53  ? 134 CYS N O   1 
ATOM   6092 C CB  . CYS D 2 140 ? -69.211 23.862 -167.501 1.00 71.39  ? 134 CYS N CB  1 
ATOM   6093 S SG  . CYS D 2 140 ? -70.452 23.747 -168.760 1.00 104.14 ? 134 CYS N SG  1 
ATOM   6094 N N   . LEU D 2 141 ? -67.464 22.206 -169.933 1.00 62.97  ? 135 LEU N N   1 
ATOM   6095 C CA  . LEU D 2 141 ? -66.853 22.376 -171.246 1.00 56.37  ? 135 LEU N CA  1 
ATOM   6096 C C   . LEU D 2 141 ? -67.901 22.564 -172.356 1.00 55.69  ? 135 LEU N C   1 
ATOM   6097 O O   . LEU D 2 141 ? -68.808 21.742 -172.506 1.00 59.10  ? 135 LEU N O   1 
ATOM   6098 C CB  . LEU D 2 141 ? -65.967 21.177 -171.566 1.00 47.89  ? 135 LEU N CB  1 
ATOM   6099 C CG  . LEU D 2 141 ? -65.495 21.212 -173.011 1.00 51.45  ? 135 LEU N CG  1 
ATOM   6100 C CD1 . LEU D 2 141 ? -64.396 22.247 -173.161 1.00 49.03  ? 135 LEU N CD1 1 
ATOM   6101 C CD2 . LEU D 2 141 ? -65.000 19.858 -173.429 1.00 59.36  ? 135 LEU N CD2 1 
ATOM   6102 N N   . LEU D 2 142 ? -67.788 23.657 -173.111 1.00 50.37  ? 136 LEU N N   1 
ATOM   6103 C CA  . LEU D 2 142 ? -68.585 23.851 -174.327 1.00 44.92  ? 136 LEU N CA  1 
ATOM   6104 C C   . LEU D 2 142 ? -67.682 23.653 -175.524 1.00 47.70  ? 136 LEU N C   1 
ATOM   6105 O O   . LEU D 2 142 ? -66.746 24.419 -175.737 1.00 50.89  ? 136 LEU N O   1 
ATOM   6106 C CB  . LEU D 2 142 ? -69.205 25.244 -174.398 1.00 39.00  ? 136 LEU N CB  1 
ATOM   6107 C CG  . LEU D 2 142 ? -70.381 25.608 -173.491 1.00 43.48  ? 136 LEU N CG  1 
ATOM   6108 C CD1 . LEU D 2 142 ? -69.969 25.573 -172.037 1.00 48.31  ? 136 LEU N CD1 1 
ATOM   6109 C CD2 . LEU D 2 142 ? -70.836 27.005 -173.827 1.00 41.60  ? 136 LEU N CD2 1 
ATOM   6110 N N   . ASN D 2 143 ? -67.971 22.629 -176.317 1.00 52.58  ? 137 ASN N N   1 
ATOM   6111 C CA  . ASN D 2 143 ? -67.066 22.230 -177.387 1.00 49.84  ? 137 ASN N CA  1 
ATOM   6112 C C   . ASN D 2 143 ? -67.557 22.569 -178.797 1.00 48.70  ? 137 ASN N C   1 
ATOM   6113 O O   . ASN D 2 143 ? -68.694 22.277 -179.161 1.00 48.26  ? 137 ASN N O   1 
ATOM   6114 C CB  . ASN D 2 143 ? -66.790 20.735 -177.289 1.00 54.90  ? 137 ASN N CB  1 
ATOM   6115 C CG  . ASN D 2 143 ? -65.368 20.405 -177.586 1.00 60.42  ? 137 ASN N CG  1 
ATOM   6116 O OD1 . ASN D 2 143 ? -64.474 21.171 -177.250 1.00 60.00  ? 137 ASN N OD1 1 
ATOM   6117 N ND2 . ASN D 2 143 ? -65.137 19.268 -178.225 1.00 69.10  ? 137 ASN N ND2 1 
ATOM   6118 N N   . ASN D 2 144 ? -66.684 23.193 -179.578 1.00 47.85  ? 138 ASN N N   1 
ATOM   6119 C CA  . ASN D 2 144 ? -66.904 23.403 -181.013 1.00 46.51  ? 138 ASN N CA  1 
ATOM   6120 C C   . ASN D 2 144 ? -68.234 24.026 -181.410 1.00 44.36  ? 138 ASN N C   1 
ATOM   6121 O O   . ASN D 2 144 ? -69.034 23.395 -182.082 1.00 44.96  ? 138 ASN N O   1 
ATOM   6122 C CB  . ASN D 2 144 ? -66.676 22.108 -181.794 1.00 43.51  ? 138 ASN N CB  1 
ATOM   6123 C CG  . ASN D 2 144 ? -65.249 21.587 -181.658 1.00 55.25  ? 138 ASN N CG  1 
ATOM   6124 O OD1 . ASN D 2 144 ? -64.939 20.838 -180.739 1.00 61.35  ? 138 ASN N OD1 1 
ATOM   6125 N ND2 . ASN D 2 144 ? -64.379 21.978 -182.583 1.00 65.11  ? 138 ASN N ND2 1 
ATOM   6126 N N   . PHE D 2 145 ? -68.444 25.277 -181.008 1.00 41.89  ? 139 PHE N N   1 
ATOM   6127 C CA  . PHE D 2 145 ? -69.663 26.002 -181.335 1.00 44.22  ? 139 PHE N CA  1 
ATOM   6128 C C   . PHE D 2 145 ? -69.353 27.281 -182.112 1.00 46.92  ? 139 PHE N C   1 
ATOM   6129 O O   . PHE D 2 145 ? -68.204 27.732 -182.158 1.00 43.19  ? 139 PHE N O   1 
ATOM   6130 C CB  . PHE D 2 145 ? -70.427 26.364 -180.066 1.00 48.96  ? 139 PHE N CB  1 
ATOM   6131 C CG  . PHE D 2 145 ? -69.613 27.155 -179.081 1.00 49.65  ? 139 PHE N CG  1 
ATOM   6132 C CD1 . PHE D 2 145 ? -69.690 28.535 -179.053 1.00 42.33  ? 139 PHE N CD1 1 
ATOM   6133 C CD2 . PHE D 2 145 ? -68.759 26.511 -178.186 1.00 46.10  ? 139 PHE N CD2 1 
ATOM   6134 C CE1 . PHE D 2 145 ? -68.920 29.265 -178.146 1.00 44.67  ? 139 PHE N CE1 1 
ATOM   6135 C CE2 . PHE D 2 145 ? -68.001 27.230 -177.293 1.00 43.35  ? 139 PHE N CE2 1 
ATOM   6136 C CZ  . PHE D 2 145 ? -68.078 28.614 -177.272 1.00 39.26  ? 139 PHE N CZ  1 
ATOM   6137 N N   . TYR D 2 146 ? -70.390 27.839 -182.734 1.00 42.44  ? 140 TYR N N   1 
ATOM   6138 C CA  . TYR D 2 146 ? -70.316 29.137 -183.383 1.00 39.34  ? 140 TYR N CA  1 
ATOM   6139 C C   . TYR D 2 146 ? -71.692 29.787 -183.316 1.00 40.11  ? 140 TYR N C   1 
ATOM   6140 O O   . TYR D 2 146 ? -72.694 29.102 -183.473 1.00 44.49  ? 140 TYR N O   1 
ATOM   6141 C CB  . TYR D 2 146 ? -69.897 28.987 -184.837 1.00 39.14  ? 140 TYR N CB  1 
ATOM   6142 C CG  . TYR D 2 146 ? -69.617 30.316 -185.473 1.00 48.77  ? 140 TYR N CG  1 
ATOM   6143 C CD1 . TYR D 2 146 ? -70.639 31.075 -186.040 1.00 49.94  ? 140 TYR N CD1 1 
ATOM   6144 C CD2 . TYR D 2 146 ? -68.332 30.836 -185.480 1.00 50.65  ? 140 TYR N CD2 1 
ATOM   6145 C CE1 . TYR D 2 146 ? -70.376 32.308 -186.603 1.00 46.53  ? 140 TYR N CE1 1 
ATOM   6146 C CE2 . TYR D 2 146 ? -68.063 32.057 -186.037 1.00 46.55  ? 140 TYR N CE2 1 
ATOM   6147 C CZ  . TYR D 2 146 ? -69.081 32.786 -186.598 1.00 47.32  ? 140 TYR N CZ  1 
ATOM   6148 O OH  . TYR D 2 146 ? -68.782 34.002 -187.146 1.00 51.56  ? 140 TYR N OH  1 
ATOM   6149 N N   . PRO D 2 147 ? -71.755 31.106 -183.073 1.00 36.69  ? 141 PRO N N   1 
ATOM   6150 C CA  . PRO D 2 147 ? -70.666 32.071 -182.876 1.00 40.64  ? 141 PRO N CA  1 
ATOM   6151 C C   . PRO D 2 147 ? -70.034 31.992 -181.489 1.00 41.12  ? 141 PRO N C   1 
ATOM   6152 O O   . PRO D 2 147 ? -70.470 31.203 -180.649 1.00 38.65  ? 141 PRO N O   1 
ATOM   6153 C CB  . PRO D 2 147 ? -71.389 33.402 -183.023 1.00 35.31  ? 141 PRO N CB  1 
ATOM   6154 C CG  . PRO D 2 147 ? -72.701 33.105 -182.331 1.00 35.62  ? 141 PRO N CG  1 
ATOM   6155 C CD  . PRO D 2 147 ? -73.063 31.763 -182.925 1.00 36.06  ? 141 PRO N CD  1 
ATOM   6156 N N   . ARG D 2 148 ? -69.025 32.831 -181.258 1.00 44.96  ? 142 ARG N N   1 
ATOM   6157 C CA  . ARG D 2 148 ? -68.244 32.804 -180.023 1.00 46.65  ? 142 ARG N CA  1 
ATOM   6158 C C   . ARG D 2 148 ? -69.083 33.113 -178.787 1.00 48.95  ? 142 ARG N C   1 
ATOM   6159 O O   . ARG D 2 148 ? -68.848 32.554 -177.740 1.00 49.36  ? 142 ARG N O   1 
ATOM   6160 C CB  . ARG D 2 148 ? -67.100 33.796 -180.130 1.00 45.94  ? 142 ARG N CB  1 
ATOM   6161 C CG  . ARG D 2 148 ? -66.161 33.867 -178.942 1.00 46.31  ? 142 ARG N CG  1 
ATOM   6162 C CD  . ARG D 2 148 ? -65.296 35.135 -179.070 1.00 58.07  ? 142 ARG N CD  1 
ATOM   6163 N NE  . ARG D 2 148 ? -63.889 34.884 -178.775 1.00 73.85  ? 142 ARG N NE  1 
ATOM   6164 C CZ  . ARG D 2 148 ? -63.301 35.170 -177.614 1.00 84.61  ? 142 ARG N CZ  1 
ATOM   6165 N NH1 . ARG D 2 148 ? -63.998 35.742 -176.630 1.00 81.88  ? 142 ARG N NH1 1 
ATOM   6166 N NH2 . ARG D 2 148 ? -62.012 34.885 -177.440 1.00 82.42  ? 142 ARG N NH2 1 
ATOM   6167 N N   . GLU D 2 149 ? -70.067 34.000 -178.917 1.00 53.20  ? 143 GLU N N   1 
ATOM   6168 C CA  . GLU D 2 149 ? -70.876 34.425 -177.781 1.00 50.73  ? 143 GLU N CA  1 
ATOM   6169 C C   . GLU D 2 149 ? -71.672 33.266 -177.237 1.00 52.03  ? 143 GLU N C   1 
ATOM   6170 O O   . GLU D 2 149 ? -72.494 32.695 -177.934 1.00 53.80  ? 143 GLU N O   1 
ATOM   6171 C CB  . GLU D 2 149 ? -71.824 35.553 -178.172 1.00 59.48  ? 143 GLU N CB  1 
ATOM   6172 C CG  . GLU D 2 149 ? -71.122 36.784 -178.749 1.00 77.88  ? 143 GLU N CG  1 
ATOM   6173 C CD  . GLU D 2 149 ? -70.667 36.600 -180.199 1.00 84.99  ? 143 GLU N CD  1 
ATOM   6174 O OE1 . GLU D 2 149 ? -71.525 36.300 -181.054 1.00 89.64  ? 143 GLU N OE1 1 
ATOM   6175 O OE2 . GLU D 2 149 ? -69.459 36.775 -180.490 1.00 85.40  ? 143 GLU N OE2 1 
ATOM   6176 N N   . ALA D 2 150 ? -71.408 32.912 -175.990 1.00 49.98  ? 144 ALA N N   1 
ATOM   6177 C CA  . ALA D 2 150 ? -72.166 31.875 -175.314 1.00 55.40  ? 144 ALA N CA  1 
ATOM   6178 C C   . ALA D 2 150 ? -72.337 32.320 -173.873 1.00 59.08  ? 144 ALA N C   1 
ATOM   6179 O O   . ALA D 2 150 ? -71.572 33.136 -173.386 1.00 60.86  ? 144 ALA N O   1 
ATOM   6180 C CB  . ALA D 2 150 ? -71.444 30.540 -175.391 1.00 50.82  ? 144 ALA N CB  1 
ATOM   6181 N N   . LYS D 2 151 ? -73.353 31.808 -173.197 1.00 63.12  ? 145 LYS N N   1 
ATOM   6182 C CA  . LYS D 2 151 ? -73.624 32.211 -171.824 1.00 61.62  ? 145 LYS N CA  1 
ATOM   6183 C C   . LYS D 2 151 ? -73.635 30.972 -170.946 1.00 58.21  ? 145 LYS N C   1 
ATOM   6184 O O   . LYS D 2 151 ? -74.402 30.046 -171.182 1.00 58.37  ? 145 LYS N O   1 
ATOM   6185 C CB  . LYS D 2 151 ? -74.964 32.940 -171.755 1.00 66.17  ? 145 LYS N CB  1 
ATOM   6186 C CG  . LYS D 2 151 ? -75.437 33.316 -170.358 1.00 83.66  ? 145 LYS N CG  1 
ATOM   6187 C CD  . LYS D 2 151 ? -76.873 33.864 -170.401 1.00 92.60  ? 145 LYS N CD  1 
ATOM   6188 C CE  . LYS D 2 151 ? -77.424 34.197 -169.019 1.00 96.56  ? 145 LYS N CE  1 
ATOM   6189 N NZ  . LYS D 2 151 ? -78.825 34.715 -169.094 1.00 98.02  ? 145 LYS N NZ  1 
ATOM   6190 N N   . VAL D 2 152 ? -72.760 30.937 -169.952 1.00 60.73  ? 146 VAL N N   1 
ATOM   6191 C CA  . VAL D 2 152 ? -72.741 29.812 -169.025 1.00 65.76  ? 146 VAL N CA  1 
ATOM   6192 C C   . VAL D 2 152 ? -73.208 30.196 -167.615 1.00 71.94  ? 146 VAL N C   1 
ATOM   6193 O O   . VAL D 2 152 ? -72.599 31.011 -166.936 1.00 75.20  ? 146 VAL N O   1 
ATOM   6194 C CB  . VAL D 2 152 ? -71.373 29.159 -168.974 1.00 64.27  ? 146 VAL N CB  1 
ATOM   6195 C CG1 . VAL D 2 152 ? -71.478 27.827 -168.273 1.00 65.61  ? 146 VAL N CG1 1 
ATOM   6196 C CG2 . VAL D 2 152 ? -70.870 28.970 -170.372 1.00 63.39  ? 146 VAL N CG2 1 
ATOM   6197 N N   . GLN D 2 153 ? -74.311 29.596 -167.194 1.00 75.09  ? 147 GLN N N   1 
ATOM   6198 C CA  . GLN D 2 153 ? -74.933 29.907 -165.927 1.00 73.50  ? 147 GLN N CA  1 
ATOM   6199 C C   . GLN D 2 153 ? -74.619 28.784 -164.959 1.00 72.42  ? 147 GLN N C   1 
ATOM   6200 O O   . GLN D 2 153 ? -74.890 27.613 -165.243 1.00 65.98  ? 147 GLN N O   1 
ATOM   6201 C CB  . GLN D 2 153 ? -76.442 29.983 -166.116 1.00 83.78  ? 147 GLN N CB  1 
ATOM   6202 C CG  . GLN D 2 153 ? -77.162 30.738 -165.043 1.00 98.64  ? 147 GLN N CG  1 
ATOM   6203 C CD  . GLN D 2 153 ? -77.122 32.222 -165.292 1.00 107.08 ? 147 GLN N CD  1 
ATOM   6204 O OE1 . GLN D 2 153 ? -77.624 32.706 -166.309 1.00 101.81 ? 147 GLN N OE1 1 
ATOM   6205 N NE2 . GLN D 2 153 ? -76.521 32.961 -164.362 1.00 114.15 ? 147 GLN N NE2 1 
ATOM   6206 N N   . TRP D 2 154 ? -74.032 29.130 -163.820 1.00 73.02  ? 148 TRP N N   1 
ATOM   6207 C CA  . TRP D 2 154 ? -73.805 28.137 -162.781 1.00 69.24  ? 148 TRP N CA  1 
ATOM   6208 C C   . TRP D 2 154 ? -74.952 28.153 -161.781 1.00 76.96  ? 148 TRP N C   1 
ATOM   6209 O O   . TRP D 2 154 ? -75.229 29.173 -161.151 1.00 78.21  ? 148 TRP N O   1 
ATOM   6210 C CB  . TRP D 2 154 ? -72.475 28.368 -162.087 1.00 63.98  ? 148 TRP N CB  1 
ATOM   6211 C CG  . TRP D 2 154 ? -71.318 27.795 -162.838 1.00 73.32  ? 148 TRP N CG  1 
ATOM   6212 C CD1 . TRP D 2 154 ? -70.356 28.488 -163.515 1.00 77.52  ? 148 TRP N CD1 1 
ATOM   6213 C CD2 . TRP D 2 154 ? -70.997 26.405 -163.000 1.00 72.45  ? 148 TRP N CD2 1 
ATOM   6214 N NE1 . TRP D 2 154 ? -69.454 27.618 -164.082 1.00 76.10  ? 148 TRP N NE1 1 
ATOM   6215 C CE2 . TRP D 2 154 ? -69.825 26.333 -163.777 1.00 72.68  ? 148 TRP N CE2 1 
ATOM   6216 C CE3 . TRP D 2 154 ? -71.583 25.220 -162.563 1.00 69.64  ? 148 TRP N CE3 1 
ATOM   6217 C CZ2 . TRP D 2 154 ? -69.231 25.126 -164.125 1.00 69.51  ? 148 TRP N CZ2 1 
ATOM   6218 C CZ3 . TRP D 2 154 ? -70.990 24.022 -162.912 1.00 71.37  ? 148 TRP N CZ3 1 
ATOM   6219 C CH2 . TRP D 2 154 ? -69.827 23.984 -163.686 1.00 67.29  ? 148 TRP N CH2 1 
ATOM   6220 N N   . LYS D 2 155 ? -75.640 27.025 -161.658 1.00 81.19  ? 149 LYS N N   1 
ATOM   6221 C CA  . LYS D 2 155 ? -76.745 26.929 -160.715 1.00 89.45  ? 149 LYS N CA  1 
ATOM   6222 C C   . LYS D 2 155 ? -76.404 25.916 -159.638 1.00 91.42  ? 149 LYS N C   1 
ATOM   6223 O O   . LYS D 2 155 ? -76.225 24.731 -159.920 1.00 90.75  ? 149 LYS N O   1 
ATOM   6224 C CB  . LYS D 2 155 ? -78.064 26.579 -161.424 1.00 91.96  ? 149 LYS N CB  1 
ATOM   6225 C CG  . LYS D 2 155 ? -78.714 27.766 -162.134 1.00 89.78  ? 149 LYS N CG  1 
ATOM   6226 C CD  . LYS D 2 155 ? -79.910 27.342 -162.962 1.00 94.30  ? 149 LYS N CD  1 
ATOM   6227 C CE  . LYS D 2 155 ? -80.511 28.518 -163.729 1.00 94.12  ? 149 LYS N CE  1 
ATOM   6228 N NZ  . LYS D 2 155 ? -81.749 28.116 -164.454 1.00 91.62  ? 149 LYS N NZ  1 
ATOM   6229 N N   . VAL D 2 156 ? -76.273 26.409 -158.409 1.00 94.75  ? 150 VAL N N   1 
ATOM   6230 C CA  . VAL D 2 156 ? -75.994 25.560 -157.257 1.00 93.80  ? 150 VAL N CA  1 
ATOM   6231 C C   . VAL D 2 156 ? -77.279 25.333 -156.473 1.00 100.75 ? 150 VAL N C   1 
ATOM   6232 O O   . VAL D 2 156 ? -77.832 26.265 -155.891 1.00 100.62 ? 150 VAL N O   1 
ATOM   6233 C CB  . VAL D 2 156 ? -74.936 26.177 -156.338 1.00 86.02  ? 150 VAL N CB  1 
ATOM   6234 C CG1 . VAL D 2 156 ? -74.801 25.351 -155.081 1.00 88.81  ? 150 VAL N CG1 1 
ATOM   6235 C CG2 . VAL D 2 156 ? -73.600 26.293 -157.066 1.00 80.79  ? 150 VAL N CG2 1 
ATOM   6236 N N   . ASP D 2 157 ? -77.750 24.089 -156.471 1.00 105.07 ? 151 ASP N N   1 
ATOM   6237 C CA  . ASP D 2 157 ? -79.051 23.760 -155.905 1.00 112.49 ? 151 ASP N CA  1 
ATOM   6238 C C   . ASP D 2 157 ? -80.105 24.619 -156.569 1.00 114.99 ? 151 ASP N C   1 
ATOM   6239 O O   . ASP D 2 157 ? -80.903 25.274 -155.901 1.00 116.08 ? 151 ASP N O   1 
ATOM   6240 C CB  . ASP D 2 157 ? -79.068 23.960 -154.389 1.00 117.24 ? 151 ASP N CB  1 
ATOM   6241 C CG  . ASP D 2 157 ? -78.793 22.674 -153.632 1.00 121.24 ? 151 ASP N CG  1 
ATOM   6242 O OD1 . ASP D 2 157 ? -78.262 22.749 -152.498 1.00 125.47 ? 151 ASP N OD1 1 
ATOM   6243 O OD2 . ASP D 2 157 ? -79.109 21.591 -154.174 1.00 118.00 ? 151 ASP N OD2 1 
ATOM   6244 N N   . ASN D 2 158 ? -80.091 24.611 -157.898 1.00 115.41 ? 152 ASN N N   1 
ATOM   6245 C CA  . ASN D 2 158 ? -80.985 25.452 -158.683 1.00 114.01 ? 152 ASN N CA  1 
ATOM   6246 C C   . ASN D 2 158 ? -81.073 26.875 -158.112 1.00 112.45 ? 152 ASN N C   1 
ATOM   6247 O O   . ASN D 2 158 ? -82.146 27.475 -158.058 1.00 111.97 ? 152 ASN N O   1 
ATOM   6248 C CB  . ASN D 2 158 ? -82.372 24.809 -158.821 1.00 113.86 ? 152 ASN N CB  1 
ATOM   6249 C CG  . ASN D 2 158 ? -83.021 25.098 -160.168 1.00 114.75 ? 152 ASN N CG  1 
ATOM   6250 O OD1 . ASN D 2 158 ? -82.343 25.407 -161.158 1.00 112.66 ? 152 ASN N OD1 1 
ATOM   6251 N ND2 . ASN D 2 158 ? -84.343 24.993 -160.215 1.00 117.58 ? 152 ASN N ND2 1 
ATOM   6252 N N   . ALA D 2 159 ? -79.928 27.389 -157.666 1.00 108.16 ? 153 ALA N N   1 
ATOM   6253 C CA  . ALA D 2 159 ? -79.762 28.809 -157.373 1.00 102.30 ? 153 ALA N CA  1 
ATOM   6254 C C   . ALA D 2 159 ? -78.530 29.304 -158.139 1.00 101.41 ? 153 ALA N C   1 
ATOM   6255 O O   . ALA D 2 159 ? -77.480 28.662 -158.117 1.00 97.13  ? 153 ALA N O   1 
ATOM   6256 C CB  . ALA D 2 159 ? -79.600 29.030 -155.892 1.00 97.73  ? 153 ALA N CB  1 
ATOM   6257 N N   . LEU D 2 160 ? -78.660 30.433 -158.830 1.00 102.34 ? 154 LEU N N   1 
ATOM   6258 C CA  . LEU D 2 160 ? -77.604 30.881 -159.737 1.00 100.36 ? 154 LEU N CA  1 
ATOM   6259 C C   . LEU D 2 160 ? -76.490 31.643 -159.027 1.00 96.80  ? 154 LEU N C   1 
ATOM   6260 O O   . LEU D 2 160 ? -76.749 32.463 -158.147 1.00 93.85  ? 154 LEU N O   1 
ATOM   6261 C CB  . LEU D 2 160 ? -78.177 31.700 -160.904 1.00 104.15 ? 154 LEU N CB  1 
ATOM   6262 C CG  . LEU D 2 160 ? -78.898 33.023 -160.623 1.00 106.08 ? 154 LEU N CG  1 
ATOM   6263 C CD1 . LEU D 2 160 ? -79.238 33.739 -161.932 1.00 93.31  ? 154 LEU N CD1 1 
ATOM   6264 C CD2 . LEU D 2 160 ? -80.155 32.819 -159.763 1.00 113.63 ? 154 LEU N CD2 1 
ATOM   6265 N N   . GLN D 2 161 ? -75.251 31.357 -159.426 1.00 96.61  ? 155 GLN N N   1 
ATOM   6266 C CA  . GLN D 2 161 ? -74.061 31.983 -158.848 1.00 94.63  ? 155 GLN N CA  1 
ATOM   6267 C C   . GLN D 2 161 ? -73.699 33.266 -159.574 1.00 95.10  ? 155 GLN N C   1 
ATOM   6268 O O   . GLN D 2 161 ? -74.220 33.550 -160.656 1.00 91.96  ? 155 GLN N O   1 
ATOM   6269 C CB  . GLN D 2 161 ? -72.873 31.029 -158.944 1.00 86.50  ? 155 GLN N CB  1 
ATOM   6270 C CG  . GLN D 2 161 ? -73.216 29.619 -158.578 1.00 86.84  ? 155 GLN N CG  1 
ATOM   6271 C CD  . GLN D 2 161 ? -73.901 29.557 -157.240 1.00 96.26  ? 155 GLN N CD  1 
ATOM   6272 O OE1 . GLN D 2 161 ? -73.307 29.883 -156.206 1.00 96.98  ? 155 GLN N OE1 1 
ATOM   6273 N NE2 . GLN D 2 161 ? -75.162 29.146 -157.245 1.00 97.88  ? 155 GLN N NE2 1 
ATOM   6274 N N   . SER D 2 162 ? -72.792 34.037 -158.987 1.00 98.69  ? 156 SER N N   1 
ATOM   6275 C CA  . SER D 2 162 ? -72.227 35.178 -159.695 1.00 105.44 ? 156 SER N CA  1 
ATOM   6276 C C   . SER D 2 162 ? -70.962 35.650 -159.000 1.00 104.40 ? 156 SER N C   1 
ATOM   6277 O O   . SER D 2 162 ? -70.985 35.944 -157.809 1.00 109.03 ? 156 SER N O   1 
ATOM   6278 C CB  . SER D 2 162 ? -73.247 36.315 -159.796 1.00 114.85 ? 156 SER N CB  1 
ATOM   6279 O OG  . SER D 2 162 ? -73.043 37.071 -160.979 1.00 117.14 ? 156 SER N OG  1 
ATOM   6280 N N   . GLY D 2 163 ? -69.857 35.704 -159.741 1.00 101.53 ? 157 GLY N N   1 
ATOM   6281 C CA  . GLY D 2 163 ? -68.584 36.150 -159.190 1.00 102.10 ? 157 GLY N CA  1 
ATOM   6282 C C   . GLY D 2 163 ? -67.757 35.083 -158.478 1.00 98.06  ? 157 GLY N C   1 
ATOM   6283 O O   . GLY D 2 163 ? -66.820 35.410 -157.737 1.00 90.50  ? 157 GLY N O   1 
ATOM   6284 N N   . ASN D 2 164 ? -68.099 33.814 -158.708 1.00 96.97  ? 158 ASN N N   1 
ATOM   6285 C CA  . ASN D 2 164 ? -67.384 32.681 -158.119 1.00 95.06  ? 158 ASN N CA  1 
ATOM   6286 C C   . ASN D 2 164 ? -66.880 31.661 -159.151 1.00 98.24  ? 158 ASN N C   1 
ATOM   6287 O O   . ASN D 2 164 ? -66.502 30.540 -158.787 1.00 99.31  ? 158 ASN N O   1 
ATOM   6288 C CB  . ASN D 2 164 ? -68.248 31.982 -157.067 1.00 95.15  ? 158 ASN N CB  1 
ATOM   6289 C CG  . ASN D 2 164 ? -69.723 31.942 -157.444 1.00 97.35  ? 158 ASN N CG  1 
ATOM   6290 O OD1 . ASN D 2 164 ? -70.212 32.782 -158.197 1.00 93.47  ? 158 ASN N OD1 1 
ATOM   6291 N ND2 . ASN D 2 164 ? -70.444 30.967 -156.901 1.00 102.87 ? 158 ASN N ND2 1 
ATOM   6292 N N   . SER D 2 165 ? -66.874 32.061 -160.427 1.00 94.86  ? 159 SER N N   1 
ATOM   6293 C CA  . SER D 2 165 ? -66.396 31.210 -161.524 1.00 91.33  ? 159 SER N CA  1 
ATOM   6294 C C   . SER D 2 165 ? -65.734 32.017 -162.634 1.00 86.65  ? 159 SER N C   1 
ATOM   6295 O O   . SER D 2 165 ? -65.916 33.230 -162.713 1.00 85.17  ? 159 SER N O   1 
ATOM   6296 C CB  . SER D 2 165 ? -67.552 30.418 -162.137 1.00 83.80  ? 159 SER N CB  1 
ATOM   6297 O OG  . SER D 2 165 ? -68.437 31.278 -162.832 1.00 72.51  ? 159 SER N OG  1 
ATOM   6298 N N   . GLN D 2 166 ? -64.977 31.338 -163.495 1.00 83.14  ? 160 GLN N N   1 
ATOM   6299 C CA  . GLN D 2 166 ? -64.423 31.987 -164.685 1.00 81.68  ? 160 GLN N CA  1 
ATOM   6300 C C   . GLN D 2 166 ? -64.168 31.063 -165.874 1.00 76.43  ? 160 GLN N C   1 
ATOM   6301 O O   . GLN D 2 166 ? -63.934 29.853 -165.732 1.00 73.27  ? 160 GLN N O   1 
ATOM   6302 C CB  . GLN D 2 166 ? -63.165 32.795 -164.362 1.00 79.80  ? 160 GLN N CB  1 
ATOM   6303 C CG  . GLN D 2 166 ? -62.074 32.028 -163.675 1.00 76.99  ? 160 GLN N CG  1 
ATOM   6304 C CD  . GLN D 2 166 ? -61.112 32.965 -162.992 1.00 77.13  ? 160 GLN N CD  1 
ATOM   6305 O OE1 . GLN D 2 166 ? -60.482 32.612 -161.999 1.00 85.46  ? 160 GLN N OE1 1 
ATOM   6306 N NE2 . GLN D 2 166 ? -61.008 34.182 -163.511 1.00 68.83  ? 160 GLN N NE2 1 
ATOM   6307 N N   . GLU D 2 167 ? -64.206 31.663 -167.056 1.00 70.40  ? 161 GLU N N   1 
ATOM   6308 C CA  . GLU D 2 167 ? -64.120 30.890 -168.277 1.00 68.58  ? 161 GLU N CA  1 
ATOM   6309 C C   . GLU D 2 167 ? -62.922 31.260 -169.137 1.00 58.78  ? 161 GLU N C   1 
ATOM   6310 O O   . GLU D 2 167 ? -62.343 32.328 -169.010 1.00 54.77  ? 161 GLU N O   1 
ATOM   6311 C CB  . GLU D 2 167 ? -65.425 30.983 -169.077 1.00 73.39  ? 161 GLU N CB  1 
ATOM   6312 C CG  . GLU D 2 167 ? -65.940 32.395 -169.310 1.00 82.43  ? 161 GLU N CG  1 
ATOM   6313 C CD  . GLU D 2 167 ? -67.382 32.412 -169.820 1.00 93.60  ? 161 GLU N CD  1 
ATOM   6314 O OE1 . GLU D 2 167 ? -68.257 31.808 -169.153 1.00 97.70  ? 161 GLU N OE1 1 
ATOM   6315 O OE2 . GLU D 2 167 ? -67.642 33.030 -170.884 1.00 92.65  ? 161 GLU N OE2 1 
ATOM   6316 N N   . SER D 2 168 ? -62.538 30.332 -169.993 1.00 55.10  ? 162 SER N N   1 
ATOM   6317 C CA  . SER D 2 168 ? -61.541 30.595 -170.991 1.00 49.50  ? 162 SER N CA  1 
ATOM   6318 C C   . SER D 2 168 ? -62.160 30.163 -172.307 1.00 48.54  ? 162 SER N C   1 
ATOM   6319 O O   . SER D 2 168 ? -62.917 29.189 -172.353 1.00 52.71  ? 162 SER N O   1 
ATOM   6320 C CB  . SER D 2 168 ? -60.295 29.786 -170.695 1.00 54.72  ? 162 SER N CB  1 
ATOM   6321 O OG  . SER D 2 168 ? -59.227 30.184 -171.526 1.00 58.65  ? 162 SER N OG  1 
ATOM   6322 N N   . VAL D 2 169 ? -61.871 30.911 -173.367 1.00 50.16  ? 163 VAL N N   1 
ATOM   6323 C CA  . VAL D 2 169 ? -62.368 30.604 -174.703 1.00 44.02  ? 163 VAL N CA  1 
ATOM   6324 C C   . VAL D 2 169 ? -61.160 30.397 -175.596 1.00 43.03  ? 163 VAL N C   1 
ATOM   6325 O O   . VAL D 2 169 ? -60.149 31.080 -175.442 1.00 45.94  ? 163 VAL N O   1 
ATOM   6326 C CB  . VAL D 2 169 ? -63.237 31.765 -175.257 1.00 46.04  ? 163 VAL N CB  1 
ATOM   6327 C CG1 . VAL D 2 169 ? -63.910 31.368 -176.565 1.00 45.25  ? 163 VAL N CG1 1 
ATOM   6328 C CG2 . VAL D 2 169 ? -64.291 32.153 -174.252 1.00 48.99  ? 163 VAL N CG2 1 
ATOM   6329 N N   . THR D 2 170 ? -61.242 29.460 -176.529 1.00 43.92  ? 164 THR N N   1 
ATOM   6330 C CA  . THR D 2 170 ? -60.137 29.285 -177.461 1.00 45.39  ? 164 THR N CA  1 
ATOM   6331 C C   . THR D 2 170 ? -60.220 30.322 -178.549 1.00 49.53  ? 164 THR N C   1 
ATOM   6332 O O   . THR D 2 170 ? -61.224 31.034 -178.674 1.00 56.90  ? 164 THR N O   1 
ATOM   6333 C CB  . THR D 2 170 ? -60.186 27.952 -178.183 1.00 47.35  ? 164 THR N CB  1 
ATOM   6334 O OG1 . THR D 2 170 ? -61.348 27.915 -179.018 1.00 55.98  ? 164 THR N OG1 1 
ATOM   6335 C CG2 . THR D 2 170 ? -60.212 26.818 -177.217 1.00 38.24  ? 164 THR N CG2 1 
ATOM   6336 N N   . GLU D 2 171 ? -59.165 30.400 -179.352 1.00 45.41  ? 165 GLU N N   1 
ATOM   6337 C CA  . GLU D 2 171 ? -59.229 31.183 -180.570 1.00 50.05  ? 165 GLU N CA  1 
ATOM   6338 C C   . GLU D 2 171 ? -59.882 30.328 -181.651 1.00 51.98  ? 165 GLU N C   1 
ATOM   6339 O O   . GLU D 2 171 ? -60.034 29.117 -181.491 1.00 55.39  ? 165 GLU N O   1 
ATOM   6340 C CB  . GLU D 2 171 ? -57.842 31.685 -180.974 1.00 57.34  ? 165 GLU N CB  1 
ATOM   6341 C CG  . GLU D 2 171 ? -57.337 32.838 -180.089 1.00 64.55  ? 165 GLU N CG  1 
ATOM   6342 C CD  . GLU D 2 171 ? -58.269 34.061 -180.103 1.00 77.08  ? 165 GLU N CD  1 
ATOM   6343 O OE1 . GLU D 2 171 ? -59.209 34.096 -180.924 1.00 82.54  ? 165 GLU N OE1 1 
ATOM   6344 O OE2 . GLU D 2 171 ? -58.065 34.997 -179.295 1.00 80.23  ? 165 GLU N OE2 1 
ATOM   6345 N N   . GLN D 2 172 ? -60.306 30.956 -182.734 1.00 52.63  ? 166 GLN N N   1 
ATOM   6346 C CA  . GLN D 2 172 ? -61.091 30.241 -183.723 1.00 49.07  ? 166 GLN N CA  1 
ATOM   6347 C C   . GLN D 2 172 ? -60.305 29.067 -184.301 1.00 47.54  ? 166 GLN N C   1 
ATOM   6348 O O   . GLN D 2 172 ? -59.148 29.214 -184.691 1.00 47.20  ? 166 GLN N O   1 
ATOM   6349 C CB  . GLN D 2 172 ? -61.549 31.185 -184.837 1.00 47.12  ? 166 GLN N CB  1 
ATOM   6350 C CG  . GLN D 2 172 ? -62.833 30.723 -185.490 1.00 54.82  ? 166 GLN N CG  1 
ATOM   6351 C CD  . GLN D 2 172 ? -63.369 31.695 -186.517 1.00 57.93  ? 166 GLN N CD  1 
ATOM   6352 O OE1 . GLN D 2 172 ? -62.673 32.614 -186.948 1.00 58.92  ? 166 GLN N OE1 1 
ATOM   6353 N NE2 . GLN D 2 172 ? -64.619 31.490 -186.919 1.00 56.05  ? 166 GLN N NE2 1 
ATOM   6354 N N   . ASP D 2 173 ? -60.941 27.904 -184.360 1.00 39.76  ? 167 ASP N N   1 
ATOM   6355 C CA  . ASP D 2 173 ? -60.302 26.723 -184.922 1.00 40.08  ? 167 ASP N CA  1 
ATOM   6356 C C   . ASP D 2 173 ? -59.887 26.881 -186.392 1.00 45.18  ? 167 ASP N C   1 
ATOM   6357 O O   . ASP D 2 173 ? -60.677 27.293 -187.241 1.00 46.44  ? 167 ASP N O   1 
ATOM   6358 C CB  . ASP D 2 173 ? -61.203 25.502 -184.748 1.00 45.34  ? 167 ASP N CB  1 
ATOM   6359 C CG  . ASP D 2 173 ? -60.496 24.206 -185.085 1.00 63.25  ? 167 ASP N CG  1 
ATOM   6360 O OD1 . ASP D 2 173 ? -60.126 24.000 -186.269 1.00 69.28  ? 167 ASP N OD1 1 
ATOM   6361 O OD2 . ASP D 2 173 ? -60.315 23.386 -184.160 1.00 68.16  ? 167 ASP N OD2 1 
ATOM   6362 N N   . SER D 2 174 ? -58.644 26.519 -186.687 1.00 49.82  ? 168 SER N N   1 
ATOM   6363 C CA  . SER D 2 174 ? -58.064 26.716 -188.019 1.00 50.93  ? 168 SER N CA  1 
ATOM   6364 C C   . SER D 2 174 ? -58.629 25.802 -189.096 1.00 52.46  ? 168 SER N C   1 
ATOM   6365 O O   . SER D 2 174 ? -58.416 26.040 -190.290 1.00 55.13  ? 168 SER N O   1 
ATOM   6366 C CB  . SER D 2 174 ? -56.558 26.530 -187.958 1.00 52.15  ? 168 SER N CB  1 
ATOM   6367 O OG  . SER D 2 174 ? -56.255 25.336 -187.265 1.00 60.59  ? 168 SER N OG  1 
ATOM   6368 N N   . LYS D 2 175 ? -59.336 24.755 -188.679 1.00 53.48  ? 169 LYS N N   1 
ATOM   6369 C CA  . LYS D 2 175 ? -59.955 23.833 -189.631 1.00 53.35  ? 169 LYS N CA  1 
ATOM   6370 C C   . LYS D 2 175 ? -61.464 24.026 -189.780 1.00 48.22  ? 169 LYS N C   1 
ATOM   6371 O O   . LYS D 2 175 ? -61.963 24.057 -190.878 1.00 50.06  ? 169 LYS N O   1 
ATOM   6372 C CB  . LYS D 2 175 ? -59.647 22.375 -189.276 1.00 59.58  ? 169 LYS N CB  1 
ATOM   6373 C CG  . LYS D 2 175 ? -58.253 21.905 -189.678 1.00 73.53  ? 169 LYS N CG  1 
ATOM   6374 C CD  . LYS D 2 175 ? -57.804 20.704 -188.840 1.00 80.27  ? 169 LYS N CD  1 
ATOM   6375 C CE  . LYS D 2 175 ? -56.335 20.369 -189.077 1.00 88.34  ? 169 LYS N CE  1 
ATOM   6376 N NZ  . LYS D 2 175 ? -55.824 19.328 -188.131 1.00 91.72  ? 169 LYS N NZ  1 
ATOM   6377 N N   . ASP D 2 176 ? -62.194 24.158 -188.681 1.00 51.30  ? 170 ASP N N   1 
ATOM   6378 C CA  . ASP D 2 176 ? -63.651 24.178 -188.771 1.00 47.29  ? 170 ASP N CA  1 
ATOM   6379 C C   . ASP D 2 176 ? -64.248 25.475 -188.249 1.00 48.26  ? 170 ASP N C   1 
ATOM   6380 O O   . ASP D 2 176 ? -65.467 25.593 -188.098 1.00 49.28  ? 170 ASP N O   1 
ATOM   6381 C CB  . ASP D 2 176 ? -64.242 22.972 -188.029 1.00 52.04  ? 170 ASP N CB  1 
ATOM   6382 C CG  . ASP D 2 176 ? -64.138 23.087 -186.514 1.00 61.73  ? 170 ASP N CG  1 
ATOM   6383 O OD1 . ASP D 2 176 ? -64.389 22.068 -185.839 1.00 65.46  ? 170 ASP N OD1 1 
ATOM   6384 O OD2 . ASP D 2 176 ? -63.828 24.178 -185.988 1.00 65.55  ? 170 ASP N OD2 1 
ATOM   6385 N N   . SER D 2 177 ? -63.373 26.427 -187.941 1.00 42.49  ? 171 SER N N   1 
ATOM   6386 C CA  . SER D 2 177 ? -63.776 27.780 -187.564 1.00 43.09  ? 171 SER N CA  1 
ATOM   6387 C C   . SER D 2 177 ? -64.750 27.880 -186.383 1.00 44.37  ? 171 SER N C   1 
ATOM   6388 O O   . SER D 2 177 ? -65.502 28.849 -186.265 1.00 41.07  ? 171 SER N O   1 
ATOM   6389 C CB  . SER D 2 177 ? -64.337 28.496 -188.792 1.00 44.27  ? 171 SER N CB  1 
ATOM   6390 O OG  . SER D 2 177 ? -63.482 28.261 -189.905 1.00 51.87  ? 171 SER N OG  1 
ATOM   6391 N N   . THR D 2 178 ? -64.732 26.887 -185.500 1.00 46.50  ? 172 THR N N   1 
ATOM   6392 C CA  . THR D 2 178 ? -65.548 26.964 -184.287 1.00 45.89  ? 172 THR N CA  1 
ATOM   6393 C C   . THR D 2 178 ? -64.736 27.426 -183.073 1.00 46.06  ? 172 THR N C   1 
ATOM   6394 O O   . THR D 2 178 ? -63.532 27.684 -183.166 1.00 42.79  ? 172 THR N O   1 
ATOM   6395 C CB  . THR D 2 178 ? -66.206 25.622 -183.974 1.00 44.42  ? 172 THR N CB  1 
ATOM   6396 O OG1 . THR D 2 178 ? -65.193 24.623 -183.896 1.00 47.73  ? 172 THR N OG1 1 
ATOM   6397 C CG2 . THR D 2 178 ? -67.179 25.235 -185.078 1.00 38.19  ? 172 THR N CG2 1 
ATOM   6398 N N   . TYR D 2 179 ? -65.411 27.538 -181.937 1.00 47.84  ? 173 TYR N N   1 
ATOM   6399 C CA  . TYR D 2 179 ? -64.758 27.884 -180.683 1.00 43.48  ? 173 TYR N CA  1 
ATOM   6400 C C   . TYR D 2 179 ? -65.055 26.851 -179.611 1.00 47.79  ? 173 TYR N C   1 
ATOM   6401 O O   . TYR D 2 179 ? -66.051 26.123 -179.696 1.00 47.65  ? 173 TYR N O   1 
ATOM   6402 C CB  . TYR D 2 179 ? -65.288 29.211 -180.183 1.00 39.46  ? 173 TYR N CB  1 
ATOM   6403 C CG  . TYR D 2 179 ? -65.052 30.344 -181.123 1.00 40.62  ? 173 TYR N CG  1 
ATOM   6404 C CD1 . TYR D 2 179 ? -66.002 30.684 -182.074 1.00 36.04  ? 173 TYR N CD1 1 
ATOM   6405 C CD2 . TYR D 2 179 ? -63.879 31.100 -181.051 1.00 38.84  ? 173 TYR N CD2 1 
ATOM   6406 C CE1 . TYR D 2 179 ? -65.796 31.748 -182.936 1.00 42.45  ? 173 TYR N CE1 1 
ATOM   6407 C CE2 . TYR D 2 179 ? -63.659 32.154 -181.910 1.00 42.99  ? 173 TYR N CE2 1 
ATOM   6408 C CZ  . TYR D 2 179 ? -64.622 32.479 -182.856 1.00 46.90  ? 173 TYR N CZ  1 
ATOM   6409 O OH  . TYR D 2 179 ? -64.407 33.526 -183.727 1.00 49.94  ? 173 TYR N OH  1 
ATOM   6410 N N   . SER D 2 180 ? -64.207 26.821 -178.585 1.00 46.29  ? 174 SER N N   1 
ATOM   6411 C CA  . SER D 2 180 ? -64.461 26.038 -177.388 1.00 49.09  ? 174 SER N CA  1 
ATOM   6412 C C   . SER D 2 180 ? -64.332 26.924 -176.141 1.00 49.77  ? 174 SER N C   1 
ATOM   6413 O O   . SER D 2 180 ? -63.653 27.959 -176.172 1.00 43.77  ? 174 SER N O   1 
ATOM   6414 C CB  . SER D 2 180 ? -63.505 24.849 -177.324 1.00 57.44  ? 174 SER N CB  1 
ATOM   6415 O OG  . SER D 2 180 ? -63.935 23.822 -178.192 1.00 61.04  ? 174 SER N OG  1 
ATOM   6416 N N   . LEU D 2 181 ? -64.971 26.511 -175.045 1.00 48.21  ? 175 LEU N N   1 
ATOM   6417 C CA  . LEU D 2 181 ? -65.029 27.335 -173.844 1.00 52.03  ? 175 LEU N CA  1 
ATOM   6418 C C   . LEU D 2 181 ? -65.162 26.484 -172.601 1.00 60.33  ? 175 LEU N C   1 
ATOM   6419 O O   . LEU D 2 181 ? -66.087 25.691 -172.484 1.00 60.34  ? 175 LEU N O   1 
ATOM   6420 C CB  . LEU D 2 181 ? -66.225 28.287 -173.931 1.00 52.33  ? 175 LEU N CB  1 
ATOM   6421 C CG  . LEU D 2 181 ? -66.542 29.262 -172.791 1.00 52.45  ? 175 LEU N CG  1 
ATOM   6422 C CD1 . LEU D 2 181 ? -67.547 30.290 -173.260 1.00 54.67  ? 175 LEU N CD1 1 
ATOM   6423 C CD2 . LEU D 2 181 ? -67.094 28.562 -171.584 1.00 51.11  ? 175 LEU N CD2 1 
ATOM   6424 N N   . SER D 2 182 ? -64.248 26.657 -171.657 1.00 65.16  ? 176 SER N N   1 
ATOM   6425 C CA  . SER D 2 182 ? -64.377 25.981 -170.375 1.00 65.95  ? 176 SER N CA  1 
ATOM   6426 C C   . SER D 2 182 ? -64.712 26.994 -169.286 1.00 68.26  ? 176 SER N C   1 
ATOM   6427 O O   . SER D 2 182 ? -64.111 28.067 -169.220 1.00 69.84  ? 176 SER N O   1 
ATOM   6428 C CB  . SER D 2 182 ? -63.097 25.224 -170.025 1.00 66.22  ? 176 SER N CB  1 
ATOM   6429 O OG  . SER D 2 182 ? -62.001 26.109 -170.016 1.00 80.55  ? 176 SER N OG  1 
ATOM   6430 N N   . SER D 2 183 ? -65.693 26.658 -168.454 1.00 66.22  ? 177 SER N N   1 
ATOM   6431 C CA  . SER D 2 183 ? -66.027 27.467 -167.291 1.00 71.16  ? 177 SER N CA  1 
ATOM   6432 C C   . SER D 2 183 ? -65.652 26.691 -166.026 1.00 72.62  ? 177 SER N C   1 
ATOM   6433 O O   . SER D 2 183 ? -66.010 25.525 -165.880 1.00 65.20  ? 177 SER N O   1 
ATOM   6434 C CB  . SER D 2 183 ? -67.519 27.822 -167.289 1.00 70.17  ? 177 SER N CB  1 
ATOM   6435 O OG  . SER D 2 183 ? -67.814 28.839 -166.343 1.00 75.01  ? 177 SER N OG  1 
ATOM   6436 N N   . THR D 2 184 ? -64.911 27.322 -165.120 1.00 75.16  ? 178 THR N N   1 
ATOM   6437 C CA  . THR D 2 184 ? -64.656 26.685 -163.828 1.00 79.17  ? 178 THR N CA  1 
ATOM   6438 C C   . THR D 2 184 ? -65.365 27.373 -162.649 1.00 75.04  ? 178 THR N C   1 
ATOM   6439 O O   . THR D 2 184 ? -65.225 28.581 -162.428 1.00 67.12  ? 178 THR N O   1 
ATOM   6440 C CB  . THR D 2 184 ? -63.157 26.541 -163.541 1.00 79.21  ? 178 THR N CB  1 
ATOM   6441 O OG1 . THR D 2 184 ? -62.523 25.920 -164.660 1.00 82.27  ? 178 THR N OG1 1 
ATOM   6442 C CG2 . THR D 2 184 ? -62.932 25.676 -162.316 1.00 77.80  ? 178 THR N CG2 1 
ATOM   6443 N N   . LEU D 2 185 ? -66.150 26.591 -161.916 1.00 73.97  ? 179 LEU N N   1 
ATOM   6444 C CA  . LEU D 2 185 ? -66.745 27.059 -160.670 1.00 79.54  ? 179 LEU N CA  1 
ATOM   6445 C C   . LEU D 2 185 ? -65.878 26.574 -159.516 1.00 85.39  ? 179 LEU N C   1 
ATOM   6446 O O   . LEU D 2 185 ? -65.670 25.368 -159.347 1.00 84.60  ? 179 LEU N O   1 
ATOM   6447 C CB  . LEU D 2 185 ? -68.184 26.562 -160.522 1.00 79.45  ? 179 LEU N CB  1 
ATOM   6448 C CG  . LEU D 2 185 ? -68.848 26.750 -159.156 1.00 85.45  ? 179 LEU N CG  1 
ATOM   6449 C CD1 . LEU D 2 185 ? -68.644 28.165 -158.626 1.00 92.83  ? 179 LEU N CD1 1 
ATOM   6450 C CD2 . LEU D 2 185 ? -70.334 26.390 -159.210 1.00 83.22  ? 179 LEU N CD2 1 
ATOM   6451 N N   . THR D 2 186 ? -65.352 27.518 -158.744 1.00 86.40  ? 180 THR N N   1 
ATOM   6452 C CA  . THR D 2 186 ? -64.432 27.183 -157.676 1.00 96.21  ? 180 THR N CA  1 
ATOM   6453 C C   . THR D 2 186 ? -65.016 27.560 -156.319 1.00 107.22 ? 180 THR N C   1 
ATOM   6454 O O   . THR D 2 186 ? -65.272 28.734 -156.042 1.00 111.67 ? 180 THR N O   1 
ATOM   6455 C CB  . THR D 2 186 ? -63.075 27.870 -157.883 1.00 100.31 ? 180 THR N CB  1 
ATOM   6456 O OG1 . THR D 2 186 ? -62.646 27.663 -159.235 1.00 103.53 ? 180 THR N OG1 1 
ATOM   6457 C CG2 . THR D 2 186 ? -62.031 27.305 -156.923 1.00 98.03  ? 180 THR N CG2 1 
ATOM   6458 N N   . LEU D 2 187 ? -65.237 26.545 -155.487 1.00 108.21 ? 181 LEU N N   1 
ATOM   6459 C CA  . LEU D 2 187 ? -65.799 26.721 -154.153 1.00 108.19 ? 181 LEU N CA  1 
ATOM   6460 C C   . LEU D 2 187 ? -64.941 26.030 -153.098 1.00 114.66 ? 181 LEU N C   1 
ATOM   6461 O O   . LEU D 2 187 ? -64.462 24.911 -153.311 1.00 118.88 ? 181 LEU N O   1 
ATOM   6462 C CB  . LEU D 2 187 ? -67.220 26.161 -154.095 1.00 105.29 ? 181 LEU N CB  1 
ATOM   6463 C CG  . LEU D 2 187 ? -68.350 27.188 -154.103 1.00 113.36 ? 181 LEU N CG  1 
ATOM   6464 C CD1 . LEU D 2 187 ? -68.241 28.099 -155.319 1.00 118.95 ? 181 LEU N CD1 1 
ATOM   6465 C CD2 . LEU D 2 187 ? -69.711 26.501 -154.055 1.00 113.18 ? 181 LEU N CD2 1 
ATOM   6466 N N   . SER D 2 188 ? -64.742 26.689 -151.962 1.00 110.59 ? 182 SER N N   1 
ATOM   6467 C CA  . SER D 2 188 ? -64.061 26.037 -150.866 1.00 116.15 ? 182 SER N CA  1 
ATOM   6468 C C   . SER D 2 188 ? -64.838 24.761 -150.563 1.00 114.47 ? 182 SER N C   1 
ATOM   6469 O O   . SER D 2 188 ? -66.064 24.749 -150.656 1.00 113.28 ? 182 SER N O   1 
ATOM   6470 C CB  . SER D 2 188 ? -64.006 26.948 -149.641 1.00 127.85 ? 182 SER N CB  1 
ATOM   6471 O OG  . SER D 2 188 ? -65.272 27.055 -149.011 1.00 134.70 ? 182 SER N OG  1 
ATOM   6472 N N   . LYS D 2 189 ? -64.129 23.688 -150.223 1.00 114.84 ? 183 LYS N N   1 
ATOM   6473 C CA  . LYS D 2 189 ? -64.767 22.403 -149.947 1.00 116.97 ? 183 LYS N CA  1 
ATOM   6474 C C   . LYS D 2 189 ? -65.892 22.548 -148.931 1.00 118.80 ? 183 LYS N C   1 
ATOM   6475 O O   . LYS D 2 189 ? -66.837 21.762 -148.923 1.00 118.73 ? 183 LYS N O   1 
ATOM   6476 C CB  . LYS D 2 189 ? -63.736 21.379 -149.464 1.00 119.65 ? 183 LYS N CB  1 
ATOM   6477 C CG  . LYS D 2 189 ? -64.307 20.010 -149.122 1.00 119.69 ? 183 LYS N CG  1 
ATOM   6478 C CD  . LYS D 2 189 ? -63.305 18.916 -149.466 1.00 119.91 ? 183 LYS N CD  1 
ATOM   6479 C CE  . LYS D 2 189 ? -63.546 17.646 -148.661 1.00 119.97 ? 183 LYS N CE  1 
ATOM   6480 N NZ  . LYS D 2 189 ? -62.960 17.705 -147.284 1.00 119.01 ? 183 LYS N NZ  1 
ATOM   6481 N N   . ALA D 2 190 ? -65.785 23.568 -148.084 1.00 121.90 ? 184 ALA N N   1 
ATOM   6482 C CA  . ALA D 2 190 ? -66.799 23.846 -147.070 1.00 120.17 ? 184 ALA N CA  1 
ATOM   6483 C C   . ALA D 2 190 ? -68.137 24.261 -147.700 1.00 116.83 ? 184 ALA N C   1 
ATOM   6484 O O   . ALA D 2 190 ? -69.207 23.795 -147.290 1.00 116.41 ? 184 ALA N O   1 
ATOM   6485 C CB  . ALA D 2 190 ? -66.293 24.912 -146.095 1.00 115.84 ? 184 ALA N CB  1 
ATOM   6486 N N   . ASP D 2 191 ? -68.072 25.139 -148.696 1.00 115.42 ? 185 ASP N N   1 
ATOM   6487 C CA  . ASP D 2 191 ? -69.265 25.526 -149.437 1.00 117.77 ? 185 ASP N CA  1 
ATOM   6488 C C   . ASP D 2 191 ? -69.741 24.348 -150.280 1.00 115.76 ? 185 ASP N C   1 
ATOM   6489 O O   . ASP D 2 191 ? -70.939 24.109 -150.396 1.00 117.84 ? 185 ASP N O   1 
ATOM   6490 C CB  . ASP D 2 191 ? -68.995 26.734 -150.342 1.00 120.29 ? 185 ASP N CB  1 
ATOM   6491 C CG  . ASP D 2 191 ? -68.467 27.940 -149.581 1.00 125.06 ? 185 ASP N CG  1 
ATOM   6492 O OD1 . ASP D 2 191 ? -67.969 27.773 -148.447 1.00 122.98 ? 185 ASP N OD1 1 
ATOM   6493 O OD2 . ASP D 2 191 ? -68.539 29.061 -150.133 1.00 127.81 ? 185 ASP N OD2 1 
ATOM   6494 N N   . TYR D 2 192 ? -68.796 23.611 -150.860 1.00 111.83 ? 186 TYR N N   1 
ATOM   6495 C CA  . TYR D 2 192 ? -69.128 22.483 -151.727 1.00 109.13 ? 186 TYR N CA  1 
ATOM   6496 C C   . TYR D 2 192 ? -70.008 21.468 -151.012 1.00 113.26 ? 186 TYR N C   1 
ATOM   6497 O O   . TYR D 2 192 ? -70.951 20.915 -151.582 1.00 115.33 ? 186 TYR N O   1 
ATOM   6498 C CB  . TYR D 2 192 ? -67.861 21.793 -152.239 1.00 104.30 ? 186 TYR N CB  1 
ATOM   6499 C CG  . TYR D 2 192 ? -68.128 20.650 -153.202 1.00 100.90 ? 186 TYR N CG  1 
ATOM   6500 C CD1 . TYR D 2 192 ? -68.562 20.890 -154.503 1.00 98.08  ? 186 TYR N CD1 1 
ATOM   6501 C CD2 . TYR D 2 192 ? -67.938 19.333 -152.815 1.00 101.90 ? 186 TYR N CD2 1 
ATOM   6502 C CE1 . TYR D 2 192 ? -68.806 19.842 -155.390 1.00 99.22  ? 186 TYR N CE1 1 
ATOM   6503 C CE2 . TYR D 2 192 ? -68.178 18.280 -153.694 1.00 104.91 ? 186 TYR N CE2 1 
ATOM   6504 C CZ  . TYR D 2 192 ? -68.612 18.539 -154.980 1.00 102.14 ? 186 TYR N CZ  1 
ATOM   6505 O OH  . TYR D 2 192 ? -68.848 17.490 -155.845 1.00 95.55  ? 186 TYR N OH  1 
ATOM   6506 N N   . GLU D 2 193 ? -69.698 21.222 -149.751 1.00 115.47 ? 187 GLU N N   1 
ATOM   6507 C CA  . GLU D 2 193 ? -70.402 20.190 -149.022 1.00 115.47 ? 187 GLU N CA  1 
ATOM   6508 C C   . GLU D 2 193 ? -71.788 20.678 -148.631 1.00 117.50 ? 187 GLU N C   1 
ATOM   6509 O O   . GLU D 2 193 ? -72.744 19.895 -148.589 1.00 114.34 ? 187 GLU N O   1 
ATOM   6510 C CB  . GLU D 2 193 ? -69.564 19.759 -147.834 1.00 112.89 ? 187 GLU N CB  1 
ATOM   6511 C CG  . GLU D 2 193 ? -68.187 19.333 -148.281 1.00 113.98 ? 187 GLU N CG  1 
ATOM   6512 C CD  . GLU D 2 193 ? -67.408 18.628 -147.204 1.00 129.83 ? 187 GLU N CD  1 
ATOM   6513 O OE1 . GLU D 2 193 ? -66.219 18.339 -147.449 1.00 135.94 ? 187 GLU N OE1 1 
ATOM   6514 O OE2 . GLU D 2 193 ? -67.979 18.362 -146.121 1.00 133.29 ? 187 GLU N OE2 1 
ATOM   6515 N N   . LYS D 2 194 ? -71.882 21.990 -148.411 1.00 117.16 ? 188 LYS N N   1 
ATOM   6516 C CA  . LYS D 2 194 ? -73.135 22.682 -148.097 1.00 112.94 ? 188 LYS N CA  1 
ATOM   6517 C C   . LYS D 2 194 ? -74.291 22.494 -149.101 1.00 114.98 ? 188 LYS N C   1 
ATOM   6518 O O   . LYS D 2 194 ? -75.446 22.745 -148.755 1.00 114.79 ? 188 LYS N O   1 
ATOM   6519 C CB  . LYS D 2 194 ? -72.866 24.172 -147.878 1.00 106.90 ? 188 LYS N CB  1 
ATOM   6520 N N   . HIS D 2 195 ? -73.994 22.067 -150.331 1.00 114.07 ? 189 HIS N N   1 
ATOM   6521 C CA  . HIS D 2 195 ? -75.041 21.886 -151.342 1.00 110.12 ? 189 HIS N CA  1 
ATOM   6522 C C   . HIS D 2 195 ? -75.003 20.515 -152.030 1.00 103.35 ? 189 HIS N C   1 
ATOM   6523 O O   . HIS D 2 195 ? -73.963 19.845 -152.043 1.00 97.32  ? 189 HIS N O   1 
ATOM   6524 C CB  . HIS D 2 195 ? -74.973 22.991 -152.401 1.00 115.13 ? 189 HIS N CB  1 
ATOM   6525 C CG  . HIS D 2 195 ? -75.061 24.380 -151.847 1.00 121.09 ? 189 HIS N CG  1 
ATOM   6526 N ND1 . HIS D 2 195 ? -76.226 24.902 -151.325 1.00 123.36 ? 189 HIS N ND1 1 
ATOM   6527 C CD2 . HIS D 2 195 ? -74.135 25.365 -151.760 1.00 123.10 ? 189 HIS N CD2 1 
ATOM   6528 C CE1 . HIS D 2 195 ? -76.007 26.143 -150.926 1.00 125.38 ? 189 HIS N CE1 1 
ATOM   6529 N NE2 . HIS D 2 195 ? -74.746 26.448 -151.179 1.00 125.09 ? 189 HIS N NE2 1 
ATOM   6530 N N   . LYS D 2 196 ? -76.145 20.124 -152.607 1.00 105.03 ? 190 LYS N N   1 
ATOM   6531 C CA  . LYS D 2 196 ? -76.296 18.844 -153.314 1.00 109.55 ? 190 LYS N CA  1 
ATOM   6532 C C   . LYS D 2 196 ? -76.380 18.951 -154.844 1.00 116.93 ? 190 LYS N C   1 
ATOM   6533 O O   . LYS D 2 196 ? -75.998 18.017 -155.548 1.00 124.01 ? 190 LYS N O   1 
ATOM   6534 C CB  . LYS D 2 196 ? -77.522 18.078 -152.812 1.00 109.54 ? 190 LYS N CB  1 
ATOM   6535 C CG  . LYS D 2 196 ? -77.221 16.966 -151.808 1.00 118.04 ? 190 LYS N CG  1 
ATOM   6536 C CD  . LYS D 2 196 ? -78.493 16.203 -151.433 1.00 120.29 ? 190 LYS N CD  1 
ATOM   6537 C CE  . LYS D 2 196 ? -78.188 14.842 -150.824 1.00 120.83 ? 190 LYS N CE  1 
ATOM   6538 N NZ  . LYS D 2 196 ? -79.410 13.984 -150.736 1.00 122.47 ? 190 LYS N NZ  1 
ATOM   6539 N N   . VAL D 2 197 ? -76.886 20.066 -155.362 1.00 111.73 ? 191 VAL N N   1 
ATOM   6540 C CA  . VAL D 2 197 ? -77.105 20.190 -156.808 1.00 104.08 ? 191 VAL N CA  1 
ATOM   6541 C C   . VAL D 2 197 ? -76.170 21.183 -157.491 1.00 99.56  ? 191 VAL N C   1 
ATOM   6542 O O   . VAL D 2 197 ? -76.173 22.366 -157.156 1.00 97.07  ? 191 VAL N O   1 
ATOM   6543 C CB  . VAL D 2 197 ? -78.542 20.626 -157.109 1.00 102.34 ? 191 VAL N CB  1 
ATOM   6544 C CG1 . VAL D 2 197 ? -78.723 20.857 -158.612 1.00 98.55  ? 191 VAL N CG1 1 
ATOM   6545 C CG2 . VAL D 2 197 ? -79.525 19.601 -156.562 1.00 95.98  ? 191 VAL N CG2 1 
ATOM   6546 N N   . TYR D 2 198 ? -75.379 20.708 -158.453 1.00 97.21  ? 192 TYR N N   1 
ATOM   6547 C CA  . TYR D 2 198 ? -74.482 21.598 -159.201 1.00 95.77  ? 192 TYR N CA  1 
ATOM   6548 C C   . TYR D 2 198 ? -74.756 21.578 -160.695 1.00 92.44  ? 192 TYR N C   1 
ATOM   6549 O O   . TYR D 2 198 ? -74.524 20.575 -161.381 1.00 88.95  ? 192 TYR N O   1 
ATOM   6550 C CB  . TYR D 2 198 ? -73.012 21.286 -158.921 1.00 94.52  ? 192 TYR N CB  1 
ATOM   6551 C CG  . TYR D 2 198 ? -72.578 21.667 -157.528 1.00 97.54  ? 192 TYR N CG  1 
ATOM   6552 C CD1 . TYR D 2 198 ? -72.250 22.979 -157.221 1.00 95.23  ? 192 TYR N CD1 1 
ATOM   6553 C CD2 . TYR D 2 198 ? -72.509 20.712 -156.516 1.00 103.34 ? 192 TYR N CD2 1 
ATOM   6554 C CE1 . TYR D 2 198 ? -71.862 23.329 -155.950 1.00 102.11 ? 192 TYR N CE1 1 
ATOM   6555 C CE2 . TYR D 2 198 ? -72.125 21.049 -155.241 1.00 102.94 ? 192 TYR N CE2 1 
ATOM   6556 C CZ  . TYR D 2 198 ? -71.804 22.359 -154.961 1.00 106.98 ? 192 TYR N CZ  1 
ATOM   6557 O OH  . TYR D 2 198 ? -71.417 22.700 -153.688 1.00 110.60 ? 192 TYR N OH  1 
ATOM   6558 N N   . ALA D 2 199 ? -75.236 22.709 -161.194 1.00 89.10  ? 193 ALA N N   1 
ATOM   6559 C CA  . ALA D 2 199 ? -75.746 22.766 -162.549 1.00 83.30  ? 193 ALA N CA  1 
ATOM   6560 C C   . ALA D 2 199 ? -74.928 23.660 -163.461 1.00 85.06  ? 193 ALA N C   1 
ATOM   6561 O O   . ALA D 2 199 ? -74.366 24.674 -163.045 1.00 88.73  ? 193 ALA N O   1 
ATOM   6562 C CB  . ALA D 2 199 ? -77.198 23.196 -162.542 1.00 81.32  ? 193 ALA N CB  1 
ATOM   6563 N N   . CYS D 2 200 ? -74.887 23.258 -164.720 1.00 82.75  ? 194 CYS N N   1 
ATOM   6564 C CA  . CYS D 2 200 ? -74.197 23.977 -165.771 1.00 78.61  ? 194 CYS N CA  1 
ATOM   6565 C C   . CYS D 2 200 ? -75.240 24.306 -166.832 1.00 72.19  ? 194 CYS N C   1 
ATOM   6566 O O   . CYS D 2 200 ? -75.748 23.408 -167.492 1.00 67.66  ? 194 CYS N O   1 
ATOM   6567 C CB  . CYS D 2 200 ? -73.124 23.067 -166.362 1.00 72.70  ? 194 CYS N CB  1 
ATOM   6568 S SG  . CYS D 2 200 ? -72.046 23.851 -167.512 1.00 88.83  ? 194 CYS N SG  1 
ATOM   6569 N N   . GLU D 2 201 ? -75.580 25.581 -166.978 1.00 67.22  ? 195 GLU N N   1 
ATOM   6570 C CA  . GLU D 2 201 ? -76.664 25.957 -167.871 1.00 67.38  ? 195 GLU N CA  1 
ATOM   6571 C C   . GLU D 2 201 ? -76.185 26.814 -169.028 1.00 70.58  ? 195 GLU N C   1 
ATOM   6572 O O   . GLU D 2 201 ? -75.662 27.914 -168.828 1.00 69.39  ? 195 GLU N O   1 
ATOM   6573 C CB  . GLU D 2 201 ? -77.767 26.679 -167.110 1.00 71.62  ? 195 GLU N CB  1 
ATOM   6574 C CG  . GLU D 2 201 ? -78.845 27.245 -168.013 1.00 77.36  ? 195 GLU N CG  1 
ATOM   6575 C CD  . GLU D 2 201 ? -80.193 27.347 -167.326 1.00 93.09  ? 195 GLU N CD  1 
ATOM   6576 O OE1 . GLU D 2 201 ? -80.349 26.793 -166.208 1.00 97.84  ? 195 GLU N OE1 1 
ATOM   6577 O OE2 . GLU D 2 201 ? -81.104 27.973 -167.912 1.00 97.95  ? 195 GLU N OE2 1 
ATOM   6578 N N   . VAL D 2 202 ? -76.377 26.311 -170.244 1.00 68.45  ? 196 VAL N N   1 
ATOM   6579 C CA  . VAL D 2 202 ? -75.793 26.952 -171.416 1.00 59.27  ? 196 VAL N CA  1 
ATOM   6580 C C   . VAL D 2 202 ? -76.828 27.514 -172.366 1.00 55.33  ? 196 VAL N C   1 
ATOM   6581 O O   . VAL D 2 202 ? -77.755 26.821 -172.780 1.00 62.31  ? 196 VAL N O   1 
ATOM   6582 C CB  . VAL D 2 202 ? -74.866 26.002 -172.183 1.00 54.22  ? 196 VAL N CB  1 
ATOM   6583 C CG1 . VAL D 2 202 ? -74.394 26.660 -173.446 1.00 44.40  ? 196 VAL N CG1 1 
ATOM   6584 C CG2 . VAL D 2 202 ? -73.683 25.623 -171.316 1.00 57.57  ? 196 VAL N CG2 1 
ATOM   6585 N N   . THR D 2 203 ? -76.658 28.790 -172.685 1.00 51.10  ? 197 THR N N   1 
ATOM   6586 C CA  . THR D 2 203 ? -77.493 29.478 -173.645 1.00 56.41  ? 197 THR N CA  1 
ATOM   6587 C C   . THR D 2 203 ? -76.598 29.871 -174.803 1.00 54.77  ? 197 THR N C   1 
ATOM   6588 O O   . THR D 2 203 ? -75.472 30.338 -174.605 1.00 52.26  ? 197 THR N O   1 
ATOM   6589 C CB  . THR D 2 203 ? -78.100 30.758 -173.053 1.00 60.94  ? 197 THR N CB  1 
ATOM   6590 O OG1 . THR D 2 203 ? -78.753 30.451 -171.822 1.00 68.50  ? 197 THR N OG1 1 
ATOM   6591 C CG2 . THR D 2 203 ? -79.110 31.370 -174.014 1.00 57.21  ? 197 THR N CG2 1 
ATOM   6592 N N   . HIS D 2 204 ? -77.099 29.687 -176.013 1.00 50.27  ? 198 HIS N N   1 
ATOM   6593 C CA  . HIS D 2 204 ? -76.284 29.917 -177.189 1.00 48.12  ? 198 HIS N CA  1 
ATOM   6594 C C   . HIS D 2 204 ? -77.172 29.971 -178.420 1.00 50.53  ? 198 HIS N C   1 
ATOM   6595 O O   . HIS D 2 204 ? -78.264 29.414 -178.418 1.00 58.08  ? 198 HIS N O   1 
ATOM   6596 C CB  . HIS D 2 204 ? -75.238 28.811 -177.349 1.00 43.66  ? 198 HIS N CB  1 
ATOM   6597 C CG  . HIS D 2 204 ? -74.355 29.012 -178.533 1.00 49.04  ? 198 HIS N CG  1 
ATOM   6598 N ND1 . HIS D 2 204 ? -74.707 28.595 -179.801 1.00 49.26  ? 198 HIS N ND1 1 
ATOM   6599 C CD2 . HIS D 2 204 ? -73.163 29.636 -178.657 1.00 50.95  ? 198 HIS N CD2 1 
ATOM   6600 C CE1 . HIS D 2 204 ? -73.753 28.928 -180.648 1.00 50.15  ? 198 HIS N CE1 1 
ATOM   6601 N NE2 . HIS D 2 204 ? -72.803 29.561 -179.981 1.00 52.78  ? 198 HIS N NE2 1 
ATOM   6602 N N   . GLN D 2 205 ? -76.692 30.628 -179.470 1.00 44.86  ? 199 GLN N N   1 
ATOM   6603 C CA  . GLN D 2 205 ? -77.488 30.862 -180.662 1.00 48.75  ? 199 GLN N CA  1 
ATOM   6604 C C   . GLN D 2 205 ? -77.883 29.554 -181.359 1.00 49.50  ? 199 GLN N C   1 
ATOM   6605 O O   . GLN D 2 205 ? -78.868 29.494 -182.083 1.00 42.84  ? 199 GLN N O   1 
ATOM   6606 C CB  . GLN D 2 205 ? -76.724 31.769 -181.626 1.00 56.12  ? 199 GLN N CB  1 
ATOM   6607 C CG  . GLN D 2 205 ? -77.514 32.170 -182.857 1.00 60.84  ? 199 GLN N CG  1 
ATOM   6608 C CD  . GLN D 2 205 ? -78.738 32.944 -182.482 1.00 68.84  ? 199 GLN N CD  1 
ATOM   6609 O OE1 . GLN D 2 205 ? -78.653 34.117 -182.107 1.00 68.43  ? 199 GLN N OE1 1 
ATOM   6610 N NE2 . GLN D 2 205 ? -79.895 32.293 -182.558 1.00 74.36  ? 199 GLN N NE2 1 
ATOM   6611 N N   . GLY D 2 206 ? -77.107 28.506 -181.133 1.00 48.64  ? 200 GLY N N   1 
ATOM   6612 C CA  . GLY D 2 206 ? -77.382 27.237 -181.770 1.00 45.32  ? 200 GLY N CA  1 
ATOM   6613 C C   . GLY D 2 206 ? -78.430 26.415 -181.054 1.00 44.06  ? 200 GLY N C   1 
ATOM   6614 O O   . GLY D 2 206 ? -78.932 25.441 -181.598 1.00 49.32  ? 200 GLY N O   1 
ATOM   6615 N N   . LEU D 2 207 ? -78.763 26.810 -179.833 1.00 46.92  ? 201 LEU N N   1 
ATOM   6616 C CA  . LEU D 2 207 ? -79.679 26.044 -178.992 1.00 45.73  ? 201 LEU N CA  1 
ATOM   6617 C C   . LEU D 2 207 ? -81.064 26.665 -178.941 1.00 50.47  ? 201 LEU N C   1 
ATOM   6618 O O   . LEU D 2 207 ? -81.230 27.813 -178.549 1.00 56.68  ? 201 LEU N O   1 
ATOM   6619 C CB  . LEU D 2 207 ? -79.117 25.935 -177.585 1.00 45.16  ? 201 LEU N CB  1 
ATOM   6620 C CG  . LEU D 2 207 ? -77.784 25.201 -177.532 1.00 48.38  ? 201 LEU N CG  1 
ATOM   6621 C CD1 . LEU D 2 207 ? -77.084 25.424 -176.203 1.00 44.71  ? 201 LEU N CD1 1 
ATOM   6622 C CD2 . LEU D 2 207 ? -78.033 23.740 -177.757 1.00 40.22  ? 201 LEU N CD2 1 
ATOM   6623 N N   . ARG D 2 208 ? -82.057 25.889 -179.347 1.00 51.33  ? 202 ARG N N   1 
ATOM   6624 C CA  . ARG D 2 208 ? -83.450 26.314 -179.333 1.00 51.03  ? 202 ARG N CA  1 
ATOM   6625 C C   . ARG D 2 208 ? -83.842 26.760 -177.926 1.00 58.93  ? 202 ARG N C   1 
ATOM   6626 O O   . ARG D 2 208 ? -84.636 27.674 -177.735 1.00 62.91  ? 202 ARG N O   1 
ATOM   6627 C CB  . ARG D 2 208 ? -84.307 25.159 -179.846 1.00 59.38  ? 202 ARG N CB  1 
ATOM   6628 C CG  . ARG D 2 208 ? -85.384 24.625 -178.913 1.00 74.81  ? 202 ARG N CG  1 
ATOM   6629 C CD  . ARG D 2 208 ? -85.606 23.099 -179.136 1.00 132.07 ? 202 ARG N CD  1 
ATOM   6630 N NE  . ARG D 2 208 ? -85.557 22.675 -180.547 1.00 127.28 ? 202 ARG N NE  1 
ATOM   6631 C CZ  . ARG D 2 208 ? -84.589 21.931 -181.089 1.00 116.55 ? 202 ARG N CZ  1 
ATOM   6632 N NH1 . ARG D 2 208 ? -83.569 21.508 -180.357 1.00 112.08 ? 202 ARG N NH1 1 
ATOM   6633 N NH2 . ARG D 2 208 ? -84.640 21.602 -182.370 1.00 111.41 ? 202 ARG N NH2 1 
ATOM   6634 N N   . SER D 2 209 ? -83.234 26.135 -176.934 1.00 62.91  ? 203 SER N N   1 
ATOM   6635 C CA  . SER D 2 209 ? -83.498 26.482 -175.562 1.00 69.45  ? 203 SER N CA  1 
ATOM   6636 C C   . SER D 2 209 ? -82.366 25.955 -174.705 1.00 69.25  ? 203 SER N C   1 
ATOM   6637 O O   . SER D 2 209 ? -81.787 24.913 -175.013 1.00 63.06  ? 203 SER N O   1 
ATOM   6638 C CB  . SER D 2 209 ? -84.825 25.874 -175.125 1.00 78.83  ? 203 SER N CB  1 
ATOM   6639 O OG  . SER D 2 209 ? -84.963 24.569 -175.653 1.00 83.97  ? 203 SER N OG  1 
ATOM   6640 N N   . PRO D 2 210 ? -82.054 26.679 -173.620 1.00 71.44  ? 204 PRO N N   1 
ATOM   6641 C CA  . PRO D 2 210 ? -80.912 26.424 -172.742 1.00 68.66  ? 204 PRO N CA  1 
ATOM   6642 C C   . PRO D 2 210 ? -80.682 24.944 -172.467 1.00 70.95  ? 204 PRO N C   1 
ATOM   6643 O O   . PRO D 2 210 ? -81.618 24.213 -172.172 1.00 76.33  ? 204 PRO N O   1 
ATOM   6644 C CB  . PRO D 2 210 ? -81.307 27.158 -171.464 1.00 63.72  ? 204 PRO N CB  1 
ATOM   6645 C CG  . PRO D 2 210 ? -82.070 28.335 -171.969 1.00 63.54  ? 204 PRO N CG  1 
ATOM   6646 C CD  . PRO D 2 210 ? -82.850 27.829 -173.154 1.00 66.64  ? 204 PRO N CD  1 
ATOM   6647 N N   . VAL D 2 211 ? -79.433 24.516 -172.583 1.00 68.46  ? 205 VAL N N   1 
ATOM   6648 C CA  . VAL D 2 211 ? -79.054 23.154 -172.272 1.00 69.57  ? 205 VAL N CA  1 
ATOM   6649 C C   . VAL D 2 211 ? -78.380 23.158 -170.916 1.00 72.94  ? 205 VAL N C   1 
ATOM   6650 O O   . VAL D 2 211 ? -77.472 23.952 -170.668 1.00 74.69  ? 205 VAL N O   1 
ATOM   6651 C CB  . VAL D 2 211 ? -78.077 22.597 -173.316 1.00 72.09  ? 205 VAL N CB  1 
ATOM   6652 C CG1 . VAL D 2 211 ? -77.332 21.406 -172.764 1.00 73.15  ? 205 VAL N CG1 1 
ATOM   6653 C CG2 . VAL D 2 211 ? -78.819 22.222 -174.582 1.00 76.23  ? 205 VAL N CG2 1 
ATOM   6654 N N   . THR D 2 212 ? -78.833 22.270 -170.043 1.00 74.27  ? 206 THR N N   1 
ATOM   6655 C CA  . THR D 2 212 ? -78.333 22.184 -168.684 1.00 72.17  ? 206 THR N CA  1 
ATOM   6656 C C   . THR D 2 212 ? -77.668 20.839 -168.463 1.00 71.78  ? 206 THR N C   1 
ATOM   6657 O O   . THR D 2 212 ? -78.249 19.807 -168.755 1.00 67.34  ? 206 THR N O   1 
ATOM   6658 C CB  . THR D 2 212 ? -79.488 22.327 -167.682 1.00 77.94  ? 206 THR N CB  1 
ATOM   6659 O OG1 . THR D 2 212 ? -80.093 23.615 -167.833 1.00 81.99  ? 206 THR N OG1 1 
ATOM   6660 C CG2 . THR D 2 212 ? -78.993 22.188 -166.274 1.00 79.45  ? 206 THR N CG2 1 
ATOM   6661 N N   . LYS D 2 213 ? -76.445 20.857 -167.952 1.00 77.68  ? 207 LYS N N   1 
ATOM   6662 C CA  . LYS D 2 213 ? -75.758 19.635 -167.550 1.00 88.99  ? 207 LYS N CA  1 
ATOM   6663 C C   . LYS D 2 213 ? -75.464 19.678 -166.043 1.00 94.13  ? 207 LYS N C   1 
ATOM   6664 O O   . LYS D 2 213 ? -75.055 20.717 -165.525 1.00 92.05  ? 207 LYS N O   1 
ATOM   6665 C CB  . LYS D 2 213 ? -74.450 19.506 -168.332 1.00 92.23  ? 207 LYS N CB  1 
ATOM   6666 C CG  . LYS D 2 213 ? -74.613 19.052 -169.766 1.00 92.01  ? 207 LYS N CG  1 
ATOM   6667 C CD  . LYS D 2 213 ? -74.740 17.539 -169.830 1.00 94.36  ? 207 LYS N CD  1 
ATOM   6668 C CE  . LYS D 2 213 ? -74.938 17.032 -171.251 1.00 94.11  ? 207 LYS N CE  1 
ATOM   6669 N NZ  . LYS D 2 213 ? -76.273 17.383 -171.824 1.00 86.40  ? 207 LYS N NZ  1 
ATOM   6670 N N   . SER D 2 214 ? -75.660 18.573 -165.325 1.00 101.06 ? 208 SER N N   1 
ATOM   6671 C CA  . SER D 2 214 ? -75.333 18.600 -163.891 1.00 104.29 ? 208 SER N CA  1 
ATOM   6672 C C   . SER D 2 214 ? -75.081 17.266 -163.194 1.00 102.49 ? 208 SER N C   1 
ATOM   6673 O O   . SER D 2 214 ? -75.062 16.213 -163.828 1.00 97.39  ? 208 SER N O   1 
ATOM   6674 C CB  . SER D 2 214 ? -76.381 19.398 -163.117 1.00 104.54 ? 208 SER N CB  1 
ATOM   6675 O OG  . SER D 2 214 ? -77.673 19.133 -163.611 1.00 108.55 ? 208 SER N OG  1 
ATOM   6676 N N   . PHE D 2 215 ? -74.877 17.353 -161.877 1.00 108.72 ? 209 PHE N N   1 
ATOM   6677 C CA  . PHE D 2 215 ? -74.590 16.208 -161.008 1.00 109.93 ? 209 PHE N CA  1 
ATOM   6678 C C   . PHE D 2 215 ? -74.944 16.556 -159.555 1.00 111.16 ? 209 PHE N C   1 
ATOM   6679 O O   . PHE D 2 215 ? -75.420 17.660 -159.272 1.00 103.79 ? 209 PHE N O   1 
ATOM   6680 C CB  . PHE D 2 215 ? -73.107 15.895 -161.061 1.00 106.13 ? 209 PHE N CB  1 
ATOM   6681 C CG  . PHE D 2 215 ? -72.272 16.953 -160.426 1.00 103.83 ? 209 PHE N CG  1 
ATOM   6682 C CD1 . PHE D 2 215 ? -71.820 18.020 -161.165 1.00 102.32 ? 209 PHE N CD1 1 
ATOM   6683 C CD2 . PHE D 2 215 ? -71.981 16.911 -159.077 1.00 105.16 ? 209 PHE N CD2 1 
ATOM   6684 C CE1 . PHE D 2 215 ? -71.062 19.009 -160.578 1.00 101.77 ? 209 PHE N CE1 1 
ATOM   6685 C CE2 . PHE D 2 215 ? -71.226 17.899 -158.482 1.00 104.60 ? 209 PHE N CE2 1 
ATOM   6686 C CZ  . PHE D 2 215 ? -70.765 18.949 -159.235 1.00 102.16 ? 209 PHE N CZ  1 
ATOM   6687 N N   . ASN D 2 216 ? -74.675 15.623 -158.635 1.00 120.30 ? 210 ASN N N   1 
ATOM   6688 C CA  . ASN D 2 216 ? -74.928 15.827 -157.201 1.00 123.00 ? 210 ASN N CA  1 
ATOM   6689 C C   . ASN D 2 216 ? -73.794 15.374 -156.262 1.00 130.11 ? 210 ASN N C   1 
ATOM   6690 O O   . ASN D 2 216 ? -73.102 14.395 -156.556 1.00 132.50 ? 210 ASN N O   1 
ATOM   6691 C CB  . ASN D 2 216 ? -76.222 15.121 -156.793 1.00 126.34 ? 210 ASN N CB  1 
ATOM   6692 C CG  . ASN D 2 216 ? -77.416 15.577 -157.605 1.00 129.12 ? 210 ASN N CG  1 
ATOM   6693 O OD1 . ASN D 2 216 ? -77.477 16.724 -158.061 1.00 130.56 ? 210 ASN N OD1 1 
ATOM   6694 N ND2 . ASN D 2 216 ? -78.380 14.681 -157.789 1.00 126.63 ? 210 ASN N ND2 1 
ATOM   6695 N N   . ARG D 2 217 ? -73.618 16.099 -155.148 1.00 135.73 ? 211 ARG N N   1 
ATOM   6696 C CA  . ARG D 2 217 ? -72.767 15.690 -154.007 1.00 142.99 ? 211 ARG N CA  1 
ATOM   6697 C C   . ARG D 2 217 ? -72.236 16.871 -153.160 1.00 144.42 ? 211 ARG N C   1 
ATOM   6698 O O   . ARG D 2 217 ? -72.845 17.305 -152.177 1.00 148.49 ? 211 ARG N O   1 
ATOM   6699 C CB  . ARG D 2 217 ? -71.593 14.805 -154.454 1.00 140.38 ? 211 ARG N CB  1 
ATOM   6700 C CG  . ARG D 2 217 ? -71.358 13.577 -153.580 1.00 138.17 ? 211 ARG N CG  1 
ATOM   6701 C CD  . ARG D 2 217 ? -72.168 12.388 -154.080 1.00 138.01 ? 211 ARG N CD  1 
ATOM   6702 N NE  . ARG D 2 217 ? -71.882 12.122 -155.486 1.00 135.86 ? 211 ARG N NE  1 
ATOM   6703 C CZ  . ARG D 2 217 ? -72.561 11.267 -156.243 1.00 130.66 ? 211 ARG N CZ  1 
ATOM   6704 N NH1 . ARG D 2 217 ? -73.574 10.585 -155.731 1.00 122.24 ? 211 ARG N NH1 1 
ATOM   6705 N NH2 . ARG D 2 217 ? -72.227 11.099 -157.516 1.00 132.06 ? 211 ARG N NH2 1 
ATOM   6706 O OXT . ARG D 2 217 ? -71.166 17.427 -153.419 1.00 137.49 ? 211 ARG N OXT 1 
HETATM 6707 S S   . SO4 E 3 .   ? -77.758 77.386 -159.168 1.00 95.43  ? 229 SO4 H S   1 
HETATM 6708 O O1  . SO4 E 3 .   ? -77.493 78.820 -159.017 1.00 84.50  ? 229 SO4 H O1  1 
HETATM 6709 O O2  . SO4 E 3 .   ? -78.864 77.121 -160.086 1.00 89.65  ? 229 SO4 H O2  1 
HETATM 6710 O O3  . SO4 E 3 .   ? -76.570 76.703 -159.672 1.00 96.86  ? 229 SO4 H O3  1 
HETATM 6711 O O4  . SO4 E 3 .   ? -78.099 76.856 -157.850 1.00 105.97 ? 229 SO4 H O4  1 
HETATM 6712 S S   . SO4 F 3 .   ? -91.729 73.939 -153.288 1.00 97.95  ? 230 SO4 H S   1 
HETATM 6713 O O1  . SO4 F 3 .   ? -91.419 73.163 -154.491 1.00 91.59  ? 230 SO4 H O1  1 
HETATM 6714 O O2  . SO4 F 3 .   ? -91.540 75.366 -153.561 1.00 91.86  ? 230 SO4 H O2  1 
HETATM 6715 O O3  . SO4 F 3 .   ? -93.091 73.650 -152.836 1.00 90.22  ? 230 SO4 H O3  1 
HETATM 6716 O O4  . SO4 F 3 .   ? -90.823 73.563 -152.210 1.00 107.63 ? 230 SO4 H O4  1 
HETATM 6717 S S   . SO4 G 3 .   ? -75.345 51.381 -125.745 1.00 93.79  ? 231 SO4 H S   1 
HETATM 6718 O O1  . SO4 G 3 .   ? -76.532 51.994 -126.351 1.00 102.75 ? 231 SO4 H O1  1 
HETATM 6719 O O2  . SO4 G 3 .   ? -75.684 51.021 -124.365 1.00 88.07  ? 231 SO4 H O2  1 
HETATM 6720 O O3  . SO4 G 3 .   ? -75.002 50.226 -126.587 1.00 95.14  ? 231 SO4 H O3  1 
HETATM 6721 O O4  . SO4 G 3 .   ? -74.206 52.304 -125.689 1.00 70.13  ? 231 SO4 H O4  1 
HETATM 6722 C C1  . GOL H 4 .   ? -77.947 51.802 -143.641 1.00 73.20  ? 232 GOL H C1  1 
HETATM 6723 O O1  . GOL H 4 .   ? -76.723 52.394 -143.284 1.00 71.00  ? 232 GOL H O1  1 
HETATM 6724 C C2  . GOL H 4 .   ? -78.563 51.260 -142.361 1.00 77.39  ? 232 GOL H C2  1 
HETATM 6725 O O2  . GOL H 4 .   ? -78.873 52.344 -141.497 1.00 68.29  ? 232 GOL H O2  1 
HETATM 6726 C C3  . GOL H 4 .   ? -79.809 50.458 -142.730 1.00 80.56  ? 232 GOL H C3  1 
HETATM 6727 O O3  . GOL H 4 .   ? -80.064 49.501 -141.725 1.00 76.73  ? 232 GOL H O3  1 
HETATM 6728 S S   . SO4 I 3 .   ? -63.289 60.161 -157.331 1.00 109.67 ? 212 SO4 L S   1 
HETATM 6729 O O1  . SO4 I 3 .   ? -61.938 60.084 -156.773 1.00 105.80 ? 212 SO4 L O1  1 
HETATM 6730 O O2  . SO4 I 3 .   ? -63.631 61.549 -157.647 1.00 107.11 ? 212 SO4 L O2  1 
HETATM 6731 O O3  . SO4 I 3 .   ? -63.376 59.374 -158.558 1.00 109.97 ? 212 SO4 L O3  1 
HETATM 6732 O O4  . SO4 I 3 .   ? -64.229 59.616 -156.351 1.00 115.66 ? 212 SO4 L O4  1 
HETATM 6733 C C1  . GOL J 4 .   ? -62.580 58.603 -162.713 1.00 79.73  ? 213 GOL L C1  1 
HETATM 6734 O O1  . GOL J 4 .   ? -61.318 58.277 -162.179 1.00 87.89  ? 213 GOL L O1  1 
HETATM 6735 C C2  . GOL J 4 .   ? -63.627 57.612 -162.210 1.00 75.88  ? 213 GOL L C2  1 
HETATM 6736 O O2  . GOL J 4 .   ? -63.141 56.800 -161.142 1.00 72.45  ? 213 GOL L O2  1 
HETATM 6737 C C3  . GOL J 4 .   ? -64.826 58.451 -161.792 1.00 70.65  ? 213 GOL L C3  1 
HETATM 6738 O O3  . GOL J 4 .   ? -65.862 57.657 -161.267 1.00 68.96  ? 213 GOL L O3  1 
HETATM 6739 S S   . SO4 K 3 .   ? -44.937 43.147 -157.718 1.00 93.06  ? 229 SO4 M S   1 
HETATM 6740 O O1  . SO4 K 3 .   ? -46.107 43.961 -157.390 1.00 95.45  ? 229 SO4 M O1  1 
HETATM 6741 O O2  . SO4 K 3 .   ? -44.162 42.889 -156.514 1.00 87.76  ? 229 SO4 M O2  1 
HETATM 6742 O O3  . SO4 K 3 .   ? -45.364 41.868 -158.299 1.00 91.07  ? 229 SO4 M O3  1 
HETATM 6743 O O4  . SO4 K 3 .   ? -44.123 43.914 -158.665 1.00 96.39  ? 229 SO4 M O4  1 
HETATM 6744 S S   . SO4 L 3 .   ? -25.979 33.204 -194.354 1.00 91.37  ? 230 SO4 M S   1 
HETATM 6745 O O1  . SO4 L 3 .   ? -25.676 34.238 -195.349 1.00 84.90  ? 230 SO4 M O1  1 
HETATM 6746 O O2  . SO4 L 3 .   ? -27.413 32.933 -194.412 1.00 92.66  ? 230 SO4 M O2  1 
HETATM 6747 O O3  . SO4 L 3 .   ? -25.233 31.965 -194.579 1.00 85.09  ? 230 SO4 M O3  1 
HETATM 6748 O O4  . SO4 L 3 .   ? -25.620 33.691 -193.025 1.00 96.77  ? 230 SO4 M O4  1 
HETATM 6749 S S   . SO4 M 3 .   ? -21.613 46.175 -189.832 1.00 85.06  ? 231 SO4 M S   1 
HETATM 6750 O O1  . SO4 M 3 .   ? -20.437 45.309 -189.786 1.00 73.26  ? 231 SO4 M O1  1 
HETATM 6751 O O2  . SO4 M 3 .   ? -21.517 47.238 -188.832 1.00 76.33  ? 231 SO4 M O2  1 
HETATM 6752 O O3  . SO4 M 3 .   ? -21.736 46.764 -191.160 1.00 91.68  ? 231 SO4 M O3  1 
HETATM 6753 O O4  . SO4 M 3 .   ? -22.816 45.382 -189.592 1.00 95.97  ? 231 SO4 M O4  1 
HETATM 6754 C C1  . GOL N 4 .   ? -45.877 46.323 -174.249 1.00 74.85  ? 232 GOL M C1  1 
HETATM 6755 O O1  . GOL N 4 .   ? -45.006 45.298 -173.827 1.00 73.47  ? 232 GOL M O1  1 
HETATM 6756 C C2  . GOL N 4 .   ? -46.114 46.239 -175.759 1.00 72.35  ? 232 GOL M C2  1 
HETATM 6757 O O2  . GOL N 4 .   ? -46.457 44.926 -176.192 1.00 52.77  ? 232 GOL M O2  1 
HETATM 6758 C C3  . GOL N 4 .   ? -47.236 47.217 -176.086 1.00 80.81  ? 232 GOL M C3  1 
HETATM 6759 O O3  . GOL N 4 .   ? -47.218 47.486 -177.469 1.00 86.03  ? 232 GOL M O3  1 
HETATM 6760 S S   . SO4 O 3 .   ? -47.987 28.995 -190.407 1.00 94.26  ? 212 SO4 N S   1 
HETATM 6761 O O1  . SO4 O 3 .   ? -46.538 29.052 -190.596 1.00 95.50  ? 212 SO4 N O1  1 
HETATM 6762 O O2  . SO4 O 3 .   ? -48.421 30.108 -189.557 1.00 99.75  ? 212 SO4 N O2  1 
HETATM 6763 O O3  . SO4 O 3 .   ? -48.608 29.117 -191.722 1.00 96.96  ? 212 SO4 N O3  1 
HETATM 6764 O O4  . SO4 O 3 .   ? -48.374 27.735 -189.773 1.00 83.67  ? 212 SO4 N O4  1 
HETATM 6765 C C1  . GOL P 4 .   ? -50.503 29.015 -194.754 1.00 75.73  ? 213 GOL N C1  1 
HETATM 6766 O O1  . GOL P 4 .   ? -51.327 28.343 -193.822 1.00 76.80  ? 213 GOL N O1  1 
HETATM 6767 C C2  . GOL P 4 .   ? -50.772 30.528 -194.750 1.00 77.23  ? 213 GOL N C2  1 
HETATM 6768 O O2  . GOL P 4 .   ? -51.599 30.999 -193.670 1.00 66.62  ? 213 GOL N O2  1 
HETATM 6769 C C3  . GOL P 4 .   ? -49.419 31.237 -194.877 1.00 71.07  ? 213 GOL N C3  1 
HETATM 6770 O O3  . GOL P 4 .   ? -49.461 32.533 -194.322 1.00 66.89  ? 213 GOL N O3  1 
HETATM 6771 O O   . HOH Q 5 .   ? -71.769 58.927 -124.410 1.00 55.45  ? 233 HOH H O   1 
HETATM 6772 O O   . HOH Q 5 .   ? -38.432 49.160 -136.695 1.00 53.50  ? 234 HOH H O   1 
HETATM 6773 O O   . HOH Q 5 .   ? -75.945 51.730 -136.403 1.00 51.72  ? 235 HOH H O   1 
HETATM 6774 O O   . HOH Q 5 .   ? -75.207 63.012 -124.665 1.00 43.71  ? 236 HOH H O   1 
HETATM 6775 O O   . HOH Q 5 .   ? -67.962 55.186 -133.517 1.00 55.39  ? 237 HOH H O   1 
HETATM 6776 O O   . HOH Q 5 .   ? -80.544 52.540 -128.002 1.00 52.96  ? 238 HOH H O   1 
HETATM 6777 O O   . HOH Q 5 .   ? -86.929 66.875 -133.969 1.00 43.99  ? 239 HOH H O   1 
HETATM 6778 O O   . HOH Q 5 .   ? -85.507 54.802 -146.148 1.00 47.15  ? 240 HOH H O   1 
HETATM 6779 O O   . HOH Q 5 .   ? -87.009 53.435 -142.361 1.00 56.69  ? 241 HOH H O   1 
HETATM 6780 O O   . HOH Q 5 .   ? -67.775 49.263 -134.459 1.00 53.83  ? 242 HOH H O   1 
HETATM 6781 O O   . HOH Q 5 .   ? -69.028 52.856 -144.227 1.00 61.55  ? 243 HOH H O   1 
HETATM 6782 O O   . HOH Q 5 .   ? -84.091 71.463 -137.998 1.00 53.10  ? 244 HOH H O   1 
HETATM 6783 O O   . HOH Q 5 .   ? -57.330 45.229 -124.484 1.00 59.55  ? 245 HOH H O   1 
HETATM 6784 O O   . HOH Q 5 .   ? -80.674 64.618 -169.085 1.00 64.61  ? 246 HOH H O   1 
HETATM 6785 O O   . HOH Q 5 .   ? -68.607 60.039 -133.642 1.00 56.48  ? 247 HOH H O   1 
HETATM 6786 O O   . HOH Q 5 .   ? -73.628 52.612 -131.016 1.00 50.37  ? 248 HOH H O   1 
HETATM 6787 O O   . HOH Q 5 .   ? -59.453 61.373 -122.852 1.00 59.40  ? 249 HOH H O   1 
HETATM 6788 O O   . HOH Q 5 .   ? -70.483 54.549 -142.466 1.00 61.59  ? 250 HOH H O   1 
HETATM 6789 O O   . HOH Q 5 .   ? -67.530 53.560 -146.753 1.00 63.93  ? 251 HOH H O   1 
HETATM 6790 O O   . HOH Q 5 .   ? -92.584 73.417 -143.088 1.00 53.22  ? 252 HOH H O   1 
HETATM 6791 O O   . HOH Q 5 .   ? -90.491 73.629 -141.290 1.00 47.73  ? 253 HOH H O   1 
HETATM 6792 O O   . HOH Q 5 .   ? -90.686 76.825 -141.699 1.00 61.67  ? 254 HOH H O   1 
HETATM 6793 O O   . HOH Q 5 .   ? -54.103 52.373 -149.248 1.00 70.45  ? 255 HOH H O   1 
HETATM 6794 O O   . HOH R 5 .   ? -52.117 33.984 -149.335 1.00 54.26  ? 214 HOH L O   1 
HETATM 6795 O O   . HOH R 5 .   ? -83.679 54.483 -148.258 1.00 51.16  ? 215 HOH L O   1 
HETATM 6796 O O   . HOH R 5 .   ? -57.909 39.176 -152.709 1.00 46.24  ? 216 HOH L O   1 
HETATM 6797 O O   . HOH R 5 .   ? -54.806 43.040 -163.345 1.00 48.09  ? 217 HOH L O   1 
HETATM 6798 O O   . HOH R 5 .   ? -84.765 53.181 -169.612 1.00 56.05  ? 218 HOH L O   1 
HETATM 6799 O O   . HOH R 5 .   ? -66.752 57.648 -153.648 1.00 57.96  ? 219 HOH L O   1 
HETATM 6800 O O   . HOH R 5 .   ? -50.785 42.122 -162.319 1.00 65.23  ? 220 HOH L O   1 
HETATM 6801 O O   . HOH R 5 .   ? -43.750 47.797 -153.058 1.00 59.03  ? 221 HOH L O   1 
HETATM 6802 O O   . HOH R 5 .   ? -54.050 49.368 -149.487 1.00 56.15  ? 222 HOH L O   1 
HETATM 6803 O O   . HOH R 5 .   ? -88.013 59.216 -150.551 1.00 55.08  ? 223 HOH L O   1 
HETATM 6804 O O   . HOH R 5 .   ? -88.240 63.372 -163.690 1.00 55.78  ? 224 HOH L O   1 
HETATM 6805 O O   . HOH R 5 .   ? -71.470 44.679 -150.475 1.00 57.46  ? 225 HOH L O   1 
HETATM 6806 O O   . HOH R 5 .   ? -83.686 48.047 -151.225 1.00 59.20  ? 226 HOH L O   1 
HETATM 6807 O O   . HOH R 5 .   ? -60.261 58.697 -166.760 1.00 61.39  ? 227 HOH L O   1 
HETATM 6808 O O   . HOH R 5 .   ? -74.215 59.103 -171.961 1.00 59.75  ? 228 HOH L O   1 
HETATM 6809 O O   . HOH R 5 .   ? -82.083 51.992 -148.901 1.00 57.10  ? 229 HOH L O   1 
HETATM 6810 O O   . HOH R 5 .   ? -83.019 61.980 -163.417 1.00 64.44  ? 230 HOH L O   1 
HETATM 6811 O O   . HOH S 5 .   ? -21.621 42.775 -178.735 1.00 42.54  ? 233 HOH M O   1 
HETATM 6812 O O   . HOH S 5 .   ? -39.949 36.784 -157.513 1.00 46.35  ? 234 HOH M O   1 
HETATM 6813 O O   . HOH S 5 .   ? -59.482 26.950 -168.403 1.00 48.58  ? 235 HOH M O   1 
HETATM 6814 O O   . HOH S 5 .   ? -46.814 35.369 -165.793 1.00 44.76  ? 236 HOH M O   1 
HETATM 6815 O O   . HOH S 5 .   ? -38.916 31.449 -156.694 1.00 54.61  ? 237 HOH M O   1 
HETATM 6816 O O   . HOH S 5 .   ? -16.996 37.599 -182.873 1.00 60.94  ? 238 HOH M O   1 
HETATM 6817 O O   . HOH S 5 .   ? -53.435 33.727 -170.598 1.00 63.14  ? 239 HOH M O   1 
HETATM 6818 O O   . HOH S 5 .   ? -34.514 26.420 -175.181 1.00 62.19  ? 240 HOH M O   1 
HETATM 6819 O O   . HOH S 5 .   ? -49.163 23.934 -174.236 1.00 54.14  ? 241 HOH M O   1 
HETATM 6820 O O   . HOH S 5 .   ? -38.283 33.718 -154.326 1.00 61.04  ? 242 HOH M O   1 
HETATM 6821 O O   . HOH S 5 .   ? -39.507 39.304 -153.227 1.00 63.46  ? 243 HOH M O   1 
HETATM 6822 O O   . HOH S 5 .   ? -32.688 33.931 -168.367 1.00 60.04  ? 244 HOH M O   1 
HETATM 6823 O O   . HOH S 5 .   ? -48.482 46.305 -181.752 1.00 51.20  ? 245 HOH M O   1 
HETATM 6824 O O   . HOH S 5 .   ? -43.958 24.435 -155.894 1.00 57.44  ? 246 HOH M O   1 
HETATM 6825 O O   . HOH S 5 .   ? -47.422 21.869 -155.764 1.00 65.75  ? 247 HOH M O   1 
HETATM 6826 O O   . HOH T 5 .   ? -74.835 32.515 -179.084 1.00 46.32  ? 214 HOH N O   1 
HETATM 6827 O O   . HOH T 5 .   ? -47.855 33.118 -186.579 1.00 52.87  ? 215 HOH N O   1 
HETATM 6828 O O   . HOH T 5 .   ? -84.341 22.125 -184.808 1.00 48.11  ? 216 HOH N O   1 
HETATM 6829 O O   . HOH T 5 .   ? -70.522 27.233 -192.282 1.00 47.74  ? 217 HOH N O   1 
HETATM 6830 O O   . HOH T 5 .   ? -67.715 30.628 -194.246 1.00 44.45  ? 218 HOH N O   1 
HETATM 6831 O O   . HOH T 5 .   ? -55.581 47.751 -184.209 1.00 57.66  ? 219 HOH N O   1 
HETATM 6832 O O   . HOH T 5 .   ? -74.608 18.550 -175.317 1.00 67.05  ? 220 HOH N O   1 
HETATM 6833 O O   . HOH T 5 .   ? -56.330 29.716 -178.832 1.00 52.11  ? 221 HOH N O   1 
HETATM 6834 O O   . HOH T 5 .   ? -67.912 34.756 -183.324 1.00 56.06  ? 222 HOH N O   1 
HETATM 6835 O O   . HOH T 5 .   ? -56.542 25.848 -184.679 1.00 60.68  ? 223 HOH N O   1 
HETATM 6836 O O   . HOH T 5 .   ? -60.311 33.566 -172.880 1.00 60.91  ? 224 HOH N O   1 
HETATM 6837 O O   . HOH T 5 .   ? -41.620 33.428 -187.878 1.00 65.42  ? 225 HOH N O   1 
HETATM 6838 O O   . HOH T 5 .   ? -64.370 41.765 -182.058 1.00 62.29  ? 226 HOH N O   1 
HETATM 6839 O O   . HOH T 5 .   ? -59.996 33.900 -183.351 1.00 62.54  ? 227 HOH N O   1 
HETATM 6840 O O   . HOH T 5 .   ? -41.730 49.301 -181.752 1.00 55.73  ? 228 HOH N O   1 
HETATM 6841 O O   . HOH T 5 .   ? -62.909 43.089 -195.898 1.00 59.87  ? 229 HOH N O   1 
HETATM 6842 O O   . HOH T 5 .   ? -80.452 29.004 -176.116 1.00 60.64  ? 230 HOH N O   1 
HETATM 6843 O O   . HOH T 5 .   ? -74.443 24.422 -191.774 1.00 56.26  ? 231 HOH N O   1 
HETATM 6844 O O   . HOH T 5 .   ? -43.943 31.609 -187.274 1.00 57.58  ? 232 HOH N O   1 
HETATM 6845 O O   . HOH T 5 .   ? -74.896 13.141 -159.956 1.00 69.37  ? 233 HOH N O   1 
HETATM 6846 O O   . HOH T 5 .   ? -52.000 27.488 -199.248 1.00 65.04  ? 234 HOH N O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . GLU A 1   ? 0.9397 0.9808 1.2468 0.1290  0.0826  0.2093  1   GLU H N   
2    C CA  . GLU A 1   ? 1.0233 1.0696 1.3162 0.1378  0.0796  0.2004  1   GLU H CA  
3    C C   . GLU A 1   ? 0.9691 1.0320 1.2323 0.1347  0.0765  0.1803  1   GLU H C   
4    O O   . GLU A 1   ? 1.0651 1.1271 1.3163 0.1327  0.0669  0.1737  1   GLU H O   
5    C CB  . GLU A 1   ? 1.1658 1.2149 1.4608 0.1566  0.0929  0.2053  1   GLU H CB  
6    C CG  . GLU A 1   ? 1.3274 1.3622 1.6532 0.1617  0.0982  0.2272  1   GLU H CG  
7    C CD  . GLU A 1   ? 1.4422 1.4800 1.7685 0.1813  0.1144  0.2320  1   GLU H CD  
8    O OE1 . GLU A 1   ? 1.4603 1.5073 1.7700 0.1934  0.1183  0.2220  1   GLU H OE1 
9    O OE2 . GLU A 1   ? 1.4692 1.4999 1.8113 0.1860  0.1240  0.2466  1   GLU H OE2 
10   N N   . VAL A 2   ? 0.7531 0.8299 1.0027 0.1342  0.0846  0.1716  2   VAL H N   
11   C CA  . VAL A 2   ? 0.7125 0.8086 0.9364 0.1295  0.0811  0.1543  2   VAL H CA  
12   C C   . VAL A 2   ? 0.7135 0.8078 0.9362 0.1122  0.0745  0.1499  2   VAL H C   
13   O O   . VAL A 2   ? 0.6816 0.7726 0.9068 0.1059  0.0808  0.1516  2   VAL H O   
14   C CB  . VAL A 2   ? 0.6991 0.8150 0.9049 0.1373  0.0918  0.1455  2   VAL H CB  
15   C CG1 . VAL A 2   ? 0.6367 0.7741 0.8204 0.1283  0.0873  0.1305  2   VAL H CG1 
16   C CG2 . VAL A 2   ? 0.6985 0.8215 0.9005 0.1558  0.0975  0.1469  2   VAL H CG2 
17   N N   . GLN A 3   ? 0.7416 0.8357 0.9580 0.1056  0.0628  0.1445  3   GLN H N   
18   C CA  . GLN A 3   ? 0.7944 0.8831 1.0135 0.0904  0.0561  0.1426  3   GLN H CA  
19   C C   . GLN A 3   ? 0.7477 0.8411 0.9516 0.0854  0.0450  0.1330  3   GLN H C   
20   O O   . GLN A 3   ? 0.8030 0.9000 0.9939 0.0940  0.0413  0.1297  3   GLN H O   
21   C CB  . GLN A 3   ? 0.8495 0.9166 1.0941 0.0855  0.0520  0.1579  3   GLN H CB  
22   C CG  . GLN A 3   ? 0.9496 1.0040 1.1984 0.0878  0.0407  0.1627  3   GLN H CG  
23   C CD  . GLN A 3   ? 1.0674 1.1041 1.3442 0.0846  0.0376  0.1805  3   GLN H CD  
24   O OE1 . GLN A 3   ? 1.0354 1.0713 1.3289 0.0842  0.0463  0.1908  3   GLN H OE1 
25   N NE2 . GLN A 3   ? 1.1656 1.1871 1.4466 0.0822  0.0252  0.1857  3   GLN H NE2 
26   N N   . LEU A 4   ? 0.6691 0.7602 0.8739 0.0727  0.0407  0.1300  4   LEU H N   
27   C CA  . LEU A 4   ? 0.5849 0.6795 0.7755 0.0679  0.0311  0.1215  4   LEU H CA  
28   C C   . LEU A 4   ? 0.6181 0.6924 0.8215 0.0583  0.0212  0.1276  4   LEU H C   
29   O O   . LEU A 4   ? 0.6520 0.7229 0.8670 0.0491  0.0243  0.1306  4   LEU H O   
30   C CB  . LEU A 4   ? 0.5187 0.6349 0.6952 0.0617  0.0362  0.1101  4   LEU H CB  
31   C CG  . LEU A 4   ? 0.4697 0.6102 0.6312 0.0700  0.0435  0.1037  4   LEU H CG  
32   C CD1 . LEU A 4   ? 0.4109 0.5709 0.5614 0.0602  0.0485  0.0944  4   LEU H CD1 
33   C CD2 . LEU A 4   ? 0.4452 0.5946 0.5915 0.0811  0.0384  0.1013  4   LEU H CD2 
34   N N   . LEU A 5   ? 0.6872 0.7466 0.8863 0.0606  0.0097  0.1298  5   LEU H N   
35   C CA  . LEU A 5   ? 0.7697 0.8094 0.9795 0.0509  -0.0017 0.1357  5   LEU H CA  
36   C C   . LEU A 5   ? 0.7509 0.7920 0.9426 0.0474  -0.0088 0.1258  5   LEU H C   
37   O O   . LEU A 5   ? 0.8145 0.8542 0.9843 0.0550  -0.0135 0.1201  5   LEU H O   
38   C CB  . LEU A 5   ? 0.8772 0.8942 1.0924 0.0531  -0.0119 0.1453  5   LEU H CB  
39   C CG  . LEU A 5   ? 1.1150 1.1314 1.3458 0.0598  -0.0045 0.1552  5   LEU H CG  
40   C CD1 . LEU A 5   ? 1.2385 1.2304 1.4803 0.0573  -0.0159 0.1673  5   LEU H CD1 
41   C CD2 . LEU A 5   ? 1.1333 1.1599 1.3853 0.0565  0.0071  0.1619  5   LEU H CD2 
42   N N   . GLU A 6   ? 0.6242 0.6671 0.8244 0.0374  -0.0082 0.1250  6   GLU H N   
43   C CA  . GLU A 6   ? 0.5542 0.6006 0.7399 0.0341  -0.0125 0.1158  6   GLU H CA  
44   C C   . GLU A 6   ? 0.5986 0.6223 0.7862 0.0294  -0.0266 0.1200  6   GLU H C   
45   O O   . GLU A 6   ? 0.5982 0.6092 0.8058 0.0229  -0.0308 0.1307  6   GLU H O   
46   C CB  . GLU A 6   ? 0.4929 0.5534 0.6844 0.0257  -0.0023 0.1116  6   GLU H CB  
47   C CG  . GLU A 6   ? 0.5125 0.5932 0.6993 0.0275  0.0108  0.1067  6   GLU H CG  
48   C CD  . GLU A 6   ? 0.5463 0.6393 0.7278 0.0187  0.0187  0.0988  6   GLU H CD  
49   O OE1 . GLU A 6   ? 0.5543 0.6525 0.7380 0.0150  0.0299  0.0989  6   GLU H OE1 
50   O OE2 . GLU A 6   ? 0.5601 0.6554 0.7335 0.0156  0.0139  0.0928  6   GLU H OE2 
51   N N   . SER A 7   ? 0.6654 0.6845 0.8316 0.0329  -0.0339 0.1128  7   SER H N   
52   C CA  . SER A 7   ? 0.6866 0.6843 0.8507 0.0281  -0.0469 0.1148  7   SER H CA  
53   C C   . SER A 7   ? 0.6970 0.7010 0.8439 0.0301  -0.0471 0.1052  7   SER H C   
54   O O   . SER A 7   ? 0.7292 0.7539 0.8641 0.0355  -0.0386 0.0977  7   SER H O   
55   C CB  . SER A 7   ? 0.6417 0.6121 0.7932 0.0322  -0.0604 0.1195  7   SER H CB  
56   O OG  . SER A 7   ? 0.7564 0.7308 0.8868 0.0445  -0.0562 0.1154  7   SER H OG  
57   N N   . GLY A 8   ? 0.6762 0.6629 0.8223 0.0258  -0.0572 0.1064  8   GLY H N   
58   C CA  . GLY A 8   ? 0.7052 0.6960 0.8376 0.0281  -0.0571 0.0986  8   GLY H CA  
59   C C   . GLY A 8   ? 0.6718 0.6744 0.8236 0.0183  -0.0493 0.0981  8   GLY H C   
60   O O   . GLY A 8   ? 0.7825 0.7866 0.9568 0.0103  -0.0453 0.1052  8   GLY H O   
61   N N   . GLY A 9   ? 0.6083 0.6186 0.7506 0.0198  -0.0461 0.0907  9   GLY H N   
62   C CA  . GLY A 9   ? 0.6297 0.6497 0.7866 0.0114  -0.0370 0.0894  9   GLY H CA  
63   C C   . GLY A 9   ? 0.6604 0.6625 0.8236 0.0080  -0.0455 0.0935  9   GLY H C   
64   O O   . GLY A 9   ? 0.6828 0.6635 0.8374 0.0113  -0.0604 0.0966  9   GLY H O   
65   N N   . GLY A 10  ? 0.6620 0.6717 0.8385 0.0013  -0.0358 0.0936  10  GLY H N   
66   C CA  . GLY A 10  ? 0.6306 0.6271 0.8143 -0.0013 -0.0421 0.0981  10  GLY H CA  
67   C C   . GLY A 10  ? 0.6023 0.6039 0.7776 0.0011  -0.0359 0.0898  10  GLY H C   
68   O O   . GLY A 10  ? 0.5422 0.5605 0.7118 0.0012  -0.0236 0.0821  10  GLY H O   
69   N N   . LEU A 11  ? 0.6272 0.6142 0.8018 0.0026  -0.0450 0.0920  11  LEU H N   
70   C CA  . LEU A 11  ? 0.5564 0.5459 0.7253 0.0058  -0.0390 0.0857  11  LEU H CA  
71   C C   . LEU A 11  ? 0.6123 0.5971 0.7565 0.0172  -0.0454 0.0777  11  LEU H C   
72   O O   . LEU A 11  ? 0.5937 0.5612 0.7227 0.0236  -0.0600 0.0792  11  LEU H O   
73   C CB  . LEU A 11  ? 0.4352 0.4112 0.6135 0.0039  -0.0465 0.0926  11  LEU H CB  
74   C CG  . LEU A 11  ? 0.5087 0.4848 0.6826 0.0083  -0.0406 0.0874  11  LEU H CG  
75   C CD1 . LEU A 11  ? 0.5008 0.4959 0.6818 0.0041  -0.0186 0.0830  11  LEU H CD1 
76   C CD2 . LEU A 11  ? 0.5617 0.5264 0.7470 0.0059  -0.0489 0.0964  11  LEU H CD2 
77   N N   . VAL A 12  ? 0.5641 0.5631 0.7027 0.0202  -0.0339 0.0702  12  VAL H N   
78   C CA  . VAL A 12  ? 0.5552 0.5517 0.6714 0.0328  -0.0383 0.0650  12  VAL H CA  
79   C C   . VAL A 12  ? 0.5499 0.5557 0.6665 0.0351  -0.0274 0.0597  12  VAL H C   
80   O O   . VAL A 12  ? 0.5551 0.5756 0.6857 0.0256  -0.0131 0.0577  12  VAL H O   
81   C CB  . VAL A 12  ? 0.5909 0.6035 0.6973 0.0359  -0.0354 0.0630  12  VAL H CB  
82   C CG1 . VAL A 12  ? 0.6523 0.6915 0.7727 0.0248  -0.0196 0.0599  12  VAL H CG1 
83   C CG2 . VAL A 12  ? 0.5756 0.5900 0.6600 0.0501  -0.0370 0.0603  12  VAL H CG2 
84   N N   . LYS A 13  ? 0.5554 0.5498 0.6547 0.0483  -0.0336 0.0580  13  LYS H N   
85   C CA  . LYS A 13  ? 0.5406 0.5428 0.6402 0.0522  -0.0233 0.0536  13  LYS H CA  
86   C C   . LYS A 13  ? 0.5392 0.5687 0.6365 0.0521  -0.0111 0.0496  13  LYS H C   
87   O O   . LYS A 13  ? 0.5588 0.5981 0.6467 0.0556  -0.0140 0.0507  13  LYS H O   
88   C CB  . LYS A 13  ? 0.4929 0.4714 0.5742 0.0679  -0.0340 0.0543  13  LYS H CB  
89   C CG  . LYS A 13  ? 0.6368 0.5941 0.7247 0.0652  -0.0423 0.0573  13  LYS H CG  
90   C CD  . LYS A 13  ? 0.8018 0.7294 0.8659 0.0802  -0.0574 0.0583  13  LYS H CD  
91   C CE  . LYS A 13  ? 0.8708 0.7836 0.9434 0.0777  -0.0629 0.0606  13  LYS H CE  
92   N NZ  . LYS A 13  ? 0.8997 0.8189 0.9966 0.0609  -0.0636 0.0663  13  LYS H NZ  
93   N N   . PRO A 14  ? 0.4109 0.6512 0.6127 -0.1089 0.0689  0.1137  14  PRO H N   
94   C CA  . PRO A 14  ? 0.4923 0.7516 0.6544 -0.1194 0.0908  0.0802  14  PRO H CA  
95   C C   . PRO A 14  ? 0.5150 0.8164 0.6395 -0.1120 0.0644  0.0503  14  PRO H C   
96   O O   . PRO A 14  ? 0.5004 0.8086 0.6144 -0.1081 0.0379  0.0556  14  PRO H O   
97   C CB  . PRO A 14  ? 0.4172 0.6662 0.5673 -0.1387 0.1124  0.0940  14  PRO H CB  
98   C CG  . PRO A 14  ? 0.4944 0.7062 0.6864 -0.1300 0.1185  0.1359  14  PRO H CG  
99   C CD  . PRO A 14  ? 0.4625 0.6873 0.6858 -0.1151 0.0809  0.1496  14  PRO H CD  
100  N N   . GLY A 15  ? 0.4591 0.7888 0.5601 -0.1074 0.0721  0.0208  15  GLY H N   
101  C CA  . GLY A 15  ? 0.4518 0.8271 0.5132 -0.0911 0.0526  -0.0059 15  GLY H CA  
102  C C   . GLY A 15  ? 0.4606 0.8108 0.5169 -0.0627 0.0238  -0.0113 15  GLY H C   
103  O O   . GLY A 15  ? 0.5140 0.8876 0.5311 -0.0385 0.0106  -0.0347 15  GLY H O   
104  N N   . GLY A 16  ? 0.4175 0.7187 0.5098 -0.0649 0.0148  0.0130  16  GLY H N   
105  C CA  . GLY A 16  ? 0.3743 0.6413 0.4579 -0.0473 -0.0146 0.0123  16  GLY H CA  
106  C C   . GLY A 16  ? 0.4375 0.7056 0.5189 -0.0336 -0.0040 -0.0047 16  GLY H C   
107  O O   . GLY A 16  ? 0.4464 0.7482 0.5311 -0.0383 0.0249  -0.0177 16  GLY H O   
108  N N   . SER A 17  ? 0.4555 0.6836 0.5270 -0.0206 -0.0290 -0.0031 17  SER H N   
109  C CA  . SER A 17  ? 0.5027 0.7280 0.5662 -0.0046 -0.0226 -0.0186 17  SER H CA  
110  C C   . SER A 17  ? 0.4497 0.6235 0.5346 -0.0093 -0.0408 0.0028  17  SER H C   
111  O O   . SER A 17  ? 0.5192 0.6610 0.6105 -0.0221 -0.0664 0.0258  17  SER H O   
112  C CB  . SER A 17  ? 0.6054 0.8453 0.6041 0.0286  -0.0342 -0.0504 17  SER H CB  
113  O OG  . SER A 17  ? 0.6904 0.8746 0.6412 0.0430  -0.0703 -0.0512 17  SER H OG  
114  N N   . LEU A 18  ? 0.5085 0.6796 0.6016 -0.0015 -0.0290 -0.0035 18  LEU H N   
115  C CA  . LEU A 18  ? 0.4801 0.6155 0.6044 -0.0108 -0.0376 0.0207  18  LEU H CA  
116  C C   . LEU A 18  ? 0.5660 0.6963 0.6685 0.0080  -0.0327 0.0008  18  LEU H C   
117  O O   . LEU A 18  ? 0.6031 0.7740 0.6958 0.0189  -0.0084 -0.0221 18  LEU H O   
118  C CB  . LEU A 18  ? 0.4614 0.6165 0.6502 -0.0292 -0.0060 0.0468  18  LEU H CB  
119  C CG  . LEU A 18  ? 0.5705 0.7077 0.8070 -0.0445 -0.0170 0.0891  18  LEU H CG  
120  C CD1 . LEU A 18  ? 0.6576 0.7646 0.8644 -0.0519 -0.0631 0.0977  18  LEU H CD1 
121  C CD2 . LEU A 18  ? 0.6121 0.7711 0.8940 -0.0542 0.0094  0.1149  18  LEU H CD2 
122  N N   . ARG A 19  ? 0.5553 0.6383 0.6468 0.0089  -0.0567 0.0112  19  ARG H N   
123  C CA  . ARG A 19  ? 0.5811 0.6547 0.6525 0.0269  -0.0524 -0.0038 19  ARG H CA  
124  C C   . ARG A 19  ? 0.6073 0.6676 0.7271 0.0093  -0.0459 0.0234  19  ARG H C   
125  O O   . ARG A 19  ? 0.6530 0.6794 0.7858 -0.0096 -0.0703 0.0520  19  ARG H O   
126  C CB  . ARG A 19  ? 0.6536 0.6724 0.6468 0.0516  -0.0862 -0.0208 19  ARG H CB  
127  C CG  . ARG A 19  ? 0.7846 0.7794 0.7503 0.0718  -0.0875 -0.0308 19  ARG H CG  
128  C CD  . ARG A 19  ? 1.0580 0.9617 0.9463 0.0833  -0.1281 -0.0325 19  ARG H CD  
129  N NE  . ARG A 19  ? 1.2533 1.1260 1.0886 0.1169  -0.1307 -0.0491 19  ARG H NE  
130  C CZ  . ARG A 19  ? 1.3746 1.2822 1.1708 0.1612  -0.1160 -0.0765 19  ARG H CZ  
131  N NH1 . ARG A 19  ? 1.4338 1.3110 1.1811 0.1945  -0.1194 -0.0867 19  ARG H NH1 
132  N NH2 . ARG A 19  ? 1.3487 1.3278 1.1553 0.1722  -0.0975 -0.0906 19  ARG H NH2 
133  N N   . LEU A 20  ? 0.5587 0.6498 0.7024 0.0130  -0.0134 0.0164  20  LEU H N   
134  C CA  . LEU A 20  ? 0.4931 0.5748 0.6770 0.0016  -0.0035 0.0401  20  LEU H CA  
135  C C   . LEU A 20  ? 0.5352 0.5880 0.6804 0.0169  -0.0185 0.0278  20  LEU H C   
136  O O   . LEU A 20  ? 0.6520 0.7119 0.7497 0.0416  -0.0192 -0.0025 20  LEU H O   
137  C CB  . LEU A 20  ? 0.5032 0.6220 0.7258 -0.0039 0.0424  0.0404  20  LEU H CB  
138  C CG  . LEU A 20  ? 0.5441 0.6833 0.7938 -0.0153 0.0647  0.0496  20  LEU H CG  
139  C CD1 . LEU A 20  ? 0.4266 0.5810 0.6894 -0.0202 0.1107  0.0441  20  LEU H CD1 
140  C CD2 . LEU A 20  ? 0.4676 0.5961 0.7595 -0.0278 0.0512  0.0905  20  LEU H CD2 
141  N N   . SER A 21  ? 0.4854 0.5100 0.6501 0.0031  -0.0304 0.0545  21  SER H N   
142  C CA  . SER A 21  ? 0.5975 0.5931 0.7295 0.0150  -0.0398 0.0466  21  SER H CA  
143  C C   . SER A 21  ? 0.6283 0.6326 0.8095 -0.0011 -0.0237 0.0741  21  SER H C   
144  O O   . SER A 21  ? 0.5878 0.6091 0.8245 -0.0223 -0.0163 0.1082  21  SER H O   
145  C CB  . SER A 21  ? 0.6927 0.6164 0.7575 0.0191  -0.0854 0.0450  21  SER H CB  
146  O OG  . SER A 21  ? 0.7724 0.6674 0.8572 -0.0151 -0.1115 0.0813  21  SER H OG  
147  N N   . CYS A 22  ? 0.6476 0.6458 0.8069 0.0127  -0.0169 0.0607  22  CYS H N   
148  C CA  . CYS A 22  ? 0.6298 0.6374 0.8270 0.0015  0.0006  0.0825  22  CYS H CA  
149  C C   . CYS A 22  ? 0.7366 0.6974 0.8874 0.0082  -0.0248 0.0806  22  CYS H C   
150  O O   . CYS A 22  ? 0.7603 0.7033 0.8535 0.0349  -0.0335 0.0512  22  CYS H O   
151  C CB  . CYS A 22  ? 0.5391 0.5929 0.7563 0.0098  0.0459  0.0655  22  CYS H CB  
152  S SG  . CYS A 22  ? 1.0581 1.1240 1.3198 -0.0010 0.0751  0.0919  22  CYS H SG  
153  N N   . ALA A 23  ? 0.7602 0.7031 0.9342 -0.0150 -0.0367 0.1152  23  ALA H N   
154  C CA  . ALA A 23  ? 0.7797 0.6715 0.9083 -0.0143 -0.0605 0.1182  23  ALA H CA  
155  C C   . ALA A 23  ? 0.7157 0.6410 0.8858 -0.0194 -0.0315 0.1334  23  ALA H C   
156  O O   . ALA A 23  ? 0.6801 0.6448 0.9146 -0.0388 -0.0124 0.1652  23  ALA H O   
157  C CB  . ALA A 23  ? 0.8191 0.6539 0.9258 -0.0450 -0.1050 0.1479  23  ALA H CB  
158  N N   . ALA A 24  ? 0.6864 0.5995 0.8181 0.0015  -0.0265 0.1123  24  ALA H N   
159  C CA  . ALA A 24  ? 0.7366 0.6757 0.8979 -0.0035 -0.0011 0.1252  24  ALA H CA  
160  C C   . ALA A 24  ? 0.8015 0.6925 0.9446 -0.0233 -0.0311 0.1548  24  ALA H C   
161  O O   . ALA A 24  ? 0.9250 0.7472 1.0011 -0.0191 -0.0685 0.1482  24  ALA H O   
162  C CB  . ALA A 24  ? 0.7942 0.7549 0.9262 0.0247  0.0208  0.0905  24  ALA H CB  
163  N N   . SER A 25  ? 0.8076 0.7314 1.0048 -0.0450 -0.0141 0.1892  25  SER H N   
164  C CA  . SER A 25  ? 0.8782 0.7688 1.0602 -0.0661 -0.0365 0.2181  25  SER H CA  
165  C C   . SER A 25  ? 0.8382 0.7726 1.0525 -0.0605 0.0015  0.2245  25  SER H C   
166  O O   . SER A 25  ? 0.7551 0.7468 1.0191 -0.0525 0.0443  0.2231  25  SER H O   
167  C CB  . SER A 25  ? 0.9228 0.8152 1.1379 -0.1082 -0.0622 0.2667  25  SER H CB  
168  O OG  . SER A 25  ? 0.9188 0.8923 1.2190 -0.1164 -0.0260 0.2982  25  SER H OG  
169  N N   . GLY A 26  ? 0.9071 0.8059 1.0844 -0.0642 -0.0135 0.2309  26  GLY H N   
170  C CA  . GLY A 26  ? 0.8717 0.8077 1.0736 -0.0616 0.0192  0.2393  26  GLY H CA  
171  C C   . GLY A 26  ? 0.8767 0.8191 1.0436 -0.0284 0.0411  0.1968  26  GLY H C   
172  O O   . GLY A 26  ? 0.8721 0.8441 1.0510 -0.0250 0.0704  0.1977  26  GLY H O   
173  N N   . PHE A 27  ? 0.8054 0.7266 0.9284 -0.0048 0.0274  0.1616  27  PHE H N   
174  C CA  . PHE A 27  ? 0.7225 0.6588 0.8069 0.0262  0.0408  0.1252  27  PHE H CA  
175  C C   . PHE A 27  ? 0.8006 0.7066 0.8304 0.0534  0.0148  0.0976  27  PHE H C   
176  O O   . PHE A 27  ? 0.8051 0.6723 0.8252 0.0465  -0.0111 0.1037  27  PHE H O   
177  C CB  . PHE A 27  ? 0.6667 0.6702 0.7886 0.0273  0.0879  0.1093  27  PHE H CB  
178  C CG  . PHE A 27  ? 0.7412 0.7687 0.8793 0.0302  0.0984  0.0911  27  PHE H CG  
179  C CD1 . PHE A 27  ? 0.7182 0.7663 0.8215 0.0512  0.0979  0.0565  27  PHE H CD1 
180  C CD2 . PHE A 27  ? 0.7661 0.8026 0.9550 0.0123  0.1095  0.1121  27  PHE H CD2 
181  C CE1 . PHE A 27  ? 0.7301 0.8016 0.8464 0.0504  0.1071  0.0415  27  PHE H CE1 
182  C CE2 . PHE A 27  ? 0.7431 0.7973 0.9434 0.0147  0.1191  0.0966  27  PHE H CE2 
183  C CZ  . PHE A 27  ? 0.7347 0.8038 0.8976 0.0316  0.1175  0.0605  27  PHE H CZ  
184  N N   . THR A 28  ? 0.8352 0.7636 0.8273 0.0849  0.0220  0.0695  28  THR H N   
185  C CA  . THR A 28  ? 0.8888 0.7913 0.8203 0.1208  -0.0014 0.0471  28  THR H CA  
186  C C   . THR A 28  ? 0.8672 0.8449 0.8121 0.1356  0.0216  0.0188  28  THR H C   
187  O O   . THR A 28  ? 0.8459 0.8881 0.7995 0.1395  0.0470  0.0063  28  THR H O   
188  C CB  . THR A 28  ? 0.9563 0.8245 0.8220 0.1534  -0.0168 0.0438  28  THR H CB  
189  O OG1 . THR A 28  ? 0.9853 0.8080 0.8528 0.1291  -0.0257 0.0717  28  THR H OG1 
190  C CG2 . THR A 28  ? 1.0049 0.8018 0.7923 0.1907  -0.0496 0.0334  28  THR H CG2 
191  N N   . LEU A 29  ? 0.8891 0.8582 0.8318 0.1392  0.0110  0.0105  29  LEU H N   
192  C CA  . LEU A 29  ? 0.8494 0.8888 0.8060 0.1464  0.0307  -0.0128 29  LEU H CA  
193  C C   . LEU A 29  ? 0.9162 1.0170 0.8402 0.1778  0.0401  -0.0329 29  LEU H C   
194  O O   . LEU A 29  ? 0.8841 1.0621 0.8306 0.1661  0.0661  -0.0458 29  LEU H O   
195  C CB  . LEU A 29  ? 0.8088 0.8194 0.7448 0.1580  0.0096  -0.0198 29  LEU H CB  
196  C CG  . LEU A 29  ? 0.7492 0.7663 0.7377 0.1248  0.0179  -0.0110 29  LEU H CG  
197  C CD1 . LEU A 29  ? 0.7933 0.8338 0.7629 0.1423  0.0134  -0.0312 29  LEU H CD1 
198  C CD2 . LEU A 29  ? 0.5859 0.6581 0.6299 0.0975  0.0563  -0.0076 29  LEU H CD2 
199  N N   . ILE A 30  ? 1.0281 0.9514 0.8145 0.1847  0.0775  0.1333  30  ILE H N   
200  C CA  . ILE A 30  ? 1.0542 0.9785 0.8264 0.2176  0.0670  0.1322  30  ILE H CA  
201  C C   . ILE A 30  ? 1.0319 0.9940 0.8195 0.2338  0.0567  0.1258  30  ILE H C   
202  O O   . ILE A 30  ? 1.0673 1.0618 0.8730 0.2554  0.0451  0.1168  30  ILE H O   
203  C CB  . ILE A 30  ? 1.1686 1.0281 0.8742 0.2337  0.0737  0.1419  30  ILE H CB  
204  C CG1 . ILE A 30  ? 1.1284 0.9910 0.8162 0.2728  0.0605  0.1371  30  ILE H CG1 
205  C CG2 . ILE A 30  ? 1.2377 1.0612 0.9013 0.2267  0.0846  0.1497  30  ILE H CG2 
206  C CD1 . ILE A 30  ? 1.0462 0.9241 0.7535 0.2801  0.0533  0.1309  30  ILE H CD1 
207  N N   . ASN A 31  ? 0.9088 0.8716 0.6918 0.2226  0.0610  0.1281  31  ASN H N   
208  C CA  . ASN A 31  ? 0.9081 0.9037 0.7014 0.2402  0.0515  0.1225  31  ASN H CA  
209  C C   . ASN A 31  ? 0.8830 0.9415 0.7380 0.2334  0.0406  0.1104  31  ASN H C   
210  O O   . ASN A 31  ? 0.9336 1.0252 0.8031 0.2509  0.0312  0.1028  31  ASN H O   
211  C CB  . ASN A 31  ? 1.0303 1.0016 0.7898 0.2335  0.0599  0.1296  31  ASN H CB  
212  C CG  . ASN A 31  ? 1.2649 1.1695 0.9534 0.2478  0.0696  0.1411  31  ASN H CG  
213  O OD1 . ASN A 31  ? 1.3713 1.2561 1.0348 0.2753  0.0645  0.1415  31  ASN H OD1 
214  N ND2 . ASN A 31  ? 1.3221 1.1902 0.9740 0.2295  0.0838  0.1492  31  ASN H ND2 
215  N N   . TYR A 32  ? 0.8102 0.8833 0.6988 0.2092  0.0419  0.1077  32  TYR H N   
216  C CA  . TYR A 32  ? 0.7179 0.8398 0.6563 0.2005  0.0326  0.0974  32  TYR H CA  
217  C C   . TYR A 32  ? 0.7062 0.8481 0.6773 0.1960  0.0288  0.0910  32  TYR H C   
218  O O   . TYR A 32  ? 0.6933 0.8136 0.6548 0.1923  0.0341  0.0951  32  TYR H O   
219  C CB  . TYR A 32  ? 0.7081 0.8337 0.6560 0.1759  0.0357  0.0973  32  TYR H CB  
220  C CG  . TYR A 32  ? 0.7500 0.8582 0.6659 0.1745  0.0417  0.1024  32  TYR H CG  
221  C CD1 . TYR A 32  ? 0.7594 0.8194 0.6306 0.1676  0.0559  0.1118  32  TYR H CD1 
222  C CD2 . TYR A 32  ? 0.7389 0.8777 0.6678 0.1788  0.0339  0.0971  32  TYR H CD2 
223  C CE1 . TYR A 32  ? 0.7999 0.8404 0.6374 0.1630  0.0639  0.1163  32  TYR H CE1 
224  C CE2 . TYR A 32  ? 0.7889 0.9130 0.6871 0.1763  0.0403  0.1016  32  TYR H CE2 
225  C CZ  . TYR A 32  ? 0.8605 0.9343 0.7117 0.1673  0.0561  0.1113  32  TYR H CZ  
226  O OH  . TYR A 32  ? 0.9809 1.0363 0.7970 0.1614  0.0651  0.1156  32  TYR H OH  
227  N N   . ARG A 33  ? 0.6671 0.8497 0.6757 0.1957  0.0199  0.0803  33  ARG H N   
228  C CA  . ARG A 33  ? 0.5751 0.7757 0.6138 0.1865  0.0179  0.0736  33  ARG H CA  
229  C C   . ARG A 33  ? 0.5925 0.7850 0.6423 0.1626  0.0201  0.0760  33  ARG H C   
230  O O   . ARG A 33  ? 0.5119 0.7113 0.5659 0.1558  0.0168  0.0746  33  ARG H O   
231  C CB  . ARG A 33  ? 0.5474 0.7909 0.6174 0.1940  0.0094  0.0596  33  ARG H CB  
232  C CG  . ARG A 33  ? 0.6354 0.8956 0.7322 0.1826  0.0097  0.0513  33  ARG H CG  
233  C CD  . ARG A 33  ? 0.6814 0.9826 0.7997 0.1952  0.0048  0.0346  33  ARG H CD  
234  N NE  . ARG A 33  ? 0.6901 1.0172 0.8369 0.1864  -0.0006 0.0253  33  ARG H NE  
235  C CZ  . ARG A 33  ? 0.6750 1.0412 0.8418 0.1982  -0.0056 0.0095  33  ARG H CZ  
236  N NH1 . ARG A 33  ? 0.7350 1.1212 0.8951 0.2217  -0.0066 0.0000  33  ARG H NH1 
237  N NH2 . ARG A 33  ? 0.5677 0.9534 0.7599 0.1884  -0.0104 0.0014  33  ARG H NH2 
238  N N   . MET A 34  ? 0.5529 0.7328 0.6059 0.1522  0.0249  0.0782  34  MET H N   
239  C CA  . MET A 34  ? 0.4971 0.6658 0.5538 0.1340  0.0274  0.0795  34  MET H CA  
240  C C   . MET A 34  ? 0.5531 0.7347 0.6342 0.1246  0.0234  0.0732  34  MET H C   
241  O O   . MET A 34  ? 0.5655 0.7557 0.6574 0.1264  0.0242  0.0705  34  MET H O   
242  C CB  . MET A 34  ? 0.5531 0.6920 0.5893 0.1290  0.0372  0.0870  34  MET H CB  
243  C CG  . MET A 34  ? 0.6810 0.7965 0.6865 0.1305  0.0441  0.0930  34  MET H CG  
244  S SD  . MET A 34  ? 0.6417 0.7644 0.6439 0.1181  0.0438  0.0884  34  MET H SD  
245  C CE  . MET A 34  ? 2.2482 2.3899 2.2508 0.1351  0.0355  0.0879  34  MET H CE  
246  N N   . ASN A 35  ? 0.4408 0.6225 0.5271 0.1147  0.0194  0.0696  35  ASN H N   
247  C CA  . ASN A 35  ? 0.4312 0.6152 0.5318 0.1066  0.0156  0.0643  35  ASN H CA  
248  C C   . ASN A 35  ? 0.4551 0.6207 0.5468 0.0981  0.0165  0.0640  35  ASN H C   
249  O O   . ASN A 35  ? 0.5305 0.6894 0.6096 0.0970  0.0189  0.0644  35  ASN H O   
250  C CB  . ASN A 35  ? 0.5213 0.7257 0.6371 0.1076  0.0055  0.0560  35  ASN H CB  
251  C CG  . ASN A 35  ? 0.5323 0.7611 0.6595 0.1185  0.0038  0.0527  35  ASN H CG  
252  O OD1 . ASN A 35  ? 0.4969 0.7412 0.6409 0.1173  0.0030  0.0455  35  ASN H OD1 
253  N ND2 . ASN A 35  ? 0.5876 0.8200 0.7035 0.1293  0.0040  0.0564  35  ASN H ND2 
254  N N   . TRP A 36  ? 0.4002 0.5574 0.4960 0.0922  0.0153  0.0615  36  TRP H N   
255  C CA  . TRP A 36  ? 0.4430 0.5830 0.5276 0.0886  0.0129  0.0582  36  TRP H CA  
256  C C   . TRP A 36  ? 0.4742 0.6125 0.5611 0.0868  0.0029  0.0511  36  TRP H C   
257  O O   . TRP A 36  ? 0.5326 0.6740 0.6299 0.0826  0.0036  0.0505  36  TRP H O   
258  C CB  . TRP A 36  ? 0.4581 0.5792 0.5364 0.0851  0.0213  0.0630  36  TRP H CB  
259  C CG  . TRP A 36  ? 0.4912 0.6094 0.5645 0.0871  0.0300  0.0684  36  TRP H CG  
260  C CD1 . TRP A 36  ? 0.5796 0.7007 0.6570 0.0888  0.0369  0.0750  36  TRP H CD1 
261  C CD2 . TRP A 36  ? 0.5109 0.6232 0.5733 0.0878  0.0326  0.0653  36  TRP H CD2 
262  N NE1 . TRP A 36  ? 0.5914 0.7037 0.6594 0.0903  0.0435  0.0782  36  TRP H NE1 
263  C CE2 . TRP A 36  ? 0.6026 0.7106 0.6628 0.0883  0.0422  0.0719  36  TRP H CE2 
264  C CE3 . TRP A 36  ? 0.4833 0.5958 0.5369 0.0887  0.0275  0.0550  36  TRP H CE3 
265  C CZ2 . TRP A 36  ? 0.6417 0.7441 0.6928 0.0868  0.0487  0.0689  36  TRP H CZ2 
266  C CZ3 . TRP A 36  ? 0.5062 0.6189 0.5522 0.0880  0.0337  0.0500  36  TRP H CZ3 
267  C CH2 . TRP A 36  ? 0.5598 0.6667 0.6053 0.0857  0.0452  0.0572  36  TRP H CH2 
268  N N   . VAL A 37  ? 0.4584 0.5929 0.5346 0.0901  -0.0063 0.0435  37  VAL H N   
269  C CA  . VAL A 37  ? 0.4453 0.5714 0.5169 0.0907  -0.0178 0.0359  37  VAL H CA  
270  C C   . VAL A 37  ? 0.5268 0.6282 0.5737 0.0954  -0.0222 0.0302  37  VAL H C   
271  O O   . VAL A 37  ? 0.6153 0.7229 0.6551 0.0999  -0.0211 0.0262  37  VAL H O   
272  C CB  . VAL A 37  ? 0.4244 0.5768 0.5061 0.0958  -0.0300 0.0282  37  VAL H CB  
273  C CG1 . VAL A 37  ? 0.4634 0.6050 0.5390 0.0977  -0.0431 0.0196  37  VAL H CG1 
274  C CG2 . VAL A 37  ? 0.4167 0.5940 0.5199 0.0954  -0.0259 0.0326  37  VAL H CG2 
275  N N   . ARG A 38  ? 0.4925 0.5648 0.5238 0.0948  -0.0264 0.0283  38  ARG H N   
276  C CA  . ARG A 38  ? 0.4817 0.5251 0.4826 0.1038  -0.0316 0.0222  38  ARG H CA  
277  C C   . ARG A 38  ? 0.5189 0.5488 0.5014 0.1123  -0.0489 0.0108  38  ARG H C   
278  O O   . ARG A 38  ? 0.5213 0.5524 0.5125 0.1075  -0.0544 0.0102  38  ARG H O   
279  C CB  . ARG A 38  ? 0.5443 0.5509 0.5287 0.0984  -0.0207 0.0308  38  ARG H CB  
280  C CG  . ARG A 38  ? 0.6366 0.6276 0.6247 0.0851  -0.0165 0.0357  38  ARG H CG  
281  C CD  . ARG A 38  ? 0.6426 0.5835 0.5986 0.0805  -0.0111 0.0392  38  ARG H CD  
282  N NE  . ARG A 38  ? 0.6707 0.6024 0.6234 0.0761  0.0033  0.0481  38  ARG H NE  
283  C CZ  . ARG A 38  ? 0.6847 0.5890 0.6261 0.0621  0.0154  0.0545  38  ARG H CZ  
284  N NH1 . ARG A 38  ? 0.6122 0.4952 0.5454 0.0489  0.0167  0.0527  38  ARG H NH1 
285  N NH2 . ARG A 38  ? 0.6947 0.5946 0.6335 0.0600  0.0271  0.0618  38  ARG H NH2 
286  N N   . GLN A 39  ? 0.4604 0.4773 0.4157 0.1268  -0.0581 -0.0001 39  GLN H N   
287  C CA  . GLN A 39  ? 0.5123 0.5130 0.4434 0.1392  -0.0768 -0.0128 39  GLN H CA  
288  C C   . GLN A 39  ? 0.6168 0.5788 0.5058 0.1546  -0.0803 -0.0192 39  GLN H C   
289  O O   . GLN A 39  ? 0.6832 0.6608 0.5681 0.1641  -0.0786 -0.0270 39  GLN H O   
290  C CB  . GLN A 39  ? 0.4578 0.5042 0.4030 0.1470  -0.0908 -0.0276 39  GLN H CB  
291  C CG  . GLN A 39  ? 0.5090 0.5450 0.4247 0.1658  -0.1132 -0.0461 39  GLN H CG  
292  C CD  . GLN A 39  ? 0.5762 0.6624 0.5113 0.1699  -0.1271 -0.0603 39  GLN H CD  
293  O OE1 . GLN A 39  ? 0.6767 0.8038 0.6283 0.1674  -0.1225 -0.0664 39  GLN H OE1 
294  N NE2 . GLN A 39  ? 0.4807 0.5636 0.4130 0.1748  -0.1435 -0.0660 39  GLN H NE2 
295  N N   . ALA A 40  ? 0.6477 0.5574 0.5035 0.1569  -0.0839 -0.0164 40  ALA H N   
296  C CA  . ALA A 40  ? 0.7067 0.5689 0.5141 0.1736  -0.0866 -0.0205 40  ALA H CA  
297  C C   . ALA A 40  ? 0.7695 0.6302 0.5466 0.1994  -0.1106 -0.0423 40  ALA H C   
298  O O   . ALA A 40  ? 0.8595 0.7286 0.6406 0.2006  -0.1251 -0.0493 40  ALA H O   
299  C CB  . ALA A 40  ? 0.7081 0.5076 0.4861 0.1631  -0.0779 -0.0074 40  ALA H CB  
300  N N   . PRO A 41  ? 0.8416 0.6936 0.5876 0.2220  -0.1158 -0.0551 41  PRO H N   
301  C CA  . PRO A 41  ? 0.8677 0.7260 0.5826 0.2512  -0.1399 -0.0814 41  PRO H CA  
302  C C   . PRO A 41  ? 0.8863 0.7037 0.5694 0.2588  -0.1580 -0.0846 41  PRO H C   
303  O O   . PRO A 41  ? 0.9271 0.6744 0.5649 0.2626  -0.1565 -0.0757 41  PRO H O   
304  C CB  . PRO A 41  ? 0.9451 0.7697 0.6157 0.2743  -0.1389 -0.0884 41  PRO H CB  
305  C CG  . PRO A 41  ? 0.9711 0.8020 0.6691 0.2553  -0.1135 -0.0696 41  PRO H CG  
306  C CD  . PRO A 41  ? 0.9585 0.7845 0.6888 0.2236  -0.1000 -0.0460 41  PRO H CD  
307  N N   . GLY A 42  ? 0.7799 0.6388 0.4853 0.2596  -0.1737 -0.0968 42  GLY H N   
308  C CA  . GLY A 42  ? 0.8427 0.6691 0.5184 0.2707  -0.1946 -0.1043 42  GLY H CA  
309  C C   . GLY A 42  ? 0.9558 0.7713 0.6577 0.2447  -0.1873 -0.0869 42  GLY H C   
310  O O   . GLY A 42  ? 0.9499 0.7352 0.6295 0.2504  -0.2026 -0.0917 42  GLY H O   
311  N N   . LYS A 43  ? 0.9612 0.8021 0.7096 0.2172  -0.1644 -0.0686 43  LYS H N   
312  C CA  . LYS A 43  ? 0.9528 0.7842 0.7248 0.1933  -0.1557 -0.0547 43  LYS H CA  
313  C C   . LYS A 43  ? 0.8576 0.7594 0.6928 0.1773  -0.1492 -0.0511 43  LYS H C   
314  O O   . LYS A 43  ? 0.7938 0.7488 0.6508 0.1845  -0.1541 -0.0601 43  LYS H O   
315  C CB  . LYS A 43  ? 1.0028 0.7802 0.7584 0.1747  -0.1330 -0.0359 43  LYS H CB  
316  C CG  . LYS A 43  ? 1.0425 0.7392 0.7276 0.1898  -0.1375 -0.0372 43  LYS H CG  
317  C CD  . LYS A 43  ? 1.1646 0.8150 0.8358 0.1690  -0.1119 -0.0184 43  LYS H CD  
318  C CE  . LYS A 43  ? 1.2670 0.8617 0.8784 0.1894  -0.1114 -0.0184 43  LYS H CE  
319  N NZ  . LYS A 43  ? 1.2389 0.8183 0.8538 0.1712  -0.0854 -0.0012 43  LYS H NZ  
320  N N   . GLY A 44  ? 0.8160 0.7171 0.6776 0.1558  -0.1376 -0.0394 44  GLY H N   
321  C CA  . GLY A 44  ? 0.8001 0.7623 0.7158 0.1445  -0.1339 -0.0372 44  GLY H CA  
322  C C   . GLY A 44  ? 0.7250 0.7171 0.6708 0.1323  -0.1133 -0.0250 44  GLY H C   
323  O O   . GLY A 44  ? 0.7686 0.7457 0.6981 0.1350  -0.1046 -0.0209 44  GLY H O   
324  N N   . LEU A 45  ? 0.6204 0.6544 0.6083 0.1212  -0.1065 -0.0203 45  LEU H N   
325  C CA  . LEU A 45  ? 0.5348 0.5968 0.5481 0.1128  -0.0892 -0.0098 45  LEU H CA  
326  C C   . LEU A 45  ? 0.5889 0.6416 0.6172 0.0954  -0.0718 0.0006  45  LEU H C   
327  O O   . LEU A 45  ? 0.6086 0.6619 0.6488 0.0878  -0.0729 -0.0024 45  LEU H O   
328  C CB  . LEU A 45  ? 0.5113 0.6281 0.5550 0.1166  -0.0938 -0.0133 45  LEU H CB  
329  C CG  . LEU A 45  ? 0.5362 0.6750 0.5703 0.1303  -0.1091 -0.0265 45  LEU H CG  
330  C CD1 . LEU A 45  ? 0.6156 0.8023 0.6779 0.1318  -0.1164 -0.0310 45  LEU H CD1 
331  C CD2 . LEU A 45  ? 0.5253 0.6691 0.5520 0.1307  -0.0990 -0.0250 45  LEU H CD2 
332  N N   . GLU A 46  ? 0.6171 0.6645 0.6458 0.0891  -0.0559 0.0106  46  GLU H N   
333  C CA  . GLU A 46  ? 0.5709 0.6118 0.6110 0.0727  -0.0393 0.0177  46  GLU H CA  
334  C C   . GLU A 46  ? 0.5483 0.6223 0.6126 0.0710  -0.0276 0.0250  46  GLU H C   
335  O O   . GLU A 46  ? 0.5437 0.6128 0.5988 0.0752  -0.0225 0.0307  46  GLU H O   
336  C CB  . GLU A 46  ? 0.6686 0.6566 0.6749 0.0656  -0.0311 0.0223  46  GLU H CB  
337  C CG  . GLU A 46  ? 0.9046 0.8900 0.9221 0.0462  -0.0125 0.0278  46  GLU H CG  
338  C CD  . GLU A 46  ? 1.1165 1.0505 1.0987 0.0383  -0.0019 0.0340  46  GLU H CD  
339  O OE1 . GLU A 46  ? 1.1151 1.0468 1.1037 0.0202  0.0140  0.0369  46  GLU H OE1 
340  O OE2 . GLU A 46  ? 1.2542 1.1521 1.2011 0.0511  -0.0094 0.0346  46  GLU H OE2 
341  N N   . TRP A 47  ? 0.5018 0.6094 0.5954 0.0666  -0.0238 0.0234  47  TRP H N   
342  C CA  . TRP A 47  ? 0.4437 0.5780 0.5546 0.0676  -0.0137 0.0293  47  TRP H CA  
343  C C   . TRP A 47  ? 0.4988 0.6124 0.6006 0.0575  0.0004  0.0357  47  TRP H C   
344  O O   . TRP A 47  ? 0.5385 0.6323 0.6341 0.0444  0.0064  0.0332  47  TRP H O   
345  C CB  . TRP A 47  ? 0.4253 0.5988 0.5652 0.0685  -0.0133 0.0233  47  TRP H CB  
346  C CG  . TRP A 47  ? 0.4460 0.6414 0.5971 0.0719  -0.0034 0.0277  47  TRP H CG  
347  C CD1 . TRP A 47  ? 0.4755 0.6837 0.6254 0.0839  -0.0036 0.0339  47  TRP H CD1 
348  C CD2 . TRP A 47  ? 0.4531 0.6581 0.6142 0.0635  0.0080  0.0248  47  TRP H CD2 
349  N NE1 . TRP A 47  ? 0.4136 0.6349 0.5695 0.0863  0.0054  0.0357  47  TRP H NE1 
350  C CE2 . TRP A 47  ? 0.4593 0.6831 0.6242 0.0745  0.0118  0.0291  47  TRP H CE2 
351  C CE3 . TRP A 47  ? 0.4754 0.6742 0.6401 0.0467  0.0159  0.0174  47  TRP H CE3 
352  C CZ2 . TRP A 47  ? 0.4432 0.6843 0.6169 0.0724  0.0207  0.0249  47  TRP H CZ2 
353  C CZ3 . TRP A 47  ? 0.4626 0.6820 0.6386 0.0412  0.0266  0.0126  47  TRP H CZ3 
354  C CH2 . TRP A 47  ? 0.4572 0.7001 0.6385 0.0555  0.0278  0.0156  47  TRP H CH2 
355  N N   . VAL A 48  ? 0.4321 0.5495 0.5318 0.0627  0.0062  0.0432  48  VAL H N   
356  C CA  . VAL A 48  ? 0.5114 0.6122 0.6027 0.0557  0.0180  0.0494  48  VAL H CA  
357  C C   . VAL A 48  ? 0.5495 0.6787 0.6595 0.0553  0.0265  0.0509  48  VAL H C   
358  O O   . VAL A 48  ? 0.6000 0.7301 0.7137 0.0448  0.0357  0.0494  48  VAL H O   
359  C CB  . VAL A 48  ? 0.4949 0.5762 0.5671 0.0635  0.0176  0.0550  48  VAL H CB  
360  C CG1 . VAL A 48  ? 0.4234 0.4930 0.4902 0.0589  0.0293  0.0617  48  VAL H CG1 
361  C CG2 . VAL A 48  ? 0.5582 0.6109 0.6071 0.0671  0.0084  0.0505  48  VAL H CG2 
362  N N   . SER A 49  ? 0.5228 0.6743 0.6413 0.0672  0.0234  0.0525  49  SER H N   
363  C CA  . SER A 49  ? 0.5333 0.7060 0.6616 0.0717  0.0295  0.0535  49  SER H CA  
364  C C   . SER A 49  ? 0.5452 0.7371 0.6767 0.0866  0.0249  0.0543  49  SER H C   
365  O O   . SER A 49  ? 0.5442 0.7307 0.6684 0.0916  0.0194  0.0568  49  SER H O   
366  C CB  . SER A 49  ? 0.5433 0.6991 0.6605 0.0704  0.0370  0.0615  49  SER H CB  
367  O OG  . SER A 49  ? 0.5854 0.7597 0.7086 0.0774  0.0409  0.0619  49  SER H OG  
368  N N   . SER A 50  ? 0.5218 0.7364 0.6614 0.0944  0.0273  0.0507  50  SER H N   
369  C CA  . SER A 50  ? 0.5527 0.7787 0.6875 0.1112  0.0237  0.0521  50  SER H CA  
370  C C   . SER A 50  ? 0.4896 0.7208 0.6172 0.1226  0.0276  0.0532  50  SER H C   
371  O O   . SER A 50  ? 0.5906 0.8347 0.7268 0.1190  0.0313  0.0470  50  SER H O   
372  C CB  . SER A 50  ? 0.6373 0.8921 0.7879 0.1175  0.0171  0.0415  50  SER H CB  
373  O OG  . SER A 50  ? 0.6749 0.9589 0.8407 0.1203  0.0192  0.0290  50  SER H OG  
374  N N   . ILE A 51  ? 0.3849 0.6049 0.4937 0.1365  0.0268  0.0601  51  ILE H N   
375  C CA  . ILE A 51  ? 0.4213 0.6373 0.5145 0.1509  0.0290  0.0622  51  ILE H CA  
376  C C   . ILE A 51  ? 0.5022 0.7157 0.5757 0.1712  0.0253  0.0635  51  ILE H C   
377  O O   . ILE A 51  ? 0.6110 0.8030 0.6680 0.1703  0.0265  0.0721  51  ILE H O   
378  C CB  . ILE A 51  ? 0.4092 0.5941 0.4872 0.1443  0.0352  0.0732  51  ILE H CB  
379  C CG1 . ILE A 51  ? 0.4350 0.6133 0.4950 0.1602  0.0360  0.0747  51  ILE H CG1 
380  C CG2 . ILE A 51  ? 0.4643 0.6232 0.5268 0.1388  0.0376  0.0821  51  ILE H CG2 
381  C CD1 . ILE A 51  ? 0.4090 0.5716 0.4660 0.1531  0.0412  0.0803  51  ILE H CD1 
382  N N   . SER A 52  ? 0.5251 0.7625 0.5990 0.1899  0.0212  0.0530  52  SER H N   
383  C CA  . SER A 52  ? 0.5250 0.7577 0.5742 0.2144  0.0173  0.0532  52  SER H CA  
384  C C   . SER A 52  ? 0.6093 0.7970 0.6182 0.2228  0.0216  0.0668  52  SER H C   
385  O O   . SER A 52  ? 0.5703 0.7417 0.5757 0.2145  0.0258  0.0717  52  SER H O   
386  C CB  . SER A 52  ? 0.5041 0.7760 0.5617 0.2357  0.0111  0.0348  52  SER H CB  
387  O OG  . SER A 52  ? 0.5541 0.8248 0.6014 0.2438  0.0114  0.0312  52  SER H OG  
388  N N   . SER A 53  A 0.6895 0.8556 0.6663 0.2392  0.0209  0.0724  52  SER H N   
389  C CA  . SER A 53  A 0.7527 0.8671 0.6841 0.2449  0.0269  0.0858  52  SER H CA  
390  C C   . SER A 53  A 0.7253 0.8245 0.6402 0.2551  0.0267  0.0856  52  SER H C   
391  O O   . SER A 53  A 0.7993 0.8606 0.6945 0.2453  0.0339  0.0964  52  SER H O   
392  C CB  . SER A 53  A 0.8723 0.9672 0.7653 0.2678  0.0253  0.0887  52  SER H CB  
393  O OG  . SER A 53  A 1.0100 1.0528 0.8519 0.2801  0.0298  0.0984  52  SER H OG  
394  N N   . SER A 54  ? 0.7021 0.8343 0.6257 0.2752  0.0182  0.0711  53  SER H N   
395  C CA  . SER A 54  ? 0.7562 0.8802 0.6623 0.2902  0.0149  0.0675  53  SER H CA  
396  C C   . SER A 54  ? 0.6927 0.8448 0.6366 0.2706  0.0164  0.0621  53  SER H C   
397  O O   . SER A 54  ? 0.6998 0.8545 0.6364 0.2808  0.0129  0.0571  53  SER H O   
398  C CB  . SER A 54  ? 0.8790 1.0311 0.7732 0.3250  0.0037  0.0498  53  SER H CB  
399  O OG  . SER A 54  ? 0.9284 1.1417 0.8691 0.3189  0.0003  0.0319  53  SER H OG  
400  N N   . SER A 55  ? 0.6084 0.7808 0.5896 0.2441  0.0208  0.0625  54  SER H N   
401  C CA  . SER A 55  ? 0.5611 0.7605 0.5768 0.2248  0.0230  0.0565  54  SER H CA  
402  C C   . SER A 55  ? 0.6148 0.8650 0.6502 0.2352  0.0170  0.0351  54  SER H C   
403  O O   . SER A 55  ? 0.6403 0.9124 0.6959 0.2233  0.0189  0.0282  54  SER H O   
404  C CB  . SER A 55  ? 0.5670 0.7399 0.5718 0.2190  0.0271  0.0660  54  SER H CB  
405  O OG  . SER A 55  ? 0.7734 0.9040 0.7618 0.2076  0.0343  0.0818  54  SER H OG  
406  N N   . SER A 56  ? 0.6510 0.9226 0.6802 0.2573  0.0102  0.0228  55  SER H N   
407  C CA  . SER A 56  ? 0.6246 0.9515 0.6724 0.2691  0.0046  -0.0029 55  SER H CA  
408  C C   . SER A 56  ? 0.5167 0.8855 0.6071 0.2466  0.0086  -0.0162 55  SER H C   
409  O O   . SER A 56  ? 0.4229 0.8406 0.5354 0.2456  0.0079  -0.0392 55  SER H O   
410  C CB  . SER A 56  ? 0.6969 1.0314 0.7167 0.3076  -0.0052 -0.0144 55  SER H CB  
411  O OG  . SER A 56  ? 0.7420 1.0347 0.7172 0.3293  -0.0091 -0.0046 55  SER H OG  
412  N N   . TYR A 57  ? 0.4686 0.8180 0.5684 0.2281  0.0129  -0.0033 56  TYR H N   
413  C CA  . TYR A 57  ? 0.3957 0.7733 0.5303 0.2059  0.0164  -0.0132 56  TYR H CA  
414  C C   . TYR A 57  ? 0.4098 0.7518 0.5484 0.1788  0.0226  0.0053  56  TYR H C   
415  O O   . TYR A 57  ? 0.5542 0.8656 0.6792 0.1797  0.0215  0.0203  56  TYR H O   
416  C CB  . TYR A 57  ? 0.4545 0.8556 0.5964 0.2203  0.0109  -0.0237 56  TYR H CB  
417  C CG  . TYR A 57  ? 0.6037 1.0459 0.7419 0.2506  0.0041  -0.0466 56  TYR H CG  
418  C CD1 . TYR A 57  ? 0.6894 1.1126 0.7905 0.2845  -0.0031 -0.0420 56  TYR H CD1 
419  C CD2 . TYR A 57  ? 0.6174 1.1167 0.7859 0.2458  0.0053  -0.0750 56  TYR H CD2 
420  C CE1 . TYR A 57  ? 0.6957 1.1562 0.7885 0.3173  -0.0111 -0.0654 56  TYR H CE1 
421  C CE2 . TYR A 57  ? 0.6441 1.1884 0.8100 0.2760  -0.0018 -0.1010 56  TYR H CE2 
422  C CZ  . TYR A 57  ? 0.6652 1.1901 0.7926 0.3138  -0.0110 -0.0962 56  TYR H CZ  
423  O OH  . TYR A 57  ? 0.6625 1.2325 0.7836 0.3478  -0.0196 -0.1245 56  TYR H OH  
424  N N   . ILE A 58  ? 0.4282 0.7756 0.5834 0.1553  0.0293  0.0023  57  ILE H N   
425  C CA  . ILE A 58  ? 0.4325 0.7448 0.5867 0.1327  0.0348  0.0179  57  ILE H CA  
426  C C   . ILE A 58  ? 0.4235 0.7494 0.5992 0.1093  0.0396  0.0080  57  ILE H C   
427  O O   . ILE A 58  ? 0.3552 0.7143 0.5462 0.1022  0.0437  -0.0093 57  ILE H O   
428  C CB  . ILE A 58  ? 0.3974 0.6924 0.5410 0.1293  0.0391  0.0264  57  ILE H CB  
429  C CG1 . ILE A 58  ? 0.4244 0.6998 0.5428 0.1518  0.0347  0.0359  57  ILE H CG1 
430  C CG2 . ILE A 58  ? 0.3544 0.6178 0.4966 0.1088  0.0448  0.0389  57  ILE H CG2 
431  C CD1 . ILE A 58  ? 0.4721 0.7193 0.5776 0.1485  0.0385  0.0486  57  ILE H CD1 
432  N N   . HIS A 59  ? 0.3593 0.6599 0.5340 0.0974  0.0392  0.0166  58  HIS H N   
433  C CA  . HIS A 59  ? 0.3817 0.6837 0.5693 0.0751  0.0438  0.0085  58  HIS H CA  
434  C C   . HIS A 59  ? 0.4231 0.6813 0.5965 0.0607  0.0458  0.0221  58  HIS H C   
435  O O   . HIS A 59  ? 0.5065 0.7398 0.6656 0.0687  0.0414  0.0353  58  HIS H O   
436  C CB  . HIS A 59  ? 0.4464 0.7728 0.6501 0.0787  0.0384  -0.0039 58  HIS H CB  
437  C CG  . HIS A 59  ? 0.6164 0.9918 0.8356 0.0926  0.0372  -0.0231 58  HIS H CG  
438  N ND1 . HIS A 59  ? 0.6585 1.0483 0.8718 0.1204  0.0291  -0.0232 58  HIS H ND1 
439  C CD2 . HIS A 59  ? 0.6295 1.0437 0.8668 0.0838  0.0435  -0.0450 58  HIS H CD2 
440  C CE1 . HIS A 59  ? 0.6951 1.1306 0.9216 0.1316  0.0287  -0.0446 58  HIS H CE1 
441  N NE2 . HIS A 59  ? 0.7226 1.1778 0.9664 0.1090  0.0374  -0.0597 58  HIS H NE2 
442  N N   . TYR A 60  ? 0.4218 0.6701 0.5964 0.0394  0.0531  0.0171  59  TYR H N   
443  C CA  . TYR A 60  ? 0.4455 0.6483 0.6003 0.0285  0.0547  0.0284  59  TYR H CA  
444  C C   . TYR A 60  ? 0.4654 0.6545 0.6194 0.0124  0.0558  0.0208  59  TYR H C   
445  O O   . TYR A 60  ? 0.3686 0.5832 0.5389 0.0010  0.0610  0.0057  59  TYR H O   
446  C CB  . TYR A 60  ? 0.3598 0.5481 0.5041 0.0186  0.0647  0.0336  59  TYR H CB  
447  C CG  . TYR A 60  ? 0.3808 0.5768 0.5235 0.0338  0.0634  0.0414  59  TYR H CG  
448  C CD1 . TYR A 60  ? 0.4272 0.6577 0.5820 0.0379  0.0663  0.0334  59  TYR H CD1 
449  C CD2 . TYR A 60  ? 0.3687 0.5383 0.4966 0.0444  0.0592  0.0546  59  TYR H CD2 
450  C CE1 . TYR A 60  ? 0.4851 0.7177 0.6347 0.0530  0.0642  0.0406  59  TYR H CE1 
451  C CE2 . TYR A 60  ? 0.4809 0.6540 0.6060 0.0566  0.0593  0.0612  59  TYR H CE2 
452  C CZ  . TYR A 60  ? 0.4955 0.6970 0.6302 0.0611  0.0614  0.0553  59  TYR H CZ  
453  O OH  . TYR A 60  ? 0.4483 0.6484 0.5768 0.0743  0.0603  0.0617  59  TYR H OH  
454  N N   . ALA A 61  ? 0.4896 0.6385 0.6230 0.0119  0.0506  0.0291  60  ALA H N   
455  C CA  . ALA A 61  ? 0.5017 0.6246 0.6248 -0.0036 0.0518  0.0234  60  ALA H CA  
456  C C   . ALA A 61  ? 0.5422 0.6410 0.6503 -0.0261 0.0672  0.0226  60  ALA H C   
457  O O   . ALA A 61  ? 0.6294 0.7224 0.7295 -0.0258 0.0735  0.0303  60  ALA H O   
458  C CB  . ALA A 61  ? 0.5328 0.6186 0.6327 0.0060  0.0404  0.0309  60  ALA H CB  
459  N N   . ASP A 62  ? 0.5085 0.5933 0.6121 -0.0466 0.0740  0.0126  61  ASP H N   
460  C CA  . ASP A 62  ? 0.5994 0.6598 0.6859 -0.0725 0.0913  0.0103  61  ASP H CA  
461  C C   . ASP A 62  ? 0.7223 0.7281 0.7701 -0.0702 0.0935  0.0268  61  ASP H C   
462  O O   . ASP A 62  ? 0.7589 0.7620 0.7998 -0.0801 0.1055  0.0301  61  ASP H O   
463  C CB  . ASP A 62  ? 0.6979 0.7385 0.7772 -0.0963 0.0985  -0.0022 61  ASP H CB  
464  C CG  . ASP A 62  ? 0.8902 0.9921 1.0094 -0.1077 0.1048  -0.0245 61  ASP H CG  
465  O OD1 . ASP A 62  ? 0.9698 1.0706 1.0949 -0.1185 0.1048  -0.0371 61  ASP H OD1 
466  O OD2 . ASP A 62  ? 0.9318 1.0844 1.0757 -0.1044 0.1091  -0.0314 61  ASP H OD2 
467  N N   . SER A 63  ? 0.7190 0.6854 0.7419 -0.0550 0.0810  0.0351  62  SER H N   
468  C CA  . SER A 63  ? 0.7318 0.6420 0.7122 -0.0491 0.0812  0.0473  62  SER H CA  
469  C C   . SER A 63  ? 0.6625 0.5881 0.6479 -0.0360 0.0825  0.0567  62  SER H C   
470  O O   . SER A 63  ? 0.7456 0.6333 0.7002 -0.0312 0.0853  0.0654  62  SER H O   
471  C CB  . SER A 63  ? 0.7571 0.6363 0.7150 -0.0296 0.0636  0.0492  62  SER H CB  
472  O OG  . SER A 63  ? 0.7885 0.7116 0.7753 -0.0094 0.0499  0.0481  62  SER H OG  
473  N N   . VAL A 64  ? 0.5114 0.6994 0.7015 0.0357  0.0302  0.1102  63  VAL H N   
474  C CA  . VAL A 64  ? 0.5756 0.7688 0.7570 0.0468  0.0310  0.1027  63  VAL H CA  
475  C C   . VAL A 64  ? 0.5677 0.7936 0.7560 0.0494  0.0385  0.0911  63  VAL H C   
476  O O   . VAL A 64  ? 0.6636 0.8986 0.8442 0.0586  0.0383  0.0843  63  VAL H O   
477  C CB  . VAL A 64  ? 0.5857 0.7613 0.7707 0.0595  0.0219  0.0969  63  VAL H CB  
478  C CG1 . VAL A 64  ? 0.5609 0.7469 0.7493 0.0710  0.0222  0.0830  63  VAL H CG1 
479  C CG2 . VAL A 64  ? 0.6222 0.7772 0.7912 0.0612  0.0160  0.1028  63  VAL H CG2 
480  N N   . LYS A 65  ? 0.6162 0.8619 0.8190 0.0417  0.0438  0.0872  64  LYS H N   
481  C CA  . LYS A 65  ? 0.6910 0.9707 0.9023 0.0476  0.0478  0.0703  64  LYS H CA  
482  C C   . LYS A 65  ? 0.5771 0.8852 0.7772 0.0451  0.0545  0.0697  64  LYS H C   
483  O O   . LYS A 65  ? 0.5472 0.8598 0.7390 0.0306  0.0623  0.0829  64  LYS H O   
484  C CB  . LYS A 65  ? 0.6888 0.9870 0.9204 0.0398  0.0522  0.0632  64  LYS H CB  
485  C CG  . LYS A 65  ? 0.6153 0.8934 0.8607 0.0502  0.0443  0.0571  64  LYS H CG  
486  C CD  . LYS A 65  ? 0.7403 1.0393 1.0081 0.0430  0.0490  0.0487  64  LYS H CD  
487  C CE  . LYS A 65  ? 0.7877 1.0721 1.0710 0.0589  0.0410  0.0376  64  LYS H CE  
488  N NZ  . LYS A 65  ? 0.8382 1.1414 1.1462 0.0512  0.0451  0.0306  64  LYS H NZ  
489  N N   . GLY A 66  ? 0.3989 0.7245 0.5968 0.0607  0.0499  0.0538  65  GLY H N   
490  C CA  . GLY A 66  ? 0.3518 0.7102 0.5412 0.0639  0.0530  0.0495  65  GLY H CA  
491  C C   . GLY A 66  ? 0.4707 0.8088 0.6449 0.0749  0.0467  0.0552  65  GLY H C   
492  O O   . GLY A 66  ? 0.4745 0.8333 0.6429 0.0879  0.0422  0.0458  65  GLY H O   
493  N N   . ARG A 67  ? 0.3740 0.6735 0.5426 0.0714  0.0448  0.0684  66  ARG H N   
494  C CA  . ARG A 67  ? 0.3952 0.6780 0.5501 0.0797  0.0409  0.0733  66  ARG H CA  
495  C C   . ARG A 67  ? 0.4265 0.6842 0.5810 0.0921  0.0298  0.0660  66  ARG H C   
496  O O   . ARG A 67  ? 0.4087 0.6596 0.5554 0.1019  0.0250  0.0641  66  ARG H O   
497  C CB  . ARG A 67  ? 0.4303 0.6900 0.5736 0.0685  0.0454  0.0901  66  ARG H CB  
498  C CG  . ARG A 67  ? 0.4362 0.7134 0.5746 0.0528  0.0567  0.1001  66  ARG H CG  
499  C CD  . ARG A 67  ? 0.5096 0.7554 0.6291 0.0427  0.0582  0.1162  66  ARG H CD  
500  N NE  . ARG A 67  ? 0.5970 0.8126 0.7209 0.0375  0.0510  0.1202  66  ARG H NE  
501  C CZ  . ARG A 67  ? 0.5390 0.7234 0.6520 0.0439  0.0420  0.1222  66  ARG H CZ  
502  N NH1 . ARG A 67  ? 0.5966 0.7740 0.6945 0.0552  0.0402  0.1197  66  ARG H NH1 
503  N NH2 . ARG A 67  ? 0.4581 0.6214 0.5763 0.0406  0.0341  0.1248  66  ARG H NH2 
504  N N   . PHE A 68  ? 0.4056 0.6489 0.5685 0.0916  0.0261  0.0618  67  PHE H N   
505  C CA  . PHE A 68  ? 0.4864 0.7021 0.6467 0.0996  0.0172  0.0574  67  PHE H CA  
506  C C   . PHE A 68  ? 0.5412 0.7607 0.7020 0.1104  0.0103  0.0418  67  PHE H C   
507  O O   . PHE A 68  ? 0.5155 0.7494 0.6839 0.1101  0.0124  0.0349  67  PHE H O   
508  C CB  . PHE A 68  ? 0.4239 0.6144 0.5887 0.0923  0.0167  0.0658  67  PHE H CB  
509  C CG  . PHE A 68  ? 0.4212 0.5993 0.5795 0.0853  0.0181  0.0776  67  PHE H CG  
510  C CD1 . PHE A 68  ? 0.5011 0.6892 0.6502 0.0829  0.0229  0.0828  67  PHE H CD1 
511  C CD2 . PHE A 68  ? 0.3844 0.5412 0.5434 0.0828  0.0136  0.0820  67  PHE H CD2 
512  C CE1 . PHE A 68  ? 0.5243 0.6962 0.6619 0.0791  0.0222  0.0910  67  PHE H CE1 
513  C CE2 . PHE A 68  ? 0.4470 0.5930 0.5968 0.0790  0.0119  0.0891  67  PHE H CE2 
514  C CZ  . PHE A 68  ? 0.5123 0.6633 0.6498 0.0775  0.0158  0.0931  67  PHE H CZ  
515  N N   . THR A 69  ? 0.5244 0.7287 0.6755 0.1204  0.0009  0.0349  68  THR H N   
516  C CA  . THR A 69  ? 0.5076 0.7041 0.6513 0.1320  -0.0090 0.0199  68  THR H CA  
517  C C   . THR A 69  ? 0.5230 0.6802 0.6585 0.1322  -0.0148 0.0215  68  THR H C   
518  O O   . THR A 69  ? 0.4932 0.6358 0.6227 0.1314  -0.0184 0.0247  68  THR H O   
519  C CB  . THR A 69  ? 0.4969 0.7089 0.6304 0.1455  -0.0191 0.0075  68  THR H CB  
520  O OG1 . THR A 69  ? 0.5661 0.8209 0.7058 0.1469  -0.0145 0.0025  68  THR H OG1 
521  C CG2 . THR A 69  ? 0.4534 0.6449 0.5717 0.1583  -0.0332 -0.0084 68  THR H CG2 
522  N N   . ILE A 70  ? 0.4369 0.5784 0.5722 0.1335  -0.0154 0.0182  69  ILE H N   
523  C CA  . ILE A 70  ? 0.4988 0.6035 0.6236 0.1333  -0.0201 0.0200  69  ILE H CA  
524  C C   . ILE A 70  ? 0.5447 0.6313 0.6479 0.1464  -0.0330 0.0048  69  ILE H C   
525  O O   . ILE A 70  ? 0.5669 0.6693 0.6658 0.1580  -0.0381 -0.0096 69  ILE H O   
526  C CB  . ILE A 70  ? 0.5421 0.6366 0.6752 0.1309  -0.0154 0.0244  69  ILE H CB  
527  C CG1 . ILE A 70  ? 0.5393 0.5995 0.6616 0.1282  -0.0181 0.0292  69  ILE H CG1 
528  C CG2 . ILE A 70  ? 0.5308 0.6332 0.6639 0.1428  -0.0176 0.0099  69  ILE H CG2 
529  C CD1 . ILE A 70  ? 0.4841 0.5385 0.6169 0.1272  -0.0140 0.0355  69  ILE H CD1 
530  N N   . SER A 71  ? 0.4608 0.5142 0.5485 0.1443  -0.0393 0.0068  70  SER H N   
531  C CA  . SER A 71  ? 0.5257 0.5513 0.5864 0.1560  -0.0541 -0.0066 70  SER H CA  
532  C C   . SER A 71  ? 0.5832 0.5656 0.6283 0.1474  -0.0560 0.0005  70  SER H C   
533  O O   . SER A 71  ? 0.6558 0.6377 0.7132 0.1329  -0.0465 0.0139  70  SER H O   
534  C CB  . SER A 71  ? 0.5499 0.5890 0.6035 0.1648  -0.0659 -0.0157 70  SER H CB  
535  O OG  . SER A 71  ? 0.7151 0.7514 0.7752 0.1551  -0.0642 -0.0057 70  SER H OG  
536  N N   . ARG A 72  ? 0.6567 0.6030 0.6716 0.1564  -0.0694 -0.0098 71  ARG H N   
537  C CA  . ARG A 72  ? 0.7472 0.6480 0.7417 0.1486  -0.0699 -0.0037 71  ARG H CA  
538  C C   . ARG A 72  ? 0.8194 0.6804 0.7791 0.1535  -0.0879 -0.0124 71  ARG H C   
539  O O   . ARG A 72  ? 0.8780 0.7407 0.8223 0.1710  -0.1031 -0.0287 71  ARG H O   
540  C CB  . ARG A 72  ? 0.7567 0.6452 0.7437 0.1588  -0.0674 -0.0086 71  ARG H CB  
541  C CG  . ARG A 72  ? 0.8206 0.6606 0.7812 0.1546  -0.0685 -0.0037 71  ARG H CG  
542  C CD  . ARG A 72  ? 0.8226 0.6451 0.7666 0.1736  -0.0721 -0.0160 71  ARG H CD  
543  N NE  . ARG A 72  ? 0.8624 0.7041 0.8323 0.1726  -0.0582 -0.0077 71  ARG H NE  
544  C CZ  . ARG A 72  ? 0.8474 0.6653 0.8107 0.1671  -0.0520 0.0031  71  ARG H CZ  
545  N NH1 . ARG A 72  ? 0.8690 0.7089 0.8580 0.1700  -0.0423 0.0089  71  ARG H NH1 
546  N NH2 . ARG A 72  ? 0.8339 0.6069 0.7645 0.1587  -0.0561 0.0082  71  ARG H NH2 
547  N N   . ASP A 73  ? 0.8468 0.6729 0.7929 0.1379  -0.0879 -0.0028 72  ASP H N   
548  C CA  . ASP A 73  ? 0.9388 0.7178 0.8469 0.1407  -0.1069 -0.0102 72  ASP H CA  
549  C C   . ASP A 73  ? 0.9743 0.6988 0.8520 0.1285  -0.1054 -0.0023 72  ASP H C   
550  O O   . ASP A 73  ? 1.0381 0.7481 0.9166 0.1068  -0.0998 0.0094  72  ASP H O   
551  C CB  . ASP A 73  ? 0.9748 0.7638 0.8936 0.1330  -0.1131 -0.0085 72  ASP H CB  
552  C CG  . ASP A 73  ? 1.1003 0.8439 0.9809 0.1400  -0.1378 -0.0187 72  ASP H CG  
553  O OD1 . ASP A 73  ? 1.1787 0.8676 1.0215 0.1365  -0.1448 -0.0185 72  ASP H OD1 
554  O OD2 . ASP A 73  ? 1.1051 0.8660 0.9916 0.1499  -0.1515 -0.0269 72  ASP H OD2 
555  N N   . ASN A 74  ? 0.9067 0.6022 0.7568 0.1427  -0.1100 -0.0099 73  ASN H N   
556  C CA  . ASN A 74  ? 0.9473 0.5910 0.7658 0.1336  -0.1069 -0.0019 73  ASN H CA  
557  C C   . ASN A 74  ? 1.0342 0.6249 0.8178 0.1172  -0.1177 0.0031  73  ASN H C   
558  O O   . ASN A 74  ? 1.0616 0.6315 0.8395 0.0945  -0.1064 0.0181  73  ASN H O   
559  C CB  . ASN A 74  ? 0.9880 0.6035 0.7755 0.1581  -0.1149 -0.0160 73  ASN H CB  
560  C CG  . ASN A 74  ? 1.0168 0.6799 0.8398 0.1706  -0.1018 -0.0192 73  ASN H CG  
561  O OD1 . ASN A 74  ? 0.9020 0.6036 0.7646 0.1571  -0.0839 -0.0047 73  ASN H OD1 
562  N ND2 . ASN A 74  ? 1.0383 0.6990 0.8463 0.1971  -0.1122 -0.0400 73  ASN H ND2 
563  N N   . ALA A 75  ? 1.0643 0.6347 0.8242 0.1283  -0.1404 -0.0100 74  ALA H N   
564  C CA  . ALA A 75  ? 1.1951 0.7153 0.9239 0.1125  -0.1536 -0.0059 74  ALA H CA  
565  C C   . ALA A 75  ? 1.2286 0.7724 0.9917 0.0816  -0.1363 0.0110  74  ALA H C   
566  O O   . ALA A 75  ? 1.2959 0.8009 1.0391 0.0576  -0.1319 0.0224  74  ALA H O   
567  C CB  . ALA A 75  ? 1.1735 0.6855 0.8847 0.1316  -0.1821 -0.0234 74  ALA H CB  
568  N N   . GLU A 76  ? 1.1360 0.7432 0.9485 0.0823  -0.1265 0.0114  75  GLU H N   
569  C CA  . GLU A 76  ? 1.1131 0.7494 0.9600 0.0579  -0.1114 0.0223  75  GLU H CA  
570  C C   . GLU A 76  ? 1.0647 0.7316 0.9377 0.0443  -0.0866 0.0345  75  GLU H C   
571  O O   . GLU A 76  ? 1.0255 0.7228 0.9275 0.0262  -0.0737 0.0408  75  GLU H O   
572  C CB  . GLU A 76  ? 1.1364 0.8220 1.0189 0.0681  -0.1151 0.0150  75  GLU H CB  
573  C CG  . GLU A 76  ? 1.2846 0.9553 1.1652 0.0596  -0.1282 0.0118  75  GLU H CG  
574  C CD  . GLU A 76  ? 1.4870 1.0889 1.3173 0.0587  -0.1503 0.0081  75  GLU H CD  
575  O OE1 . GLU A 76  ? 1.5441 1.1177 1.3664 0.0383  -0.1546 0.0119  75  GLU H OE1 
576  O OE2 . GLU A 76  ? 1.5677 1.1423 1.3645 0.0783  -0.1644 0.0001  75  GLU H OE2 
577  N N   . ASN A 77  ? 1.0401 0.6995 0.9019 0.0551  -0.0817 0.0358  76  ASN H N   
578  C CA  . ASN A 77  ? 0.9895 0.6810 0.8769 0.0476  -0.0618 0.0460  76  ASN H CA  
579  C C   . ASN A 77  ? 0.9715 0.7249 0.9062 0.0459  -0.0520 0.0468  76  ASN H C   
580  O O   . ASN A 77  ? 0.9368 0.7144 0.8923 0.0283  -0.0394 0.0543  76  ASN H O   
581  C CB  . ASN A 77  ? 1.0600 0.7266 0.9326 0.0219  -0.0517 0.0584  76  ASN H CB  
582  C CG  . ASN A 77  ? 1.2002 0.8303 1.0416 0.0290  -0.0498 0.0624  76  ASN H CG  
583  O OD1 . ASN A 77  ? 1.2609 0.9087 1.1143 0.0221  -0.0356 0.0718  76  ASN H OD1 
584  N ND2 . ASN A 77  ? 1.2354 0.8152 1.0353 0.0458  -0.0656 0.0536  76  ASN H ND2 
585  N N   . SER A 78  ? 0.9683 0.7468 0.9167 0.0650  -0.0586 0.0377  77  SER H N   
586  C CA  . SER A 78  ? 0.8687 0.6993 0.8551 0.0657  -0.0512 0.0379  77  SER H CA  
587  C C   . SER A 78  ? 0.7980 0.6600 0.8009 0.0840  -0.0490 0.0343  77  SER H C   
588  O O   . SER A 78  ? 0.7831 0.6325 0.7702 0.1007  -0.0573 0.0260  77  SER H O   
589  C CB  . SER A 78  ? 0.9142 0.7500 0.9048 0.0664  -0.0609 0.0310  77  SER H CB  
590  O OG  . SER A 78  ? 0.9805 0.8043 0.9708 0.0454  -0.0580 0.0347  77  SER H OG  
591  N N   . LEU A 79  ? 0.7165 0.6193 0.7499 0.0804  -0.0385 0.0392  78  LEU H N   
592  C CA  . LEU A 79  ? 0.6869 0.6211 0.7383 0.0928  -0.0349 0.0379  78  LEU H CA  
593  C C   . LEU A 79  ? 0.6990 0.6679 0.7712 0.0929  -0.0326 0.0373  78  LEU H C   
594  O O   . LEU A 79  ? 0.6720 0.6487 0.7532 0.0820  -0.0287 0.0403  78  LEU H O   
595  C CB  . LEU A 79  ? 0.5122 0.4559 0.5758 0.0893  -0.0253 0.0463  78  LEU H CB  
596  C CG  . LEU A 79  ? 0.5208 0.4967 0.6061 0.0979  -0.0209 0.0471  78  LEU H CG  
597  C CD1 . LEU A 79  ? 0.5297 0.4988 0.6070 0.1141  -0.0255 0.0382  78  LEU H CD1 
598  C CD2 . LEU A 79  ? 0.4645 0.4547 0.5659 0.0917  -0.0140 0.0565  78  LEU H CD2 
599  N N   . TYR A 80  ? 0.6685 0.6589 0.7470 0.1057  -0.0349 0.0321  79  TYR H N   
600  C CA  . TYR A 80  ? 0.6880 0.7093 0.7822 0.1074  -0.0323 0.0322  79  TYR H CA  
601  C C   . TYR A 80  ? 0.6600 0.7110 0.7699 0.1105  -0.0245 0.0360  79  TYR H C   
602  O O   . TYR A 80  ? 0.6821 0.7353 0.7921 0.1159  -0.0239 0.0341  79  TYR H O   
603  C CB  . TYR A 80  ? 0.7100 0.7323 0.7954 0.1187  -0.0439 0.0222  79  TYR H CB  
604  C CG  . TYR A 80  ? 0.7726 0.7608 0.8405 0.1152  -0.0543 0.0183  79  TYR H CG  
605  C CD1 . TYR A 80  ? 0.7482 0.7037 0.7908 0.1208  -0.0657 0.0120  79  TYR H CD1 
606  C CD2 . TYR A 80  ? 0.7693 0.7557 0.8440 0.1059  -0.0533 0.0198  79  TYR H CD2 
607  C CE1 . TYR A 80  ? 0.7998 0.7178 0.8220 0.1154  -0.0763 0.0097  79  TYR H CE1 
608  C CE2 . TYR A 80  ? 0.7821 0.7362 0.8416 0.0996  -0.0626 0.0165  79  TYR H CE2 
609  C CZ  . TYR A 80  ? 0.8606 0.7786 0.8928 0.1033  -0.0743 0.0128  79  TYR H CZ  
610  O OH  . TYR A 80  ? 0.9036 0.7834 0.9165 0.0949  -0.0847 0.0109  79  TYR H OH  
611  N N   . LEU A 81  ? 0.5458 0.6174 0.6674 0.1070  -0.0191 0.0406  80  LEU H N   
612  C CA  . LEU A 81  ? 0.5376 0.6345 0.6695 0.1086  -0.0129 0.0447  80  LEU H CA  
613  C C   . LEU A 81  ? 0.5443 0.6600 0.6773 0.1139  -0.0129 0.0426  80  LEU H C   
614  O O   . LEU A 81  ? 0.5170 0.6313 0.6508 0.1117  -0.0121 0.0436  80  LEU H O   
615  C CB  . LEU A 81  ? 0.4660 0.5645 0.6063 0.0996  -0.0067 0.0542  80  LEU H CB  
616  C CG  . LEU A 81  ? 0.4019 0.5180 0.5504 0.0990  -0.0017 0.0596  80  LEU H CG  
617  C CD1 . LEU A 81  ? 0.4341 0.5525 0.5851 0.1044  -0.0024 0.0545  80  LEU H CD1 
618  C CD2 . LEU A 81  ? 0.4124 0.5266 0.5664 0.0920  0.0000  0.0684  80  LEU H CD2 
619  N N   . GLN A 82  ? 0.5841 0.7196 0.7166 0.1224  -0.0144 0.0380  81  GLN H N   
620  C CA  . GLN A 82  ? 0.5380 0.6963 0.6715 0.1294  -0.0139 0.0367  81  GLN H CA  
621  C C   . GLN A 82  ? 0.5345 0.7117 0.6730 0.1231  -0.0031 0.0459  81  GLN H C   
622  O O   . GLN A 82  ? 0.5824 0.7740 0.7247 0.1204  0.0007  0.0464  81  GLN H O   
623  C CB  . GLN A 82  ? 0.5530 0.7270 0.6815 0.1432  -0.0232 0.0251  81  GLN H CB  
624  C CG  . GLN A 82  ? 0.6039 0.8081 0.7342 0.1527  -0.0228 0.0238  81  GLN H CG  
625  C CD  . GLN A 82  ? 0.6769 0.8719 0.8073 0.1579  -0.0259 0.0237  81  GLN H CD  
626  O OE1 . GLN A 82  ? 0.7085 0.8806 0.8363 0.1594  -0.0347 0.0185  81  GLN H OE1 
627  N NE2 . GLN A 82  ? 0.7528 0.9642 0.8850 0.1606  -0.0187 0.0288  81  GLN H NE2 
628  N N   . MET A 83  ? 0.4710 0.6462 0.6077 0.1206  0.0011  0.0519  82  MET H N   
629  C CA  . MET A 83  ? 0.4723 0.6552 0.6072 0.1132  0.0096  0.0621  82  MET H CA  
630  C C   . MET A 83  ? 0.5434 0.7462 0.6719 0.1206  0.0130  0.0628  82  MET H C   
631  O O   . MET A 83  ? 0.5743 0.7735 0.6982 0.1301  0.0101  0.0587  82  MET H O   
632  C CB  . MET A 83  ? 0.4668 0.6287 0.5977 0.1065  0.0098  0.0674  82  MET H CB  
633  C CG  . MET A 83  ? 0.4697 0.6149 0.6067 0.1003  0.0062  0.0672  82  MET H CG  
634  S SD  . MET A 83  ? 0.6232 0.7533 0.7545 0.0942  0.0040  0.0716  82  MET H SD  
635  C CE  . MET A 83  ? 0.8332 0.9587 0.9605 0.1006  0.0004  0.0601  82  MET H CE  
636  N N   . ASN A 84  A 0.4881 0.7140 0.6171 0.1167  0.0195  0.0668  82  ASN H N   
637  C CA  . ASN A 84  A 0.4406 0.6888 0.5620 0.1227  0.0243  0.0690  82  ASN H CA  
638  C C   . ASN A 84  A 0.4926 0.7366 0.6031 0.1094  0.0345  0.0829  82  ASN H C   
639  O O   . ASN A 84  A 0.4849 0.7159 0.5975 0.0951  0.0371  0.0899  82  ASN H O   
640  C CB  . ASN A 84  A 0.4452 0.7301 0.5730 0.1283  0.0235  0.0614  82  ASN H CB  
641  C CG  . ASN A 84  A 0.4941 0.7818 0.6259 0.1448  0.0100  0.0468  82  ASN H CG  
642  O OD1 . ASN A 84  A 0.5504 0.8196 0.6802 0.1539  0.0029  0.0434  82  ASN H OD1 
643  N ND2 . ASN A 84  A 0.3465 0.6572 0.4825 0.1491  0.0049  0.0363  82  ASN H ND2 
644  N N   . SER A 85  B 0.4720 0.7250 0.5690 0.1151  0.0393  0.0869  82  SER H N   
645  C CA  . SER A 85  B 0.4397 0.6873 0.5208 0.1013  0.0491  0.1009  82  SER H CA  
646  C C   . SER A 85  B 0.4872 0.6962 0.5597 0.0909  0.0460  0.1077  82  SER H C   
647  O O   . SER A 85  B 0.5119 0.7146 0.5846 0.0740  0.0494  0.1167  82  SER H O   
648  C CB  . SER A 85  B 0.4322 0.7099 0.5233 0.0867  0.0572  0.1043  82  SER H CB  
649  O OG  . SER A 85  B 0.4856 0.7750 0.5611 0.0768  0.0684  0.1157  82  SER H OG  
650  N N   . LEU A 86  C 0.4634 0.6488 0.5293 0.1017  0.0383  0.1016  82  LEU H N   
651  C CA  . LEU A 86  C 0.5179 0.6726 0.5775 0.0952  0.0318  0.1037  82  LEU H CA  
652  C C   . LEU A 86  C 0.5889 0.7196 0.6196 0.0888  0.0329  0.1142  82  LEU H C   
653  O O   . LEU A 86  C 0.6896 0.8192 0.7002 0.0955  0.0375  0.1163  82  LEU H O   
654  C CB  . LEU A 86  C 0.5347 0.6780 0.5972 0.1082  0.0231  0.0906  82  LEU H CB  
655  C CG  . LEU A 86  C 0.5654 0.7179 0.6520 0.1083  0.0194  0.0831  82  LEU H CG  
656  C CD1 . LEU A 86  C 0.6405 0.7837 0.7289 0.1181  0.0125  0.0705  82  LEU H CD1 
657  C CD2 . LEU A 86  C 0.4758 0.6208 0.5710 0.0951  0.0178  0.0892  82  LEU H CD2 
658  N N   . ARG A 87  ? 0.5858 0.6953 0.6122 0.0772  0.0273  0.1204  83  ARG H N   
659  C CA  . ARG A 87  ? 0.6482 0.7274 0.6426 0.0702  0.0243  0.1303  83  ARG H CA  
660  C C   . ARG A 87  ? 0.6719 0.7212 0.6519 0.0763  0.0087  0.1239  83  ARG H C   
661  O O   . ARG A 87  ? 0.5873 0.6426 0.5874 0.0800  0.0017  0.1151  83  ARG H O   
662  C CB  . ARG A 87  ? 0.6926 0.7729 0.6906 0.0488  0.0293  0.1450  83  ARG H CB  
663  C CG  . ARG A 87  ? 0.8509 0.9695 0.8698 0.0408  0.0435  0.1477  83  ARG H CG  
664  C CD  . ARG A 87  ? 0.9334 1.0583 0.9694 0.0216  0.0457  0.1551  83  ARG H CD  
665  N NE  . ARG A 87  ? 0.9812 1.1444 1.0321 0.0114  0.0597  0.1565  83  ARG H NE  
666  C CZ  . ARG A 87  ? 0.9990 1.1788 1.0713 -0.0031 0.0636  0.1577  83  ARG H CZ  
667  N NH1 . ARG A 87  ? 0.9834 1.2033 1.0683 -0.0115 0.0761  0.1555  83  ARG H NH1 
668  N NH2 . ARG A 87  ? 0.9621 1.1210 1.0439 -0.0075 0.0540  0.1593  83  ARG H NH2 
669  N N   . ALA A 88  ? 0.7122 0.4996 0.6431 0.0128  0.1030  0.0011  84  ALA H N   
670  C CA  . ALA A 88  ? 0.7869 0.5466 0.6737 0.0248  0.0925  -0.0159 84  ALA H CA  
671  C C   . ALA A 88  ? 0.8366 0.6134 0.7276 0.0119  0.0749  -0.0187 84  ALA H C   
672  O O   . ALA A 88  ? 0.8575 0.6416 0.7339 0.0247  0.0656  -0.0293 84  ALA H O   
673  C CB  . ALA A 88  ? 0.7069 0.4104 0.5471 0.0264  0.0957  -0.0219 84  ALA H CB  
674  N N   . GLU A 89  ? 0.7508 0.5344 0.6632 -0.0114 0.0706  -0.0098 85  GLU H N   
675  C CA  . GLU A 89  ? 0.7391 0.5351 0.6551 -0.0214 0.0528  -0.0135 85  GLU H CA  
676  C C   . GLU A 89  ? 0.6955 0.5411 0.6421 -0.0172 0.0484  -0.0108 85  GLU H C   
677  O O   . GLU A 89  ? 0.7344 0.5916 0.6787 -0.0179 0.0338  -0.0153 85  GLU H O   
678  C CB  . GLU A 89  ? 0.8514 0.6396 0.7872 -0.0455 0.0498  -0.0067 85  GLU H CB  
679  C CG  . GLU A 89  ? 1.1591 0.9030 1.0768 -0.0519 0.0600  -0.0035 85  GLU H CG  
680  C CD  . GLU A 89  ? 1.2973 1.0492 1.2380 -0.0534 0.0814  0.0099  85  GLU H CD  
681  O OE1 . GLU A 89  ? 1.3303 1.1148 1.3145 -0.0679 0.0850  0.0202  85  GLU H OE1 
682  O OE2 . GLU A 89  ? 1.2993 1.0251 1.2135 -0.0386 0.0937  0.0092  85  GLU H OE2 
683  N N   . ASP A 90  ? 0.5728 0.4478 0.5487 -0.0111 0.0605  -0.0032 86  ASP H N   
684  C CA  . ASP A 90  ? 0.5699 0.4918 0.5771 -0.0063 0.0581  0.0005  86  ASP H CA  
685  C C   . ASP A 90  ? 0.6367 0.5609 0.6258 0.0174  0.0570  -0.0084 86  ASP H C   
686  O O   . ASP A 90  ? 0.6030 0.5637 0.6163 0.0245  0.0563  -0.0051 86  ASP H O   
687  C CB  . ASP A 90  ? 0.5345 0.4903 0.5865 -0.0110 0.0691  0.0126  86  ASP H CB  
688  C CG  . ASP A 90  ? 0.6935 0.6497 0.7663 -0.0346 0.0712  0.0211  86  ASP H CG  
689  O OD1 . ASP A 90  ? 0.7599 0.7069 0.8288 -0.0491 0.0616  0.0186  86  ASP H OD1 
690  O OD2 . ASP A 90  ? 0.6922 0.6588 0.7871 -0.0373 0.0818  0.0296  86  ASP H OD2 
691  N N   . THR A 91  ? 0.6414 0.5258 0.5886 0.0298  0.0574  -0.0201 87  THR H N   
692  C CA  . THR A 91  ? 0.6069 0.4885 0.5337 0.0523  0.0558  -0.0320 87  THR H CA  
693  C C   . THR A 91  ? 0.6024 0.4973 0.5188 0.0532  0.0417  -0.0352 87  THR H C   
694  O O   . THR A 91  ? 0.6724 0.5465 0.5619 0.0448  0.0289  -0.0396 87  THR H O   
695  C CB  . THR A 91  ? 0.6633 0.4945 0.5403 0.0645  0.0565  -0.0473 87  THR H CB  
696  O OG1 . THR A 91  ? 0.6685 0.4897 0.5544 0.0727  0.0710  -0.0458 87  THR H OG1 
697  C CG2 . THR A 91  ? 0.5569 0.3840 0.4097 0.0857  0.0514  -0.0626 87  THR H CG2 
698  N N   . ALA A 92  ? 0.4981 0.4286 0.4380 0.0647  0.0436  -0.0322 88  ALA H N   
699  C CA  . ALA A 92  ? 0.5706 0.5178 0.5021 0.0691  0.0322  -0.0331 88  ALA H CA  
700  C C   . ALA A 92  ? 0.5717 0.5588 0.5350 0.0832  0.0393  -0.0271 88  ALA H C   
701  O O   . ALA A 92  ? 0.4963 0.5008 0.4939 0.0880  0.0516  -0.0225 88  ALA H O   
702  C CB  . ALA A 92  ? 0.5524 0.5114 0.4953 0.0516  0.0227  -0.0252 88  ALA H CB  
703  N N   . VAL A 93  ? 0.4680 0.4699 0.4212 0.0915  0.0312  -0.0271 89  VAL H N   
704  C CA  . VAL A 93  ? 0.5080 0.5521 0.4960 0.1019  0.0383  -0.0168 89  VAL H CA  
705  C C   . VAL A 93  ? 0.5164 0.5921 0.5363 0.0884  0.0371  -0.0024 89  VAL H C   
706  O O   . VAL A 93  ? 0.5814 0.6508 0.5835 0.0813  0.0249  -0.0034 89  VAL H O   
707  C CB  . VAL A 93  ? 0.5133 0.5596 0.4743 0.1197  0.0316  -0.0221 89  VAL H CB  
708  C CG1 . VAL A 93  ? 0.5012 0.5905 0.5008 0.1305  0.0417  -0.0091 89  VAL H CG1 
709  C CG2 . VAL A 93  ? 0.5543 0.5683 0.4812 0.1328  0.0312  -0.0395 89  VAL H CG2 
710  N N   . TYR A 94  ? 0.4774 0.5861 0.5448 0.0860  0.0483  0.0091  90  TYR H N   
711  C CA  . TYR A 94  ? 0.5028 0.6437 0.6016 0.0744  0.0477  0.0214  90  TYR H CA  
712  C C   . TYR A 94  ? 0.5435 0.7205 0.6628 0.0882  0.0522  0.0313  90  TYR H C   
713  O O   . TYR A 94  ? 0.5552 0.7491 0.6990 0.1006  0.0627  0.0353  90  TYR H O   
714  C CB  . TYR A 94  ? 0.3655 0.5217 0.5043 0.0610  0.0552  0.0282  90  TYR H CB  
715  C CG  . TYR A 94  ? 0.4056 0.5313 0.5289 0.0452  0.0522  0.0225  90  TYR H CG  
716  C CD1 . TYR A 94  ? 0.4899 0.5798 0.5860 0.0511  0.0544  0.0127  90  TYR H CD1 
717  C CD2 . TYR A 94  ? 0.3749 0.5059 0.5103 0.0253  0.0478  0.0263  90  TYR H CD2 
718  C CE1 . TYR A 94  ? 0.5363 0.5966 0.6175 0.0375  0.0536  0.0093  90  TYR H CE1 
719  C CE2 . TYR A 94  ? 0.4474 0.5495 0.5710 0.0105  0.0467  0.0225  90  TYR H CE2 
720  C CZ  . TYR A 94  ? 0.4449 0.5122 0.5417 0.0169  0.0504  0.0154  90  TYR H CZ  
721  O OH  . TYR A 94  ? 0.4707 0.5088 0.5558 0.0038  0.0514  0.0135  90  TYR H OH  
722  N N   . TYR A 95  ? 0.4549 0.6432 0.5661 0.0879  0.0445  0.0350  91  TYR H N   
723  C CA  . TYR A 95  ? 0.4322 0.6535 0.5586 0.1027  0.0494  0.0459  91  TYR H CA  
724  C C   . TYR A 95  ? 0.4495 0.7002 0.6101 0.0914  0.0512  0.0557  91  TYR H C   
725  O O   . TYR A 95  ? 0.4785 0.7199 0.6336 0.0762  0.0422  0.0507  91  TYR H O   
726  C CB  . TYR A 95  ? 0.4890 0.7010 0.5750 0.1167  0.0377  0.0414  91  TYR H CB  
727  C CG  . TYR A 95  ? 0.5406 0.7248 0.5863 0.1292  0.0322  0.0302  91  TYR H CG  
728  C CD1 . TYR A 95  ? 0.5207 0.7155 0.5667 0.1483  0.0411  0.0334  91  TYR H CD1 
729  C CD2 . TYR A 95  ? 0.5038 0.6514 0.5116 0.1221  0.0175  0.0160  91  TYR H CD2 
730  C CE1 . TYR A 95  ? 0.5148 0.6845 0.5221 0.1597  0.0349  0.0210  91  TYR H CE1 
731  C CE2 . TYR A 95  ? 0.5502 0.6721 0.5181 0.1335  0.0104  0.0042  91  TYR H CE2 
732  C CZ  . TYR A 95  ? 0.5696 0.7029 0.5360 0.1522  0.0188  0.0059  91  TYR H CZ  
733  O OH  . TYR A 95  ? 0.5673 0.6756 0.4927 0.1637  0.0110  -0.0078 91  TYR H OH  
734  N N   . CYS A 96  ? 0.4014 0.6871 0.5986 0.0984  0.0622  0.0687  92  CYS H N   
735  C CA  . CYS A 96  ? 0.5009 0.8126 0.7195 0.0911  0.0611  0.0761  92  CYS H CA  
736  C C   . CYS A 96  ? 0.4983 0.8187 0.6958 0.1100  0.0589  0.0799  92  CYS H C   
737  O O   . CYS A 96  ? 0.4850 0.8059 0.6688 0.1296  0.0638  0.0835  92  CYS H O   
738  C CB  . CYS A 96  ? 0.5355 0.8810 0.8065 0.0845  0.0709  0.0874  92  CYS H CB  
739  S SG  . CYS A 96  ? 0.9355 1.3177 1.2424 0.1045  0.0860  0.1043  92  CYS H SG  
740  N N   . VAL A 97  ? 0.4477 0.7727 0.6397 0.1058  0.0505  0.0774  93  VAL H N   
741  C CA  . VAL A 97  ? 0.4991 0.8292 0.6664 0.1274  0.0460  0.0787  93  VAL H CA  
742  C C   . VAL A 97  ? 0.5372 0.8911 0.7220 0.1272  0.0464  0.0831  93  VAL H C   
743  O O   . VAL A 97  ? 0.5825 0.9380 0.7852 0.1064  0.0422  0.0777  93  VAL H O   
744  C CB  . VAL A 97  ? 0.5694 0.8679 0.6940 0.1313  0.0279  0.0631  93  VAL H CB  
745  C CG1 . VAL A 97  ? 0.5312 0.8027 0.6360 0.1286  0.0262  0.0565  93  VAL H CG1 
746  C CG2 . VAL A 97  ? 0.5859 0.8724 0.7145 0.1116  0.0160  0.0513  93  VAL H CG2 
747  N N   . ARG A 98  ? 0.5308 0.9029 0.7090 0.1516  0.0520  0.0929  94  ARG H N   
748  C CA  . ARG A 98  ? 0.4238 0.8159 0.6109 0.1572  0.0525  0.0960  94  ARG H CA  
749  C C   . ARG A 98  ? 0.4649 0.8401 0.6164 0.1706  0.0354  0.0812  94  ARG H C   
750  O O   . ARG A 98  ? 0.5751 0.9373 0.6945 0.1907  0.0284  0.0781  94  ARG H O   
751  C CB  . ARG A 98  ? 0.4284 0.8489 0.6274 0.1801  0.0693  0.1157  94  ARG H CB  
752  C CG  . ARG A 98  ? 0.4033 0.8446 0.6121 0.1864  0.0718  0.1199  94  ARG H CG  
753  C CD  . ARG A 98  ? 0.4749 0.9437 0.6988 0.2080  0.0908  0.1419  94  ARG H CD  
754  N NE  . ARG A 98  ? 0.6323 1.0979 0.8188 0.2419  0.0905  0.1448  94  ARG H NE  
755  C CZ  . ARG A 98  ? 0.6931 1.1797 0.8834 0.2675  0.1073  0.1645  94  ARG H CZ  
756  N NH1 . ARG A 98  ? 0.6838 1.1953 0.9168 0.2612  0.1256  0.1827  94  ARG H NH1 
757  N NH2 . ARG A 98  ? 0.6971 1.1806 0.8502 0.3005  0.1054  0.1665  94  ARG H NH2 
758  N N   . GLU A 99  ? 0.4207 0.7965 0.5791 0.1607  0.0271  0.0706  95  GLU H N   
759  C CA  . GLU A 99  ? 0.4489 0.8109 0.5801 0.1766  0.0101  0.0545  95  GLU H CA  
760  C C   . GLU A 99  ? 0.5655 0.9496 0.6890 0.2076  0.0170  0.0635  95  GLU H C   
761  O O   . GLU A 99  ? 0.6389 1.0473 0.7863 0.2046  0.0321  0.0773  95  GLU H O   
762  C CB  . GLU A 99  ? 0.4602 0.8107 0.6049 0.1518  -0.0017 0.0364  95  GLU H CB  
763  C CG  . GLU A 99  ? 0.5864 0.9124 0.7079 0.1621  -0.0231 0.0148  95  GLU H CG  
764  C CD  . GLU A 99  ? 0.7263 1.0339 0.8642 0.1322  -0.0338 -0.0027 95  GLU H CD  
765  O OE1 . GLU A 99  ? 0.7600 1.0669 0.9195 0.1024  -0.0258 0.0027  95  GLU H OE1 
766  O OE2 . GLU A 99  ? 0.7850 1.0788 0.9157 0.1404  -0.0505 -0.0224 95  GLU H OE2 
767  N N   . GLY A 100 ? 0.6014 0.9776 0.6918 0.2392  0.0057  0.0565  96  GLY H N   
768  C CA  . GLY A 100 ? 0.5659 0.9605 0.6433 0.2743  0.0119  0.0647  96  GLY H CA  
769  C C   . GLY A 100 ? 0.6396 1.0459 0.7328 0.2698  0.0144  0.0596  96  GLY H C   
770  O O   . GLY A 100 ? 0.6676 1.0644 0.7769 0.2424  0.0054  0.0439  96  GLY H O   
771  N N   . PRO A 101 ? 0.6226 1.0493 0.7101 0.2979  0.0269  0.0728  97  PRO H N   
772  C CA  . PRO A 101 ? 0.5889 1.0294 0.6905 0.2953  0.0325  0.0710  97  PRO H CA  
773  C C   . PRO A 101 ? 0.6705 1.0941 0.7590 0.2994  0.0120  0.0411  97  PRO H C   
774  O O   . PRO A 101 ? 0.6940 1.1248 0.7982 0.2853  0.0135  0.0344  97  PRO H O   
775  C CB  . PRO A 101 ? 0.5189 0.9804 0.6087 0.3327  0.0504  0.0929  97  PRO H CB  
776  C CG  . PRO A 101 ? 0.5273 0.9797 0.5849 0.3634  0.0444  0.0948  97  PRO H CG  
777  C CD  . PRO A 101 ? 0.5881 1.0272 0.6562 0.3336  0.0388  0.0924  97  PRO H CD  
778  N N   . ARG A 102 ? 0.6941 1.0963 0.7572 0.3185  -0.0079 0.0223  98  ARG H N   
779  C CA  . ARG A 102 ? 0.6556 1.0404 0.7125 0.3230  -0.0286 -0.0089 98  ARG H CA  
780  C C   . ARG A 102 ? 0.6540 1.0237 0.7376 0.2777  -0.0386 -0.0260 98  ARG H C   
781  O O   . ARG A 102 ? 0.6444 0.9977 0.7292 0.2762  -0.0560 -0.0536 98  ARG H O   
782  C CB  . ARG A 102 ? 0.7059 1.0741 0.7325 0.3609  -0.0492 -0.0248 98  ARG H CB  
783  C CG  . ARG A 102 ? 0.9013 1.2838 0.8981 0.4099  -0.0417 -0.0088 98  ARG H CG  
784  C CD  . ARG A 102 ? 1.1045 1.4723 1.0725 0.4516  -0.0670 -0.0292 98  ARG H CD  
785  N NE  . ARG A 102 ? 1.3181 1.7017 1.2557 0.5008  -0.0598 -0.0118 98  ARG H NE  
786  C CZ  . ARG A 102 ? 1.4755 1.8672 1.4008 0.5093  -0.0537 0.0088  98  ARG H CZ  
787  N NH1 . ARG A 102 ? 1.4878 1.8714 1.4269 0.4726  -0.0544 0.0133  98  ARG H NH1 
788  N NH2 . ARG A 102 ? 1.5263 1.9338 1.4243 0.5559  -0.0467 0.0245  98  ARG H NH2 
789  N N   . ALA A 103 ? 0.6946 0.9809 0.5356 0.1381  -0.0421 -0.0060 99  ALA H N   
790  C CA  . ALA A 103 ? 0.7320 1.0466 0.6027 0.1217  -0.0535 -0.0070 99  ALA H CA  
791  C C   . ALA A 103 ? 0.7854 1.1066 0.6427 0.1293  -0.0522 0.0031  99  ALA H C   
792  O O   . ALA A 103 ? 0.8005 1.1017 0.6486 0.1303  -0.0373 0.0190  99  ALA H O   
793  C CB  . ALA A 103 ? 0.7315 1.0368 0.6375 0.0981  -0.0499 0.0001  99  ALA H CB  
794  N N   . THR A 104 ? 0.8162 1.1668 0.6741 0.1334  -0.0659 -0.0072 100 THR H N   
795  C CA  . THR A 104 ? 0.8881 1.2464 0.7299 0.1429  -0.0643 0.0022  100 THR H CA  
796  C C   . THR A 104 ? 0.9503 1.3327 0.8233 0.1259  -0.0776 -0.0055 100 THR H C   
797  O O   . THR A 104 ? 1.0349 1.4371 0.9285 0.1186  -0.0901 -0.0265 100 THR H O   
798  C CB  . THR A 104 ? 1.0377 1.4044 0.8364 0.1755  -0.0664 -0.0046 100 THR H CB  
799  O OG1 . THR A 104 ? 0.9782 1.3102 0.7384 0.1931  -0.0455 0.0078  100 THR H OG1 
800  C CG2 . THR A 104 ? 1.0733 1.4644 0.8660 0.1837  -0.0730 -0.0033 100 THR H CG2 
801  N N   . GLY A 105 A 0.9137 1.2909 0.7895 0.1180  -0.0718 0.0103  100 GLY H N   
802  C CA  . GLY A 105 A 0.9500 1.3418 0.8519 0.1025  -0.0820 0.0035  100 GLY H CA  
803  C C   . GLY A 105 A 0.9661 1.3675 0.9014 0.0856  -0.0933 -0.0200 100 GLY H C   
804  O O   . GLY A 105 A 1.0153 1.3969 0.9718 0.0654  -0.0890 -0.0163 100 GLY H O   
805  N N   . TYR A 106 B 0.9012 1.3334 0.8393 0.0950  -0.1059 -0.0457 100 TYR H N   
806  C CA  . TYR A 106 B 0.9154 1.3589 0.8838 0.0787  -0.1115 -0.0728 100 TYR H CA  
807  C C   . TYR A 106 B 0.9210 1.3856 0.8832 0.0891  -0.1157 -0.0939 100 TYR H C   
808  O O   . TYR A 106 B 0.9298 1.4162 0.9120 0.0809  -0.1197 -0.1229 100 TYR H O   
809  C CB  . TYR A 106 B 1.0238 1.4856 1.0123 0.0719  -0.1198 -0.0916 100 TYR H CB  
810  C CG  . TYR A 106 B 1.1953 1.6957 1.1691 0.0961  -0.1326 -0.1045 100 TYR H CG  
811  C CD1 . TYR A 106 B 1.2637 1.8020 1.2532 0.0992  -0.1438 -0.1413 100 TYR H CD1 
812  C CD2 . TYR A 106 B 1.2730 1.7726 1.2155 0.1170  -0.1316 -0.0815 100 TYR H CD2 
813  C CE1 . TYR A 106 B 1.3457 1.9234 1.3219 0.1240  -0.1582 -0.1548 100 TYR H CE1 
814  C CE2 . TYR A 106 B 1.3463 1.8803 1.2711 0.1432  -0.1434 -0.0928 100 TYR H CE2 
815  C CZ  . TYR A 106 B 1.3879 1.9625 1.3305 0.1474  -0.1589 -0.1295 100 TYR H CZ  
816  O OH  . TYR A 106 B 1.3916 2.0045 1.3168 0.1759  -0.1733 -0.1425 100 TYR H OH  
817  N N   . SER A 107 C 0.9297 1.3844 0.8635 0.1057  -0.1118 -0.0805 100 SER H N   
818  C CA  . SER A 107 C 0.9557 1.4225 0.8785 0.1152  -0.1141 -0.0963 100 SER H CA  
819  C C   . SER A 107 C 0.8877 1.3383 0.8298 0.0949  -0.1034 -0.0993 100 SER H C   
820  O O   . SER A 107 C 0.8957 1.3251 0.8576 0.0763  -0.0953 -0.0894 100 SER H O   
821  C CB  . SER A 107 C 0.9727 1.4234 0.8538 0.1409  -0.1107 -0.0808 100 SER H CB  
822  O OG  . SER A 107 C 0.9486 1.3600 0.8253 0.1345  -0.0955 -0.0566 100 SER H OG  
823  N N   . MET A 108 D 0.8538 1.3132 0.7872 0.0995  -0.1026 -0.1126 100 MET H N   
824  C CA  . MET A 108 D 0.7825 1.2228 0.7271 0.0833  -0.0890 -0.1110 100 MET H CA  
825  C C   . MET A 108 D 0.7879 1.1880 0.7279 0.0815  -0.0791 -0.0812 100 MET H C   
826  O O   . MET A 108 D 0.8077 1.1934 0.7246 0.0977  -0.0798 -0.0650 100 MET H O   
827  C CB  . MET A 108 D 0.7823 1.2301 0.7088 0.0916  -0.0882 -0.1227 100 MET H CB  
828  C CG  . MET A 108 D 0.7460 1.2362 0.6841 0.0864  -0.0929 -0.1567 100 MET H CG  
829  S SD  . MET A 108 D 0.8377 1.3303 0.8117 0.0542  -0.0734 -0.1739 100 MET H SD  
830  C CE  . MET A 108 D 1.0751 1.5762 1.0733 0.0467  -0.0789 -0.1830 100 MET H CE  
831  N N   . ALA A 109 E 0.6941 1.0765 0.6550 0.0628  -0.0678 -0.0759 100 ALA H N   
832  C CA  . ALA A 109 E 0.6219 0.9717 0.5851 0.0597  -0.0596 -0.0512 100 ALA H CA  
833  C C   . ALA A 109 E 0.6361 0.9620 0.5827 0.0679  -0.0509 -0.0413 100 ALA H C   
834  O O   . ALA A 109 E 0.5904 0.9208 0.5242 0.0726  -0.0499 -0.0524 100 ALA H O   
835  C CB  . ALA A 109 E 0.5298 0.8694 0.5190 0.0403  -0.0519 -0.0498 100 ALA H CB  
836  N N   . ASP A 110 F 0.6603 0.9594 0.6077 0.0686  -0.0437 -0.0222 100 ASP H N   
837  C CA  . ASP A 110 F 0.6556 0.9243 0.5933 0.0731  -0.0322 -0.0138 100 ASP H CA  
838  C C   . ASP A 110 F 0.6747 0.9273 0.6402 0.0579  -0.0235 -0.0027 100 ASP H C   
839  O O   . ASP A 110 F 0.6702 0.9332 0.6563 0.0470  -0.0270 -0.0008 100 ASP H O   
840  C CB  . ASP A 110 F 0.6568 0.9070 0.5681 0.0912  -0.0281 -0.0048 100 ASP H CB  
841  C CG  . ASP A 110 F 0.8378 1.0540 0.7245 0.1027  -0.0166 -0.0055 100 ASP H CG  
842  O OD1 . ASP A 110 F 0.8927 1.0917 0.7459 0.1223  -0.0112 -0.0045 100 ASP H OD1 
843  O OD2 . ASP A 110 F 0.9105 1.1124 0.8084 0.0923  -0.0103 -0.0069 100 ASP H OD2 
844  N N   . VAL A 111 G 0.6804 0.9046 0.6451 0.0586  -0.0120 0.0039  100 VAL H N   
845  C CA  . VAL A 111 G 0.6504 0.8604 0.6417 0.0468  -0.0039 0.0137  100 VAL H CA  
846  C C   . VAL A 111 G 0.6241 0.8308 0.6280 0.0478  -0.0051 0.0246  100 VAL H C   
847  O O   . VAL A 111 G 0.6773 0.8796 0.6656 0.0580  -0.0042 0.0266  100 VAL H O   
848  C CB  . VAL A 111 G 0.6727 0.8504 0.6611 0.0468  0.0099  0.0164  100 VAL H CB  
849  C CG1 . VAL A 111 G 0.7077 0.8868 0.6889 0.0401  0.0145  0.0080  100 VAL H CG1 
850  C CG2 . VAL A 111 G 0.5342 0.6873 0.4971 0.0626  0.0151  0.0161  100 VAL H CG2 
851  N N   . PHE A 112 H 0.6276 0.8361 0.6574 0.0378  -0.0051 0.0311  100 PHE H N   
852  C CA  . PHE A 112 H 0.5860 0.7931 0.6308 0.0376  -0.0065 0.0403  100 PHE H CA  
853  C C   . PHE A 112 H 0.5701 0.7543 0.6205 0.0416  0.0057  0.0424  100 PHE H C   
854  O O   . PHE A 112 H 0.6339 0.8082 0.7045 0.0364  0.0109  0.0454  100 PHE H O   
855  C CB  . PHE A 112 H 0.5507 0.7643 0.6182 0.0287  -0.0111 0.0453  100 PHE H CB  
856  C CG  . PHE A 112 H 0.5481 0.7755 0.6111 0.0238  -0.0198 0.0410  100 PHE H CG  
857  C CD1 . PHE A 112 H 0.5526 0.7787 0.6218 0.0172  -0.0167 0.0371  100 PHE H CD1 
858  C CD2 . PHE A 112 H 0.5692 0.8069 0.6205 0.0256  -0.0277 0.0400  100 PHE H CD2 
859  C CE1 . PHE A 112 H 0.5608 0.7926 0.6250 0.0124  -0.0210 0.0292  100 PHE H CE1 
860  C CE2 . PHE A 112 H 0.5588 0.8040 0.6083 0.0196  -0.0344 0.0342  100 PHE H CE2 
861  C CZ  . PHE A 112 H 0.5342 0.7749 0.5904 0.0130  -0.0309 0.0273  100 PHE H CZ  
862  N N   . ASP A 113 ? 0.4969 0.6699 0.5289 0.0511  0.0128  0.0399  101 ASP H N   
863  C CA  . ASP A 113 ? 0.5830 0.7246 0.6132 0.0561  0.0292  0.0362  101 ASP H CA  
864  C C   . ASP A 113 ? 0.6215 0.7612 0.6708 0.0555  0.0370  0.0368  101 ASP H C   
865  O O   . ASP A 113 ? 0.7105 0.8237 0.7663 0.0575  0.0524  0.0307  101 ASP H O   
866  C CB  . ASP A 113 ? 0.6661 0.7861 0.6566 0.0699  0.0384  0.0291  101 ASP H CB  
867  C CG  . ASP A 113 ? 0.8487 0.9747 0.8180 0.0798  0.0428  0.0289  101 ASP H CG  
868  O OD1 . ASP A 113 ? 0.9172 1.0679 0.9036 0.0730  0.0365  0.0352  101 ASP H OD1 
869  O OD2 . ASP A 113 ? 0.9239 1.0274 0.8566 0.0949  0.0545  0.0232  101 ASP H OD2 
870  N N   . ILE A 114 ? 0.5918 0.7578 0.6503 0.0518  0.0280  0.0421  102 ILE H N   
871  C CA  . ILE A 114 ? 0.6208 0.7916 0.7009 0.0492  0.0345  0.0411  102 ILE H CA  
872  C C   . ILE A 114 ? 0.6106 0.8098 0.7135 0.0408  0.0177  0.0496  102 ILE H C   
873  O O   . ILE A 114 ? 0.6232 0.8369 0.7147 0.0379  0.0073  0.0558  102 ILE H O   
874  C CB  . ILE A 114 ? 0.6167 0.7793 0.6740 0.0561  0.0522  0.0357  102 ILE H CB  
875  C CG1 . ILE A 114 ? 0.7385 0.8616 0.7726 0.0668  0.0728  0.0247  102 ILE H CG1 
876  C CG2 . ILE A 114 ? 0.4921 0.6686 0.5745 0.0501  0.0589  0.0331  102 ILE H CG2 
877  C CD1 . ILE A 114 ? 0.7760 0.8790 0.8027 0.0720  0.1003  0.0127  102 ILE H CD1 
878  N N   . TRP A 115 ? 0.5907 0.7944 0.7251 0.0378  0.0157  0.0490  103 TRP H N   
879  C CA  . TRP A 115 ? 0.5113 0.7358 0.6653 0.0330  -0.0009 0.0566  103 TRP H CA  
880  C C   . TRP A 115 ? 0.5370 0.7770 0.7134 0.0315  0.0007  0.0531  103 TRP H C   
881  O O   . TRP A 115 ? 0.5620 0.7963 0.7547 0.0337  0.0139  0.0424  103 TRP H O   
882  C CB  . TRP A 115 ? 0.4307 0.6496 0.6010 0.0336  -0.0060 0.0593  103 TRP H CB  
883  C CG  . TRP A 115 ? 0.4314 0.6399 0.5826 0.0324  -0.0062 0.0614  103 TRP H CG  
884  C CD1 . TRP A 115 ? 0.4633 0.6554 0.5963 0.0336  0.0039  0.0566  103 TRP H CD1 
885  C CD2 . TRP A 115 ? 0.4823 0.6948 0.6292 0.0298  -0.0146 0.0663  103 TRP H CD2 
886  N NE1 . TRP A 115 ? 0.5522 0.7441 0.6732 0.0305  0.0011  0.0577  103 TRP H NE1 
887  C CE2 . TRP A 115 ? 0.4558 0.6592 0.5852 0.0277  -0.0081 0.0626  103 TRP H CE2 
888  C CE3 . TRP A 115 ? 0.4072 0.6270 0.5606 0.0298  -0.0249 0.0716  103 TRP H CE3 
889  C CZ2 . TRP A 115 ? 0.4353 0.6394 0.5563 0.0239  -0.0089 0.0619  103 TRP H CZ2 
890  C CZ3 . TRP A 115 ? 0.4133 0.6268 0.5542 0.0279  -0.0248 0.0718  103 TRP H CZ3 
891  C CH2 . TRP A 115 ? 0.4191 0.6263 0.5454 0.0241  -0.0155 0.0660  103 TRP H CH2 
892  N N   . GLY A 116 ? 0.4930 0.7510 0.6706 0.0268  -0.0114 0.0601  104 GLY H N   
893  C CA  . GLY A 116 ? 0.3699 0.6477 0.5710 0.0245  -0.0133 0.0568  104 GLY H CA  
894  C C   . GLY A 116 ? 0.4060 0.6915 0.6366 0.0298  -0.0249 0.0555  104 GLY H C   
895  O O   . GLY A 116 ? 0.4106 0.6839 0.6397 0.0341  -0.0300 0.0602  104 GLY H O   
896  N N   . GLN A 117 ? 0.3672 0.6746 0.6241 0.0300  -0.0276 0.0486  105 GLN H N   
897  C CA  . GLN A 117 ? 0.4066 0.7252 0.6931 0.0381  -0.0392 0.0462  105 GLN H CA  
898  C C   . GLN A 117 ? 0.4115 0.7298 0.6871 0.0429  -0.0598 0.0601  105 GLN H C   
899  O O   . GLN A 117 ? 0.4894 0.8103 0.7793 0.0530  -0.0688 0.0619  105 GLN H O   
900  C CB  . GLN A 117 ? 0.4880 0.8358 0.8072 0.0382  -0.0383 0.0316  105 GLN H CB  
901  C CG  . GLN A 117 ? 0.6683 1.0246 0.9824 0.0280  -0.0197 0.0213  105 GLN H CG  
902  C CD  . GLN A 117 ? 0.7447 1.1094 1.0357 0.0194  -0.0273 0.0339  105 GLN H CD  
903  O OE1 . GLN A 117 ? 0.7598 1.1087 1.0208 0.0129  -0.0166 0.0411  105 GLN H OE1 
904  N NE2 . GLN A 117 ? 0.6346 1.0223 0.9387 0.0196  -0.0457 0.0367  105 GLN H NE2 
905  N N   . GLY A 118 ? 0.3888 0.7002 0.6373 0.0364  -0.0650 0.0693  106 GLY H N   
906  C CA  . GLY A 118 ? 0.4028 0.7042 0.6355 0.0404  -0.0809 0.0799  106 GLY H CA  
907  C C   . GLY A 118 ? 0.4814 0.7990 0.7215 0.0417  -0.0957 0.0815  106 GLY H C   
908  O O   . GLY A 118 ? 0.4044 0.7489 0.6719 0.0440  -0.0973 0.0725  106 GLY H O   
909  N N   . THR A 119 ? 0.5719 0.8711 0.7870 0.0398  -0.1057 0.0911  107 THR H N   
910  C CA  . THR A 119 ? 0.5306 0.8357 0.7444 0.0410  -0.1210 0.0946  107 THR H CA  
911  C C   . THR A 119 ? 0.4800 0.7555 0.6715 0.0547  -0.1325 0.1013  107 THR H C   
912  O O   . THR A 119 ? 0.4528 0.6955 0.6179 0.0518  -0.1269 0.1054  107 THR H O   
913  C CB  . THR A 119 ? 0.6673 0.9651 0.8638 0.0226  -0.1178 0.1009  107 THR H CB  
914  O OG1 . THR A 119 ? 0.8205 1.1453 1.0336 0.0116  -0.1036 0.0943  107 THR H OG1 
915  C CG2 . THR A 119 ? 0.7040 0.9968 0.8924 0.0224  -0.1334 0.1066  107 THR H CG2 
916  N N   . MET A 120 ? 0.5040 0.5451 0.5062 -0.0814 0.0340  -0.0329 108 MET H N   
917  C CA  . MET A 120 ? 0.5078 0.5555 0.5311 -0.0704 0.0358  -0.0280 108 MET H CA  
918  C C   . MET A 120 ? 0.5684 0.6074 0.5902 -0.0612 0.0379  -0.0175 108 MET H C   
919  O O   . MET A 120 ? 0.6103 0.6426 0.6137 -0.0615 0.0387  -0.0152 108 MET H O   
920  C CB  . MET A 120 ? 0.5442 0.6081 0.5750 -0.0690 0.0369  -0.0342 108 MET H CB  
921  C CG  . MET A 120 ? 0.5835 0.6513 0.6313 -0.0574 0.0382  -0.0298 108 MET H CG  
922  S SD  . MET A 120 ? 0.7598 0.8274 0.8276 -0.0526 0.0365  -0.0286 108 MET H SD  
923  C CE  . MET A 120 ? 1.7563 1.8375 1.8254 -0.0571 0.0358  -0.0408 108 MET H CE  
924  N N   . VAL A 121 ? 0.5332 0.5706 0.5724 -0.0532 0.0389  -0.0104 109 VAL H N   
925  C CA  . VAL A 121 ? 0.5840 0.6139 0.6240 -0.0433 0.0424  0.0001  109 VAL H CA  
926  C C   . VAL A 121 ? 0.5826 0.6183 0.6406 -0.0349 0.0441  0.0028  109 VAL H C   
927  O O   . VAL A 121 ? 0.5902 0.6304 0.6650 -0.0343 0.0423  0.0030  109 VAL H O   
928  C CB  . VAL A 121 ? 0.5459 0.5666 0.5881 -0.0413 0.0425  0.0087  109 VAL H CB  
929  C CG1 . VAL A 121 ? 0.4239 0.4387 0.4695 -0.0298 0.0477  0.0201  109 VAL H CG1 
930  C CG2 . VAL A 121 ? 0.5207 0.5320 0.5407 -0.0484 0.0404  0.0060  109 VAL H CG2 
931  N N   . THR A 122 ? 0.6057 0.6385 0.6575 -0.0288 0.0469  0.0048  110 THR H N   
932  C CA  . THR A 122 ? 0.5957 0.6315 0.6610 -0.0210 0.0482  0.0061  110 THR H CA  
933  C C   . THR A 122 ? 0.5326 0.5561 0.5964 -0.0115 0.0531  0.0171  110 THR H C   
934  O O   . THR A 122 ? 0.6162 0.6288 0.6626 -0.0086 0.0555  0.0204  110 THR H O   
935  C CB  . THR A 122 ? 0.6559 0.6982 0.7165 -0.0212 0.0467  -0.0019 110 THR H CB  
936  O OG1 . THR A 122 ? 0.6923 0.7477 0.7543 -0.0295 0.0434  -0.0119 110 THR H OG1 
937  C CG2 . THR A 122 ? 0.6700 0.7132 0.7430 -0.0128 0.0471  -0.0016 110 THR H CG2 
938  N N   . VAL A 123 ? 0.4612 0.4853 0.5421 -0.0068 0.0545  0.0235  111 VAL H N   
939  C CA  . VAL A 123 ? 0.4819 0.4960 0.5645 0.0026  0.0603  0.0345  111 VAL H CA  
940  C C   . VAL A 123 ? 0.5228 0.5348 0.6102 0.0086  0.0611  0.0329  111 VAL H C   
941  O O   . VAL A 123 ? 0.5421 0.5606 0.6445 0.0084  0.0585  0.0313  111 VAL H O   
942  C CB  . VAL A 123 ? 0.5311 0.5482 0.6304 0.0034  0.0613  0.0435  111 VAL H CB  
943  C CG1 . VAL A 123 ? 0.5105 0.5185 0.6109 0.0134  0.0690  0.0559  111 VAL H CG1 
944  C CG2 . VAL A 123 ? 0.5406 0.5594 0.6356 -0.0034 0.0586  0.0431  111 VAL H CG2 
945  N N   . SER A 124 ? 0.5190 0.5194 0.5912 0.0137  0.0638  0.0333  112 SER H N   
946  C CA  . SER A 124 ? 0.5658 0.5613 0.6388 0.0191  0.0635  0.0301  112 SER H CA  
947  C C   . SER A 124 ? 0.6198 0.5945 0.6767 0.0274  0.0689  0.0369  112 SER H C   
948  O O   . SER A 124 ? 0.6266 0.5906 0.6650 0.0278  0.0708  0.0406  112 SER H O   
949  C CB  . SER A 124 ? 0.6160 0.6213 0.6864 0.0143  0.0573  0.0176  112 SER H CB  
950  O OG  . SER A 124 ? 0.5848 0.5827 0.6518 0.0201  0.0563  0.0143  112 SER H OG  
951  N N   . SER A 125 ? 0.4765 0.4428 0.5377 0.0341  0.0708  0.0384  113 SER H N   
952  C CA  . SER A 125 ? 0.5104 0.4532 0.5548 0.0423  0.0756  0.0439  113 SER H CA  
953  C C   . SER A 125 ? 0.5728 0.5070 0.6000 0.0413  0.0705  0.0364  113 SER H C   
954  O O   . SER A 125 ? 0.6738 0.5853 0.6812 0.0465  0.0731  0.0413  113 SER H O   
955  C CB  . SER A 125 ? 0.4598 0.3950 0.5132 0.0487  0.0789  0.0469  113 SER H CB  
956  O OG  . SER A 125 ? 0.5993 0.5429 0.6609 0.0464  0.0719  0.0362  113 SER H OG  
957  N N   . ALA A 126 ? 0.4554 0.4073 0.4898 0.0347  0.0632  0.0254  114 ALA H N   
958  C CA  . ALA A 126 ? 0.4925 0.4409 0.5157 0.0334  0.0574  0.0181  114 ALA H CA  
959  C C   . ALA A 126 ? 0.5500 0.4969 0.5558 0.0270  0.0552  0.0190  114 ALA H C   
960  O O   . ALA A 126 ? 0.6846 0.6440 0.6922 0.0204  0.0553  0.0190  114 ALA H O   
961  C CB  . ALA A 126 ? 0.4491 0.4187 0.4884 0.0304  0.0510  0.0062  114 ALA H CB  
962  N N   . SER A 127 ? 0.5565 0.4864 0.5435 0.0283  0.0523  0.0197  115 SER H N   
963  C CA  . SER A 127 ? 0.6324 0.5586 0.5995 0.0211  0.0489  0.0212  115 SER H CA  
964  C C   . SER A 127 ? 0.6313 0.5854 0.6098 0.0112  0.0422  0.0106  115 SER H C   
965  O O   . SER A 127 ? 0.5983 0.5694 0.5959 0.0120  0.0396  0.0023  115 SER H O   
966  C CB  . SER A 127 ? 0.7074 0.6038 0.6485 0.0248  0.0466  0.0265  115 SER H CB  
967  O OG  . SER A 127 ? 0.7477 0.6360 0.6951 0.0314  0.0451  0.0232  115 SER H OG  
968  N N   . THR A 128 ? 0.6393 0.5974 0.6046 0.0020  0.0397  0.0111  116 THR H N   
969  C CA  . THR A 128 ? 0.5828 0.5685 0.5587 -0.0082 0.0348  0.0017  116 THR H CA  
970  C C   . THR A 128 ? 0.6285 0.6177 0.6034 -0.0097 0.0280  -0.0027 116 THR H C   
971  O O   . THR A 128 ? 0.6706 0.6362 0.6273 -0.0065 0.0255  0.0029  116 THR H O   
972  C CB  . THR A 128 ? 0.5644 0.5514 0.5239 -0.0186 0.0340  0.0035  116 THR H CB  
973  O OG1 . THR A 128 ? 0.6979 0.7126 0.6692 -0.0287 0.0305  -0.0058 116 THR H OG1 
974  C CG2 . THR A 128 ? 0.5611 0.5248 0.4899 -0.0212 0.0302  0.0103  116 THR H CG2 
975  N N   . LYS A 129 ? 0.6301 0.6477 0.6244 -0.0138 0.0250  -0.0124 117 LYS H N   
976  C CA  . LYS A 129 ? 0.6086 0.6351 0.6051 -0.0159 0.0180  -0.0169 117 LYS H CA  
977  C C   . LYS A 129 ? 0.5736 0.6307 0.5788 -0.0272 0.0155  -0.0236 117 LYS H C   
978  O O   . LYS A 129 ? 0.5753 0.6536 0.5978 -0.0281 0.0188  -0.0300 117 LYS H O   
979  C CB  . LYS A 129 ? 0.5713 0.6016 0.5853 -0.0055 0.0170  -0.0226 117 LYS H CB  
980  C CG  . LYS A 129 ? 0.6076 0.6499 0.6269 -0.0067 0.0094  -0.0279 117 LYS H CG  
981  C CD  . LYS A 129 ? 0.7131 0.7525 0.7443 0.0049  0.0076  -0.0334 117 LYS H CD  
982  C CE  . LYS A 129 ? 0.8510 0.8844 0.8773 0.0056  -0.0011 -0.0342 117 LYS H CE  
983  N NZ  . LYS A 129 ? 0.9143 0.9681 0.9404 -0.0063 -0.0064 -0.0342 117 LYS H NZ  
984  N N   . GLY A 130 ? 0.5543 0.6123 0.5462 -0.0364 0.0096  -0.0215 118 GLY H N   
985  C CA  . GLY A 130 ? 0.6138 0.7013 0.6130 -0.0484 0.0075  -0.0271 118 GLY H CA  
986  C C   . GLY A 130 ? 0.5908 0.7076 0.6156 -0.0455 0.0052  -0.0358 118 GLY H C   
987  O O   . GLY A 130 ? 0.5417 0.6524 0.5721 -0.0368 0.0016  -0.0363 118 GLY H O   
988  N N   . PRO A 131 ? 0.6140 0.7618 0.6533 -0.0523 0.0073  -0.0427 119 PRO H N   
989  C CA  . PRO A 131 ? 0.5556 0.7333 0.6199 -0.0476 0.0067  -0.0512 119 PRO H CA  
990  C C   . PRO A 131 ? 0.5909 0.7809 0.6571 -0.0527 -0.0011 -0.0502 119 PRO H C   
991  O O   . PRO A 131 ? 0.6709 0.8513 0.7188 -0.0636 -0.0058 -0.0436 119 PRO H O   
992  C CB  . PRO A 131 ? 0.5749 0.7777 0.6481 -0.0551 0.0120  -0.0571 119 PRO H CB  
993  C CG  . PRO A 131 ? 0.6011 0.7874 0.6526 -0.0661 0.0137  -0.0519 119 PRO H CG  
994  C CD  . PRO A 131 ? 0.6804 0.8356 0.7096 -0.0658 0.0093  -0.0425 119 PRO H CD  
995  N N   . SER A 132 ? 0.6051 0.8152 0.6919 -0.0447 -0.0033 -0.0564 120 SER H N   
996  C CA  . SER A 132 ? 0.6094 0.8422 0.7051 -0.0506 -0.0101 -0.0567 120 SER H CA  
997  C C   . SER A 132 ? 0.5431 0.8157 0.6583 -0.0550 -0.0050 -0.0638 120 SER H C   
998  O O   . SER A 132 ? 0.6881 0.9716 0.8169 -0.0456 0.0012  -0.0708 120 SER H O   
999  C CB  . SER A 132 ? 0.6410 0.8720 0.7479 -0.0380 -0.0161 -0.0593 120 SER H CB  
1000 O OG  . SER A 132 ? 0.7045 0.8953 0.7930 -0.0319 -0.0190 -0.0538 120 SER H OG  
1001 N N   . VAL A 133 ? 0.4933 0.7862 0.6082 -0.0694 -0.0075 -0.0614 121 VAL H N   
1002 C CA  . VAL A 133 ? 0.4871 0.8177 0.6193 -0.0746 -0.0016 -0.0676 121 VAL H CA  
1003 C C   . VAL A 133 ? 0.6050 0.9702 0.7603 -0.0732 -0.0062 -0.0698 121 VAL H C   
1004 O O   . VAL A 133 ? 0.6556 1.0260 0.8077 -0.0835 -0.0144 -0.0638 121 VAL H O   
1005 C CB  . VAL A 133 ? 0.4729 0.8040 0.5883 -0.0932 0.0001  -0.0640 121 VAL H CB  
1006 C CG1 . VAL A 133 ? 0.4302 0.7973 0.5616 -0.0985 0.0078  -0.0708 121 VAL H CG1 
1007 C CG2 . VAL A 133 ? 0.4661 0.7607 0.5576 -0.0935 0.0032  -0.0610 121 VAL H CG2 
1008 N N   . PHE A 134 ? 0.6146 1.0028 0.7922 -0.0599 -0.0014 -0.0780 122 PHE H N   
1009 C CA  . PHE A 134 ? 0.5152 0.9396 0.7173 -0.0563 -0.0047 -0.0808 122 PHE H CA  
1010 C C   . PHE A 134 ? 0.5002 0.9648 0.7197 -0.0596 0.0044  -0.0860 122 PHE H C   
1011 O O   . PHE A 134 ? 0.4762 0.9387 0.6932 -0.0560 0.0138  -0.0910 122 PHE H O   
1012 C CB  . PHE A 134 ? 0.4746 0.8935 0.6874 -0.0361 -0.0072 -0.0862 122 PHE H CB  
1013 C CG  . PHE A 134 ? 0.4592 0.8375 0.6550 -0.0316 -0.0151 -0.0818 122 PHE H CG  
1014 C CD1 . PHE A 134 ? 0.5004 0.8490 0.6864 -0.0192 -0.0121 -0.0847 122 PHE H CD1 
1015 C CD2 . PHE A 134 ? 0.5002 0.8682 0.6883 -0.0400 -0.0257 -0.0742 122 PHE H CD2 
1016 C CE1 . PHE A 134 ? 0.5495 0.8601 0.7194 -0.0148 -0.0183 -0.0805 122 PHE H CE1 
1017 C CE2 . PHE A 134 ? 0.4858 0.8126 0.6555 -0.0352 -0.0324 -0.0698 122 PHE H CE2 
1018 C CZ  . PHE A 134 ? 0.5183 0.8171 0.6795 -0.0224 -0.0280 -0.0732 122 PHE H CZ  
1019 N N   . PRO A 135 ? 0.5958 1.0970 0.8331 -0.0665 0.0015  -0.0845 123 PRO H N   
1020 C CA  . PRO A 135 ? 0.5174 1.0586 0.7718 -0.0698 0.0113  -0.0890 123 PRO H CA  
1021 C C   . PRO A 135 ? 0.4976 1.0569 0.7713 -0.0488 0.0178  -0.0978 123 PRO H C   
1022 O O   . PRO A 135 ? 0.4671 1.0203 0.7476 -0.0336 0.0121  -0.1001 123 PRO H O   
1023 C CB  . PRO A 135 ? 0.4531 1.0272 0.7222 -0.0823 0.0044  -0.0832 123 PRO H CB  
1024 C CG  . PRO A 135 ? 0.4484 1.0102 0.7221 -0.0719 -0.0076 -0.0811 123 PRO H CG  
1025 C CD  . PRO A 135 ? 0.5287 1.0378 0.7732 -0.0706 -0.0107 -0.0786 123 PRO H CD  
1026 N N   . LEU A 136 ? 0.3966 0.9741 0.6754 -0.0477 0.0296  -0.1029 124 LEU H N   
1027 C CA  . LEU A 136 ? 0.3951 0.9962 0.6918 -0.0292 0.0366  -0.1104 124 LEU H CA  
1028 C C   . LEU A 136 ? 0.4723 1.1232 0.7912 -0.0364 0.0424  -0.1100 124 LEU H C   
1029 O O   . LEU A 136 ? 0.4646 1.1269 0.7810 -0.0441 0.0529  -0.1116 124 LEU H O   
1030 C CB  . LEU A 136 ? 0.3956 0.9743 0.6779 -0.0207 0.0460  -0.1159 124 LEU H CB  
1031 C CG  . LEU A 136 ? 0.3953 0.9290 0.6592 -0.0122 0.0405  -0.1160 124 LEU H CG  
1032 C CD1 . LEU A 136 ? 0.4039 0.9143 0.6522 -0.0079 0.0484  -0.1196 124 LEU H CD1 
1033 C CD2 . LEU A 136 ? 0.5245 1.0593 0.7985 0.0066  0.0342  -0.1194 124 LEU H CD2 
1034 N N   . ALA A 137 ? 0.3953 1.0752 0.7357 -0.0345 0.0352  -0.1075 125 ALA H N   
1035 C CA  . ALA A 137 ? 0.4441 1.1736 0.8077 -0.0442 0.0388  -0.1048 125 ALA H CA  
1036 C C   . ALA A 137 ? 0.4509 1.2134 0.8315 -0.0303 0.0528  -0.1116 125 ALA H C   
1037 O O   . ALA A 137 ? 0.4533 1.2186 0.8422 -0.0077 0.0541  -0.1175 125 ALA H O   
1038 C CB  . ALA A 137 ? 0.3962 1.1472 0.7794 -0.0454 0.0259  -0.0995 125 ALA H CB  
1039 N N   . PRO A 138 ? 0.3979 1.1835 0.7810 -0.0435 0.0635  -0.1107 126 PRO H N   
1040 C CA  . PRO A 138 ? 0.4102 1.2305 0.8097 -0.0320 0.0780  -0.1158 126 PRO H CA  
1041 C C   . PRO A 138 ? 0.4347 1.3015 0.8681 -0.0209 0.0749  -0.1148 126 PRO H C   
1042 O O   . PRO A 138 ? 0.4267 1.3104 0.8733 -0.0329 0.0637  -0.1079 126 PRO H O   
1043 C CB  . PRO A 138 ? 0.4399 1.2768 0.8362 -0.0550 0.0864  -0.1126 126 PRO H CB  
1044 C CG  . PRO A 138 ? 0.5222 1.3530 0.9129 -0.0778 0.0727  -0.1041 126 PRO H CG  
1045 C CD  . PRO A 138 ? 0.5631 1.3444 0.9330 -0.0706 0.0619  -0.1045 126 PRO H CD  
1046 N N   . SER A 139 ? 0.4027 1.2877 0.8483 0.0022  0.0836  -0.1210 127 SER H N   
1047 C CA  . SER A 139 ? 0.4026 1.3321 0.8805 0.0159  0.0811  -0.1208 127 SER H CA  
1048 C C   . SER A 139 ? 0.4095 1.3648 0.8971 0.0360  0.0972  -0.1268 127 SER H C   
1049 O O   . SER A 139 ? 0.4419 1.3786 0.9100 0.0368  0.1094  -0.1304 127 SER H O   
1050 C CB  . SER A 139 ? 0.4010 1.3077 0.8775 0.0308  0.0661  -0.1228 127 SER H CB  
1051 O OG  . SER A 139 ? 0.5481 1.4399 1.0167 0.0577  0.0707  -0.1314 127 SER H OG  
1052 N N   . SER A 140 ? 0.4111 1.4077 0.9274 0.0528  0.0973  -0.1277 128 SER H N   
1053 C CA  . SER A 140 ? 0.4203 1.4400 0.9436 0.0750  0.1129  -0.1332 128 SER H CA  
1054 C C   . SER A 140 ? 0.4668 1.4373 0.9593 0.0961  0.1139  -0.1413 128 SER H C   
1055 O O   . SER A 140 ? 0.5452 1.5170 1.0300 0.1135  0.1270  -0.1460 128 SER H O   
1056 C CB  . SER A 140 ? 0.4213 1.4945 0.9814 0.0909  0.1117  -0.1325 128 SER H CB  
1057 O OG  . SER A 140 ? 0.7368 1.7903 1.2925 0.1140  0.1010  -0.1381 128 SER H OG  
1058 N N   . LYS A 141 ? 0.4744 1.4004 0.9479 0.0943  0.0998  -0.1422 129 LYS H N   
1059 C CA  . LYS A 141 ? 0.5072 1.3850 0.9510 0.1122  0.0984  -0.1489 129 LYS H CA  
1060 C C   . LYS A 141 ? 0.5753 1.4070 0.9874 0.0988  0.1020  -0.1486 129 LYS H C   
1061 O O   . LYS A 141 ? 0.5663 1.3552 0.9522 0.1100  0.1003  -0.1528 129 LYS H O   
1062 C CB  . LYS A 141 ? 0.4426 1.2997 0.8847 0.1220  0.0815  -0.1508 129 LYS H CB  
1063 C CG  . LYS A 141 ? 0.4570 1.3468 0.9202 0.1459  0.0795  -0.1549 129 LYS H CG  
1064 C CD  . LYS A 141 ? 0.5397 1.4051 0.9981 0.1562  0.0625  -0.1580 129 LYS H CD  
1065 C CE  . LYS A 141 ? 0.5520 1.4563 1.0359 0.1775  0.0591  -0.1614 129 LYS H CE  
1066 N NZ  . LYS A 141 ? 0.4937 1.4105 0.9730 0.2031  0.0716  -0.1677 129 LYS H NZ  
1067 N N   . SER A 142 ? 0.5086 1.0773 0.8282 -0.0865 0.0175  -0.0452 130 SER H N   
1068 C CA  . SER A 142 ? 0.5934 1.1260 0.8850 -0.0790 0.0250  -0.0439 130 SER H CA  
1069 C C   . SER A 142 ? 0.5981 1.1359 0.8905 -0.0676 0.0470  -0.0298 130 SER H C   
1070 O O   . SER A 142 ? 0.6065 1.1213 0.8871 -0.0686 0.0588  -0.0253 130 SER H O   
1071 C CB  . SER A 142 ? 0.6394 1.1484 0.9312 -0.1012 0.0240  -0.0490 130 SER H CB  
1072 O OG  . SER A 142 ? 0.6399 1.1670 0.9624 -0.1250 0.0280  -0.0473 130 SER H OG  
1073 N N   . THR A 143 ? 0.6207 1.1895 0.9271 -0.0556 0.0534  -0.0219 131 THR H N   
1074 C CA  . THR A 143 ? 0.7076 1.2869 1.0182 -0.0435 0.0760  -0.0063 131 THR H CA  
1075 C C   . THR A 143 ? 0.8018 1.3820 1.0868 -0.0106 0.0774  -0.0032 131 THR H C   
1076 O O   . THR A 143 ? 0.8182 1.4138 1.1040 -0.0018 0.0654  -0.0080 131 THR H O   
1077 C CB  . THR A 143 ? 0.6875 1.3077 1.0442 -0.0600 0.0865  0.0049  131 THR H CB  
1078 O OG1 . THR A 143 ? 0.7654 1.3801 1.1423 -0.0916 0.0821  0.0003  131 THR H OG1 
1079 C CG2 . THR A 143 ? 0.6404 1.2718 1.0040 -0.0480 0.1121  0.0236  131 THR H CG2 
1080 N N   . SER A 144 ? 0.8298 1.3907 1.0892 0.0084  0.0918  0.0047  132 SER H N   
1081 C CA  . SER A 144 ? 0.8697 1.4276 1.1004 0.0415  0.0958  0.0090  132 SER H CA  
1082 C C   . SER A 144 ? 0.8792 1.4427 1.1099 0.0544  0.1228  0.0264  132 SER H C   
1083 O O   . SER A 144 ? 0.8867 1.4288 1.1083 0.0496  0.1327  0.0302  132 SER H O   
1084 C CB  . SER A 144 ? 0.9278 1.4441 1.1119 0.0568  0.0795  -0.0025 132 SER H CB  
1085 O OG  . SER A 144 ? 0.9440 1.4540 1.0971 0.0881  0.0789  -0.0010 132 SER H OG  
1086 N N   . GLY A 145 ? 0.8754 1.4682 1.1167 0.0717  0.1359  0.0385  133 GLY H N   
1087 C CA  . GLY A 145 ? 0.8109 1.4152 1.0583 0.0835  0.1638  0.0579  133 GLY H CA  
1088 C C   . GLY A 145 ? 0.7611 1.3755 1.0461 0.0529  0.1748  0.0652  133 GLY H C   
1089 O O   . GLY A 145 ? 0.7892 1.4288 1.1148 0.0256  0.1678  0.0635  133 GLY H O   
1090 N N   . GLY A 146 ? 0.7120 1.3042 0.9814 0.0572  0.1908  0.0730  134 GLY H N   
1091 C CA  . GLY A 146 ? 0.7242 1.3218 1.0260 0.0301  0.2034  0.0814  134 GLY H CA  
1092 C C   . GLY A 146 ? 0.7952 1.3628 1.0924 0.0046  0.1890  0.0669  134 GLY H C   
1093 O O   . GLY A 146 ? 0.8352 1.4046 1.1589 -0.0203 0.1970  0.0719  134 GLY H O   
1094 N N   . THR A 147 ? 0.8112 1.3505 1.0750 0.0107  0.1681  0.0499  137 THR H N   
1095 C CA  . THR A 147 ? 0.8169 1.3260 1.0724 -0.0090 0.1564  0.0381  137 THR H CA  
1096 C C   . THR A 147 ? 0.7719 1.2857 1.0400 -0.0282 0.1323  0.0221  137 THR H C   
1097 O O   . THR A 147 ? 0.8023 1.3277 1.0655 -0.0179 0.1178  0.0150  137 THR H O   
1098 C CB  . THR A 147 ? 0.8292 1.2983 1.0374 0.0106  0.1520  0.0332  137 THR H CB  
1099 O OG1 . THR A 147 ? 0.8583 1.3222 1.0415 0.0288  0.1330  0.0230  137 THR H OG1 
1100 C CG2 . THR A 147 ? 0.7606 1.2210 0.9510 0.0311  0.1755  0.0486  137 THR H CG2 
1101 N N   . ALA A 148 ? 0.6496 1.1520 0.9312 -0.0549 0.1286  0.0168  138 ALA H N   
1102 C CA  . ALA A 148 ? 0.5564 1.0599 0.8476 -0.0735 0.1074  0.0023  138 ALA H CA  
1103 C C   . ALA A 148 ? 0.5728 1.0379 0.8380 -0.0778 0.0981  -0.0076 138 ALA H C   
1104 O O   . ALA A 148 ? 0.6249 1.0662 0.8788 -0.0793 0.1103  -0.0024 138 ALA H O   
1105 C CB  . ALA A 148 ? 0.5005 1.0259 0.8321 -0.1027 0.1094  0.0044  138 ALA H CB  
1106 N N   . ALA A 149 ? 0.4895 0.9497 0.7464 -0.0792 0.0771  -0.0204 139 ALA H N   
1107 C CA  . ALA A 149 ? 0.4945 0.9225 0.7308 -0.0836 0.0674  -0.0285 139 ALA H CA  
1108 C C   . ALA A 149 ? 0.5263 0.9519 0.7792 -0.1099 0.0603  -0.0364 139 ALA H C   
1109 O O   . ALA A 149 ? 0.6430 1.0912 0.9153 -0.1200 0.0496  -0.0421 139 ALA H O   
1110 C CB  . ALA A 149 ? 0.4981 0.9185 0.7116 -0.0662 0.0490  -0.0358 139 ALA H CB  
1111 N N   . LEU A 150 ? 0.4311 0.8279 0.6742 -0.1197 0.0663  -0.0365 140 LEU H N   
1112 C CA  . LEU A 150 ? 0.4392 0.8240 0.6877 -0.1412 0.0590  -0.0450 140 LEU H CA  
1113 C C   . LEU A 150 ? 0.4827 0.8325 0.7044 -0.1360 0.0567  -0.0475 140 LEU H C   
1114 O O   . LEU A 150 ? 0.5376 0.8746 0.7411 -0.1192 0.0619  -0.0414 140 LEU H O   
1115 C CB  . LEU A 150 ? 0.5129 0.8971 0.7806 -0.1623 0.0724  -0.0404 140 LEU H CB  
1116 C CG  . LEU A 150 ? 0.5938 0.9566 0.8518 -0.1586 0.0933  -0.0294 140 LEU H CG  
1117 C CD1 . LEU A 150 ? 0.5841 0.9086 0.8249 -0.1690 0.0958  -0.0333 140 LEU H CD1 
1118 C CD2 . LEU A 150 ? 0.6842 1.0661 0.9697 -0.1702 0.1083  -0.0191 140 LEU H CD2 
1119 N N   . GLY A 151 ? 0.5494 0.8839 0.7680 -0.1495 0.0489  -0.0555 141 GLY H N   
1120 C CA  . GLY A 151 ? 0.5744 0.8773 0.7697 -0.1439 0.0492  -0.0553 141 GLY H CA  
1121 C C   . GLY A 151 ? 0.5431 0.8302 0.7336 -0.1569 0.0408  -0.0641 141 GLY H C   
1122 O O   . GLY A 151 ? 0.5566 0.8537 0.7606 -0.1730 0.0348  -0.0714 141 GLY H O   
1123 N N   . CYS A 152 ? 0.5295 0.7919 0.7001 -0.1490 0.0403  -0.0626 142 CYS H N   
1124 C CA  . CYS A 152 ? 0.5708 0.8147 0.7317 -0.1568 0.0341  -0.0693 142 CYS H CA  
1125 C C   . CYS A 152 ? 0.6479 0.8935 0.8003 -0.1430 0.0206  -0.0693 142 CYS H C   
1126 O O   . CYS A 152 ? 0.6648 0.9088 0.8102 -0.1274 0.0206  -0.0613 142 CYS H O   
1127 C CB  . CYS A 152 ? 0.5527 0.7605 0.6967 -0.1610 0.0498  -0.0650 142 CYS H CB  
1128 S SG  . CYS A 152 ? 1.4615 1.6601 1.6146 -0.1816 0.0640  -0.0657 142 CYS H SG  
1129 N N   . LEU A 153 ? 0.6394 0.8881 0.7927 -0.1491 0.0085  -0.0777 143 LEU H N   
1130 C CA  . LEU A 153 ? 0.5732 0.8200 0.7187 -0.1379 -0.0027 -0.0765 143 LEU H CA  
1131 C C   . LEU A 153 ? 0.5973 0.8121 0.7244 -0.1396 0.0055  -0.0747 143 LEU H C   
1132 O O   . LEU A 153 ? 0.5644 0.7650 0.6854 -0.1527 0.0079  -0.0824 143 LEU H O   
1133 C CB  . LEU A 153 ? 0.5062 0.7755 0.6624 -0.1417 -0.0199 -0.0857 143 LEU H CB  
1134 C CG  . LEU A 153 ? 0.5444 0.8131 0.6950 -0.1324 -0.0320 -0.0849 143 LEU H CG  
1135 C CD1 . LEU A 153 ? 0.4418 0.7121 0.5908 -0.1159 -0.0350 -0.0742 143 LEU H CD1 
1136 C CD2 . LEU A 153 ? 0.4937 0.7867 0.6560 -0.1363 -0.0479 -0.0940 143 LEU H CD2 
1137 N N   . VAL A 154 ? 0.5639 0.7660 0.6810 -0.1258 0.0099  -0.0639 144 VAL H N   
1138 C CA  . VAL A 154 ? 0.5654 0.7375 0.6641 -0.1231 0.0199  -0.0590 144 VAL H CA  
1139 C C   . VAL A 154 ? 0.5774 0.7544 0.6748 -0.1130 0.0087  -0.0556 144 VAL H C   
1140 O O   . VAL A 154 ? 0.5960 0.7814 0.6982 -0.1001 0.0041  -0.0448 144 VAL H O   
1141 C CB  . VAL A 154 ? 0.5605 0.7154 0.6506 -0.1142 0.0355  -0.0463 144 VAL H CB  
1142 C CG1 . VAL A 154 ? 0.5831 0.7052 0.6529 -0.1107 0.0485  -0.0408 144 VAL H CG1 
1143 C CG2 . VAL A 154 ? 0.5095 0.6636 0.6037 -0.1229 0.0463  -0.0482 144 VAL H CG2 
1144 N N   . LYS A 155 ? 0.5666 0.7384 0.6578 -0.1192 0.0035  -0.0641 145 LYS H N   
1145 C CA  . LYS A 155 ? 0.5943 0.7781 0.6888 -0.1112 -0.0094 -0.0624 145 LYS H CA  
1146 C C   . LYS A 155 ? 0.6027 0.7629 0.6790 -0.1030 -0.0023 -0.0557 145 LYS H C   
1147 O O   . LYS A 155 ? 0.5375 0.6696 0.5935 -0.1080 0.0084  -0.0604 145 LYS H O   
1148 C CB  . LYS A 155 ? 0.6124 0.8160 0.7162 -0.1212 -0.0240 -0.0763 145 LYS H CB  
1149 C CG  . LYS A 155 ? 0.6208 0.8430 0.7328 -0.1125 -0.0390 -0.0740 145 LYS H CG  
1150 C CD  . LYS A 155 ? 0.6470 0.8965 0.7740 -0.1194 -0.0540 -0.0849 145 LYS H CD  
1151 C CE  . LYS A 155 ? 0.6951 0.9639 0.8329 -0.1085 -0.0684 -0.0796 145 LYS H CE  
1152 N NZ  . LYS A 155 ? 0.6975 0.9548 0.8256 -0.1013 -0.0687 -0.0738 145 LYS H NZ  
1153 N N   . ASP A 156 ? 0.5696 0.7409 0.6532 -0.0897 -0.0086 -0.0439 146 ASP H N   
1154 C CA  . ASP A 156 ? 0.5367 0.6935 0.6079 -0.0792 -0.0036 -0.0350 146 ASP H CA  
1155 C C   . ASP A 156 ? 0.5764 0.7015 0.6272 -0.0726 0.0169  -0.0256 146 ASP H C   
1156 O O   . ASP A 156 ? 0.6971 0.7946 0.7239 -0.0743 0.0263  -0.0314 146 ASP H O   
1157 C CB  . ASP A 156 ? 0.5911 0.7453 0.6525 -0.0847 -0.0105 -0.0475 146 ASP H CB  
1158 C CG  . ASP A 156 ? 0.6773 0.8635 0.7589 -0.0888 -0.0301 -0.0546 146 ASP H CG  
1159 O OD1 . ASP A 156 ? 0.6593 0.8669 0.7602 -0.0823 -0.0388 -0.0458 146 ASP H OD1 
1160 O OD2 . ASP A 156 ? 0.8009 0.9898 0.8782 -0.0983 -0.0375 -0.0688 146 ASP H OD2 
1161 N N   . TYR A 157 ? 0.5222 0.6497 0.5808 -0.0640 0.0231  -0.0108 147 TYR H N   
1162 C CA  . TYR A 157 ? 0.5274 0.6274 0.5687 -0.0553 0.0430  0.0008  147 TYR H CA  
1163 C C   . TYR A 157 ? 0.5470 0.6575 0.6001 -0.0385 0.0444  0.0238  147 TYR H C   
1164 O O   . TYR A 157 ? 0.5222 0.6608 0.5986 -0.0361 0.0288  0.0302  147 TYR H O   
1165 C CB  . TYR A 157 ? 0.4102 0.4979 0.4467 -0.0627 0.0533  -0.0031 147 TYR H CB  
1166 C CG  . TYR A 157 ? 0.5134 0.6249 0.5707 -0.0608 0.0461  0.0036  147 TYR H CG  
1167 C CD1 . TYR A 157 ? 0.5449 0.6784 0.6166 -0.0708 0.0325  -0.0081 147 TYR H CD1 
1168 C CD2 . TYR A 157 ? 0.4590 0.5697 0.5195 -0.0482 0.0529  0.0219  147 TYR H CD2 
1169 C CE1 . TYR A 157 ? 0.5123 0.6631 0.5974 -0.0672 0.0262  -0.0026 147 TYR H CE1 
1170 C CE2 . TYR A 157 ? 0.5345 0.6634 0.6096 -0.0461 0.0449  0.0271  147 TYR H CE2 
1171 C CZ  . TYR A 157 ? 0.5152 0.6625 0.6007 -0.0552 0.0316  0.0143  147 TYR H CZ  
1172 O OH  . TYR A 157 ? 0.5219 0.6836 0.6170 -0.0511 0.0237  0.0192  147 TYR H OH  
1173 N N   . PHE A 158 ? 0.5482 0.6351 0.5847 -0.0269 0.0626  0.0367  148 PHE H N   
1174 C CA  . PHE A 158 ? 0.4792 0.5760 0.5280 -0.0106 0.0663  0.0613  148 PHE H CA  
1175 C C   . PHE A 158 ? 0.5729 0.6392 0.6000 0.0001  0.0905  0.0727  148 PHE H C   
1176 O O   . PHE A 158 ? 0.6441 0.6789 0.6424 0.0003  0.1039  0.0646  148 PHE H O   
1177 C CB  . PHE A 158 ? 0.4117 0.5217 0.4688 -0.0019 0.0595  0.0703  148 PHE H CB  
1178 C CG  . PHE A 158 ? 0.4815 0.6068 0.5575 0.0137  0.0615  0.0981  148 PHE H CG  
1179 C CD1 . PHE A 158 ? 0.4638 0.6198 0.5706 0.0123  0.0435  0.1076  148 PHE H CD1 
1180 C CD2 . PHE A 158 ? 0.5083 0.6162 0.5707 0.0299  0.0814  0.1155  148 PHE H CD2 
1181 C CE1 . PHE A 158 ? 0.3899 0.5615 0.5173 0.0248  0.0432  0.1345  148 PHE H CE1 
1182 C CE2 . PHE A 158 ? 0.4937 0.6193 0.5775 0.0441  0.0834  0.1435  148 PHE H CE2 
1183 C CZ  . PHE A 158 ? 0.4340 0.5927 0.5522 0.0404  0.0635  0.1533  148 PHE H CZ  
1184 N N   . PRO A 159 ? 0.5647 0.6386 0.6036 0.0093  0.0957  0.0914  149 PRO H N   
1185 C CA  . PRO A 159 ? 0.5129 0.6198 0.5820 0.0092  0.0783  0.1009  149 PRO H CA  
1186 C C   . PRO A 159 ? 0.5119 0.6170 0.5795 -0.0012 0.0763  0.0892  149 PRO H C   
1187 O O   . PRO A 159 ? 0.5304 0.6148 0.5795 -0.0110 0.0850  0.0725  149 PRO H O   
1188 C CB  . PRO A 159 ? 0.4964 0.6046 0.5720 0.0263  0.0895  0.1286  149 PRO H CB  
1189 C CG  . PRO A 159 ? 0.4892 0.5609 0.5347 0.0303  0.1148  0.1268  149 PRO H CG  
1190 C CD  . PRO A 159 ? 0.5838 0.6305 0.6036 0.0205  0.1192  0.1038  149 PRO H CD  
1191 N N   . GLU A 160 ? 0.5053 0.6316 0.5920 0.0010  0.0643  0.0986  150 GLU H N   
1192 C CA  . GLU A 160 ? 0.5164 0.6397 0.5996 -0.0037 0.0657  0.0931  150 GLU H CA  
1193 C C   . GLU A 160 ? 0.5955 0.6941 0.6619 0.0048  0.0894  0.1042  150 GLU H C   
1194 O O   . GLU A 160 ? 0.7230 0.8133 0.7858 0.0170  0.1012  0.1207  150 GLU H O   
1195 C CB  . GLU A 160 ? 0.4561 0.6054 0.5603 -0.0007 0.0454  0.1022  150 GLU H CB  
1196 C CG  . GLU A 160 ? 0.5568 0.7274 0.6751 -0.0086 0.0218  0.0906  150 GLU H CG  
1197 C CD  . GLU A 160 ? 0.8339 1.0084 0.9490 -0.0161 0.0139  0.0759  150 GLU H CD  
1198 O OE1 . GLU A 160 ? 0.8689 1.0336 0.9725 -0.0254 0.0226  0.0588  150 GLU H OE1 
1199 O OE2 . GLU A 160 ? 0.8770 1.0638 1.0007 -0.0120 -0.0011 0.0826  150 GLU H OE2 
1200 N N   . PRO A 161 ? 0.5205 0.6071 0.5764 -0.0005 0.0975  0.0966  151 PRO H N   
1201 C CA  . PRO A 161 ? 0.4974 0.5930 0.5565 -0.0128 0.0874  0.0794  151 PRO H CA  
1202 C C   . PRO A 161 ? 0.6107 0.6861 0.6545 -0.0262 0.0981  0.0605  151 PRO H C   
1203 O O   . PRO A 161 ? 0.6447 0.6941 0.6713 -0.0260 0.1135  0.0599  151 PRO H O   
1204 C CB  . PRO A 161 ? 0.4463 0.5374 0.5012 -0.0070 0.0954  0.0882  151 PRO H CB  
1205 C CG  . PRO A 161 ? 0.4401 0.5081 0.4818 0.0047  0.1174  0.1048  151 PRO H CG  
1206 C CD  . PRO A 161 ? 0.5176 0.5798 0.5572 0.0078  0.1202  0.1075  151 PRO H CD  
1207 N N   . VAL A 162 ? 0.5985 0.6850 0.6480 -0.0376 0.0897  0.0459  152 VAL H N   
1208 C CA  . VAL A 162 ? 0.5849 0.6560 0.6248 -0.0522 0.0986  0.0299  152 VAL H CA  
1209 C C   . VAL A 162 ? 0.6641 0.7385 0.7059 -0.0543 0.1035  0.0296  152 VAL H C   
1210 O O   . VAL A 162 ? 0.7974 0.8938 0.8503 -0.0490 0.0913  0.0327  152 VAL H O   
1211 C CB  . VAL A 162 ? 0.6445 0.7320 0.6938 -0.0640 0.0825  0.0136  152 VAL H CB  
1212 C CG1 . VAL A 162 ? 0.6671 0.7672 0.7247 -0.0755 0.0789  0.0018  152 VAL H CG1 
1213 C CG2 . VAL A 162 ? 0.7009 0.7663 0.7355 -0.0705 0.0886  0.0055  152 VAL H CG2 
1214 N N   . THR A 163 ? 0.6029 0.6538 0.6325 -0.0610 0.1215  0.0267  153 THR H N   
1215 C CA  . THR A 163 ? 0.6537 0.7091 0.6862 -0.0630 0.1274  0.0270  153 THR H CA  
1216 C C   . THR A 163 ? 0.6310 0.6913 0.6705 -0.0806 0.1263  0.0116  153 THR H C   
1217 O O   . THR A 163 ? 0.6441 0.6898 0.6787 -0.0932 0.1286  0.0018  153 THR H O   
1218 C CB  . THR A 163 ? 0.7456 0.7749 0.7630 -0.0562 0.1491  0.0388  153 THR H CB  
1219 O OG1 . THR A 163 ? 0.8718 0.8689 0.8741 -0.0654 0.1639  0.0336  153 THR H OG1 
1220 C CG2 . THR A 163 ? 0.6814 0.7116 0.6958 -0.0377 0.1487  0.0563  153 THR H CG2 
1221 N N   . VAL A 164 ? 0.6222 0.7034 0.6727 -0.0808 0.1219  0.0102  154 VAL H N   
1222 C CA  . VAL A 164 ? 0.5850 0.6770 0.6468 -0.0962 0.1214  -0.0012 154 VAL H CA  
1223 C C   . VAL A 164 ? 0.6217 0.7133 0.6844 -0.0950 0.1355  0.0048  154 VAL H C   
1224 O O   . VAL A 164 ? 0.6295 0.7330 0.6915 -0.0812 0.1336  0.0124  154 VAL H O   
1225 C CB  . VAL A 164 ? 0.5765 0.7011 0.6540 -0.0968 0.1009  -0.0094 154 VAL H CB  
1226 C CG1 . VAL A 164 ? 0.5515 0.6908 0.6429 -0.1100 0.1027  -0.0173 154 VAL H CG1 
1227 C CG2 . VAL A 164 ? 0.6422 0.7689 0.7207 -0.0998 0.0871  -0.0163 154 VAL H CG2 
1228 N N   . SER A 165 ? 0.6839 0.7604 0.7473 -0.1095 0.1492  0.0017  156 SER H N   
1229 C CA  . SER A 165 ? 0.7391 0.8186 0.8074 -0.1102 0.1630  0.0078  156 SER H CA  
1230 C C   . SER A 165 ? 0.8065 0.9017 0.8945 -0.1290 0.1610  -0.0012 156 SER H C   
1231 O O   . SER A 165 ? 0.7729 0.8677 0.8665 -0.1436 0.1515  -0.0122 156 SER H O   
1232 C CB  . SER A 165 ? 0.7936 0.8391 0.8462 -0.1092 0.1847  0.0172  156 SER H CB  
1233 O OG  . SER A 165 ? 0.9230 0.9440 0.9726 -0.1276 0.1910  0.0101  156 SER H OG  
1234 N N   . TRP A 166 ? 0.8537 0.9639 0.9525 -0.1279 0.1697  0.0046  157 TRP H N   
1235 C CA  . TRP A 166 ? 0.8213 0.9505 0.9432 -0.1449 0.1694  -0.0003 157 TRP H CA  
1236 C C   . TRP A 166 ? 0.8602 0.9725 0.9860 -0.1560 0.1903  0.0075  157 TRP H C   
1237 O O   . TRP A 166 ? 0.8531 0.9569 0.9700 -0.1436 0.2059  0.0195  157 TRP H O   
1238 C CB  . TRP A 166 ? 0.7596 0.9259 0.8948 -0.1343 0.1613  0.0007  157 TRP H CB  
1239 C CG  . TRP A 166 ? 0.7136 0.8969 0.8503 -0.1304 0.1391  -0.0092 157 TRP H CG  
1240 C CD1 . TRP A 166 ? 0.6149 0.7977 0.7372 -0.1134 0.1276  -0.0088 157 TRP H CD1 
1241 C CD2 . TRP A 166 ? 0.6857 0.8885 0.8400 -0.1446 0.1249  -0.0203 157 TRP H CD2 
1242 N NE1 . TRP A 166 ? 0.5818 0.7819 0.7116 -0.1159 0.1081  -0.0188 157 TRP H NE1 
1243 C CE2 . TRP A 166 ? 0.5941 0.8069 0.7426 -0.1342 0.1064  -0.0263 157 TRP H CE2 
1244 C CE3 . TRP A 166 ? 0.6959 0.9094 0.8713 -0.1656 0.1252  -0.0250 157 TRP H CE3 
1245 C CZ2 . TRP A 166 ? 0.5328 0.7651 0.6941 -0.1426 0.0897  -0.0369 157 TRP H CZ2 
1246 C CZ3 . TRP A 166 ? 0.6871 0.9213 0.8756 -0.1742 0.1074  -0.0357 157 TRP H CZ3 
1247 C CH2 . TRP A 166 ? 0.6051 0.8480 0.7855 -0.1620 0.0905  -0.0417 157 TRP H CH2 
1248 N N   . ASN A 167 ? 0.8477 0.9539 0.9864 -0.1797 0.1895  0.0009  162 ASN H N   
1249 C CA  . ASN A 167 ? 0.8967 0.9833 1.0410 -0.1947 0.2072  0.0075  162 ASN H CA  
1250 C C   . ASN A 167 ? 0.9669 1.0162 1.0855 -0.1839 0.2249  0.0166  162 ASN H C   
1251 O O   . ASN A 167 ? 0.9447 0.9914 1.0646 -0.1778 0.2427  0.0293  162 ASN H O   
1252 C CB  . ASN A 167 ? 0.8853 1.0034 1.0564 -0.1966 0.2157  0.0170  162 ASN H CB  
1253 C CG  . ASN A 167 ? 0.9354 1.0882 1.1355 -0.2116 0.2005  0.0096  162 ASN H CG  
1254 O OD1 . ASN A 167 ? 0.9985 1.1431 1.2028 -0.2309 0.1881  -0.0017 162 ASN H OD1 
1255 N ND2 . ASN A 167 ? 0.9308 1.1218 1.1493 -0.2015 0.2013  0.0162  162 ASN H ND2 
1256 N N   . SER A 168 ? 1.0184 1.0401 1.1135 -0.1799 0.2202  0.0109  163 SER H N   
1257 C CA  . SER A 168 ? 0.9855 0.9685 1.0544 -0.1703 0.2361  0.0188  163 SER H CA  
1258 C C   . SER A 168 ? 0.9666 0.9574 1.0298 -0.1481 0.2485  0.0336  163 SER H C   
1259 O O   . SER A 168 ? 1.0301 0.9959 1.0819 -0.1445 0.2677  0.0440  163 SER H O   
1260 C CB  . SER A 168 ? 0.9724 0.9199 1.0379 -0.1903 0.2496  0.0189  163 SER H CB  
1261 O OG  . SER A 168 ? 1.0058 0.9498 1.0788 -0.2126 0.2353  0.0048  163 SER H OG  
1262 N N   . GLY A 169 ? 0.8700 0.8937 0.9392 -0.1329 0.2367  0.0343  164 GLY H N   
1263 C CA  . GLY A 169 ? 0.8349 0.8655 0.8955 -0.1109 0.2449  0.0470  164 GLY H CA  
1264 C C   . GLY A 169 ? 0.8861 0.9400 0.9621 -0.1094 0.2534  0.0538  164 GLY H C   
1265 O O   . GLY A 169 ? 0.9798 1.0471 1.0488 -0.0896 0.2541  0.0613  164 GLY H O   
1266 N N   . ALA A 170 ? 0.8554 0.9142 0.9520 -0.1296 0.2594  0.0519  165 ALA H N   
1267 C CA  . ALA A 170 ? 0.8353 0.9169 0.9491 -0.1278 0.2710  0.0616  165 ALA H CA  
1268 C C   . ALA A 170 ? 0.9039 1.0228 1.0240 -0.1127 0.2581  0.0599  165 ALA H C   
1269 O O   . ALA A 170 ? 0.9448 1.0748 1.0599 -0.0948 0.2673  0.0703  165 ALA H O   
1270 C CB  . ALA A 170 ? 0.7291 0.8136 0.8694 -0.1547 0.2765  0.0605  165 ALA H CB  
1271 N N   . LEU A 171 ? 0.8890 1.1232 1.0114 -0.1602 0.1866  0.1081  166 LEU H N   
1272 C CA  . LEU A 171 ? 0.8126 1.0831 0.9424 -0.1376 0.1851  0.1029  166 LEU H CA  
1273 C C   . LEU A 171 ? 0.8509 1.1001 0.9426 -0.1139 0.1776  0.0821  166 LEU H C   
1274 O O   . LEU A 171 ? 0.9386 1.1590 1.0156 -0.1229 0.1613  0.0656  166 LEU H O   
1275 C CB  . LEU A 171 ? 0.7581 1.0489 0.9186 -0.1545 0.1680  0.0980  166 LEU H CB  
1276 C CG  . LEU A 171 ? 0.6983 1.0210 0.8605 -0.1331 0.1618  0.0892  166 LEU H CG  
1277 C CD1 . LEU A 171 ? 0.5681 0.9358 0.7424 -0.1105 0.1801  0.1081  166 LEU H CD1 
1278 C CD2 . LEU A 171 ? 0.7351 1.0696 0.9228 -0.1518 0.1445  0.0817  166 LEU H CD2 
1279 N N   . THR A 172 ? 0.8518 1.1152 0.9287 -0.0822 0.1887  0.0840  167 THR H N   
1280 C CA  . THR A 172 ? 0.8757 1.1185 0.9192 -0.0585 0.1802  0.0650  167 THR H CA  
1281 C C   . THR A 172 ? 0.8549 1.1259 0.8961 -0.0270 0.1770  0.0625  167 THR H C   
1282 O O   . THR A 172 ? 0.8495 1.1073 0.8721 -0.0127 0.1619  0.0451  167 THR H O   
1283 C CB  . THR A 172 ? 0.8864 1.1019 0.8991 -0.0439 0.1934  0.0645  167 THR H CB  
1284 O OG1 . THR A 172 ? 0.9279 1.1661 0.9438 -0.0225 0.2147  0.0821  167 THR H OG1 
1285 C CG2 . THR A 172 ? 0.8406 1.0227 0.8451 -0.0713 0.1948  0.0657  167 THR H CG2 
1286 N N   . SER A 173 ? 0.8142 1.1231 0.8729 -0.0147 0.1905  0.0811  168 SER H N   
1287 C CA  . SER A 173 ? 0.8461 1.1819 0.8967 0.0205  0.1871  0.0809  168 SER H CA  
1288 C C   . SER A 173 ? 0.7711 1.1248 0.8344 0.0119  0.1683  0.0721  168 SER H C   
1289 O O   . SER A 173 ? 0.7318 1.1023 0.8245 -0.0156 0.1676  0.0782  168 SER H O   
1290 C CB  . SER A 173 ? 0.9401 1.3136 1.0029 0.0410  0.2098  0.1069  168 SER H CB  
1291 O OG  . SER A 173 ? 1.0265 1.3804 1.0699 0.0575  0.2276  0.1131  168 SER H OG  
1292 N N   . GLY A 174 ? 0.7418 1.0896 0.7816 0.0365  0.1518  0.0567  169 GLY H N   
1293 C CA  . GLY A 174 ? 0.7212 1.0817 0.7651 0.0326  0.1335  0.0464  169 GLY H CA  
1294 C C   . GLY A 174 ? 0.7104 1.0370 0.7528 0.0062  0.1173  0.0274  169 GLY H C   
1295 O O   . GLY A 174 ? 0.7509 1.0786 0.7907 0.0046  0.1010  0.0153  169 GLY H O   
1296 N N   . VAL A 175 ? 0.6380 0.9340 0.6790 -0.0118 0.1224  0.0254  171 VAL H N   
1297 C CA  . VAL A 175 ? 0.6374 0.9014 0.6760 -0.0345 0.1095  0.0110  171 VAL H CA  
1298 C C   . VAL A 175 ? 0.7256 0.9667 0.7414 -0.0189 0.0933  -0.0060 171 VAL H C   
1299 O O   . VAL A 175 ? 0.7979 1.0272 0.7956 0.0018  0.0943  -0.0087 171 VAL H O   
1300 C CB  . VAL A 175 ? 0.6134 0.8510 0.6505 -0.0535 0.1190  0.0150  171 VAL H CB  
1301 C CG1 . VAL A 175 ? 0.6517 0.8591 0.6848 -0.0731 0.1056  0.0026  171 VAL H CG1 
1302 C CG2 . VAL A 175 ? 0.6038 0.8590 0.6645 -0.0710 0.1331  0.0328  171 VAL H CG2 
1303 N N   . HIS A 176 ? 0.6883 0.9222 0.7058 -0.0282 0.0778  -0.0174 172 HIS H N   
1304 C CA  . HIS A 176 ? 0.6647 0.8733 0.6663 -0.0207 0.0616  -0.0320 172 HIS H CA  
1305 C C   . HIS A 176 ? 0.6759 0.8615 0.6834 -0.0451 0.0565  -0.0378 172 HIS H C   
1306 O O   . HIS A 176 ? 0.7703 0.9607 0.7869 -0.0564 0.0512  -0.0408 172 HIS H O   
1307 C CB  . HIS A 176 ? 0.6724 0.8919 0.6650 -0.0029 0.0462  -0.0397 172 HIS H CB  
1308 C CG  . HIS A 176 ? 0.7118 0.9455 0.6889 0.0297  0.0453  -0.0364 172 HIS H CG  
1309 N ND1 . HIS A 176 ? 0.7719 0.9921 0.7369 0.0471  0.0480  -0.0362 172 HIS H ND1 
1310 C CD2 . HIS A 176 ? 0.7533 1.0125 0.7216 0.0521  0.0409  -0.0335 172 HIS H CD2 
1311 C CE1 . HIS A 176 ? 0.8506 1.0856 0.8003 0.0801  0.0451  -0.0330 172 HIS H CE1 
1312 N NE2 . HIS A 176 ? 0.7845 1.0439 0.7349 0.0842  0.0407  -0.0304 172 HIS H NE2 
1313 N N   . THR A 177 ? 0.6315 0.7928 0.6322 -0.0505 0.0583  -0.0391 173 THR H N   
1314 C CA  . THR A 177 ? 0.6347 0.7738 0.6371 -0.0682 0.0534  -0.0427 173 THR H CA  
1315 C C   . THR A 177 ? 0.6766 0.7999 0.6725 -0.0607 0.0397  -0.0520 173 THR H C   
1316 O O   . THR A 177 ? 0.7471 0.8628 0.7353 -0.0495 0.0378  -0.0543 173 THR H O   
1317 C CB  . THR A 177 ? 0.6181 0.7410 0.6150 -0.0794 0.0637  -0.0361 173 THR H CB  
1318 O OG1 . THR A 177 ? 0.6572 0.7911 0.6633 -0.0905 0.0737  -0.0266 173 THR H OG1 
1319 C CG2 . THR A 177 ? 0.5552 0.6550 0.5489 -0.0910 0.0574  -0.0386 173 THR H CG2 
1320 N N   . PHE A 178 ? 0.6338 0.7516 0.6337 -0.0661 0.0298  -0.0574 174 PHE H N   
1321 C CA  . PHE A 178 ? 0.6371 0.7411 0.6339 -0.0596 0.0160  -0.0646 174 PHE H CA  
1322 C C   . PHE A 178 ? 0.6474 0.7313 0.6466 -0.0687 0.0163  -0.0620 174 PHE H C   
1323 O O   . PHE A 178 ? 0.7133 0.7908 0.7127 -0.0800 0.0249  -0.0560 174 PHE H O   
1324 C CB  . PHE A 178 ? 0.6423 0.7478 0.6389 -0.0585 0.0056  -0.0713 174 PHE H CB  
1325 C CG  . PHE A 178 ? 0.5685 0.6961 0.5590 -0.0452 0.0030  -0.0739 174 PHE H CG  
1326 C CD1 . PHE A 178 ? 0.5652 0.6924 0.5432 -0.0266 -0.0112 -0.0802 174 PHE H CD1 
1327 C CD2 . PHE A 178 ? 0.5161 0.6655 0.5135 -0.0501 0.0137  -0.0689 174 PHE H CD2 
1328 C CE1 . PHE A 178 ? 0.6009 0.7499 0.5685 -0.0101 -0.0138 -0.0811 174 PHE H CE1 
1329 C CE2 . PHE A 178 ? 0.5190 0.6943 0.5122 -0.0363 0.0128  -0.0686 174 PHE H CE2 
1330 C CZ  . PHE A 178 ? 0.5671 0.7429 0.5431 -0.0148 -0.0003 -0.0744 174 PHE H CZ  
1331 N N   . PRO A 179 ? 0.5978 0.6720 0.5986 -0.0625 0.0055  -0.0656 175 PRO H N   
1332 C CA  . PRO A 179 ? 0.5837 0.6436 0.5907 -0.0700 0.0048  -0.0614 175 PRO H CA  
1333 C C   . PRO A 179 ? 0.6298 0.6814 0.6416 -0.0797 0.0049  -0.0581 175 PRO H C   
1334 O O   . PRO A 179 ? 0.6883 0.7399 0.7003 -0.0777 -0.0024 -0.0637 175 PRO H O   
1335 C CB  . PRO A 179 ? 0.4920 0.5461 0.5051 -0.0610 -0.0116 -0.0672 175 PRO H CB  
1336 C CG  . PRO A 179 ? 0.5225 0.5855 0.5254 -0.0446 -0.0164 -0.0740 175 PRO H CG  
1337 C CD  . PRO A 179 ? 0.5917 0.6684 0.5883 -0.0458 -0.0081 -0.0730 175 PRO H CD  
1338 N N   . ALA A 180 ? 0.6002 0.6434 0.6121 -0.0869 0.0127  -0.0495 176 ALA H N   
1339 C CA  . ALA A 180 ? 0.5085 0.5415 0.5225 -0.0909 0.0133  -0.0455 176 ALA H CA  
1340 C C   . ALA A 180 ? 0.5036 0.5306 0.5286 -0.0892 0.0027  -0.0472 176 ALA H C   
1341 O O   . ALA A 180 ? 0.5191 0.5464 0.5536 -0.0881 -0.0048 -0.0471 176 ALA H O   
1342 C CB  . ALA A 180 ? 0.5375 0.5619 0.5466 -0.0934 0.0215  -0.0339 176 ALA H CB  
1343 N N   . VAL A 181 ? 0.5537 0.5734 0.5770 -0.0885 0.0009  -0.0497 177 VAL H N   
1344 C CA  . VAL A 181 ? 0.6175 0.6261 0.6494 -0.0879 -0.0069 -0.0484 177 VAL H CA  
1345 C C   . VAL A 181 ? 0.6223 0.6194 0.6556 -0.0877 0.0021  -0.0373 177 VAL H C   
1346 O O   . VAL A 181 ? 0.6629 0.6568 0.6851 -0.0848 0.0098  -0.0365 177 VAL H O   
1347 C CB  . VAL A 181 ? 0.6850 0.6906 0.7081 -0.0829 -0.0169 -0.0610 177 VAL H CB  
1348 C CG1 . VAL A 181 ? 0.6961 0.7096 0.7162 -0.0781 -0.0291 -0.0695 177 VAL H CG1 
1349 C CG2 . VAL A 181 ? 0.7119 0.7213 0.7218 -0.0800 -0.0103 -0.0677 177 VAL H CG2 
1350 N N   . LEU A 182 ? 0.6295 0.6199 0.6774 -0.0893 -0.0001 -0.0276 178 LEU H N   
1351 C CA  . LEU A 182 ? 0.5837 0.5645 0.6340 -0.0853 0.0094  -0.0138 178 LEU H CA  
1352 C C   . LEU A 182 ? 0.6819 0.6480 0.7238 -0.0790 0.0078  -0.0206 178 LEU H C   
1353 O O   . LEU A 182 ? 0.7338 0.6947 0.7786 -0.0812 -0.0027 -0.0283 178 LEU H O   
1354 C CB  . LEU A 182 ? 0.5358 0.5199 0.6099 -0.0904 0.0085  0.0016  178 LEU H CB  
1355 C CG  . LEU A 182 ? 0.5756 0.5587 0.6558 -0.0849 0.0211  0.0229  178 LEU H CG  
1356 C CD1 . LEU A 182 ? 0.5921 0.5781 0.6516 -0.0776 0.0308  0.0269  178 LEU H CD1 
1357 C CD2 . LEU A 182 ? 0.5100 0.5042 0.6199 -0.0934 0.0174  0.0361  178 LEU H CD2 
1358 N N   . GLN A 183 ? 0.6951 0.6517 0.7231 -0.0690 0.0167  -0.0188 179 GLN H N   
1359 C CA  . GLN A 183 ? 0.6559 0.5966 0.6724 -0.0594 0.0166  -0.0266 179 GLN H CA  
1360 C C   . GLN A 183 ? 0.6960 0.6233 0.7218 -0.0532 0.0235  -0.0100 179 GLN H C   
1361 O O   . GLN A 183 ? 0.6953 0.6297 0.7405 -0.0586 0.0268  0.0077  179 GLN H O   
1362 C CB  . GLN A 183 ? 0.6554 0.5911 0.6525 -0.0493 0.0204  -0.0355 179 GLN H CB  
1363 C CG  . GLN A 183 ? 0.7729 0.7235 0.7646 -0.0564 0.0133  -0.0521 179 GLN H CG  
1364 C CD  . GLN A 183 ? 0.8994 0.8497 0.8815 -0.0525 0.0158  -0.0555 179 GLN H CD  
1365 O OE1 . GLN A 183 ? 0.9564 0.9105 0.9317 -0.0509 0.0116  -0.0699 179 GLN H OE1 
1366 N NE2 . GLN A 183 ? 0.9444 0.8897 0.9251 -0.0504 0.0212  -0.0419 179 GLN H NE2 
1367 N N   . SER A 184 ? 0.7708 0.6799 0.7836 -0.0410 0.0264  -0.0149 180 SER H N   
1368 C CA  . SER A 184 ? 0.7821 0.6777 0.8039 -0.0334 0.0351  0.0029  180 SER H CA  
1369 C C   . SER A 184 ? 0.7284 0.6220 0.7470 -0.0178 0.0490  0.0214  180 SER H C   
1370 O O   . SER A 184 ? 0.7592 0.6532 0.7934 -0.0138 0.0584  0.0447  180 SER H O   
1371 C CB  . SER A 184 ? 0.8338 0.7073 0.8382 -0.0226 0.0344  -0.0090 180 SER H CB  
1372 O OG  . SER A 184 ? 0.8822 0.7515 0.8977 -0.0354 0.0242  -0.0104 180 SER H OG  
1373 N N   . SER A 185 ? 0.6399 0.5316 0.6380 -0.0081 0.0491  0.0118  182 SER H N   
1374 C CA  . SER A 185 ? 0.6413 0.5273 0.6281 0.0101  0.0579  0.0267  182 SER H CA  
1375 C C   . SER A 185 ? 0.6501 0.5550 0.6516 0.0014  0.0612  0.0466  182 SER H C   
1376 O O   . SER A 185 ? 0.6274 0.5294 0.6190 0.0181  0.0689  0.0641  182 SER H O   
1377 C CB  . SER A 185 ? 0.6953 0.5735 0.6583 0.0183  0.0517  0.0094  182 SER H CB  
1378 O OG  . SER A 185 ? 0.7096 0.6052 0.6785 -0.0026 0.0427  -0.0031 182 SER H OG  
1379 N N   . GLY A 186 ? 0.5565 0.4797 0.5782 -0.0216 0.0544  0.0432  183 GLY H N   
1380 C CA  . GLY A 186 ? 0.4977 0.4398 0.5325 -0.0300 0.0563  0.0581  183 GLY H CA  
1381 C C   . GLY A 186 ? 0.5975 0.5438 0.6132 -0.0317 0.0527  0.0489  183 GLY H C   
1382 O O   . GLY A 186 ? 0.5225 0.4812 0.5391 -0.0348 0.0548  0.0592  183 GLY H O   
1383 N N   . LEU A 187 ? 0.5984 0.5340 0.5962 -0.0294 0.0472  0.0300  184 LEU H N   
1384 C CA  . LEU A 187 ? 0.6063 0.5446 0.5893 -0.0340 0.0428  0.0209  184 LEU H CA  
1385 C C   . LEU A 187 ? 0.6063 0.5597 0.6007 -0.0529 0.0357  0.0050  184 LEU H C   
1386 O O   . LEU A 187 ? 0.5761 0.5325 0.5824 -0.0585 0.0313  -0.0036 184 LEU H O   
1387 C CB  . LEU A 187 ? 0.5480 0.4671 0.5086 -0.0202 0.0397  0.0114  184 LEU H CB  
1388 C CG  . LEU A 187 ? 0.6198 0.5197 0.5626 0.0052  0.0449  0.0264  184 LEU H CG  
1389 C CD1 . LEU A 187 ? 0.5976 0.4756 0.5197 0.0201  0.0378  0.0130  184 LEU H CD1 
1390 C CD2 . LEU A 187 ? 0.4855 0.3888 0.4166 0.0103  0.0482  0.0446  184 LEU H CD2 
1391 N N   . TYR A 188 ? 0.6145 0.5754 0.6019 -0.0601 0.0344  0.0017  185 TYR H N   
1392 C CA  . TYR A 188 ? 0.6166 0.5919 0.6117 -0.0732 0.0292  -0.0118 185 TYR H CA  
1393 C C   . TYR A 188 ? 0.6889 0.6636 0.6768 -0.0747 0.0252  -0.0265 185 TYR H C   
1394 O O   . TYR A 188 ? 0.7161 0.6790 0.6913 -0.0689 0.0249  -0.0271 185 TYR H O   
1395 C CB  . TYR A 188 ? 0.5231 0.5080 0.5151 -0.0792 0.0317  -0.0074 185 TYR H CB  
1396 C CG  . TYR A 188 ? 0.5365 0.5293 0.5407 -0.0803 0.0336  0.0035  185 TYR H CG  
1397 C CD1 . TYR A 188 ? 0.5432 0.5335 0.5383 -0.0734 0.0400  0.0193  185 TYR H CD1 
1398 C CD2 . TYR A 188 ? 0.4741 0.4772 0.4980 -0.0868 0.0274  -0.0017 185 TYR H CD2 
1399 C CE1 . TYR A 188 ? 0.6108 0.6129 0.6205 -0.0748 0.0418  0.0300  185 TYR H CE1 
1400 C CE2 . TYR A 188 ? 0.5119 0.5228 0.5514 -0.0889 0.0268  0.0077  185 TYR H CE2 
1401 C CZ  . TYR A 188 ? 0.5900 0.6026 0.6245 -0.0838 0.0349  0.0237  185 TYR H CZ  
1402 O OH  . TYR A 188 ? 0.4944 0.5193 0.5478 -0.0862 0.0343  0.0336  185 TYR H OH  
1403 N N   . SER A 189 ? 0.6881 0.6764 0.6844 -0.0812 0.0205  -0.0378 186 SER H N   
1404 C CA  . SER A 189 ? 0.6583 0.6547 0.6520 -0.0837 0.0174  -0.0499 186 SER H CA  
1405 C C   . SER A 189 ? 0.6556 0.6716 0.6554 -0.0901 0.0163  -0.0536 186 SER H C   
1406 O O   . SER A 189 ? 0.6000 0.6202 0.6055 -0.0898 0.0133  -0.0530 186 SER H O   
1407 C CB  . SER A 189 ? 0.6947 0.6877 0.6872 -0.0774 0.0125  -0.0609 186 SER H CB  
1408 O OG  . SER A 189 ? 0.8263 0.8211 0.8149 -0.0764 0.0107  -0.0696 186 SER H OG  
1409 N N   . LEU A 190 ? 0.6140 0.6413 0.6134 -0.0946 0.0180  -0.0568 187 LEU H N   
1410 C CA  . LEU A 190 ? 0.6593 0.7052 0.6624 -0.0971 0.0198  -0.0577 187 LEU H CA  
1411 C C   . LEU A 190 ? 0.7060 0.7683 0.7135 -0.1001 0.0206  -0.0621 187 LEU H C   
1412 O O   . LEU A 190 ? 0.6785 0.7349 0.6871 -0.1044 0.0205  -0.0621 187 LEU H O   
1413 C CB  . LEU A 190 ? 0.6343 0.6758 0.6325 -0.1005 0.0266  -0.0485 187 LEU H CB  
1414 C CG  . LEU A 190 ? 0.6319 0.6854 0.6284 -0.1034 0.0333  -0.0460 187 LEU H CG  
1415 C CD1 . LEU A 190 ? 0.6764 0.7172 0.6610 -0.1046 0.0390  -0.0382 187 LEU H CD1 
1416 C CD2 . LEU A 190 ? 0.6145 0.6757 0.6153 -0.1104 0.0357  -0.0456 187 LEU H CD2 
1417 N N   . SER A 191 ? 0.7557 0.8393 0.7665 -0.0963 0.0202  -0.0651 188 SER H N   
1418 C CA  . SER A 191 ? 0.7065 0.8117 0.7254 -0.0991 0.0227  -0.0658 188 SER H CA  
1419 C C   . SER A 191 ? 0.6890 0.8137 0.7110 -0.0972 0.0303  -0.0590 188 SER H C   
1420 O O   . SER A 191 ? 0.7371 0.8624 0.7520 -0.0873 0.0296  -0.0590 188 SER H O   
1421 C CB  . SER A 191 ? 0.6725 0.7899 0.6904 -0.0916 0.0153  -0.0762 188 SER H CB  
1422 O OG  . SER A 191 ? 0.7048 0.8265 0.7133 -0.0795 0.0096  -0.0800 188 SER H OG  
1423 N N   . SER A 192 ? 0.6224 0.7613 0.6557 -0.1057 0.0369  -0.0526 189 SER H N   
1424 C CA  . SER A 192 ? 0.6143 0.7728 0.6519 -0.1032 0.0471  -0.0434 189 SER H CA  
1425 C C   . SER A 192 ? 0.6268 0.8192 0.6797 -0.1018 0.0494  -0.0406 189 SER H C   
1426 O O   . SER A 192 ? 0.5963 0.7949 0.6641 -0.1135 0.0472  -0.0408 189 SER H O   
1427 C CB  . SER A 192 ? 0.5596 0.7045 0.5980 -0.1160 0.0555  -0.0338 189 SER H CB  
1428 O OG  . SER A 192 ? 0.5958 0.7592 0.6384 -0.1126 0.0675  -0.0238 189 SER H OG  
1429 N N   . VAL A 193 ? 0.6123 0.8274 0.6613 -0.0853 0.0527  -0.0376 190 VAL H N   
1430 C CA  . VAL A 193 ? 0.5731 0.8262 0.6360 -0.0808 0.0565  -0.0318 190 VAL H CA  
1431 C C   . VAL A 193 ? 0.6280 0.9037 0.6973 -0.0734 0.0715  -0.0157 190 VAL H C   
1432 O O   . VAL A 193 ? 0.6720 0.9350 0.7268 -0.0621 0.0766  -0.0132 190 VAL H O   
1433 C CB  . VAL A 193 ? 0.5434 0.8096 0.5917 -0.0610 0.0459  -0.0414 190 VAL H CB  
1434 C CG1 . VAL A 193 ? 0.5684 0.8148 0.6108 -0.0672 0.0332  -0.0564 190 VAL H CG1 
1435 C CG2 . VAL A 193 ? 0.5471 0.8029 0.5728 -0.0392 0.0422  -0.0432 190 VAL H CG2 
1436 N N   . VAL A 194 ? 0.4736 0.7838 0.5658 -0.0784 0.0790  -0.0044 191 VAL H N   
1437 C CA  . VAL A 194 ? 0.5565 0.8941 0.6567 -0.0680 0.0950  0.0137  191 VAL H CA  
1438 C C   . VAL A 194 ? 0.5683 0.9522 0.6776 -0.0529 0.0956  0.0198  191 VAL H C   
1439 O O   . VAL A 194 ? 0.5150 0.9112 0.6333 -0.0600 0.0860  0.0118  191 VAL H O   
1440 C CB  . VAL A 194 ? 0.7358 1.0693 0.8586 -0.0918 0.1078  0.0284  191 VAL H CB  
1441 C CG1 . VAL A 194 ? 0.7123 1.0528 0.8638 -0.1175 0.1010  0.0280  191 VAL H CG1 
1442 C CG2 . VAL A 194 ? 0.7109 1.0735 0.8434 -0.0802 0.1273  0.0497  191 VAL H CG2 
1443 N N   . THR A 195 ? 0.5679 0.9766 0.6704 -0.0277 0.1062  0.0331  192 THR H N   
1444 C CA  . THR A 195 ? 0.6027 1.0605 0.7137 -0.0111 0.1094  0.0437  192 THR H CA  
1445 C C   . THR A 195 ? 0.6288 1.1202 0.7709 -0.0164 0.1315  0.0706  192 THR H C   
1446 O O   . THR A 195 ? 0.6489 1.1279 0.7866 -0.0108 0.1452  0.0813  192 THR H O   
1447 C CB  . THR A 195 ? 0.6244 1.0875 0.6982 0.0297  0.1012  0.0389  192 THR H CB  
1448 O OG1 . THR A 195 ? 0.7423 1.1817 0.7961 0.0479  0.1067  0.0415  192 THR H OG1 
1449 C CG2 . THR A 195 ? 0.4925 0.9302 0.5410 0.0322  0.0780  0.0142  192 THR H CG2 
1450 N N   . VAL A 196 ? 0.6394 1.1730 0.8143 -0.0280 0.1349  0.0816  193 VAL H N   
1451 C CA  . VAL A 196 ? 0.6188 1.1865 0.8335 -0.0405 0.1549  0.1091  193 VAL H CA  
1452 C C   . VAL A 196 ? 0.6419 1.2728 0.8755 -0.0255 0.1598  0.1244  193 VAL H C   
1453 O O   . VAL A 196 ? 0.6448 1.2880 0.8631 -0.0137 0.1449  0.1096  193 VAL H O   
1454 C CB  . VAL A 196 ? 0.6215 1.1718 0.8710 -0.0838 0.1514  0.1079  193 VAL H CB  
1455 C CG1 . VAL A 196 ? 0.6465 1.1355 0.8722 -0.0960 0.1452  0.0927  193 VAL H CG1 
1456 C CG2 . VAL A 196 ? 0.6279 1.1904 0.8919 -0.0973 0.1339  0.0927  193 VAL H CG2 
1457 N N   . PRO A 197 ? 0.5984 1.2705 0.8642 -0.0247 0.1814  0.1552  194 PRO H N   
1458 C CA  . PRO A 197 ? 0.6317 1.3717 0.9226 -0.0120 0.1886  0.1747  194 PRO H CA  
1459 C C   . PRO A 197 ? 0.7166 1.4755 1.0422 -0.0425 0.1746  0.1648  194 PRO H C   
1460 O O   . PRO A 197 ? 0.7313 1.4729 1.0923 -0.0812 0.1720  0.1642  194 PRO H O   
1461 C CB  . PRO A 197 ? 0.6094 1.3797 0.9379 -0.0168 0.2159  0.2111  194 PRO H CB  
1462 C CG  . PRO A 197 ? 0.5714 1.2884 0.8740 -0.0142 0.2236  0.2082  194 PRO H CG  
1463 C CD  . PRO A 197 ? 0.5647 1.2222 0.8445 -0.0350 0.2011  0.1744  194 PRO H CD  
1464 N N   . SER A 198 ? 0.7178 1.5087 1.0296 -0.0229 0.1639  0.1557  195 SER H N   
1465 C CA  . SER A 198 ? 0.6762 1.4921 1.0194 -0.0454 0.1517  0.1463  195 SER H CA  
1466 C C   . SER A 198 ? 0.6807 1.5357 1.0924 -0.0765 0.1649  0.1735  195 SER H C   
1467 O O   . SER A 198 ? 0.7314 1.5761 1.1782 -0.1116 0.1534  0.1641  195 SER H O   
1468 C CB  . SER A 198 ? 0.7014 1.5637 1.0219 -0.0124 0.1459  0.1431  195 SER H CB  
1469 O OG  . SER A 198 ? 0.7603 1.5810 1.0216 0.0082  0.1271  0.1128  195 SER H OG  
1470 N N   . SER A 199 ? 0.6488 1.5475 1.0794 -0.0620 0.1884  0.2080  196 SER H N   
1471 C CA  . SER A 199 ? 0.5978 1.5409 1.0975 -0.0896 0.2036  0.2397  196 SER H CA  
1472 C C   . SER A 199 ? 0.6060 1.5019 1.1378 -0.1364 0.1969  0.2346  196 SER H C   
1473 O O   . SER A 199 ? 0.6477 1.5676 1.2382 -0.1697 0.1935  0.2452  196 SER H O   
1474 C CB  . SER A 199 ? 0.5234 1.5006 1.0285 -0.0649 0.2329  0.2776  196 SER H CB  
1475 O OG  . SER A 199 ? 0.5334 1.4544 1.0179 -0.0687 0.2413  0.2776  196 SER H OG  
1476 N N   . SER A 200 ? 0.4902 1.3187 0.9823 -0.1371 0.1934  0.2184  197 SER H N   
1477 C CA  . SER A 200 ? 0.5351 1.3131 1.0450 -0.1745 0.1886  0.2159  197 SER H CA  
1478 C C   . SER A 200 ? 0.5906 1.3283 1.1002 -0.1996 0.1601  0.1842  197 SER H C   
1479 O O   . SER A 200 ? 0.6242 1.3214 1.1498 -0.2303 0.1516  0.1816  197 SER H O   
1480 C CB  . SER A 200 ? 0.6400 1.3644 1.1021 -0.1605 0.1971  0.2114  197 SER H CB  
1481 O OG  . SER A 200 ? 0.6496 1.3291 1.0599 -0.1469 0.1789  0.1774  197 SER H OG  
1482 N N   . LEU A 201 ? 0.5966 1.3420 1.0838 -0.1836 0.1449  0.1602  198 LEU H N   
1483 C CA  . LEU A 201 ? 0.6124 1.3133 1.0883 -0.1989 0.1192  0.1279  198 LEU H CA  
1484 C C   . LEU A 201 ? 0.6911 1.3907 1.2208 -0.2365 0.1061  0.1301  198 LEU H C   
1485 O O   . LEU A 201 ? 0.7871 1.4312 1.3081 -0.2538 0.0891  0.1124  198 LEU H O   
1486 C CB  . LEU A 201 ? 0.5533 1.2676 0.9984 -0.1744 0.1068  0.1036  198 LEU H CB  
1487 C CG  . LEU A 201 ? 0.5661 1.2419 0.9463 -0.1458 0.1049  0.0856  198 LEU H CG  
1488 C CD1 . LEU A 201 ? 0.5901 1.2677 0.9399 -0.1275 0.0888  0.0588  198 LEU H CD1 
1489 C CD2 . LEU A 201 ? 0.5021 1.1091 0.8622 -0.1603 0.0992  0.0741  198 LEU H CD2 
1490 N N   . GLY A 202 ? 0.7207 1.4812 1.3061 -0.2476 0.1127  0.1525  199 GLY H N   
1491 C CA  . GLY A 202 ? 0.7752 1.5377 1.4170 -0.2833 0.0968  0.1543  199 GLY H CA  
1492 C C   . GLY A 202 ? 0.8232 1.5552 1.4920 -0.3132 0.1008  0.1747  199 GLY H C   
1493 O O   . GLY A 202 ? 0.8712 1.5711 1.5662 -0.3420 0.0800  0.1674  199 GLY H O   
1494 N N   . THR A 203 ? 0.7912 1.5296 1.4497 -0.3040 0.1266  0.1996  200 THR H N   
1495 C CA  . THR A 203 ? 0.7760 1.4938 1.4618 -0.3308 0.1349  0.2240  200 THR H CA  
1496 C C   . THR A 203 ? 0.7718 1.4146 1.4033 -0.3287 0.1340  0.2118  200 THR H C   
1497 O O   . THR A 203 ? 0.7627 1.3626 1.4046 -0.3557 0.1249  0.2158  200 THR H O   
1498 C CB  . THR A 203 ? 0.7916 1.5701 1.5112 -0.3243 0.1668  0.2652  200 THR H CB  
1499 O OG1 . THR A 203 ? 0.8561 1.5976 1.5449 -0.3186 0.1857  0.2780  200 THR H OG1 
1500 C CG2 . THR A 203 ? 0.7725 1.6090 1.4748 -0.2854 0.1805  0.2674  200 THR H CG2 
1501 N N   . GLN A 204 ? 0.8026 1.4291 1.3754 -0.2962 0.1418  0.1972  203 GLN H N   
1502 C CA  . GLN A 204 ? 0.8199 1.3807 1.3405 -0.2913 0.1417  0.1852  203 GLN H CA  
1503 C C   . GLN A 204 ? 0.8234 1.3291 1.3122 -0.2956 0.1143  0.1515  203 GLN H C   
1504 O O   . GLN A 204 ? 0.8034 1.3167 1.2760 -0.2799 0.1032  0.1299  203 GLN H O   
1505 C CB  . GLN A 204 ? 0.9002 1.4680 1.3757 -0.2542 0.1621  0.1865  203 GLN H CB  
1506 C CG  . GLN A 204 ? 0.9916 1.5447 1.4563 -0.2511 0.1852  0.2081  203 GLN H CG  
1507 C CD  . GLN A 204 ? 1.0388 1.5202 1.4617 -0.2589 0.1763  0.1917  203 GLN H CD  
1508 O OE1 . GLN A 204 ? 1.0322 1.4766 1.4556 -0.2808 0.1533  0.1758  203 GLN H OE1 
1509 N NE2 . GLN A 204 ? 1.0893 1.5505 1.4731 -0.2379 0.1936  0.1950  203 GLN H NE2 
1510 N N   . THR A 205 ? 0.8385 1.2874 1.3151 -0.3144 0.1037  0.1480  205 THR H N   
1511 C CA  . THR A 205 ? 0.8748 1.2676 1.3172 -0.3151 0.0791  0.1196  205 THR H CA  
1512 C C   . THR A 205 ? 0.8003 1.1627 1.1817 -0.2885 0.0861  0.1046  205 THR H C   
1513 O O   . THR A 205 ? 0.8008 1.1531 1.1601 -0.2806 0.1042  0.1158  205 THR H O   
1514 C CB  . THR A 205 ? 0.9395 1.2815 1.3876 -0.3424 0.0627  0.1230  205 THR H CB  
1515 O OG1 . THR A 205 ? 0.9650 1.2953 1.4353 -0.3554 0.0338  0.1077  205 THR H OG1 
1516 C CG2 . THR A 205 ? 0.9755 1.2558 1.3635 -0.3327 0.0615  0.1124  205 THR H CG2 
1517 N N   . TYR A 206 ? 0.7188 1.0671 1.0744 -0.2740 0.0722  0.0796  206 TYR H N   
1518 C CA  . TYR A 206 ? 0.6988 1.0193 1.0024 -0.2510 0.0767  0.0661  206 TYR H CA  
1519 C C   . TYR A 206 ? 0.6987 0.9627 0.9700 -0.2519 0.0576  0.0462  206 TYR H C   
1520 O O   . TYR A 206 ? 0.6397 0.8962 0.9124 -0.2504 0.0403  0.0294  206 TYR H O   
1521 C CB  . TYR A 206 ? 0.6083 0.9645 0.9014 -0.2254 0.0828  0.0581  206 TYR H CB  
1522 C CG  . TYR A 206 ? 0.5962 1.0017 0.9054 -0.2144 0.1043  0.0791  206 TYR H CG  
1523 C CD1 . TYR A 206 ? 0.6592 1.0571 0.9494 -0.2038 0.1225  0.0920  206 TYR H CD1 
1524 C CD2 . TYR A 206 ? 0.6354 1.0961 0.9771 -0.2114 0.1066  0.0867  206 TYR H CD2 
1525 C CE1 . TYR A 206 ? 0.7389 1.1811 1.0415 -0.1885 0.1430  0.1127  206 TYR H CE1 
1526 C CE2 . TYR A 206 ? 0.6671 1.1757 1.0221 -0.1971 0.1271  0.1090  206 TYR H CE2 
1527 C CZ  . TYR A 206 ? 0.7062 1.2044 1.0414 -0.1848 0.1454  0.1224  206 TYR H CZ  
1528 O OH  . TYR A 206 ? 0.6716 1.2159 1.0173 -0.1655 0.1662  0.1455  206 TYR H OH  
1529 N N   . ILE A 207 ? 0.7493 0.9740 0.9888 -0.2514 0.0617  0.0487  207 ILE H N   
1530 C CA  . ILE A 207 ? 0.8090 0.9817 1.0146 -0.2492 0.0457  0.0340  207 ILE H CA  
1531 C C   . ILE A 207 ? 0.7915 0.9460 0.9543 -0.2297 0.0549  0.0276  207 ILE H C   
1532 O O   . ILE A 207 ? 0.7776 0.9382 0.9297 -0.2243 0.0721  0.0376  207 ILE H O   
1533 C CB  . ILE A 207 ? 0.8409 0.9755 1.0445 -0.2682 0.0361  0.0425  207 ILE H CB  
1534 C CG1 . ILE A 207 ? 0.9013 1.0501 1.1511 -0.2892 0.0222  0.0477  207 ILE H CG1 
1535 C CG2 . ILE A 207 ? 0.8941 0.9759 1.0566 -0.2605 0.0198  0.0291  207 ILE H CG2 
1536 C CD1 . ILE A 207 ? 1.0001 1.1207 1.2574 -0.3113 0.0158  0.0624  207 ILE H CD1 
1537 N N   . CYS A 208 ? 0.8099 0.9424 0.9496 -0.2180 0.0436  0.0112  208 CYS H N   
1538 C CA  . CYS A 208 ? 0.8412 0.9516 0.9432 -0.2029 0.0491  0.0063  208 CYS H CA  
1539 C C   . CYS A 208 ? 0.8246 0.8870 0.8979 -0.2059 0.0386  0.0051  208 CYS H C   
1540 O O   . CYS A 208 ? 0.8531 0.8933 0.9272 -0.2104 0.0213  -0.0002 208 CYS H O   
1541 C CB  . CYS A 208 ? 0.8148 0.9349 0.9084 -0.1856 0.0467  -0.0075 208 CYS H CB  
1542 S SG  . CYS A 208 ? 1.1109 1.2058 1.1983 -0.1823 0.0271  -0.0226 208 CYS H SG  
1543 N N   . ASN A 209 ? 0.7315 0.7779 0.7768 -0.2006 0.0486  0.0098  209 ASN H N   
1544 C CA  . ASN A 209 ? 0.7011 0.7040 0.7118 -0.1999 0.0407  0.0103  209 ASN H CA  
1545 C C   . ASN A 209 ? 0.7362 0.7281 0.7196 -0.1821 0.0410  0.0021  209 ASN H C   
1546 O O   . ASN A 209 ? 0.8209 0.8220 0.7927 -0.1729 0.0538  0.0023  209 ASN H O   
1547 C CB  . ASN A 209 ? 0.7671 0.7598 0.7631 -0.2063 0.0525  0.0220  209 ASN H CB  
1548 C CG  . ASN A 209 ? 0.8167 0.8307 0.8478 -0.2240 0.0579  0.0340  209 ASN H CG  
1549 O OD1 . ASN A 209 ? 0.7794 0.8257 0.8266 -0.2213 0.0758  0.0409  209 ASN H OD1 
1550 N ND2 . ASN A 209 ? 0.7598 0.7562 0.8040 -0.2403 0.0416  0.0375  209 ASN H ND2 
1551 N N   . VAL A 210 ? 0.6814 0.6545 0.6567 -0.1757 0.0267  -0.0048 210 VAL H N   
1552 C CA  . VAL A 210 ? 0.6770 0.6405 0.6302 -0.1595 0.0272  -0.0093 210 VAL H CA  
1553 C C   . VAL A 210 ? 0.7345 0.6614 0.6486 -0.1527 0.0218  -0.0043 210 VAL H C   
1554 O O   . VAL A 210 ? 0.6531 0.5515 0.5541 -0.1534 0.0074  -0.0026 210 VAL H O   
1555 C CB  . VAL A 210 ? 0.6369 0.6035 0.6014 -0.1514 0.0182  -0.0184 210 VAL H CB  
1556 C CG1 . VAL A 210 ? 0.5586 0.5114 0.5005 -0.1357 0.0187  -0.0188 210 VAL H CG1 
1557 C CG2 . VAL A 210 ? 0.6421 0.6455 0.6366 -0.1536 0.0239  -0.0244 210 VAL H CG2 
1558 N N   . ASN A 211 ? 0.8113 0.7385 0.7047 -0.1440 0.0320  -0.0022 211 ASN H N   
1559 C CA  . ASN A 211 ? 0.8614 0.7586 0.7146 -0.1339 0.0278  0.0029  211 ASN H CA  
1560 C C   . ASN A 211 ? 0.7760 0.6782 0.6224 -0.1184 0.0301  0.0021  211 ASN H C   
1561 O O   . ASN A 211 ? 0.7886 0.7145 0.6497 -0.1168 0.0400  -0.0009 211 ASN H O   
1562 C CB  . ASN A 211 ? 0.9695 0.8590 0.7983 -0.1369 0.0376  0.0077  211 ASN H CB  
1563 C CG  . ASN A 211 ? 1.0392 0.8910 0.8207 -0.1289 0.0287  0.0135  211 ASN H CG  
1564 O OD1 . ASN A 211 ? 0.9999 0.8281 0.7690 -0.1231 0.0127  0.0152  211 ASN H OD1 
1565 N ND2 . ASN A 211 ? 1.1407 0.9848 0.8914 -0.1254 0.0382  0.0161  211 ASN H ND2 
1566 N N   . HIS A 212 ? 0.7696 0.6487 0.5946 -0.1058 0.0198  0.0059  212 HIS H N   
1567 C CA  . HIS A 212 ? 0.7231 0.6055 0.5396 -0.0900 0.0229  0.0100  212 HIS H CA  
1568 C C   . HIS A 212 ? 0.7194 0.5743 0.4897 -0.0761 0.0181  0.0195  212 HIS H C   
1569 O O   . HIS A 212 ? 0.7622 0.5912 0.5119 -0.0639 0.0052  0.0236  212 HIS H O   
1570 C CB  . HIS A 212 ? 0.6730 0.5561 0.5074 -0.0821 0.0164  0.0074  212 HIS H CB  
1571 C CG  . HIS A 212 ? 0.7064 0.5972 0.5407 -0.0679 0.0217  0.0138  212 HIS H CG  
1572 N ND1 . HIS A 212 ? 0.7933 0.6659 0.6101 -0.0482 0.0159  0.0216  212 HIS H ND1 
1573 C CD2 . HIS A 212 ? 0.5930 0.5076 0.4447 -0.0698 0.0317  0.0146  212 HIS H CD2 
1574 C CE1 . HIS A 212 ? 0.7596 0.6474 0.5856 -0.0404 0.0243  0.0289  212 HIS H CE1 
1575 N NE2 . HIS A 212 ? 0.6159 0.5286 0.4644 -0.0546 0.0327  0.0242  212 HIS H NE2 
1576 N N   . LYS A 213 ? 0.7620 0.7326 0.8288 -0.0975 0.0329  0.0283  213 LYS H N   
1577 C CA  . LYS A 213 ? 0.7776 0.7239 0.8383 -0.0903 0.0608  0.0407  213 LYS H CA  
1578 C C   . LYS A 213 ? 0.7898 0.7378 0.8361 -0.0927 0.0467  0.0374  213 LYS H C   
1579 O O   . LYS A 213 ? 0.7998 0.7259 0.8470 -0.0977 0.0641  0.0254  213 LYS H O   
1580 C CB  . LYS A 213 ? 0.8000 0.7517 0.8524 -0.0664 0.0800  0.0743  213 LYS H CB  
1581 C CG  . LYS A 213 ? 0.9073 0.8544 0.9796 -0.0581 0.1096  0.0832  213 LYS H CG  
1582 C CD  . LYS A 213 ? 0.9940 0.9605 1.0591 -0.0289 0.1312  0.1192  213 LYS H CD  
1583 C CE  . LYS A 213 ? 1.1219 1.0903 1.2137 -0.0162 0.1642  0.1325  213 LYS H CE  
1584 N NZ  . LYS A 213 ? 1.2307 1.2168 1.3216 0.0153  0.2000  0.1720  213 LYS H NZ  
1585 N N   . PRO A 214 ? 0.7615 0.7376 0.7989 -0.0878 0.0155  0.0474  214 PRO H N   
1586 C CA  . PRO A 214 ? 0.6154 0.6013 0.6432 -0.0842 0.0017  0.0538  214 PRO H CA  
1587 C C   . PRO A 214 ? 0.6888 0.6752 0.7215 -0.0954 0.0001  0.0271  214 PRO H C   
1588 O O   . PRO A 214 ? 0.7359 0.7234 0.7579 -0.0874 0.0021  0.0326  214 PRO H O   
1589 C CB  . PRO A 214 ? 0.6230 0.6414 0.6579 -0.0827 -0.0330 0.0621  214 PRO H CB  
1590 C CG  . PRO A 214 ? 0.6576 0.6796 0.6944 -0.0778 -0.0325 0.0679  214 PRO H CG  
1591 C CD  . PRO A 214 ? 0.7124 0.7142 0.7539 -0.0843 -0.0086 0.0525  214 PRO H CD  
1592 N N   . SER A 215 ? 0.6428 0.6348 0.6906 -0.1115 -0.0042 -0.0009 215 SER H N   
1593 C CA  . SER A 215 ? 0.6250 0.6303 0.6787 -0.1215 -0.0073 -0.0301 215 SER H CA  
1594 C C   . SER A 215 ? 0.8050 0.7819 0.8707 -0.1357 0.0189  -0.0583 215 SER H C   
1595 O O   . SER A 215 ? 0.6660 0.6564 0.7408 -0.1474 0.0174  -0.0908 215 SER H O   
1596 C CB  . SER A 215 ? 0.6176 0.6638 0.6829 -0.1290 -0.0342 -0.0409 215 SER H CB  
1597 O OG  . SER A 215 ? 0.6168 0.6580 0.6930 -0.1423 -0.0325 -0.0537 215 SER H OG  
1598 N N   . ASN A 216 ? 0.8028 0.7453 0.8731 -0.1335 0.0441  -0.0453 216 ASN H N   
1599 C CA  . ASN A 216 ? 0.8924 0.8048 0.9861 -0.1469 0.0726  -0.0669 216 ASN H CA  
1600 C C   . ASN A 216 ? 0.8432 0.7742 0.9574 -0.1674 0.0613  -0.0961 216 ASN H C   
1601 O O   . ASN A 216 ? 0.9074 0.8334 1.0406 -0.1840 0.0706  -0.1302 216 ASN H O   
1602 C CB  . ASN A 216 ? 0.9995 0.8874 1.0948 -0.1480 0.0934  -0.0859 216 ASN H CB  
1603 C CG  . ASN A 216 ? 1.1317 0.9811 1.2214 -0.1318 0.1262  -0.0571 216 ASN H CG  
1604 O OD1 . ASN A 216 ? 1.1409 0.9982 1.2070 -0.1128 0.1214  -0.0208 216 ASN H OD1 
1605 N ND2 . ASN A 216 ? 1.1962 1.0056 1.3117 -0.1389 0.1618  -0.0723 216 ASN H ND2 
1606 N N   . THR A 217 ? 0.7931 0.7475 0.9038 -0.1659 0.0410  -0.0833 217 THR H N   
1607 C CA  . THR A 217 ? 0.7831 0.7578 0.9090 -0.1824 0.0305  -0.1035 217 THR H CA  
1608 C C   . THR A 217 ? 0.7988 0.7565 0.9399 -0.1807 0.0463  -0.0885 217 THR H C   
1609 O O   . THR A 217 ? 0.8014 0.7632 0.9312 -0.1640 0.0410  -0.0611 217 THR H O   
1610 C CB  . THR A 217 ? 0.8077 0.8246 0.9201 -0.1797 -0.0032 -0.0997 217 THR H CB  
1611 O OG1 . THR A 217 ? 0.7834 0.8223 0.8855 -0.1747 -0.0155 -0.1048 217 THR H OG1 
1612 C CG2 . THR A 217 ? 0.8179 0.8601 0.9431 -0.1961 -0.0117 -0.1204 217 THR H CG2 
1613 N N   . LYS A 218 ? 0.8192 0.7621 0.9900 -0.1965 0.0663  -0.1071 218 LYS H N   
1614 C CA  . LYS A 218 ? 0.8323 0.7658 1.0252 -0.1942 0.0825  -0.0915 218 LYS H CA  
1615 C C   . LYS A 218 ? 0.8235 0.7798 1.0323 -0.2160 0.0703  -0.1171 218 LYS H C   
1616 O O   . LYS A 218 ? 0.8288 0.7808 1.0610 -0.2371 0.0790  -0.1492 218 LYS H O   
1617 C CB  . LYS A 218 ? 0.9385 0.8311 1.1640 -0.1930 0.1241  -0.0855 218 LYS H CB  
1618 C CG  . LYS A 218 ? 1.0148 0.8998 1.2489 -0.1684 0.1468  -0.0442 218 LYS H CG  
1619 C CD  . LYS A 218 ? 1.1568 1.0032 1.4139 -0.1600 0.1893  -0.0310 218 LYS H CD  
1620 C CE  . LYS A 218 ? 1.2550 1.1070 1.5152 -0.1278 0.2132  0.0163  218 LYS H CE  
1621 N NZ  . LYS A 218 ? 1.3350 1.1526 1.6162 -0.1161 0.2583  0.0348  218 LYS H NZ  
1622 N N   . VAL A 219 ? 0.7931 0.7769 0.9887 -0.2108 0.0494  -0.1053 219 VAL H N   
1623 C CA  . VAL A 219 ? 0.7432 0.7543 0.9489 -0.2292 0.0376  -0.1246 219 VAL H CA  
1624 C C   . VAL A 219 ? 0.7737 0.7857 0.9939 -0.2226 0.0453  -0.1032 219 VAL H C   
1625 O O   . VAL A 219 ? 0.7798 0.7918 0.9854 -0.1989 0.0429  -0.0741 219 VAL H O   
1626 C CB  . VAL A 219 ? 0.7166 0.7678 0.8932 -0.2286 0.0051  -0.1304 219 VAL H CB  
1627 C CG1 . VAL A 219 ? 0.6380 0.7197 0.8179 -0.2380 -0.0058 -0.1341 219 VAL H CG1 
1628 C CG2 . VAL A 219 ? 0.7404 0.8073 0.9135 -0.2387 -0.0011 -0.1574 219 VAL H CG2 
1629 N N   . ASP A 220 ? 0.8767 0.8946 1.1275 -0.2423 0.0541  -0.1182 220 ASP H N   
1630 C CA  . ASP A 220 ? 0.9607 0.9843 1.2288 -0.2354 0.0618  -0.0951 220 ASP H CA  
1631 C C   . ASP A 220 ? 0.9107 0.9720 1.1737 -0.2513 0.0422  -0.1087 220 ASP H C   
1632 O O   . ASP A 220 ? 0.8757 0.9437 1.1705 -0.2761 0.0505  -0.1310 220 ASP H O   
1633 C CB  . ASP A 220 ? 1.0108 1.0039 1.3334 -0.2415 0.0987  -0.0900 220 ASP H CB  
1634 C CG  . ASP A 220 ? 1.0732 1.0376 1.4017 -0.2152 0.1236  -0.0596 220 ASP H CG  
1635 O OD1 . ASP A 220 ? 1.0690 1.0054 1.4459 -0.2175 0.1588  -0.0525 220 ASP H OD1 
1636 O OD2 . ASP A 220 ? 1.1379 1.1105 1.4264 -0.1917 0.1097  -0.0420 220 ASP H OD2 
1637 N N   . LYS A 221 ? 0.8961 0.9834 1.1214 -0.2373 0.0171  -0.0962 221 LYS H N   
1638 C CA  . LYS A 221 ? 0.8906 1.0169 1.1067 -0.2494 0.0003  -0.1049 221 LYS H CA  
1639 C C   . LYS A 221 ? 0.8588 0.9929 1.0846 -0.2400 0.0055  -0.0792 221 LYS H C   
1640 O O   . LYS A 221 ? 0.7809 0.9075 0.9944 -0.2120 0.0052  -0.0500 221 LYS H O   
1641 C CB  . LYS A 221 ? 0.9219 1.0731 1.0978 -0.2395 -0.0265 -0.1045 221 LYS H CB  
1642 C CG  . LYS A 221 ? 0.9357 1.1310 1.0993 -0.2475 -0.0409 -0.1080 221 LYS H CG  
1643 C CD  . LYS A 221 ? 0.9153 1.1433 1.0936 -0.2743 -0.0394 -0.1405 221 LYS H CD  
1644 C CE  . LYS A 221 ? 0.9176 1.1595 1.0833 -0.2731 -0.0489 -0.1565 221 LYS H CE  
1645 N NZ  . LYS A 221 ? 0.9254 1.2142 1.1030 -0.2939 -0.0491 -0.1897 221 LYS H NZ  
1646 N N   . LYS A 222 ? 0.9075 1.0621 1.1574 -0.2622 0.0100  -0.0908 222 LYS H N   
1647 C CA  . LYS A 222 ? 0.8979 1.0682 1.1573 -0.2552 0.0131  -0.0655 222 LYS H CA  
1648 C C   . LYS A 222 ? 0.8188 1.0276 1.0354 -0.2490 -0.0118 -0.0606 222 LYS H C   
1649 O O   . LYS A 222 ? 0.8036 1.0407 1.0070 -0.2662 -0.0238 -0.0844 222 LYS H O   
1650 C CB  . LYS A 222 ? 0.9725 1.1484 1.2841 -0.2845 0.0305  -0.0803 222 LYS H CB  
1651 C CG  . LYS A 222 ? 1.0536 1.2472 1.3836 -0.2777 0.0363  -0.0494 222 LYS H CG  
1652 C CD  . LYS A 222 ? 1.0748 1.2688 1.4709 -0.3088 0.0567  -0.0638 222 LYS H CD  
1653 C CE  . LYS A 222 ? 1.0844 1.3000 1.5021 -0.3006 0.0625  -0.0274 222 LYS H CE  
1654 N NZ  . LYS A 222 ? 1.1016 1.3179 1.5939 -0.3321 0.0829  -0.0393 222 LYS H NZ  
1655 N N   . VAL A 223 ? 0.7576 0.9711 0.9534 -0.2213 -0.0181 -0.0288 225 VAL H N   
1656 C CA  . VAL A 223 ? 0.7399 0.9838 0.8954 -0.2115 -0.0392 -0.0216 225 VAL H CA  
1657 C C   . VAL A 223 ? 0.8092 1.0832 0.9699 -0.2147 -0.0369 -0.0046 225 VAL H C   
1658 O O   . VAL A 223 ? 0.7957 1.0643 0.9726 -0.1986 -0.0264 0.0225  225 VAL H O   
1659 C CB  . VAL A 223 ? 0.7662 0.9973 0.8896 -0.1767 -0.0519 -0.0034 225 VAL H CB  
1660 C CG1 . VAL A 223 ? 0.7686 1.0244 0.8546 -0.1681 -0.0723 -0.0008 225 VAL H CG1 
1661 C CG2 . VAL A 223 ? 0.7938 0.9970 0.9176 -0.1744 -0.0522 -0.0169 225 VAL H CG2 
1662 N N   . GLU A 224 ? 0.8650 1.1769 1.0132 -0.2332 -0.0454 -0.0176 226 GLU H N   
1663 C CA  . GLU A 224 ? 0.8951 1.2422 1.0486 -0.2407 -0.0428 -0.0031 226 GLU H CA  
1664 C C   . GLU A 224 ? 0.8581 1.2328 0.9648 -0.2203 -0.0577 0.0178  226 GLU H C   
1665 O O   . GLU A 224 ? 0.8285 1.2140 0.9072 -0.2174 -0.0691 0.0075  226 GLU H O   
1666 C CB  . GLU A 224 ? 0.9182 1.2983 1.0996 -0.2793 -0.0373 -0.0341 226 GLU H CB  
1667 C CG  . GLU A 224 ? 0.9951 1.3465 1.2222 -0.3014 -0.0234 -0.0637 226 GLU H CG  
1668 C CD  . GLU A 224 ? 1.1256 1.4975 1.4033 -0.3338 -0.0108 -0.0808 226 GLU H CD  
1669 O OE1 . GLU A 224 ? 1.1805 1.6066 1.4518 -0.3507 -0.0178 -0.0910 226 GLU H OE1 
1670 O OE2 . GLU A 224 ? 1.1870 1.5230 1.5148 -0.3421 0.0077  -0.0834 226 GLU H OE2 
1671 N N   . PRO A 225 ? 0.7637 1.1508 0.8655 -0.2046 -0.0556 0.0495  227 PRO H N   
1672 C CA  . PRO A 225 ? 0.7846 1.1940 0.8433 -0.1797 -0.0665 0.0761  227 PRO H CA  
1673 C C   . PRO A 225 ? 0.7950 1.2520 0.8317 -0.1954 -0.0710 0.0703  227 PRO H C   
1674 O O   . PRO A 225 ? 0.6865 1.1681 0.7425 -0.2260 -0.0668 0.0437  227 PRO H O   
1675 C CB  . PRO A 225 ? 0.8326 1.2490 0.9077 -0.1661 -0.0575 0.1102  227 PRO H CB  
1676 C CG  . PRO A 225 ? 0.8047 1.1881 0.9270 -0.1694 -0.0429 0.1067  227 PRO H CG  
1677 C CD  . PRO A 225 ? 0.7130 1.0875 0.8589 -0.2060 -0.0390 0.0654  227 PRO H CD  
1678 N N   . LYS A 226 ? 0.9767 1.4512 0.9741 -0.1715 -0.0779 0.0962  228 LYS H N   
1679 C CA  . LYS A 226 ? 1.0142 1.5323 0.9836 -0.1757 -0.0802 0.0978  228 LYS H CA  
1680 C C   . LYS A 226 ? 1.0468 1.5668 1.0222 -0.1896 -0.0822 0.0675  228 LYS H C   
1681 O O   . LYS A 226 ? 1.0294 1.5955 0.9963 -0.1988 -0.0794 0.0630  228 LYS H O   
1682 C CB  . LYS A 226 ? 0.9793 1.5547 0.9559 -0.1970 -0.0716 0.1072  228 LYS H CB  
1683 C CG  . LYS A 226 ? 0.9564 1.5835 0.8963 -0.1906 -0.0709 0.1220  228 LYS H CG  
1684 C CD  . LYS A 226 ? 0.9231 1.6117 0.8644 -0.2064 -0.0630 0.1382  228 LYS H CD  
1685 C CE  . LYS A 226 ? 0.8698 1.5970 0.7641 -0.1845 -0.0606 0.1706  228 LYS H CE  
1686 N NZ  . LYS A 226 ? 0.8173 1.5485 0.6926 -0.1732 -0.0601 0.1624  228 LYS H NZ  
1687 O OXT . LYS A 226 ? 1.0678 1.5468 1.0578 -0.1889 -0.0856 0.0499  228 LYS H OXT 
1688 N N   . GLU B 1   ? 0.6391 1.5658 1.3381 0.1727  0.0481  -0.0771 1   GLU L N   
1689 C CA  . GLU B 1   ? 0.5635 1.4307 1.2309 0.1907  0.0269  -0.0815 1   GLU L CA  
1690 C C   . GLU B 1   ? 0.5541 1.3715 1.2006 0.1565  0.0227  -0.0701 1   GLU L C   
1691 O O   . GLU B 1   ? 0.6476 1.4473 1.2686 0.1317  0.0471  -0.0579 1   GLU L O   
1692 C CB  . GLU B 1   ? 0.5693 1.4124 1.1939 0.2193  0.0443  -0.0841 1   GLU L CB  
1693 C CG  . GLU B 1   ? 0.7352 1.5295 1.3343 0.2455  0.0196  -0.0924 1   GLU L CG  
1694 C CD  . GLU B 1   ? 0.9203 1.6695 1.4658 0.2571  0.0383  -0.0894 1   GLU L CD  
1695 O OE1 . GLU B 1   ? 0.9820 1.7088 1.5010 0.2310  0.0606  -0.0773 1   GLU L OE1 
1696 O OE2 . GLU B 1   ? 0.9335 1.6664 1.4605 0.2929  0.0288  -0.0995 1   GLU L OE2 
1697 N N   . LEU B 2   ? 0.4785 1.2716 1.1324 0.1549  -0.0087 -0.0741 2   LEU L N   
1698 C CA  . LEU B 2   ? 0.4222 1.1698 1.0550 0.1253  -0.0134 -0.0648 2   LEU L CA  
1699 C C   . LEU B 2   ? 0.4820 1.1794 1.0633 0.1341  -0.0020 -0.0625 2   LEU L C   
1700 O O   . LEU B 2   ? 0.5442 1.2257 1.1091 0.1650  -0.0109 -0.0716 2   LEU L O   
1701 C CB  . LEU B 2   ? 0.3653 1.1003 1.0164 0.1206  -0.0493 -0.0696 2   LEU L CB  
1702 C CG  . LEU B 2   ? 0.3504 1.1147 1.0413 0.0938  -0.0599 -0.0662 2   LEU L CG  
1703 C CD1 . LEU B 2   ? 0.2947 1.1196 1.0245 0.1094  -0.0567 -0.0734 2   LEU L CD1 
1704 C CD2 . LEU B 2   ? 0.3622 1.1041 1.0613 0.0883  -0.0953 -0.0702 2   LEU L CD2 
1705 N N   . VAL B 3   ? 0.4582 1.1285 1.0123 0.1072  0.0159  -0.0510 3   VAL L N   
1706 C CA  . VAL B 3   ? 0.4309 1.0509 0.9341 0.1147  0.0247  -0.0496 3   VAL L CA  
1707 C C   . VAL B 3   ? 0.4464 1.0301 0.9375 0.0963  0.0080  -0.0472 3   VAL L C   
1708 O O   . VAL B 3   ? 0.4531 1.0348 0.9525 0.0644  0.0074  -0.0387 3   VAL L O   
1709 C CB  . VAL B 3   ? 0.4582 1.0655 0.9273 0.1028  0.0573  -0.0394 3   VAL L CB  
1710 C CG1 . VAL B 3   ? 0.3926 0.9461 0.8057 0.1175  0.0641  -0.0406 3   VAL L CG1 
1711 C CG2 . VAL B 3   ? 0.4018 1.0537 0.8869 0.1166  0.0759  -0.0410 3   VAL L CG2 
1712 N N   . MET B 4   ? 0.4007 0.9580 0.8721 0.1169  -0.0060 -0.0553 4   MET L N   
1713 C CA  . MET B 4   ? 0.3670 0.8958 0.8274 0.1036  -0.0225 -0.0554 4   MET L CA  
1714 C C   . MET B 4   ? 0.4599 0.9478 0.8698 0.1070  -0.0069 -0.0536 4   MET L C   
1715 O O   . MET B 4   ? 0.5362 1.0117 0.9201 0.1338  0.0020  -0.0590 4   MET L O   
1716 C CB  . MET B 4   ? 0.3429 0.8737 0.8168 0.1221  -0.0506 -0.0664 4   MET L CB  
1717 C CG  . MET B 4   ? 0.4333 0.9983 0.9501 0.1265  -0.0694 -0.0707 4   MET L CG  
1718 S SD  . MET B 4   ? 0.5713 1.1563 1.1235 0.0888  -0.0768 -0.0622 4   MET L SD  
1719 C CE  . MET B 4   ? 0.3429 0.8949 0.8817 0.0696  -0.0985 -0.0617 4   MET L CE  
1720 N N   . THR B 5   ? 0.5042 0.9693 0.8980 0.0814  -0.0051 -0.0467 5   THR L N   
1721 C CA  . THR B 5   ? 0.4973 0.9208 0.8396 0.0836  0.0089  -0.0450 5   THR L CA  
1722 C C   . THR B 5   ? 0.5678 0.9721 0.8990 0.0783  -0.0072 -0.0493 5   THR L C   
1723 O O   . THR B 5   ? 0.6927 1.0987 1.0377 0.0517  -0.0157 -0.0440 5   THR L O   
1724 C CB  . THR B 5   ? 0.4835 0.8927 0.8075 0.0570  0.0285  -0.0321 5   THR L CB  
1725 O OG1 . THR B 5   ? 0.5345 0.9703 0.8737 0.0575  0.0445  -0.0276 5   THR L OG1 
1726 C CG2 . THR B 5   ? 0.5152 0.8741 0.7783 0.0626  0.0412  -0.0312 5   THR L CG2 
1727 N N   . GLN B 6   ? 0.4885 0.8770 0.7955 0.1032  -0.0118 -0.0593 6   GLN L N   
1728 C CA  . GLN B 6   ? 0.5033 0.8804 0.8006 0.0984  -0.0257 -0.0645 6   GLN L CA  
1729 C C   . GLN B 6   ? 0.6621 1.0007 0.9083 0.1005  -0.0135 -0.0645 6   GLN L C   
1730 O O   . GLN B 6   ? 0.6972 1.0111 0.9078 0.1135  0.0037  -0.0631 6   GLN L O   
1731 C CB  . GLN B 6   ? 0.4253 0.8157 0.7343 0.1196  -0.0440 -0.0766 6   GLN L CB  
1732 C CG  . GLN B 6   ? 0.4457 0.8668 0.7994 0.1170  -0.0613 -0.0775 6   GLN L CG  
1733 C CD  . GLN B 6   ? 0.4993 0.9278 0.8586 0.1373  -0.0802 -0.0888 6   GLN L CD  
1734 O OE1 . GLN B 6   ? 0.4711 0.9121 0.8463 0.1550  -0.0876 -0.0929 6   GLN L OE1 
1735 N NE2 . GLN B 6   ? 0.5117 0.9335 0.8569 0.1352  -0.0884 -0.0946 6   GLN L NE2 
1736 N N   . SER B 7   ? 0.6734 1.0059 0.9138 0.0883  -0.0234 -0.0667 7   SER L N   
1737 C CA  . SER B 7   ? 0.6599 0.9565 0.8539 0.0862  -0.0150 -0.0663 7   SER L CA  
1738 C C   . SER B 7   ? 0.6543 0.9595 0.8510 0.0834  -0.0303 -0.0745 7   SER L C   
1739 O O   . SER B 7   ? 0.6791 1.0075 0.9100 0.0620  -0.0432 -0.0716 7   SER L O   
1740 C CB  . SER B 7   ? 0.7118 0.9921 0.8995 0.0566  -0.0048 -0.0521 7   SER L CB  
1741 O OG  . SER B 7   ? 0.8751 1.1303 1.0350 0.0434  -0.0073 -0.0511 7   SER L OG  
1742 N N   . PRO B 8   ? 0.5915 0.8799 0.7519 0.1058  -0.0295 -0.0855 8   PRO L N   
1743 C CA  . PRO B 8   ? 0.6809 0.9386 0.7979 0.1338  -0.0171 -0.0903 8   PRO L CA  
1744 C C   . PRO B 8   ? 0.7162 0.9920 0.8477 0.1609  -0.0208 -0.0988 8   PRO L C   
1745 O O   . PRO B 8   ? 0.6225 0.9335 0.7966 0.1576  -0.0342 -0.1012 8   PRO L O   
1746 C CB  . PRO B 8   ? 0.6598 0.8993 0.7384 0.1470  -0.0206 -0.1013 8   PRO L CB  
1747 C CG  . PRO B 8   ? 0.5533 0.8352 0.6701 0.1404  -0.0373 -0.1085 8   PRO L CG  
1748 C CD  . PRO B 8   ? 0.5292 0.8279 0.6854 0.1058  -0.0410 -0.0950 8   PRO L CD  
1749 N N   . ASP B 9   ? 0.7729 1.0203 0.8650 0.1875  -0.0104 -0.1035 9   ASP L N   
1750 C CA  . ASP B 9   ? 0.7788 1.0378 0.8778 0.2163  -0.0143 -0.1127 9   ASP L CA  
1751 C C   . ASP B 9   ? 0.7408 1.0204 0.8477 0.2310  -0.0313 -0.1277 9   ASP L C   
1752 O O   . ASP B 9   ? 0.7438 1.0497 0.8785 0.2420  -0.0434 -0.1343 9   ASP L O   
1753 C CB  . ASP B 9   ? 0.8665 1.0850 0.9147 0.2413  0.0006  -0.1144 9   ASP L CB  
1754 C CG  . ASP B 9   ? 1.0226 1.2330 1.0714 0.2301  0.0175  -0.1007 9   ASP L CG  
1755 O OD1 . ASP B 9   ? 0.9677 1.2068 1.0591 0.2048  0.0167  -0.0910 9   ASP L OD1 
1756 O OD2 . ASP B 9   ? 1.1813 1.3576 1.1871 0.2465  0.0313  -0.1000 9   ASP L OD2 
1757 N N   . SER B 10  ? 0.7226 0.9908 0.8041 0.2303  -0.0327 -0.1333 10  SER L N   
1758 C CA  . SER B 10  ? 0.7181 1.0078 0.8016 0.2459  -0.0462 -0.1491 10  SER L CA  
1759 C C   . SER B 10  ? 0.7224 1.0204 0.8037 0.2271  -0.0501 -0.1502 10  SER L C   
1760 O O   . SER B 10  ? 0.8152 1.0834 0.8689 0.2157  -0.0409 -0.1430 10  SER L O   
1761 C CB  . SER B 10  ? 0.7944 1.0562 0.8317 0.2838  -0.0426 -0.1621 10  SER L CB  
1762 O OG  . SER B 10  ? 0.8756 1.1681 0.9261 0.3020  -0.0572 -0.1781 10  SER L OG  
1763 N N   . LEU B 11  ? 0.6209 0.9593 0.7298 0.2234  -0.0643 -0.1592 11  LEU L N   
1764 C CA  . LEU B 11  ? 0.5946 0.9497 0.7068 0.2046  -0.0687 -0.1609 11  LEU L CA  
1765 C C   . LEU B 11  ? 0.6455 1.0365 0.7623 0.2207  -0.0798 -0.1789 11  LEU L C   
1766 O O   . LEU B 11  ? 0.6742 1.0919 0.8161 0.2287  -0.0899 -0.1849 11  LEU L O   
1767 C CB  . LEU B 11  ? 0.6053 0.9832 0.7610 0.1673  -0.0753 -0.1479 11  LEU L CB  
1768 C CG  . LEU B 11  ? 0.6564 1.0507 0.8187 0.1416  -0.0798 -0.1465 11  LEU L CG  
1769 C CD1 . LEU B 11  ? 0.7460 1.1013 0.8704 0.1372  -0.0680 -0.1407 11  LEU L CD1 
1770 C CD2 . LEU B 11  ? 0.5816 0.9976 0.7877 0.1087  -0.0898 -0.1351 11  LEU L CD2 
1771 N N   . ALA B 12  ? 0.6727 1.0653 0.7645 0.2263  -0.0785 -0.1881 12  ALA L N   
1772 C CA  . ALA B 12  ? 0.5632 0.9986 0.6616 0.2394  -0.0880 -0.2061 12  ALA L CA  
1773 C C   . ALA B 12  ? 0.5998 1.0598 0.7046 0.2157  -0.0896 -0.2061 12  ALA L C   
1774 O O   . ALA B 12  ? 0.5821 1.0123 0.6559 0.2129  -0.0819 -0.2027 12  ALA L O   
1775 C CB  . ALA B 12  ? 0.4591 0.8750 0.5139 0.2807  -0.0853 -0.2229 12  ALA L CB  
1776 N N   . VAL B 13  ? 0.6176 1.1305 0.7597 0.1983  -0.1001 -0.2101 13  VAL L N   
1777 C CA  . VAL B 13  ? 0.6381 1.1781 0.7913 0.1701  -0.1018 -0.2078 13  VAL L CA  
1778 C C   . VAL B 13  ? 0.5756 1.1760 0.7434 0.1741  -0.1094 -0.2249 13  VAL L C   
1779 O O   . VAL B 13  ? 0.5483 1.1778 0.7378 0.1816  -0.1182 -0.2322 13  VAL L O   
1780 C CB  . VAL B 13  ? 0.6563 1.1978 0.8446 0.1300  -0.1071 -0.1890 13  VAL L CB  
1781 C CG1 . VAL B 13  ? 0.6791 1.2604 0.8865 0.0995  -0.1132 -0.1887 13  VAL L CG1 
1782 C CG2 . VAL B 13  ? 0.6676 1.1581 0.8395 0.1212  -0.0978 -0.1735 13  VAL L CG2 
1783 N N   . SER B 14  ? 0.5879 1.2088 0.7430 0.1694  -0.1062 -0.2319 14  SER L N   
1784 C CA  . SER B 14  ? 0.5936 1.2800 0.7645 0.1712  -0.1118 -0.2486 14  SER L CA  
1785 C C   . SER B 14  ? 0.5707 1.2972 0.7864 0.1316  -0.1220 -0.2395 14  SER L C   
1786 O O   . SER B 14  ? 0.5414 1.2458 0.7702 0.1004  -0.1238 -0.2212 14  SER L O   
1787 C CB  . SER B 14  ? 0.5775 1.2780 0.7229 0.1762  -0.1053 -0.2584 14  SER L CB  
1788 O OG  . SER B 14  ? 0.6626 1.3185 0.7604 0.2143  -0.0987 -0.2672 14  SER L OG  
1789 N N   . LEU B 15  ? 0.5182 1.3016 0.7559 0.1326  -0.1301 -0.2524 15  LEU L N   
1790 C CA  . LEU B 15  ? 0.4835 1.3014 0.7588 0.0938  -0.1420 -0.2440 15  LEU L CA  
1791 C C   . LEU B 15  ? 0.5729 1.3965 0.8511 0.0551  -0.1392 -0.2323 15  LEU L C   
1792 O O   . LEU B 15  ? 0.6138 1.4437 0.8707 0.0609  -0.1292 -0.2383 15  LEU L O   
1793 C CB  . LEU B 15  ? 0.4588 1.3428 0.7529 0.0988  -0.1497 -0.2614 15  LEU L CB  
1794 C CG  . LEU B 15  ? 0.5018 1.4184 0.8310 0.0637  -0.1655 -0.2549 15  LEU L CG  
1795 C CD1 . LEU B 15  ? 0.4934 1.3723 0.8312 0.0724  -0.1766 -0.2476 15  LEU L CD1 
1796 C CD2 . LEU B 15  ? 0.4880 1.4797 0.8324 0.0655  -0.1696 -0.2736 15  LEU L CD2 
1797 N N   . GLY B 16  ? 0.8506 1.5371 0.7702 0.2932  0.0295  -0.2456 16  GLY L N   
1798 C CA  . GLY B 16  ? 0.7074 1.3989 0.5905 0.3092  0.0350  -0.2575 16  GLY L CA  
1799 C C   . GLY B 16  ? 0.7628 1.4245 0.6475 0.3255  0.0000  -0.2643 16  GLY L C   
1800 O O   . GLY B 16  ? 0.7949 1.4514 0.6468 0.3371  0.0024  -0.2704 16  GLY L O   
1801 N N   . GLU B 17  ? 0.7783 1.4181 0.6987 0.3257  -0.0340 -0.2634 17  GLU L N   
1802 C CA  . GLU B 17  ? 0.8238 1.4331 0.7479 0.3389  -0.0698 -0.2668 17  GLU L CA  
1803 C C   . GLU B 17  ? 0.8284 1.4078 0.7444 0.3213  -0.0676 -0.2373 17  GLU L C   
1804 O O   . GLU B 17  ? 0.8006 1.3832 0.7052 0.3005  -0.0382 -0.2154 17  GLU L O   
1805 C CB  . GLU B 17  ? 0.9337 1.5303 0.8966 0.3455  -0.1108 -0.2792 17  GLU L CB  
1806 C CG  . GLU B 17  ? 1.1342 1.7476 1.1035 0.3752  -0.1330 -0.3155 17  GLU L CG  
1807 C CD  . GLU B 17  ? 1.3104 1.9075 1.3171 0.3795  -0.1772 -0.3270 17  GLU L CD  
1808 O OE1 . GLU B 17  ? 1.3474 1.9213 1.3733 0.3564  -0.1869 -0.3064 17  GLU L OE1 
1809 O OE2 . GLU B 17  ? 1.3624 1.9683 1.3774 0.4052  -0.2034 -0.3573 17  GLU L OE2 
1810 N N   . ARG B 18  ? 0.8348 1.3856 0.7583 0.3298  -0.1002 -0.2375 18  ARG L N   
1811 C CA  . ARG B 18  ? 0.8275 1.3522 0.7432 0.3178  -0.0998 -0.2151 18  ARG L CA  
1812 C C   . ARG B 18  ? 0.7798 1.2832 0.7286 0.2973  -0.1179 -0.1970 18  ARG L C   
1813 O O   . ARG B 18  ? 0.8359 1.3266 0.8091 0.3022  -0.1520 -0.2057 18  ARG L O   
1814 C CB  . ARG B 18  ? 0.9018 1.4075 0.7993 0.3402  -0.1211 -0.2264 18  ARG L CB  
1815 C CG  . ARG B 18  ? 0.9348 1.4109 0.8313 0.3312  -0.1290 -0.2076 18  ARG L CG  
1816 C CD  . ARG B 18  ? 1.0903 1.5479 0.9608 0.3547  -0.1444 -0.2198 18  ARG L CD  
1817 N NE  . ARG B 18  ? 1.2284 1.6540 1.1154 0.3544  -0.1735 -0.2106 18  ARG L NE  
1818 C CZ  . ARG B 18  ? 1.2857 1.6947 1.1912 0.3689  -0.2126 -0.2203 18  ARG L CZ  
1819 N NH1 . ARG B 18  ? 1.2685 1.6893 1.1783 0.3863  -0.2288 -0.2410 18  ARG L NH1 
1820 N NH2 . ARG B 18  ? 1.2544 1.6355 1.1746 0.3661  -0.2368 -0.2102 18  ARG L NH2 
1821 N N   . ALA B 19  ? 0.6912 1.1899 0.6388 0.2735  -0.0956 -0.1724 19  ALA L N   
1822 C CA  . ALA B 19  ? 0.6897 1.1697 0.6656 0.2501  -0.1070 -0.1540 19  ALA L CA  
1823 C C   . ALA B 19  ? 0.6973 1.1580 0.6710 0.2449  -0.1112 -0.1412 19  ALA L C   
1824 O O   . ALA B 19  ? 0.7512 1.2162 0.7026 0.2426  -0.0867 -0.1327 19  ALA L O   
1825 C CB  . ALA B 19  ? 0.6539 1.1450 0.6345 0.2251  -0.0777 -0.1364 19  ALA L CB  
1826 N N   . THR B 20  ? 0.6607 1.0996 0.6572 0.2429  -0.1437 -0.1406 20  THR L N   
1827 C CA  . THR B 20  ? 0.7191 1.1407 0.7211 0.2362  -0.1497 -0.1292 20  THR L CA  
1828 C C   . THR B 20  ? 0.7086 1.1184 0.7414 0.2077  -0.1586 -0.1133 20  THR L C   
1829 O O   . THR B 20  ? 0.6660 1.0657 0.7169 0.2025  -0.1845 -0.1173 20  THR L O   
1830 C CB  . THR B 20  ? 0.8353 1.2391 0.8323 0.2613  -0.1814 -0.1433 20  THR L CB  
1831 O OG1 . THR B 20  ? 0.9601 1.3594 0.9663 0.2756  -0.2130 -0.1593 20  THR L OG1 
1832 C CG2 . THR B 20  ? 0.8209 1.2287 0.7820 0.2827  -0.1667 -0.1528 20  THR L CG2 
1833 N N   . ILE B 21  ? 0.6936 1.1039 0.7303 0.1891  -0.1379 -0.0965 21  ILE L N   
1834 C CA  . ILE B 21  ? 0.6384 1.0403 0.7022 0.1595  -0.1402 -0.0811 21  ILE L CA  
1835 C C   . ILE B 21  ? 0.5610 0.9524 0.6373 0.1587  -0.1510 -0.0783 21  ILE L C   
1836 O O   . ILE B 21  ? 0.5398 0.9327 0.6009 0.1738  -0.1426 -0.0816 21  ILE L O   
1837 C CB  . ILE B 21  ? 0.6292 1.0440 0.6899 0.1365  -0.1029 -0.0638 21  ILE L CB  
1838 C CG1 . ILE B 21  ? 0.5597 0.9861 0.6073 0.1372  -0.0877 -0.0650 21  ILE L CG1 
1839 C CG2 . ILE B 21  ? 0.5849 0.9912 0.6723 0.1041  -0.1031 -0.0485 21  ILE L CG2 
1840 C CD1 . ILE B 21  ? 0.6766 1.1164 0.7118 0.1225  -0.0498 -0.0490 21  ILE L CD1 
1841 N N   . ASN B 22  ? 0.6204 1.0002 0.7239 0.1387  -0.1692 -0.0721 22  ASN L N   
1842 C CA  . ASN B 22  ? 0.6797 1.0515 0.8012 0.1360  -0.1810 -0.0704 22  ASN L CA  
1843 C C   . ASN B 22  ? 0.6836 1.0623 0.8272 0.1043  -0.1616 -0.0556 22  ASN L C   
1844 O O   . ASN B 22  ? 0.7146 1.0960 0.8651 0.0786  -0.1504 -0.0454 22  ASN L O   
1845 C CB  . ASN B 22  ? 0.7484 1.1011 0.8838 0.1418  -0.2235 -0.0784 22  ASN L CB  
1846 C CG  . ASN B 22  ? 0.8255 1.1715 0.9400 0.1745  -0.2443 -0.0947 22  ASN L CG  
1847 O OD1 . ASN B 22  ? 0.8658 1.2120 0.9617 0.1997  -0.2411 -0.1032 22  ASN L OD1 
1848 N ND2 . ASN B 22  ? 0.8434 1.1822 0.9593 0.1739  -0.2665 -0.1004 22  ASN L ND2 
1849 N N   . CYS B 23  ? 0.6842 1.0646 0.8388 0.1068  -0.1589 -0.0559 23  CYS L N   
1850 C CA  . CYS B 23  ? 0.6557 1.0453 0.8362 0.0796  -0.1431 -0.0459 23  CYS L CA  
1851 C C   . CYS B 23  ? 0.6660 1.0479 0.8732 0.0817  -0.1670 -0.0520 23  CYS L C   
1852 O O   . CYS B 23  ? 0.5751 0.9495 0.7758 0.1071  -0.1781 -0.0616 23  CYS L O   
1853 C CB  . CYS B 23  ? 0.5620 0.9666 0.7298 0.0808  -0.1094 -0.0412 23  CYS L CB  
1854 S SG  . CYS B 23  ? 0.8658 1.2865 1.0605 0.0454  -0.0828 -0.0283 23  CYS L SG  
1855 N N   . LYS B 24  ? 0.6779 1.0596 0.9137 0.0540  -0.1757 -0.0465 24  LYS L N   
1856 C CA  . LYS B 24  ? 0.6661 1.0441 0.9316 0.0515  -0.1961 -0.0514 24  LYS L CA  
1857 C C   . LYS B 24  ? 0.6666 1.0638 0.9621 0.0197  -0.1731 -0.0446 24  LYS L C   
1858 O O   . LYS B 24  ? 0.6998 1.1021 1.0007 -0.0113 -0.1611 -0.0348 24  LYS L O   
1859 C CB  . LYS B 24  ? 0.6366 0.9960 0.9092 0.0474  -0.2340 -0.0532 24  LYS L CB  
1860 C CG  . LYS B 24  ? 0.8434 1.1972 1.1455 0.0464  -0.2587 -0.0579 24  LYS L CG  
1861 C CD  . LYS B 24  ? 1.0023 1.3311 1.2972 0.0638  -0.3028 -0.0637 24  LYS L CD  
1862 C CE  . LYS B 24  ? 1.0721 1.3901 1.3548 0.0469  -0.3172 -0.0587 24  LYS L CE  
1863 N NZ  . LYS B 24  ? 1.1121 1.4382 1.4145 0.0020  -0.3053 -0.0479 24  LYS L NZ  
1864 N N   . SER B 25  ? 0.5454 0.9520 0.8595 0.0272  -0.1672 -0.0510 25  SER L N   
1865 C CA  . SER B 25  ? 0.4966 0.9252 0.8438 -0.0008 -0.1463 -0.0483 25  SER L CA  
1866 C C   . SER B 25  ? 0.5158 0.9460 0.9029 -0.0151 -0.1678 -0.0536 25  SER L C   
1867 O O   . SER B 25  ? 0.5559 0.9706 0.9482 0.0055  -0.1981 -0.0617 25  SER L O   
1868 C CB  . SER B 25  ? 0.4567 0.8980 0.8032 0.0129  -0.1246 -0.0535 25  SER L CB  
1869 O OG  . SER B 25  ? 0.5005 0.9291 0.8498 0.0419  -0.1463 -0.0663 25  SER L OG  
1870 N N   . SER B 26  ? 0.4755 0.9243 0.8898 -0.0513 -0.1518 -0.0488 26  SER L N   
1871 C CA  . SER B 26  ? 0.5120 0.9662 0.9647 -0.0711 -0.1692 -0.0531 26  SER L CA  
1872 C C   . SER B 26  ? 0.5803 1.0416 1.0629 -0.0504 -0.1787 -0.0675 26  SER L C   
1873 O O   . SER B 26  ? 0.5961 1.0531 1.1052 -0.0526 -0.2045 -0.0732 26  SER L O   
1874 C CB  . SER B 26  ? 0.5151 0.9902 0.9886 -0.1164 -0.1452 -0.0463 26  SER L CB  
1875 O OG  . SER B 26  ? 0.5875 1.0861 1.0666 -0.1200 -0.1090 -0.0469 26  SER L OG  
1876 N N   . GLN B 27  ? 0.5880 1.0574 1.0650 -0.0306 -0.1602 -0.0735 27  GLN L N   
1877 C CA  . GLN B 27  ? 0.5980 1.0670 1.0974 -0.0071 -0.1720 -0.0887 27  GLN L CA  
1878 C C   . GLN B 27  ? 0.5587 1.0089 1.0199 0.0295  -0.1727 -0.0925 27  GLN L C   
1879 O O   . GLN B 27  ? 0.6430 1.0897 1.0658 0.0335  -0.1565 -0.0838 27  GLN L O   
1880 C CB  . GLN B 27  ? 0.6751 1.1765 1.2165 -0.0261 -0.1492 -0.0968 27  GLN L CB  
1881 C CG  . GLN B 27  ? 0.8289 1.3518 1.4124 -0.0632 -0.1480 -0.0965 27  GLN L CG  
1882 C CD  . GLN B 27  ? 0.9794 1.5394 1.5974 -0.0859 -0.1166 -0.1032 27  GLN L CD  
1883 O OE1 . GLN B 27  ? 0.9901 1.5614 1.6315 -0.0698 -0.1140 -0.1182 27  GLN L OE1 
1884 N NE2 . GLN B 27  ? 1.0339 1.6110 1.6540 -0.1234 -0.0934 -0.0931 27  GLN L NE2 
1885 N N   . SER B 28  A 0.4960 0.9330 0.9672 0.0547  -0.1917 -0.1059 27  SER L N   
1886 C CA  . SER B 28  A 0.5528 0.9666 0.9845 0.0880  -0.1956 -0.1109 27  SER L CA  
1887 C C   . SER B 28  A 0.5716 1.0013 0.9928 0.0853  -0.1654 -0.1116 27  SER L C   
1888 O O   . SER B 28  A 0.5054 0.9594 0.9633 0.0693  -0.1518 -0.1174 27  SER L O   
1889 C CB  . SER B 28  A 0.5738 0.9637 1.0197 0.1133  -0.2269 -0.1255 27  SER L CB  
1890 O OG  . SER B 28  A 0.6326 1.0012 1.0445 0.1400  -0.2276 -0.1328 27  SER L OG  
1891 N N   . VAL B 29  B 0.4768 0.8937 0.8480 0.1007  -0.1555 -0.1064 27  VAL L N   
1892 C CA  . VAL B 29  B 0.5989 1.0273 0.9550 0.0991  -0.1302 -0.1059 27  VAL L CA  
1893 C C   . VAL B 29  B 0.5872 0.9885 0.9158 0.1282  -0.1444 -0.1176 27  VAL L C   
1894 O O   . VAL B 29  B 0.6576 1.0583 0.9576 0.1325  -0.1292 -0.1169 27  VAL L O   
1895 C CB  . VAL B 29  B 0.5372 0.9763 0.8584 0.0868  -0.1022 -0.0892 27  VAL L CB  
1896 C CG1 . VAL B 29  B 0.5075 0.9669 0.8548 0.0559  -0.0912 -0.0786 27  VAL L CG1 
1897 C CG2 . VAL B 29  B 0.5112 0.9272 0.7819 0.1077  -0.1100 -0.0851 27  VAL L CG2 
1898 N N   . LEU B 30  C 0.5780 0.9537 0.9136 0.1472  -0.1755 -0.1281 27  LEU L N   
1899 C CA  . LEU B 30  C 0.5952 0.9373 0.9047 0.1743  -0.1942 -0.1405 27  LEU L CA  
1900 C C   . LEU B 30  C 0.5837 0.9315 0.9320 0.1726  -0.1990 -0.1554 27  LEU L C   
1901 O O   . LEU B 30  C 0.6370 0.9939 1.0374 0.1666  -0.2125 -0.1637 27  LEU L O   
1902 C CB  . LEU B 30  C 0.5850 0.8939 0.8871 0.1955  -0.2274 -0.1457 27  LEU L CB  
1903 C CG  . LEU B 30  C 0.6186 0.8844 0.8684 0.2242  -0.2442 -0.1531 27  LEU L CG  
1904 C CD1 . LEU B 30  C 0.6236 0.8567 0.8896 0.2428  -0.2812 -0.1638 27  LEU L CD1 
1905 C CD2 . LEU B 30  C 0.6049 0.8624 0.8348 0.2278  -0.2359 -0.1606 27  LEU L CD2 
1906 N N   . TYR B 31  D 0.5445 0.8872 0.8669 0.1778  -0.1892 -0.1595 27  TYR L N   
1907 C CA  . TYR B 31  D 0.6182 0.9646 0.9714 0.1784  -0.1946 -0.1758 27  TYR L CA  
1908 C C   . TYR B 31  D 0.6615 0.9607 0.9990 0.2052  -0.2290 -0.1925 27  TYR L C   
1909 O O   . TYR B 31  D 0.7780 1.0449 1.0570 0.2199  -0.2337 -0.1918 27  TYR L O   
1910 C CB  . TYR B 31  D 0.5996 0.9598 0.9243 0.1704  -0.1690 -0.1702 27  TYR L CB  
1911 C CG  . TYR B 31  D 0.6531 1.0338 1.0169 0.1628  -0.1649 -0.1841 27  TYR L CG  
1912 C CD1 . TYR B 31  D 0.6295 1.0495 1.0597 0.1434  -0.1554 -0.1894 27  TYR L CD1 
1913 C CD2 . TYR B 31  D 0.6990 1.0610 1.0311 0.1735  -0.1697 -0.1922 27  TYR L CD2 
1914 C CE1 . TYR B 31  D 0.5943 1.0370 1.0625 0.1371  -0.1505 -0.2046 27  TYR L CE1 
1915 C CE2 . TYR B 31  D 0.7164 1.0977 1.0845 0.1681  -0.1680 -0.2067 27  TYR L CE2 
1916 C CZ  . TYR B 31  D 0.6590 1.0824 1.0970 0.1507  -0.1577 -0.2137 27  TYR L CZ  
1917 O OH  . TYR B 31  D 0.6478 1.0935 1.1237 0.1461  -0.1554 -0.2306 27  TYR L OH  
1918 N N   . SER B 32  E 0.6025 0.8951 0.9895 0.2106  -0.2536 -0.2075 27  SER L N   
1919 C CA  . SER B 32  E 0.6430 0.8875 1.0187 0.2352  -0.2878 -0.2251 27  SER L CA  
1920 C C   . SER B 32  E 0.6911 0.9274 1.0442 0.2379  -0.2840 -0.2346 27  SER L C   
1921 O O   . SER B 32  E 0.7816 1.0569 1.1599 0.2211  -0.2614 -0.2346 27  SER L O   
1922 C CB  . SER B 32  E 0.6812 0.9279 1.1251 0.2371  -0.3118 -0.2415 27  SER L CB  
1923 O OG  . SER B 32  E 0.7252 1.0024 1.2076 0.2216  -0.3049 -0.2316 27  SER L OG  
1924 N N   . SER B 33  F 0.7115 0.8954 1.0152 0.2581  -0.3072 -0.2429 27  SER L N   
1925 C CA  . SER B 33  F 0.7570 0.9267 1.0230 0.2598  -0.3051 -0.2489 27  SER L CA  
1926 C C   . SER B 33  F 0.8437 1.0311 1.0564 0.2488  -0.2726 -0.2273 27  SER L C   
1927 O O   . SER B 33  F 0.7983 1.0313 1.0330 0.2312  -0.2436 -0.2129 27  SER L O   
1928 C CB  . SER B 33  F 0.6529 0.8529 0.9767 0.2507  -0.3035 -0.2650 27  SER L CB  
1929 O OG  . SER B 33  F 0.6128 0.8681 0.9558 0.2286  -0.2666 -0.2526 27  SER L OG  
1930 N N   . ASN B 34  ? 0.9824 1.1307 1.1232 0.2583  -0.2787 -0.2255 28  ASN L N   
1931 C CA  . ASN B 34  ? 0.8824 1.0364 0.9633 0.2527  -0.2536 -0.2055 28  ASN L CA  
1932 C C   . ASN B 34  ? 0.9142 1.0725 0.9899 0.2559  -0.2482 -0.1939 28  ASN L C   
1933 O O   . ASN B 34  ? 0.9952 1.1444 1.0147 0.2581  -0.2369 -0.1830 28  ASN L O   
1934 C CB  . ASN B 34  ? 0.7581 0.9541 0.8378 0.2335  -0.2208 -0.1931 28  ASN L CB  
1935 C CG  . ASN B 34  ? 0.6953 0.9449 0.8226 0.2156  -0.1923 -0.1792 28  ASN L CG  
1936 O OD1 . ASN B 34  ? 0.6070 0.8648 0.7646 0.2159  -0.1957 -0.1771 28  ASN L OD1 
1937 N ND2 . ASN B 34  ? 0.5878 0.8709 0.7184 0.1990  -0.1655 -0.1692 28  ASN L ND2 
1938 N N   . ASN B 35  ? 0.6769 0.8468 0.8095 0.2569  -0.2590 -0.1979 29  ASN L N   
1939 C CA  . ASN B 35  ? 0.8107 0.9833 0.9433 0.2606  -0.2595 -0.1884 29  ASN L CA  
1940 C C   . ASN B 35  ? 0.8725 1.0742 0.9766 0.2491  -0.2283 -0.1692 29  ASN L C   
1941 O O   . ASN B 35  ? 0.8850 1.0791 0.9690 0.2568  -0.2313 -0.1636 29  ASN L O   
1942 C CB  . ASN B 35  ? 0.9375 1.0553 1.0310 0.2844  -0.2897 -0.1967 29  ASN L CB  
1943 C CG  . ASN B 35  ? 1.1052 1.2233 1.2142 0.2912  -0.2998 -0.1916 29  ASN L CG  
1944 O OD1 . ASN B 35  ? 1.1669 1.2968 1.3335 0.2886  -0.3126 -0.1950 29  ASN L OD1 
1945 N ND2 . ASN B 35  ? 1.1491 1.2547 1.2066 0.2998  -0.2952 -0.1845 29  ASN L ND2 
1946 N N   . LYS B 36  ? 0.6682 1.2309 0.7446 0.1675  -0.0979 -0.0446 30  LYS L N   
1947 C CA  . LYS B 36  ? 0.6633 1.2102 0.7246 0.1644  -0.0842 -0.0343 30  LYS L CA  
1948 C C   . LYS B 36  ? 0.6451 1.1755 0.6977 0.1468  -0.0748 -0.0526 30  LYS L C   
1949 O O   . LYS B 36  ? 0.5776 1.1119 0.6497 0.1335  -0.0747 -0.0710 30  LYS L O   
1950 C CB  . LYS B 36  ? 0.6343 1.1846 0.7255 0.1656  -0.0803 -0.0192 30  LYS L CB  
1951 C CG  . LYS B 36  ? 0.6480 1.2099 0.7452 0.1814  -0.0891 0.0028  30  LYS L CG  
1952 C CD  . LYS B 36  ? 0.7951 1.3541 0.8562 0.1924  -0.0849 0.0217  30  LYS L CD  
1953 C CE  . LYS B 36  ? 0.9512 1.5217 1.0069 0.2075  -0.0944 0.0420  30  LYS L CE  
1954 N NZ  . LYS B 36  ? 0.9763 1.5481 1.0449 0.2109  -0.0898 0.0683  30  LYS L NZ  
1955 N N   . SER B 37  ? 0.6824 1.1945 0.7053 0.1465  -0.0672 -0.0476 31  SER L N   
1956 C CA  . SER B 37  ? 0.6120 1.1033 0.6244 0.1298  -0.0590 -0.0613 31  SER L CA  
1957 C C   . SER B 37  ? 0.6228 1.1081 0.6529 0.1243  -0.0498 -0.0536 31  SER L C   
1958 O O   . SER B 37  ? 0.6736 1.1586 0.7021 0.1344  -0.0476 -0.0359 31  SER L O   
1959 C CB  . SER B 37  ? 0.6742 1.1449 0.6435 0.1329  -0.0589 -0.0629 31  SER L CB  
1960 O OG  . SER B 37  ? 0.8187 1.2949 0.7698 0.1413  -0.0690 -0.0684 31  SER L OG  
1961 N N   . TYR B 38  ? 0.5999 1.0819 0.6481 0.1082  -0.0444 -0.0673 32  TYR L N   
1962 C CA  . TYR B 38  ? 0.5795 1.0559 0.6449 0.1035  -0.0373 -0.0621 32  TYR L CA  
1963 C C   . TYR B 38  ? 0.5680 1.0167 0.6039 0.0969  -0.0309 -0.0610 32  TYR L C   
1964 O O   . TYR B 38  ? 0.5353 0.9684 0.5661 0.0810  -0.0244 -0.0728 32  TYR L O   
1965 C CB  . TYR B 38  ? 0.6603 1.1472 0.7583 0.0914  -0.0340 -0.0776 32  TYR L CB  
1966 C CG  . TYR B 38  ? 0.6442 1.1562 0.7800 0.1025  -0.0420 -0.0731 32  TYR L CG  
1967 C CD1 . TYR B 38  ? 0.6137 1.1418 0.7513 0.1132  -0.0526 -0.0711 32  TYR L CD1 
1968 C CD2 . TYR B 38  ? 0.6164 1.1333 0.7843 0.1030  -0.0407 -0.0711 32  TYR L CD2 
1969 C CE1 . TYR B 38  ? 0.6220 1.1695 0.7917 0.1240  -0.0622 -0.0660 32  TYR L CE1 
1970 C CE2 . TYR B 38  ? 0.5906 1.1266 0.7924 0.1139  -0.0501 -0.0668 32  TYR L CE2 
1971 C CZ  . TYR B 38  ? 0.6103 1.1610 0.8126 0.1244  -0.0611 -0.0637 32  TYR L CZ  
1972 O OH  . TYR B 38  ? 0.5682 1.1347 0.8022 0.1360  -0.0728 -0.0585 32  TYR L OH  
1973 N N   . LEU B 39  ? 0.5804 1.0238 0.5966 0.1098  -0.0330 -0.0465 33  LEU L N   
1974 C CA  . LEU B 39  ? 0.5888 1.0072 0.5776 0.1075  -0.0299 -0.0448 33  LEU L CA  
1975 C C   . LEU B 39  ? 0.5151 0.9387 0.5125 0.1203  -0.0295 -0.0254 33  LEU L C   
1976 O O   . LEU B 39  ? 0.5462 0.9897 0.5521 0.1343  -0.0317 -0.0117 33  LEU L O   
1977 C CB  . LEU B 39  ? 0.6795 1.0847 0.6315 0.1110  -0.0338 -0.0508 33  LEU L CB  
1978 C CG  . LEU B 39  ? 0.7001 1.0739 0.6228 0.1061  -0.0326 -0.0533 33  LEU L CG  
1979 C CD1 . LEU B 39  ? 0.6126 0.9635 0.5213 0.0845  -0.0301 -0.0702 33  LEU L CD1 
1980 C CD2 . LEU B 39  ? 0.7699 1.1361 0.6625 0.1204  -0.0378 -0.0509 33  LEU L CD2 
1981 N N   . ALA B 40  ? 0.4886 0.8944 0.4827 0.1147  -0.0268 -0.0242 34  ALA L N   
1982 C CA  . ALA B 40  ? 0.5081 0.9191 0.5151 0.1243  -0.0267 -0.0072 34  ALA L CA  
1983 C C   . ALA B 40  ? 0.5469 0.9352 0.5280 0.1255  -0.0276 -0.0079 34  ALA L C   
1984 O O   . ALA B 40  ? 0.6164 0.9783 0.5722 0.1148  -0.0283 -0.0214 34  ALA L O   
1985 C CB  . ALA B 40  ? 0.4814 0.8957 0.5214 0.1174  -0.0256 -0.0041 34  ALA L CB  
1986 N N   . TRP B 41  ? 0.4950 0.8937 0.4836 0.1381  -0.0279 0.0069  35  TRP L N   
1987 C CA  . TRP B 41  ? 0.5675 0.9477 0.5388 0.1415  -0.0305 0.0066  35  TRP L CA  
1988 C C   . TRP B 41  ? 0.5466 0.9304 0.5456 0.1407  -0.0312 0.0172  35  TRP L C   
1989 O O   . TRP B 41  ? 0.5669 0.9756 0.5972 0.1455  -0.0288 0.0318  35  TRP L O   
1990 C CB  . TRP B 41  ? 0.5805 0.9714 0.5360 0.1589  -0.0307 0.0119  35  TRP L CB  
1991 C CG  . TRP B 41  ? 0.6134 0.9930 0.5358 0.1606  -0.0330 -0.0009 35  TRP L CG  
1992 C CD1 . TRP B 41  ? 0.5699 0.9668 0.4889 0.1658  -0.0319 -0.0012 35  TRP L CD1 
1993 C CD2 . TRP B 41  ? 0.6222 0.9682 0.5090 0.1567  -0.0386 -0.0152 35  TRP L CD2 
1994 N NE1 . TRP B 41  ? 0.5581 0.9354 0.4434 0.1653  -0.0365 -0.0158 35  TRP L NE1 
1995 C CE2 . TRP B 41  ? 0.6141 0.9591 0.4791 0.1593  -0.0404 -0.0242 35  TRP L CE2 
1996 C CE3 . TRP B 41  ? 0.5983 0.9126 0.4681 0.1512  -0.0438 -0.0210 35  TRP L CE3 
1997 C CZ2 . TRP B 41  ? 0.6599 0.9726 0.4882 0.1555  -0.0469 -0.0386 35  TRP L CZ2 
1998 C CZ3 . TRP B 41  ? 0.6002 0.8810 0.4312 0.1479  -0.0503 -0.0344 35  TRP L CZ3 
1999 C CH2 . TRP B 41  ? 0.6144 0.8945 0.4259 0.1496  -0.0516 -0.0429 35  TRP L CH2 
2000 N N   . TYR B 42  ? 0.4697 0.8269 0.4560 0.1344  -0.0357 0.0103  36  TYR L N   
2001 C CA  . TYR B 42  ? 0.4574 0.8155 0.4679 0.1343  -0.0389 0.0189  36  TYR L CA  
2002 C C   . TYR B 42  ? 0.5501 0.8969 0.5469 0.1433  -0.0450 0.0195  36  TYR L C   
2003 O O   . TYR B 42  ? 0.5989 0.9238 0.5605 0.1454  -0.0485 0.0094  36  TYR L O   
2004 C CB  . TYR B 42  ? 0.4051 0.7424 0.4187 0.1186  -0.0409 0.0099  36  TYR L CB  
2005 C CG  . TYR B 42  ? 0.4532 0.8020 0.4850 0.1104  -0.0357 0.0065  36  TYR L CG  
2006 C CD1 . TYR B 42  ? 0.4902 0.8330 0.5024 0.1028  -0.0316 -0.0066 36  TYR L CD1 
2007 C CD2 . TYR B 42  ? 0.4622 0.8268 0.5322 0.1100  -0.0362 0.0155  36  TYR L CD2 
2008 C CE1 . TYR B 42  ? 0.5222 0.8779 0.5545 0.0965  -0.0277 -0.0117 36  TYR L CE1 
2009 C CE2 . TYR B 42  ? 0.5328 0.9065 0.6206 0.1043  -0.0332 0.0107  36  TYR L CE2 
2010 C CZ  . TYR B 42  ? 0.5536 0.9244 0.6233 0.0982  -0.0288 -0.0034 36  TYR L CZ  
2011 O OH  . TYR B 42  ? 0.5213 0.9042 0.6120 0.0938  -0.0266 -0.0099 36  TYR L OH  
2012 N N   . GLN B 43  ? 0.5031 0.8643 0.5298 0.1483  -0.0473 0.0312  37  GLN L N   
2013 C CA  . GLN B 43  ? 0.4718 0.8261 0.4946 0.1573  -0.0547 0.0316  37  GLN L CA  
2014 C C   . GLN B 43  ? 0.5192 0.8513 0.5496 0.1479  -0.0641 0.0285  37  GLN L C   
2015 O O   . GLN B 43  ? 0.5416 0.8846 0.6039 0.1414  -0.0637 0.0356  37  GLN L O   
2016 C CB  . GLN B 43  ? 0.4512 0.8448 0.5058 0.1712  -0.0497 0.0475  37  GLN L CB  
2017 C CG  . GLN B 43  ? 0.4397 0.8347 0.5019 0.1815  -0.0570 0.0483  37  GLN L CG  
2018 C CD  . GLN B 43  ? 0.4953 0.9349 0.5941 0.1927  -0.0490 0.0647  37  GLN L CD  
2019 O OE1 . GLN B 43  ? 0.5627 1.0236 0.6969 0.1863  -0.0445 0.0787  37  GLN L OE1 
2020 N NE2 . GLN B 43  ? 0.4571 0.9110 0.5470 0.2091  -0.0467 0.0629  37  GLN L NE2 
2021 N N   . GLN B 44  ? 0.5381 0.8369 0.5381 0.1474  -0.0742 0.0179  38  GLN L N   
2022 C CA  . GLN B 44  ? 0.5128 0.7908 0.5182 0.1404  -0.0851 0.0156  38  GLN L CA  
2023 C C   . GLN B 44  ? 0.5421 0.8135 0.5477 0.1523  -0.0978 0.0159  38  GLN L C   
2024 O O   . GLN B 44  ? 0.6299 0.8770 0.6006 0.1583  -0.1048 0.0076  38  GLN L O   
2025 C CB  . GLN B 44  ? 0.5578 0.7956 0.5268 0.1241  -0.0877 0.0020  38  GLN L CB  
2026 C CG  . GLN B 44  ? 0.5191 0.7385 0.4953 0.1161  -0.0977 -0.0003 38  GLN L CG  
2027 C CD  . GLN B 44  ? 0.6480 0.8301 0.5858 0.0994  -0.0976 -0.0137 38  GLN L CD  
2028 O OE1 . GLN B 44  ? 0.7864 0.9429 0.6817 0.0949  -0.0966 -0.0217 38  GLN L OE1 
2029 N NE2 . GLN B 44  ? 0.6505 0.8290 0.6024 0.0896  -0.0982 -0.0164 38  GLN L NE2 
2030 N N   . LYS B 45  ? 0.5075 0.8006 0.5548 0.1554  -0.1020 0.0254  39  LYS L N   
2031 C CA  . LYS B 45  ? 0.5332 0.8265 0.5918 0.1666  -0.1151 0.0258  39  LYS L CA  
2032 C C   . LYS B 45  ? 0.6032 0.8611 0.6517 0.1573  -0.1313 0.0186  39  LYS L C   
2033 O O   . LYS B 45  ? 0.6148 0.8667 0.6730 0.1439  -0.1304 0.0188  39  LYS L O   
2034 C CB  . LYS B 45  ? 0.4813 0.8229 0.5961 0.1741  -0.1099 0.0411  39  LYS L CB  
2035 C CG  . LYS B 45  ? 0.4516 0.8295 0.5744 0.1877  -0.0964 0.0481  39  LYS L CG  
2036 C CD  . LYS B 45  ? 0.5174 0.9417 0.6937 0.1884  -0.0872 0.0658  39  LYS L CD  
2037 C CE  . LYS B 45  ? 0.6613 1.1238 0.8438 0.2025  -0.0727 0.0734  39  LYS L CE  
2038 N NZ  . LYS B 45  ? 0.7335 1.2390 0.9631 0.1993  -0.0613 0.0932  39  LYS L NZ  
2039 N N   . PRO B 46  ? 0.6415 0.8752 0.6701 0.1654  -0.1474 0.0116  40  PRO L N   
2040 C CA  . PRO B 46  ? 0.6952 0.8889 0.7043 0.1574  -0.1653 0.0038  40  PRO L CA  
2041 C C   . PRO B 46  ? 0.7111 0.9152 0.7562 0.1468  -0.1673 0.0084  40  PRO L C   
2042 O O   . PRO B 46  ? 0.7068 0.9482 0.8042 0.1520  -0.1668 0.0187  40  PRO L O   
2043 C CB  . PRO B 46  ? 0.6680 0.8587 0.6820 0.1740  -0.1831 0.0017  40  PRO L CB  
2044 C CG  . PRO B 46  ? 0.6833 0.8897 0.6883 0.1885  -0.1745 0.0016  40  PRO L CG  
2045 C CD  . PRO B 46  ? 0.6204 0.8655 0.6477 0.1846  -0.1510 0.0107  40  PRO L CD  
2046 N N   . GLY B 47  ? 0.7382 0.9094 0.7552 0.1316  -0.1691 0.0004  41  GLY L N   
2047 C CA  . GLY B 47  ? 0.6950 0.8682 0.7400 0.1223  -0.1741 0.0013  41  GLY L CA  
2048 C C   . GLY B 47  ? 0.7320 0.9428 0.8209 0.1180  -0.1586 0.0111  41  GLY L C   
2049 O O   . GLY B 47  ? 0.6881 0.9119 0.8165 0.1145  -0.1639 0.0162  41  GLY L O   
2050 N N   . GLN B 48  ? 0.7376 0.9641 0.8192 0.1183  -0.1411 0.0138  42  GLN L N   
2051 C CA  . GLN B 48  ? 0.6376 0.8961 0.7562 0.1148  -0.1278 0.0234  42  GLN L CA  
2052 C C   . GLN B 48  ? 0.5678 0.8167 0.6577 0.1066  -0.1144 0.0156  42  GLN L C   
2053 O O   . GLN B 48  ? 0.6444 0.8710 0.6902 0.1053  -0.1121 0.0063  42  GLN L O   
2054 C CB  . GLN B 48  ? 0.6877 0.9894 0.8407 0.1267  -0.1196 0.0390  42  GLN L CB  
2055 C CG  . GLN B 48  ? 0.6681 0.9903 0.8602 0.1346  -0.1297 0.0481  42  GLN L CG  
2056 C CD  . GLN B 48  ? 0.7261 1.0959 0.9546 0.1437  -0.1171 0.0647  42  GLN L CD  
2057 O OE1 . GLN B 48  ? 0.7576 1.1426 0.9794 0.1447  -0.1022 0.0698  42  GLN L OE1 
2058 N NE2 . GLN B 48  ? 0.7425 1.1371 1.0094 0.1500  -0.1230 0.0731  42  GLN L NE2 
2059 N N   . PRO B 49  ? 0.4819 0.7469 0.5984 0.1008  -0.1066 0.0190  43  PRO L N   
2060 C CA  . PRO B 49  ? 0.4578 0.7237 0.5581 0.0949  -0.0933 0.0127  43  PRO L CA  
2061 C C   . PRO B 49  ? 0.5223 0.8122 0.6206 0.1040  -0.0830 0.0207  43  PRO L C   
2062 O O   . PRO B 49  ? 0.5473 0.8620 0.6690 0.1144  -0.0833 0.0341  43  PRO L O   
2063 C CB  . PRO B 49  ? 0.4616 0.7435 0.6022 0.0907  -0.0914 0.0174  43  PRO L CB  
2064 C CG  . PRO B 49  ? 0.4424 0.7423 0.6242 0.0963  -0.0998 0.0325  43  PRO L CG  
2065 C CD  . PRO B 49  ? 0.3795 0.6592 0.5431 0.0985  -0.1122 0.0275  43  PRO L CD  
2066 N N   . PRO B 50  ? 0.4784 0.7621 0.5487 0.0998  -0.0738 0.0118  44  PRO L N   
2067 C CA  . PRO B 50  ? 0.4448 0.7500 0.5112 0.1084  -0.0653 0.0178  44  PRO L CA  
2068 C C   . PRO B 50  ? 0.4840 0.8257 0.5934 0.1143  -0.0603 0.0340  44  PRO L C   
2069 O O   . PRO B 50  ? 0.4964 0.8428 0.6325 0.1084  -0.0609 0.0361  44  PRO L O   
2070 C CB  . PRO B 50  ? 0.4567 0.7496 0.4953 0.0989  -0.0576 0.0042  44  PRO L CB  
2071 C CG  . PRO B 50  ? 0.5009 0.7609 0.5167 0.0860  -0.0615 -0.0096 44  PRO L CG  
2072 C CD  . PRO B 50  ? 0.4213 0.6799 0.4640 0.0863  -0.0705 -0.0047 44  PRO L CD  
2073 N N   . LYS B 51  ? 0.5618 0.9275 0.6762 0.1261  -0.0559 0.0453  45  LYS L N   
2074 C CA  . LYS B 51  ? 0.5671 0.9664 0.7143 0.1313  -0.0497 0.0623  45  LYS L CA  
2075 C C   . LYS B 51  ? 0.5536 0.9633 0.6819 0.1354  -0.0415 0.0605  45  LYS L C   
2076 O O   . LYS B 51  ? 0.5394 0.9421 0.6356 0.1408  -0.0400 0.0527  45  LYS L O   
2077 C CB  . LYS B 51  ? 0.5471 0.9706 0.7167 0.1414  -0.0495 0.0780  45  LYS L CB  
2078 C CG  . LYS B 51  ? 0.6364 1.0931 0.8385 0.1444  -0.0425 0.0984  45  LYS L CG  
2079 C CD  . LYS B 51  ? 0.6621 1.1448 0.8927 0.1508  -0.0411 0.1144  45  LYS L CD  
2080 C CE  . LYS B 51  ? 0.6723 1.1770 0.8858 0.1648  -0.0319 0.1180  45  LYS L CE  
2081 N NZ  . LYS B 51  ? 0.6514 1.1909 0.8987 0.1699  -0.0262 0.1364  45  LYS L NZ  
2082 N N   . LEU B 52  ? 0.5076 0.9319 0.6553 0.1333  -0.0382 0.0670  46  LEU L N   
2083 C CA  . LEU B 52  ? 0.4981 0.9338 0.6307 0.1378  -0.0326 0.0658  46  LEU L CA  
2084 C C   . LEU B 52  ? 0.5560 1.0168 0.6861 0.1512  -0.0274 0.0804  46  LEU L C   
2085 O O   . LEU B 52  ? 0.5382 1.0190 0.6951 0.1549  -0.0256 0.0985  46  LEU L O   
2086 C CB  . LEU B 52  ? 0.4157 0.8592 0.5709 0.1332  -0.0329 0.0681  46  LEU L CB  
2087 C CG  . LEU B 52  ? 0.4655 0.9229 0.6090 0.1388  -0.0296 0.0680  46  LEU L CG  
2088 C CD1 . LEU B 52  ? 0.4752 0.9168 0.5858 0.1344  -0.0286 0.0470  46  LEU L CD1 
2089 C CD2 . LEU B 52  ? 0.4297 0.8969 0.6014 0.1371  -0.0326 0.0738  46  LEU L CD2 
2090 N N   . LEU B 53  ? 0.5983 1.0580 0.6960 0.1578  -0.0247 0.0722  47  LEU L N   
2091 C CA  . LEU B 53  ? 0.5917 1.0744 0.6803 0.1720  -0.0190 0.0825  47  LEU L CA  
2092 C C   . LEU B 53  ? 0.6205 1.1155 0.6990 0.1758  -0.0165 0.0844  47  LEU L C   
2093 O O   . LEU B 53  ? 0.6357 1.1548 0.7257 0.1823  -0.0122 0.1016  47  LEU L O   
2094 C CB  . LEU B 53  ? 0.4293 0.8993 0.4853 0.1798  -0.0201 0.0700  47  LEU L CB  
2095 C CG  . LEU B 53  ? 0.4172 0.8759 0.4769 0.1809  -0.0245 0.0674  47  LEU L CG  
2096 C CD1 . LEU B 53  ? 0.5906 1.0291 0.6122 0.1880  -0.0283 0.0520  47  LEU L CD1 
2097 C CD2 . LEU B 53  ? 0.3580 0.8476 0.4476 0.1895  -0.0196 0.0852  47  LEU L CD2 
2098 N N   . ILE B 54  ? 0.6115 1.0394 0.5813 0.1437  0.0334  -0.0057 48  ILE L N   
2099 C CA  . ILE B 54  ? 0.5726 0.9970 0.5117 0.1705  0.0258  -0.0196 48  ILE L CA  
2100 C C   . ILE B 54  ? 0.5831 0.9905 0.5200 0.1622  0.0121  -0.0340 48  ILE L C   
2101 O O   . ILE B 54  ? 0.6000 1.0002 0.5607 0.1394  0.0025  -0.0423 48  ILE L O   
2102 C CB  . ILE B 54  ? 0.6332 1.0701 0.5713 0.1868  0.0125  -0.0405 48  ILE L CB  
2103 C CG1 . ILE B 54  ? 0.5690 1.0249 0.5099 0.1940  0.0227  -0.0284 48  ILE L CG1 
2104 C CG2 . ILE B 54  ? 0.7045 1.1401 0.6143 0.2193  0.0024  -0.0585 48  ILE L CG2 
2105 C CD1 . ILE B 54  ? 0.4973 0.9612 0.4097 0.2248  0.0366  -0.0144 48  ILE L CD1 
2106 N N   . TYR B 55  ? 0.5894 0.9889 0.4950 0.1832  0.0117  -0.0378 49  TYR L N   
2107 C CA  . TYR B 55  ? 0.6002 0.9886 0.5020 0.1804  -0.0040 -0.0575 49  TYR L CA  
2108 C C   . TYR B 55  ? 0.6737 1.0669 0.5511 0.2150  -0.0158 -0.0835 49  TYR L C   
2109 O O   . TYR B 55  ? 0.6569 1.0561 0.5092 0.2457  -0.0097 -0.0808 49  TYR L O   
2110 C CB  . TYR B 55  ? 0.5571 0.9277 0.4455 0.1686  0.0023  -0.0412 49  TYR L CB  
2111 C CG  . TYR B 55  ? 0.6924 1.0540 0.5399 0.1919  0.0189  -0.0248 49  TYR L CG  
2112 C CD1 . TYR B 55  ? 0.8166 1.1686 0.6222 0.2221  0.0132  -0.0396 49  TYR L CD1 
2113 C CD2 . TYR B 55  ? 0.8016 1.1622 0.6515 0.1854  0.0418  0.0041  49  TYR L CD2 
2114 C CE1 . TYR B 55  ? 0.9534 1.2900 0.7135 0.2476  0.0311  -0.0242 49  TYR L CE1 
2115 C CE2 . TYR B 55  ? 0.9134 1.2601 0.7242 0.2071  0.0621  0.0208  49  TYR L CE2 
2116 C CZ  . TYR B 55  ? 0.9957 1.3276 0.7579 0.2393  0.0574  0.0076  49  TYR L CZ  
2117 O OH  . TYR B 55  ? 1.0828 1.3939 0.7979 0.2651  0.0802  0.0245  49  TYR L OH  
2118 N N   . TRP B 56  ? 0.7404 1.1312 0.6267 0.2120  -0.0329 -0.1101 50  TRP L N   
2119 C CA  . TRP B 56  ? 0.7587 1.1574 0.6320 0.2441  -0.0481 -0.1425 50  TRP L CA  
2120 C C   . TRP B 56  ? 0.8039 1.2178 0.6843 0.2621  -0.0513 -0.1510 50  TRP L C   
2121 O O   . TRP B 56  ? 0.8286 1.2483 0.6827 0.3009  -0.0563 -0.1629 50  TRP L O   
2122 C CB  . TRP B 56  ? 0.7620 1.1513 0.5857 0.2778  -0.0452 -0.1419 50  TRP L CB  
2123 C CG  . TRP B 56  ? 0.9035 1.2808 0.7174 0.2690  -0.0525 -0.1507 50  TRP L CG  
2124 C CD1 . TRP B 56  ? 0.9242 1.3035 0.7714 0.2421  -0.0652 -0.1674 50  TRP L CD1 
2125 C CD2 . TRP B 56  ? 0.9502 1.3101 0.7141 0.2893  -0.0469 -0.1436 50  TRP L CD2 
2126 N NE1 . TRP B 56  ? 0.9157 1.2834 0.7380 0.2440  -0.0698 -0.1710 50  TRP L NE1 
2127 C CE2 . TRP B 56  ? 0.9705 1.3253 0.7397 0.2728  -0.0595 -0.1572 50  TRP L CE2 
2128 C CE3 . TRP B 56  ? 1.0056 1.3505 0.7176 0.3209  -0.0306 -0.1263 50  TRP L CE3 
2129 C CZ2 . TRP B 56  ? 1.0489 1.3856 0.7707 0.2873  -0.0590 -0.1553 50  TRP L CZ2 
2130 C CZ3 . TRP B 56  ? 1.1457 1.4684 0.8095 0.3355  -0.0275 -0.1241 50  TRP L CZ3 
2131 C CH2 . TRP B 56  ? 1.1720 1.4914 0.8397 0.3187  -0.0429 -0.1391 50  TRP L CH2 
2132 N N   . ALA B 57  ? 0.7544 1.1725 0.6663 0.2364  -0.0489 -0.1448 51  ALA L N   
2133 C CA  . ALA B 57  ? 0.7201 1.1512 0.6411 0.2489  -0.0551 -0.1562 51  ALA L CA  
2134 C C   . ALA B 57  ? 0.6597 1.0999 0.5556 0.2719  -0.0436 -0.1342 51  ALA L C   
2135 O O   . ALA B 57  ? 0.7042 1.1535 0.6104 0.2679  -0.0424 -0.1294 51  ALA L O   
2136 C CB  . ALA B 57  ? 0.7830 1.2212 0.7090 0.2726  -0.0754 -0.1954 51  ALA L CB  
2137 N N   . SER B 58  ? 0.5430 0.9789 0.4035 0.2972  -0.0339 -0.1209 52  SER L N   
2138 C CA  . SER B 58  ? 0.6489 1.0920 0.4829 0.3262  -0.0218 -0.1025 52  SER L CA  
2139 C C   . SER B 58  ? 0.7461 1.1779 0.5521 0.3321  0.0042  -0.0699 52  SER L C   
2140 O O   . SER B 58  ? 0.8258 1.2618 0.6095 0.3574  0.0180  -0.0532 52  SER L O   
2141 C CB  . SER B 58  ? 0.7466 1.1964 0.5573 0.3737  -0.0383 -0.1274 52  SER L CB  
2142 O OG  . SER B 58  ? 0.8463 1.2850 0.6326 0.3986  -0.0466 -0.1465 52  SER L OG  
2143 N N   . THR B 59  ? 0.6898 1.1061 0.4963 0.3097  0.0122  -0.0598 53  THR L N   
2144 C CA  . THR B 59  ? 0.7490 1.1511 0.5313 0.3123  0.0394  -0.0284 53  THR L CA  
2145 C C   . THR B 59  ? 0.8140 1.2225 0.6325 0.2730  0.0559  -0.0026 53  THR L C   
2146 O O   . THR B 59  ? 0.8503 1.2587 0.7018 0.2379  0.0472  -0.0061 53  THR L O   
2147 C CB  . THR B 59  ? 0.8168 1.1949 0.5720 0.3139  0.0403  -0.0303 53  THR L CB  
2148 O OG1 . THR B 59  ? 0.8985 1.2711 0.6170 0.3558  0.0251  -0.0572 53  THR L OG1 
2149 C CG2 . THR B 59  ? 0.7603 1.1190 0.4909 0.3141  0.0712  0.0032  53  THR L CG2 
2150 N N   . ARG B 60  ? 0.8371 1.2511 0.6505 0.2812  0.0797  0.0217  54  ARG L N   
2151 C CA  . ARG B 60  ? 0.7637 1.1860 0.6144 0.2468  0.0967  0.0436  54  ARG L CA  
2152 C C   . ARG B 60  ? 0.7776 1.1787 0.6304 0.2242  0.1100  0.0594  54  ARG L C   
2153 O O   . ARG B 60  ? 0.8185 1.1971 0.6321 0.2434  0.1237  0.0685  54  ARG L O   
2154 C CB  . ARG B 60  ? 0.7569 1.1922 0.6040 0.2623  0.1215  0.0646  54  ARG L CB  
2155 C CG  . ARG B 60  ? 0.7702 1.2330 0.6323 0.2691  0.1105  0.0556  54  ARG L CG  
2156 C CD  . ARG B 60  ? 0.9167 1.3922 0.7698 0.2894  0.1368  0.0778  54  ARG L CD  
2157 N NE  . ARG B 60  ? 1.0810 1.5423 0.8818 0.3370  0.1448  0.0817  54  ARG L NE  
2158 C CZ  . ARG B 60  ? 1.2323 1.7001 1.0072 0.3727  0.1246  0.0644  54  ARG L CZ  
2159 N NH1 . ARG B 60  ? 1.2302 1.7174 1.0272 0.3626  0.0974  0.0433  54  ARG L NH1 
2160 N NH2 . ARG B 60  ? 1.2966 1.7487 1.0216 0.4210  0.1314  0.0671  54  ARG L NH2 
2161 N N   . GLU B 61  ? 0.7043 1.1098 0.5995 0.1862  0.1053  0.0619  55  GLU L N   
2162 C CA  . GLU B 61  ? 0.6972 1.0857 0.6014 0.1635  0.1189  0.0797  55  GLU L CA  
2163 C C   . GLU B 61  ? 0.7343 1.1214 0.6383 0.1668  0.1537  0.1062  55  GLU L C   
2164 O O   . GLU B 61  ? 0.7038 1.1114 0.6202 0.1750  0.1663  0.1122  55  GLU L O   
2165 C CB  . GLU B 61  ? 0.6990 1.0940 0.6512 0.1270  0.1057  0.0760  55  GLU L CB  
2166 C CG  . GLU B 61  ? 0.9211 1.2953 0.8669 0.1138  0.0882  0.0686  55  GLU L CG  
2167 C CD  . GLU B 61  ? 1.0443 1.3952 0.9736 0.1078  0.1036  0.0879  55  GLU L CD  
2168 O OE1 . GLU B 61  ? 1.0545 1.3849 0.9483 0.1164  0.0948  0.0827  55  GLU L OE1 
2169 O OE2 . GLU B 61  ? 1.1147 1.4676 1.0671 0.0946  0.1248  0.1070  55  GLU L OE2 
2170 N N   . SER B 62  ? 0.8114 1.1730 0.7013 0.1600  0.1704  0.1223  56  SER L N   
2171 C CA  . SER B 62  ? 0.9223 1.2777 0.8186 0.1571  0.2076  0.1484  56  SER L CA  
2172 C C   . SER B 62  ? 0.8408 1.2273 0.8023 0.1298  0.2144  0.1527  56  SER L C   
2173 O O   . SER B 62  ? 0.8230 1.2182 0.8275 0.1000  0.1980  0.1454  56  SER L O   
2174 C CB  . SER B 62  ? 1.0111 1.3328 0.8924 0.1440  0.2198  0.1623  56  SER L CB  
2175 O OG  . SER B 62  ? 1.1251 1.4338 1.0075 0.1434  0.2605  0.1878  56  SER L OG  
2176 N N   . GLY B 63  ? 0.8033 1.2067 0.7705 0.1432  0.2375  0.1630  57  GLY L N   
2177 C CA  . GLY B 63  ? 0.8346 1.2687 0.8631 0.1195  0.2476  0.1663  57  GLY L CA  
2178 C C   . GLY B 63  ? 0.8240 1.2919 0.8721 0.1220  0.2237  0.1470  57  GLY L C   
2179 O O   . GLY B 63  ? 0.8634 1.3599 0.9568 0.1082  0.2302  0.1462  57  GLY L O   
2180 N N   . VAL B 64  ? 0.7519 1.2162 0.7662 0.1401  0.1964  0.1297  58  VAL L N   
2181 C CA  . VAL B 64  ? 0.6863 1.1768 0.7102 0.1457  0.1751  0.1116  58  VAL L CA  
2182 C C   . VAL B 64  ? 0.7315 1.2375 0.7314 0.1774  0.1886  0.1185  58  VAL L C   
2183 O O   . VAL B 64  ? 0.8116 1.3018 0.7642 0.2088  0.1923  0.1220  58  VAL L O   
2184 C CB  . VAL B 64  ? 0.6665 1.1452 0.6676 0.1516  0.1426  0.0894  58  VAL L CB  
2185 C CG1 . VAL B 64  ? 0.6689 1.1691 0.6732 0.1602  0.1234  0.0713  58  VAL L CG1 
2186 C CG2 . VAL B 64  ? 0.5968 1.0603 0.6206 0.1223  0.1286  0.0835  58  VAL L CG2 
2187 N N   . PRO B 65  ? 0.7529 1.2901 0.7835 0.1724  0.1947  0.1189  59  PRO L N   
2188 C CA  . PRO B 65  ? 0.7005 1.2560 0.7119 0.2019  0.2091  0.1279  59  PRO L CA  
2189 C C   . PRO B 65  ? 0.7793 1.3297 0.7415 0.2370  0.1862  0.1150  59  PRO L C   
2190 O O   . PRO B 65  ? 0.8096 1.3576 0.7698 0.2314  0.1554  0.0927  59  PRO L O   
2191 C CB  . PRO B 65  ? 0.5567 1.1488 0.6127 0.1849  0.2057  0.1198  59  PRO L CB  
2192 C CG  . PRO B 65  ? 0.5929 1.1813 0.6771 0.1561  0.1805  0.1002  59  PRO L CG  
2193 C CD  . PRO B 65  ? 0.6647 1.2221 0.7487 0.1412  0.1865  0.1086  59  PRO L CD  
2194 N N   . ASP B 66  ? 0.8717 1.4193 0.7960 0.2743  0.2019  0.1281  60  ASP L N   
2195 C CA  . ASP B 66  ? 0.9516 1.4886 0.8270 0.3126  0.1804  0.1150  60  ASP L CA  
2196 C C   . ASP B 66  ? 0.8715 1.4318 0.7468 0.3215  0.1511  0.0949  60  ASP L C   
2197 O O   . ASP B 66  ? 0.8581 1.4119 0.7000 0.3516  0.1299  0.0802  60  ASP L O   
2198 C CB  . ASP B 66  ? 1.1111 1.6327 0.9396 0.3569  0.2050  0.1343  60  ASP L CB  
2199 C CG  . ASP B 66  ? 1.2437 1.7773 1.0890 0.3548  0.2447  0.1624  60  ASP L CG  
2200 O OD1 . ASP B 66  ? 1.2686 1.8064 1.1589 0.3158  0.2630  0.1714  60  ASP L OD1 
2201 O OD2 . ASP B 66  ? 1.2957 1.8342 1.1109 0.3932  0.2580  0.1747  60  ASP L OD2 
2202 N N   . ARG B 67  ? 0.8050 1.3911 0.7170 0.2969  0.1488  0.0919  61  ARG L N   
2203 C CA  . ARG B 67  ? 0.6936 1.2975 0.6017 0.3032  0.1215  0.0721  61  ARG L CA  
2204 C C   . ARG B 67  ? 0.6745 1.2615 0.5861 0.2868  0.0924  0.0466  61  ARG L C   
2205 O O   . ARG B 67  ? 0.7093 1.3000 0.6096 0.2954  0.0684  0.0272  61  ARG L O   
2206 C CB  . ARG B 67  ? 0.7203 1.3550 0.6610 0.2852  0.1279  0.0739  61  ARG L CB  
2207 C CG  . ARG B 67  ? 0.7179 1.3536 0.7058 0.2429  0.1299  0.0683  61  ARG L CG  
2208 C CD  . ARG B 67  ? 0.7026 1.3724 0.7224 0.2324  0.1396  0.0692  61  ARG L CD  
2209 N NE  . ARG B 67  ? 0.6726 1.3449 0.7402 0.1969  0.1411  0.0618  61  ARG L NE  
2210 C CZ  . ARG B 67  ? 0.7170 1.3949 0.8240 0.1779  0.1669  0.0760  61  ARG L CZ  
2211 N NH1 . ARG B 67  ? 0.6947 1.3733 0.7963 0.1898  0.1972  0.1003  61  ARG L NH1 
2212 N NH2 . ARG B 67  ? 0.7432 1.4232 0.8943 0.1487  0.1630  0.0653  61  ARG L NH2 
2213 N N   . PHE B 68  ? 0.6630 1.2297 0.5898 0.2635  0.0963  0.0473  62  PHE L N   
2214 C CA  . PHE B 68  ? 0.7229 1.2708 0.6540 0.2479  0.0729  0.0256  62  PHE L CA  
2215 C C   . PHE B 68  ? 0.7969 1.3263 0.6957 0.2732  0.0638  0.0173  62  PHE L C   
2216 O O   . PHE B 68  ? 0.8703 1.3878 0.7515 0.2861  0.0800  0.0315  62  PHE L O   
2217 C CB  . PHE B 68  ? 0.6612 1.1970 0.6241 0.2118  0.0796  0.0302  62  PHE L CB  
2218 C CG  . PHE B 68  ? 0.6077 1.1591 0.6065 0.1871  0.0815  0.0293  62  PHE L CG  
2219 C CD1 . PHE B 68  ? 0.5989 1.1671 0.6226 0.1779  0.1048  0.0472  62  PHE L CD1 
2220 C CD2 . PHE B 68  ? 0.5374 1.0844 0.5450 0.1745  0.0611  0.0086  62  PHE L CD2 
2221 C CE1 . PHE B 68  ? 0.6028 1.1880 0.6624 0.1580  0.1040  0.0412  62  PHE L CE1 
2222 C CE2 . PHE B 68  ? 0.4876 1.0462 0.5227 0.1575  0.0613  0.0045  62  PHE L CE2 
2223 C CZ  . PHE B 68  ? 0.5257 1.1055 0.5881 0.1497  0.0809  0.0192  62  PHE L CZ  
2224 N N   . SER B 69  ? 0.7492 1.2745 0.6400 0.2815  0.0385  -0.0076 63  SER L N   
2225 C CA  . SER B 69  ? 0.7515 1.2624 0.6181 0.3060  0.0265  -0.0222 63  SER L CA  
2226 C C   . SER B 69  ? 0.7689 1.2721 0.6477 0.2961  0.0008  -0.0528 63  SER L C   
2227 O O   . SER B 69  ? 0.7851 1.2950 0.6745 0.2882  -0.0103 -0.0642 63  SER L O   
2228 C CB  . SER B 69  ? 0.7704 1.2891 0.6007 0.3534  0.0271  -0.0188 63  SER L CB  
2229 O OG  . SER B 69  ? 0.7552 1.2858 0.5822 0.3679  0.0053  -0.0375 63  SER L OG  
2230 N N   . GLY B 70  ? 0.8078 1.2957 0.6840 0.2971  -0.0070 -0.0667 64  GLY L N   
2231 C CA  . GLY B 70  ? 0.7851 1.2651 0.6785 0.2860  -0.0277 -0.0964 64  GLY L CA  
2232 C C   . GLY B 70  ? 0.7816 1.2625 0.6576 0.3219  -0.0449 -0.1212 64  GLY L C   
2233 O O   . GLY B 70  ? 0.8553 1.3333 0.7042 0.3504  -0.0407 -0.1169 64  GLY L O   
2234 N N   . SER B 71  ? 0.7171 1.1998 0.6079 0.3228  -0.0640 -0.1489 65  SER L N   
2235 C CA  . SER B 71  ? 0.7395 1.2241 0.6240 0.3546  -0.0837 -0.1794 65  SER L CA  
2236 C C   . SER B 71  ? 0.7495 1.2260 0.6692 0.3314  -0.0972 -0.2112 65  SER L C   
2237 O O   . SER B 71  ? 0.7424 1.2086 0.6864 0.2931  -0.0903 -0.2074 65  SER L O   
2238 C CB  . SER B 71  ? 0.7778 1.2756 0.6462 0.3893  -0.0962 -0.1867 65  SER L CB  
2239 O OG  . SER B 71  ? 0.8846 1.3819 0.7770 0.3708  -0.1077 -0.2046 65  SER L OG  
2240 N N   . GLY B 72  ? 0.8095 1.2898 0.7322 0.3575  -0.1157 -0.2439 66  GLY L N   
2241 C CA  . GLY B 72  ? 0.8001 1.2765 0.7618 0.3402  -0.1289 -0.2794 66  GLY L CA  
2242 C C   . GLY B 72  ? 0.8565 1.3308 0.8267 0.3422  -0.1344 -0.2996 66  GLY L C   
2243 O O   . GLY B 72  ? 0.8477 1.3202 0.7882 0.3570  -0.1279 -0.2850 66  GLY L O   
2244 N N   . SER B 73  ? 0.9255 1.3987 0.9363 0.3267  -0.1450 -0.3341 67  SER L N   
2245 C CA  . SER B 73  ? 0.8783 1.3539 0.9031 0.3297  -0.1534 -0.3611 67  SER L CA  
2246 C C   . SER B 73  ? 0.7960 1.2676 0.8753 0.2981  -0.1566 -0.3913 67  SER L C   
2247 O O   . SER B 73  ? 0.7412 1.2122 0.8463 0.2929  -0.1612 -0.4076 67  SER L O   
2248 C CB  . SER B 73  ? 0.8904 1.3807 0.8964 0.3827  -0.1741 -0.3900 67  SER L CB  
2249 O OG  . SER B 73  ? 1.0249 1.5161 1.0236 0.3927  -0.1789 -0.4062 67  SER L OG  
2250 N N   . GLY B 74  ? 0.7447 1.2116 0.8403 0.2774  -0.1525 -0.3979 68  GLY L N   
2251 C CA  . GLY B 74  ? 0.6590 1.1219 0.8080 0.2489  -0.1525 -0.4274 68  GLY L CA  
2252 C C   . GLY B 74  ? 0.6726 1.1124 0.8386 0.2087  -0.1330 -0.4062 68  GLY L C   
2253 O O   . GLY B 74  ? 0.6644 1.0888 0.8253 0.1826  -0.1183 -0.3810 68  GLY L O   
2254 N N   . THR B 75  ? 0.7501 1.1848 0.9319 0.2069  -0.1336 -0.4165 69  THR L N   
2255 C CA  . THR B 75  ? 0.8085 1.2157 1.0037 0.1725  -0.1145 -0.4025 69  THR L CA  
2256 C C   . THR B 75  ? 0.7951 1.1927 0.9542 0.1745  -0.1072 -0.3702 69  THR L C   
2257 O O   . THR B 75  ? 0.7734 1.1471 0.9259 0.1500  -0.0899 -0.3473 69  THR L O   
2258 C CB  . THR B 75  ? 0.8894 1.2880 1.1345 0.1600  -0.1145 -0.4413 69  THR L CB  
2259 O OG1 . THR B 75  ? 0.9178 1.3169 1.2017 0.1430  -0.1110 -0.4629 69  THR L OG1 
2260 C CG2 . THR B 75  ? 0.9408 1.3055 1.1852 0.1347  -0.0946 -0.4264 69  THR L CG2 
2261 N N   . ASP B 76  ? 0.8251 1.2412 0.9600 0.2065  -0.1208 -0.3700 70  ASP L N   
2262 C CA  . ASP B 76  ? 0.8825 1.2942 0.9853 0.2112  -0.1159 -0.3439 70  ASP L CA  
2263 C C   . ASP B 76  ? 0.8766 1.3040 0.9397 0.2303  -0.1148 -0.3119 70  ASP L C   
2264 O O   . ASP B 76  ? 0.9280 1.3738 0.9781 0.2600  -0.1260 -0.3178 70  ASP L O   
2265 C CB  . ASP B 76  ? 0.9361 1.3537 1.0411 0.2322  -0.1305 -0.3665 70  ASP L CB  
2266 C CG  . ASP B 76  ? 1.0805 1.4736 1.2187 0.2081  -0.1245 -0.3902 70  ASP L CG  
2267 O OD1 . ASP B 76  ? 1.0745 1.4496 1.2415 0.1793  -0.1107 -0.3967 70  ASP L OD1 
2268 O OD2 . ASP B 76  ? 1.2245 1.6143 1.3584 0.2191  -0.1324 -0.4021 70  ASP L OD2 
2269 N N   . PHE B 77  ? 0.7584 1.1766 0.8024 0.2147  -0.0999 -0.2795 71  PHE L N   
2270 C CA  . PHE B 77  ? 0.6940 1.1256 0.7069 0.2278  -0.0942 -0.2480 71  PHE L CA  
2271 C C   . PHE B 77  ? 0.6927 1.1235 0.6872 0.2251  -0.0869 -0.2273 71  PHE L C   
2272 O O   . PHE B 77  ? 0.7201 1.1341 0.7216 0.2092  -0.0842 -0.2343 71  PHE L O   
2273 C CB  . PHE B 77  ? 0.6731 1.0969 0.6893 0.2070  -0.0823 -0.2297 71  PHE L CB  
2274 C CG  . PHE B 77  ? 0.6545 1.0761 0.6901 0.2042  -0.0891 -0.2524 71  PHE L CG  
2275 C CD1 . PHE B 77  ? 0.6151 1.0509 0.6352 0.2313  -0.0978 -0.2592 71  PHE L CD1 
2276 C CD2 . PHE B 77  ? 0.6574 1.0615 0.7245 0.1774  -0.0862 -0.2686 71  PHE L CD2 
2277 C CE1 . PHE B 77  ? 0.5617 0.9979 0.5981 0.2312  -0.1060 -0.2839 71  PHE L CE1 
2278 C CE2 . PHE B 77  ? 0.6488 1.0547 0.7369 0.1751  -0.0927 -0.2918 71  PHE L CE2 
2279 C CZ  . PHE B 77  ? 0.5296 0.9534 0.6025 0.2020  -0.1040 -0.3007 71  PHE L CZ  
2280 N N   . THR B 78  ? 0.6842 1.1320 0.6532 0.2427  -0.0826 -0.2031 72  THR L N   
2281 C CA  . THR B 78  ? 0.6893 1.1412 0.6425 0.2400  -0.0748 -0.1831 72  THR L CA  
2282 C C   . THR B 78  ? 0.6419 1.1054 0.5847 0.2396  -0.0604 -0.1523 72  THR L C   
2283 O O   . THR B 78  ? 0.6890 1.1612 0.6214 0.2575  -0.0587 -0.1455 72  THR L O   
2284 C CB  . THR B 78  ? 0.7061 1.1731 0.6380 0.2707  -0.0868 -0.1893 72  THR L CB  
2285 O OG1 . THR B 78  ? 0.7056 1.1927 0.6165 0.3020  -0.0868 -0.1756 72  THR L OG1 
2286 C CG2 . THR B 78  ? 0.6485 1.1073 0.5930 0.2785  -0.1040 -0.2235 72  THR L CG2 
2287 N N   . LEU B 79  ? 0.5596 1.0209 0.5050 0.2205  -0.0491 -0.1357 73  LEU L N   
2288 C CA  . LEU B 79  ? 0.6054 1.0824 0.5449 0.2219  -0.0348 -0.1080 73  LEU L CA  
2289 C C   . LEU B 79  ? 0.7245 1.2214 0.6453 0.2414  -0.0353 -0.1017 73  LEU L C   
2290 O O   . LEU B 79  ? 0.7461 1.2388 0.6624 0.2386  -0.0426 -0.1131 73  LEU L O   
2291 C CB  . LEU B 79  ? 0.5511 1.0170 0.5100 0.1911  -0.0241 -0.0969 73  LEU L CB  
2292 C CG  . LEU B 79  ? 0.5764 1.0582 0.5400 0.1869  -0.0080 -0.0710 73  LEU L CG  
2293 C CD1 . LEU B 79  ? 0.6415 1.1268 0.5982 0.1972  0.0007  -0.0572 73  LEU L CD1 
2294 C CD2 . LEU B 79  ? 0.5270 0.9966 0.5132 0.1589  -0.0029 -0.0668 73  LEU L CD2 
2295 N N   . THR B 80  ? 0.7053 1.2216 0.6113 0.2636  -0.0271 -0.0838 74  THR L N   
2296 C CA  . THR B 80  ? 0.6699 1.2071 0.5602 0.2801  -0.0254 -0.0749 74  THR L CA  
2297 C C   . THR B 80  ? 0.7303 1.2846 0.6268 0.2766  -0.0030 -0.0474 74  THR L C   
2298 O O   . THR B 80  ? 0.7847 1.3368 0.6818 0.2800  0.0107  -0.0326 74  THR L O   
2299 C CB  . THR B 80  ? 0.7036 1.2504 0.5658 0.3196  -0.0391 -0.0827 74  THR L CB  
2300 O OG1 . THR B 80  ? 0.6964 1.2595 0.5418 0.3452  -0.0251 -0.0598 74  THR L OG1 
2301 C CG2 . THR B 80  ? 0.7660 1.2968 0.6299 0.3284  -0.0554 -0.1067 74  THR L CG2 
2302 N N   . ILE B 81  ? 0.7603 1.3301 0.6618 0.2692  0.0012  -0.0427 75  ILE L N   
2303 C CA  . ILE B 81  ? 0.7589 1.3506 0.6725 0.2663  0.0224  -0.0204 75  ILE L CA  
2304 C C   . ILE B 81  ? 0.7527 1.3678 0.6405 0.2973  0.0205  -0.0153 75  ILE L C   
2305 O O   . ILE B 81  ? 0.7515 1.3737 0.6283 0.3010  0.0067  -0.0282 75  ILE L O   
2306 C CB  . ILE B 81  ? 0.6991 1.2939 0.6409 0.2368  0.0258  -0.0241 75  ILE L CB  
2307 C CG1 . ILE B 81  ? 0.6225 1.1882 0.5816 0.2110  0.0198  -0.0348 75  ILE L CG1 
2308 C CG2 . ILE B 81  ? 0.7305 1.3484 0.6977 0.2288  0.0495  -0.0036 75  ILE L CG2 
2309 C CD1 . ILE B 81  ? 0.5893 1.1529 0.5751 0.1864  0.0221  -0.0390 75  ILE L CD1 
2310 N N   . SER B 82  ? 0.7575 1.3811 0.6305 0.3228  0.0342  0.0031  76  SER L N   
2311 C CA  . SER B 82  ? 0.8521 1.4944 0.6944 0.3595  0.0301  0.0085  76  SER L CA  
2312 C C   . SER B 82  ? 1.0067 1.6786 0.8580 0.3542  0.0382  0.0155  76  SER L C   
2313 O O   . SER B 82  ? 1.1065 1.7897 0.9365 0.3691  0.0208  0.0049  76  SER L O   
2314 C CB  . SER B 82  ? 0.8391 1.4790 0.6596 0.3922  0.0462  0.0281  76  SER L CB  
2315 O OG  . SER B 82  ? 0.9163 1.5575 0.7591 0.3754  0.0778  0.0507  76  SER L OG  
2316 N N   . SER B 83  ? 0.9513 1.6364 0.8349 0.3335  0.0638  0.0314  77  SER L N   
2317 C CA  . SER B 83  ? 0.8628 1.5789 0.7628 0.3256  0.0700  0.0322  77  SER L CA  
2318 C C   . SER B 83  ? 0.7545 1.4703 0.6982 0.2861  0.0740  0.0225  77  SER L C   
2319 O O   . SER B 83  ? 0.7834 1.5009 0.7626 0.2666  0.0964  0.0353  77  SER L O   
2320 C CB  . SER B 83  ? 0.8299 1.5725 0.7308 0.3450  0.0973  0.0578  77  SER L CB  
2321 O OG  . SER B 83  ? 0.8148 1.5611 0.7579 0.3208  0.1279  0.0733  77  SER L OG  
2322 N N   . LEU B 84  ? 0.6150 1.3252 0.5532 0.2773  0.0519  -0.0011 78  LEU L N   
2323 C CA  . LEU B 84  ? 0.5978 1.3024 0.5694 0.2470  0.0507  -0.0146 78  LEU L CA  
2324 C C   . LEU B 84  ? 0.6281 1.3668 0.6401 0.2354  0.0690  -0.0097 78  LEU L C   
2325 O O   . LEU B 84  ? 0.6459 1.4160 0.6511 0.2506  0.0715  -0.0093 78  LEU L O   
2326 C CB  . LEU B 84  ? 0.5495 1.2386 0.4959 0.2485  0.0256  -0.0409 78  LEU L CB  
2327 C CG  . LEU B 84  ? 0.5299 1.1945 0.4973 0.2234  0.0199  -0.0569 78  LEU L CG  
2328 C CD1 . LEU B 84  ? 0.5522 1.1852 0.5292 0.2093  0.0215  -0.0510 78  LEU L CD1 
2329 C CD2 . LEU B 84  ? 0.5484 1.1948 0.4812 0.2314  -0.0005 -0.0815 78  LEU L CD2 
2330 N N   . GLN B 85  ? 0.5883 1.3216 0.6443 0.2087  0.0806  -0.0077 79  GLN L N   
2331 C CA  . GLN B 85  ? 0.4897 1.2546 0.5947 0.1943  0.0962  -0.0086 79  GLN L CA  
2332 C C   . GLN B 85  ? 0.5044 1.2621 0.6289 0.1787  0.0793  -0.0353 79  GLN L C   
2333 O O   . GLN B 85  ? 0.4844 1.2060 0.5931 0.1726  0.0631  -0.0455 79  GLN L O   
2334 C CB  . GLN B 85  ? 0.4889 1.2534 0.6337 0.1774  0.1243  0.0137  79  GLN L CB  
2335 C CG  . GLN B 85  ? 0.6569 1.4094 0.7728 0.1942  0.1402  0.0396  79  GLN L CG  
2336 C CD  . GLN B 85  ? 0.8465 1.6307 0.9604 0.2137  0.1623  0.0562  79  GLN L CD  
2337 O OE1 . GLN B 85  ? 0.9066 1.7115 0.9953 0.2343  0.1504  0.0485  79  GLN L OE1 
2338 N NE2 . GLN B 85  ? 0.9589 1.7448 1.0967 0.2085  0.1961  0.0801  79  GLN L NE2 
2339 N N   . ALA B 86  ? 0.4444 1.2360 0.6043 0.1745  0.0838  -0.0477 80  ALA L N   
2340 C CA  . ALA B 86  ? 0.3808 1.1676 0.5575 0.1668  0.0669  -0.0766 80  ALA L CA  
2341 C C   . ALA B 86  ? 0.3821 1.1350 0.5828 0.1459  0.0642  -0.0765 80  ALA L C   
2342 O O   . ALA B 86  ? 0.4500 1.1767 0.6386 0.1464  0.0451  -0.0971 80  ALA L O   
2343 C CB  . ALA B 86  ? 0.3523 1.1856 0.5765 0.1642  0.0750  -0.0905 80  ALA L CB  
2344 N N   . GLU B 87  ? 0.3895 1.1406 0.6201 0.1301  0.0843  -0.0528 81  GLU L N   
2345 C CA  . GLU B 87  ? 0.3935 1.1163 0.6495 0.1100  0.0832  -0.0499 81  GLU L CA  
2346 C C   . GLU B 87  ? 0.4129 1.0930 0.6253 0.1121  0.0729  -0.0419 81  GLU L C   
2347 O O   . GLU B 87  ? 0.5145 1.1686 0.7395 0.0976  0.0706  -0.0378 81  GLU L O   
2348 C CB  . GLU B 87  ? 0.4950 1.2316 0.8006 0.0916  0.1104  -0.0286 81  GLU L CB  
2349 C CG  . GLU B 87  ? 0.6705 1.4122 0.9555 0.0999  0.1344  0.0004  81  GLU L CG  
2350 C CD  . GLU B 87  ? 0.8679 1.6540 1.1715 0.1089  0.1539  0.0043  81  GLU L CD  
2351 O OE1 . GLU B 87  ? 0.8592 1.6729 1.1735 0.1149  0.1420  -0.0184 81  GLU L OE1 
2352 O OE2 . GLU B 87  ? 0.9767 1.7688 1.2819 0.1121  0.1821  0.0300  81  GLU L OE2 
2353 N N   . ASP B 88  ? 0.4240 1.0976 0.5870 0.1306  0.0658  -0.0410 82  ASP L N   
2354 C CA  . ASP B 88  ? 0.5066 1.1426 0.6347 0.1325  0.0558  -0.0376 82  ASP L CA  
2355 C C   . ASP B 88  ? 0.4924 1.0993 0.5971 0.1352  0.0340  -0.0609 82  ASP L C   
2356 O O   . ASP B 88  ? 0.5746 1.1510 0.6514 0.1372  0.0252  -0.0628 82  ASP L O   
2357 C CB  . ASP B 88  ? 0.5548 1.1949 0.6453 0.1522  0.0595  -0.0252 82  ASP L CB  
2358 C CG  . ASP B 88  ? 0.6287 1.2852 0.7338 0.1531  0.0845  0.0006  82  ASP L CG  
2359 O OD1 . ASP B 88  ? 0.6509 1.3203 0.7300 0.1748  0.0909  0.0109  82  ASP L OD1 
2360 O OD2 . ASP B 88  ? 0.6592 1.3128 0.7994 0.1340  0.0984  0.0108  82  ASP L OD2 
2361 N N   . VAL B 89  ? 0.4846 1.0994 0.6000 0.1370  0.0265  -0.0802 83  VAL L N   
2362 C CA  . VAL B 89  ? 0.4607 1.0415 0.5470 0.1438  0.0091  -0.1022 83  VAL L CA  
2363 C C   . VAL B 89  ? 0.4330 0.9803 0.5362 0.1289  0.0060  -0.1013 83  VAL L C   
2364 O O   . VAL B 89  ? 0.5021 1.0587 0.6471 0.1167  0.0101  -0.0981 83  VAL L O   
2365 C CB  . VAL B 89  ? 0.4329 1.0272 0.5153 0.1569  0.0006  -0.1266 83  VAL L CB  
2366 C CG1 . VAL B 89  ? 0.4704 1.0935 0.5248 0.1745  0.0005  -0.1286 83  VAL L CG1 
2367 C CG2 . VAL B 89  ? 0.3506 0.9708 0.4881 0.1470  0.0055  -0.1310 83  VAL L CG2 
2368 N N   . ALA B 90  ? 0.4110 0.9195 0.4836 0.1300  -0.0010 -0.1040 84  ALA L N   
2369 C CA  . ALA B 90  ? 0.3729 0.8485 0.4573 0.1172  -0.0036 -0.1008 84  ALA L CA  
2370 C C   . ALA B 90  ? 0.4663 0.9016 0.5140 0.1217  -0.0096 -0.1087 84  ALA L C   
2371 O O   . ALA B 90  ? 0.5388 0.9718 0.5543 0.1337  -0.0121 -0.1171 84  ALA L O   
2372 C CB  . ALA B 90  ? 0.3476 0.8351 0.4583 0.1017  0.0065  -0.0778 84  ALA L CB  
2373 N N   . VAL B 91  ? 0.4392 0.8424 0.4930 0.1119  -0.0115 -0.1063 85  VAL L N   
2374 C CA  . VAL B 91  ? 0.4471 0.8148 0.4759 0.1116  -0.0131 -0.1110 85  VAL L CA  
2375 C C   . VAL B 91  ? 0.4847 0.8626 0.5252 0.1005  -0.0095 -0.0955 85  VAL L C   
2376 O O   . VAL B 91  ? 0.4794 0.8669 0.5449 0.0894  -0.0068 -0.0814 85  VAL L O   
2377 C CB  . VAL B 91  ? 0.4779 0.8018 0.5031 0.1105  -0.0161 -0.1183 85  VAL L CB  
2378 C CG1 . VAL B 91  ? 0.4872 0.7763 0.4940 0.1071  -0.0137 -0.1222 85  VAL L CG1 
2379 C CG2 . VAL B 91  ? 0.3421 0.6510 0.3486 0.1277  -0.0199 -0.1362 85  VAL L CG2 
2380 N N   . TYR B 92  ? 0.5135 0.8887 0.5348 0.1055  -0.0102 -0.1001 86  TYR L N   
2381 C CA  . TYR B 92  ? 0.5120 0.8965 0.5391 0.1010  -0.0088 -0.0905 86  TYR L CA  
2382 C C   . TYR B 92  ? 0.4930 0.8451 0.5167 0.0942  -0.0118 -0.0998 86  TYR L C   
2383 O O   . TYR B 92  ? 0.5259 0.8547 0.5346 0.0981  -0.0133 -0.1156 86  TYR L O   
2384 C CB  . TYR B 92  ? 0.4866 0.8985 0.4990 0.1160  -0.0088 -0.0901 86  TYR L CB  
2385 C CG  . TYR B 92  ? 0.4474 0.8942 0.4689 0.1209  -0.0015 -0.0758 86  TYR L CG  
2386 C CD1 . TYR B 92  ? 0.4281 0.8925 0.4618 0.1186  0.0076  -0.0573 86  TYR L CD1 
2387 C CD2 . TYR B 92  ? 0.4491 0.9093 0.4665 0.1280  -0.0018 -0.0815 86  TYR L CD2 
2388 C CE1 . TYR B 92  ? 0.4213 0.9150 0.4671 0.1216  0.0190  -0.0436 86  TYR L CE1 
2389 C CE2 . TYR B 92  ? 0.4356 0.9302 0.4675 0.1309  0.0068  -0.0699 86  TYR L CE2 
2390 C CZ  . TYR B 92  ? 0.4456 0.9563 0.4940 0.1266  0.0186  -0.0502 86  TYR L CZ  
2391 O OH  . TYR B 92  ? 0.4504 0.9931 0.5164 0.1284  0.0315  -0.0381 86  TYR L OH  
2392 N N   . TYR B 93  ? 0.5404 0.8901 0.5780 0.0839  -0.0115 -0.0902 87  TYR L N   
2393 C CA  . TYR B 93  ? 0.4972 0.8194 0.5367 0.0760  -0.0138 -0.0984 87  TYR L CA  
2394 C C   . TYR B 93  ? 0.5040 0.8411 0.5439 0.0784  -0.0165 -0.0993 87  TYR L C   
2395 O O   . TYR B 93  ? 0.5867 0.9433 0.6284 0.0798  -0.0149 -0.0849 87  TYR L O   
2396 C CB  . TYR B 93  ? 0.4366 0.7397 0.4891 0.0641  -0.0139 -0.0884 87  TYR L CB  
2397 C CG  . TYR B 93  ? 0.4653 0.7431 0.5148 0.0662  -0.0132 -0.0929 87  TYR L CG  
2398 C CD1 . TYR B 93  ? 0.4454 0.7342 0.5044 0.0682  -0.0144 -0.0852 87  TYR L CD1 
2399 C CD2 . TYR B 93  ? 0.4964 0.7369 0.5333 0.0684  -0.0103 -0.1069 87  TYR L CD2 
2400 C CE1 . TYR B 93  ? 0.4550 0.7191 0.5080 0.0759  -0.0160 -0.0934 87  TYR L CE1 
2401 C CE2 . TYR B 93  ? 0.5186 0.7296 0.5444 0.0762  -0.0085 -0.1119 87  TYR L CE2 
2402 C CZ  . TYR B 93  ? 0.5255 0.7487 0.5577 0.0818  -0.0129 -0.1062 87  TYR L CZ  
2403 O OH  . TYR B 93  ? 0.5609 0.7531 0.5788 0.0951  -0.0132 -0.1152 87  TYR L OH  
2404 N N   . CYS B 94  ? 0.5122 0.8388 0.5501 0.0807  -0.0198 -0.1178 88  CYS L N   
2405 C CA  . CYS B 94  ? 0.5182 0.8546 0.5595 0.0838  -0.0248 -0.1241 88  CYS L CA  
2406 C C   . CYS B 94  ? 0.5438 0.8583 0.5974 0.0688  -0.0250 -0.1254 88  CYS L C   
2407 O O   . CYS B 94  ? 0.6080 0.8954 0.6669 0.0588  -0.0208 -0.1266 88  CYS L O   
2408 C CB  . CYS B 94  ? 0.5713 0.9127 0.6106 0.0957  -0.0305 -0.1475 88  CYS L CB  
2409 S SG  . CYS B 94  ? 0.8169 1.1242 0.8685 0.0846  -0.0275 -0.1713 88  CYS L SG  
2410 N N   . GLN B 95  ? 0.5171 0.8415 0.5712 0.0699  -0.0296 -0.1246 89  GLN L N   
2411 C CA  . GLN B 95  ? 0.5264 0.8331 0.5902 0.0573  -0.0314 -0.1268 89  GLN L CA  
2412 C C   . GLN B 95  ? 0.5290 0.8489 0.5930 0.0651  -0.0392 -0.1438 89  GLN L C   
2413 O O   . GLN B 95  ? 0.6669 1.0071 0.7155 0.0802  -0.0428 -0.1410 89  GLN L O   
2414 C CB  . GLN B 95  ? 0.5497 0.8513 0.6100 0.0489  -0.0305 -0.1019 89  GLN L CB  
2415 C CG  . GLN B 95  ? 0.6032 0.8869 0.6689 0.0380  -0.0344 -0.1008 89  GLN L CG  
2416 C CD  . GLN B 95  ? 0.7236 1.0160 0.7768 0.0381  -0.0388 -0.0838 89  GLN L CD  
2417 O OE1 . GLN B 95  ? 0.7648 1.0714 0.8087 0.0433  -0.0354 -0.0689 89  GLN L OE1 
2418 N NE2 . GLN B 95  ? 0.7115 0.9941 0.7631 0.0328  -0.0451 -0.0860 89  GLN L NE2 
2419 N N   . GLN B 96  ? 0.5370 0.8447 0.7484 0.1109  0.0194  -0.0233 90  GLN L N   
2420 C CA  . GLN B 96  ? 0.5080 0.8548 0.7241 0.1191  0.0138  -0.0520 90  GLN L CA  
2421 C C   . GLN B 96  ? 0.5723 0.9126 0.7281 0.1345  0.0038  -0.0381 90  GLN L C   
2422 O O   . GLN B 96  ? 0.5878 0.9074 0.7286 0.1351  0.0091  -0.0128 90  GLN L O   
2423 C CB  . GLN B 96  ? 0.4344 0.8079 0.7172 0.1077  0.0292  -0.0717 90  GLN L CB  
2424 C CG  . GLN B 96  ? 0.4285 0.7908 0.7219 0.1013  0.0444  -0.0485 90  GLN L CG  
2425 C CD  . GLN B 96  ? 0.4614 0.8462 0.7216 0.1154  0.0389  -0.0500 90  GLN L CD  
2426 O OE1 . GLN B 96  ? 0.4550 0.8670 0.6938 0.1282  0.0258  -0.0744 90  GLN L OE1 
2427 N NE2 . GLN B 96  ? 0.4421 0.8173 0.6957 0.1158  0.0486  -0.0244 90  GLN L NE2 
2428 N N   . TYR B 97  ? 0.5720 0.9281 0.6896 0.1493  -0.0120 -0.0539 91  TYR L N   
2429 C CA  . TYR B 97  ? 0.5975 0.9478 0.6574 0.1661  -0.0235 -0.0452 91  TYR L CA  
2430 C C   . TYR B 97  ? 0.5970 0.9918 0.6631 0.1781  -0.0266 -0.0783 91  TYR L C   
2431 O O   . TYR B 97  ? 0.6209 1.0190 0.6338 0.1970  -0.0422 -0.0851 91  TYR L O   
2432 C CB  . TYR B 97  ? 0.6133 0.9306 0.6054 0.1758  -0.0417 -0.0267 91  TYR L CB  
2433 C CG  . TYR B 97  ? 0.6377 0.9661 0.6184 0.1794  -0.0513 -0.0424 91  TYR L CG  
2434 C CD1 . TYR B 97  ? 0.6296 0.9661 0.5610 0.1979  -0.0668 -0.0540 91  TYR L CD1 
2435 C CD2 . TYR B 97  ? 0.6442 0.9754 0.6594 0.1667  -0.0456 -0.0444 91  TYR L CD2 
2436 C CE1 . TYR B 97  ? 0.6379 0.9868 0.5575 0.2034  -0.0743 -0.0658 91  TYR L CE1 
2437 C CE2 . TYR B 97  ? 0.6543 1.0017 0.6586 0.1725  -0.0545 -0.0573 91  TYR L CE2 
2438 C CZ  . TYR B 97  ? 0.6798 1.0366 0.6370 0.1907  -0.0680 -0.0670 91  TYR L CZ  
2439 O OH  . TYR B 97  ? 0.6459 1.0207 0.5909 0.1984  -0.0756 -0.0775 91  TYR L OH  
2440 N N   . TYR B 98  ? 0.5540 0.9817 0.6857 0.1668  -0.0116 -0.0987 92  TYR L N   
2441 C CA  . TYR B 98  ? 0.5811 1.0594 0.7351 0.1749  -0.0117 -0.1360 92  TYR L CA  
2442 C C   . TYR B 98  ? 0.6147 1.1104 0.7607 0.1806  -0.0076 -0.1318 92  TYR L C   
2443 O O   . TYR B 98  ? 0.5570 1.0711 0.6579 0.2016  -0.0201 -0.1442 92  TYR L O   
2444 C CB  . TYR B 98  ? 0.5982 1.1031 0.8327 0.1576  0.0010  -0.1617 92  TYR L CB  
2445 C CG  . TYR B 98  ? 0.6581 1.2197 0.9288 0.1635  0.0016  -0.2055 92  TYR L CG  
2446 C CD1 . TYR B 98  ? 0.6777 1.2664 0.9352 0.1812  -0.0112 -0.2370 92  TYR L CD1 
2447 C CD2 . TYR B 98  ? 0.5989 1.1897 0.9198 0.1514  0.0157  -0.2156 92  TYR L CD2 
2448 C CE1 . TYR B 98  ? 0.6777 1.3212 0.9695 0.1889  -0.0110 -0.2800 92  TYR L CE1 
2449 C CE2 . TYR B 98  ? 0.5876 1.2334 0.9450 0.1557  0.0161  -0.2578 92  TYR L CE2 
2450 C CZ  . TYR B 98  ? 0.6671 1.3394 1.0098 0.1754  0.0023  -0.2914 92  TYR L CZ  
2451 O OH  . TYR B 98  ? 0.7277 1.4585 1.1077 0.1821  0.0024  -0.3366 92  TYR L OH  
2452 N N   . SER B 99  ? 0.5897 1.0793 0.7756 0.1638  0.0095  -0.1129 93  SER L N   
2453 C CA  . SER B 99  ? 0.5869 1.0960 0.7664 0.1694  0.0146  -0.1043 93  SER L CA  
2454 C C   . SER B 99  ? 0.6259 1.0959 0.7863 0.1672  0.0204  -0.0609 93  SER L C   
2455 O O   . SER B 99  ? 0.7692 1.2043 0.9490 0.1529  0.0291  -0.0405 93  SER L O   
2456 C CB  . SER B 99  ? 0.6029 1.1599 0.8571 0.1532  0.0324  -0.1277 93  SER L CB  
2457 O OG  . SER B 99  ? 0.6581 1.1971 0.9630 0.1301  0.0528  -0.1040 93  SER L OG  
2458 N N   . ALA B 100 ? 0.5617 1.0398 0.6820 0.1844  0.0143  -0.0483 94  ALA L N   
2459 C CA  . ALA B 100 ? 0.5518 0.9984 0.6498 0.1886  0.0174  -0.0089 94  ALA L CA  
2460 C C   . ALA B 100 ? 0.5544 1.0181 0.7135 0.1715  0.0433  0.0054  94  ALA L C   
2461 O O   . ALA B 100 ? 0.4815 0.9925 0.6827 0.1639  0.0543  -0.0134 94  ALA L O   
2462 C CB  . ALA B 100 ? 0.4504 0.8993 0.4785 0.2176  -0.0024 -0.0019 94  ALA L CB  
2463 N N   . PRO B 101 ? 0.5618 0.9881 0.7246 0.1662  0.0534  0.0393  95  PRO L N   
2464 C CA  . PRO B 101 ? 0.5365 0.9113 0.6492 0.1761  0.0401  0.0614  95  PRO L CA  
2465 C C   . PRO B 101 ? 0.5890 0.9372 0.7178 0.1605  0.0395  0.0520  95  PRO L C   
2466 O O   . PRO B 101 ? 0.5758 0.9335 0.7648 0.1398  0.0558  0.0405  95  PRO L O   
2467 C CB  . PRO B 101 ? 0.5299 0.8873 0.6565 0.1753  0.0568  0.0968  95  PRO L CB  
2468 C CG  . PRO B 101 ? 0.4877 0.8667 0.6910 0.1501  0.0832  0.0905  95  PRO L CG  
2469 C CD  . PRO B 101 ? 0.4276 0.8605 0.6453 0.1504  0.0799  0.0593  95  PRO L CD  
2470 N N   . LEU B 102 ? 0.6143 0.9309 0.6909 0.1702  0.0204  0.0569  96  LEU L N   
2471 C CA  . LEU B 102 ? 0.5508 0.8462 0.6375 0.1575  0.0186  0.0504  96  LEU L CA  
2472 C C   . LEU B 102 ? 0.5688 0.8387 0.6905 0.1434  0.0364  0.0713  96  LEU L C   
2473 O O   . LEU B 102 ? 0.6376 0.8874 0.7442 0.1504  0.0413  0.0991  96  LEU L O   
2474 C CB  . LEU B 102 ? 0.5693 0.8356 0.5915 0.1696  -0.0043 0.0572  96  LEU L CB  
2475 C CG  . LEU B 102 ? 0.6854 0.9656 0.6576 0.1882  -0.0247 0.0420  96  LEU L CG  
2476 C CD1 . LEU B 102 ? 0.7229 0.9747 0.6451 0.1928  -0.0442 0.0449  96  LEU L CD1 
2477 C CD2 . LEU B 102 ? 0.6456 0.9730 0.6517 0.1864  -0.0198 0.0075  96  LEU L CD2 
2478 N N   . THR B 103 ? 0.5028 0.7736 0.6691 0.1263  0.0450  0.0572  97  THR L N   
2479 C CA  . THR B 103 ? 0.5564 0.8023 0.7571 0.1138  0.0622  0.0742  97  THR L CA  
2480 C C   . THR B 103 ? 0.5949 0.8235 0.7998 0.1060  0.0572  0.0671  97  THR L C   
2481 O O   . THR B 103 ? 0.6174 0.8633 0.8190 0.1059  0.0448  0.0432  97  THR L O   
2482 C CB  . THR B 103 ? 0.5332 0.7986 0.7997 0.0986  0.0837  0.0672  97  THR L CB  
2483 O OG1 . THR B 103 ? 0.5503 0.8487 0.8530 0.0896  0.0806  0.0309  97  THR L OG1 
2484 C CG2 . THR B 103 ? 0.4962 0.7801 0.7570 0.1068  0.0909  0.0810  97  THR L CG2 
2485 N N   . PHE B 104 ? 0.5524 0.7497 0.7625 0.1020  0.0667  0.0878  98  PHE L N   
2486 C CA  . PHE B 104 ? 0.4759 0.6567 0.6842 0.0971  0.0617  0.0846  98  PHE L CA  
2487 C C   . PHE B 104 ? 0.5295 0.7028 0.7935 0.0835  0.0783  0.0793  98  PHE L C   
2488 O O   . PHE B 104 ? 0.5033 0.6678 0.7957 0.0788  0.0963  0.0921  98  PHE L O   
2489 C CB  . PHE B 104 ? 0.4714 0.6200 0.6325 0.1063  0.0565  0.1121  98  PHE L CB  
2490 C CG  . PHE B 104 ? 0.5148 0.6622 0.6184 0.1182  0.0365  0.1176  98  PHE L CG  
2491 C CD1 . PHE B 104 ? 0.5991 0.7451 0.6751 0.1310  0.0331  0.1304  98  PHE L CD1 
2492 C CD2 . PHE B 104 ? 0.4938 0.6407 0.5698 0.1173  0.0206  0.1111  98  PHE L CD2 
2493 C CE1 . PHE B 104 ? 0.6180 0.7573 0.6394 0.1427  0.0124  0.1348  98  PHE L CE1 
2494 C CE2 . PHE B 104 ? 0.6272 0.7676 0.6503 0.1265  0.0021  0.1176  98  PHE L CE2 
2495 C CZ  . PHE B 104 ? 0.6598 0.7936 0.6550 0.1393  -0.0028 0.1288  98  PHE L CZ  
2496 N N   . GLY B 105 ? 0.5607 0.7369 0.8392 0.0782  0.0718  0.0614  99  GLY L N   
2497 C CA  . GLY B 105 ? 0.4759 0.6371 0.7986 0.0682  0.0837  0.0572  99  GLY L CA  
2498 C C   . GLY B 105 ? 0.4523 0.5761 0.7497 0.0737  0.0912  0.0867  99  GLY L C   
2499 O O   . GLY B 105 ? 0.5084 0.6230 0.7569 0.0842  0.0840  0.1049  99  GLY L O   
2500 N N   . GLY B 106 ? 0.4489 0.5500 0.7785 0.0676  0.1048  0.0902  100 GLY L N   
2501 C CA  . GLY B 106 ? 0.4688 0.5345 0.7755 0.0754  0.1142  0.1172  100 GLY L CA  
2502 C C   . GLY B 106 ? 0.5410 0.5995 0.8121 0.0832  0.1012  0.1170  100 GLY L C   
2503 O O   . GLY B 106 ? 0.5168 0.5485 0.7666 0.0917  0.1079  0.1362  100 GLY L O   
2504 N N   . GLY B 107 ? 0.4299 0.5154 0.6942 0.0814  0.0833  0.0952  101 GLY L N   
2505 C CA  . GLY B 107 ? 0.4561 0.5435 0.6889 0.0871  0.0704  0.0941  101 GLY L CA  
2506 C C   . GLY B 107 ? 0.4314 0.5129 0.6876 0.0863  0.0709  0.0803  101 GLY L C   
2507 O O   . GLY B 107 ? 0.4507 0.5060 0.7334 0.0847  0.0850  0.0842  101 GLY L O   
2508 N N   . THR B 108 ? 0.5490 0.6553 0.7932 0.0886  0.0546  0.0646  102 THR L N   
2509 C CA  . THR B 108 ? 0.5591 0.6662 0.8168 0.0920  0.0501  0.0499  102 THR L CA  
2510 C C   . THR B 108 ? 0.6158 0.7267 0.8280 0.1001  0.0418  0.0611  102 THR L C   
2511 O O   . THR B 108 ? 0.6043 0.7378 0.7855 0.1000  0.0307  0.0655  102 THR L O   
2512 C CB  . THR B 108 ? 0.5528 0.6972 0.8415 0.0902  0.0364  0.0173  102 THR L CB  
2513 O OG1 . THR B 108 ? 0.6422 0.7802 0.9817 0.0822  0.0449  0.0030  102 THR L OG1 
2514 C CG2 . THR B 108 ? 0.4971 0.6520 0.7878 0.0981  0.0257  0.0018  102 THR L CG2 
2515 N N   . LYS B 109 ? 0.6977 0.7859 0.9046 0.1073  0.0475  0.0661  103 LYS L N   
2516 C CA  . LYS B 109 ? 0.6191 0.7146 0.7841 0.1153  0.0403  0.0750  103 LYS L CA  
2517 C C   . LYS B 109 ? 0.6118 0.7426 0.7800 0.1194  0.0243  0.0520  103 LYS L C   
2518 O O   . LYS B 109 ? 0.5736 0.6987 0.7675 0.1245  0.0236  0.0349  103 LYS L O   
2519 C CB  . LYS B 109 ? 0.5917 0.6486 0.7408 0.1253  0.0543  0.0926  103 LYS L CB  
2520 C CG  . LYS B 109 ? 0.7642 0.8324 0.8692 0.1339  0.0470  0.1007  103 LYS L CG  
2521 C CD  . LYS B 109 ? 0.8794 0.9172 0.9720 0.1487  0.0578  0.1072  103 LYS L CD  
2522 C CE  . LYS B 109 ? 0.9476 0.9566 1.0160 0.1565  0.0712  0.1331  103 LYS L CE  
2523 N NZ  . LYS B 109 ? 1.0478 1.0249 1.1059 0.1741  0.0840  0.1389  103 LYS L NZ  
2524 N N   . VAL B 110 ? 0.6007 0.7685 0.7425 0.1180  0.0107  0.0522  104 VAL L N   
2525 C CA  . VAL B 110 ? 0.6408 0.8513 0.7826 0.1235  -0.0051 0.0328  104 VAL L CA  
2526 C C   . VAL B 110 ? 0.6584 0.8786 0.7633 0.1306  -0.0090 0.0416  104 VAL L C   
2527 O O   . VAL B 110 ? 0.6419 0.8707 0.7135 0.1256  -0.0111 0.0591  104 VAL L O   
2528 C CB  . VAL B 110 ? 0.5905 0.8445 0.7316 0.1182  -0.0177 0.0251  104 VAL L CB  
2529 C CG1 . VAL B 110 ? 0.5307 0.8358 0.6702 0.1266  -0.0339 0.0071  104 VAL L CG1 
2530 C CG2 . VAL B 110 ? 0.5033 0.7531 0.6821 0.1139  -0.0145 0.0113  104 VAL L CG2 
2531 N N   . GLU B 111 ? 0.6651 0.8834 0.7760 0.1426  -0.0109 0.0282  105 GLU L N   
2532 C CA  . GLU B 111 ? 0.6639 0.8969 0.7408 0.1521  -0.0154 0.0318  105 GLU L CA  
2533 C C   . GLU B 111 ? 0.7145 1.0032 0.7922 0.1605  -0.0339 0.0100  105 GLU L C   
2534 O O   . GLU B 111 ? 0.6250 0.9332 0.7332 0.1632  -0.0427 -0.0109 105 GLU L O   
2535 C CB  . GLU B 111 ? 0.7108 0.8976 0.7830 0.1643  -0.0031 0.0354  105 GLU L CB  
2536 C CG  . GLU B 111 ? 0.9709 1.1039 1.0501 0.1597  0.0163  0.0552  105 GLU L CG  
2537 C CD  . GLU B 111 ? 1.1145 1.2155 1.1630 0.1718  0.0286  0.0722  105 GLU L CD  
2538 O OE1 . GLU B 111 ? 1.1026 1.2106 1.1213 0.1699  0.0293  0.0887  105 GLU L OE1 
2539 O OE2 . GLU B 111 ? 1.1510 1.2180 1.2054 0.1841  0.0373  0.0686  105 GLU L OE2 
2540 N N   . ILE B 112 ? 0.7986 0.8560 0.6202 0.2052  0.0399  0.0205  106 ILE L N   
2541 C CA  . ILE B 112 ? 0.7940 0.8641 0.6201 0.2040  0.0500  0.0168  106 ILE L CA  
2542 C C   . ILE B 112 ? 0.8223 0.9436 0.7025 0.2070  0.0415  0.0124  106 ILE L C   
2543 O O   . ILE B 112 ? 0.8037 0.9490 0.7134 0.2002  0.0326  0.0133  106 ILE L O   
2544 C CB  . ILE B 112 ? 0.7648 0.8232 0.5667 0.1789  0.0687  0.0168  106 ILE L CB  
2545 C CG1 . ILE B 112 ? 0.7409 0.7391 0.4806 0.1777  0.0760  0.0211  106 ILE L CG1 
2546 C CG2 . ILE B 112 ? 0.7635 0.8464 0.5770 0.1740  0.0798  0.0102  106 ILE L CG2 
2547 C CD1 . ILE B 112 ? 0.7923 0.7626 0.4949 0.1836  0.0864  0.0198  106 ILE L CD1 
2548 N N   . LYS B 113 ? 0.8774 1.0126 0.7678 0.2190  0.0423  0.0073  107 LYS L N   
2549 C CA  . LYS B 113 ? 0.8262 1.0083 0.7638 0.2225  0.0343  0.0006  107 LYS L CA  
2550 C C   . LYS B 113 ? 0.7961 1.0008 0.7383 0.2060  0.0492  -0.0077 107 LYS L C   
2551 O O   . LYS B 113 ? 0.8952 1.0901 0.8151 0.2062  0.0621  -0.0108 107 LYS L O   
2552 C CB  . LYS B 113 ? 0.8447 1.0326 0.7942 0.2470  0.0245  -0.0025 107 LYS L CB  
2553 C CG  . LYS B 113 ? 0.8637 1.0622 0.8407 0.2604  0.0044  -0.0004 107 LYS L CG  
2554 C CD  . LYS B 113 ? 0.8630 1.0732 0.8565 0.2824  -0.0041 -0.0057 107 LYS L CD  
2555 C CE  . LYS B 113 ? 0.8522 1.0364 0.8115 0.2933  0.0075  -0.0073 107 LYS L CE  
2556 N NZ  . LYS B 113 ? 0.8519 1.0571 0.8306 0.3104  0.0035  -0.0149 107 LYS L NZ  
2557 N N   . ARG B 114 ? 0.7165 0.9528 0.6873 0.1913  0.0474  -0.0126 108 ARG L N   
2558 C CA  . ARG B 114 ? 0.6241 0.8909 0.6058 0.1731  0.0610  -0.0243 108 ARG L CA  
2559 C C   . ARG B 114 ? 0.5682 0.8849 0.5991 0.1844  0.0462  -0.0367 108 ARG L C   
2560 O O   . ARG B 114 ? 0.6067 0.9280 0.6595 0.2020  0.0255  -0.0334 108 ARG L O   
2561 C CB  . ARG B 114 ? 0.7075 0.9807 0.6943 0.1519  0.0644  -0.0247 108 ARG L CB  
2562 C CG  . ARG B 114 ? 0.7490 0.9807 0.6926 0.1343  0.0790  -0.0160 108 ARG L CG  
2563 C CD  . ARG B 114 ? 0.6599 0.9196 0.6240 0.1125  0.0837  -0.0237 108 ARG L CD  
2564 N NE  . ARG B 114 ? 0.5457 0.8596 0.5501 0.1121  0.0826  -0.0411 108 ARG L NE  
2565 C CZ  . ARG B 114 ? 0.4674 0.8102 0.4792 0.0901  0.0987  -0.0558 108 ARG L CZ  
2566 N NH1 . ARG B 114 ? 0.4111 0.8070 0.4621 0.0934  0.0948  -0.0746 108 ARG L NH1 
2567 N NH2 . ARG B 114 ? 0.5343 0.8537 0.5148 0.0645  0.1178  -0.0533 108 ARG L NH2 
2568 N N   . THR B 115 ? 0.4962 0.8510 0.5444 0.1728  0.0558  -0.0525 109 THR L N   
2569 C CA  . THR B 115 ? 0.5140 0.9192 0.6110 0.1821  0.0389  -0.0677 109 THR L CA  
2570 C C   . THR B 115 ? 0.5378 0.9544 0.6537 0.1734  0.0287  -0.0687 109 THR L C   
2571 O O   . THR B 115 ? 0.5563 0.9554 0.6524 0.1538  0.0412  -0.0631 109 THR L O   
2572 C CB  . THR B 115 ? 0.5372 0.9865 0.6497 0.1721  0.0518  -0.0886 109 THR L CB  
2573 O OG1 . THR B 115 ? 0.5648 1.0024 0.6475 0.1429  0.0783  -0.0891 109 THR L OG1 
2574 C CG2 . THR B 115 ? 0.5686 1.0189 0.6758 0.1881  0.0536  -0.0910 109 THR L CG2 
2575 N N   . VAL B 116 ? 0.4695 0.9127 0.6214 0.1889  0.0046  -0.0761 110 VAL L N   
2576 C CA  . VAL B 116 ? 0.4526 0.9083 0.6232 0.1835  -0.0080 -0.0791 110 VAL L CA  
2577 C C   . VAL B 116 ? 0.5164 1.0012 0.6936 0.1596  0.0090  -0.0946 110 VAL L C   
2578 O O   . VAL B 116 ? 0.4824 1.0017 0.6705 0.1523  0.0216  -0.1129 110 VAL L O   
2579 C CB  . VAL B 116 ? 0.4381 0.9195 0.6442 0.2050  -0.0377 -0.0892 110 VAL L CB  
2580 C CG1 . VAL B 116 ? 0.2309 0.7603 0.4649 0.2124  -0.0387 -0.1136 110 VAL L CG1 
2581 C CG2 . VAL B 116 ? 0.4560 0.9452 0.6763 0.2009  -0.0524 -0.0922 110 VAL L CG2 
2582 N N   . ALA B 117 ? 0.4909 0.9633 0.6617 0.1465  0.0100  -0.0882 111 ALA L N   
2583 C CA  . ALA B 117 ? 0.4432 0.9415 0.6215 0.1233  0.0247  -0.1027 111 ALA L CA  
2584 C C   . ALA B 117 ? 0.4260 0.9352 0.6247 0.1249  0.0067  -0.1057 111 ALA L C   
2585 O O   . ALA B 117 ? 0.4071 0.8826 0.5915 0.1293  -0.0031 -0.0872 111 ALA L O   
2586 C CB  . ALA B 117 ? 0.3689 0.8317 0.5066 0.1000  0.0511  -0.0908 111 ALA L CB  
2587 N N   . ALA B 118 ? 0.4595 1.0175 0.6909 0.1212  0.0028  -0.1307 112 ALA L N   
2588 C CA  . ALA B 118 ? 0.4011 0.9727 0.6529 0.1247  -0.0158 -0.1374 112 ALA L CA  
2589 C C   . ALA B 118 ? 0.4208 0.9771 0.6570 0.1023  -0.0012 -0.1304 112 ALA L C   
2590 O O   . ALA B 118 ? 0.4861 1.0449 0.7093 0.0788  0.0251  -0.1345 112 ALA L O   
2591 C CB  . ALA B 118 ? 0.2659 0.8966 0.5582 0.1312  -0.0268 -0.1703 112 ALA L CB  
2592 N N   . PRO B 119 ? 0.4586 0.9979 0.6945 0.1087  -0.0186 -0.1201 113 PRO L N   
2593 C CA  . PRO B 119 ? 0.4408 0.9666 0.6641 0.0901  -0.0079 -0.1138 113 PRO L CA  
2594 C C   . PRO B 119 ? 0.4781 1.0508 0.7299 0.0782  -0.0038 -0.1409 113 PRO L C   
2595 O O   . PRO B 119 ? 0.4239 1.0357 0.7078 0.0921  -0.0212 -0.1627 113 PRO L O   
2596 C CB  . PRO B 119 ? 0.3911 0.8910 0.6096 0.1048  -0.0321 -0.0975 113 PRO L CB  
2597 C CG  . PRO B 119 ? 0.4496 0.9735 0.6946 0.1276  -0.0584 -0.1110 113 PRO L CG  
2598 C CD  . PRO B 119 ? 0.5038 1.0345 0.7493 0.1331  -0.0501 -0.1146 113 PRO L CD  
2599 N N   . SER B 120 ? 0.5123 1.0808 0.7519 0.0532  0.0182  -0.1412 114 SER L N   
2600 C CA  . SER B 120 ? 0.4531 1.0610 0.7179 0.0406  0.0213  -0.1646 114 SER L CA  
2601 C C   . SER B 120 ? 0.4422 1.0318 0.7061 0.0493  0.0023  -0.1531 114 SER L C   
2602 O O   . SER B 120 ? 0.3922 0.9370 0.6265 0.0459  0.0050  -0.1276 114 SER L O   
2603 C CB  . SER B 120 ? 0.5333 1.1381 0.7807 0.0077  0.0539  -0.1679 114 SER L CB  
2604 O OG  . SER B 120 ? 0.5516 1.1791 0.8000 -0.0048 0.0735  -0.1826 114 SER L OG  
2605 N N   . VAL B 121 ? 0.3956 1.0201 0.6907 0.0609  -0.0175 -0.1732 115 VAL L N   
2606 C CA  . VAL B 121 ? 0.3447 0.9516 0.6374 0.0710  -0.0379 -0.1630 115 VAL L CA  
2607 C C   . VAL B 121 ? 0.3621 0.9946 0.6706 0.0572  -0.0322 -0.1799 115 VAL L C   
2608 O O   . VAL B 121 ? 0.3324 1.0140 0.6727 0.0566  -0.0336 -0.2111 115 VAL L O   
2609 C CB  . VAL B 121 ? 0.3294 0.9434 0.6373 0.1000  -0.0717 -0.1691 115 VAL L CB  
2610 C CG1 . VAL B 121 ? 0.3947 0.9854 0.6935 0.1085  -0.0921 -0.1569 115 VAL L CG1 
2611 C CG2 . VAL B 121 ? 0.2747 0.8631 0.5679 0.1135  -0.0779 -0.1528 115 VAL L CG2 
2612 N N   . PHE B 122 ? 0.3693 0.9706 0.6569 0.0469  -0.0268 -0.1610 116 PHE L N   
2613 C CA  . PHE B 122 ? 0.3706 0.9924 0.6716 0.0339  -0.0216 -0.1749 116 PHE L CA  
2614 C C   . PHE B 122 ? 0.4284 1.0293 0.7227 0.0468  -0.0435 -0.1615 116 PHE L C   
2615 O O   . PHE B 122 ? 0.4615 1.0208 0.7292 0.0540  -0.0512 -0.1342 116 PHE L O   
2616 C CB  . PHE B 122 ? 0.3709 0.9753 0.6507 0.0047  0.0092  -0.1671 116 PHE L CB  
2617 C CG  . PHE B 122 ? 0.4781 1.0927 0.7539 -0.0110 0.0327  -0.1757 116 PHE L CG  
2618 C CD1 . PHE B 122 ? 0.5072 1.0783 0.7462 -0.0190 0.0477  -0.1529 116 PHE L CD1 
2619 C CD2 . PHE B 122 ? 0.5886 1.2576 0.8966 -0.0171 0.0391  -0.2086 116 PHE L CD2 
2620 C CE1 . PHE B 122 ? 0.5644 1.1418 0.7954 -0.0337 0.0693  -0.1603 116 PHE L CE1 
2621 C CE2 . PHE B 122 ? 0.5775 1.2573 0.8798 -0.0336 0.0620  -0.2171 116 PHE L CE2 
2622 C CZ  . PHE B 122 ? 0.5350 1.1667 0.7971 -0.0422 0.0771  -0.1916 116 PHE L CZ  
2623 N N   . ILE B 123 ? 0.3625 0.9936 0.6805 0.0492  -0.0533 -0.1818 117 ILE L N   
2624 C CA  . ILE B 123 ? 0.4197 1.0312 0.7291 0.0595  -0.0727 -0.1698 117 ILE L CA  
2625 C C   . ILE B 123 ? 0.4382 1.0604 0.7533 0.0416  -0.0595 -0.1766 117 ILE L C   
2626 O O   . ILE B 123 ? 0.3959 1.0567 0.7350 0.0280  -0.0450 -0.2026 117 ILE L O   
2627 C CB  . ILE B 123 ? 0.3580 0.9824 0.6823 0.0871  -0.1065 -0.1828 117 ILE L CB  
2628 C CG1 . ILE B 123 ? 0.4665 1.0547 0.7678 0.0972  -0.1264 -0.1609 117 ILE L CG1 
2629 C CG2 . ILE B 123 ? 0.2837 0.9617 0.6453 0.0902  -0.1113 -0.2210 117 ILE L CG2 
2630 C CD1 . ILE B 123 ? 0.4567 1.0346 0.7548 0.1238  -0.1604 -0.1626 117 ILE L CD1 
2631 N N   . PHE B 124 ? 0.4357 1.0248 0.7283 0.0402  -0.0634 -0.1540 118 PHE L N   
2632 C CA  . PHE B 124 ? 0.4255 1.0208 0.7216 0.0256  -0.0540 -0.1582 118 PHE L CA  
2633 C C   . PHE B 124 ? 0.4676 1.0578 0.7632 0.0403  -0.0777 -0.1541 118 PHE L C   
2634 O O   . PHE B 124 ? 0.5316 1.0863 0.8011 0.0472  -0.0881 -0.1290 118 PHE L O   
2635 C CB  . PHE B 124 ? 0.3564 0.9152 0.6222 0.0067  -0.0333 -0.1355 118 PHE L CB  
2636 C CG  . PHE B 124 ? 0.4844 1.0355 0.7393 -0.0088 -0.0098 -0.1344 118 PHE L CG  
2637 C CD1 . PHE B 124 ? 0.5450 1.1079 0.8031 -0.0338 0.0148  -0.1477 118 PHE L CD1 
2638 C CD2 . PHE B 124 ? 0.4728 1.0013 0.7105 0.0003  -0.0117 -0.1193 118 PHE L CD2 
2639 C CE1 . PHE B 124 ? 0.5547 1.1047 0.7958 -0.0497 0.0368  -0.1454 118 PHE L CE1 
2640 C CE2 . PHE B 124 ? 0.4646 0.9832 0.6887 -0.0132 0.0096  -0.1178 118 PHE L CE2 
2641 C CZ  . PHE B 124 ? 0.4875 1.0153 0.7114 -0.0385 0.0339  -0.1303 118 PHE L CZ  
2642 N N   . PRO B 125 ? 0.3656 0.9921 0.6893 0.0447  -0.0860 -0.1801 119 PRO L N   
2643 C CA  . PRO B 125 ? 0.4111 1.0298 0.7304 0.0569  -0.1067 -0.1755 119 PRO L CA  
2644 C C   . PRO B 125 ? 0.4675 1.0636 0.7682 0.0413  -0.0941 -0.1566 119 PRO L C   
2645 O O   . PRO B 125 ? 0.4726 1.0653 0.7694 0.0203  -0.0695 -0.1542 119 PRO L O   
2646 C CB  . PRO B 125 ? 0.3448 1.0123 0.7011 0.0628  -0.1140 -0.2122 119 PRO L CB  
2647 C CG  . PRO B 125 ? 0.2956 0.9971 0.6747 0.0456  -0.0901 -0.2343 119 PRO L CG  
2648 C CD  . PRO B 125 ? 0.3427 1.0197 0.7027 0.0455  -0.0841 -0.2163 119 PRO L CD  
2649 N N   . PRO B 126 ? 0.5119 1.0907 0.7986 0.0514  -0.1118 -0.1438 120 PRO L N   
2650 C CA  . PRO B 126 ? 0.4659 1.0257 0.7355 0.0395  -0.1036 -0.1271 120 PRO L CA  
2651 C C   . PRO B 126 ? 0.4690 1.0554 0.7603 0.0238  -0.0878 -0.1459 120 PRO L C   
2652 O O   . PRO B 126 ? 0.4446 1.0679 0.7660 0.0270  -0.0906 -0.1734 120 PRO L O   
2653 C CB  . PRO B 126 ? 0.4298 0.9776 0.6869 0.0561  -0.1293 -0.1181 120 PRO L CB  
2654 C CG  . PRO B 126 ? 0.5013 1.0681 0.7753 0.0758  -0.1504 -0.1378 120 PRO L CG  
2655 C CD  . PRO B 126 ? 0.5229 1.0939 0.8034 0.0749  -0.1419 -0.1424 120 PRO L CD  
2656 N N   . SER B 127 ? 0.5088 1.0766 0.7844 0.0074  -0.0722 -0.1330 121 SER L N   
2657 C CA  . SER B 127 ? 0.6002 1.1869 0.8921 -0.0094 -0.0572 -0.1489 121 SER L CA  
2658 C C   . SER B 127 ? 0.6586 1.2624 0.9639 -0.0002 -0.0728 -0.1573 121 SER L C   
2659 O O   . SER B 127 ? 0.6097 1.1998 0.9012 0.0155  -0.0925 -0.1435 121 SER L O   
2660 C CB  . SER B 127 ? 0.6694 1.2237 0.9349 -0.0281 -0.0386 -0.1318 121 SER L CB  
2661 O OG  . SER B 127 ? 0.7168 1.2440 0.9579 -0.0200 -0.0502 -0.1094 121 SER L OG  
2662 N N   . ASP B 128 ? 0.6897 1.3236 1.0210 -0.0110 -0.0634 -0.1808 122 ASP L N   
2663 C CA  . ASP B 128 ? 0.6841 1.3343 1.0284 -0.0029 -0.0766 -0.1894 122 ASP L CA  
2664 C C   . ASP B 128 ? 0.6981 1.3156 1.0143 -0.0077 -0.0762 -0.1642 122 ASP L C   
2665 O O   . ASP B 128 ? 0.7836 1.3965 1.0922 0.0062  -0.0943 -0.1556 122 ASP L O   
2666 C CB  . ASP B 128 ? 0.6633 1.3539 1.0424 -0.0157 -0.0645 -0.2214 122 ASP L CB  
2667 N N   . GLU B 129 ? 0.6325 1.2258 0.9306 -0.0266 -0.0567 -0.1528 123 GLU L N   
2668 C CA  . GLU B 129 ? 0.6131 1.1758 0.8838 -0.0299 -0.0572 -0.1315 123 GLU L CA  
2669 C C   . GLU B 129 ? 0.6919 1.2362 0.9406 -0.0125 -0.0759 -0.1100 123 GLU L C   
2670 O O   . GLU B 129 ? 0.7141 1.2535 0.9531 -0.0079 -0.0857 -0.1013 123 GLU L O   
2671 C CB  . GLU B 129 ? 0.5623 1.0938 0.8095 -0.0489 -0.0366 -0.1217 123 GLU L CB  
2672 N N   . GLN B 130 ? 0.6533 1.1885 0.8936 -0.0041 -0.0805 -0.1023 124 GLN L N   
2673 C CA  . GLN B 130 ? 0.5958 1.1108 0.8122 0.0085  -0.0960 -0.0819 124 GLN L CA  
2674 C C   . GLN B 130 ? 0.6202 1.1486 0.8432 0.0252  -0.1185 -0.0863 124 GLN L C   
2675 O O   . GLN B 130 ? 0.6169 1.1320 0.8196 0.0313  -0.1312 -0.0715 124 GLN L O   
2676 C CB  . GLN B 130 ? 0.5867 1.0827 0.7888 0.0105  -0.0926 -0.0712 124 GLN L CB  
2677 C CG  . GLN B 130 ? 0.5743 1.0498 0.7517 0.0213  -0.1077 -0.0517 124 GLN L CG  
2678 C CD  . GLN B 130 ? 0.5854 1.0480 0.7555 0.0262  -0.1077 -0.0456 124 GLN L CD  
2679 O OE1 . GLN B 130 ? 0.6188 1.0945 0.8069 0.0265  -0.1019 -0.0589 124 GLN L OE1 
2680 N NE2 . GLN B 130 ? 0.4668 0.9062 0.6115 0.0296  -0.1137 -0.0271 124 GLN L NE2 
2681 N N   . LEU B 131 ? 0.7266 1.0408 0.8218 0.1362  0.0140  -0.1008 125 LEU L N   
2682 C CA  . LEU B 131 ? 0.8049 1.1004 0.8630 0.1585  0.0194  -0.1097 125 LEU L CA  
2683 C C   . LEU B 131 ? 0.9140 1.1849 0.9594 0.1698  0.0170  -0.1165 125 LEU L C   
2684 O O   . LEU B 131 ? 0.8789 1.1177 0.8929 0.1878  0.0279  -0.1214 125 LEU L O   
2685 C CB  . LEU B 131 ? 0.7371 1.0599 0.7858 0.1639  0.0089  -0.1154 125 LEU L CB  
2686 C CG  . LEU B 131 ? 0.7797 1.1142 0.8228 0.1627  0.0158  -0.1111 125 LEU L CG  
2687 C CD1 . LEU B 131 ? 0.7170 1.0868 0.7602 0.1646  0.0038  -0.1159 125 LEU L CD1 
2688 C CD2 . LEU B 131 ? 0.8380 1.1372 0.8441 0.1804  0.0323  -0.1132 125 LEU L CD2 
2689 N N   . LYS B 132 ? 0.9779 1.2609 1.0456 0.1589  0.0031  -0.1165 126 LYS L N   
2690 C CA  . LYS B 132 ? 1.0076 1.2676 1.0641 0.1684  -0.0015 -0.1229 126 LYS L CA  
2691 C C   . LYS B 132 ? 0.9659 1.1896 1.0138 0.1752  0.0152  -0.1201 126 LYS L C   
2692 O O   . LYS B 132 ? 0.9881 1.1855 1.0201 0.1867  0.0156  -0.1252 126 LYS L O   
2693 C CB  . LYS B 132 ? 1.0597 1.3364 1.1431 0.1522  -0.0185 -0.1218 126 LYS L CB  
2694 C CG  . LYS B 132 ? 1.1320 1.4472 1.2287 0.1418  -0.0346 -0.1247 126 LYS L CG  
2695 C CD  . LYS B 132 ? 1.2073 1.5278 1.2787 0.1601  -0.0400 -0.1364 126 LYS L CD  
2696 C CE  . LYS B 132 ? 1.2533 1.6182 1.3400 0.1505  -0.0504 -0.1384 126 LYS L CE  
2697 N NZ  . LYS B 132 ? 1.2753 1.6646 1.3906 0.1297  -0.0657 -0.1380 126 LYS L NZ  
2698 N N   . SER B 133 ? 0.9229 1.1454 0.9816 0.1681  0.0291  -0.1126 127 SER L N   
2699 C CA  . SER B 133 ? 0.9287 1.1216 0.9853 0.1723  0.0461  -0.1103 127 SER L CA  
2700 C C   . SER B 133 ? 0.9192 1.0944 0.9550 0.1802  0.0666  -0.1096 127 SER L C   
2701 O O   . SER B 133 ? 0.9322 1.0936 0.9770 0.1769  0.0822  -0.1057 127 SER L O   
2702 C CB  . SER B 133 ? 0.9198 1.1244 1.0149 0.1544  0.0437  -0.1024 127 SER L CB  
2703 O OG  . SER B 133 ? 0.9058 1.1395 1.0232 0.1387  0.0391  -0.0959 127 SER L OG  
2704 N N   . GLY B 134 ? 0.9260 1.1017 0.9338 0.1906  0.0666  -0.1137 128 GLY L N   
2705 C CA  . GLY B 134 ? 0.9948 1.1438 0.9710 0.2019  0.0861  -0.1148 128 GLY L CA  
2706 C C   . GLY B 134 ? 1.0214 1.1824 1.0103 0.1897  0.0950  -0.1078 128 GLY L C   
2707 O O   . GLY B 134 ? 1.0777 1.2158 1.0392 0.1972  0.1112  -0.1084 128 GLY L O   
2708 N N   . THR B 135 ? 0.9217 1.1156 0.9492 0.1709  0.0844  -0.1012 129 THR L N   
2709 C CA  . THR B 135 ? 0.8022 1.0082 0.8429 0.1589  0.0906  -0.0946 129 THR L CA  
2710 C C   . THR B 135 ? 0.7403 0.9788 0.7872 0.1527  0.0757  -0.0927 129 THR L C   
2711 O O   . THR B 135 ? 0.7832 1.0437 0.8416 0.1498  0.0591  -0.0943 129 THR L O   
2712 C CB  . THR B 135 ? 0.8201 1.0337 0.9002 0.1423  0.0932  -0.0880 129 THR L CB  
2713 O OG1 . THR B 135 ? 0.8655 1.0504 0.9404 0.1487  0.1094  -0.0904 129 THR L OG1 
2714 C CG2 . THR B 135 ? 0.8633 1.0882 0.9560 0.1303  0.0981  -0.0820 129 THR L CG2 
2715 N N   . ALA B 136 ? 0.6446 0.8850 0.6825 0.1507  0.0824  -0.0896 130 ALA L N   
2716 C CA  . ALA B 136 ? 0.7038 0.9739 0.7455 0.1457  0.0707  -0.0874 130 ALA L CA  
2717 C C   . ALA B 136 ? 0.6512 0.9299 0.7104 0.1309  0.0748  -0.0792 130 ALA L C   
2718 O O   . ALA B 136 ? 0.6376 0.8975 0.6771 0.1347  0.0880  -0.0786 130 ALA L O   
2719 C CB  . ALA B 136 ? 0.7500 1.0128 0.7507 0.1647  0.0715  -0.0944 130 ALA L CB  
2720 N N   . SER B 137 ? 0.6346 0.9390 0.7286 0.1141  0.0633  -0.0732 131 SER L N   
2721 C CA  . SER B 137 ? 0.5850 0.8998 0.6951 0.1004  0.0637  -0.0657 131 SER L CA  
2722 C C   . SER B 137 ? 0.5455 0.8860 0.6509 0.0980  0.0535  -0.0636 131 SER L C   
2723 O O   . SER B 137 ? 0.6118 0.9753 0.7278 0.0945  0.0407  -0.0643 131 SER L O   
2724 C CB  . SER B 137 ? 0.5188 0.8419 0.6673 0.0844  0.0577  -0.0603 131 SER L CB  
2725 O OG  . SER B 137 ? 0.5650 0.8664 0.7205 0.0856  0.0699  -0.0615 131 SER L OG  
2726 N N   . VAL B 138 ? 0.3791 0.7154 0.4678 0.0997  0.0596  -0.0613 132 VAL L N   
2727 C CA  . VAL B 138 ? 0.4294 0.7905 0.5160 0.0964  0.0507  -0.0584 132 VAL L CA  
2728 C C   . VAL B 138 ? 0.5534 0.9203 0.6607 0.0801  0.0487  -0.0497 132 VAL L C   
2729 O O   . VAL B 138 ? 0.6229 0.9706 0.7263 0.0782  0.0582  -0.0477 132 VAL L O   
2730 C CB  . VAL B 138 ? 0.4453 0.7993 0.4929 0.1128  0.0563  -0.0626 132 VAL L CB  
2731 C CG1 . VAL B 138 ? 0.3506 0.7356 0.3991 0.1106  0.0462  -0.0607 132 VAL L CG1 
2732 C CG2 . VAL B 138 ? 0.4627 0.8032 0.4846 0.1315  0.0593  -0.0720 132 VAL L CG2 
2733 N N   . VAL B 139 ? 0.4628 0.8548 0.5910 0.0680  0.0364  -0.0449 133 VAL L N   
2734 C CA  . VAL B 139 ? 0.4388 0.8348 0.5854 0.0532  0.0323  -0.0369 133 VAL L CA  
2735 C C   . VAL B 139 ? 0.5115 0.9213 0.6450 0.0519  0.0290  -0.0328 133 VAL L C   
2736 O O   . VAL B 139 ? 0.4943 0.9262 0.6228 0.0537  0.0231  -0.0338 133 VAL L O   
2737 C CB  . VAL B 139 ? 0.3851 0.7917 0.5633 0.0389  0.0213  -0.0329 133 VAL L CB  
2738 C CG1 . VAL B 139 ? 0.3641 0.7738 0.5557 0.0258  0.0155  -0.0251 133 VAL L CG1 
2739 C CG2 . VAL B 139 ? 0.1794 0.5702 0.3723 0.0397  0.0247  -0.0359 133 VAL L CG2 
2740 N N   . CYS B 140 ? 0.5060 0.9029 0.6345 0.0486  0.0330  -0.0288 134 CYS L N   
2741 C CA  . CYS B 140 ? 0.5201 0.9256 0.6356 0.0469  0.0299  -0.0241 134 CYS L CA  
2742 C C   . CYS B 140 ? 0.5257 0.9337 0.6641 0.0309  0.0217  -0.0165 134 CYS L C   
2743 O O   . CYS B 140 ? 0.5545 0.9480 0.7091 0.0246  0.0228  -0.0155 134 CYS L O   
2744 C CB  . CYS B 140 ? 0.6166 1.0008 0.7027 0.0565  0.0402  -0.0257 134 CYS L CB  
2745 S SG  . CYS B 140 ? 0.8839 1.2775 0.9433 0.0611  0.0375  -0.0221 134 CYS L SG  
2746 N N   . LEU B 141 ? 0.5302 0.9564 0.6696 0.0247  0.0135  -0.0117 135 LEU L N   
2747 C CA  . LEU B 141 ? 0.4233 0.8498 0.5796 0.0104  0.0044  -0.0043 135 LEU L CA  
2748 C C   . LEU B 141 ? 0.4160 0.8425 0.5537 0.0100  0.0030  0.0009  135 LEU L C   
2749 O O   . LEU B 141 ? 0.5058 0.9470 0.6258 0.0155  0.0042  0.0009  135 LEU L O   
2750 C CB  . LEU B 141 ? 0.3893 0.8324 0.5632 0.0008  -0.0045 -0.0021 135 LEU L CB  
2751 C CG  . LEU B 141 ? 0.4676 0.9086 0.6524 -0.0129 -0.0145 0.0058  135 LEU L CG  
2752 C CD1 . LEU B 141 ? 0.4280 0.8515 0.6339 -0.0180 -0.0186 0.0062  135 LEU L CD1 
2753 C CD2 . LEU B 141 ? 0.5068 0.9645 0.6985 -0.0222 -0.0210 0.0083  135 LEU L CD2 
2754 N N   . LEU B 142 ? 0.3877 0.7979 0.5297 0.0041  0.0002  0.0046  136 LEU L N   
2755 C CA  . LEU B 142 ? 0.3752 0.7815 0.5012 0.0018  -0.0035 0.0103  136 LEU L CA  
2756 C C   . LEU B 142 ? 0.4566 0.8639 0.6007 -0.0115 -0.0157 0.0166  136 LEU L C   
2757 O O   . LEU B 142 ? 0.5277 0.9238 0.6924 -0.0179 -0.0211 0.0167  136 LEU L O   
2758 C CB  . LEU B 142 ? 0.3687 0.7525 0.4839 0.0047  0.0010  0.0091  136 LEU L CB  
2759 C CG  . LEU B 142 ? 0.3661 0.7401 0.4519 0.0181  0.0129  0.0043  136 LEU L CG  
2760 C CD1 . LEU B 142 ? 0.3813 0.7578 0.4693 0.0261  0.0213  -0.0026 136 LEU L CD1 
2761 C CD2 . LEU B 142 ? 0.4061 0.7552 0.4858 0.0160  0.0162  0.0038  136 LEU L CD2 
2762 N N   . ASN B 143 ? 0.4408 0.8611 0.5763 -0.0152 -0.0198 0.0215  137 ASN L N   
2763 C CA  . ASN B 143 ? 0.5039 0.9229 0.6517 -0.0275 -0.0306 0.0276  137 ASN L CA  
2764 C C   . ASN B 143 ? 0.4962 0.9033 0.6277 -0.0307 -0.0367 0.0343  137 ASN L C   
2765 O O   . ASN B 143 ? 0.5324 0.9440 0.6398 -0.0252 -0.0322 0.0362  137 ASN L O   
2766 C CB  . ASN B 143 ? 0.5834 1.0230 0.7346 -0.0324 -0.0306 0.0283  137 ASN L CB  
2767 C CG  . ASN B 143 ? 0.6504 1.0841 0.8189 -0.0452 -0.0405 0.0321  137 ASN L CG  
2768 O OD1 . ASN B 143 ? 0.6948 1.1147 0.8808 -0.0473 -0.0460 0.0307  137 ASN L OD1 
2769 N ND2 . ASN B 143 ? 0.6685 1.1120 0.8314 -0.0537 -0.0424 0.0366  137 ASN L ND2 
2770 N N   . ASN B 144 ? 0.4248 0.8158 0.5685 -0.0383 -0.0474 0.0373  138 ASN L N   
2771 C CA  . ASN B 144 ? 0.5136 0.8903 0.6420 -0.0417 -0.0557 0.0437  138 ASN L CA  
2772 C C   . ASN B 144 ? 0.5456 0.9148 0.6490 -0.0338 -0.0514 0.0440  138 ASN L C   
2773 O O   . ASN B 144 ? 0.6309 1.0045 0.7099 -0.0313 -0.0486 0.0482  138 ASN L O   
2774 C CB  . ASN B 144 ? 0.5447 0.9280 0.6623 -0.0486 -0.0584 0.0502  138 ASN L CB  
2775 C CG  . ASN B 144 ? 0.6849 1.0759 0.8223 -0.0565 -0.0608 0.0495  138 ASN L CG  
2776 O OD1 . ASN B 144 ? 0.7684 1.1499 0.9268 -0.0589 -0.0676 0.0470  138 ASN L OD1 
2777 N ND2 . ASN B 144 ? 0.6629 1.0715 0.7939 -0.0605 -0.0553 0.0513  138 ASN L ND2 
2778 N N   . PHE B 145 ? 0.5366 0.8935 0.6455 -0.0305 -0.0505 0.0395  139 PHE L N   
2779 C CA  . PHE B 145 ? 0.5284 0.8721 0.6124 -0.0244 -0.0480 0.0399  139 PHE L CA  
2780 C C   . PHE B 145 ? 0.5368 0.8595 0.6284 -0.0294 -0.0593 0.0400  139 PHE L C   
2781 O O   . PHE B 145 ? 0.5811 0.9013 0.6991 -0.0362 -0.0687 0.0390  139 PHE L O   
2782 C CB  . PHE B 145 ? 0.4762 0.8216 0.5517 -0.0152 -0.0346 0.0336  139 PHE L CB  
2783 C CG  . PHE B 145 ? 0.4622 0.8053 0.5650 -0.0173 -0.0312 0.0270  139 PHE L CG  
2784 C CD1 . PHE B 145 ? 0.5068 0.8326 0.6152 -0.0192 -0.0310 0.0235  139 PHE L CD1 
2785 C CD2 . PHE B 145 ? 0.4184 0.7764 0.5405 -0.0175 -0.0274 0.0240  139 PHE L CD2 
2786 C CE1 . PHE B 145 ? 0.4636 0.7885 0.5974 -0.0213 -0.0259 0.0172  139 PHE L CE1 
2787 C CE2 . PHE B 145 ? 0.4432 0.7980 0.5880 -0.0183 -0.0231 0.0181  139 PHE L CE2 
2788 C CZ  . PHE B 145 ? 0.4814 0.8204 0.6325 -0.0202 -0.0215 0.0147  139 PHE L CZ  
2789 N N   . TYR B 146 ? 0.5454 0.8529 0.6128 -0.0254 -0.0590 0.0407  140 TYR L N   
2790 C CA  . TYR B 146 ? 0.5220 0.8094 0.5943 -0.0297 -0.0695 0.0395  140 TYR L CA  
2791 C C   . TYR B 146 ? 0.5393 0.8119 0.5811 -0.0235 -0.0633 0.0385  140 TYR L C   
2792 O O   . TYR B 146 ? 0.6172 0.8904 0.6265 -0.0160 -0.0580 0.0425  140 TYR L O   
2793 C CB  . TYR B 146 ? 0.4328 0.7097 0.5003 -0.0343 -0.0857 0.0455  140 TYR L CB  
2794 C CG  . TYR B 146 ? 0.5301 0.7887 0.6088 -0.0385 -0.0988 0.0424  140 TYR L CG  
2795 C CD1 . TYR B 146 ? 0.6181 0.8586 0.6734 -0.0361 -0.1004 0.0421  140 TYR L CD1 
2796 C CD2 . TYR B 146 ? 0.5871 0.8470 0.7006 -0.0445 -0.1102 0.0388  140 TYR L CD2 
2797 C CE1 . TYR B 146 ? 0.6232 0.8483 0.6910 -0.0409 -0.1133 0.0380  140 TYR L CE1 
2798 C CE2 . TYR B 146 ? 0.6003 0.8471 0.7279 -0.0480 -0.1232 0.0343  140 TYR L CE2 
2799 C CZ  . TYR B 146 ? 0.5904 0.8205 0.6961 -0.0469 -0.1248 0.0338  140 TYR L CZ  
2800 O OH  . TYR B 146 ? 0.5964 0.8149 0.7180 -0.0512 -0.1385 0.0284  140 TYR L OH  
2801 N N   . PRO B 147 ? 0.4950 0.7538 0.5462 -0.0267 -0.0636 0.0330  141 PRO L N   
2802 C CA  . PRO B 147 ? 0.4931 0.7519 0.5836 -0.0352 -0.0693 0.0271  141 PRO L CA  
2803 C C   . PRO B 147 ? 0.5191 0.7940 0.6362 -0.0354 -0.0576 0.0218  141 PRO L C   
2804 O O   . PRO B 147 ? 0.4716 0.7572 0.5767 -0.0290 -0.0467 0.0228  141 PRO L O   
2805 C CB  . PRO B 147 ? 0.4629 0.7016 0.5437 -0.0374 -0.0683 0.0228  141 PRO L CB  
2806 C CG  . PRO B 147 ? 0.4537 0.6853 0.4943 -0.0280 -0.0541 0.0243  141 PRO L CG  
2807 C CD  . PRO B 147 ? 0.4952 0.7351 0.5133 -0.0215 -0.0578 0.0321  141 PRO L CD  
2808 N N   . ARG B 148 ? 0.5867 0.8635 0.7398 -0.0421 -0.0600 0.0156  142 ARG L N   
2809 C CA  . ARG B 148 ? 0.5911 0.8812 0.7700 -0.0420 -0.0494 0.0105  142 ARG L CA  
2810 C C   . ARG B 148 ? 0.5479 0.8326 0.7071 -0.0364 -0.0301 0.0071  142 ARG L C   
2811 O O   . ARG B 148 ? 0.5910 0.8855 0.7482 -0.0307 -0.0200 0.0063  142 ARG L O   
2812 C CB  . ARG B 148 ? 0.6833 0.9765 0.9047 -0.0497 -0.0555 0.0038  142 ARG L CB  
2813 C CG  . ARG B 148 ? 0.7863 1.0914 1.0340 -0.0491 -0.0432 -0.0019 142 ARG L CG  
2814 C CD  . ARG B 148 ? 0.8814 1.1900 1.1700 -0.0562 -0.0453 -0.0100 142 ARG L CD  
2815 N NE  . ARG B 148 ? 1.0485 1.3626 1.3616 -0.0595 -0.0659 -0.0099 142 ARG L NE  
2816 C CZ  . ARG B 148 ? 1.2193 1.5396 1.5706 -0.0646 -0.0731 -0.0173 142 ARG L CZ  
2817 N NH1 . ARG B 148 ? 1.2577 1.5809 1.6294 -0.0689 -0.0595 -0.0254 142 ARG L NH1 
2818 N NH2 . ARG B 148 ? 1.2626 1.5858 1.6311 -0.0652 -0.0937 -0.0172 142 ARG L NH2 
2819 N N   . GLU B 149 ? 0.5015 0.7682 0.6438 -0.0377 -0.0255 0.0048  143 GLU L N   
2820 C CA  . GLU B 149 ? 0.5295 0.7847 0.6509 -0.0329 -0.0069 0.0008  143 GLU L CA  
2821 C C   . GLU B 149 ? 0.5624 0.8191 0.6459 -0.0199 0.0010  0.0044  143 GLU L C   
2822 O O   . GLU B 149 ? 0.6236 0.8764 0.6779 -0.0148 -0.0044 0.0095  143 GLU L O   
2823 C CB  . GLU B 149 ? 0.5137 0.7455 0.6213 -0.0384 -0.0047 -0.0021 143 GLU L CB  
2824 C CG  . GLU B 149 ? 0.7268 0.9519 0.8323 -0.0436 -0.0229 0.0013  143 GLU L CG  
2825 C CD  . GLU B 149 ? 0.8430 1.0814 0.9951 -0.0532 -0.0381 -0.0012 143 GLU L CD  
2826 O OE1 . GLU B 149 ? 0.8610 1.1058 1.0153 -0.0522 -0.0539 0.0040  143 GLU L OE1 
2827 O OE2 . GLU B 149 ? 0.8511 1.0929 1.0364 -0.0611 -0.0340 -0.0086 143 GLU L OE2 
2828 N N   . ALA B 150 ? 0.5807 0.8439 0.6659 -0.0140 0.0134  0.0010  144 ALA L N   
2829 C CA  . ALA B 150 ? 0.6245 0.8914 0.6776 -0.0004 0.0212  0.0020  144 ALA L CA  
2830 C C   . ALA B 150 ? 0.6869 0.9427 0.7324 0.0051  0.0380  -0.0045 144 ALA L C   
2831 O O   . ALA B 150 ? 0.7478 1.0046 0.8230 -0.0015 0.0426  -0.0086 144 ALA L O   
2832 C CB  . ALA B 150 ? 0.5518 0.8447 0.6202 0.0013  0.0141  0.0051  144 ALA L CB  
2833 N N   . LYS B 151 ? 0.7168 0.9606 0.7212 0.0181  0.0474  -0.0058 145 LYS L N   
2834 C CA  . LYS B 151 ? 0.7115 0.9400 0.7017 0.0253  0.0636  -0.0119 145 LYS L CA  
2835 C C   . LYS B 151 ? 0.7125 0.9570 0.6950 0.0386  0.0661  -0.0137 145 LYS L C   
2836 O O   . LYS B 151 ? 0.7172 0.9681 0.6716 0.0507  0.0636  -0.0125 145 LYS L O   
2837 C CB  . LYS B 151 ? 0.7257 0.9211 0.6706 0.0312  0.0735  -0.0137 145 LYS L CB  
2838 C CG  . LYS B 151 ? 0.8283 1.0005 0.7560 0.0367  0.0915  -0.0201 145 LYS L CG  
2839 C CD  . LYS B 151 ? 0.9418 1.0749 0.8296 0.0367  0.1018  -0.0219 145 LYS L CD  
2840 C CE  . LYS B 151 ? 1.0583 1.1717 0.8883 0.0571  0.1082  -0.0234 145 LYS L CE  
2841 N NZ  . LYS B 151 ? 1.1350 1.2697 0.9511 0.0686  0.0951  -0.0193 145 LYS L NZ  
2842 N N   . VAL B 152 ? 0.6894 0.9412 0.6975 0.0368  0.0705  -0.0173 146 VAL L N   
2843 C CA  . VAL B 152 ? 0.6620 0.9266 0.6629 0.0492  0.0726  -0.0202 146 VAL L CA  
2844 C C   . VAL B 152 ? 0.7641 1.0037 0.7384 0.0601  0.0886  -0.0267 146 VAL L C   
2845 O O   . VAL B 152 ? 0.8276 1.0526 0.8157 0.0538  0.0985  -0.0298 146 VAL L O   
2846 C CB  . VAL B 152 ? 0.5872 0.8773 0.6297 0.0421  0.0645  -0.0194 146 VAL L CB  
2847 C CG1 . VAL B 152 ? 0.5422 0.8423 0.5759 0.0545  0.0670  -0.0235 146 VAL L CG1 
2848 C CG2 . VAL B 152 ? 0.6992 1.0111 0.7595 0.0335  0.0489  -0.0127 146 VAL L CG2 
2849 N N   . GLN B 153 ? 0.8078 1.0423 0.7429 0.0772  0.0913  -0.0293 147 GLN L N   
2850 C CA  . GLN B 153 ? 0.8067 1.0125 0.7065 0.0906  0.1056  -0.0356 147 GLN L CA  
2851 C C   . GLN B 153 ? 0.8562 1.0768 0.7463 0.1069  0.1031  -0.0403 147 GLN L C   
2852 O O   . GLN B 153 ? 0.9221 1.1624 0.8000 0.1166  0.0942  -0.0400 147 GLN L O   
2853 C CB  . GLN B 153 ? 0.8220 0.9996 0.6735 0.0990  0.1109  -0.0356 147 GLN L CB  
2854 C CG  . GLN B 153 ? 1.0010 1.1360 0.8201 0.1029  0.1282  -0.0402 147 GLN L CG  
2855 C CD  . GLN B 153 ? 1.1174 1.2221 0.8997 0.1022  0.1324  -0.0385 147 GLN L CD  
2856 O OE1 . GLN B 153 ? 1.0691 1.1855 0.8484 0.1009  0.1215  -0.0340 147 GLN L OE1 
2857 N NE2 . GLN B 153 ? 1.1968 1.2598 0.9487 0.1026  0.1488  -0.0421 147 GLN L NE2 
2858 N N   . TRP B 154 ? 0.8351 1.0467 0.7312 0.1099  0.1109  -0.0450 148 TRP L N   
2859 C CA  . TRP B 154 ? 0.7526 0.9739 0.6381 0.1258  0.1085  -0.0508 148 TRP L CA  
2860 C C   . TRP B 154 ? 0.8594 1.0491 0.6894 0.1470  0.1180  -0.0571 148 TRP L C   
2861 O O   . TRP B 154 ? 0.9067 1.0584 0.7133 0.1477  0.1327  -0.0589 148 TRP L O   
2862 C CB  . TRP B 154 ? 0.6754 0.8972 0.5894 0.1206  0.1123  -0.0531 148 TRP L CB  
2863 C CG  . TRP B 154 ? 0.6833 0.9370 0.6477 0.1047  0.1007  -0.0486 148 TRP L CG  
2864 C CD1 . TRP B 154 ? 0.6449 0.8999 0.6447 0.0872  0.1013  -0.0446 148 TRP L CD1 
2865 C CD2 . TRP B 154 ? 0.6315 0.9191 0.6158 0.1050  0.0867  -0.0483 148 TRP L CD2 
2866 N NE1 . TRP B 154 ? 0.6507 0.9354 0.6878 0.0779  0.0880  -0.0415 148 TRP L NE1 
2867 C CE2 . TRP B 154 ? 0.6216 0.9258 0.6497 0.0874  0.0795  -0.0433 148 TRP L CE2 
2868 C CE3 . TRP B 154 ? 0.5935 0.8993 0.5630 0.1182  0.0793  -0.0523 148 TRP L CE3 
2869 C CZ2 . TRP B 154 ? 0.6557 0.9900 0.7097 0.0817  0.0662  -0.0414 148 TRP L CZ2 
2870 C CZ3 . TRP B 154 ? 0.6447 0.9842 0.6442 0.1112  0.0664  -0.0509 148 TRP L CZ3 
2871 C CH2 . TRP B 154 ? 0.6993 1.0508 0.7389 0.0927  0.0605  -0.0451 148 TRP L CH2 
2872 N N   . LYS B 155 ? 0.8740 1.0789 0.6826 0.1643  0.1099  -0.0611 149 LYS L N   
2873 C CA  . LYS B 155 ? 0.8889 1.0650 0.6436 0.1881  0.1164  -0.0686 149 LYS L CA  
2874 C C   . LYS B 155 ? 0.9180 1.1107 0.6730 0.2033  0.1097  -0.0764 149 LYS L C   
2875 O O   . LYS B 155 ? 1.0770 1.3063 0.8427 0.2093  0.0965  -0.0783 149 LYS L O   
2876 C CB  . LYS B 155 ? 0.8495 1.0225 0.5671 0.2001  0.1128  -0.0683 149 LYS L CB  
2877 C CG  . LYS B 155 ? 0.9837 1.1331 0.6912 0.1876  0.1194  -0.0618 149 LYS L CG  
2878 C CD  . LYS B 155 ? 1.1006 1.2426 0.7650 0.2025  0.1159  -0.0621 149 LYS L CD  
2879 C CE  . LYS B 155 ? 1.1010 1.2529 0.7818 0.1860  0.1110  -0.0535 149 LYS L CE  
2880 N NZ  . LYS B 155 ? 1.0865 1.2328 0.7257 0.2009  0.1071  -0.0534 149 LYS L NZ  
2881 N N   . VAL B 156 ? 0.9249 1.1138 1.0264 0.0025  0.0383  0.0017  150 VAL L N   
2882 C CA  . VAL B 156 ? 0.9135 1.1084 1.0411 0.0277  0.0092  -0.0064 150 VAL L CA  
2883 C C   . VAL B 156 ? 0.9193 1.0897 1.0304 0.0300  0.0211  0.0129  150 VAL L C   
2884 O O   . VAL B 156 ? 0.9376 1.1086 1.0022 0.0209  0.0413  0.0212  150 VAL L O   
2885 C CB  . VAL B 156 ? 0.7911 1.0295 0.8991 0.0452  -0.0129 -0.0322 150 VAL L CB  
2886 C CG1 . VAL B 156 ? 0.8609 1.1023 0.9953 0.0723  -0.0494 -0.0466 150 VAL L CG1 
2887 C CG2 . VAL B 156 ? 0.7335 0.9982 0.8526 0.0440  -0.0201 -0.0494 150 VAL L CG2 
2888 N N   . ASP B 157 ? 0.9072 1.0581 1.0612 0.0417  0.0083  0.0234  151 ASP L N   
2889 C CA  . ASP B 157 ? 0.9796 1.1063 1.1255 0.0453  0.0212  0.0462  151 ASP L CA  
2890 C C   . ASP B 157 ? 1.0097 1.1081 1.1103 0.0257  0.0617  0.0630  151 ASP L C   
2891 O O   . ASP B 157 ? 1.0142 1.1065 1.0811 0.0255  0.0735  0.0741  151 ASP L O   
2892 C CB  . ASP B 157 ? 0.9985 1.1491 1.1252 0.0634  0.0002  0.0391  151 ASP L CB  
2893 C CG  . ASP B 157 ? 1.0281 1.1869 1.2055 0.0841  -0.0401 0.0314  151 ASP L CG  
2894 O OD1 . ASP B 157 ? 0.9577 1.0963 1.1896 0.0833  -0.0438 0.0464  151 ASP L OD1 
2895 O OD2 . ASP B 157 ? 1.1084 1.2956 1.2714 0.1017  -0.0689 0.0109  151 ASP L OD2 
2896 N N   . ASN B 158 ? 1.0415 1.1221 1.1413 0.0094  0.0811  0.0648  152 ASN L N   
2897 C CA  . ASN B 158 ? 1.0967 1.1433 1.1527 -0.0105 0.1156  0.0754  152 ASN L CA  
2898 C C   . ASN B 158 ? 1.0423 1.1068 1.0510 -0.0282 0.1224  0.0671  152 ASN L C   
2899 O O   . ASN B 158 ? 1.0675 1.1030 1.0415 -0.0490 0.1464  0.0738  152 ASN L O   
2900 C CB  . ASN B 158 ? 1.1621 1.1697 1.2135 -0.0028 0.1327  0.0982  152 ASN L CB  
2901 C CG  . ASN B 158 ? 1.2316 1.2145 1.3218 0.0085  0.1406  0.1129  152 ASN L CG  
2902 O OD1 . ASN B 158 ? 1.2497 1.2190 1.3396 0.0005  0.1552  0.1117  152 ASN L OD1 
2903 N ND2 . ASN B 158 ? 1.2555 1.2379 1.3806 0.0284  0.1309  0.1291  152 ASN L ND2 
2904 N N   . ALA B 159 ? 0.9575 1.0697 0.9658 -0.0193 0.1007  0.0529  153 ALA L N   
2905 C CA  . ALA B 159 ? 1.0018 1.1430 0.9712 -0.0336 0.1079  0.0497  153 ALA L CA  
2906 C C   . ALA B 159 ? 0.9865 1.1489 0.9556 -0.0498 0.1081  0.0358  153 ALA L C   
2907 O O   . ALA B 159 ? 0.9931 1.1872 0.9876 -0.0367 0.0875  0.0188  153 ALA L O   
2908 C CB  . ALA B 159 ? 0.9820 1.1705 0.9446 -0.0119 0.0882  0.0426  153 ALA L CB  
2909 N N   . LEU B 160 ? 0.9175 1.0603 0.8593 -0.0783 0.1295  0.0430  154 LEU L N   
2910 C CA  . LEU B 160 ? 0.9512 1.1172 0.8904 -0.0964 0.1295  0.0326  154 LEU L CA  
2911 C C   . LEU B 160 ? 0.9261 1.1587 0.8664 -0.0888 0.1150  0.0222  154 LEU L C   
2912 O O   . LEU B 160 ? 0.9599 1.2187 0.8776 -0.0930 0.1205  0.0307  154 LEU L O   
2913 C CB  . LEU B 160 ? 1.0690 1.2037 0.9743 -0.1300 0.1507  0.0415  154 LEU L CB  
2914 C CG  . LEU B 160 ? 1.1853 1.3545 1.0846 -0.1521 0.1482  0.0333  154 LEU L CG  
2915 C CD1 . LEU B 160 ? 1.1744 1.3559 1.1022 -0.1402 0.1369  0.0211  154 LEU L CD1 
2916 C CD2 . LEU B 160 ? 1.2993 1.4288 1.1661 -0.1871 0.1643  0.0391  154 LEU L CD2 
2917 N N   . GLN B 161 ? 0.8372 1.0984 0.8056 -0.0760 0.0978  0.0062  155 GLN L N   
2918 C CA  . GLN B 161 ? 0.7240 1.0464 0.6962 -0.0611 0.0832  -0.0071 155 GLN L CA  
2919 C C   . GLN B 161 ? 0.7677 1.1267 0.7264 -0.0849 0.0928  -0.0037 155 GLN L C   
2920 O O   . GLN B 161 ? 0.8259 1.1609 0.7753 -0.1138 0.1056  0.0045  155 GLN L O   
2921 C CB  . GLN B 161 ? 0.6692 1.0012 0.6827 -0.0357 0.0582  -0.0261 155 GLN L CB  
2922 C CG  . GLN B 161 ? 0.7382 1.0426 0.7751 -0.0117 0.0411  -0.0308 155 GLN L CG  
2923 C CD  . GLN B 161 ? 0.7272 1.0485 0.7385 0.0061  0.0359  -0.0329 155 GLN L CD  
2924 O OE1 . GLN B 161 ? 0.6656 1.0344 0.6593 0.0209  0.0291  -0.0447 155 GLN L OE1 
2925 N NE2 . GLN B 161 ? 0.7116 0.9976 0.7197 0.0076  0.0402  -0.0195 155 GLN L NE2 
2926 N N   . SER B 162 ? 0.7935 1.2131 0.7510 -0.0705 0.0854  -0.0107 156 SER L N   
2927 C CA  . SER B 162 ? 0.8630 1.3304 0.8178 -0.0885 0.0912  -0.0064 156 SER L CA  
2928 C C   . SER B 162 ? 0.7663 1.3022 0.7252 -0.0581 0.0810  -0.0174 156 SER L C   
2929 O O   . SER B 162 ? 0.7697 1.3147 0.7202 -0.0279 0.0730  -0.0263 156 SER L O   
2930 C CB  . SER B 162 ? 0.9104 1.3739 0.8379 -0.1263 0.1116  0.0168  156 SER L CB  
2931 O OG  . SER B 162 ? 0.9273 1.3960 0.8346 -0.1197 0.1197  0.0301  156 SER L OG  
2932 N N   . GLY B 163 ? 0.6183 1.2029 0.5886 -0.0633 0.0807  -0.0178 157 GLY L N   
2933 C CA  . GLY B 163 ? 0.5747 1.2276 0.5481 -0.0318 0.0743  -0.0276 157 GLY L CA  
2934 C C   . GLY B 163 ? 0.6948 1.3412 0.6887 0.0121  0.0499  -0.0582 157 GLY L C   
2935 O O   . GLY B 163 ? 0.7904 1.4876 0.7851 0.0448  0.0424  -0.0726 157 GLY L O   
2936 N N   . ASN B 164 ? 0.6482 1.2325 0.6609 0.0141  0.0368  -0.0679 158 ASN L N   
2937 C CA  . ASN B 164 ? 0.6365 1.2064 0.6759 0.0515  0.0089  -0.0958 158 ASN L CA  
2938 C C   . ASN B 164 ? 0.6807 1.2190 0.7667 0.0458  -0.0039 -0.0991 158 ASN L C   
2939 O O   . ASN B 164 ? 0.7247 1.2327 0.8430 0.0676  -0.0283 -0.1160 158 ASN L O   
2940 C CB  . ASN B 164 ? 0.5618 1.0938 0.5905 0.0665  -0.0018 -0.1033 158 ASN L CB  
2941 C CG  . ASN B 164 ? 0.6639 1.1432 0.6896 0.0353  0.0126  -0.0809 158 ASN L CG  
2942 O OD1 . ASN B 164 ? 0.7609 1.2308 0.7837 0.0024  0.0317  -0.0622 158 ASN L OD1 
2943 N ND2 . ASN B 164 ? 0.6741 1.1191 0.6992 0.0472  0.0027  -0.0837 158 ASN L ND2 
2944 N N   . SER B 165 ? 0.6690 1.2162 0.7602 0.0161  0.0108  -0.0812 159 SER L N   
2945 C CA  . SER B 165 ? 0.6657 1.1907 0.7986 0.0102  0.0019  -0.0781 159 SER L CA  
2946 C C   . SER B 165 ? 0.6900 1.2609 0.8338 0.0004  0.0068  -0.0702 159 SER L C   
2947 O O   . SER B 165 ? 0.7247 1.3368 0.8410 -0.0175 0.0227  -0.0595 159 SER L O   
2948 C CB  . SER B 165 ? 0.6387 1.1115 0.7688 -0.0172 0.0142  -0.0602 159 SER L CB  
2949 O OG  . SER B 165 ? 0.7025 1.1719 0.7869 -0.0441 0.0369  -0.0471 159 SER L OG  
2950 N N   . GLN B 166 ? 0.6666 1.2321 0.8557 0.0115  -0.0083 -0.0725 160 GLN L N   
2951 C CA  . GLN B 166 ? 0.5914 1.1964 0.7972 0.0016  -0.0053 -0.0606 160 GLN L CA  
2952 C C   . GLN B 166 ? 0.5664 1.1370 0.7999 -0.0135 -0.0062 -0.0443 160 GLN L C   
2953 O O   . GLN B 166 ? 0.5429 1.0688 0.8042 -0.0025 -0.0172 -0.0463 160 GLN L O   
2954 C CB  . GLN B 166 ? 0.5133 1.1548 0.7519 0.0382  -0.0233 -0.0771 160 GLN L CB  
2955 C CG  . GLN B 166 ? 0.5605 1.2385 0.7719 0.0643  -0.0233 -0.0961 160 GLN L CG  
2956 C CD  . GLN B 166 ? 0.7584 1.5009 0.9390 0.0460  -0.0014 -0.0798 160 GLN L CD  
2957 O OE1 . GLN B 166 ? 0.8310 1.5883 1.0108 0.0119  0.0101  -0.0574 160 GLN L OE1 
2958 N NE2 . GLN B 166 ? 0.8205 1.6047 0.9765 0.0692  0.0032  -0.0898 160 GLN L NE2 
2959 N N   . GLU B 167 ? 0.5390 1.1339 0.7652 -0.0386 0.0050  -0.0260 161 GLU L N   
2960 C CA  . GLU B 167 ? 0.4282 1.0049 0.6820 -0.0463 0.0037  -0.0085 161 GLU L CA  
2961 C C   . GLU B 167 ? 0.4031 1.0292 0.6845 -0.0441 -0.0023 0.0029  161 GLU L C   
2962 O O   . GLU B 167 ? 0.3980 1.0750 0.6704 -0.0438 -0.0016 -0.0003 161 GLU L O   
2963 C CB  . GLU B 167 ? 0.5437 1.0876 0.7577 -0.0775 0.0230  0.0048  161 GLU L CB  
2964 C CG  . GLU B 167 ? 0.6334 1.2018 0.7973 -0.1103 0.0374  0.0092  161 GLU L CG  
2965 C CD  . GLU B 167 ? 0.8385 1.3616 0.9617 -0.1363 0.0537  0.0168  161 GLU L CD  
2966 O OE1 . GLU B 167 ? 0.8796 1.3523 0.9945 -0.1309 0.0601  0.0134  161 GLU L OE1 
2967 O OE2 . GLU B 167 ? 0.8755 1.4132 0.9738 -0.1606 0.0591  0.0251  161 GLU L OE2 
2968 N N   . SER B 168 ? 0.4803 1.0952 0.7997 -0.0407 -0.0078 0.0200  162 SER L N   
2969 C CA  . SER B 168 ? 0.4212 1.0811 0.7711 -0.0381 -0.0136 0.0367  162 SER L CA  
2970 C C   . SER B 168 ? 0.4443 1.0906 0.8025 -0.0515 -0.0068 0.0637  162 SER L C   
2971 O O   . SER B 168 ? 0.4790 1.0807 0.8533 -0.0467 -0.0057 0.0701  162 SER L O   
2972 C CB  . SER B 168 ? 0.3823 1.0498 0.7935 -0.0014 -0.0357 0.0281  162 SER L CB  
2973 O OG  . SER B 168 ? 0.3601 1.0792 0.7986 0.0040  -0.0404 0.0429  162 SER L OG  
2974 N N   . VAL B 169 ? 0.3771 0.9953 0.5910 0.1567  0.0371  0.0489  163 VAL L N   
2975 C CA  . VAL B 169 ? 0.3942 0.9882 0.6046 0.1531  0.0301  0.0478  163 VAL L CA  
2976 C C   . VAL B 169 ? 0.4150 1.0106 0.6165 0.1801  0.0310  0.0468  163 VAL L C   
2977 O O   . VAL B 169 ? 0.4377 1.0751 0.6462 0.1957  0.0335  0.0504  163 VAL L O   
2978 C CB  . VAL B 169 ? 0.4101 1.0346 0.6385 0.1316  0.0231  0.0536  163 VAL L CB  
2979 C CG1 . VAL B 169 ? 0.3838 0.9808 0.6069 0.1276  0.0161  0.0524  163 VAL L CG1 
2980 C CG2 . VAL B 169 ? 0.4324 1.0555 0.6675 0.1057  0.0238  0.0557  163 VAL L CG2 
2981 N N   . THR B 170 ? 0.4012 0.9514 0.5866 0.1863  0.0295  0.0420  164 THR L N   
2982 C CA  . THR B 170 ? 0.4351 0.9808 0.6083 0.2127  0.0309  0.0412  164 THR L CA  
2983 C C   . THR B 170 ? 0.4871 1.0724 0.6746 0.2126  0.0229  0.0475  164 THR L C   
2984 O O   . THR B 170 ? 0.4703 1.0829 0.6760 0.1897  0.0165  0.0516  164 THR L O   
2985 C CB  . THR B 170 ? 0.5016 0.9843 0.6515 0.2176  0.0322  0.0338  164 THR L CB  
2986 O OG1 . THR B 170 ? 0.5117 0.9739 0.6671 0.1937  0.0245  0.0334  164 THR L OG1 
2987 C CG2 . THR B 170 ? 0.5670 1.0145 0.7007 0.2206  0.0407  0.0267  164 THR L CG2 
2988 N N   . GLU B 171 ? 0.4582 1.0464 0.6357 0.2384  0.0238  0.0483  165 GLU L N   
2989 C CA  . GLU B 171 ? 0.4427 1.0618 0.6300 0.2395  0.0153  0.0534  165 GLU L CA  
2990 C C   . GLU B 171 ? 0.5489 1.1195 0.7243 0.2296  0.0097  0.0499  165 GLU L C   
2991 O O   . GLU B 171 ? 0.5663 1.0808 0.7236 0.2293  0.0139  0.0433  165 GLU L O   
2992 C CB  . GLU B 171 ? 0.5444 1.1907 0.7260 0.2732  0.0187  0.0569  165 GLU L CB  
2993 C CG  . GLU B 171 ? 0.7391 1.4547 0.9419 0.2780  0.0202  0.0631  165 GLU L CG  
2994 C CD  . GLU B 171 ? 0.8705 1.6390 1.1000 0.2528  0.0104  0.0681  165 GLU L CD  
2995 O OE1 . GLU B 171 ? 0.9951 1.7464 1.2256 0.2332  0.0023  0.0673  165 GLU L OE1 
2996 O OE2 . GLU B 171 ? 0.8050 1.6317 1.0535 0.2519  0.0116  0.0724  165 GLU L OE2 
2997 N N   . GLN B 172 ? 0.5418 1.1344 0.7273 0.2199  0.0004  0.0539  166 GLN L N   
2998 C CA  . GLN B 172 ? 0.4873 1.0352 0.6633 0.2066  -0.0050 0.0508  166 GLN L CA  
2999 C C   . GLN B 172 ? 0.5214 1.0189 0.6703 0.2309  -0.0002 0.0459  166 GLN L C   
3000 O O   . GLN B 172 ? 0.4715 0.9830 0.6117 0.2588  0.0023  0.0481  166 GLN L O   
3001 C CB  . GLN B 172 ? 0.3757 0.9576 0.5642 0.1951  -0.0153 0.0559  166 GLN L CB  
3002 C CG  . GLN B 172 ? 0.4176 0.9575 0.6004 0.1730  -0.0206 0.0533  166 GLN L CG  
3003 C CD  . GLN B 172 ? 0.4486 1.0246 0.6448 0.1559  -0.0302 0.0581  166 GLN L CD  
3004 O OE1 . GLN B 172 ? 0.3636 0.9937 0.5699 0.1664  -0.0339 0.0629  166 GLN L OE1 
3005 N NE2 . GLN B 172 ? 0.3996 0.9468 0.5954 0.1290  -0.0339 0.0567  166 GLN L NE2 
3006 N N   . ASP B 173 ? 0.5432 0.9819 0.6780 0.2205  0.0019  0.0392  167 ASP L N   
3007 C CA  . ASP B 173 ? 0.6482 1.0324 0.7551 0.2396  0.0079  0.0329  167 ASP L CA  
3008 C C   . ASP B 173 ? 0.6411 1.0255 0.7393 0.2535  0.0027  0.0358  167 ASP L C   
3009 O O   . ASP B 173 ? 0.6726 1.0697 0.7820 0.2366  -0.0066 0.0390  167 ASP L O   
3010 C CB  . ASP B 173 ? 0.8321 1.1593 0.9297 0.2202  0.0093  0.0254  167 ASP L CB  
3011 C CG  . ASP B 173 ? 0.9876 1.2558 1.0550 0.2370  0.0172  0.0173  167 ASP L CG  
3012 O OD1 . ASP B 173 ? 1.0068 1.2382 1.0630 0.2325  0.0145  0.0144  167 ASP L OD1 
3013 O OD2 . ASP B 173 ? 1.0887 1.3457 1.1422 0.2537  0.0270  0.0134  167 ASP L OD2 
3014 N N   . SER B 174 ? 0.6768 1.0447 0.7531 0.2842  0.0095  0.0347  168 SER L N   
3015 C CA  . SER B 174 ? 0.6243 0.9928 0.6891 0.3025  0.0055  0.0382  168 SER L CA  
3016 C C   . SER B 174 ? 0.6392 0.9470 0.6842 0.2959  0.0042  0.0326  168 SER L C   
3017 O O   . SER B 174 ? 0.6684 0.9715 0.7014 0.3104  0.0009  0.0353  168 SER L O   
3018 C CB  . SER B 174 ? 0.6475 1.0188 0.6933 0.3404  0.0146  0.0399  168 SER L CB  
3019 O OG  . SER B 174 ? 0.7493 1.0546 0.7649 0.3505  0.0264  0.0313  168 SER L OG  
3020 N N   . LYS B 175 ? 0.6961 0.9584 0.7369 0.2751  0.0069  0.0252  169 LYS L N   
3021 C CA  . LYS B 175 ? 0.7002 0.9087 0.7259 0.2649  0.0051  0.0200  169 LYS L CA  
3022 C C   . LYS B 175 ? 0.6655 0.8770 0.7109 0.2307  -0.0036 0.0207  169 LYS L C   
3023 O O   . LYS B 175 ? 0.7045 0.9191 0.7525 0.2227  -0.0116 0.0238  169 LYS L O   
3024 C CB  . LYS B 175 ? 0.7978 0.9411 0.7956 0.2720  0.0168  0.0097  169 LYS L CB  
3025 C CG  . LYS B 175 ? 0.9934 1.1181 0.9625 0.3067  0.0264  0.0087  169 LYS L CG  
3026 C CD  . LYS B 175 ? 1.1394 1.1993 1.0787 0.3120  0.0399  -0.0026 169 LYS L CD  
3027 C CE  . LYS B 175 ? 1.2632 1.3173 1.1782 0.3452  0.0522  -0.0027 169 LYS L CE  
3028 N NZ  . LYS B 175 ? 1.3492 1.3425 1.2337 0.3488  0.0670  -0.0144 169 LYS L NZ  
3029 N N   . ASP B 176 ? 0.6621 0.8729 0.7203 0.2111  -0.0017 0.0182  170 ASP L N   
3030 C CA  . ASP B 176 ? 0.5885 0.7962 0.6624 0.1797  -0.0080 0.0190  170 ASP L CA  
3031 C C   . ASP B 176 ? 0.5803 0.8475 0.6814 0.1639  -0.0147 0.0270  170 ASP L C   
3032 O O   . ASP B 176 ? 0.5547 0.8217 0.6682 0.1377  -0.0186 0.0285  170 ASP L O   
3033 C CB  . ASP B 176 ? 0.6207 0.7887 0.6909 0.1659  -0.0021 0.0117  170 ASP L CB  
3034 C CG  . ASP B 176 ? 0.8534 1.0429 0.9305 0.1698  0.0036  0.0111  170 ASP L CG  
3035 O OD1 . ASP B 176 ? 0.9596 1.1151 1.0256 0.1697  0.0106  0.0037  170 ASP L OD1 
3036 O OD2 . ASP B 176 ? 0.9374 1.1784 1.0306 0.1722  0.0012  0.0177  170 ASP L OD2 
3037 N N   . SER B 177 ? 0.5091 0.8260 0.6183 0.1800  -0.0150 0.0321  171 SER L N   
3038 C CA  . SER B 177 ? 0.4677 0.8450 0.6016 0.1662  -0.0209 0.0393  171 SER L CA  
3039 C C   . SER B 177 ? 0.4242 0.8096 0.5732 0.1433  -0.0188 0.0395  171 SER L C   
3040 O O   . SER B 177 ? 0.5064 0.9253 0.6728 0.1224  -0.0234 0.0443  171 SER L O   
3041 C CB  . SER B 177 ? 0.4895 0.8800 0.6290 0.1518  -0.0305 0.0433  171 SER L CB  
3042 O OG  . SER B 177 ? 0.4646 0.8625 0.5929 0.1749  -0.0335 0.0450  171 SER L OG  
3043 N N   . THR B 178 ? 0.3950 0.7502 0.5360 0.1470  -0.0113 0.0342  172 THR L N   
3044 C CA  . THR B 178 ? 0.3468 0.7094 0.5002 0.1278  -0.0091 0.0348  172 THR L CA  
3045 C C   . THR B 178 ? 0.5054 0.9033 0.6654 0.1400  -0.0038 0.0362  172 THR L C   
3046 O O   . THR B 178 ? 0.5478 0.9631 0.7022 0.1644  -0.0010 0.0366  172 THR L O   
3047 C CB  . THR B 178 ? 0.5287 0.8362 0.6714 0.1178  -0.0053 0.0282  172 THR L CB  
3048 O OG1 . THR B 178 ? 0.5932 0.8672 0.7162 0.1385  0.0011  0.0211  172 THR L OG1 
3049 C CG2 . THR B 178 ? 0.5265 0.8020 0.6663 0.1008  -0.0101 0.0277  172 THR L CG2 
3050 N N   . TYR B 179 ? 0.4175 0.8249 0.5882 0.1233  -0.0018 0.0374  173 TYR L N   
3051 C CA  . TYR B 179 ? 0.2975 0.7333 0.4735 0.1319  0.0039  0.0383  173 TYR L CA  
3052 C C   . TYR B 179 ? 0.4265 0.8265 0.5933 0.1284  0.0096  0.0327  173 TYR L C   
3053 O O   . TYR B 179 ? 0.4549 0.8169 0.6166 0.1147  0.0084  0.0296  173 TYR L O   
3054 C CB  . TYR B 179 ? 0.2980 0.7840 0.4950 0.1148  0.0015  0.0452  173 TYR L CB  
3055 C CG  . TYR B 179 ? 0.3655 0.8927 0.5734 0.1141  -0.0047 0.0503  173 TYR L CG  
3056 C CD1 . TYR B 179 ? 0.4090 0.9316 0.6212 0.0932  -0.0111 0.0524  173 TYR L CD1 
3057 C CD2 . TYR B 179 ? 0.3856 0.9569 0.5987 0.1346  -0.0039 0.0531  173 TYR L CD2 
3058 C CE1 . TYR B 179 ? 0.4885 1.0511 0.7101 0.0910  -0.0172 0.0567  173 TYR L CE1 
3059 C CE2 . TYR B 179 ? 0.4097 1.0239 0.6336 0.1341  -0.0103 0.0578  173 TYR L CE2 
3060 C CZ  . TYR B 179 ? 0.4705 1.0809 0.6987 0.1114  -0.0172 0.0593  173 TYR L CZ  
3061 O OH  . TYR B 179 ? 0.4925 1.1470 0.7308 0.1091  -0.0240 0.0634  173 TYR L OH  
3062 N N   . SER B 180 ? 0.4678 0.8815 0.6324 0.1410  0.0160  0.0314  174 SER L N   
3063 C CA  . SER B 180 ? 0.4464 0.8357 0.6039 0.1366  0.0212  0.0267  174 SER L CA  
3064 C C   . SER B 180 ? 0.4774 0.9071 0.6464 0.1353  0.0246  0.0308  174 SER L C   
3065 O O   . SER B 180 ? 0.5425 1.0129 0.7193 0.1463  0.0255  0.0350  174 SER L O   
3066 C CB  . SER B 180 ? 0.4532 0.8051 0.5881 0.1558  0.0279  0.0181  174 SER L CB  
3067 O OG  . SER B 180 ? 0.4602 0.7653 0.5830 0.1511  0.0263  0.0125  174 SER L OG  
3068 N N   . LEU B 181 ? 0.4107 0.8298 0.5801 0.1225  0.0266  0.0297  175 LEU L N   
3069 C CA  . LEU B 181 ? 0.4463 0.9008 0.6263 0.1175  0.0295  0.0342  175 LEU L CA  
3070 C C   . LEU B 181 ? 0.5089 0.9435 0.6777 0.1200  0.0352  0.0291  175 LEU L C   
3071 O O   . LEU B 181 ? 0.4788 0.8768 0.6388 0.1129  0.0345  0.0244  175 LEU L O   
3072 C CB  . LEU B 181 ? 0.3356 0.8069 0.5308 0.0930  0.0252  0.0410  175 LEU L CB  
3073 C CG  . LEU B 181 ? 0.3540 0.8614 0.5598 0.0846  0.0286  0.0462  175 LEU L CG  
3074 C CD1 . LEU B 181 ? 0.3231 0.8573 0.5435 0.0651  0.0251  0.0531  175 LEU L CD1 
3075 C CD2 . LEU B 181 ? 0.4378 0.9232 0.6368 0.0770  0.0318  0.0446  175 LEU L CD2 
3076 N N   . SER B 182 ? 0.5481 1.0087 0.7174 0.1298  0.0408  0.0300  176 SER L N   
3077 C CA  . SER B 182 ? 0.5660 1.0113 0.7235 0.1329  0.0465  0.0250  176 SER L CA  
3078 C C   . SER B 182 ? 0.5421 1.0204 0.7107 0.1233  0.0484  0.0308  176 SER L C   
3079 O O   . SER B 182 ? 0.5533 1.0698 0.7313 0.1292  0.0508  0.0354  176 SER L O   
3080 C CB  . SER B 182 ? 0.6269 1.0647 0.7682 0.1567  0.0538  0.0193  176 SER L CB  
3081 O OG  . SER B 182 ? 0.7740 1.2017 0.9036 0.1588  0.0601  0.0146  176 SER L OG  
3082 N N   . SER B 183 ? 0.5757 1.0397 0.7427 0.1089  0.0476  0.0308  177 SER L N   
3083 C CA  . SER B 183 ? 0.5798 1.0695 0.7538 0.0996  0.0501  0.0362  177 SER L CA  
3084 C C   . SER B 183 ? 0.5599 1.0360 0.7201 0.1043  0.0549  0.0312  177 SER L C   
3085 O O   . SER B 183 ? 0.5634 1.0072 0.7130 0.1013  0.0534  0.0258  177 SER L O   
3086 C CB  . SER B 183 ? 0.5763 1.0646 0.7596 0.0779  0.0457  0.0426  177 SER L CB  
3087 O OG  . SER B 183 ? 0.6043 1.1175 0.7930 0.0694  0.0492  0.0483  177 SER L OG  
3088 N N   . THR B 184 ? 0.4777 0.9800 0.6380 0.1110  0.0608  0.0328  178 THR L N   
3089 C CA  . THR B 184 ? 0.4398 0.9321 0.5857 0.1161  0.0660  0.0279  178 THR L CA  
3090 C C   . THR B 184 ? 0.4929 1.0038 0.6429 0.1046  0.0676  0.0337  178 THR L C   
3091 O O   . THR B 184 ? 0.4428 0.9869 0.6026 0.1043  0.0709  0.0394  178 THR L O   
3092 C CB  . THR B 184 ? 0.4171 0.9182 0.5538 0.1364  0.0738  0.0239  178 THR L CB  
3093 O OG1 . THR B 184 ? 0.4770 0.9515 0.6031 0.1484  0.0739  0.0173  178 THR L OG1 
3094 C CG2 . THR B 184 ? 0.3191 0.8135 0.4407 0.1397  0.0800  0.0194  178 THR L CG2 
3095 N N   . LEU B 185 ? 0.5412 1.0314 0.6833 0.0956  0.0655  0.0321  179 LEU L N   
3096 C CA  . LEU B 185 ? 0.5674 1.0704 0.7085 0.0873  0.0676  0.0369  179 LEU L CA  
3097 C C   . LEU B 185 ? 0.5477 1.0505 0.6737 0.0974  0.0737  0.0312  179 LEU L C   
3098 O O   . LEU B 185 ? 0.5768 1.0545 0.6887 0.1013  0.0734  0.0230  179 LEU L O   
3099 C CB  . LEU B 185 ? 0.5930 1.0756 0.7323 0.0739  0.0623  0.0391  179 LEU L CB  
3100 C CG  . LEU B 185 ? 0.5491 1.0434 0.6862 0.0655  0.0644  0.0456  179 LEU L CG  
3101 C CD1 . LEU B 185 ? 0.4277 0.9502 0.5770 0.0587  0.0676  0.0543  179 LEU L CD1 
3102 C CD2 . LEU B 185 ? 0.4787 0.9518 0.6125 0.0553  0.0593  0.0481  179 LEU L CD2 
3103 N N   . THR B 186 ? 0.4830 1.0132 0.6110 0.1004  0.0797  0.0351  180 THR L N   
3104 C CA  . THR B 186 ? 0.5354 1.0651 0.6479 0.1091  0.0862  0.0300  180 THR L CA  
3105 C C   . THR B 186 ? 0.6114 1.1503 0.7196 0.1002  0.0877  0.0346  180 THR L C   
3106 O O   . THR B 186 ? 0.5643 1.1253 0.6828 0.0924  0.0889  0.0429  180 THR L O   
3107 C CB  . THR B 186 ? 0.6001 1.1499 0.7123 0.1247  0.0943  0.0288  180 THR L CB  
3108 O OG1 . THR B 186 ? 0.6272 1.1697 0.7421 0.1352  0.0934  0.0256  180 THR L OG1 
3109 C CG2 . THR B 186 ? 0.6366 1.1759 0.7282 0.1339  0.1015  0.0219  180 THR L CG2 
3110 N N   . LEU B 187 ? 0.7127 1.2339 0.8039 0.1012  0.0880  0.0285  181 LEU L N   
3111 C CA  . LEU B 187 ? 0.7088 1.2352 0.7919 0.0946  0.0889  0.0317  181 LEU L CA  
3112 C C   . LEU B 187 ? 0.7360 1.2576 0.7999 0.1034  0.0950  0.0237  181 LEU L C   
3113 O O   . LEU B 187 ? 0.8288 1.3333 0.8826 0.1118  0.0970  0.0145  181 LEU L O   
3114 C CB  . LEU B 187 ? 0.6506 1.1585 0.7312 0.0843  0.0810  0.0324  181 LEU L CB  
3115 C CG  . LEU B 187 ? 0.6157 1.1229 0.7114 0.0740  0.0755  0.0407  181 LEU L CG  
3116 C CD1 . LEU B 187 ? 0.6085 1.0995 0.6989 0.0661  0.0693  0.0422  181 LEU L CD1 
3117 C CD2 . LEU B 187 ? 0.6460 1.1777 0.7515 0.0686  0.0798  0.0507  181 LEU L CD2 
3118 N N   . SER B 188 ? 0.6963 1.2306 0.7530 0.1011  0.0988  0.0270  182 SER L N   
3119 C CA  . SER B 188 ? 0.7644 1.2911 0.8000 0.1065  0.1037  0.0194  182 SER L CA  
3120 C C   . SER B 188 ? 0.8257 1.3310 0.8500 0.0998  0.0967  0.0136  182 SER L C   
3121 O O   . SER B 188 ? 0.8979 1.4023 0.9295 0.0904  0.0893  0.0192  182 SER L O   
3122 C CB  . SER B 188 ? 0.8347 1.3809 0.8657 0.1046  0.1090  0.0253  182 SER L CB  
3123 O OG  . SER B 188 ? 0.8805 1.4276 0.9124 0.0933  0.1030  0.0322  182 SER L OG  
3124 N N   . LYS B 189 ? 0.8020 1.2903 0.8079 0.1042  0.0996  0.0023  183 LYS L N   
3125 C CA  . LYS B 189 ? 0.8121 1.2834 0.8068 0.0968  0.0933  -0.0047 183 LYS L CA  
3126 C C   . LYS B 189 ? 0.7934 1.2767 0.7894 0.0876  0.0871  0.0031  183 LYS L C   
3127 O O   . LYS B 189 ? 0.7714 1.2480 0.7702 0.0805  0.0789  0.0033  183 LYS L O   
3128 C CB  . LYS B 189 ? 0.8584 1.3151 0.8283 0.1007  0.0999  -0.0174 183 LYS L CB  
3129 C CG  . LYS B 189 ? 0.8829 1.3244 0.8396 0.0919  0.0943  -0.0267 183 LYS L CG  
3130 C CD  . LYS B 189 ? 0.9842 1.4103 0.9139 0.0946  0.1030  -0.0398 183 LYS L CD  
3131 C CE  . LYS B 189 ? 1.0629 1.4749 0.9780 0.0843  0.0984  -0.0511 183 LYS L CE  
3132 N NZ  . LYS B 189 ? 1.1432 1.5330 1.0309 0.0864  0.1088  -0.0654 183 LYS L NZ  
3133 N N   . ALA B 190 ? 0.8001 1.3010 0.7933 0.0887  0.0918  0.0097  184 ALA L N   
3134 C CA  . ALA B 190 ? 0.7658 1.2778 0.7577 0.0820  0.0877  0.0183  184 ALA L CA  
3135 C C   . ALA B 190 ? 0.7702 1.2832 0.7797 0.0759  0.0811  0.0283  184 ALA L C   
3136 O O   . ALA B 190 ? 0.7837 1.2915 0.7918 0.0707  0.0738  0.0303  184 ALA L O   
3137 C CB  . ALA B 190 ? 0.7014 1.2308 0.6886 0.0847  0.0956  0.0243  184 ALA L CB  
3138 N N   . ASP B 191 ? 1.1607 1.3236 0.8402 0.0352  -0.1351 0.0582  185 ASP L N   
3139 C CA  . ASP B 191 ? 1.1940 1.3648 0.8961 0.0324  -0.1542 0.0545  185 ASP L CA  
3140 C C   . ASP B 191 ? 1.1540 1.3441 0.9065 0.0450  -0.1547 0.0334  185 ASP L C   
3141 O O   . ASP B 191 ? 1.2403 1.4245 1.0126 0.0470  -0.1798 0.0211  185 ASP L O   
3142 C CB  . ASP B 191 ? 1.2466 1.4472 0.9425 0.0248  -0.1379 0.0750  185 ASP L CB  
3143 C CG  . ASP B 191 ? 1.3931 1.5763 1.0411 0.0074  -0.1472 0.0946  185 ASP L CG  
3144 O OD1 . ASP B 191 ? 1.4400 1.6010 1.0553 0.0033  -0.1458 0.0974  185 ASP L OD1 
3145 O OD2 . ASP B 191 ? 1.4432 1.6339 1.0836 -0.0037 -0.1564 0.1078  185 ASP L OD2 
3146 N N   . TYR B 192 ? 1.0369 1.2499 0.8077 0.0532  -0.1279 0.0285  186 TYR L N   
3147 C CA  . TYR B 192 ? 0.9886 1.2250 0.8049 0.0614  -0.1246 0.0093  186 TYR L CA  
3148 C C   . TYR B 192 ? 1.0433 1.2596 0.8764 0.0661  -0.1512 -0.0124 186 TYR L C   
3149 O O   . TYR B 192 ? 1.0486 1.2815 0.9203 0.0716  -0.1612 -0.0309 186 TYR L O   
3150 C CB  . TYR B 192 ? 0.9288 1.1889 0.7524 0.0655  -0.0923 0.0102  186 TYR L CB  
3151 C CG  . TYR B 192 ? 0.7828 1.0675 0.6487 0.0696  -0.0873 -0.0094 186 TYR L CG  
3152 C CD1 . TYR B 192 ? 0.7209 1.0304 0.6177 0.0694  -0.0867 -0.0155 186 TYR L CD1 
3153 C CD2 . TYR B 192 ? 0.6896 0.9720 0.5615 0.0720  -0.0835 -0.0213 186 TYR L CD2 
3154 C CE1 . TYR B 192 ? 0.6776 1.0122 0.6115 0.0710  -0.0806 -0.0344 186 TYR L CE1 
3155 C CE2 . TYR B 192 ? 0.6214 0.9300 0.5300 0.0720  -0.0784 -0.0390 186 TYR L CE2 
3156 C CZ  . TYR B 192 ? 0.6857 1.0219 0.6259 0.0713  -0.0760 -0.0462 186 TYR L CZ  
3157 O OH  . TYR B 192 ? 0.7550 1.1196 0.7303 0.0694  -0.0694 -0.0647 186 TYR L OH  
3158 N N   . GLU B 193 ? 1.0869 1.2676 0.8911 0.0641  -0.1629 -0.0107 187 GLU L N   
3159 C CA  . GLU B 193 ? 1.1252 1.2851 0.9455 0.0683  -0.1890 -0.0305 187 GLU L CA  
3160 C C   . GLU B 193 ? 1.0936 1.2238 0.9100 0.0667  -0.2285 -0.0378 187 GLU L C   
3161 O O   . GLU B 193 ? 1.1105 1.2323 0.9527 0.0731  -0.2536 -0.0584 187 GLU L O   
3162 C CB  . GLU B 193 ? 1.1820 1.3139 0.9752 0.0675  -0.1848 -0.0270 187 GLU L CB  
3163 C CG  . GLU B 193 ? 1.2577 1.4173 1.0620 0.0714  -0.1543 -0.0273 187 GLU L CG  
3164 C CD  . GLU B 193 ? 1.4323 1.5608 1.2004 0.0715  -0.1485 -0.0203 187 GLU L CD  
3165 O OE1 . GLU B 193 ? 1.4858 1.6293 1.2585 0.0742  -0.1298 -0.0220 187 GLU L OE1 
3166 O OE2 . GLU B 193 ? 1.4518 1.5377 1.1830 0.0678  -0.1638 -0.0130 187 GLU L OE2 
3167 N N   . LYS B 194 ? 1.0677 1.1833 0.8517 0.0578  -0.2354 -0.0213 188 LYS L N   
3168 C CA  . LYS B 194 ? 1.0946 1.1785 0.8679 0.0545  -0.2757 -0.0267 188 LYS L CA  
3169 C C   . LYS B 194 ? 1.1820 1.2911 0.9946 0.0640  -0.2877 -0.0413 188 LYS L C   
3170 O O   . LYS B 194 ? 1.2220 1.3059 1.0206 0.0619  -0.3206 -0.0432 188 LYS L O   
3171 C CB  . LYS B 194 ? 1.0343 1.0921 0.7528 0.0378  -0.2807 -0.0025 188 LYS L CB  
3172 N N   . HIS B 195 ? 1.1347 1.2901 0.9919 0.0736  -0.2626 -0.0518 189 HIS L N   
3173 C CA  . HIS B 195 ? 0.9937 1.1760 0.8887 0.0833  -0.2696 -0.0670 189 HIS L CA  
3174 C C   . HIS B 195 ? 0.9494 1.1750 0.8971 0.0935  -0.2512 -0.0886 189 HIS L C   
3175 O O   . HIS B 195 ? 0.9491 1.1892 0.9013 0.0907  -0.2259 -0.0864 189 HIS L O   
3176 C CB  . HIS B 195 ? 1.0118 1.2104 0.8945 0.0770  -0.2526 -0.0472 189 HIS L CB  
3177 C CG  . HIS B 195 ? 1.1232 1.2864 0.9555 0.0641  -0.2711 -0.0253 189 HIS L CG  
3178 N ND1 . HIS B 195 ? 1.1820 1.3088 0.9965 0.0637  -0.3140 -0.0310 189 HIS L ND1 
3179 C CD2 . HIS B 195 ? 1.1261 1.2861 0.9204 0.0499  -0.2534 0.0019  189 HIS L CD2 
3180 C CE1 . HIS B 195 ? 1.2388 1.3398 1.0035 0.0468  -0.3223 -0.0068 189 HIS L CE1 
3181 N NE2 . HIS B 195 ? 1.1932 1.3172 0.9472 0.0383  -0.2845 0.0133  189 HIS L NE2 
3182 N N   . LYS B 196 ? 0.9202 1.1660 0.9042 0.1045  -0.2644 -0.1094 190 LYS L N   
3183 C CA  . LYS B 196 ? 0.8865 1.1758 0.9226 0.1130  -0.2519 -0.1340 190 LYS L CA  
3184 C C   . LYS B 196 ? 0.8699 1.2006 0.9292 0.1132  -0.2246 -0.1349 190 LYS L C   
3185 O O   . LYS B 196 ? 0.8577 1.2221 0.9374 0.1087  -0.1948 -0.1382 190 LYS L O   
3186 C CB  . LYS B 196 ? 0.9259 1.2122 0.9929 0.1277  -0.2886 -0.1639 190 LYS L CB  
3187 C CG  . LYS B 196 ? 0.9657 1.2828 1.0756 0.1323  -0.2838 -0.1869 190 LYS L CG  
3188 C CD  . LYS B 196 ? 1.0855 1.3681 1.1699 0.1246  -0.2901 -0.1774 190 LYS L CD  
3189 C CE  . LYS B 196 ? 1.1152 1.4125 1.2386 0.1311  -0.3049 -0.2025 190 LYS L CE  
3190 N NZ  . LYS B 196 ? 1.1694 1.4195 1.2625 0.1249  -0.3207 -0.1934 190 LYS L NZ  
3191 N N   . VAL B 197 ? 0.8554 1.1793 0.9079 0.1170  -0.2368 -0.1313 191 VAL L N   
3192 C CA  . VAL B 197 ? 0.8403 1.1993 0.9173 0.1190  -0.2165 -0.1363 191 VAL L CA  
3193 C C   . VAL B 197 ? 0.8585 1.2154 0.9077 0.1068  -0.1916 -0.1071 191 VAL L C   
3194 O O   . VAL B 197 ? 0.9277 1.2595 0.9478 0.1045  -0.2062 -0.0902 191 VAL L O   
3195 C CB  . VAL B 197 ? 0.8472 1.2038 0.9401 0.1342  -0.2460 -0.1555 191 VAL L CB  
3196 C CG1 . VAL B 197 ? 0.7881 1.1751 0.8993 0.1347  -0.2238 -0.1578 191 VAL L CG1 
3197 C CG2 . VAL B 197 ? 0.9057 1.2753 1.0366 0.1491  -0.2685 -0.1892 191 VAL L CG2 
3198 N N   . TYR B 198 ? 0.7666 1.1494 0.8241 0.0982  -0.1560 -0.1014 192 TYR L N   
3199 C CA  . TYR B 198 ? 0.7122 1.0970 0.7496 0.0880  -0.1317 -0.0766 192 TYR L CA  
3200 C C   . TYR B 198 ? 0.7547 1.1631 0.8154 0.0886  -0.1191 -0.0842 192 TYR L C   
3201 O O   . TYR B 198 ? 0.8010 1.2389 0.8954 0.0906  -0.1082 -0.1067 192 TYR L O   
3202 C CB  . TYR B 198 ? 0.5789 0.9703 0.6043 0.0790  -0.1037 -0.0647 192 TYR L CB  
3203 C CG  . TYR B 198 ? 0.6479 1.0101 0.6403 0.0777  -0.1153 -0.0514 192 TYR L CG  
3204 C CD1 . TYR B 198 ? 0.5664 0.9111 0.5225 0.0711  -0.1135 -0.0246 192 TYR L CD1 
3205 C CD2 . TYR B 198 ? 0.6917 1.0435 0.6886 0.0820  -0.1298 -0.0657 192 TYR L CD2 
3206 C CE1 . TYR B 198 ? 0.6922 1.0111 0.6159 0.0683  -0.1231 -0.0134 192 TYR L CE1 
3207 C CE2 . TYR B 198 ? 0.7092 1.0292 0.6721 0.0796  -0.1412 -0.0536 192 TYR L CE2 
3208 C CZ  . TYR B 198 ? 0.7927 1.0967 0.7183 0.0726  -0.1370 -0.0281 192 TYR L CZ  
3209 O OH  . TYR B 198 ? 0.9422 1.2158 0.8317 0.0686  -0.1468 -0.0168 192 TYR L OH  
3210 N N   . ALA B 199 ? 0.6743 1.0690 0.7149 0.0852  -0.1211 -0.0649 193 ALA L N   
3211 C CA  . ALA B 199 ? 0.6583 1.0664 0.7157 0.0865  -0.1141 -0.0713 193 ALA L CA  
3212 C C   . ALA B 199 ? 0.6936 1.0941 0.7290 0.0752  -0.0977 -0.0431 193 ALA L C   
3213 O O   . ALA B 199 ? 0.7340 1.1133 0.7374 0.0695  -0.1048 -0.0171 193 ALA L O   
3214 C CB  . ALA B 199 ? 0.5740 0.9708 0.6390 0.1010  -0.1474 -0.0883 193 ALA L CB  
3215 N N   . CYS B 200 ? 0.6160 1.0351 0.6696 0.0708  -0.0760 -0.0495 194 CYS L N   
3216 C CA  . CYS B 200 ? 0.6126 1.0252 0.6517 0.0603  -0.0603 -0.0270 194 CYS L CA  
3217 C C   . CYS B 200 ? 0.6405 1.0468 0.6864 0.0658  -0.0720 -0.0351 194 CYS L C   
3218 O O   . CYS B 200 ? 0.6391 1.0648 0.7131 0.0718  -0.0687 -0.0625 194 CYS L O   
3219 C CB  . CYS B 200 ? 0.5964 1.0293 0.6478 0.0494  -0.0274 -0.0306 194 CYS L CB  
3220 S SG  . CYS B 200 ? 1.2354 1.6582 1.2694 0.0357  -0.0075 -0.0032 194 CYS L SG  
3221 N N   . GLU B 201 ? 0.6862 1.0659 0.7051 0.0638  -0.0868 -0.0116 195 GLU L N   
3222 C CA  . GLU B 201 ? 0.7230 1.0898 0.7413 0.0692  -0.0992 -0.0163 195 GLU L CA  
3223 C C   . GLU B 201 ? 0.6715 1.0276 0.6755 0.0554  -0.0819 0.0084  195 GLU L C   
3224 O O   . GLU B 201 ? 0.7527 1.0913 0.7293 0.0463  -0.0859 0.0395  195 GLU L O   
3225 C CB  . GLU B 201 ? 0.8814 1.2175 0.8756 0.0798  -0.1398 -0.0122 195 GLU L CB  
3226 C CG  . GLU B 201 ? 1.0205 1.3325 0.9998 0.0836  -0.1551 -0.0070 195 GLU L CG  
3227 C CD  . GLU B 201 ? 1.1181 1.3953 1.0700 0.0955  -0.2003 -0.0069 195 GLU L CD  
3228 O OE1 . GLU B 201 ? 1.1669 1.4486 1.1347 0.1124  -0.2203 -0.0359 195 GLU L OE1 
3229 O OE2 . GLU B 201 ? 1.1464 1.3903 1.0595 0.0872  -0.2178 0.0221  195 GLU L OE2 
3230 N N   . VAL B 202 ? 0.5873 0.9543 0.6096 0.0527  -0.0634 -0.0059 196 VAL L N   
3231 C CA  . VAL B 202 ? 0.5852 0.9402 0.5962 0.0381  -0.0452 0.0146  196 VAL L CA  
3232 C C   . VAL B 202 ? 0.6698 0.9993 0.6686 0.0418  -0.0597 0.0172  196 VAL L C   
3233 O O   . VAL B 202 ? 0.7302 1.0659 0.7439 0.0542  -0.0672 -0.0100 196 VAL L O   
3234 C CB  . VAL B 202 ? 0.5737 0.9519 0.6067 0.0272  -0.0127 -0.0008 196 VAL L CB  
3235 C CG1 . VAL B 202 ? 0.5419 0.9020 0.5600 0.0109  0.0034  0.0222  196 VAL L CG1 
3236 C CG2 . VAL B 202 ? 0.5898 0.9904 0.6323 0.0253  -0.0010 -0.0064 196 VAL L CG2 
3237 N N   . THR B 203 ? 0.7175 1.0189 0.6883 0.0315  -0.0638 0.0503  197 THR L N   
3238 C CA  . THR B 203 ? 0.6752 0.9443 0.6267 0.0325  -0.0778 0.0591  197 THR L CA  
3239 C C   . THR B 203 ? 0.6363 0.8933 0.5816 0.0140  -0.0547 0.0788  197 THR L C   
3240 O O   . THR B 203 ? 0.5738 0.8325 0.5124 0.0009  -0.0431 0.1034  197 THR L O   
3241 C CB  . THR B 203 ? 0.6966 0.9333 0.6118 0.0358  -0.1136 0.0846  197 THR L CB  
3242 O OG1 . THR B 203 ? 0.6909 0.9284 0.6079 0.0543  -0.1410 0.0622  197 THR L OG1 
3243 C CG2 . THR B 203 ? 0.7206 0.9179 0.6084 0.0323  -0.1263 0.1024  197 THR L CG2 
3244 N N   . HIS B 204 ? 0.6239 0.8680 0.5710 0.0133  -0.0485 0.0668  198 HIS L N   
3245 C CA  . HIS B 204 ? 0.5841 0.8152 0.5278 -0.0055 -0.0250 0.0789  198 HIS L CA  
3246 C C   . HIS B 204 ? 0.6550 0.8613 0.5907 -0.0046 -0.0261 0.0683  198 HIS L C   
3247 O O   . HIS B 204 ? 0.7807 1.0017 0.7312 0.0096  -0.0291 0.0362  198 HIS L O   
3248 C CB  . HIS B 204 ? 0.4851 0.7489 0.4548 -0.0155 0.0057  0.0613  198 HIS L CB  
3249 C CG  . HIS B 204 ? 0.5880 0.8348 0.5517 -0.0362 0.0274  0.0721  198 HIS L CG  
3250 N ND1 . HIS B 204 ? 0.6341 0.8689 0.5986 -0.0444 0.0393  0.0558  198 HIS L ND1 
3251 C CD2 . HIS B 204 ? 0.6018 0.8393 0.5570 -0.0505 0.0376  0.0968  198 HIS L CD2 
3252 C CE1 . HIS B 204 ? 0.6434 0.8578 0.5979 -0.0647 0.0549  0.0709  198 HIS L CE1 
3253 N NE2 . HIS B 204 ? 0.6452 0.8615 0.5954 -0.0675 0.0534  0.0954  198 HIS L NE2 
3254 N N   . GLN B 205 ? 0.6397 0.8093 0.5526 -0.0193 -0.0233 0.0944  199 GLN L N   
3255 C CA  . GLN B 205 ? 0.7519 0.8881 0.6485 -0.0186 -0.0275 0.0894  199 GLN L CA  
3256 C C   . GLN B 205 ? 0.7068 0.8654 0.6270 -0.0203 -0.0030 0.0507  199 GLN L C   
3257 O O   . GLN B 205 ? 0.8079 0.9486 0.7192 -0.0148 -0.0061 0.0373  199 GLN L O   
3258 C CB  . GLN B 205 ? 0.8080 0.8977 0.6751 -0.0373 -0.0280 0.1268  199 GLN L CB  
3259 C CG  . GLN B 205 ? 1.0061 1.0805 0.8513 -0.0396 -0.0501 0.1665  199 GLN L CG  
3260 C CD  . GLN B 205 ? 1.2047 1.2391 1.0258 -0.0593 -0.0499 0.2042  199 GLN L CD  
3261 O OE1 . GLN B 205 ? 1.3772 1.3716 1.1787 -0.0643 -0.0525 0.2081  199 GLN L OE1 
3262 N NE2 . GLN B 205 ? 1.1635 1.2089 0.9859 -0.0702 -0.0471 0.2319  199 GLN L NE2 
3263 N N   . GLY B 206 ? 0.6388 0.8367 0.5867 -0.0287 0.0206  0.0329  200 GLY L N   
3264 C CA  . GLY B 206 ? 0.6176 0.8433 0.5878 -0.0339 0.0437  -0.0039 200 GLY L CA  
3265 C C   . GLY B 206 ? 0.5903 0.8570 0.5871 -0.0111 0.0356  -0.0394 200 GLY L C   
3266 O O   . GLY B 206 ? 0.5840 0.8795 0.6011 -0.0127 0.0520  -0.0723 200 GLY L O   
3267 N N   . LEU B 207 ? 0.5998 0.8696 0.5961 0.0090  0.0094  -0.0329 201 LEU L N   
3268 C CA  . LEU B 207 ? 0.5895 0.8947 0.6111 0.0324  -0.0033 -0.0655 201 LEU L CA  
3269 C C   . LEU B 207 ? 0.7169 0.9963 0.7216 0.0561  -0.0343 -0.0699 201 LEU L C   
3270 O O   . LEU B 207 ? 0.7259 0.9619 0.6964 0.0589  -0.0589 -0.0393 201 LEU L O   
3271 C CB  . LEU B 207 ? 0.5716 0.8967 0.6035 0.0380  -0.0130 -0.0595 201 LEU L CB  
3272 C CG  . LEU B 207 ? 0.6075 0.9579 0.6541 0.0185  0.0144  -0.0579 201 LEU L CG  
3273 C CD1 . LEU B 207 ? 0.4639 0.8264 0.5138 0.0248  0.0037  -0.0483 201 LEU L CD1 
3274 C CD2 . LEU B 207 ? 0.4632 0.8549 0.5404 0.0125  0.0380  -0.0947 201 LEU L CD2 
3275 N N   . ARG B 208 ? 0.8331 1.1403 0.8607 0.0732  -0.0345 -0.1086 202 ARG L N   
3276 C CA  . ARG B 208 ? 0.8114 1.0960 0.8239 0.0999  -0.0652 -0.1195 202 ARG L CA  
3277 C C   . ARG B 208 ? 0.8393 1.1061 0.8371 0.1175  -0.1043 -0.1070 202 ARG L C   
3278 O O   . ARG B 208 ? 0.8851 1.1070 0.8477 0.1309  -0.1373 -0.0936 202 ARG L O   
3279 C CB  . ARG B 208 ? 0.9686 1.2997 1.0171 0.1170  -0.0563 -0.1682 202 ARG L CB  
3280 C CG  . ARG B 208 ? 1.2900 1.5976 1.3224 0.1477  -0.0875 -0.1840 202 ARG L CG  
3281 C CD  . ARG B 208 ? 1.4548 1.7962 1.5105 0.1557  -0.0669 -0.2243 202 ARG L CD  
3282 N NE  . ARG B 208 ? 1.5318 1.8580 1.5770 0.1917  -0.0994 -0.2462 202 ARG L NE  
3283 C CZ  . ARG B 208 ? 1.5425 1.8765 1.5898 0.2034  -0.0902 -0.2735 202 ARG L CZ  
3284 N NH1 . ARG B 208 ? 1.5334 1.8893 1.5916 0.1786  -0.0486 -0.2813 202 ARG L NH1 
3285 N NH2 . ARG B 208 ? 1.5501 1.8675 1.5854 0.2397  -0.1238 -0.2936 202 ARG L NH2 
3286 N N   . SER B 209 ? 0.8160 1.1146 0.8369 0.1159  -0.1020 -0.1107 203 SER L N   
3287 C CA  . SER B 209 ? 0.8569 1.1368 0.8606 0.1263  -0.1363 -0.0957 203 SER L CA  
3288 C C   . SER B 209 ? 0.8262 1.1344 0.8481 0.1121  -0.1198 -0.0877 203 SER L C   
3289 O O   . SER B 209 ? 0.8564 1.2015 0.9072 0.0995  -0.0864 -0.1007 203 SER L O   
3290 C CB  . SER B 209 ? 0.9148 1.2027 0.9302 0.1576  -0.1684 -0.1291 203 SER L CB  
3291 O OG  . SER B 209 ? 0.9213 1.2644 0.9839 0.1633  -0.1544 -0.1616 203 SER L OG  
3292 N N   . PRO B 210 ? 0.8402 1.1292 0.8413 0.1131  -0.1440 -0.0664 204 PRO L N   
3293 C CA  . PRO B 210 ? 0.7100 1.0219 0.7231 0.0996  -0.1272 -0.0566 204 PRO L CA  
3294 C C   . PRO B 210 ? 0.6621 1.0237 0.7201 0.1049  -0.1091 -0.0927 204 PRO L C   
3295 O O   . PRO B 210 ? 0.6752 1.0547 0.7554 0.1238  -0.1202 -0.1258 204 PRO L O   
3296 C CB  . PRO B 210 ? 0.7333 1.0200 0.7200 0.1063  -0.1630 -0.0409 204 PRO L CB  
3297 C CG  . PRO B 210 ? 0.9030 1.1432 0.8510 0.1122  -0.1937 -0.0251 204 PRO L CG  
3298 C CD  . PRO B 210 ? 0.9673 1.2123 0.9301 0.1253  -0.1885 -0.0517 204 PRO L CD  
3299 N N   . VAL B 211 ? 0.6135 0.9975 0.6838 0.0885  -0.0822 -0.0864 205 VAL L N   
3300 C CA  . VAL B 211 ? 0.6051 1.0344 0.7133 0.0890  -0.0647 -0.1162 205 VAL L CA  
3301 C C   . VAL B 211 ? 0.6565 1.0901 0.7634 0.0876  -0.0701 -0.1074 205 VAL L C   
3302 O O   . VAL B 211 ? 0.6656 1.0767 0.7456 0.0777  -0.0703 -0.0764 205 VAL L O   
3303 C CB  . VAL B 211 ? 0.5999 1.0492 0.7198 0.0682  -0.0270 -0.1195 205 VAL L CB  
3304 C CG1 . VAL B 211 ? 0.4780 0.9647 0.6228 0.0604  -0.0092 -0.1352 205 VAL L CG1 
3305 C CG2 . VAL B 211 ? 0.6970 1.1567 0.8298 0.0718  -0.0198 -0.1429 205 VAL L CG2 
3306 N N   . THR B 212 ? 0.6334 1.0966 0.7691 0.0975  -0.0747 -0.1351 206 THR L N   
3307 C CA  . THR B 212 ? 0.6311 1.0928 0.7632 0.0984  -0.0842 -0.1288 206 THR L CA  
3308 C C   . THR B 212 ? 0.5687 1.0692 0.7300 0.0906  -0.0612 -0.1477 206 THR L C   
3309 O O   . THR B 212 ? 0.5469 1.0814 0.7413 0.0960  -0.0565 -0.1784 206 THR L O   
3310 C CB  . THR B 212 ? 0.6563 1.1035 0.7873 0.1197  -0.1243 -0.1415 206 THR L CB  
3311 O OG1 . THR B 212 ? 0.7879 1.2024 0.8949 0.1288  -0.1479 -0.1331 206 THR L OG1 
3312 C CG2 . THR B 212 ? 0.5450 0.9714 0.6540 0.1167  -0.1384 -0.1232 206 THR L CG2 
3313 N N   . LYS B 213 ? 0.5669 1.0630 0.7141 0.0774  -0.0471 -0.1291 207 LYS L N   
3314 C CA  . LYS B 213 ? 0.6294 1.1537 0.7960 0.0708  -0.0324 -0.1439 207 LYS L CA  
3315 C C   . LYS B 213 ? 0.6985 1.2086 0.8544 0.0780  -0.0511 -0.1373 207 LYS L C   
3316 O O   . LYS B 213 ? 0.8422 1.3219 0.9669 0.0772  -0.0595 -0.1111 207 LYS L O   
3317 C CB  . LYS B 213 ? 0.6066 1.1335 0.7613 0.0497  -0.0016 -0.1304 207 LYS L CB  
3318 C CG  . LYS B 213 ? 0.6302 1.1852 0.8054 0.0372  0.0203  -0.1505 207 LYS L CG  
3319 C CD  . LYS B 213 ? 0.6860 1.2752 0.8837 0.0304  0.0288  -0.1730 207 LYS L CD  
3320 C CE  . LYS B 213 ? 0.7436 1.3617 0.9562 0.0119  0.0523  -0.1914 207 LYS L CE  
3321 N NZ  . LYS B 213 ? 0.7644 1.3910 0.9912 0.0181  0.0521  -0.2047 207 LYS L NZ  
3322 N N   . SER B 214 ? 0.5755 1.1072 0.7561 0.0838  -0.0580 -0.1603 208 SER L N   
3323 C CA  . SER B 214 ? 0.6021 1.1147 0.7690 0.0888  -0.0755 -0.1530 208 SER L CA  
3324 C C   . SER B 214 ? 0.6466 1.1823 0.8344 0.0862  -0.0714 -0.1707 208 SER L C   
3325 O O   . SER B 214 ? 0.6775 1.2482 0.8903 0.0779  -0.0531 -0.1879 208 SER L O   
3326 C CB  . SER B 214 ? 0.5729 1.0615 0.7341 0.1059  -0.1120 -0.1564 208 SER L CB  
3327 O OG  . SER B 214 ? 0.6146 1.1278 0.8119 0.1200  -0.1252 -0.1884 208 SER L OG  
3328 N N   . PHE B 215 ? 0.6264 1.1401 0.8001 0.0910  -0.0890 -0.1646 209 PHE L N   
3329 C CA  . PHE B 215 ? 0.6085 1.1358 0.7977 0.0896  -0.0910 -0.1787 209 PHE L CA  
3330 C C   . PHE B 215 ? 0.6797 1.1723 0.8515 0.0990  -0.1202 -0.1733 209 PHE L C   
3331 O O   . PHE B 215 ? 0.6651 1.1242 0.8086 0.1032  -0.1352 -0.1565 209 PHE L O   
3332 C CB  . PHE B 215 ? 0.5898 1.1207 0.7622 0.0725  -0.0636 -0.1661 209 PHE L CB  
3333 C CG  . PHE B 215 ? 0.6573 1.1507 0.7849 0.0691  -0.0597 -0.1361 209 PHE L CG  
3334 C CD1 . PHE B 215 ? 0.7278 1.2116 0.8334 0.0631  -0.0433 -0.1153 209 PHE L CD1 
3335 C CD2 . PHE B 215 ? 0.6302 1.0991 0.7380 0.0718  -0.0720 -0.1292 209 PHE L CD2 
3336 C CE1 . PHE B 215 ? 0.7011 1.1579 0.7691 0.0611  -0.0385 -0.0896 209 PHE L CE1 
3337 C CE2 . PHE B 215 ? 0.6669 1.1057 0.7336 0.0693  -0.0664 -0.1035 209 PHE L CE2 
3338 C CZ  . PHE B 215 ? 0.6859 1.1219 0.7344 0.0645  -0.0491 -0.0844 209 PHE L CZ  
3339 N N   . ASN B 216 ? 0.7085 1.2069 0.8945 0.1002  -0.1294 -0.1867 210 ASN L N   
3340 C CA  . ASN B 216 ? 0.7146 1.1750 0.8816 0.1070  -0.1576 -0.1820 210 ASN L CA  
3341 C C   . ASN B 216 ? 0.7706 1.2114 0.9098 0.0967  -0.1476 -0.1664 210 ASN L C   
3342 O O   . ASN B 216 ? 0.7350 1.2000 0.8865 0.0880  -0.1295 -0.1724 210 ASN L O   
3343 C CB  . ASN B 216 ? 0.7673 1.2414 0.9727 0.1205  -0.1861 -0.2119 210 ASN L CB  
3344 C CG  . ASN B 216 ? 0.8449 1.3365 1.0763 0.1346  -0.1993 -0.2304 210 ASN L CG  
3345 O OD1 . ASN B 216 ? 0.8948 1.3688 1.1038 0.1357  -0.1992 -0.2164 210 ASN L OD1 
3346 N ND2 . ASN B 216 ? 0.8370 1.3637 1.1151 0.1461  -0.2119 -0.2623 210 ASN L ND2 
3347 N N   . ARG B 217 ? 0.8742 1.2702 0.9730 0.0970  -0.1603 -0.1469 211 ARG L N   
3348 C CA  . ARG B 217 ? 0.9774 1.3476 1.0468 0.0908  -0.1569 -0.1345 211 ARG L CA  
3349 C C   . ARG B 217 ? 1.1685 1.4951 1.1863 0.0881  -0.1598 -0.1081 211 ARG L C   
3350 O O   . ARG B 217 ? 1.1633 1.4518 1.1575 0.0894  -0.1824 -0.1040 211 ARG L O   
3351 C CB  . ARG B 217 ? 0.9123 1.3060 0.9817 0.0804  -0.1256 -0.1309 211 ARG L CB  
3352 C CG  . ARG B 217 ? 0.8775 1.2623 0.9426 0.0765  -0.1297 -0.1352 211 ARG L CG  
3353 C CD  . ARG B 217 ? 0.8244 1.2293 0.9331 0.0818  -0.1517 -0.1615 211 ARG L CD  
3354 N NE  . ARG B 217 ? 0.8606 1.3193 1.0126 0.0787  -0.1377 -0.1807 211 ARG L NE  
3355 C CZ  . ARG B 217 ? 0.8708 1.3636 1.0570 0.0739  -0.1386 -0.2003 211 ARG L CZ  
3356 N NH1 . ARG B 217 ? 0.7768 1.3212 1.0003 0.0692  -0.1238 -0.2181 211 ARG L NH1 
3357 N NH2 . ARG B 217 ? 0.8607 1.3357 1.0420 0.0723  -0.1543 -0.2015 211 ARG L NH2 
3358 O OXT . ARG B 217 ? 1.2950 1.6243 1.2917 0.0831  -0.1381 -0.0896 211 ARG L OXT 
3359 N N   . GLU C 1   ? 1.0020 1.2869 1.2205 -0.1370 0.1277  -0.2957 1   GLU M N   
3360 C CA  . GLU C 1   ? 1.1053 1.4052 1.2981 -0.1681 0.1101  -0.2798 1   GLU M CA  
3361 C C   . GLU C 1   ? 1.0028 1.3102 1.1775 -0.1689 0.0904  -0.2520 1   GLU M C   
3362 O O   . GLU C 1   ? 1.0009 1.2996 1.1825 -0.1451 0.0918  -0.2444 1   GLU M O   
3363 C CB  . GLU C 1   ? 1.2610 1.5129 1.4471 -0.1734 0.1090  -0.2719 1   GLU M CB  
3364 C CG  . GLU C 1   ? 1.3959 1.6576 1.5583 -0.2030 0.0894  -0.2554 1   GLU M CG  
3365 C CD  . GLU C 1   ? 1.5101 1.8269 1.6676 -0.2352 0.0884  -0.2707 1   GLU M CD  
3366 O OE1 . GLU C 1   ? 1.5548 1.8901 1.7282 -0.2368 0.1068  -0.2987 1   GLU M OE1 
3367 O OE2 . GLU C 1   ? 1.5013 1.8429 1.6389 -0.2600 0.0686  -0.2546 1   GLU M OE2 
3368 N N   . VAL C 2   ? 0.8682 1.1918 1.0200 -0.1972 0.0715  -0.2370 2   VAL M N   
3369 C CA  . VAL C 2   ? 0.8150 1.1407 0.9472 -0.2020 0.0506  -0.2105 2   VAL M CA  
3370 C C   . VAL C 2   ? 0.7365 1.0033 0.8632 -0.1857 0.0428  -0.1893 2   VAL M C   
3371 O O   . VAL C 2   ? 0.7556 0.9922 0.8787 -0.1916 0.0400  -0.1865 2   VAL M O   
3372 C CB  . VAL C 2   ? 0.7937 1.1514 0.9034 -0.2395 0.0306  -0.2009 2   VAL M CB  
3373 C CG1 . VAL C 2   ? 0.7532 1.1010 0.8416 -0.2450 0.0067  -0.1723 2   VAL M CG1 
3374 C CG2 . VAL C 2   ? 0.7494 1.1747 0.8616 -0.2597 0.0361  -0.2199 2   VAL M CG2 
3375 N N   . GLN C 3   ? 0.6731 0.9274 0.7990 -0.1663 0.0389  -0.1750 3   GLN M N   
3376 C CA  . GLN C 3   ? 0.7299 0.9339 0.8511 -0.1520 0.0321  -0.1571 3   GLN M CA  
3377 C C   . GLN C 3   ? 0.7457 0.9437 0.8608 -0.1374 0.0232  -0.1385 3   GLN M C   
3378 O O   . GLN C 3   ? 0.7079 0.9390 0.8244 -0.1338 0.0243  -0.1388 3   GLN M O   
3379 C CB  . GLN C 3   ? 0.7917 0.9583 0.9314 -0.1310 0.0507  -0.1673 3   GLN M CB  
3380 C CG  . GLN C 3   ? 0.8725 1.0388 1.0304 -0.1045 0.0652  -0.1726 3   GLN M CG  
3381 C CD  . GLN C 3   ? 1.0372 1.1724 1.2141 -0.0896 0.0838  -0.1869 3   GLN M CD  
3382 O OE1 . GLN C 3   ? 1.1436 1.2589 1.3356 -0.0648 0.0937  -0.1858 3   GLN M OE1 
3383 N NE2 . GLN C 3   ? 1.0698 1.1997 1.2458 -0.1059 0.0880  -0.1994 3   GLN M NE2 
3384 N N   . LEU C 4   ? 0.7162 0.8742 0.8251 -0.1293 0.0149  -0.1237 4   LEU M N   
3385 C CA  . LEU C 4   ? 0.6194 0.7676 0.7217 -0.1165 0.0060  -0.1060 4   LEU M CA  
3386 C C   . LEU C 4   ? 0.6652 0.7758 0.7807 -0.0903 0.0176  -0.1030 4   LEU M C   
3387 O O   . LEU C 4   ? 0.7059 0.7859 0.8229 -0.0895 0.0191  -0.1045 4   LEU M O   
3388 C CB  . LEU C 4   ? 0.5186 0.6572 0.5996 -0.1339 -0.0183 -0.0910 4   LEU M CB  
3389 C CG  . LEU C 4   ? 0.5190 0.6924 0.5828 -0.1627 -0.0348 -0.0877 4   LEU M CG  
3390 C CD1 . LEU C 4   ? 0.5041 0.6565 0.5510 -0.1807 -0.0587 -0.0760 4   LEU M CD1 
3391 C CD2 . LEU C 4   ? 0.4819 0.6858 0.5383 -0.1626 -0.0395 -0.0794 4   LEU M CD2 
3392 N N   . LEU C 5   ? 0.5987 0.7141 0.7237 -0.0700 0.0256  -0.0982 5   LEU M N   
3393 C CA  . LEU C 5   ? 0.5916 0.6735 0.7275 -0.0476 0.0346  -0.0919 5   LEU M CA  
3394 C C   . LEU C 5   ? 0.6370 0.7164 0.7620 -0.0420 0.0224  -0.0730 5   LEU M C   
3395 O O   . LEU C 5   ? 0.6750 0.7819 0.7952 -0.0413 0.0173  -0.0662 5   LEU M O   
3396 C CB  . LEU C 5   ? 0.5358 0.6199 0.6936 -0.0265 0.0527  -0.0992 5   LEU M CB  
3397 C CG  . LEU C 5   ? 0.8108 0.9291 0.9777 -0.0320 0.0606  -0.1180 5   LEU M CG  
3398 C CD1 . LEU C 5   ? 1.5625 1.6902 1.7516 -0.0072 0.0741  -0.1233 5   LEU M CD1 
3399 C CD2 . LEU C 5   ? 0.8998 1.0088 1.0696 -0.0460 0.0673  -0.1359 5   LEU M CD2 
3400 N N   . GLU C 6   ? 0.5711 0.6205 0.6925 -0.0387 0.0183  -0.0659 6   GLU M N   
3401 C CA  . GLU C 6   ? 0.5889 0.6349 0.6997 -0.0351 0.0061  -0.0508 6   GLU M CA  
3402 C C   . GLU C 6   ? 0.6561 0.6925 0.7780 -0.0138 0.0162  -0.0412 6   GLU M C   
3403 O O   . GLU C 6   ? 0.6312 0.6498 0.7673 -0.0028 0.0302  -0.0448 6   GLU M O   
3404 C CB  . GLU C 6   ? 0.4553 0.4801 0.5555 -0.0455 -0.0070 -0.0508 6   GLU M CB  
3405 C CG  . GLU C 6   ? 0.5626 0.5965 0.6495 -0.0675 -0.0224 -0.0547 6   GLU M CG  
3406 C CD  . GLU C 6   ? 0.6038 0.6166 0.6815 -0.0748 -0.0390 -0.0533 6   GLU M CD  
3407 O OE1 . GLU C 6   ? 0.5903 0.5954 0.6675 -0.0860 -0.0422 -0.0612 6   GLU M OE1 
3408 O OE2 . GLU C 6   ? 0.5357 0.5414 0.6074 -0.0690 -0.0490 -0.0452 6   GLU M OE2 
3409 N N   . SER C 7   ? 0.6834 0.7320 0.7978 -0.0096 0.0081  -0.0280 7   SER M N   
3410 C CA  . SER C 7   ? 0.6568 0.6986 0.7788 0.0073  0.0144  -0.0160 7   SER M CA  
3411 C C   . SER C 7   ? 0.6343 0.6802 0.7421 0.0033  0.0002  -0.0060 7   SER M C   
3412 O O   . SER C 7   ? 0.6567 0.7076 0.7498 -0.0112 -0.0146 -0.0085 7   SER M O   
3413 C CB  . SER C 7   ? 0.6492 0.7104 0.7837 0.0221  0.0242  -0.0106 7   SER M CB  
3414 O OG  . SER C 7   ? 0.7633 0.8519 0.8947 0.0140  0.0218  -0.0183 7   SER M OG  
3415 N N   . GLY C 8   ? 0.6253 0.6689 0.7374 0.0150  0.0040  0.0050  8   GLY M N   
3416 C CA  . GLY C 8   ? 0.6962 0.7446 0.7966 0.0115  -0.0080 0.0115  8   GLY M CA  
3417 C C   . GLY C 8   ? 0.7198 0.7467 0.8182 0.0073  -0.0123 0.0040  8   GLY M C   
3418 O O   . GLY C 8   ? 0.7459 0.7544 0.8522 0.0081  -0.0041 -0.0034 8   GLY M O   
3419 N N   . GLY C 9   ? 0.6907 0.7214 0.7787 0.0028  -0.0254 0.0043  9   GLY M N   
3420 C CA  . GLY C 9   ? 0.6985 0.7146 0.7860 0.0005  -0.0307 -0.0050 9   GLY M CA  
3421 C C   . GLY C 9   ? 0.6845 0.7054 0.7796 0.0097  -0.0212 0.0012  9   GLY M C   
3422 O O   . GLY C 9   ? 0.6670 0.6998 0.7673 0.0175  -0.0119 0.0145  9   GLY M O   
3423 N N   . GLY C 10  ? 0.6325 0.6466 0.7286 0.0082  -0.0241 -0.0082 10  GLY M N   
3424 C CA  . GLY C 10  ? 0.5545 0.5788 0.6559 0.0133  -0.0165 -0.0028 10  GLY M CA  
3425 C C   . GLY C 10  ? 0.6011 0.6414 0.6967 0.0116  -0.0283 -0.0090 10  GLY M C   
3426 O O   . GLY C 10  ? 0.6505 0.6845 0.7403 0.0072  -0.0428 -0.0219 10  GLY M O   
3427 N N   . LEU C 11  ? 0.5540 0.6153 0.6518 0.0148  -0.0228 0.0001  11  LEU M N   
3428 C CA  . LEU C 11  ? 0.5066 0.5883 0.6013 0.0130  -0.0313 -0.0086 11  LEU M CA  
3429 C C   . LEU C 11  ? 0.5543 0.6525 0.6407 0.0122  -0.0399 -0.0027 11  LEU M C   
3430 O O   . LEU C 11  ? 0.5149 0.6196 0.5999 0.0143  -0.0346 0.0137  11  LEU M O   
3431 C CB  . LEU C 11  ? 0.5040 0.6054 0.6046 0.0136  -0.0204 -0.0012 11  LEU M CB  
3432 C CG  . LEU C 11  ? 0.4903 0.6222 0.5899 0.0110  -0.0256 -0.0104 11  LEU M CG  
3433 C CD1 . LEU C 11  ? 0.4726 0.5966 0.5729 0.0102  -0.0370 -0.0362 11  LEU M CD1 
3434 C CD2 . LEU C 11  ? 0.5326 0.6838 0.6375 0.0083  -0.0135 0.0001  11  LEU M CD2 
3435 N N   . VAL C 12  ? 0.5434 0.6491 0.6246 0.0093  -0.0535 -0.0170 12  VAL M N   
3436 C CA  . VAL C 12  ? 0.4535 0.5716 0.5249 0.0061  -0.0631 -0.0133 12  VAL M CA  
3437 C C   . VAL C 12  ? 0.4826 0.6118 0.5520 0.0042  -0.0757 -0.0318 12  VAL M C   
3438 O O   . VAL C 12  ? 0.5381 0.6509 0.6105 0.0049  -0.0855 -0.0508 12  VAL M O   
3439 C CB  . VAL C 12  ? 0.5218 0.6178 0.5846 0.0014  -0.0727 -0.0120 12  VAL M CB  
3440 C CG1 . VAL C 12  ? 0.5834 0.6508 0.6465 -0.0013 -0.0849 -0.0295 12  VAL M CG1 
3441 C CG2 . VAL C 12  ? 0.4996 0.6085 0.5501 -0.0046 -0.0838 -0.0084 12  VAL M CG2 
3442 N N   . LYS C 13  ? 0.5167 0.6755 0.5821 0.0023  -0.0758 -0.0271 13  LYS M N   
3443 C CA  . LYS C 13  ? 0.5722 0.7472 0.6371 0.0007  -0.0862 -0.0465 13  LYS M CA  
3444 C C   . LYS C 13  ? 0.6299 0.7794 0.6869 -0.0027 -0.1066 -0.0612 13  LYS M C   
3445 O O   . LYS C 13  ? 0.6526 0.7838 0.7001 -0.0075 -0.1122 -0.0508 13  LYS M O   
3446 C CB  . LYS C 13  ? 0.5326 0.7490 0.5944 -0.0026 -0.0802 -0.0363 13  LYS M CB  
3447 C CG  . LYS C 13  ? 0.5250 0.7646 0.5935 -0.0007 -0.0621 -0.0161 13  LYS M CG  
3448 C CD  . LYS C 13  ? 0.6518 0.9384 0.7200 -0.0053 -0.0579 -0.0120 13  LYS M CD  
3449 C CE  . LYS C 13  ? 0.8314 1.1395 0.9071 -0.0053 -0.0423 0.0073  13  LYS M CE  
3450 N NZ  . LYS C 13  ? 0.8926 1.1975 0.9770 -0.0049 -0.0385 -0.0060 13  LYS M NZ  
3451 N N   . PRO C 14  ? 0.6461 0.7949 0.7076 -0.0007 -0.1188 -0.0860 14  PRO M N   
3452 C CA  . PRO C 14  ? 0.6088 0.7298 0.6637 -0.0036 -0.1413 -0.1006 14  PRO M CA  
3453 C C   . PRO C 14  ? 0.6590 0.7906 0.6996 -0.0126 -0.1467 -0.0910 14  PRO M C   
3454 O O   . PRO C 14  ? 0.5842 0.7530 0.6243 -0.0140 -0.1369 -0.0862 14  PRO M O   
3455 C CB  . PRO C 14  ? 0.5145 0.6441 0.5807 0.0031  -0.1498 -0.1300 14  PRO M CB  
3456 C CG  . PRO C 14  ? 0.6147 0.7695 0.6930 0.0086  -0.1321 -0.1304 14  PRO M CG  
3457 C CD  . PRO C 14  ? 0.5756 0.7515 0.6489 0.0042  -0.1131 -0.1023 14  PRO M CD  
3458 N N   . GLY C 15  ? 0.7588 0.8608 0.7871 -0.0205 -0.1622 -0.0872 15  GLY M N   
3459 C CA  . GLY C 15  ? 0.7407 0.8527 0.7529 -0.0316 -0.1671 -0.0755 15  GLY M CA  
3460 C C   . GLY C 15  ? 0.7325 0.8587 0.7384 -0.0351 -0.1523 -0.0482 15  GLY M C   
3461 O O   . GLY C 15  ? 0.7258 0.8560 0.7171 -0.0456 -0.1574 -0.0362 15  GLY M O   
3462 N N   . GLY C 16  ? 0.6516 0.7856 0.6692 -0.0263 -0.1344 -0.0394 16  GLY M N   
3463 C CA  . GLY C 16  ? 0.4846 0.6314 0.5011 -0.0257 -0.1195 -0.0162 16  GLY M CA  
3464 C C   . GLY C 16  ? 0.5935 0.7150 0.6045 -0.0304 -0.1236 -0.0092 16  GLY M C   
3465 O O   . GLY C 16  ? 0.5443 0.6351 0.5506 -0.0363 -0.1397 -0.0198 16  GLY M O   
3466 N N   . SER C 17  ? 0.6774 0.8140 0.6900 -0.0279 -0.1095 0.0088  17  SER M N   
3467 C CA  . SER C 17  ? 0.6801 0.8046 0.6872 -0.0337 -0.1114 0.0159  17  SER M CA  
3468 C C   . SER C 17  ? 0.6115 0.7352 0.6323 -0.0237 -0.0937 0.0230  17  SER M C   
3469 O O   . SER C 17  ? 0.5815 0.7206 0.6135 -0.0129 -0.0787 0.0306  17  SER M O   
3470 C CB  . SER C 17  ? 0.7691 0.9174 0.7621 -0.0432 -0.1147 0.0289  17  SER M CB  
3471 O OG  . SER C 17  ? 0.9319 1.0672 0.9083 -0.0582 -0.1356 0.0219  17  SER M OG  
3472 N N   . LEU C 18  ? 0.6571 0.7630 0.6762 -0.0288 -0.0968 0.0209  18  LEU M N   
3473 C CA  . LEU C 18  ? 0.6572 0.7571 0.6890 -0.0211 -0.0820 0.0232  18  LEU M CA  
3474 C C   . LEU C 18  ? 0.5827 0.6846 0.6067 -0.0311 -0.0862 0.0261  18  LEU M C   
3475 O O   . LEU C 18  ? 0.5369 0.6298 0.5470 -0.0455 -0.1033 0.0221  18  LEU M O   
3476 C CB  . LEU C 18  ? 0.6985 0.7700 0.7376 -0.0195 -0.0838 0.0093  18  LEU M CB  
3477 C CG  . LEU C 18  ? 0.7249 0.7940 0.7800 -0.0077 -0.0651 0.0112  18  LEU M CG  
3478 C CD1 . LEU C 18  ? 0.7335 0.8266 0.7933 0.0010  -0.0551 0.0232  18  LEU M CD1 
3479 C CD2 . LEU C 18  ? 0.7457 0.7946 0.8064 -0.0067 -0.0678 -0.0029 18  LEU M CD2 
3480 N N   . ARG C 19  ? 0.5460 0.6602 0.5793 -0.0242 -0.0716 0.0323  19  ARG M N   
3481 C CA  . ARG C 19  ? 0.5501 0.6704 0.5778 -0.0344 -0.0744 0.0315  19  ARG M CA  
3482 C C   . ARG C 19  ? 0.5809 0.6868 0.6225 -0.0291 -0.0627 0.0241  19  ARG M C   
3483 O O   . ARG C 19  ? 0.6846 0.7933 0.7419 -0.0141 -0.0460 0.0268  19  ARG M O   
3484 C CB  . ARG C 19  ? 0.5925 0.7496 0.6175 -0.0331 -0.0694 0.0429  19  ARG M CB  
3485 C CG  . ARG C 19  ? 0.6637 0.8380 0.6822 -0.0451 -0.0722 0.0414  19  ARG M CG  
3486 C CD  . ARG C 19  ? 0.7148 0.9038 0.7520 -0.0299 -0.0535 0.0413  19  ARG M CD  
3487 N NE  . ARG C 19  ? 0.7598 0.9892 0.7935 -0.0333 -0.0521 0.0458  19  ARG M NE  
3488 C CZ  . ARG C 19  ? 0.7916 1.0436 0.8425 -0.0163 -0.0371 0.0478  19  ARG M CZ  
3489 N NH1 . ARG C 19  ? 0.9059 1.1997 0.9537 -0.0196 -0.0368 0.0500  19  ARG M NH1 
3490 N NH2 . ARG C 19  ? 0.6974 0.9304 0.7689 0.0037  -0.0233 0.0474  19  ARG M NH2 
3491 N N   . LEU C 20  ? 0.5545 0.6439 0.5901 -0.0423 -0.0722 0.0150  20  LEU M N   
3492 C CA  . LEU C 20  ? 0.5260 0.6046 0.5730 -0.0406 -0.0618 0.0065  20  LEU M CA  
3493 C C   . LEU C 20  ? 0.5966 0.7003 0.6436 -0.0466 -0.0568 0.0063  20  LEU M C   
3494 O O   . LEU C 20  ? 0.6704 0.7951 0.7030 -0.0599 -0.0679 0.0112  20  LEU M O   
3495 C CB  . LEU C 20  ? 0.5073 0.5604 0.5485 -0.0527 -0.0750 -0.0029 20  LEU M CB  
3496 C CG  . LEU C 20  ? 0.4782 0.5097 0.5209 -0.0466 -0.0812 -0.0067 20  LEU M CG  
3497 C CD1 . LEU C 20  ? 0.4720 0.4802 0.5123 -0.0563 -0.0938 -0.0166 20  LEU M CD1 
3498 C CD2 . LEU C 20  ? 0.5436 0.5728 0.6023 -0.0294 -0.0622 -0.0067 20  LEU M CD2 
3499 N N   . SER C 21  ? 0.5229 0.6257 0.5857 -0.0381 -0.0406 -0.0006 21  SER M N   
3500 C CA  . SER C 21  ? 0.5368 0.6666 0.6032 -0.0424 -0.0341 -0.0054 21  SER M CA  
3501 C C   . SER C 21  ? 0.5816 0.7011 0.6533 -0.0508 -0.0299 -0.0193 21  SER M C   
3502 O O   . SER C 21  ? 0.6107 0.7017 0.6901 -0.0461 -0.0248 -0.0250 21  SER M O   
3503 C CB  . SER C 21  ? 0.5199 0.6668 0.6040 -0.0214 -0.0168 -0.0025 21  SER M CB  
3504 O OG  . SER C 21  ? 0.7157 0.8808 0.7945 -0.0152 -0.0205 0.0112  21  SER M OG  
3505 N N   . CYS C 22  ? 0.5182 0.6659 0.5858 -0.0645 -0.0315 -0.0250 22  CYS M N   
3506 C CA  . CYS C 22  ? 0.5428 0.6900 0.6161 -0.0739 -0.0260 -0.0392 22  CYS M CA  
3507 C C   . CYS C 22  ? 0.6181 0.8064 0.6990 -0.0751 -0.0162 -0.0480 22  CYS M C   
3508 O O   . CYS C 22  ? 0.6200 0.8429 0.6898 -0.0851 -0.0242 -0.0428 22  CYS M O   
3509 C CB  . CYS C 22  ? 0.6205 0.7610 0.6756 -0.0993 -0.0454 -0.0384 22  CYS M CB  
3510 S SG  . CYS C 22  ? 1.1957 1.3312 1.2573 -0.1119 -0.0398 -0.0541 22  CYS M SG  
3511 N N   . ALA C 23  ? 0.6189 0.5818 0.7645 -0.0640 0.0286  -0.0929 23  ALA M N   
3512 C CA  . ALA C 23  ? 0.6306 0.6096 0.7864 -0.0577 0.0259  -0.1138 23  ALA M CA  
3513 C C   . ALA C 23  ? 0.6977 0.7032 0.8524 -0.0587 0.0261  -0.1288 23  ALA M C   
3514 O O   . ALA C 23  ? 0.7873 0.7863 0.9459 -0.0621 0.0226  -0.1302 23  ALA M O   
3515 C CB  . ALA C 23  ? 0.5827 0.5385 0.7593 -0.0534 0.0158  -0.1241 23  ALA M CB  
3516 N N   . ALA C 24  ? 0.6550 0.6923 0.8037 -0.0574 0.0300  -0.1394 24  ALA M N   
3517 C CA  . ALA C 24  ? 0.6368 0.7027 0.7832 -0.0599 0.0302  -0.1550 24  ALA M CA  
3518 C C   . ALA C 24  ? 0.6592 0.7307 0.8253 -0.0508 0.0241  -0.1830 24  ALA M C   
3519 O O   . ALA C 24  ? 0.7207 0.7922 0.8990 -0.0423 0.0221  -0.1938 24  ALA M O   
3520 C CB  . ALA C 24  ? 0.6486 0.7510 0.7773 -0.0662 0.0359  -0.1524 24  ALA M CB  
3521 N N   . SER C 25  ? 0.6158 0.6908 0.7860 -0.0520 0.0197  -0.1955 25  SER M N   
3522 C CA  . SER C 25  ? 0.7219 0.8064 0.9089 -0.0426 0.0124  -0.2256 25  SER M CA  
3523 C C   . SER C 25  ? 0.7720 0.8874 0.9499 -0.0478 0.0146  -0.2387 25  SER M C   
3524 O O   . SER C 25  ? 0.8033 0.9121 0.9706 -0.0574 0.0152  -0.2250 25  SER M O   
3525 C CB  . SER C 25  ? 0.8707 0.9150 1.0766 -0.0378 -0.0019 -0.2290 25  SER M CB  
3526 O OG  . SER C 25  ? 1.0179 1.0452 1.2177 -0.0471 -0.0043 -0.2142 25  SER M OG  
3527 N N   . GLY C 26  ? 0.7268 0.8785 0.9089 -0.0418 0.0160  -0.2657 26  GLY M N   
3528 C CA  . GLY C 26  ? 0.6594 0.8451 0.8317 -0.0480 0.0183  -0.2804 26  GLY M CA  
3529 C C   . GLY C 26  ? 0.7418 0.9688 0.8909 -0.0617 0.0292  -0.2698 26  GLY M C   
3530 O O   . GLY C 26  ? 0.7946 1.0510 0.9310 -0.0718 0.0312  -0.2765 26  GLY M O   
3531 N N   . PHE C 27  ? 0.6518 0.8795 0.7943 -0.0639 0.0345  -0.2517 27  PHE M N   
3532 C CA  . PHE C 27  ? 0.6351 0.9010 0.7560 -0.0778 0.0413  -0.2399 27  PHE M CA  
3533 C C   . PHE C 27  ? 0.6870 0.9475 0.8085 -0.0739 0.0443  -0.2267 27  PHE M C   
3534 O O   . PHE C 27  ? 0.7521 0.9777 0.8898 -0.0617 0.0414  -0.2259 27  PHE M O   
3535 C CB  . PHE C 27  ? 0.6648 0.9229 0.7655 -0.0943 0.0396  -0.2153 27  PHE M CB  
3536 C CG  . PHE C 27  ? 0.6658 0.8811 0.7637 -0.0945 0.0375  -0.1863 27  PHE M CG  
3537 C CD1 . PHE C 27  ? 0.6581 0.8768 0.7399 -0.1026 0.0381  -0.1636 27  PHE M CD1 
3538 C CD2 . PHE C 27  ? 0.6156 0.7897 0.7260 -0.0876 0.0337  -0.1821 27  PHE M CD2 
3539 C CE1 . PHE C 27  ? 0.5906 0.7720 0.6700 -0.1013 0.0356  -0.1400 27  PHE M CE1 
3540 C CE2 . PHE C 27  ? 0.6079 0.7498 0.7157 -0.0879 0.0328  -0.1581 27  PHE M CE2 
3541 C CZ  . PHE C 27  ? 0.5745 0.7199 0.6670 -0.0937 0.0341  -0.1383 27  PHE M CZ  
3542 N N   . THR C 28  ? 0.6687 0.9631 0.7723 -0.0856 0.0484  -0.2156 28  THR M N   
3543 C CA  . THR C 28  ? 0.7437 1.0355 0.8476 -0.0821 0.0506  -0.2038 28  THR M CA  
3544 C C   . THR C 28  ? 0.7311 1.0079 0.8126 -0.0953 0.0483  -0.1692 28  THR M C   
3545 O O   . THR C 28  ? 0.8369 1.1408 0.8978 -0.1121 0.0463  -0.1587 28  THR M O   
3546 C CB  . THR C 28  ? 0.8503 1.1984 0.9569 -0.0817 0.0559  -0.2236 28  THR M CB  
3547 O OG1 . THR C 28  ? 0.8958 1.2935 0.9840 -0.0986 0.0579  -0.2279 28  THR M OG1 
3548 C CG2 . THR C 28  ? 0.8902 1.2425 1.0257 -0.0619 0.0556  -0.2589 28  THR M CG2 
3549 N N   . LEU C 29  ? 0.6631 0.8960 0.7487 -0.0882 0.0466  -0.1520 29  LEU M N   
3550 C CA  . LEU C 29  ? 0.6713 0.8823 0.7380 -0.0971 0.0424  -0.1213 29  LEU M CA  
3551 C C   . LEU C 29  ? 0.7568 1.0033 0.8017 -0.1121 0.0399  -0.1078 29  LEU M C   
3552 O O   . LEU C 29  ? 0.8343 1.0732 0.8603 -0.1241 0.0321  -0.0858 29  LEU M O   
3553 C CB  . LEU C 29  ? 0.5857 0.7536 0.6601 -0.0866 0.0424  -0.1089 29  LEU M CB  
3554 C CG  . LEU C 29  ? 0.6296 0.7583 0.6973 -0.0877 0.0384  -0.0886 29  LEU M CG  
3555 C CD1 . LEU C 29  ? 0.5449 0.6580 0.6267 -0.0832 0.0387  -0.1003 29  LEU M CD1 
3556 C CD2 . LEU C 29  ? 0.7068 0.8017 0.7758 -0.0811 0.0386  -0.0739 29  LEU M CD2 
3557 N N   . ILE C 30  ? 0.6347 0.9208 0.6831 -0.1120 0.0447  -0.1212 30  ILE M N   
3558 C CA  . ILE C 30  ? 0.6224 0.9452 0.6506 -0.1277 0.0418  -0.1069 30  ILE M CA  
3559 C C   . ILE C 30  ? 0.6426 0.9916 0.6483 -0.1494 0.0343  -0.0969 30  ILE M C   
3560 O O   . ILE C 30  ? 0.6241 0.9854 0.6080 -0.1662 0.0253  -0.0742 30  ILE M O   
3561 C CB  . ILE C 30  ? 0.6209 0.9943 0.6597 -0.1244 0.0496  -0.1291 30  ILE M CB  
3562 C CG1 . ILE C 30  ? 0.5874 1.0017 0.6048 -0.1429 0.0461  -0.1115 30  ILE M CG1 
3563 C CG2 . ILE C 30  ? 0.6702 1.0823 0.7186 -0.1236 0.0548  -0.1604 30  ILE M CG2 
3564 C CD1 . ILE C 30  ? 0.5533 0.9455 0.5705 -0.1376 0.0444  -0.0932 30  ILE M CD1 
3565 N N   . ASN C 31  ? 0.6286 0.9841 0.6391 -0.1504 0.0357  -0.1126 31  ASN M N   
3566 C CA  . ASN C 31  ? 0.7806 1.1632 0.7705 -0.1727 0.0278  -0.1046 31  ASN M CA  
3567 C C   . ASN C 31  ? 0.8611 1.2031 0.8383 -0.1805 0.0144  -0.0782 31  ASN M C   
3568 O O   . ASN C 31  ? 0.8971 1.2559 0.8534 -0.2020 0.0019  -0.0617 31  ASN M O   
3569 C CB  . ASN C 31  ? 0.8482 1.2582 0.8469 -0.1723 0.0340  -0.1327 31  ASN M CB  
3570 C CG  . ASN C 31  ? 0.9479 1.4100 0.9567 -0.1672 0.0447  -0.1614 31  ASN M CG  
3571 O OD1 . ASN C 31  ? 0.9730 1.4761 0.9722 -0.1771 0.0458  -0.1570 31  ASN M OD1 
3572 N ND2 . ASN C 31  ? 0.9853 1.4479 1.0146 -0.1516 0.0512  -0.1917 31  ASN M ND2 
3573 N N   . TYR C 32  ? 0.7350 1.0255 0.7255 -0.1637 0.0153  -0.0746 32  TYR M N   
3574 C CA  . TYR C 32  ? 0.6292 0.8854 0.6137 -0.1673 0.0041  -0.0574 32  TYR M CA  
3575 C C   . TYR C 32  ? 0.6611 0.8785 0.6403 -0.1618 -0.0037 -0.0345 32  TYR M C   
3576 O O   . TYR C 32  ? 0.7084 0.9115 0.6937 -0.1500 0.0027  -0.0334 32  TYR M O   
3577 C CB  . TYR C 32  ? 0.5671 0.8000 0.5703 -0.1548 0.0101  -0.0722 32  TYR M CB  
3578 C CG  . TYR C 32  ? 0.6481 0.9132 0.6574 -0.1580 0.0164  -0.0964 32  TYR M CG  
3579 C CD1 . TYR C 32  ? 0.6822 0.9627 0.7069 -0.1458 0.0276  -0.1205 32  TYR M CD1 
3580 C CD2 . TYR C 32  ? 0.6118 0.8912 0.6120 -0.1729 0.0095  -0.0960 32  TYR M CD2 
3581 C CE1 . TYR C 32  ? 0.6456 0.9555 0.6761 -0.1469 0.0319  -0.1454 32  TYR M CE1 
3582 C CE2 . TYR C 32  ? 0.5908 0.8995 0.5951 -0.1760 0.0150  -0.1189 32  TYR M CE2 
3583 C CZ  . TYR C 32  ? 0.6360 0.9603 0.6552 -0.1623 0.0263  -0.1443 32  TYR M CZ  
3584 O OH  . TYR C 32  ? 0.6696 1.0229 0.6929 -0.1638 0.0303  -0.1696 32  TYR M OH  
3585 N N   . ARG C 33  ? 0.6265 0.8262 0.5947 -0.1701 -0.0191 -0.0170 33  ARG M N   
3586 C CA  . ARG C 33  ? 0.6003 0.7594 0.5661 -0.1619 -0.0279 0.0008  33  ARG M CA  
3587 C C   . ARG C 33  ? 0.6871 0.8145 0.6729 -0.1442 -0.0194 -0.0086 33  ARG M C   
3588 O O   . ARG C 33  ? 0.6978 0.8274 0.6915 -0.1456 -0.0190 -0.0174 33  ARG M O   
3589 C CB  . ARG C 33  ? 0.6128 0.7671 0.5613 -0.1772 -0.0511 0.0204  33  ARG M CB  
3590 C CG  . ARG C 33  ? 0.7485 0.8636 0.6930 -0.1684 -0.0636 0.0373  33  ARG M CG  
3591 C CD  . ARG C 33  ? 0.8200 0.9365 0.7431 -0.1869 -0.0909 0.0586  33  ARG M CD  
3592 N NE  . ARG C 33  ? 0.8070 0.9147 0.7325 -0.1928 -0.1067 0.0603  33  ARG M NE  
3593 C CZ  . ARG C 33  ? 0.8336 0.9444 0.7430 -0.2124 -0.1338 0.0768  33  ARG M CZ  
3594 N NH1 . ARG C 33  ? 0.8723 0.9969 0.7603 -0.2294 -0.1477 0.0940  33  ARG M NH1 
3595 N NH2 . ARG C 33  ? 0.8750 0.9753 0.7898 -0.2164 -0.1488 0.0770  33  ARG M NH2 
3596 N N   . MET C 34  ? 0.6644 0.7640 0.6573 -0.1296 -0.0131 -0.0057 34  MET M N   
3597 C CA  . MET C 34  ? 0.6143 0.6892 0.6257 -0.1150 -0.0036 -0.0144 34  MET M CA  
3598 C C   . MET C 34  ? 0.6305 0.6757 0.6407 -0.1084 -0.0120 -0.0021 34  MET M C   
3599 O O   . MET C 34  ? 0.6304 0.6658 0.6266 -0.1104 -0.0236 0.0128  34  MET M O   
3600 C CB  . MET C 34  ? 0.5729 0.6405 0.5947 -0.1047 0.0094  -0.0220 34  MET M CB  
3601 C CG  . MET C 34  ? 0.5193 0.6144 0.5497 -0.1061 0.0181  -0.0407 34  MET M CG  
3602 S SD  . MET C 34  ? 0.6378 0.7395 0.6837 -0.1052 0.0219  -0.0598 34  MET M SD  
3603 C CE  . MET C 34  ? 1.6130 1.7456 1.6415 -0.1229 0.0120  -0.0556 34  MET M CE  
3604 N N   . ASN C 35  ? 0.6029 0.6356 0.6281 -0.1005 -0.0072 -0.0089 35  ASN M N   
3605 C CA  . ASN C 35  ? 0.5266 0.5382 0.5536 -0.0930 -0.0144 -0.0013 35  ASN M CA  
3606 C C   . ASN C 35  ? 0.5370 0.5356 0.5802 -0.0823 -0.0025 -0.0081 35  ASN M C   
3607 O O   . ASN C 35  ? 0.5345 0.5382 0.5893 -0.0821 0.0086  -0.0183 35  ASN M O   
3608 C CB  . ASN C 35  ? 0.5876 0.6053 0.6151 -0.0987 -0.0281 -0.0003 35  ASN M CB  
3609 C CG  . ASN C 35  ? 0.6370 0.6674 0.6469 -0.1133 -0.0444 0.0092  35  ASN M CG  
3610 O OD1 . ASN C 35  ? 0.7001 0.7196 0.7016 -0.1153 -0.0634 0.0205  35  ASN M OD1 
3611 N ND2 . ASN C 35  ? 0.5647 0.6198 0.5693 -0.1245 -0.0388 0.0041  35  ASN M ND2 
3612 N N   . TRP C 36  ? 0.5087 0.4921 0.5527 -0.0741 -0.0068 -0.0027 36  TRP M N   
3613 C CA  . TRP C 36  ? 0.4765 0.4546 0.5352 -0.0664 0.0024  -0.0083 36  TRP M CA  
3614 C C   . TRP C 36  ? 0.5263 0.5083 0.5925 -0.0625 -0.0066 -0.0102 36  TRP M C   
3615 O O   . TRP C 36  ? 0.5948 0.5713 0.6531 -0.0604 -0.0220 -0.0046 36  TRP M O   
3616 C CB  . TRP C 36  ? 0.5423 0.5034 0.5969 -0.0594 0.0080  -0.0030 36  TRP M CB  
3617 C CG  . TRP C 36  ? 0.5867 0.5430 0.6390 -0.0625 0.0168  -0.0024 36  TRP M CG  
3618 C CD1 . TRP C 36  ? 0.5718 0.5243 0.6111 -0.0649 0.0136  0.0043  36  TRP M CD1 
3619 C CD2 . TRP C 36  ? 0.5646 0.5199 0.6294 -0.0641 0.0279  -0.0088 36  TRP M CD2 
3620 N NE1 . TRP C 36  ? 0.5627 0.5126 0.6076 -0.0661 0.0230  0.0006  36  TRP M NE1 
3621 C CE2 . TRP C 36  ? 0.5231 0.4723 0.5835 -0.0657 0.0305  -0.0074 36  TRP M CE2 
3622 C CE3 . TRP C 36  ? 0.5476 0.5064 0.6272 -0.0653 0.0338  -0.0150 36  TRP M CE3 
3623 C CZ2 . TRP C 36  ? 0.5322 0.4759 0.6040 -0.0672 0.0371  -0.0132 36  TRP M CZ2 
3624 C CZ3 . TRP C 36  ? 0.4879 0.4408 0.5763 -0.0688 0.0396  -0.0185 36  TRP M CZ3 
3625 C CH2 . TRP C 36  ? 0.4629 0.4067 0.5481 -0.0692 0.0403  -0.0182 36  TRP M CH2 
3626 N N   . VAL C 37  ? 0.5237 0.5152 0.6061 -0.0618 0.0009  -0.0181 37  VAL M N   
3627 C CA  . VAL C 37  ? 0.4484 0.4476 0.5424 -0.0572 -0.0059 -0.0219 37  VAL M CA  
3628 C C   . VAL C 37  ? 0.4593 0.4644 0.5667 -0.0522 0.0066  -0.0267 37  VAL M C   
3629 O O   . VAL C 37  ? 0.4944 0.5008 0.6058 -0.0575 0.0183  -0.0279 37  VAL M O   
3630 C CB  . VAL C 37  ? 0.5002 0.5124 0.6010 -0.0658 -0.0106 -0.0260 37  VAL M CB  
3631 C CG1 . VAL C 37  ? 0.4960 0.5177 0.6129 -0.0609 -0.0164 -0.0308 37  VAL M CG1 
3632 C CG2 . VAL C 37  ? 0.4585 0.4696 0.5444 -0.0742 -0.0241 -0.0204 37  VAL M CG2 
3633 N N   . ARG C 38  ? 0.5159 0.5261 0.6305 -0.0426 0.0028  -0.0299 38  ARG M N   
3634 C CA  . ARG C 38  ? 0.4969 0.5196 0.6229 -0.0400 0.0154  -0.0342 38  ARG M CA  
3635 C C   . ARG C 38  ? 0.4802 0.5250 0.6248 -0.0361 0.0127  -0.0423 38  ARG M C   
3636 O O   . ARG C 38  ? 0.5698 0.6157 0.7186 -0.0315 -0.0014 -0.0451 38  ARG M O   
3637 C CB  . ARG C 38  ? 0.5287 0.5428 0.6461 -0.0316 0.0181  -0.0326 38  ARG M CB  
3638 C CG  . ARG C 38  ? 0.5099 0.5271 0.6303 -0.0174 0.0063  -0.0386 38  ARG M CG  
3639 C CD  . ARG C 38  ? 0.5118 0.5186 0.6211 -0.0098 0.0090  -0.0373 38  ARG M CD  
3640 N NE  . ARG C 38  ? 0.5590 0.5625 0.6687 0.0056  -0.0066 -0.0439 38  ARG M NE  
3641 C CZ  . ARG C 38  ? 0.5911 0.5843 0.6909 0.0153  -0.0086 -0.0450 38  ARG M CZ  
3642 N NH1 . ARG C 38  ? 0.5001 0.4858 0.5882 0.0096  0.0051  -0.0384 38  ARG M NH1 
3643 N NH2 . ARG C 38  ? 0.6243 0.6135 0.7264 0.0308  -0.0261 -0.0532 38  ARG M NH2 
3644 N N   . GLN C 39  ? 0.4631 0.5265 0.6192 -0.0394 0.0248  -0.0453 39  GLN M N   
3645 C CA  . GLN C 39  ? 0.4454 0.5357 0.6212 -0.0371 0.0243  -0.0529 39  GLN M CA  
3646 C C   . GLN C 39  ? 0.4357 0.5495 0.6190 -0.0368 0.0367  -0.0562 39  GLN M C   
3647 O O   . GLN C 39  ? 0.5387 0.6566 0.7208 -0.0492 0.0471  -0.0505 39  GLN M O   
3648 C CB  . GLN C 39  ? 0.3935 0.4892 0.5770 -0.0492 0.0247  -0.0510 39  GLN M CB  
3649 C CG  . GLN C 39  ? 0.3936 0.5164 0.5981 -0.0478 0.0223  -0.0574 39  GLN M CG  
3650 C CD  . GLN C 39  ? 0.4330 0.5569 0.6430 -0.0600 0.0205  -0.0545 39  GLN M CD  
3651 O OE1 . GLN C 39  ? 0.4157 0.5305 0.6193 -0.0711 0.0263  -0.0494 39  GLN M OE1 
3652 N NE2 . GLN C 39  ? 0.3941 0.5277 0.6166 -0.0577 0.0106  -0.0585 39  GLN M NE2 
3653 N N   . ALA C 40  ? 0.4334 0.5639 0.6244 -0.0232 0.0340  -0.0659 40  ALA M N   
3654 C CA  . ALA C 40  ? 0.4668 0.6292 0.6662 -0.0234 0.0462  -0.0714 40  ALA M CA  
3655 C C   . ALA C 40  ? 0.5435 0.7376 0.7610 -0.0338 0.0517  -0.0723 40  ALA M C   
3656 O O   . ALA C 40  ? 0.5653 0.7633 0.7950 -0.0320 0.0433  -0.0753 40  ALA M O   
3657 C CB  . ALA C 40  ? 0.4522 0.6288 0.6582 -0.0042 0.0405  -0.0856 40  ALA M CB  
3658 N N   . PRO C 41  ? 0.6418 0.8585 0.8604 -0.0468 0.0643  -0.0682 41  PRO M N   
3659 C CA  . PRO C 41  ? 0.5613 0.8108 0.7965 -0.0587 0.0682  -0.0672 41  PRO M CA  
3660 C C   . PRO C 41  ? 0.5961 0.8766 0.8533 -0.0450 0.0630  -0.0812 41  PRO M C   
3661 O O   . PRO C 41  ? 0.6064 0.9067 0.8700 -0.0295 0.0633  -0.0947 41  PRO M O   
3662 C CB  . PRO C 41  ? 0.5730 0.8503 0.8054 -0.0717 0.0806  -0.0633 41  PRO M CB  
3663 C CG  . PRO C 41  ? 0.6782 0.9197 0.8889 -0.0744 0.0822  -0.0553 41  PRO M CG  
3664 C CD  . PRO C 41  ? 0.6815 0.8944 0.8855 -0.0538 0.0737  -0.0625 41  PRO M CD  
3665 N N   . GLY C 42  ? 0.5286 1.1022 0.5696 -0.0200 -0.0118 0.0397  42  GLY M N   
3666 C CA  . GLY C 42  ? 0.4567 1.0883 0.5380 -0.0020 -0.0091 0.0491  42  GLY M CA  
3667 C C   . GLY C 42  ? 0.4969 1.0931 0.6246 0.0298  -0.0098 0.0509  42  GLY M C   
3668 O O   . GLY C 42  ? 0.5083 1.1458 0.6756 0.0478  -0.0108 0.0616  42  GLY M O   
3669 N N   . LYS C 43  ? 0.4866 1.0084 0.6096 0.0349  -0.0116 0.0428  43  LYS M N   
3670 C CA  . LYS C 43  ? 0.5585 1.0423 0.7222 0.0640  -0.0141 0.0389  43  LYS M CA  
3671 C C   . LYS C 43  ? 0.5566 0.9807 0.7093 0.0507  -0.0247 0.0620  43  LYS M C   
3672 O O   . LYS C 43  ? 0.4389 0.8473 0.5521 0.0206  -0.0280 0.0801  43  LYS M O   
3673 C CB  . LYS C 43  ? 0.6084 1.0598 0.7817 0.0846  -0.0068 0.0049  43  LYS M CB  
3674 C CG  . LYS C 43  ? 0.6290 1.1341 0.8088 0.0946  0.0060  -0.0231 43  LYS M CG  
3675 C CD  . LYS C 43  ? 0.7262 1.2951 0.9514 0.1218  0.0103  -0.0257 43  LYS M CD  
3676 C CE  . LYS C 43  ? 0.8324 1.4428 1.0699 0.1393  0.0263  -0.0633 43  LYS M CE  
3677 N NZ  . LYS C 43  ? 0.8306 1.3745 1.0522 0.1423  0.0296  -0.0884 43  LYS M NZ  
3678 N N   . GLY C 44  ? 0.5647 0.9535 0.7504 0.0726  -0.0303 0.0593  44  GLY M N   
3679 C CA  . GLY C 44  ? 0.4378 0.7746 0.6175 0.0595  -0.0412 0.0793  44  GLY M CA  
3680 C C   . GLY C 44  ? 0.4519 0.7354 0.5990 0.0447  -0.0386 0.0698  44  GLY M C   
3681 O O   . GLY C 44  ? 0.4811 0.7662 0.6069 0.0412  -0.0302 0.0519  44  GLY M O   
3682 N N   . LEU C 45  ? 0.4970 0.7372 0.6409 0.0338  -0.0469 0.0833  45  LEU M N   
3683 C CA  . LEU C 45  ? 0.4704 0.6655 0.5893 0.0208  -0.0447 0.0759  45  LEU M CA  
3684 C C   . LEU C 45  ? 0.5709 0.7314 0.7109 0.0388  -0.0503 0.0613  45  LEU M C   
3685 O O   . LEU C 45  ? 0.6517 0.8045 0.8198 0.0518  -0.0616 0.0677  45  LEU M O   
3686 C CB  . LEU C 45  ? 0.4266 0.6012 0.5246 -0.0070 -0.0489 0.0988  45  LEU M CB  
3687 C CG  . LEU C 45  ? 0.4837 0.6827 0.5521 -0.0291 -0.0451 0.1155  45  LEU M CG  
3688 C CD1 . LEU C 45  ? 0.5090 0.6891 0.5604 -0.0564 -0.0498 0.1391  45  LEU M CD1 
3689 C CD2 . LEU C 45  ? 0.4544 0.6484 0.4892 -0.0361 -0.0360 0.1016  45  LEU M CD2 
3690 N N   . GLU C 46  ? 0.5624 0.7001 0.6876 0.0382  -0.0448 0.0435  46  GLU M N   
3691 C CA  . GLU C 46  ? 0.5663 0.6666 0.7017 0.0493  -0.0511 0.0311  46  GLU M CA  
3692 C C   . GLU C 46  ? 0.5502 0.6221 0.6631 0.0309  -0.0500 0.0307  46  GLU M C   
3693 O O   . GLU C 46  ? 0.5833 0.6619 0.6785 0.0245  -0.0407 0.0221  46  GLU M O   
3694 C CB  . GLU C 46  ? 0.5687 0.6765 0.7139 0.0722  -0.0450 0.0052  46  GLU M CB  
3695 C CG  . GLU C 46  ? 0.7181 0.7812 0.8640 0.0802  -0.0513 -0.0087 46  GLU M CG  
3696 C CD  . GLU C 46  ? 0.7994 0.8672 0.9463 0.0976  -0.0423 -0.0367 46  GLU M CD  
3697 O OE1 . GLU C 46  ? 0.7680 0.8678 0.9028 0.0916  -0.0301 -0.0462 46  GLU M OE1 
3698 O OE2 . GLU C 46  ? 0.8778 0.9142 1.0343 0.1149  -0.0487 -0.0493 46  GLU M OE2 
3699 N N   . TRP C 47  ? 0.4942 0.5374 0.6089 0.0210  -0.0610 0.0413  47  TRP M N   
3700 C CA  . TRP C 47  ? 0.4885 0.5121 0.5863 0.0044  -0.0602 0.0404  47  TRP M CA  
3701 C C   . TRP C 47  ? 0.5270 0.5354 0.6223 0.0146  -0.0590 0.0213  47  TRP M C   
3702 O O   . TRP C 47  ? 0.5484 0.5411 0.6541 0.0308  -0.0654 0.0114  47  TRP M O   
3703 C CB  . TRP C 47  ? 0.4366 0.4380 0.5351 -0.0127 -0.0742 0.0564  47  TRP M CB  
3704 C CG  . TRP C 47  ? 0.5810 0.5686 0.6654 -0.0289 -0.0745 0.0540  47  TRP M CG  
3705 C CD1 . TRP C 47  ? 0.5951 0.5964 0.6656 -0.0453 -0.0634 0.0556  47  TRP M CD1 
3706 C CD2 . TRP C 47  ? 0.7115 0.6711 0.7937 -0.0302 -0.0867 0.0493  47  TRP M CD2 
3707 N NE1 . TRP C 47  ? 0.6506 0.6426 0.7152 -0.0560 -0.0670 0.0527  47  TRP M NE1 
3708 C CE2 . TRP C 47  ? 0.7115 0.6772 0.7802 -0.0495 -0.0822 0.0503  47  TRP M CE2 
3709 C CE3 . TRP C 47  ? 0.6788 0.6074 0.7673 -0.0167 -0.1014 0.0438  47  TRP M CE3 
3710 C CZ2 . TRP C 47  ? 0.7049 0.6517 0.7648 -0.0596 -0.0928 0.0491  47  TRP M CZ2 
3711 C CZ3 . TRP C 47  ? 0.7206 0.6208 0.7955 -0.0270 -0.1129 0.0418  47  TRP M CZ3 
3712 C CH2 . TRP C 47  ? 0.7623 0.6739 0.8223 -0.0502 -0.1091 0.0460  47  TRP M CH2 
3713 N N   . VAL C 48  ? 0.4334 0.4453 0.5146 0.0047  -0.0513 0.0165  48  VAL M N   
3714 C CA  . VAL C 48  ? 0.5495 0.5528 0.6253 0.0092  -0.0494 0.0013  48  VAL M CA  
3715 C C   . VAL C 48  ? 0.6690 0.6536 0.7369 -0.0055 -0.0558 0.0053  48  VAL M C   
3716 O O   . VAL C 48  ? 0.6735 0.6339 0.7367 -0.0047 -0.0637 -0.0009 48  VAL M O   
3717 C CB  . VAL C 48  ? 0.5303 0.5576 0.5977 0.0083  -0.0382 -0.0058 48  VAL M CB  
3718 C CG1 . VAL C 48  ? 0.6421 0.6610 0.7025 0.0053  -0.0381 -0.0164 48  VAL M CG1 
3719 C CG2 . VAL C 48  ? 0.6564 0.7058 0.7275 0.0197  -0.0334 -0.0123 48  VAL M CG2 
3720 N N   . SER C 49  ? 0.6391 0.6361 0.7033 -0.0199 -0.0520 0.0152  49  SER M N   
3721 C CA  . SER C 49  ? 0.6677 0.6606 0.7265 -0.0348 -0.0560 0.0190  49  SER M CA  
3722 C C   . SER C 49  ? 0.6683 0.6787 0.7262 -0.0501 -0.0509 0.0288  49  SER M C   
3723 O O   . SER C 49  ? 0.6941 0.7188 0.7516 -0.0481 -0.0408 0.0300  49  SER M O   
3724 C CB  . SER C 49  ? 0.6463 0.6467 0.7024 -0.0330 -0.0512 0.0105  49  SER M CB  
3725 O OG  . SER C 49  ? 0.6996 0.7081 0.7541 -0.0478 -0.0534 0.0167  49  SER M OG  
3726 N N   . SER C 50  ? 0.6076 0.6170 0.6617 -0.0676 -0.0581 0.0353  50  SER M N   
3727 C CA  . SER C 50  ? 0.5936 0.6264 0.6466 -0.0843 -0.0511 0.0412  50  SER M CA  
3728 C C   . SER C 50  ? 0.5470 0.5987 0.6003 -0.0967 -0.0515 0.0417  50  SER M C   
3729 O O   . SER C 50  ? 0.5962 0.6347 0.6438 -0.1026 -0.0640 0.0439  50  SER M O   
3730 C CB  . SER C 50  ? 0.6528 0.6766 0.7000 -0.1025 -0.0605 0.0531  50  SER M CB  
3731 O OG  . SER C 50  ? 0.8547 0.8646 0.8946 -0.1202 -0.0783 0.0605  50  SER M OG  
3732 N N   . ILE C 51  ? 0.5069 0.5905 0.5659 -0.1009 -0.0377 0.0396  51  ILE M N   
3733 C CA  . ILE C 51  ? 0.5690 0.6832 0.6336 -0.1122 -0.0363 0.0407  51  ILE M CA  
3734 C C   . ILE C 51  ? 0.5472 0.6937 0.6121 -0.1291 -0.0257 0.0410  51  ILE M C   
3735 O O   . ILE C 51  ? 0.5536 0.7068 0.6204 -0.1212 -0.0105 0.0341  51  ILE M O   
3736 C CB  . ILE C 51  ? 0.6139 0.7441 0.6935 -0.0930 -0.0280 0.0338  51  ILE M CB  
3737 C CG1 . ILE C 51  ? 0.6496 0.8202 0.7405 -0.1035 -0.0266 0.0371  51  ILE M CG1 
3738 C CG2 . ILE C 51  ? 0.5249 0.6589 0.6110 -0.0747 -0.0129 0.0250  51  ILE M CG2 
3739 C CD1 . ILE C 51  ? 0.6263 0.8101 0.7338 -0.0880 -0.0249 0.0354  51  ILE M CD1 
3740 N N   . SER C 52  ? 0.5632 0.7287 0.6219 -0.1555 -0.0342 0.0487  52  SER M N   
3741 C CA  . SER C 52  ? 0.5369 0.7419 0.5951 -0.1759 -0.0229 0.0470  52  SER M CA  
3742 C C   . SER C 52  ? 0.5395 0.7896 0.6200 -0.1589 -0.0021 0.0347  52  SER M C   
3743 O O   . SER C 52  ? 0.5715 0.8246 0.6673 -0.1384 -0.0023 0.0328  52  SER M O   
3744 C CB  . SER C 52  ? 0.5431 0.7621 0.5865 -0.2130 -0.0400 0.0595  52  SER M CB  
3745 O OG  . SER C 52  ? 0.6195 0.8678 0.6700 -0.2161 -0.0439 0.0623  52  SER M OG  
3746 N N   . SER C 53  A 0.5711 0.8559 0.6538 -0.1678 0.0153  0.0261  52  SER M N   
3747 C CA  . SER C 53  A 0.5652 0.8922 0.6720 -0.1475 0.0364  0.0115  52  SER M CA  
3748 C C   . SER C 53  A 0.5727 0.9412 0.7016 -0.1446 0.0316  0.0161  52  SER M C   
3749 O O   . SER C 53  A 0.5818 0.9629 0.7359 -0.1161 0.0387  0.0100  52  SER M O   
3750 C CB  . SER C 53  A 0.6097 0.9729 0.7117 -0.1645 0.0558  0.0000  52  SER M CB  
3751 O OG  . SER C 53  A 0.6835 1.0877 0.8118 -0.1403 0.0774  -0.0172 52  SER M OG  
3752 N N   . SER C 54  ? 0.6069 0.9961 0.7248 -0.1768 0.0171  0.0290  53  SER M N   
3753 C CA  . SER C 54  ? 0.5877 1.0211 0.7208 -0.1825 0.0103  0.0377  53  SER M CA  
3754 C C   . SER C 54  ? 0.5485 0.9420 0.6785 -0.1720 -0.0081 0.0489  53  SER M C   
3755 O O   . SER C 54  ? 0.5432 0.9651 0.6820 -0.1780 -0.0162 0.0590  53  SER M O   
3756 C CB  . SER C 54  ? 0.6344 1.0984 0.7465 -0.2275 -0.0025 0.0498  53  SER M CB  
3757 O OG  . SER C 54  ? 0.7086 1.1115 0.7866 -0.2483 -0.0262 0.0624  53  SER M OG  
3758 N N   . SER C 55  ? 0.4898 0.8203 0.6056 -0.1592 -0.0144 0.0473  54  SER M N   
3759 C CA  . SER C 55  ? 0.4805 0.7680 0.5875 -0.1523 -0.0305 0.0545  54  SER M CA  
3760 C C   . SER C 55  ? 0.5371 0.8041 0.6156 -0.1827 -0.0538 0.0691  54  SER M C   
3761 O O   . SER C 55  ? 0.6075 0.8427 0.6753 -0.1810 -0.0667 0.0743  54  SER M O   
3762 C CB  . SER C 55  ? 0.4341 0.7441 0.5664 -0.1323 -0.0265 0.0544  54  SER M CB  
3763 O OG  . SER C 55  ? 0.5243 0.8310 0.6758 -0.1021 -0.0115 0.0417  54  SER M OG  
3764 N N   . SER C 56  ? 0.6032 0.8837 0.6655 -0.2126 -0.0603 0.0752  55  SER M N   
3765 C CA  . SER C 56  ? 0.6566 0.9187 0.6874 -0.2469 -0.0862 0.0911  55  SER M CA  
3766 C C   . SER C 56  ? 0.6670 0.8560 0.6716 -0.2497 -0.1051 0.0940  55  SER M C   
3767 O O   . SER C 56  ? 0.6605 0.8080 0.6399 -0.2613 -0.1270 0.1026  55  SER M O   
3768 C CB  . SER C 56  ? 0.6747 0.9898 0.6976 -0.2837 -0.0884 0.0985  55  SER M CB  
3769 O OG  . SER C 56  ? 0.7744 1.1564 0.8148 -0.2889 -0.0809 0.1022  55  SER M OG  
3770 N N   . TYR C 57  ? 0.6590 0.8315 0.6689 -0.2395 -0.0973 0.0871  56  TYR M N   
3771 C CA  . TYR C 57  ? 0.7136 0.8218 0.7088 -0.2336 -0.1131 0.0890  56  TYR M CA  
3772 C C   . TYR C 57  ? 0.6352 0.7223 0.6475 -0.1943 -0.0993 0.0759  56  TYR M C   
3773 O O   . TYR C 57  ? 0.6853 0.7943 0.7163 -0.1764 -0.0787 0.0667  56  TYR M O   
3774 C CB  . TYR C 57  ? 0.8636 0.9670 0.8526 -0.2512 -0.1172 0.0939  56  TYR M CB  
3775 C CG  . TYR C 57  ? 1.0565 1.1052 1.0448 -0.2337 -0.1262 0.0938  56  TYR M CG  
3776 C CD1 . TYR C 57  ? 1.1222 1.1151 1.0955 -0.2315 -0.1509 0.0991  56  TYR M CD1 
3777 C CD2 . TYR C 57  ? 1.0845 1.1383 1.0869 -0.2187 -0.1101 0.0883  56  TYR M CD2 
3778 C CE1 . TYR C 57  ? 1.0962 1.0465 1.0753 -0.2114 -0.1581 0.0979  56  TYR M CE1 
3779 C CE2 . TYR C 57  ? 1.0520 1.0655 1.0571 -0.2031 -0.1185 0.0903  56  TYR M CE2 
3780 C CZ  . TYR C 57  ? 1.0700 1.0351 1.0669 -0.1977 -0.1419 0.0946  56  TYR M CZ  
3781 O OH  . TYR C 57  ? 1.0880 1.0198 1.0937 -0.1784 -0.1492 0.0954  56  TYR M OH  
3782 N N   . ILE C 58  ? 0.5997 0.6438 0.6019 -0.1835 -0.1111 0.0745  57  ILE M N   
3783 C CA  . ILE C 58  ? 0.6580 0.6837 0.6723 -0.1511 -0.1003 0.0619  57  ILE M CA  
3784 C C   . ILE C 58  ? 0.7572 0.7271 0.7591 -0.1426 -0.1154 0.0599  57  ILE M C   
3785 O O   . ILE C 58  ? 0.8463 0.7820 0.8261 -0.1584 -0.1366 0.0667  57  ILE M O   
3786 C CB  . ILE C 58  ? 0.6604 0.6956 0.6769 -0.1446 -0.0963 0.0584  57  ILE M CB  
3787 C CG1 . ILE C 58  ? 0.6701 0.7635 0.7070 -0.1464 -0.0814 0.0599  57  ILE M CG1 
3788 C CG2 . ILE C 58  ? 0.6196 0.6315 0.6419 -0.1179 -0.0890 0.0455  57  ILE M CG2 
3789 C CD1 . ILE C 58  ? 0.6120 0.7206 0.6521 -0.1475 -0.0825 0.0630  57  ILE M CD1 
3790 N N   . HIS C 59  ? 0.7161 0.6768 0.7313 -0.1175 -0.1057 0.0506  58  HIS M N   
3791 C CA  . HIS C 59  ? 0.7504 0.6667 0.7615 -0.1054 -0.1184 0.0479  58  HIS M CA  
3792 C C   . HIS C 59  ? 0.7046 0.6211 0.7296 -0.0757 -0.1044 0.0334  58  HIS M C   
3793 O O   . HIS C 59  ? 0.7351 0.6832 0.7732 -0.0673 -0.0876 0.0306  58  HIS M O   
3794 C CB  . HIS C 59  ? 0.8491 0.7589 0.8620 -0.1174 -0.1294 0.0602  58  HIS M CB  
3795 C CG  . HIS C 59  ? 1.0605 0.9182 1.0642 -0.1163 -0.1542 0.0644  58  HIS M CG  
3796 N ND1 . HIS C 59  ? 1.1967 1.0352 1.1873 -0.1430 -0.1779 0.0809  58  HIS M ND1 
3797 C CD2 . HIS C 59  ? 1.1572 0.9767 1.1626 -0.0914 -0.1603 0.0533  58  HIS M CD2 
3798 C CE1 . HIS C 59  ? 1.2737 1.0591 1.2593 -0.1327 -0.1998 0.0812  58  HIS M CE1 
3799 N NE2 . HIS C 59  ? 1.2265 1.0003 1.2221 -0.0993 -0.1879 0.0630  58  HIS M NE2 
3800 N N   . TYR C 60  ? 0.6700 0.5505 0.6890 -0.0615 -0.1119 0.0235  59  TYR M N   
3801 C CA  . TYR C 60  ? 0.6307 0.5157 0.6605 -0.0361 -0.0990 0.0076  59  TYR M CA  
3802 C C   . TYR C 60  ? 0.6628 0.5214 0.7018 -0.0164 -0.1072 0.0026  59  TYR M C   
3803 O O   . TYR C 60  ? 0.7479 0.5690 0.7800 -0.0206 -0.1267 0.0088  59  TYR M O   
3804 C CB  . TYR C 60  ? 0.5908 0.4665 0.6065 -0.0357 -0.0953 -0.0050 59  TYR M CB  
3805 C CG  . TYR C 60  ? 0.5612 0.4683 0.5747 -0.0514 -0.0878 0.0010  59  TYR M CG  
3806 C CD1 . TYR C 60  ? 0.5124 0.4132 0.5100 -0.0737 -0.0980 0.0108  59  TYR M CD1 
3807 C CD2 . TYR C 60  ? 0.5186 0.4620 0.5460 -0.0445 -0.0726 -0.0017 59  TYR M CD2 
3808 C CE1 . TYR C 60  ? 0.4902 0.4260 0.4922 -0.0855 -0.0916 0.0175  59  TYR M CE1 
3809 C CE2 . TYR C 60  ? 0.5220 0.4923 0.5521 -0.0553 -0.0680 0.0042  59  TYR M CE2 
3810 C CZ  . TYR C 60  ? 0.5899 0.5592 0.6105 -0.0742 -0.0767 0.0137  59  TYR M CZ  
3811 O OH  . TYR C 60  ? 0.6217 0.6238 0.6512 -0.0825 -0.0726 0.0207  59  TYR M OH  
3812 N N   . ALA C 61  ? 0.6774 0.5574 0.7324 0.0045  -0.0941 -0.0074 60  ALA M N   
3813 C CA  . ALA C 61  ? 0.7170 0.5809 0.7865 0.0282  -0.0993 -0.0151 60  ALA M CA  
3814 C C   . ALA C 61  ? 0.7747 0.6087 0.8330 0.0420  -0.0990 -0.0372 60  ALA M C   
3815 O O   . ALA C 61  ? 0.6945 0.5396 0.7397 0.0365  -0.0872 -0.0485 60  ALA M O   
3816 C CB  . ALA C 61  ? 0.5440 0.4507 0.6338 0.0424  -0.0852 -0.0163 60  ALA M CB  
3817 N N   . ASP C 62  ? 0.8379 0.6315 0.9002 0.0588  -0.1129 -0.0433 61  ASP M N   
3818 C CA  . ASP C 62  ? 0.8864 0.6414 0.9330 0.0720  -0.1133 -0.0668 61  ASP M CA  
3819 C C   . ASP C 62  ? 0.8832 0.6739 0.9334 0.0845  -0.0892 -0.0899 61  ASP M C   
3820 O O   . ASP C 62  ? 0.9625 0.7335 0.9892 0.0800  -0.0838 -0.1071 61  ASP M O   
3821 C CB  . ASP C 62  ? 1.0015 0.7109 1.0594 0.0970  -0.1305 -0.0726 61  ASP M CB  
3822 C CG  . ASP C 62  ? 1.1622 0.8146 1.1999 0.0780  -0.1605 -0.0541 61  ASP M CG  
3823 O OD1 . ASP C 62  ? 1.2097 0.8155 1.2542 0.0961  -0.1805 -0.0557 61  ASP M OD1 
3824 O OD2 . ASP C 62  ? 1.2166 0.8723 1.2318 0.0446  -0.1655 -0.0375 61  ASP M OD2 
3825 N N   . SER C 63  ? 0.8011 0.6446 0.8770 0.0957  -0.0760 -0.0890 62  SER M N   
3826 C CA  . SER C 63  ? 0.7515 0.6358 0.8290 0.1025  -0.0551 -0.1089 62  SER M CA  
3827 C C   . SER C 63  ? 0.7697 0.6681 0.8234 0.0754  -0.0474 -0.1074 62  SER M C   
3828 O O   . SER C 63  ? 0.8138 0.7278 0.8572 0.0735  -0.0350 -0.1259 62  SER M O   
3829 C CB  . SER C 63  ? 0.8374 0.7778 0.9429 0.1148  -0.0460 -0.1036 62  SER M CB  
3830 O OG  . SER C 63  ? 0.9279 0.8755 1.0425 0.1041  -0.0553 -0.0759 62  SER M OG  
3831 N N   . VAL C 64  ? 0.7753 0.6704 0.8213 0.0538  -0.0551 -0.0855 63  VAL M N   
3832 C CA  . VAL C 64  ? 0.7371 0.6479 0.7669 0.0308  -0.0498 -0.0816 63  VAL M CA  
3833 C C   . VAL C 64  ? 0.6851 0.5605 0.6922 0.0109  -0.0608 -0.0748 63  VAL M C   
3834 O O   . VAL C 64  ? 0.6774 0.5647 0.6727 -0.0075 -0.0580 -0.0715 63  VAL M O   
3835 C CB  . VAL C 64  ? 0.7376 0.6874 0.7780 0.0217  -0.0457 -0.0640 63  VAL M CB  
3836 C CG1 . VAL C 64  ? 0.6835 0.6710 0.7369 0.0339  -0.0356 -0.0694 63  VAL M CG1 
3837 C CG2 . VAL C 64  ? 0.6899 0.6293 0.7371 0.0165  -0.0556 -0.0443 63  VAL M CG2 
3838 N N   . LYS C 65  ? 0.7608 0.5937 0.7608 0.0123  -0.0755 -0.0704 64  LYS M N   
3839 C CA  . LYS C 65  ? 0.7857 0.5851 0.7581 -0.0105 -0.0881 -0.0627 64  LYS M CA  
3840 C C   . LYS C 65  ? 0.8075 0.6009 0.7570 -0.0210 -0.0806 -0.0769 64  LYS M C   
3841 O O   . LYS C 65  ? 0.8928 0.6744 0.8373 -0.0069 -0.0723 -0.0999 64  LYS M O   
3842 C CB  . LYS C 65  ? 0.8123 0.5541 0.7710 -0.0064 -0.1074 -0.0624 64  LYS M CB  
3843 C CG  . LYS C 65  ? 0.8745 0.6093 0.8304 -0.0253 -0.1251 -0.0377 64  LYS M CG  
3844 C CD  . LYS C 65  ? 1.0264 0.6959 0.9488 -0.0374 -0.1489 -0.0352 64  LYS M CD  
3845 C CE  . LYS C 65  ? 1.1686 0.8266 1.0904 -0.0532 -0.1707 -0.0124 64  LYS M CE  
3846 N NZ  . LYS C 65  ? 1.2029 0.8703 1.1577 -0.0316 -0.1719 -0.0101 64  LYS M NZ  
3847 N N   . GLY C 66  ? 0.7880 0.5938 0.7251 -0.0469 -0.0831 -0.0632 65  GLY M N   
3848 C CA  . GLY C 66  ? 0.6423 0.4395 0.5540 -0.0645 -0.0799 -0.0713 65  GLY M CA  
3849 C C   . GLY C 66  ? 0.7431 0.5880 0.6679 -0.0688 -0.0668 -0.0735 65  GLY M C   
3850 O O   . GLY C 66  ? 0.8215 0.6691 0.7287 -0.0904 -0.0664 -0.0730 65  GLY M O   
3851 N N   . ARG C 67  ? 0.7031 0.5837 0.6559 -0.0518 -0.0585 -0.0735 66  ARG M N   
3852 C CA  . ARG C 67  ? 0.6755 0.5950 0.6357 -0.0557 -0.0489 -0.0776 66  ARG M CA  
3853 C C   . ARG C 67  ? 0.6399 0.5957 0.6227 -0.0555 -0.0491 -0.0594 66  ARG M C   
3854 O O   . ARG C 67  ? 0.7373 0.7184 0.7224 -0.0660 -0.0481 -0.0552 66  ARG M O   
3855 C CB  . ARG C 67  ? 0.6508 0.5793 0.6144 -0.0376 -0.0373 -0.1010 66  ARG M CB  
3856 C CG  . ARG C 67  ? 0.7173 0.6132 0.6563 -0.0387 -0.0335 -0.1247 66  ARG M CG  
3857 C CD  . ARG C 67  ? 0.7438 0.6555 0.6910 -0.0168 -0.0199 -0.1510 66  ARG M CD  
3858 N NE  . ARG C 67  ? 0.7221 0.6408 0.6973 0.0116  -0.0205 -0.1475 66  ARG M NE  
3859 C CZ  . ARG C 67  ? 0.6928 0.6575 0.6893 0.0211  -0.0138 -0.1448 66  ARG M CZ  
3860 N NH1 . ARG C 67  ? 0.6806 0.6848 0.6715 0.0050  -0.0074 -0.1463 66  ARG M NH1 
3861 N NH2 . ARG C 67  ? 0.6755 0.6456 0.6959 0.0431  -0.0160 -0.1384 66  ARG M NH2 
3862 N N   . PHE C 68  ? 0.5168 0.4724 0.5143 -0.0448 -0.0516 -0.0490 67  PHE M N   
3863 C CA  . PHE C 68  ? 0.5653 0.5504 0.5804 -0.0440 -0.0501 -0.0347 67  PHE M CA  
3864 C C   . PHE C 68  ? 0.5899 0.5739 0.6081 -0.0551 -0.0572 -0.0184 67  PHE M C   
3865 O O   . PHE C 68  ? 0.6509 0.6107 0.6596 -0.0597 -0.0645 -0.0160 67  PHE M O   
3866 C CB  . PHE C 68  ? 0.6229 0.6168 0.6508 -0.0268 -0.0450 -0.0354 67  PHE M CB  
3867 C CG  . PHE C 68  ? 0.6952 0.7041 0.7226 -0.0173 -0.0376 -0.0485 67  PHE M CG  
3868 C CD1 . PHE C 68  ? 0.7448 0.7530 0.7600 -0.0216 -0.0347 -0.0641 67  PHE M CD1 
3869 C CD2 . PHE C 68  ? 0.6883 0.7152 0.7251 -0.0071 -0.0334 -0.0449 67  PHE M CD2 
3870 C CE1 . PHE C 68  ? 0.6600 0.6916 0.6748 -0.0153 -0.0272 -0.0770 67  PHE M CE1 
3871 C CE2 . PHE C 68  ? 0.5951 0.6436 0.6306 -0.0012 -0.0275 -0.0549 67  PHE M CE2 
3872 C CZ  . PHE C 68  ? 0.5673 0.6211 0.5930 -0.0048 -0.0241 -0.0716 67  PHE M CZ  
3873 N N   . THR C 69  ? 0.5348 0.5462 0.5662 -0.0596 -0.0562 -0.0074 68  THR M N   
3874 C CA  . THR C 69  ? 0.5736 0.5971 0.6128 -0.0688 -0.0604 0.0067  68  THR M CA  
3875 C C   . THR C 69  ? 0.5656 0.6159 0.6250 -0.0592 -0.0534 0.0120  68  THR M C   
3876 O O   . THR C 69  ? 0.6103 0.6779 0.6804 -0.0546 -0.0509 0.0132  68  THR M O   
3877 C CB  . THR C 69  ? 0.5499 0.5834 0.5864 -0.0861 -0.0671 0.0155  68  THR M CB  
3878 O OG1 . THR C 69  ? 0.6738 0.6759 0.6841 -0.0993 -0.0739 0.0114  68  THR M OG1 
3879 C CG2 . THR C 69  ? 0.4569 0.5180 0.5080 -0.0936 -0.0696 0.0306  68  THR M CG2 
3880 N N   . ILE C 70  ? 0.6269 0.6768 0.6886 -0.0579 -0.0514 0.0148  69  ILE M N   
3881 C CA  . ILE C 70  ? 0.6017 0.6727 0.6770 -0.0506 -0.0426 0.0170  69  ILE M CA  
3882 C C   . ILE C 70  ? 0.5558 0.6577 0.6461 -0.0571 -0.0414 0.0250  69  ILE M C   
3883 O O   . ILE C 70  ? 0.5752 0.6831 0.6626 -0.0716 -0.0488 0.0322  69  ILE M O   
3884 C CB  . ILE C 70  ? 0.5769 0.6376 0.6471 -0.0511 -0.0409 0.0176  69  ILE M CB  
3885 C CG1 . ILE C 70  ? 0.5800 0.6566 0.6569 -0.0450 -0.0298 0.0173  69  ILE M CG1 
3886 C CG2 . ILE C 70  ? 0.5785 0.6379 0.6435 -0.0680 -0.0491 0.0254  69  ILE M CG2 
3887 C CD1 . ILE C 70  ? 0.5808 0.6485 0.6507 -0.0504 -0.0288 0.0203  69  ILE M CD1 
3888 N N   . SER C 71  ? 0.4847 0.6067 0.5900 -0.0462 -0.0326 0.0234  70  SER M N   
3889 C CA  . SER C 71  ? 0.5009 0.6575 0.6279 -0.0454 -0.0306 0.0285  70  SER M CA  
3890 C C   . SER C 71  ? 0.5209 0.6924 0.6596 -0.0320 -0.0176 0.0222  70  SER M C   
3891 O O   . SER C 71  ? 0.5220 0.6722 0.6488 -0.0244 -0.0126 0.0158  70  SER M O   
3892 C CB  . SER C 71  ? 0.5901 0.7476 0.7255 -0.0414 -0.0383 0.0318  70  SER M CB  
3893 O OG  . SER C 71  ? 0.6221 0.8154 0.7814 -0.0429 -0.0404 0.0407  70  SER M OG  
3894 N N   . ARG C 72  ? 0.5159 0.7252 0.6771 -0.0294 -0.0117 0.0237  71  ARG M N   
3895 C CA  . ARG C 72  ? 0.5021 0.7263 0.6717 -0.0184 0.0034  0.0142  71  ARG M CA  
3896 C C   . ARG C 72  ? 0.5202 0.7867 0.7240 -0.0046 0.0084  0.0134  71  ARG M C   
3897 O O   . ARG C 72  ? 0.6103 0.9082 0.8309 -0.0124 0.0014  0.0236  71  ARG M O   
3898 C CB  . ARG C 72  ? 0.5516 0.7853 0.7080 -0.0375 0.0095  0.0138  71  ARG M CB  
3899 C CG  . ARG C 72  ? 0.5841 0.8366 0.7442 -0.0334 0.0271  0.0029  71  ARG M CG  
3900 C CD  . ARG C 72  ? 0.4910 0.7682 0.6428 -0.0598 0.0297  0.0059  71  ARG M CD  
3901 N NE  . ARG C 72  ? 0.5648 0.8076 0.6883 -0.0756 0.0262  0.0085  71  ARG M NE  
3902 C CZ  . ARG C 72  ? 0.5193 0.7564 0.6295 -0.0807 0.0385  0.0015  71  ARG M CZ  
3903 N NH1 . ARG C 72  ? 0.5586 0.7665 0.6459 -0.0972 0.0316  0.0084  71  ARG M NH1 
3904 N NH2 . ARG C 72  ? 0.4352 0.6944 0.5545 -0.0696 0.0571  -0.0123 71  ARG M NH2 
3905 N N   . ASP C 73  ? 0.4623 0.7288 0.6761 0.0163  0.0196  0.0016  72  ASP M N   
3906 C CA  . ASP C 73  ? 0.4330 0.7411 0.6845 0.0356  0.0261  -0.0024 72  ASP M CA  
3907 C C   . ASP C 73  ? 0.5639 0.8795 0.8151 0.0473  0.0472  -0.0209 72  ASP M C   
3908 O O   . ASP C 73  ? 0.6068 0.8903 0.8523 0.0675  0.0509  -0.0316 72  ASP M O   
3909 C CB  . ASP C 73  ? 0.5353 0.8248 0.8028 0.0559  0.0128  0.0018  72  ASP M CB  
3910 C CG  . ASP C 73  ? 0.7024 1.0346 1.0162 0.0806  0.0165  -0.0008 72  ASP M CG  
3911 O OD1 . ASP C 73  ? 0.7144 1.0926 1.0477 0.0859  0.0339  -0.0105 72  ASP M OD1 
3912 O OD2 . ASP C 73  ? 0.7817 1.1033 1.1135 0.0944  0.0010  0.0069  72  ASP M OD2 
3913 N N   . ASN C 74  ? 0.5915 0.9473 0.8440 0.0313  0.0602  -0.0249 73  ASN M N   
3914 C CA  . ASN C 74  ? 0.5925 0.9535 0.8360 0.0343  0.0818  -0.0437 73  ASN M CA  
3915 C C   . ASN C 74  ? 0.5417 0.9152 0.8139 0.0696  0.0939  -0.0604 73  ASN M C   
3916 O O   . ASN C 74  ? 0.5643 0.9032 0.8185 0.0823  0.1050  -0.0762 73  ASN M O   
3917 C CB  . ASN C 74  ? 0.6110 1.0220 0.8521 0.0058  0.0918  -0.0441 73  ASN M CB  
3918 C CG  . ASN C 74  ? 0.5965 0.9783 0.8011 -0.0278 0.0800  -0.0311 73  ASN M CG  
3919 O OD1 . ASN C 74  ? 0.5913 0.9176 0.7712 -0.0273 0.0715  -0.0272 73  ASN M OD1 
3920 N ND2 . ASN C 74  ? 0.5387 0.9591 0.7402 -0.0576 0.0777  -0.0236 73  ASN M ND2 
3921 N N   . ALA C 75  ? 0.4989 0.9203 0.8153 0.0855  0.0905  -0.0560 74  ALA M N   
3922 C CA  . ALA C 75  ? 0.6127 1.0502 0.9648 0.1237  0.1003  -0.0717 74  ALA M CA  
3923 C C   . ALA C 75  ? 0.6203 0.9841 0.9554 0.1466  0.0901  -0.0762 74  ALA M C   
3924 O O   . ALA C 75  ? 0.6137 0.9649 0.9595 0.1765  0.1001  -0.0948 74  ALA M O   
3925 C CB  . ALA C 75  ? 0.6654 1.1636 1.0707 0.1362  0.0915  -0.0592 74  ALA M CB  
3926 N N   . GLU C 76  ? 0.6672 0.9822 0.9739 0.1315  0.0695  -0.0598 75  GLU M N   
3927 C CA  . GLU C 76  ? 0.7712 1.0194 1.0564 0.1461  0.0559  -0.0606 75  GLU M CA  
3928 C C   . GLU C 76  ? 0.7163 0.9111 0.9457 0.1268  0.0589  -0.0638 75  GLU M C   
3929 O O   . GLU C 76  ? 0.7204 0.8604 0.9222 0.1297  0.0455  -0.0610 75  GLU M O   
3930 C CB  . GLU C 76  ? 0.8571 1.0943 1.1549 0.1449  0.0283  -0.0398 75  GLU M CB  
3931 C CG  . GLU C 76  ? 1.0501 1.3389 1.4039 0.1630  0.0225  -0.0327 75  GLU M CG  
3932 C CD  . GLU C 76  ? 1.2417 1.4987 1.6114 0.1835  -0.0013 -0.0247 75  GLU M CD  
3933 O OE1 . GLU C 76  ? 1.3074 1.5953 1.7120 0.1829  -0.0177 -0.0066 75  GLU M OE1 
3934 O OE2 . GLU C 76  ? 1.2835 1.4830 1.6280 0.1969  -0.0057 -0.0346 75  GLU M OE2 
3935 N N   . ASN C 77  ? 0.6658 0.8795 0.8782 0.1042  0.0746  -0.0676 76  ASN M N   
3936 C CA  . ASN C 77  ? 0.6953 0.8663 0.8591 0.0849  0.0785  -0.0690 76  ASN M CA  
3937 C C   . ASN C 77  ? 0.7314 0.8636 0.8718 0.0737  0.0572  -0.0525 76  ASN M C   
3938 O O   . ASN C 77  ? 0.8354 0.9219 0.9391 0.0695  0.0537  -0.0527 76  ASN M O   
3939 C CB  . ASN C 77  ? 0.7667 0.9005 0.9084 0.1007  0.0907  -0.0875 76  ASN M CB  
3940 C CG  . ASN C 77  ? 0.8829 1.0213 0.9970 0.0806  0.1129  -0.0990 76  ASN M CG  
3941 O OD1 . ASN C 77  ? 0.8679 1.0583 0.9995 0.0678  0.1264  -0.1028 76  ASN M OD1 
3942 N ND2 . ASN C 77  ? 0.9394 1.0247 1.0068 0.0731  0.1154  -0.1030 76  ASN M ND2 
3943 N N   . SER C 78  ? 0.6857 0.8388 0.8454 0.0668  0.0435  -0.0385 77  SER M N   
3944 C CA  . SER C 78  ? 0.7105 0.8344 0.8532 0.0582  0.0244  -0.0258 77  SER M CA  
3945 C C   . SER C 78  ? 0.7099 0.8480 0.8491 0.0362  0.0199  -0.0154 77  SER M C   
3946 O O   . SER C 78  ? 0.7258 0.9003 0.8848 0.0290  0.0236  -0.0127 77  SER M O   
3947 C CB  . SER C 78  ? 0.8038 0.9263 0.9692 0.0729  0.0073  -0.0197 77  SER M CB  
3948 O OG  . SER C 78  ? 0.9539 1.0421 1.1101 0.0911  0.0036  -0.0270 77  SER M OG  
3949 N N   . LEU C 79  ? 0.6218 0.7310 0.7346 0.0257  0.0110  -0.0099 78  LEU M N   
3950 C CA  . LEU C 79  ? 0.4771 0.5901 0.5846 0.0091  0.0053  -0.0023 78  LEU M CA  
3951 C C   . LEU C 79  ? 0.4987 0.5971 0.6007 0.0077  -0.0100 0.0030  78  LEU M C   
3952 O O   . LEU C 79  ? 0.5605 0.6392 0.6501 0.0129  -0.0165 0.0024  78  LEU M O   
3953 C CB  . LEU C 79  ? 0.3950 0.4948 0.4789 -0.0032 0.0118  -0.0023 78  LEU M CB  
3954 C CG  . LEU C 79  ? 0.5382 0.6330 0.6155 -0.0160 0.0039  0.0046  78  LEU M CG  
3955 C CD1 . LEU C 79  ? 0.5147 0.6297 0.6044 -0.0275 0.0031  0.0082  78  LEU M CD1 
3956 C CD2 . LEU C 79  ? 0.5728 0.6497 0.6275 -0.0236 0.0061  0.0071  78  LEU M CD2 
3957 N N   . TYR C 80  ? 0.4381 0.5453 0.5456 -0.0023 -0.0163 0.0079  79  TYR M N   
3958 C CA  . TYR C 80  ? 0.4302 0.5288 0.5329 -0.0069 -0.0287 0.0109  79  TYR M CA  
3959 C C   . TYR C 80  ? 0.5189 0.6085 0.6085 -0.0174 -0.0306 0.0100  79  TYR M C   
3960 O O   . TYR C 80  ? 0.5985 0.6912 0.6894 -0.0231 -0.0275 0.0113  79  TYR M O   
3961 C CB  . TYR C 80  ? 0.4813 0.5986 0.6061 -0.0078 -0.0367 0.0174  79  TYR M CB  
3962 C CG  . TYR C 80  ? 0.6374 0.7674 0.7841 0.0075  -0.0356 0.0179  79  TYR M CG  
3963 C CD1 . TYR C 80  ? 0.6899 0.8487 0.8588 0.0140  -0.0254 0.0169  79  TYR M CD1 
3964 C CD2 . TYR C 80  ? 0.6551 0.7684 0.7996 0.0154  -0.0458 0.0187  79  TYR M CD2 
3965 C CE1 . TYR C 80  ? 0.7294 0.9020 0.9222 0.0329  -0.0224 0.0141  79  TYR M CE1 
3966 C CE2 . TYR C 80  ? 0.6871 0.8060 0.8533 0.0337  -0.0465 0.0179  79  TYR M CE2 
3967 C CZ  . TYR C 80  ? 0.7283 0.8776 0.9205 0.0448  -0.0333 0.0143  79  TYR M CZ  
3968 O OH  . TYR C 80  ? 0.8071 0.9648 1.0247 0.0675  -0.0318 0.0102  79  TYR M OH  
3969 N N   . LEU C 81  ? 0.5565 0.6348 0.6325 -0.0205 -0.0366 0.0073  80  LEU M N   
3970 C CA  . LEU C 81  ? 0.5746 0.6449 0.6412 -0.0270 -0.0385 0.0031  80  LEU M CA  
3971 C C   . LEU C 81  ? 0.6107 0.6817 0.6726 -0.0358 -0.0469 0.0017  80  LEU M C   
3972 O O   . LEU C 81  ? 0.6114 0.6832 0.6653 -0.0375 -0.0512 0.0008  80  LEU M O   
3973 C CB  . LEU C 81  ? 0.4977 0.5603 0.5514 -0.0227 -0.0342 -0.0018 80  LEU M CB  
3974 C CG  . LEU C 81  ? 0.4785 0.5327 0.5273 -0.0234 -0.0352 -0.0089 80  LEU M CG  
3975 C CD1 . LEU C 81  ? 0.4863 0.5306 0.5407 -0.0269 -0.0374 -0.0058 80  LEU M CD1 
3976 C CD2 . LEU C 81  ? 0.4453 0.4998 0.4889 -0.0164 -0.0313 -0.0117 80  LEU M CD2 
3977 N N   . GLN C 82  ? 0.6095 0.6791 0.6725 -0.0455 -0.0508 0.0031  81  GLN M N   
3978 C CA  . GLN C 82  ? 0.4979 0.5669 0.5524 -0.0596 -0.0585 0.0023  81  GLN M CA  
3979 C C   . GLN C 82  ? 0.5436 0.5979 0.5798 -0.0628 -0.0550 -0.0112 81  GLN M C   
3980 O O   . GLN C 82  ? 0.6970 0.7362 0.7285 -0.0629 -0.0537 -0.0142 81  GLN M O   
3981 C CB  . GLN C 82  ? 0.4200 0.4965 0.4835 -0.0716 -0.0655 0.0135  81  GLN M CB  
3982 C CG  . GLN C 82  ? 0.5105 0.5863 0.5634 -0.0916 -0.0748 0.0158  81  GLN M CG  
3983 C CD  . GLN C 82  ? 0.5660 0.6474 0.6219 -0.1081 -0.0820 0.0286  81  GLN M CD  
3984 O OE1 . GLN C 82  ? 0.6007 0.6659 0.6397 -0.1170 -0.0807 0.0256  81  GLN M OE1 
3985 N NE2 . GLN C 82  ? 0.5622 0.6652 0.6384 -0.1130 -0.0914 0.0443  81  GLN M NE2 
3986 N N   . MET C 83  ? 0.5201 0.5791 0.5450 -0.0655 -0.0544 -0.0200 82  MET M N   
3987 C CA  . MET C 83  ? 0.6643 0.7176 0.6753 -0.0644 -0.0482 -0.0367 82  MET M CA  
3988 C C   . MET C 83  ? 0.7196 0.7704 0.7142 -0.0848 -0.0516 -0.0436 82  MET M C   
3989 O O   . MET C 83  ? 0.8497 0.9145 0.8387 -0.1009 -0.0584 -0.0395 82  MET M O   
3990 C CB  . MET C 83  ? 0.6741 0.7445 0.6815 -0.0581 -0.0443 -0.0420 82  MET M CB  
3991 C CG  . MET C 83  ? 0.7467 0.8160 0.7633 -0.0395 -0.0381 -0.0406 82  MET M CG  
3992 S SD  . MET C 83  ? 0.7757 0.8695 0.7836 -0.0378 -0.0357 -0.0420 82  MET M SD  
3993 C CE  . MET C 83  ? 0.3548 0.4431 0.3618 -0.0431 -0.0439 -0.0253 82  MET M CE  
3994 N N   . ASN C 84  A 0.6024 0.6320 0.5859 -0.0869 -0.0484 -0.0538 82  ASN M N   
3995 C CA  . ASN C 84  A 0.5615 0.5828 0.5235 -0.1104 -0.0507 -0.0606 82  ASN M CA  
3996 C C   . ASN C 84  A 0.6274 0.6367 0.5721 -0.1057 -0.0400 -0.0867 82  ASN M C   
3997 O O   . ASN C 84  A 0.6740 0.6734 0.6265 -0.0817 -0.0334 -0.0968 82  ASN M O   
3998 C CB  . ASN C 84  A 0.6390 0.6401 0.5959 -0.1233 -0.0586 -0.0475 82  ASN M CB  
3999 C CG  . ASN C 84  A 0.7760 0.7932 0.7564 -0.1209 -0.0663 -0.0243 82  ASN M CG  
4000 O OD1 . ASN C 84  A 0.7937 0.8334 0.7870 -0.1248 -0.0716 -0.0142 82  ASN M OD1 
4001 N ND2 . ASN C 84  A 0.7477 0.7536 0.7334 -0.1149 -0.0679 -0.0163 82  ASN M ND2 
4002 N N   . SER C 85  B 0.7027 0.7125 0.6245 -0.1291 -0.0386 -0.0979 82  SER M N   
4003 C CA  . SER C 85  B 0.7261 0.7273 0.6308 -0.1241 -0.0256 -0.1274 82  SER M CA  
4004 C C   . SER C 85  B 0.7463 0.7718 0.6701 -0.0953 -0.0156 -0.1397 82  SER M C   
4005 O O   . SER C 85  B 0.7719 0.7806 0.7013 -0.0701 -0.0079 -0.1554 82  SER M O   
4006 C CB  . SER C 85  B 0.7807 0.7328 0.6706 -0.1173 -0.0252 -0.1353 82  SER M CB  
4007 O OG  . SER C 85  B 0.7757 0.7069 0.6513 -0.1422 -0.0374 -0.1156 82  SER M OG  
4008 N N   . LEU C 86  C 0.6858 0.7491 0.6193 -0.0997 -0.0182 -0.1302 82  LEU M N   
4009 C CA  . LEU C 86  C 0.6632 0.7541 0.6129 -0.0771 -0.0109 -0.1360 82  LEU M CA  
4010 C C   . LEU C 86  C 0.6533 0.7666 0.5959 -0.0722 0.0038  -0.1657 82  LEU M C   
4011 O O   . LEU C 86  C 0.7207 0.8398 0.6412 -0.0949 0.0080  -0.1809 82  LEU M O   
4012 C CB  . LEU C 86  C 0.5843 0.7054 0.5368 -0.0883 -0.0194 -0.1180 82  LEU M CB  
4013 C CG  . LEU C 86  C 0.5323 0.6358 0.4975 -0.0849 -0.0308 -0.0922 82  LEU M CG  
4014 C CD1 . LEU C 86  C 0.5443 0.6659 0.5038 -0.1024 -0.0426 -0.0769 82  LEU M CD1 
4015 C CD2 . LEU C 86  C 0.5040 0.6012 0.4878 -0.0576 -0.0264 -0.0876 82  LEU M CD2 
4016 N N   . ARG C 87  ? 0.6051 0.7339 0.5674 -0.0431 0.0120  -0.1739 83  ARG M N   
4017 C CA  . ARG C 87  ? 0.6009 0.7640 0.5644 -0.0334 0.0274  -0.2021 83  ARG M CA  
4018 C C   . ARG C 87  ? 0.6077 0.8242 0.5881 -0.0235 0.0300  -0.1964 83  ARG M C   
4019 O O   . ARG C 87  ? 0.5306 0.7459 0.5216 -0.0190 0.0205  -0.1716 83  ARG M O   
4020 C CB  . ARG C 87  ? 0.6830 0.8111 0.6543 -0.0043 0.0363  -0.2246 83  ARG M CB  
4021 C CG  . ARG C 87  ? 0.7447 0.8182 0.7267 0.0130  0.0249  -0.2081 83  ARG M CG  
4022 C CD  . ARG C 87  ? 0.8822 0.9010 0.8471 0.0188  0.0267  -0.2277 83  ARG M CD  
4023 N NE  . ARG C 87  ? 1.0062 0.9780 0.9848 0.0451  0.0175  -0.2216 83  ARG M NE  
4024 C CZ  . ARG C 87  ? 1.1089 1.0189 1.0675 0.0468  0.0114  -0.2298 83  ARG M CZ  
4025 N NH1 . ARG C 87  ? 1.0873 0.9549 1.0570 0.0679  -0.0010 -0.2217 83  ARG M NH1 
4026 N NH2 . ARG C 87  ? 1.1301 1.0183 1.0535 0.0236  0.0158  -0.2444 83  ARG M NH2 
4027 N N   . ALA C 88  ? 0.4798 0.7829 0.6547 0.0802  0.0646  -0.2474 84  ALA M N   
4028 C CA  . ALA C 88  ? 0.4342 0.7862 0.6457 0.0677  0.0706  -0.2418 84  ALA M CA  
4029 C C   . ALA C 88  ? 0.4442 0.7859 0.6880 0.0710  0.0407  -0.2273 84  ALA M C   
4030 O O   . ALA C 88  ? 0.5912 0.9384 0.8340 0.0523  0.0352  -0.2081 84  ALA M O   
4031 C CB  . ALA C 88  ? 0.3706 0.7826 0.6288 0.0790  0.0939  -0.2680 84  ALA M CB  
4032 N N   . GLU C 89  ? 0.4587 0.7790 0.7253 0.0933  0.0183  -0.2357 85  GLU M N   
4033 C CA  . GLU C 89  ? 0.5189 0.8171 0.8082 0.0947  -0.0147 -0.2230 85  GLU M CA  
4034 C C   . GLU C 89  ? 0.5333 0.7839 0.7733 0.0728  -0.0271 -0.1953 85  GLU M C   
4035 O O   . GLU C 89  ? 0.5803 0.8093 0.8284 0.0673  -0.0517 -0.1814 85  GLU M O   
4036 C CB  . GLU C 89  ? 0.6222 0.8945 0.9316 0.1194  -0.0406 -0.2372 85  GLU M CB  
4037 C CG  . GLU C 89  ? 0.8437 1.1545 1.1926 0.1451  -0.0287 -0.2689 85  GLU M CG  
4038 C CD  . GLU C 89  ? 1.0242 1.3256 1.3282 0.1481  -0.0039 -0.2772 85  GLU M CD  
4039 O OE1 . GLU C 89  ? 1.1079 1.3566 1.3663 0.1464  -0.0154 -0.2663 85  GLU M OE1 
4040 O OE2 . GLU C 89  ? 1.0662 1.4101 1.3793 0.1506  0.0267  -0.2949 85  GLU M OE2 
4041 N N   . ASP C 90  ? 0.4782 0.7089 0.6672 0.0604  -0.0120 -0.1893 86  ASP M N   
4042 C CA  . ASP C 90  ? 0.5317 0.7226 0.6788 0.0405  -0.0211 -0.1683 86  ASP M CA  
4043 C C   . ASP C 90  ? 0.5013 0.7138 0.6426 0.0196  -0.0152 -0.1530 86  ASP M C   
4044 O O   . ASP C 90  ? 0.4787 0.6634 0.5891 0.0033  -0.0235 -0.1366 86  ASP M O   
4045 C CB  . ASP C 90  ? 0.5758 0.7342 0.6791 0.0374  -0.0123 -0.1713 86  ASP M CB  
4046 C CG  . ASP C 90  ? 0.6803 0.8087 0.7835 0.0552  -0.0230 -0.1813 86  ASP M CG  
4047 O OD1 . ASP C 90  ? 0.7292 0.8417 0.8486 0.0613  -0.0447 -0.1782 86  ASP M OD1 
4048 O OD2 . ASP C 90  ? 0.6930 0.8091 0.7773 0.0617  -0.0130 -0.1914 86  ASP M OD2 
4049 N N   . THR C 91  ? 0.4168 0.6797 0.5878 0.0195  -0.0007 -0.1594 87  THR M N   
4050 C CA  . THR C 91  ? 0.4044 0.6900 0.5704 -0.0016 0.0031  -0.1439 87  THR M CA  
4051 C C   . THR C 91  ? 0.4049 0.6778 0.5875 -0.0063 -0.0218 -0.1251 87  THR M C   
4052 O O   . THR C 91  ? 0.4185 0.7016 0.6471 0.0068  -0.0348 -0.1297 87  THR M O   
4053 C CB  . THR C 91  ? 0.4279 0.7732 0.6265 -0.0025 0.0253  -0.1561 87  THR M CB  
4054 O OG1 . THR C 91  ? 0.4988 0.8452 0.6647 -0.0049 0.0480  -0.1701 87  THR M OG1 
4055 C CG2 . THR C 91  ? 0.3484 0.7201 0.5505 -0.0248 0.0242  -0.1375 87  THR M CG2 
4056 N N   . ALA C 92  ? 0.4359 0.6818 0.5807 -0.0245 -0.0315 -0.1054 88  ALA M N   
4057 C CA  . ALA C 92  ? 0.4520 0.6742 0.6017 -0.0298 -0.0565 -0.0866 88  ALA M CA  
4058 C C   . ALA C 92  ? 0.4655 0.6610 0.5685 -0.0497 -0.0637 -0.0678 88  ALA M C   
4059 O O   . ALA C 92  ? 0.4978 0.6891 0.5668 -0.0583 -0.0525 -0.0712 88  ALA M O   
4060 C CB  . ALA C 92  ? 0.3172 0.4964 0.4675 -0.0182 -0.0742 -0.0903 88  ALA M CB  
4061 N N   . VAL C 93  ? 0.5006 0.6739 0.6020 -0.0565 -0.0856 -0.0493 89  VAL M N   
4062 C CA  . VAL C 93  ? 0.5260 0.6619 0.5792 -0.0722 -0.0957 -0.0343 89  VAL M CA  
4063 C C   . VAL C 93  ? 0.5443 0.6291 0.5671 -0.0712 -0.0992 -0.0391 89  VAL M C   
4064 O O   . VAL C 93  ? 0.6408 0.7024 0.6755 -0.0643 -0.1117 -0.0393 89  VAL M O   
4065 C CB  . VAL C 93  ? 0.4834 0.6105 0.5413 -0.0806 -0.1186 -0.0115 89  VAL M CB  
4066 C CG1 . VAL C 93  ? 0.4290 0.5097 0.4341 -0.0944 -0.1302 0.0012  89  VAL M CG1 
4067 C CG2 . VAL C 93  ? 0.4105 0.5877 0.4929 -0.0865 -0.1147 -0.0048 89  VAL M CG2 
4068 N N   . TYR C 94  ? 0.5087 0.5755 0.4938 -0.0794 -0.0899 -0.0443 90  TYR M N   
4069 C CA  . TYR C 94  ? 0.4913 0.5137 0.4472 -0.0826 -0.0888 -0.0501 90  TYR M CA  
4070 C C   . TYR C 94  ? 0.5869 0.5731 0.5034 -0.0991 -0.0981 -0.0386 90  TYR M C   
4071 O O   . TYR C 94  ? 0.6280 0.6215 0.5287 -0.1071 -0.0969 -0.0373 90  TYR M O   
4072 C CB  . TYR C 94  ? 0.4744 0.5008 0.4237 -0.0785 -0.0702 -0.0695 90  TYR M CB  
4073 C CG  . TYR C 94  ? 0.5504 0.5952 0.5290 -0.0612 -0.0628 -0.0820 90  TYR M CG  
4074 C CD1 . TYR C 94  ? 0.5063 0.5943 0.5131 -0.0528 -0.0557 -0.0861 90  TYR M CD1 
4075 C CD2 . TYR C 94  ? 0.5469 0.5653 0.5233 -0.0544 -0.0636 -0.0901 90  TYR M CD2 
4076 C CE1 . TYR C 94  ? 0.5073 0.6127 0.5406 -0.0357 -0.0481 -0.1003 90  TYR M CE1 
4077 C CE2 . TYR C 94  ? 0.5350 0.5685 0.5383 -0.0362 -0.0609 -0.1022 90  TYR M CE2 
4078 C CZ  . TYR C 94  ? 0.4859 0.5636 0.5184 -0.0258 -0.0524 -0.1083 90  TYR M CZ  
4079 O OH  . TYR C 94  ? 0.4673 0.5615 0.5264 -0.0067 -0.0483 -0.1231 90  TYR M OH  
4080 N N   . TYR C 95  ? 0.6346 0.5778 0.5319 -0.1052 -0.1093 -0.0313 91  TYR M N   
4081 C CA  . TYR C 95  ? 0.6796 0.5833 0.5333 -0.1222 -0.1161 -0.0216 91  TYR M CA  
4082 C C   . TYR C 95  ? 0.6616 0.5339 0.4836 -0.1322 -0.1010 -0.0353 91  TYR M C   
4083 O O   . TYR C 95  ? 0.6952 0.5511 0.5186 -0.1303 -0.0987 -0.0414 91  TYR M O   
4084 C CB  . TYR C 95  ? 0.6900 0.5565 0.5338 -0.1277 -0.1415 -0.0018 91  TYR M CB  
4085 C CG  . TYR C 95  ? 0.6679 0.5626 0.5467 -0.1201 -0.1587 0.0132  91  TYR M CG  
4086 C CD1 . TYR C 95  ? 0.6811 0.5859 0.5496 -0.1263 -0.1657 0.0261  91  TYR M CD1 
4087 C CD2 . TYR C 95  ? 0.6446 0.5567 0.5699 -0.1070 -0.1693 0.0132  91  TYR M CD2 
4088 C CE1 . TYR C 95  ? 0.6920 0.6235 0.5935 -0.1218 -0.1815 0.0411  91  TYR M CE1 
4089 C CE2 . TYR C 95  ? 0.6436 0.5862 0.6080 -0.1014 -0.1826 0.0247  91  TYR M CE2 
4090 C CZ  . TYR C 95  ? 0.7067 0.6587 0.6580 -0.1100 -0.1881 0.0401  91  TYR M CZ  
4091 O OH  . TYR C 95  ? 0.7138 0.6975 0.7049 -0.1068 -0.2013 0.0530  91  TYR M OH  
4092 N N   . CYS C 96  ? 0.6295 0.4944 0.4253 -0.1433 -0.0917 -0.0415 92  CYS M N   
4093 C CA  . CYS C 96  ? 0.7733 0.6019 0.5350 -0.1585 -0.0784 -0.0519 92  CYS M CA  
4094 C C   . CYS C 96  ? 0.7554 0.5327 0.4715 -0.1760 -0.0915 -0.0357 92  CYS M C   
4095 O O   . CYS C 96  ? 0.8011 0.5720 0.5056 -0.1780 -0.1071 -0.0210 92  CYS M O   
4096 C CB  . CYS C 96  ? 0.7712 0.6143 0.5319 -0.1626 -0.0588 -0.0737 92  CYS M CB  
4097 S SG  . CYS C 96  ? 1.3653 1.2153 1.1120 -0.1675 -0.0668 -0.0731 92  CYS M SG  
4098 N N   . VAL C 97  ? 0.7447 0.4808 0.4312 -0.1901 -0.0873 -0.0377 93  VAL M N   
4099 C CA  . VAL C 97  ? 0.8579 0.5332 0.4938 -0.2097 -0.1027 -0.0219 93  VAL M CA  
4100 C C   . VAL C 97  ? 0.9465 0.5857 0.5337 -0.2353 -0.0807 -0.0344 93  VAL M C   
4101 O O   . VAL C 97  ? 1.0700 0.7160 0.6654 -0.2382 -0.0641 -0.0489 93  VAL M O   
4102 C CB  . VAL C 97  ? 0.9770 0.6267 0.6216 -0.2054 -0.1286 -0.0090 93  VAL M CB  
4103 C CG1 . VAL C 97  ? 1.1425 0.7275 0.7410 -0.2222 -0.1559 0.0119  93  VAL M CG1 
4104 C CG2 . VAL C 97  ? 0.9565 0.6591 0.6646 -0.1782 -0.1391 -0.0067 93  VAL M CG2 
4105 N N   . ARG C 98  ? 0.8905 0.9073 0.8709 -0.1556 -0.1365 0.0484  94  ARG M N   
4106 C CA  . ARG C 98  ? 0.6093 0.6673 0.6266 -0.1492 -0.1343 0.0495  94  ARG M CA  
4107 C C   . ARG C 98  ? 0.6336 0.7019 0.6337 -0.1413 -0.1100 0.0430  94  ARG M C   
4108 O O   . ARG C 98  ? 0.7123 0.7785 0.7003 -0.1286 -0.0931 0.0316  94  ARG M O   
4109 C CB  . ARG C 98  ? 0.6090 0.7106 0.6885 -0.1313 -0.1387 0.0410  94  ARG M CB  
4110 C CG  . ARG C 98  ? 0.6001 0.7473 0.7210 -0.1265 -0.1370 0.0408  94  ARG M CG  
4111 C CD  . ARG C 98  ? 0.5817 0.7740 0.7664 -0.1089 -0.1385 0.0281  94  ARG M CD  
4112 N NE  . ARG C 98  ? 0.6258 0.8474 0.8169 -0.0897 -0.1146 0.0104  94  ARG M NE  
4113 C CZ  . ARG C 98  ? 0.5546 0.8209 0.7985 -0.0728 -0.1093 -0.0058 94  ARG M CZ  
4114 N NH1 . ARG C 98  ? 0.5180 0.8042 0.8168 -0.0717 -0.1261 -0.0070 94  ARG M NH1 
4115 N NH2 . ARG C 98  ? 0.4715 0.7633 0.7153 -0.0577 -0.0875 -0.0210 94  ARG M NH2 
4116 N N   . GLU C 99  ? 0.6026 0.6816 0.6022 -0.1497 -0.1092 0.0515  95  GLU M N   
4117 C CA  . GLU C 99  ? 0.6802 0.7755 0.6719 -0.1431 -0.0888 0.0483  95  GLU M CA  
4118 C C   . GLU C 99  ? 0.6484 0.8023 0.6893 -0.1257 -0.0816 0.0404  95  GLU M C   
4119 O O   . GLU C 99  ? 0.6720 0.8531 0.7531 -0.1245 -0.0941 0.0413  95  GLU M O   
4120 C CB  . GLU C 99  ? 0.7052 0.7853 0.6750 -0.1611 -0.0915 0.0617  95  GLU M CB  
4121 C CG  . GLU C 99  ? 0.8245 0.8890 0.7633 -0.1622 -0.0729 0.0606  95  GLU M CG  
4122 C CD  . GLU C 99  ? 0.9641 1.0079 0.8819 -0.1813 -0.0767 0.0731  95  GLU M CD  
4123 O OE1 . GLU C 99  ? 1.0041 1.0127 0.8983 -0.1989 -0.0899 0.0785  95  GLU M OE1 
4124 O OE2 . GLU C 99  ? 0.9797 1.0437 0.9050 -0.1796 -0.0666 0.0776  95  GLU M OE2 
4125 N N   . GLY C 100 ? 0.6274 0.8018 0.6669 -0.1132 -0.0615 0.0319  96  GLY M N   
4126 C CA  . GLY C 100 ? 0.5765 0.8089 0.6587 -0.0986 -0.0526 0.0226  96  GLY M CA  
4127 C C   . GLY C 100 ? 0.6381 0.9053 0.7476 -0.1056 -0.0585 0.0309  96  GLY M C   
4128 O O   . GLY C 100 ? 0.6875 0.9333 0.7782 -0.1211 -0.0665 0.0455  96  GLY M O   
4129 N N   . PRO C 101 ? 0.6330 0.9556 0.7880 -0.0947 -0.0536 0.0205  97  PRO M N   
4130 C CA  . PRO C 101 ? 0.5998 0.9601 0.7898 -0.1003 -0.0604 0.0253  97  PRO M CA  
4131 C C   . PRO C 101 ? 0.6241 0.9956 0.7968 -0.1101 -0.0529 0.0386  97  PRO M C   
4132 O O   . PRO C 101 ? 0.6049 0.9917 0.7950 -0.1193 -0.0619 0.0478  97  PRO M O   
4133 C CB  . PRO C 101 ? 0.4782 0.8964 0.7175 -0.0849 -0.0513 0.0057  97  PRO M CB  
4134 C CG  . PRO C 101 ? 0.5107 0.9288 0.7295 -0.0734 -0.0337 -0.0046 97  PRO M CG  
4135 C CD  . PRO C 101 ? 0.5972 0.9521 0.7752 -0.0766 -0.0405 0.0014  97  PRO M CD  
4136 N N   . ARG C 102 ? 0.6031 0.9667 0.7448 -0.1088 -0.0379 0.0408  98  ARG M N   
4137 C CA  . ARG C 102 ? 0.6974 1.0725 0.8273 -0.1188 -0.0323 0.0553  98  ARG M CA  
4138 C C   . ARG C 102 ? 0.7326 1.0593 0.8332 -0.1356 -0.0445 0.0725  98  ARG M C   
4139 O O   . ARG C 102 ? 0.6822 1.0082 0.7698 -0.1447 -0.0407 0.0855  98  ARG M O   
4140 C CB  . ARG C 102 ? 0.7194 1.1033 0.8310 -0.1132 -0.0137 0.0541  98  ARG M CB  
4141 C CG  . ARG C 102 ? 0.7504 1.1919 0.8903 -0.0999 -0.0002 0.0392  98  ARG M CG  
4142 C CD  . ARG C 102 ? 0.8950 1.3401 1.0134 -0.0968 0.0160  0.0415  98  ARG M CD  
4143 N NE  . ARG C 102 ? 0.9928 1.5014 1.1357 -0.0893 0.0295  0.0317  98  ARG M NE  
4144 C CZ  . ARG C 102 ? 1.0295 1.5536 1.1795 -0.0756 0.0395  0.0139  98  ARG M CZ  
4145 N NH1 . ARG C 102 ? 1.0352 1.5150 1.1707 -0.0670 0.0369  0.0051  98  ARG M NH1 
4146 N NH2 . ARG C 102 ? 0.9832 1.5682 1.1545 -0.0714 0.0520  0.0048  98  ARG M NH2 
4147 N N   . ALA C 103 ? 0.8136 1.1017 0.9057 -0.1407 -0.0596 0.0725  99  ALA M N   
4148 C CA  . ALA C 103 ? 0.7671 1.0085 0.8301 -0.1583 -0.0720 0.0864  99  ALA M CA  
4149 C C   . ALA C 103 ? 0.7234 0.9729 0.8105 -0.1673 -0.0909 0.0941  99  ALA M C   
4150 O O   . ALA C 103 ? 0.7867 1.0352 0.8931 -0.1645 -0.1029 0.0887  99  ALA M O   
4151 C CB  . ALA C 103 ? 0.6890 0.8761 0.7163 -0.1614 -0.0751 0.0820  99  ALA M CB  
4152 N N   . THR C 104 ? 0.6751 0.9319 0.7633 -0.1785 -0.0944 0.1076  100 THR M N   
4153 C CA  . THR C 104 ? 0.6933 0.9573 0.8046 -0.1880 -0.1125 0.1164  100 THR M CA  
4154 C C   . THR C 104 ? 0.7380 0.9653 0.8197 -0.2067 -0.1211 0.1321  100 THR M C   
4155 O O   . THR C 104 ? 0.8021 1.0194 0.8612 -0.2107 -0.1104 0.1373  100 THR M O   
4156 C CB  . THR C 104 ? 0.7086 1.0332 0.8639 -0.1825 -0.1086 0.1162  100 THR M CB  
4157 O OG1 . THR C 104 ? 0.7095 1.0746 0.8863 -0.1659 -0.0931 0.1003  100 THR M OG1 
4158 C CG2 . THR C 104 ? 0.7053 1.0419 0.8969 -0.1872 -0.1274 0.1192  100 THR M CG2 
4159 N N   . GLY C 105 A 0.7569 0.9655 0.8418 -0.2187 -0.1410 0.1399  100 GLY M N   
4160 C CA  . GLY C 105 A 0.8462 1.0227 0.9060 -0.2378 -0.1506 0.1541  100 GLY M CA  
4161 C C   . GLY C 105 A 0.9684 1.1079 0.9845 -0.2442 -0.1389 0.1539  100 GLY M C   
4162 O O   . GLY C 105 A 0.9962 1.1002 0.9830 -0.2459 -0.1372 0.1464  100 GLY M O   
4163 N N   . TYR C 106 B 0.9510 1.1003 0.9661 -0.2479 -0.1306 0.1621  100 TYR M N   
4164 C CA  . TYR C 106 B 0.9274 1.0414 0.9086 -0.2561 -0.1210 0.1631  100 TYR M CA  
4165 C C   . TYR C 106 B 0.9371 1.0672 0.9191 -0.2431 -0.1005 0.1574  100 TYR M C   
4166 O O   . TYR C 106 B 1.0179 1.1272 0.9828 -0.2488 -0.0916 0.1600  100 TYR M O   
4167 C CB  . TYR C 106 B 0.9042 1.0126 0.8851 -0.2713 -0.1274 0.1775  100 TYR M CB  
4168 C CG  . TYR C 106 B 0.9825 1.0659 0.9545 -0.2880 -0.1476 0.1840  100 TYR M CG  
4169 C CD1 . TYR C 106 B 0.9396 1.0503 0.9417 -0.2878 -0.1621 0.1912  100 TYR M CD1 
4170 C CD2 . TYR C 106 B 0.9679 1.0017 0.9028 -0.3052 -0.1520 0.1826  100 TYR M CD2 
4171 C CE1 . TYR C 106 B 0.9177 1.0061 0.9130 -0.3038 -0.1816 0.1989  100 TYR M CE1 
4172 C CE2 . TYR C 106 B 0.9318 0.9448 0.8570 -0.3224 -0.1709 0.1894  100 TYR M CE2 
4173 C CZ  . TYR C 106 B 0.9847 1.0246 0.9401 -0.3215 -0.1864 0.1986  100 TYR M CZ  
4174 O OH  . TYR C 106 B 1.1601 1.1795 1.1072 -0.3395 -0.2067 0.2072  100 TYR M OH  
4175 N N   . SER C 107 C 0.8548 1.0226 0.8592 -0.2263 -0.0933 0.1495  100 SER M N   
4176 C CA  . SER C 107 C 0.8352 1.0274 0.8448 -0.2147 -0.0750 0.1464  100 SER M CA  
4177 C C   . SER C 107 C 0.8977 1.0524 0.8773 -0.2117 -0.0636 0.1370  100 SER M C   
4178 O O   . SER C 107 C 0.8557 0.9657 0.8085 -0.2183 -0.0687 0.1307  100 SER M O   
4179 C CB  . SER C 107 C 0.7539 0.9988 0.7956 -0.1988 -0.0701 0.1380  100 SER M CB  
4180 O OG  . SER C 107 C 0.7683 1.0006 0.8069 -0.1898 -0.0720 0.1236  100 SER M OG  
4181 N N   . MET C 108 D 0.9046 1.0796 0.8897 -0.2031 -0.0483 0.1368  100 MET M N   
4182 C CA  . MET C 108 D 0.8418 0.9925 0.8072 -0.1960 -0.0356 0.1265  100 MET M CA  
4183 C C   . MET C 108 D 0.8469 0.9897 0.8071 -0.1864 -0.0386 0.1114  100 MET M C   
4184 O O   . MET C 108 D 0.7865 0.9612 0.7704 -0.1799 -0.0456 0.1085  100 MET M O   
4185 C CB  . MET C 108 D 0.7676 0.9574 0.7495 -0.1856 -0.0210 0.1290  100 MET M CB  
4186 C CG  . MET C 108 D 0.7971 0.9863 0.7819 -0.1948 -0.0162 0.1443  100 MET M CG  
4187 S SD  . MET C 108 D 1.0940 1.2258 1.0527 -0.1996 -0.0064 0.1402  100 MET M SD  
4188 C CE  . MET C 108 D 0.9057 0.9895 0.8465 -0.2192 -0.0190 0.1429  100 MET M CE  
4189 N N   . ALA C 109 E 0.8251 0.9265 0.7577 -0.1858 -0.0333 0.1015  100 ALA M N   
4190 C CA  . ALA C 109 E 0.7729 0.8627 0.6990 -0.1779 -0.0368 0.0885  100 ALA M CA  
4191 C C   . ALA C 109 E 0.7394 0.8681 0.6871 -0.1579 -0.0265 0.0787  100 ALA M C   
4192 O O   . ALA C 109 E 0.7018 0.8619 0.6626 -0.1511 -0.0146 0.0812  100 ALA M O   
4193 C CB  . ALA C 109 E 0.7904 0.8253 0.6792 -0.1850 -0.0335 0.0810  100 ALA M CB  
4194 N N   . ASP C 110 F 0.6980 0.8258 0.6509 -0.1498 -0.0321 0.0680  100 ASP M N   
4195 C CA  . ASP C 110 F 0.6059 0.7616 0.5755 -0.1310 -0.0220 0.0551  100 ASP M CA  
4196 C C   . ASP C 110 F 0.6813 0.7942 0.6246 -0.1281 -0.0208 0.0448  100 ASP M C   
4197 O O   . ASP C 110 F 0.6826 0.7498 0.5965 -0.1418 -0.0278 0.0478  100 ASP M O   
4198 C CB  . ASP C 110 F 0.5841 0.7843 0.5939 -0.1229 -0.0301 0.0503  100 ASP M CB  
4199 C CG  . ASP C 110 F 0.7255 0.9718 0.7607 -0.1048 -0.0164 0.0377  100 ASP M CG  
4200 O OD1 . ASP C 110 F 0.7250 1.0173 0.7986 -0.0987 -0.0193 0.0321  100 ASP M OD1 
4201 O OD2 . ASP C 110 F 0.7449 0.9822 0.7629 -0.0975 -0.0025 0.0324  100 ASP M OD2 
4202 N N   . VAL C 111 G 0.6576 0.7860 0.6108 -0.1114 -0.0117 0.0321  100 VAL M N   
4203 C CA  . VAL C 111 G 0.6347 0.7245 0.5639 -0.1077 -0.0095 0.0225  100 VAL M CA  
4204 C C   . VAL C 111 G 0.6662 0.7440 0.6015 -0.1106 -0.0268 0.0204  100 VAL M C   
4205 O O   . VAL C 111 G 0.6612 0.7668 0.6270 -0.1112 -0.0391 0.0239  100 VAL M O   
4206 C CB  . VAL C 111 G 0.6129 0.7236 0.5523 -0.0885 0.0054  0.0100  100 VAL M CB  
4207 C CG1 . VAL C 111 G 0.6305 0.7474 0.5611 -0.0875 0.0215  0.0139  100 VAL M CG1 
4208 C CG2 . VAL C 111 G 0.5611 0.7265 0.5444 -0.0755 0.0030  0.0030  100 VAL M CG2 
4209 N N   . PHE C 112 H 0.6665 0.7034 0.5744 -0.1129 -0.0281 0.0150  100 PHE M N   
4210 C CA  . PHE C 112 H 0.6238 0.6456 0.5347 -0.1170 -0.0453 0.0146  100 PHE M CA  
4211 C C   . PHE C 112 H 0.6391 0.6878 0.5819 -0.0967 -0.0436 0.0025  100 PHE M C   
4212 O O   . PHE C 112 H 0.6588 0.6908 0.5870 -0.0878 -0.0344 -0.0070 100 PHE M O   
4213 C CB  . PHE C 112 H 0.6406 0.6076 0.5051 -0.1313 -0.0467 0.0146  100 PHE M CB  
4214 C CG  . PHE C 112 H 0.7734 0.7123 0.6084 -0.1539 -0.0508 0.0246  100 PHE M CG  
4215 C CD1 . PHE C 112 H 0.7688 0.6652 0.5622 -0.1654 -0.0413 0.0208  100 PHE M CD1 
4216 C CD2 . PHE C 112 H 0.8059 0.7615 0.6571 -0.1638 -0.0635 0.0364  100 PHE M CD2 
4217 C CE1 . PHE C 112 H 0.7397 0.6118 0.5093 -0.1865 -0.0444 0.0276  100 PHE M CE1 
4218 C CE2 . PHE C 112 H 0.8003 0.7306 0.6259 -0.1844 -0.0673 0.0448  100 PHE M CE2 
4219 C CZ  . PHE C 112 H 0.7791 0.6678 0.5640 -0.1959 -0.0576 0.0398  100 PHE M CZ  
4220 N N   . ASP C 113 ? 0.6079 0.6986 0.5967 -0.0894 -0.0520 0.0017  101 ASP M N   
4221 C CA  . ASP C 113 ? 0.6638 0.7893 0.6907 -0.0688 -0.0469 -0.0127 101 ASP M CA  
4222 C C   . ASP C 113 ? 0.6536 0.7706 0.7015 -0.0658 -0.0632 -0.0159 101 ASP M C   
4223 O O   . ASP C 113 ? 0.6696 0.8032 0.7408 -0.0490 -0.0578 -0.0291 101 ASP M O   
4224 C CB  . ASP C 113 ? 0.6144 0.7984 0.6857 -0.0601 -0.0420 -0.0170 101 ASP M CB  
4225 C CG  . ASP C 113 ? 0.7146 0.9147 0.8184 -0.0691 -0.0609 -0.0089 101 ASP M CG  
4226 O OD1 . ASP C 113 ? 0.7888 0.9531 0.8741 -0.0850 -0.0777 0.0038  101 ASP M OD1 
4227 O OD2 . ASP C 113 ? 0.7155 0.9652 0.8641 -0.0612 -0.0589 -0.0156 101 ASP M OD2 
4228 N N   . ILE C 114 ? 0.5370 0.6297 0.5788 -0.0828 -0.0838 -0.0029 102 ILE M N   
4229 C CA  . ILE C 114 ? 0.6018 0.6827 0.6614 -0.0838 -0.1023 -0.0014 102 ILE M CA  
4230 C C   . ILE C 114 ? 0.7539 0.7820 0.7641 -0.1057 -0.1141 0.0113  102 ILE M C   
4231 O O   . ILE C 114 ? 0.7898 0.8018 0.7766 -0.1244 -0.1209 0.0235  102 ILE M O   
4232 C CB  . ILE C 114 ? 0.6465 0.7581 0.7609 -0.0856 -0.1216 0.0039  102 ILE M CB  
4233 C CG1 . ILE C 114 ? 0.6510 0.8191 0.8148 -0.0678 -0.1092 -0.0098 102 ILE M CG1 
4234 C CG2 . ILE C 114 ? 0.5373 0.6390 0.6773 -0.0862 -0.1418 0.0067  102 ILE M CG2 
4235 C CD1 . ILE C 114 ? 0.6264 0.8175 0.8182 -0.0460 -0.0977 -0.0288 102 ILE M CD1 
4236 N N   . TRP C 115 ? 0.7242 0.6967 0.7323 -0.0090 -0.0424 -0.1025 103 TRP M N   
4237 C CA  . TRP C 115 ? 0.6360 0.5944 0.6505 -0.0225 -0.0446 -0.0946 103 TRP M CA  
4238 C C   . TRP C 115 ? 0.6295 0.5789 0.6453 -0.0051 -0.0524 -0.0955 103 TRP M C   
4239 O O   . TRP C 115 ? 0.6587 0.5847 0.6670 0.0146  -0.0601 -0.1027 103 TRP M O   
4240 C CB  . TRP C 115 ? 0.5511 0.4665 0.5625 -0.0384 -0.0461 -0.0915 103 TRP M CB  
4241 C CG  . TRP C 115 ? 0.5972 0.5171 0.6078 -0.0562 -0.0390 -0.0897 103 TRP M CG  
4242 C CD1 . TRP C 115 ? 0.4664 0.3971 0.4738 -0.0534 -0.0356 -0.0946 103 TRP M CD1 
4243 C CD2 . TRP C 115 ? 0.5398 0.4530 0.5524 -0.0789 -0.0353 -0.0826 103 TRP M CD2 
4244 N NE1 . TRP C 115 ? 0.5161 0.4478 0.5257 -0.0747 -0.0300 -0.0896 103 TRP M NE1 
4245 C CE2 . TRP C 115 ? 0.5037 0.4227 0.5154 -0.0898 -0.0300 -0.0828 103 TRP M CE2 
4246 C CE3 . TRP C 115 ? 0.5674 0.4702 0.5808 -0.0894 -0.0363 -0.0765 103 TRP M CE3 
4247 C CZ2 . TRP C 115 ? 0.4836 0.3953 0.4952 -0.1107 -0.0266 -0.0772 103 TRP M CZ2 
4248 C CZ3 . TRP C 115 ? 0.6329 0.5279 0.6435 -0.1083 -0.0327 -0.0724 103 TRP M CZ3 
4249 C CH2 . TRP C 115 ? 0.5438 0.4414 0.5535 -0.1187 -0.0283 -0.0728 103 TRP M CH2 
4250 N N   . GLY C 116 ? 0.5878 0.5533 0.6121 -0.0127 -0.0519 -0.0879 104 GLY M N   
4251 C CA  . GLY C 116 ? 0.5887 0.5406 0.6162 -0.0010 -0.0599 -0.0861 104 GLY M CA  
4252 C C   . GLY C 116 ? 0.6191 0.5239 0.6446 -0.0083 -0.0671 -0.0827 104 GLY M C   
4253 O O   . GLY C 116 ? 0.6393 0.5259 0.6607 -0.0227 -0.0641 -0.0812 104 GLY M O   
4254 N N   . GLN C 117 ? 0.6203 0.5083 0.6496 0.0013  -0.0770 -0.0792 105 GLN M N   
4255 C CA  . GLN C 117 ? 0.6461 0.4952 0.6756 -0.0054 -0.0858 -0.0718 105 GLN M CA  
4256 C C   . GLN C 117 ? 0.6859 0.5411 0.7211 -0.0247 -0.0810 -0.0610 105 GLN M C   
4257 O O   . GLN C 117 ? 0.7437 0.5745 0.7787 -0.0326 -0.0853 -0.0526 105 GLN M O   
4258 C CB  . GLN C 117 ? 0.7097 0.5419 0.7430 0.0108  -0.1002 -0.0696 105 GLN M CB  
4259 C CG  . GLN C 117 ? 0.9988 0.8517 1.0307 0.0333  -0.1010 -0.0790 105 GLN M CG  
4260 C CD  . GLN C 117 ? 1.0825 0.9817 1.1250 0.0313  -0.0924 -0.0747 105 GLN M CD  
4261 O OE1 . GLN C 117 ? 1.0394 0.9740 1.0806 0.0385  -0.0840 -0.0799 105 GLN M OE1 
4262 N NE2 . GLN C 117 ? 1.0485 0.9500 1.1015 0.0215  -0.0952 -0.0636 105 GLN M NE2 
4263 N N   . GLY C 118 ? 0.6199 0.5084 0.6588 -0.0317 -0.0730 -0.0604 106 GLY M N   
4264 C CA  . GLY C 118 ? 0.5691 0.4615 0.6092 -0.0474 -0.0697 -0.0524 106 GLY M CA  
4265 C C   . GLY C 118 ? 0.5902 0.4929 0.6391 -0.0443 -0.0751 -0.0442 106 GLY M C   
4266 O O   . GLY C 118 ? 0.5983 0.4931 0.6541 -0.0315 -0.0844 -0.0413 106 GLY M O   
4267 N N   . THR C 119 ? 0.5840 0.5030 0.6316 -0.0564 -0.0704 -0.0406 107 THR M N   
4268 C CA  . THR C 119 ? 0.6442 0.5781 0.6989 -0.0564 -0.0739 -0.0327 107 THR M CA  
4269 C C   . THR C 119 ? 0.6643 0.5915 0.7107 -0.0685 -0.0710 -0.0277 107 THR M C   
4270 O O   . THR C 119 ? 0.6165 0.5439 0.6514 -0.0796 -0.0649 -0.0329 107 THR M O   
4271 C CB  . THR C 119 ? 0.7122 0.6811 0.7698 -0.0582 -0.0707 -0.0349 107 THR M CB  
4272 O OG1 . THR C 119 ? 0.8456 0.8268 0.9106 -0.0431 -0.0728 -0.0383 107 THR M OG1 
4273 C CG2 . THR C 119 ? 0.7562 0.7401 0.8192 -0.0609 -0.0738 -0.0266 107 THR M CG2 
4274 N N   . MET C 120 ? 0.6168 0.5386 0.6683 -0.0657 -0.0764 -0.0170 108 MET M N   
4275 C CA  . MET C 120 ? 0.5372 0.4579 0.5796 -0.0728 -0.0735 -0.0115 108 MET M CA  
4276 C C   . MET C 120 ? 0.5455 0.4912 0.5846 -0.0776 -0.0721 -0.0127 108 MET M C   
4277 O O   . MET C 120 ? 0.6258 0.5915 0.6770 -0.0732 -0.0764 -0.0084 108 MET M O   
4278 C CB  . MET C 120 ? 0.5968 0.5094 0.6471 -0.0675 -0.0804 0.0037  108 MET M CB  
4279 C CG  . MET C 120 ? 0.6284 0.5438 0.6687 -0.0706 -0.0771 0.0119  108 MET M CG  
4280 S SD  . MET C 120 ? 0.7556 0.6494 0.7752 -0.0771 -0.0674 0.0036  108 MET M SD  
4281 C CE  . MET C 120 ? 0.7324 0.6355 0.7381 -0.0745 -0.0642 0.0125  108 MET M CE  
4282 N N   . VAL C 121 ? 0.5479 0.4910 0.5697 -0.0870 -0.0672 -0.0188 109 VAL M N   
4283 C CA  . VAL C 121 ? 0.5586 0.5194 0.5726 -0.0924 -0.0681 -0.0195 109 VAL M CA  
4284 C C   . VAL C 121 ? 0.5346 0.4865 0.5323 -0.0916 -0.0670 -0.0168 109 VAL M C   
4285 O O   . VAL C 121 ? 0.5576 0.4883 0.5406 -0.0934 -0.0633 -0.0209 109 VAL M O   
4286 C CB  . VAL C 121 ? 0.5528 0.5193 0.5571 -0.1044 -0.0671 -0.0290 109 VAL M CB  
4287 C CG1 . VAL C 121 ? 0.4582 0.4379 0.4513 -0.1111 -0.0706 -0.0291 109 VAL M CG1 
4288 C CG2 . VAL C 121 ? 0.5258 0.5107 0.5459 -0.1026 -0.0675 -0.0296 109 VAL M CG2 
4289 N N   . THR C 122 ? 0.5899 0.5604 0.5902 -0.0874 -0.0701 -0.0092 110 THR M N   
4290 C CA  . THR C 122 ? 0.5932 0.5627 0.5784 -0.0823 -0.0691 -0.0049 110 THR M CA  
4291 C C   . THR C 122 ? 0.5801 0.5635 0.5501 -0.0858 -0.0716 -0.0098 110 THR M C   
4292 O O   . THR C 122 ? 0.6839 0.6929 0.6664 -0.0851 -0.0753 -0.0035 110 THR M O   
4293 C CB  . THR C 122 ? 0.6243 0.6077 0.6267 -0.0722 -0.0719 0.0129  110 THR M CB  
4294 O OG1 . THR C 122 ? 0.6922 0.6595 0.7075 -0.0703 -0.0725 0.0183  110 THR M OG1 
4295 C CG2 . THR C 122 ? 0.5765 0.5649 0.5626 -0.0647 -0.0697 0.0190  110 THR M CG2 
4296 N N   . VAL C 123 ? 0.5699 0.5345 0.5120 -0.0895 -0.0707 -0.0209 111 VAL M N   
4297 C CA  . VAL C 123 ? 0.5980 0.5678 0.5190 -0.0930 -0.0753 -0.0275 111 VAL M CA  
4298 C C   . VAL C 123 ? 0.6388 0.6173 0.5468 -0.0786 -0.0742 -0.0218 111 VAL M C   
4299 O O   . VAL C 123 ? 0.7189 0.6806 0.6107 -0.0697 -0.0702 -0.0231 111 VAL M O   
4300 C CB  . VAL C 123 ? 0.6419 0.5818 0.5362 -0.1041 -0.0782 -0.0427 111 VAL M CB  
4301 C CG1 . VAL C 123 ? 0.6109 0.5531 0.4842 -0.1118 -0.0869 -0.0496 111 VAL M CG1 
4302 C CG2 . VAL C 123 ? 0.5217 0.4568 0.4315 -0.1162 -0.0776 -0.0449 111 VAL M CG2 
4303 N N   . SER C 124 ? 0.6182 0.6266 0.5339 -0.0754 -0.0774 -0.0141 112 SER M N   
4304 C CA  . SER C 124 ? 0.5864 0.6138 0.4949 -0.0604 -0.0763 -0.0049 112 SER M CA  
4305 C C   . SER C 124 ? 0.6704 0.7287 0.5794 -0.0606 -0.0814 -0.0015 112 SER M C   
4306 O O   . SER C 124 ? 0.7078 0.7814 0.6364 -0.0709 -0.0849 0.0011  112 SER M O   
4307 C CB  . SER C 124 ? 0.5688 0.6109 0.5050 -0.0521 -0.0733 0.0141  112 SER M CB  
4308 O OG  . SER C 124 ? 0.6138 0.6896 0.5555 -0.0405 -0.0743 0.0299  112 SER M OG  
4309 N N   . SER C 125 ? 0.6066 0.6764 0.4936 -0.0479 -0.0815 -0.0008 113 SER M N   
4310 C CA  . SER C 125 ? 0.5654 0.6671 0.4510 -0.0465 -0.0861 0.0032  113 SER M CA  
4311 C C   . SER C 125 ? 0.5435 0.6882 0.4639 -0.0398 -0.0854 0.0267  113 SER M C   
4312 O O   . SER C 125 ? 0.5822 0.7595 0.5105 -0.0402 -0.0892 0.0338  113 SER M O   
4313 C CB  . SER C 125 ? 0.6284 0.7251 0.4722 -0.0330 -0.0873 -0.0070 113 SER M CB  
4314 O OG  . SER C 125 ? 0.6603 0.7750 0.5027 -0.0129 -0.0813 0.0055  113 SER M OG  
4315 N N   . ALA C 126 ? 0.5194 0.6638 0.4601 -0.0347 -0.0821 0.0399  114 ALA M N   
4316 C CA  . ALA C 126 ? 0.5621 0.7442 0.5344 -0.0286 -0.0842 0.0652  114 ALA M CA  
4317 C C   . ALA C 126 ? 0.5725 0.7631 0.5798 -0.0401 -0.0895 0.0723  114 ALA M C   
4318 O O   . ALA C 126 ? 0.6728 0.8368 0.6854 -0.0494 -0.0893 0.0619  114 ALA M O   
4319 C CB  . ALA C 126 ? 0.5666 0.7437 0.5458 -0.0200 -0.0812 0.0789  114 ALA M CB  
4320 N N   . SER C 127 ? 0.5327 0.7622 0.5640 -0.0380 -0.0947 0.0910  115 SER M N   
4321 C CA  . SER C 127 ? 0.6309 0.8680 0.6960 -0.0461 -0.1008 0.0994  115 SER M CA  
4322 C C   . SER C 127 ? 0.6523 0.8749 0.7399 -0.0444 -0.1045 0.1127  115 SER M C   
4323 O O   . SER C 127 ? 0.6281 0.8483 0.7107 -0.0378 -0.1032 0.1220  115 SER M O   
4324 C CB  . SER C 127 ? 0.6609 0.9434 0.7449 -0.0455 -0.1063 0.1154  115 SER M CB  
4325 O OG  . SER C 127 ? 0.7701 1.0795 0.8748 -0.0383 -0.1113 0.1409  115 SER M OG  
4326 N N   . THR C 128 ? 0.6396 0.8519 0.7502 -0.0498 -0.1098 0.1135  116 THR M N   
4327 C CA  . THR C 128 ? 0.5953 0.7856 0.7233 -0.0489 -0.1157 0.1225  116 THR M CA  
4328 C C   . THR C 128 ? 0.5467 0.7638 0.7005 -0.0456 -0.1266 0.1516  116 THR M C   
4329 O O   . THR C 128 ? 0.5278 0.7817 0.6948 -0.0451 -0.1308 0.1641  116 THR M O   
4330 C CB  . THR C 128 ? 0.6304 0.8012 0.7715 -0.0524 -0.1190 0.1128  116 THR M CB  
4331 O OG1 . THR C 128 ? 0.7283 0.8748 0.8842 -0.0503 -0.1272 0.1211  116 THR M OG1 
4332 C CG2 . THR C 128 ? 0.5431 0.7438 0.7047 -0.0533 -0.1247 0.1206  116 THR M CG2 
4333 N N   . LYS C 129 ? 0.5208 0.7211 0.6824 -0.0446 -0.1325 0.1641  117 LYS M N   
4334 C CA  . LYS C 129 ? 0.6201 0.8438 0.8079 -0.0441 -0.1463 0.1956  117 LYS M CA  
4335 C C   . LYS C 129 ? 0.6445 0.8334 0.8478 -0.0475 -0.1592 0.2036  117 LYS M C   
4336 O O   . LYS C 129 ? 0.5722 0.7298 0.7616 -0.0479 -0.1553 0.1957  117 LYS M O   
4337 C CB  . LYS C 129 ? 0.6218 0.8738 0.7994 -0.0386 -0.1420 0.2118  117 LYS M CB  
4338 C CG  . LYS C 129 ? 0.6010 0.8934 0.8070 -0.0388 -0.1561 0.2479  117 LYS M CG  
4339 C CD  . LYS C 129 ? 0.7449 1.0670 0.9414 -0.0317 -0.1519 0.2668  117 LYS M CD  
4340 C CE  . LYS C 129 ? 0.8838 1.2456 1.1136 -0.0348 -0.1693 0.3078  117 LYS M CE  
4341 N NZ  . LYS C 129 ? 0.9538 1.3489 1.2054 -0.0371 -0.1767 0.3158  117 LYS M NZ  
4342 N N   . GLY C 130 ? 0.5710 0.7641 0.8024 -0.0497 -0.1758 0.2196  118 GLY M N   
4343 C CA  . GLY C 130 ? 0.5728 0.7282 0.8168 -0.0522 -0.1919 0.2268  118 GLY M CA  
4344 C C   . GLY C 130 ? 0.6322 0.7964 0.8882 -0.0564 -0.2052 0.2583  118 GLY M C   
4345 O O   . GLY C 130 ? 0.7114 0.9213 0.9778 -0.0568 -0.2070 0.2820  118 GLY M O   
4346 N N   . PRO C 131 ? 0.6458 0.7686 0.9006 -0.0598 -0.2154 0.2602  119 PRO M N   
4347 C CA  . PRO C 131 ? 0.6215 0.7499 0.8848 -0.0659 -0.2279 0.2909  119 PRO M CA  
4348 C C   . PRO C 131 ? 0.6440 0.7943 0.9396 -0.0721 -0.2531 0.3267  119 PRO M C   
4349 O O   . PRO C 131 ? 0.6390 0.7831 0.9506 -0.0717 -0.2649 0.3252  119 PRO M O   
4350 C CB  . PRO C 131 ? 0.6147 0.6856 0.8680 -0.0688 -0.2346 0.2794  119 PRO M CB  
4351 C CG  . PRO C 131 ? 0.6297 0.6684 0.8818 -0.0638 -0.2368 0.2535  119 PRO M CG  
4352 C CD  . PRO C 131 ? 0.6517 0.7223 0.8979 -0.0578 -0.2177 0.2357  119 PRO M CD  
4353 N N   . SER C 132 ? 0.6641 0.8421 0.9696 -0.0778 -0.2618 0.3606  120 SER M N   
4354 C CA  . SER C 132 ? 0.7752 0.9623 1.1115 -0.0880 -0.2917 0.3993  120 SER M CA  
4355 C C   . SER C 132 ? 0.8101 0.9455 1.1423 -0.0963 -0.3083 0.4052  120 SER M C   
4356 O O   . SER C 132 ? 0.8403 0.9688 1.1541 -0.0963 -0.2963 0.4015  120 SER M O   
4357 C CB  . SER C 132 ? 0.7729 1.0291 1.1244 -0.0901 -0.2932 0.4378  120 SER M CB  
4358 O OG  . SER C 132 ? 0.8001 1.1037 1.1479 -0.0805 -0.2743 0.4282  120 SER M OG  
4359 N N   . VAL C 133 ? 0.7963 0.8933 1.1440 -0.1027 -0.3365 0.4135  121 VAL M N   
4360 C CA  . VAL C 133 ? 0.8315 0.8742 1.1741 -0.1112 -0.3568 0.4192  121 VAL M CA  
4361 C C   . VAL C 133 ? 0.9313 0.9905 1.3007 -0.1271 -0.3892 0.4697  121 VAL M C   
4362 O O   . VAL C 133 ? 0.9922 1.0450 1.3845 -0.1325 -0.4161 0.4873  121 VAL M O   
4363 C CB  . VAL C 133 ? 0.8221 0.8003 1.1577 -0.1057 -0.3691 0.3909  121 VAL M CB  
4364 C CG1 . VAL C 133 ? 0.8623 0.7806 1.1871 -0.1132 -0.3897 0.3934  121 VAL M CG1 
4365 C CG2 . VAL C 133 ? 0.8027 0.7733 1.1154 -0.0908 -0.3384 0.3455  121 VAL M CG2 
4366 N N   . PHE C 134 ? 0.8776 0.9596 1.2451 -0.1350 -0.3877 0.4950  122 PHE M N   
4367 C CA  . PHE C 134 ? 0.8716 0.9730 1.2648 -0.1522 -0.4195 0.5472  122 PHE M CA  
4368 C C   . PHE C 134 ? 0.9441 0.9831 1.3293 -0.1650 -0.4439 0.5540  122 PHE M C   
4369 O O   . PHE C 134 ? 0.8391 0.8455 1.1982 -0.1613 -0.4278 0.5291  122 PHE M O   
4370 C CB  . PHE C 134 ? 0.8544 1.0320 1.2542 -0.1531 -0.4058 0.5802  122 PHE M CB  
4371 C CG  . PHE C 134 ? 0.7932 1.0334 1.1947 -0.1390 -0.3801 0.5725  122 PHE M CG  
4372 C CD1 . PHE C 134 ? 0.7664 1.0349 1.1433 -0.1249 -0.3452 0.5529  122 PHE M CD1 
4373 C CD2 . PHE C 134 ? 0.7830 1.0524 1.2096 -0.1398 -0.3921 0.5852  122 PHE M CD2 
4374 C CE1 . PHE C 134 ? 0.7763 1.0982 1.1508 -0.1115 -0.3236 0.5446  122 PHE M CE1 
4375 C CE2 . PHE C 134 ? 0.7754 1.1024 1.2019 -0.1272 -0.3691 0.5780  122 PHE M CE2 
4376 C CZ  . PHE C 134 ? 0.7597 1.1117 1.1588 -0.1129 -0.3352 0.5570  122 PHE M CZ  
4377 N N   . PRO C 135 ? 1.0617 1.0853 1.4698 -0.1814 -0.4846 0.5904  123 PRO M N   
4378 C CA  . PRO C 135 ? 1.0590 1.0212 1.4593 -0.1959 -0.5133 0.6008  123 PRO M CA  
4379 C C   . PRO C 135 ? 1.0058 1.0000 1.4029 -0.2062 -0.5069 0.6298  123 PRO M C   
4380 O O   . PRO C 135 ? 0.9675 1.0377 1.3782 -0.2057 -0.4929 0.6577  123 PRO M O   
4381 C CB  . PRO C 135 ? 1.0125 0.9644 1.4423 -0.2122 -0.5599 0.6400  123 PRO M CB  
4382 C CG  . PRO C 135 ? 0.9666 1.0032 1.4255 -0.2119 -0.5531 0.6697  123 PRO M CG  
4383 C CD  . PRO C 135 ? 0.9734 1.0437 1.4169 -0.1896 -0.5069 0.6298  123 PRO M CD  
4384 N N   . LEU C 136 ? 1.0167 0.9548 1.3944 -0.2137 -0.5161 0.6222  124 LEU M N   
4385 C CA  . LEU C 136 ? 1.0404 1.0002 1.4188 -0.2284 -0.5208 0.6583  124 LEU M CA  
4386 C C   . LEU C 136 ? 1.1353 1.0435 1.5235 -0.2518 -0.5712 0.6899  124 LEU M C   
4387 O O   . LEU C 136 ? 1.1746 1.0059 1.5411 -0.2542 -0.5844 0.6655  124 LEU M O   
4388 C CB  . LEU C 136 ? 1.0344 0.9738 1.3807 -0.2191 -0.4884 0.6241  124 LEU M CB  
4389 C CG  . LEU C 136 ? 0.9581 0.9519 1.2927 -0.1993 -0.4410 0.6015  124 LEU M CG  
4390 C CD1 . LEU C 136 ? 0.9024 0.8502 1.2043 -0.1875 -0.4140 0.5509  124 LEU M CD1 
4391 C CD2 . LEU C 136 ? 0.9545 1.0214 1.2983 -0.2027 -0.4307 0.6432  124 LEU M CD2 
4392 N N   . ALA C 137 ? 1.1765 1.1316 1.6004 -0.2710 -0.5983 0.7404  125 ALA M N   
4393 C CA  . ALA C 137 ? 1.1878 1.1044 1.6309 -0.2987 -0.6497 0.7713  125 ALA M CA  
4394 C C   . ALA C 137 ? 1.2879 1.1581 1.7170 -0.3176 -0.6671 0.7755  125 ALA M C   
4395 O O   . ALA C 137 ? 1.2955 1.2156 1.7309 -0.3282 -0.6527 0.7966  125 ALA M O   
4396 C CB  . ALA C 137 ? 1.1340 1.1303 1.6228 -0.3195 -0.6674 0.8273  125 ALA M CB  
4397 N N   . PRO C 138 ? 1.4066 1.1813 1.8159 -0.3207 -0.6989 0.7554  126 PRO M N   
4398 C CA  . PRO C 138 ? 1.4664 1.1822 1.8592 -0.3390 -0.7241 0.7564  126 PRO M CA  
4399 C C   . PRO C 138 ? 1.4943 1.2335 1.9206 -0.3765 -0.7689 0.8146  126 PRO M C   
4400 O O   . PRO C 138 ? 1.6037 1.2813 2.0325 -0.3913 -0.8175 0.8254  126 PRO M O   
4401 C CB  . PRO C 138 ? 1.5205 1.1306 1.8847 -0.3261 -0.7483 0.7185  126 PRO M CB  
4402 C CG  . PRO C 138 ? 1.5420 1.1649 1.9261 -0.3161 -0.7574 0.7238  126 PRO M CG  
4403 C CD  . PRO C 138 ? 1.4614 1.1753 1.8580 -0.3009 -0.7090 0.7236  126 PRO M CD  
4404 N N   . SER C 139 ? 2.0667 2.0239 2.0135 -0.0268 -0.5063 0.3637  127 SER M N   
4405 C CA  . SER C 139 ? 1.9982 1.9327 1.9214 -0.0098 -0.4961 0.3739  127 SER M CA  
4406 C C   . SER C 139 ? 1.9567 1.9329 1.8852 -0.0324 -0.4742 0.3796  127 SER M C   
4407 O O   . SER C 139 ? 1.9280 1.9532 1.8725 -0.0637 -0.4660 0.3757  127 SER M O   
4408 C CB  . SER C 139 ? 1.9845 1.8708 1.8644 0.0127  -0.5038 0.3982  127 SER M CB  
4409 O OG  . SER C 139 ? 1.9734 1.8707 1.8502 -0.0031 -0.5069 0.4149  127 SER M OG  
4410 N N   . SER C 140 ? 1.9385 1.8964 1.8524 -0.0182 -0.4660 0.3904  128 SER M N   
4411 C CA  . SER C 140 ? 1.8743 1.8591 1.7858 -0.0360 -0.4492 0.4039  128 SER M CA  
4412 C C   . SER C 140 ? 1.8660 1.8409 1.7531 -0.0419 -0.4508 0.4340  128 SER M C   
4413 O O   . SER C 140 ? 1.8371 1.8346 1.7232 -0.0626 -0.4420 0.4507  128 SER M O   
4414 C CB  . SER C 140 ? 1.7975 1.7624 1.7057 -0.0178 -0.4434 0.4107  128 SER M CB  
4415 O OG  . SER C 140 ? 1.7549 1.6710 1.6362 0.0123  -0.4522 0.4242  128 SER M OG  
4416 N N   . LYS C 141 ? 1.8811 1.8206 1.7528 -0.0237 -0.4656 0.4394  129 LYS M N   
4417 C CA  . LYS C 141 ? 1.9080 1.8314 1.7668 -0.0235 -0.4733 0.4627  129 LYS M CA  
4418 C C   . LYS C 141 ? 2.0177 1.9724 1.8962 -0.0556 -0.4851 0.4667  129 LYS M C   
4419 O O   . LYS C 141 ? 2.0325 1.9754 1.9127 -0.0597 -0.4998 0.4855  129 LYS M O   
4420 C CB  . LYS C 141 ? 1.8220 1.6946 1.6571 0.0116  -0.4858 0.4608  129 LYS M CB  
4421 C CG  . LYS C 141 ? 1.7975 1.6453 1.6137 0.0300  -0.4807 0.4790  129 LYS M CG  
4422 C CD  . LYS C 141 ? 1.8232 1.6276 1.6138 0.0621  -0.4935 0.4700  129 LYS M CD  
4423 C CE  . LYS C 141 ? 1.8425 1.6285 1.6088 0.0863  -0.4788 0.4792  129 LYS M CE  
4424 N NZ  . LYS C 141 ? 1.5971 1.4024 1.3861 0.0723  -0.4683 0.4996  129 LYS M NZ  
4425 N N   . SER C 142 ? 2.0505 2.0482 1.9487 -0.0793 -0.4796 0.4485  130 SER M N   
4426 C CA  . SER C 142 ? 2.0383 2.0780 1.9548 -0.1154 -0.4877 0.4528  130 SER M CA  
4427 C C   . SER C 142 ? 2.0726 2.1765 2.0001 -0.1519 -0.4683 0.4425  130 SER M C   
4428 O O   . SER C 142 ? 2.0605 2.2106 2.0071 -0.1765 -0.4659 0.4262  130 SER M O   
4429 C CB  . SER C 142 ? 1.9832 2.0159 1.9158 -0.1073 -0.5027 0.4343  130 SER M CB  
4430 O OG  . SER C 142 ? 1.9732 1.9446 1.8903 -0.0709 -0.5205 0.4372  130 SER M OG  
4431 N N   . THR C 143 ? 2.1049 2.2139 2.0212 -0.1556 -0.4544 0.4505  131 THR M N   
4432 C CA  . THR C 143 ? 2.1034 2.2701 2.0259 -0.1873 -0.4363 0.4364  131 THR M CA  
4433 C C   . THR C 143 ? 2.1249 2.3120 2.0331 -0.2203 -0.4366 0.4691  131 THR M C   
4434 O O   . THR C 143 ? 2.1451 2.3063 2.0437 -0.2084 -0.4336 0.4854  131 THR M O   
4435 C CB  . THR C 143 ? 2.0895 2.2463 2.0189 -0.1636 -0.4223 0.4110  131 THR M CB  
4436 O OG1 . THR C 143 ? 2.0876 2.2341 2.0389 -0.1407 -0.4251 0.3787  131 THR M OG1 
4437 C CG2 . THR C 143 ? 2.0766 2.2897 2.0123 -0.1948 -0.4059 0.3948  131 THR M CG2 
4438 N N   . SER C 144 ? 2.1237 2.3588 2.0325 -0.2641 -0.4421 0.4814  132 SER M N   
4439 C CA  . SER C 144 ? 2.1275 2.3862 2.0236 -0.3034 -0.4477 0.5159  132 SER M CA  
4440 C C   . SER C 144 ? 2.2128 2.5424 2.1000 -0.3443 -0.4289 0.4968  132 SER M C   
4441 O O   . SER C 144 ? 2.2120 2.5982 2.1040 -0.3717 -0.4214 0.4771  132 SER M O   
4442 C CB  . SER C 144 ? 2.0620 2.3236 1.9644 -0.3298 -0.4743 0.5527  132 SER M CB  
4443 O OG  . SER C 144 ? 2.0017 2.2915 1.8950 -0.3752 -0.4842 0.5885  132 SER M OG  
4444 N N   . GLY C 145 ? 1.7277 0.9579 1.8200 0.0558  -0.7838 0.1520  133 GLY M N   
4445 C CA  . GLY C 145 ? 1.7708 0.9499 1.8790 0.1072  -0.8420 0.1007  133 GLY M CA  
4446 C C   . GLY C 145 ? 1.8491 0.9665 1.9754 0.1185  -0.9082 0.0930  133 GLY M C   
4447 O O   . GLY C 145 ? 1.9383 1.0138 2.1051 0.0787  -0.9599 0.1369  133 GLY M O   
4448 N N   . GLY C 146 ? 1.8103 0.9253 1.9032 0.1739  -0.9043 0.0394  134 GLY M N   
4449 C CA  . GLY C 146 ? 1.8477 0.9083 1.9450 0.1902  -0.9612 0.0287  134 GLY M CA  
4450 C C   . GLY C 146 ? 1.8888 0.9821 1.9470 0.1902  -0.9144 0.0339  134 GLY M C   
4451 O O   . GLY C 146 ? 1.9325 0.9937 1.9760 0.2207  -0.9468 0.0103  134 GLY M O   
4452 N N   . THR C 147 ? 1.8887 1.0454 1.9292 0.1578  -0.8401 0.0638  137 THR M N   
4453 C CA  . THR C 147 ? 1.8433 1.0363 1.8523 0.1558  -0.7929 0.0698  137 THR M CA  
4454 C C   . THR C 147 ? 1.7225 0.9492 1.7401 0.0957  -0.7591 0.1277  137 THR M C   
4455 O O   . THR C 147 ? 1.6049 0.8589 1.6345 0.0595  -0.7354 0.1584  137 THR M O   
4456 C CB  . THR C 147 ? 1.5636 0.8156 1.5274 0.1986  -0.7214 0.0289  137 THR M CB  
4457 O OG1 . THR C 147 ? 1.4446 0.7404 1.4017 0.1904  -0.6707 0.0319  137 THR M OG1 
4458 C CG2 . THR C 147 ? 1.6040 0.8317 1.5493 0.2638  -0.7533 -0.0288 137 THR M CG2 
4459 N N   . ALA C 148 ? 1.7524 0.9812 1.7607 0.0886  -0.7566 0.1402  138 ALA M N   
4460 C CA  . ALA C 148 ? 1.6947 0.9597 1.7079 0.0394  -0.7265 0.1892  138 ALA M CA  
4461 C C   . ALA C 148 ? 1.5834 0.9003 1.5623 0.0519  -0.6649 0.1765  138 ALA M C   
4462 O O   . ALA C 148 ? 1.5988 0.9166 1.5537 0.0971  -0.6545 0.1351  138 ALA M O   
4463 C CB  . ALA C 148 ? 1.7460 0.9635 1.7887 0.0142  -0.7880 0.2250  138 ALA M CB  
4464 N N   . ALA C 149 ? 1.4807 0.8434 1.4590 0.0133  -0.6258 0.2120  139 ALA M N   
4465 C CA  . ALA C 149 ? 1.3936 0.8063 1.3449 0.0232  -0.5685 0.2008  139 ALA M CA  
4466 C C   . ALA C 149 ? 1.4012 0.8218 1.3590 -0.0020 -0.5770 0.2321  139 ALA M C   
4467 O O   . ALA C 149 ? 1.4208 0.8495 1.3988 -0.0426 -0.5872 0.2740  139 ALA M O   
4468 C CB  . ALA C 149 ? 1.2640 0.7378 1.1997 0.0109  -0.4979 0.2024  139 ALA M CB  
4469 N N   . LEU C 150 ? 1.4066 0.8294 1.3473 0.0256  -0.5721 0.2114  140 LEU M N   
4470 C CA  . LEU C 150 ? 1.4106 0.8474 1.3513 0.0109  -0.5741 0.2342  140 LEU M CA  
4471 C C   . LEU C 150 ? 1.3384 0.8246 1.2565 0.0302  -0.5206 0.2125  140 LEU M C   
4472 O O   . LEU C 150 ? 1.2532 0.7524 1.1576 0.0603  -0.4917 0.1794  140 LEU M O   
4473 C CB  . LEU C 150 ? 1.4197 0.7999 1.3633 0.0298  -0.6364 0.2312  140 LEU M CB  
4474 C CG  . LEU C 150 ? 1.3753 0.7305 1.2978 0.0826  -0.6502 0.1830  140 LEU M CG  
4475 C CD1 . LEU C 150 ? 1.3762 0.6923 1.2899 0.1023  -0.6976 0.1801  140 LEU M CD1 
4476 C CD2 . LEU C 150 ? 1.3905 0.7096 1.3190 0.1001  -0.6744 0.1601  140 LEU M CD2 
4477 N N   . GLY C 151 ? 1.3182 0.8344 1.2345 0.0157  -0.5079 0.2312  141 GLY M N   
4478 C CA  . GLY C 151 ? 1.2541 0.8165 1.1545 0.0331  -0.4625 0.2123  141 GLY M CA  
4479 C C   . GLY C 151 ? 1.1982 0.7930 1.0973 0.0200  -0.4557 0.2311  141 GLY M C   
4480 O O   . GLY C 151 ? 1.2248 0.8078 1.1336 -0.0009 -0.4850 0.2607  141 GLY M O   
4481 N N   . CYS C 152 ? 1.1265 0.7651 1.0153 0.0347  -0.4168 0.2141  142 CYS M N   
4482 C CA  . CYS C 152 ? 1.0577 0.7357 0.9440 0.0269  -0.4078 0.2261  142 CYS M CA  
4483 C C   . CYS C 152 ? 0.9727 0.7048 0.8568 0.0065  -0.3549 0.2320  142 CYS M C   
4484 O O   . CYS C 152 ? 1.0033 0.7535 0.8827 0.0184  -0.3172 0.2123  142 CYS M O   
4485 C CB  . CYS C 152 ? 0.9586 0.6445 0.8364 0.0650  -0.4182 0.1996  142 CYS M CB  
4486 S SG  . CYS C 152 ? 2.0295 1.6732 1.9024 0.0783  -0.4803 0.2069  142 CYS M SG  
4487 N N   . LEU C 153 ? 0.9217 0.6801 0.8087 -0.0219 -0.3519 0.2593  143 LEU M N   
4488 C CA  . LEU C 153 ? 0.9140 0.7239 0.7958 -0.0406 -0.3062 0.2636  143 LEU M CA  
4489 C C   . LEU C 153 ? 0.9379 0.7862 0.8139 -0.0264 -0.3030 0.2538  143 LEU M C   
4490 O O   . LEU C 153 ? 1.0342 0.8960 0.9118 -0.0298 -0.3255 0.2688  143 LEU M O   
4491 C CB  . LEU C 153 ? 0.9617 0.7870 0.8517 -0.0757 -0.3058 0.2965  143 LEU M CB  
4492 C CG  . LEU C 153 ? 0.9868 0.8670 0.8715 -0.0950 -0.2656 0.3020  143 LEU M CG  
4493 C CD1 . LEU C 153 ? 1.0019 0.8946 0.8787 -0.0967 -0.2205 0.2809  143 LEU M CD1 
4494 C CD2 . LEU C 153 ? 0.9603 0.8590 0.8585 -0.1209 -0.2760 0.3363  143 LEU M CD2 
4495 N N   . VAL C 154 ? 0.8509 0.7215 0.7222 -0.0077 -0.2762 0.2283  144 VAL M N   
4496 C CA  . VAL C 154 ? 0.8513 0.7693 0.7222 0.0066  -0.2762 0.2136  144 VAL M CA  
4497 C C   . VAL C 154 ? 0.8837 0.8490 0.7457 -0.0178 -0.2401 0.2196  144 VAL M C   
4498 O O   . VAL C 154 ? 0.9315 0.9027 0.7855 -0.0241 -0.1991 0.2128  144 VAL M O   
4499 C CB  . VAL C 154 ? 0.7624 0.6866 0.6403 0.0417  -0.2708 0.1830  144 VAL M CB  
4500 C CG1 . VAL C 154 ? 0.6645 0.6504 0.5543 0.0512  -0.2686 0.1597  144 VAL M CG1 
4501 C CG2 . VAL C 154 ? 0.7435 0.6163 0.6238 0.0674  -0.3066 0.1748  144 VAL M CG2 
4502 N N   . LYS C 155 ? 0.8707 0.8685 0.7313 -0.0292 -0.2535 0.2311  145 LYS M N   
4503 C CA  . LYS C 155 ? 0.8355 0.8674 0.6854 -0.0550 -0.2242 0.2418  145 LYS M CA  
4504 C C   . LYS C 155 ? 0.7992 0.8960 0.6529 -0.0549 -0.2190 0.2195  145 LYS M C   
4505 O O   . LYS C 155 ? 0.7659 0.8894 0.6313 -0.0395 -0.2490 0.2101  145 LYS M O   
4506 C CB  . LYS C 155 ? 0.9508 0.9690 0.8062 -0.0746 -0.2350 0.2753  145 LYS M CB  
4507 C CG  . LYS C 155 ? 0.9919 1.0391 0.8416 -0.0992 -0.2014 0.2851  145 LYS M CG  
4508 C CD  . LYS C 155 ? 1.0610 1.1044 0.9253 -0.1151 -0.2144 0.3174  145 LYS M CD  
4509 C CE  . LYS C 155 ? 1.0872 1.1540 0.9530 -0.1353 -0.1816 0.3190  145 LYS M CE  
4510 N NZ  . LYS C 155 ? 1.0155 1.1295 0.8693 -0.1373 -0.1598 0.3107  145 LYS M NZ  
4511 N N   . ASP C 156 ? 0.7755 0.8975 0.6276 -0.0746 -0.1740 0.2036  146 ASP M N   
4512 C CA  . ASP C 156 ? 0.7511 0.9339 0.6158 -0.0829 -0.1621 0.1783  146 ASP M CA  
4513 C C   . ASP C 156 ? 0.6881 0.9105 0.5904 -0.0706 -0.1619 0.1305  146 ASP M C   
4514 O O   . ASP C 156 ? 0.7197 0.9846 0.6332 -0.0601 -0.1873 0.1185  146 ASP M O   
4515 C CB  . ASP C 156 ? 0.8209 1.0264 0.6717 -0.0782 -0.1968 0.2083  146 ASP M CB  
4516 C CG  . ASP C 156 ? 0.9091 1.0970 0.7310 -0.0941 -0.1867 0.2511  146 ASP M CG  
4517 O OD1 . ASP C 156 ? 0.8665 1.0450 0.6758 -0.1125 -0.1473 0.2473  146 ASP M OD1 
4518 O OD2 . ASP C 156 ? 1.0177 1.2047 0.8509 -0.0908 -0.2069 0.2792  146 ASP M OD2 
4519 N N   . TYR C 157 ? 0.6760 0.8892 0.5979 -0.0693 -0.1319 0.1044  147 TYR M N   
4520 C CA  . TYR C 157 ? 0.6055 0.8604 0.5659 -0.0580 -0.1284 0.0621  147 TYR M CA  
4521 C C   . TYR C 157 ? 0.5497 0.8325 0.5397 -0.0772 -0.0752 0.0283  147 TYR M C   
4522 O O   . TYR C 157 ? 0.5769 0.8333 0.5535 -0.0932 -0.0378 0.0378  147 TYR M O   
4523 C CB  . TYR C 157 ? 0.5390 0.7634 0.5036 -0.0289 -0.1480 0.0626  147 TYR M CB  
4524 C CG  . TYR C 157 ? 0.5514 0.7318 0.5132 -0.0251 -0.1164 0.0687  147 TYR M CG  
4525 C CD1 . TYR C 157 ? 0.5898 0.7130 0.5192 -0.0239 -0.1264 0.1039  147 TYR M CD1 
4526 C CD2 . TYR C 157 ? 0.4862 0.6856 0.4802 -0.0197 -0.0765 0.0398  147 TYR M CD2 
4527 C CE1 . TYR C 157 ? 0.5258 0.6142 0.4515 -0.0150 -0.0978 0.1064  147 TYR M CE1 
4528 C CE2 . TYR C 157 ? 0.5060 0.6700 0.4973 -0.0087 -0.0459 0.0455  147 TYR M CE2 
4529 C CZ  . TYR C 157 ? 0.5116 0.6211 0.4668 -0.0053 -0.0565 0.0769  147 TYR M CZ  
4530 O OH  . TYR C 157 ? 0.5495 0.6294 0.5014 0.0099  -0.0240 0.0792  147 TYR M OH  
4531 N N   . PHE C 158 ? 0.4711 0.8079 0.5016 -0.0753 -0.0712 -0.0105 148 PHE M N   
4532 C CA  . PHE C 158 ? 0.4071 0.7727 0.4765 -0.0946 -0.0225 -0.0440 148 PHE M CA  
4533 C C   . PHE C 158 ? 0.4354 0.8552 0.5535 -0.0834 -0.0276 -0.0807 148 PHE M C   
4534 O O   . PHE C 158 ? 0.4457 0.9015 0.5643 -0.0712 -0.0662 -0.0896 148 PHE M O   
4535 C CB  . PHE C 158 ? 0.3945 0.7853 0.4604 -0.1227 -0.0080 -0.0536 148 PHE M CB  
4536 C CG  . PHE C 158 ? 0.4405 0.8506 0.5452 -0.1458 0.0432  -0.0862 148 PHE M CG  
4537 C CD1 . PHE C 158 ? 0.4262 0.7933 0.5183 -0.1570 0.0906  -0.0742 148 PHE M CD1 
4538 C CD2 . PHE C 158 ? 0.4304 0.9024 0.5866 -0.1553 0.0454  -0.1294 148 PHE M CD2 
4539 C CE1 . PHE C 158 ? 0.4186 0.7997 0.5484 -0.1777 0.1408  -0.1024 148 PHE M CE1 
4540 C CE2 . PHE C 158 ? 0.3963 0.8836 0.5961 -0.1789 0.0928  -0.1592 148 PHE M CE2 
4541 C CZ  . PHE C 158 ? 0.4324 0.8721 0.6194 -0.1901 0.1413  -0.1447 148 PHE M CZ  
4542 N N   . PRO C 159 ? 0.4472 0.8753 0.6058 -0.0845 0.0129  -0.0999 149 PRO M N   
4543 C CA  . PRO C 159 ? 0.4616 0.8479 0.6184 -0.0914 0.0623  -0.0885 149 PRO M CA  
4544 C C   . PRO C 159 ? 0.4796 0.8196 0.6147 -0.0571 0.0524  -0.0630 149 PRO M C   
4545 O O   . PRO C 159 ? 0.5691 0.8964 0.6794 -0.0344 0.0031  -0.0482 149 PRO M O   
4546 C CB  . PRO C 159 ? 0.4320 0.8620 0.6535 -0.1013 0.1041  -0.1229 149 PRO M CB  
4547 C CG  . PRO C 159 ? 0.2680 0.7403 0.5150 -0.0762 0.0698  -0.1368 149 PRO M CG  
4548 C CD  . PRO C 159 ? 0.4847 0.9656 0.6936 -0.0719 0.0126  -0.1302 149 PRO M CD  
4549 N N   . GLU C 160 ? 0.4335 0.7491 0.5781 -0.0503 0.0985  -0.0590 150