data_3IQS
# 
_entry.id   3IQS 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3IQS         
RCSB  RCSB054748   
WWPDB D_1000054748 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          3E1U 
_pdbx_database_related.details        'Previous version of this entry' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3IQS 
_pdbx_database_status.recvd_initial_deposition_date   2009-08-20 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Holden, L.G.'     1 
'Prochnow, C.'     2 
'Chang, Y.P.'      3 
'Bransteitter, R.' 4 
'Chelico, L.'      5 
'Sen, U.'          6 
'Stevens, R.C.'    7 
'Goodman, R.F.'    8 
'Chen, X.S.'       9 
# 
_citation.id                        primary 
_citation.title                     'Crystal structure of the anti-viral APOBEC3G catalytic domain and functional implications.' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            456 
_citation.page_first                121 
_citation.page_last                 124 
_citation.year                      2008 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   18849968 
_citation.pdbx_database_id_DOI      10.1038/nature07357 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Holden, L.G.'     1 
primary 'Prochnow, C.'     2 
primary 'Chang, Y.P.'      3 
primary 'Bransteitter, R.' 4 
primary 'Chelico, L.'      5 
primary 'Sen, U.'          6 
primary 'Stevens, R.C.'    7 
primary 'Goodman, M.F.'    8 
primary 'Chen, X.S.'       9 
# 
_cell.entry_id           3IQS 
_cell.length_a           83.464 
_cell.length_b           57.329 
_cell.length_c           40.578 
_cell.angle_alpha        90.00 
_cell.angle_beta         96.46 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3IQS 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'DNA dC->dU-editing enzyme APOBEC-3G' 22087.990 1  3.5.4.- ? 'APOBEC3G Catalytic Domain (UNP residues 197-380)' 
? 
2 non-polymer syn 'ZINC ION'                            65.409    1  ?       ? ?                                                  
? 
3 water       nat water                                 18.015    28 ?       ? ?                                                  
? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'APOBEC-related cytidine deaminase, ARCD, APOBEC-related protein, ARP-9, CEM-15, CEM15' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GPLGSMDPPTFTFNFNNEPWVRGRHETYLCYEVERMHNDTWVLLNQRRGFLCNQAPHKHGFLEGRHAELCFLDVIPFWKL
DLDQDYRVTCFTSWSPCFSCAQEMAKFISKNKHVSLCIFTARIYDDQGRCQEGLRTLAEAGAKISIMTYSEFKHCWDTFV
DHQGCPFQPWDGLDEHSQDLSGRLRAILQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GPLGSMDPPTFTFNFNNEPWVRGRHETYLCYEVERMHNDTWVLLNQRRGFLCNQAPHKHGFLEGRHAELCFLDVIPFWKL
DLDQDYRVTCFTSWSPCFSCAQEMAKFISKNKHVSLCIFTARIYDDQGRCQEGLRTLAEAGAKISIMTYSEFKHCWDTFV
DHQGCPFQPWDGLDEHSQDLSGRLRAILQ
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   LEU n 
1 4   GLY n 
1 5   SER n 
1 6   MET n 
1 7   ASP n 
1 8   PRO n 
1 9   PRO n 
1 10  THR n 
1 11  PHE n 
1 12  THR n 
1 13  PHE n 
1 14  ASN n 
1 15  PHE n 
1 16  ASN n 
1 17  ASN n 
1 18  GLU n 
1 19  PRO n 
1 20  TRP n 
1 21  VAL n 
1 22  ARG n 
1 23  GLY n 
1 24  ARG n 
1 25  HIS n 
1 26  GLU n 
1 27  THR n 
1 28  TYR n 
1 29  LEU n 
1 30  CYS n 
1 31  TYR n 
1 32  GLU n 
1 33  VAL n 
1 34  GLU n 
1 35  ARG n 
1 36  MET n 
1 37  HIS n 
1 38  ASN n 
1 39  ASP n 
1 40  THR n 
1 41  TRP n 
1 42  VAL n 
1 43  LEU n 
1 44  LEU n 
1 45  ASN n 
1 46  GLN n 
1 47  ARG n 
1 48  ARG n 
1 49  GLY n 
1 50  PHE n 
1 51  LEU n 
1 52  CYS n 
1 53  ASN n 
1 54  GLN n 
1 55  ALA n 
1 56  PRO n 
1 57  HIS n 
1 58  LYS n 
1 59  HIS n 
1 60  GLY n 
1 61  PHE n 
1 62  LEU n 
1 63  GLU n 
1 64  GLY n 
1 65  ARG n 
1 66  HIS n 
1 67  ALA n 
1 68  GLU n 
1 69  LEU n 
1 70  CYS n 
1 71  PHE n 
1 72  LEU n 
1 73  ASP n 
1 74  VAL n 
1 75  ILE n 
1 76  PRO n 
1 77  PHE n 
1 78  TRP n 
1 79  LYS n 
1 80  LEU n 
1 81  ASP n 
1 82  LEU n 
1 83  ASP n 
1 84  GLN n 
1 85  ASP n 
1 86  TYR n 
1 87  ARG n 
1 88  VAL n 
1 89  THR n 
1 90  CYS n 
1 91  PHE n 
1 92  THR n 
1 93  SER n 
1 94  TRP n 
1 95  SER n 
1 96  PRO n 
1 97  CYS n 
1 98  PHE n 
1 99  SER n 
1 100 CYS n 
1 101 ALA n 
1 102 GLN n 
1 103 GLU n 
1 104 MET n 
1 105 ALA n 
1 106 LYS n 
1 107 PHE n 
1 108 ILE n 
1 109 SER n 
1 110 LYS n 
1 111 ASN n 
1 112 LYS n 
1 113 HIS n 
1 114 VAL n 
1 115 SER n 
1 116 LEU n 
1 117 CYS n 
1 118 ILE n 
1 119 PHE n 
1 120 THR n 
1 121 ALA n 
1 122 ARG n 
1 123 ILE n 
1 124 TYR n 
1 125 ASP n 
1 126 ASP n 
1 127 GLN n 
1 128 GLY n 
1 129 ARG n 
1 130 CYS n 
1 131 GLN n 
1 132 GLU n 
1 133 GLY n 
1 134 LEU n 
1 135 ARG n 
1 136 THR n 
1 137 LEU n 
1 138 ALA n 
1 139 GLU n 
1 140 ALA n 
1 141 GLY n 
1 142 ALA n 
1 143 LYS n 
1 144 ILE n 
1 145 SER n 
1 146 ILE n 
1 147 MET n 
1 148 THR n 
1 149 TYR n 
1 150 SER n 
1 151 GLU n 
1 152 PHE n 
1 153 LYS n 
1 154 HIS n 
1 155 CYS n 
1 156 TRP n 
1 157 ASP n 
1 158 THR n 
1 159 PHE n 
1 160 VAL n 
1 161 ASP n 
1 162 HIS n 
1 163 GLN n 
1 164 GLY n 
1 165 CYS n 
1 166 PRO n 
1 167 PHE n 
1 168 GLN n 
1 169 PRO n 
1 170 TRP n 
1 171 ASP n 
1 172 GLY n 
1 173 LEU n 
1 174 ASP n 
1 175 GLU n 
1 176 HIS n 
1 177 SER n 
1 178 GLN n 
1 179 ASP n 
1 180 LEU n 
1 181 SER n 
1 182 GLY n 
1 183 ARG n 
1 184 LEU n 
1 185 ARG n 
1 186 ALA n 
1 187 ILE n 
1 188 LEU n 
1 189 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'APOBEC3G, MDS019' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               XA-90 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pGEX6P-1 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ABC3G_HUMAN 
_struct_ref.pdbx_db_accession          Q9HC16 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MDPPTFTFNFNNEPWVRGRHETYLCYEVERMHNDTWVLLNQRRGFLCNQAPHKHGFLEGRHAELCFLDVIPFWKLDLDQD
YRVTCFTSWSPCFSCAQEMAKFISKNKHVSLCIFTARIYDDQGRCQEGLRTLAEAGAKISIMTYSEFKHCWDTFVDHQGC
PFQPWDGLDEHSQDLSGRLRAILQ
;
_struct_ref.pdbx_align_begin           197 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              3IQS 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 6 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 189 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9HC16 
_struct_ref_seq.db_align_beg                  197 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  380 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       197 
_struct_ref_seq.pdbx_auth_seq_align_end       380 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3IQS GLY A 1 ? UNP Q9HC16 ? ? 'EXPRESSION TAG' 192 1 
1 3IQS PRO A 2 ? UNP Q9HC16 ? ? 'EXPRESSION TAG' 193 2 
1 3IQS LEU A 3 ? UNP Q9HC16 ? ? 'EXPRESSION TAG' 194 3 
1 3IQS GLY A 4 ? UNP Q9HC16 ? ? 'EXPRESSION TAG' 195 4 
1 3IQS SER A 5 ? UNP Q9HC16 ? ? 'EXPRESSION TAG' 196 5 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
_exptl.entry_id          3IQS 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.18 
_exptl_crystal.density_percent_sol   43.67 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    '100mM MES pH 6.5, 40% PEG 200, VAPOR DIFFUSION, HANGING DROP, temperature 291K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2007-12-13 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             MAD 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
loop_
_diffrn_radiation_wavelength.id 
_diffrn_radiation_wavelength.wavelength 
_diffrn_radiation_wavelength.wt 
1 0.9792060 1.0 
2 0.9790670 1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'APS BEAMLINE 19-ID' 
_diffrn_source.pdbx_synchrotron_site       APS 
_diffrn_source.pdbx_synchrotron_beamline   19-ID 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        '0.9792060, 0.9790670' 
# 
_reflns.entry_id                     3IQS 
_reflns.observed_criterion_sigma_I   -3.0 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             50.0 
_reflns.d_resolution_high            2.20 
_reflns.number_obs                   17604 
_reflns.number_all                   18902 
_reflns.percent_possible_obs         93.1 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        ? 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              ? 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.20 
_reflns_shell.d_res_low              2.28 
_reflns_shell.percent_possible_all   ? 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3IQS 
_refine.ls_number_reflns_obs                     15669 
_refine.ls_number_reflns_all                     16598 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.7 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             30.0 
_refine.ls_d_res_high                            2.30 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.251 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.251 
_refine.ls_R_factor_R_free                       0.263 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 ? 
_refine.ls_number_reflns_R_free                  1511 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               ? 
_refine.details                                  
;1. The Friedel pairs were used in phasing. 2. Authors state that the main difference between the old (3E1U, see remark 900) and this entry is that the conformation of four residues (residues 268-271) of a loop on the surface is readjusted.
;
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          MAD 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            random 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1523 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         1 
_refine_hist.number_atoms_solvent             28 
_refine_hist.number_atoms_total               1552 
_refine_hist.d_res_high                       2.30 
_refine_hist.d_res_low                        30.0 
# 
_struct.entry_id                  3IQS 
_struct.title                     'Crystal structure of the anti-viral APOBEC3G catalytic domain' 
_struct.pdbx_descriptor           'DNA dC->dU-editing enzyme APOBEC-3G (E.C.3.5.4.-)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3IQS 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
;FIVE BETA-STRANDS SURROUNDED BY SIX ALPHA-HELICES, ALTERNATIVE SPLICING, ANTIVIRAL DEFENSE, CYTOPLASM, HOST-VIRUS INTERACTION, HYDROLASE, METAL-BINDING, NUCLEUS, POLYMORPHISM, UBL CONJUGATION, ZINC
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 ASP A 7   ? ASN A 16  ? ASP A 198 ASN A 207 1 ? 10 
HELX_P HELX_P2 2 HIS A 66  ? ILE A 75  ? HIS A 257 ILE A 266 1 ? 10 
HELX_P HELX_P3 3 PRO A 76  ? LYS A 79  ? PRO A 267 LYS A 270 5 ? 4  
HELX_P HELX_P4 4 CYS A 97  ? LYS A 112 ? CYS A 288 LYS A 303 1 ? 16 
HELX_P HELX_P5 5 ARG A 129 ? ALA A 140 ? ARG A 320 ALA A 331 1 ? 12 
HELX_P HELX_P6 6 THR A 148 ? VAL A 160 ? THR A 339 VAL A 351 1 ? 13 
HELX_P HELX_P7 7 GLY A 172 ? GLN A 189 ? GLY A 363 GLN A 380 1 ? 18 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? A HIS 66  ND1 ? ? ? 1_555 B ZN . ZN ? ? A HIS 257 A ZN 400 1_555 ? ? ? ? ? ? ? 2.248 ? 
metalc2 metalc ? ? A CYS 97  SG  ? ? ? 1_555 B ZN . ZN ? ? A CYS 288 A ZN 400 1_555 ? ? ? ? ? ? ? 2.364 ? 
metalc3 metalc ? ? A CYS 100 SG  ? ? ? 1_555 B ZN . ZN ? ? A CYS 291 A ZN 400 1_555 ? ? ? ? ? ? ? 2.297 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   5 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? parallel      
A 4 5 ? parallel      
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 LEU A 44  ? CYS A 52  ? LEU A 235 CYS A 243 
A 2 TYR A 28  ? ARG A 35  ? TYR A 219 ARG A 226 
A 3 TYR A 86  ? THR A 92  ? TYR A 277 THR A 283 
A 4 VAL A 114 ? THR A 120 ? VAL A 305 THR A 311 
A 5 LYS A 143 ? ILE A 146 ? LYS A 334 ILE A 337 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O GLY A 49  ? O GLY A 240 N TYR A 31  ? N TYR A 222 
A 2 3 N GLU A 34  ? N GLU A 225 O ARG A 87  ? O ARG A 278 
A 3 4 N CYS A 90  ? N CYS A 281 O PHE A 119 ? O PHE A 310 
A 4 5 N ILE A 118 ? N ILE A 309 O LYS A 143 ? O LYS A 334 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    4 
_struct_site.details              'BINDING SITE FOR RESIDUE ZN A 400' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 HIS A 66  ? HIS A 257 . ? 1_555 ? 
2 AC1 4 CYS A 97  ? CYS A 288 . ? 1_555 ? 
3 AC1 4 CYS A 100 ? CYS A 291 . ? 1_555 ? 
4 AC1 4 HOH C .   ? HOH A 426 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3IQS 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3IQS 
_atom_sites.fract_transf_matrix[1][1]   0.011981 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001357 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.017443 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.024801 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . MET A 1 6   ? 18.349 44.767 13.021  1.00 27.80 ? 197 MET A N   1 
ATOM   2    C  CA  . MET A 1 6   ? 16.893 44.444 13.199  1.00 27.90 ? 197 MET A CA  1 
ATOM   3    C  C   . MET A 1 6   ? 16.394 45.021 14.529  1.00 28.69 ? 197 MET A C   1 
ATOM   4    O  O   . MET A 1 6   ? 17.004 44.801 15.571  1.00 29.04 ? 197 MET A O   1 
ATOM   5    C  CB  . MET A 1 6   ? 16.669 42.933 13.164  1.00 27.14 ? 197 MET A CB  1 
ATOM   6    C  CG  . MET A 1 6   ? 15.205 42.494 13.005  1.00 25.06 ? 197 MET A CG  1 
ATOM   7    S  SD  . MET A 1 6   ? 14.943 40.696 13.025  1.00 18.73 ? 197 MET A SD  1 
ATOM   8    C  CE  . MET A 1 6   ? 16.359 40.109 12.107  1.00 15.45 ? 197 MET A CE  1 
ATOM   9    N  N   . ASP A 1 7   ? 15.287 45.757 14.492  1.00 29.43 ? 198 ASP A N   1 
ATOM   10   C  CA  . ASP A 1 7   ? 14.731 46.319 15.722  1.00 30.46 ? 198 ASP A CA  1 
ATOM   11   C  C   . ASP A 1 7   ? 14.099 45.213 16.582  1.00 29.55 ? 198 ASP A C   1 
ATOM   12   O  O   . ASP A 1 7   ? 13.508 44.269 16.047  1.00 29.78 ? 198 ASP A O   1 
ATOM   13   C  CB  . ASP A 1 7   ? 13.724 47.437 15.413  1.00 31.26 ? 198 ASP A CB  1 
ATOM   14   C  CG  . ASP A 1 7   ? 12.512 46.936 14.666  1.00 34.45 ? 198 ASP A CG  1 
ATOM   15   O  OD1 . ASP A 1 7   ? 12.685 46.432 13.519  1.00 37.29 ? 198 ASP A OD1 1 
ATOM   16   O  OD2 . ASP A 1 7   ? 11.392 47.042 15.225  1.00 36.23 ? 198 ASP A OD2 1 
ATOM   17   N  N   . PRO A 1 8   ? 14.237 45.321 17.917  1.00 28.68 ? 199 PRO A N   1 
ATOM   18   C  CA  . PRO A 1 8   ? 13.699 44.349 18.886  1.00 27.79 ? 199 PRO A CA  1 
ATOM   19   C  C   . PRO A 1 8   ? 12.210 43.913 18.721  1.00 27.08 ? 199 PRO A C   1 
ATOM   20   O  O   . PRO A 1 8   ? 11.930 42.698 18.772  1.00 26.14 ? 199 PRO A O   1 
ATOM   21   C  CB  . PRO A 1 8   ? 13.960 45.028 20.238  1.00 27.81 ? 199 PRO A CB  1 
ATOM   22   C  CG  . PRO A 1 8   ? 15.184 45.849 19.974  1.00 28.33 ? 199 PRO A CG  1 
ATOM   23   C  CD  . PRO A 1 8   ? 14.972 46.405 18.598  1.00 28.70 ? 199 PRO A CD  1 
ATOM   24   N  N   . PRO A 1 9   ? 11.268 44.870 18.526  1.00 26.33 ? 200 PRO A N   1 
ATOM   25   C  CA  . PRO A 1 9   ? 9.874  44.442 18.296  1.00 26.07 ? 200 PRO A CA  1 
ATOM   26   C  C   . PRO A 1 9   ? 9.714  43.496 17.107  1.00 25.77 ? 200 PRO A C   1 
ATOM   27   O  O   . PRO A 1 9   ? 8.994  42.506 17.202  1.00 26.50 ? 200 PRO A O   1 
ATOM   28   C  CB  . PRO A 1 9   ? 9.134  45.764 18.019  1.00 26.06 ? 200 PRO A CB  1 
ATOM   29   C  CG  . PRO A 1 9   ? 9.968  46.823 18.681  1.00 25.27 ? 200 PRO A CG  1 
ATOM   30   C  CD  . PRO A 1 9   ? 11.393 46.344 18.502  1.00 26.58 ? 200 PRO A CD  1 
ATOM   31   N  N   . THR A 1 10  ? 10.383 43.796 16.003  1.00 25.41 ? 201 THR A N   1 
ATOM   32   C  CA  . THR A 1 10  ? 10.348 42.957 14.803  1.00 25.21 ? 201 THR A CA  1 
ATOM   33   C  C   . THR A 1 10  ? 10.896 41.549 15.065  1.00 25.45 ? 201 THR A C   1 
ATOM   34   O  O   . THR A 1 10  ? 10.260 40.564 14.706  1.00 25.16 ? 201 THR A O   1 
ATOM   35   C  CB  . THR A 1 10  ? 11.117 43.631 13.651  1.00 25.03 ? 201 THR A CB  1 
ATOM   36   O  OG1 . THR A 1 10  ? 10.586 44.952 13.459  1.00 25.06 ? 201 THR A OG1 1 
ATOM   37   C  CG2 . THR A 1 10  ? 11.001 42.826 12.352  1.00 23.90 ? 201 THR A CG2 1 
ATOM   38   N  N   . PHE A 1 11  ? 12.066 41.461 15.702  1.00 25.56 ? 202 PHE A N   1 
ATOM   39   C  CA  . PHE A 1 11  ? 12.645 40.171 16.057  1.00 25.20 ? 202 PHE A CA  1 
ATOM   40   C  C   . PHE A 1 11  ? 11.654 39.373 16.891  1.00 25.76 ? 202 PHE A C   1 
ATOM   41   O  O   . PHE A 1 11  ? 11.238 38.279 16.496  1.00 25.74 ? 202 PHE A O   1 
ATOM   42   C  CB  . PHE A 1 11  ? 13.970 40.333 16.819  1.00 24.62 ? 202 PHE A CB  1 
ATOM   43   C  CG  . PHE A 1 11  ? 14.500 39.032 17.394  1.00 23.44 ? 202 PHE A CG  1 
ATOM   44   C  CD1 . PHE A 1 11  ? 15.100 38.082 16.564  1.00 23.54 ? 202 PHE A CD1 1 
ATOM   45   C  CD2 . PHE A 1 11  ? 14.378 38.751 18.746  1.00 22.33 ? 202 PHE A CD2 1 
ATOM   46   C  CE1 . PHE A 1 11  ? 15.572 36.866 17.078  1.00 21.63 ? 202 PHE A CE1 1 
ATOM   47   C  CE2 . PHE A 1 11  ? 14.831 37.539 19.269  1.00 22.68 ? 202 PHE A CE2 1 
ATOM   48   C  CZ  . PHE A 1 11  ? 15.440 36.597 18.423  1.00 21.62 ? 202 PHE A CZ  1 
ATOM   49   N  N   . THR A 1 12  ? 11.281 39.938 18.041  1.00 26.42 ? 203 THR A N   1 
ATOM   50   C  CA  . THR A 1 12  ? 10.378 39.283 18.995  1.00 26.68 ? 203 THR A CA  1 
ATOM   51   C  C   . THR A 1 12  ? 9.056  38.901 18.350  1.00 25.86 ? 203 THR A C   1 
ATOM   52   O  O   . THR A 1 12  ? 8.542  37.821 18.613  1.00 25.94 ? 203 THR A O   1 
ATOM   53   C  CB  . THR A 1 12  ? 10.084 40.160 20.240  1.00 27.04 ? 203 THR A CB  1 
ATOM   54   O  OG1 . THR A 1 12  ? 11.285 40.782 20.694  1.00 28.87 ? 203 THR A OG1 1 
ATOM   55   C  CG2 . THR A 1 12  ? 9.524  39.311 21.375  1.00 28.34 ? 203 THR A CG2 1 
ATOM   56   N  N   . PHE A 1 13  ? 8.500  39.783 17.523  1.00 25.23 ? 204 PHE A N   1 
ATOM   57   C  CA  . PHE A 1 13  ? 7.258  39.451 16.819  1.00 24.45 ? 204 PHE A CA  1 
ATOM   58   C  C   . PHE A 1 13  ? 7.431  38.333 15.773  1.00 23.98 ? 204 PHE A C   1 
ATOM   59   O  O   . PHE A 1 13  ? 6.580  37.439 15.646  1.00 24.06 ? 204 PHE A O   1 
ATOM   60   C  CB  . PHE A 1 13  ? 6.617  40.681 16.181  1.00 24.52 ? 204 PHE A CB  1 
ATOM   61   C  CG  . PHE A 1 13  ? 5.399  40.360 15.350  1.00 25.48 ? 204 PHE A CG  1 
ATOM   62   C  CD1 . PHE A 1 13  ? 4.197  39.994 15.965  1.00 25.06 ? 204 PHE A CD1 1 
ATOM   63   C  CD2 . PHE A 1 13  ? 5.460  40.402 13.950  1.00 25.19 ? 204 PHE A CD2 1 
ATOM   64   C  CE1 . PHE A 1 13  ? 3.064  39.686 15.202  1.00 26.32 ? 204 PHE A CE1 1 
ATOM   65   C  CE2 . PHE A 1 13  ? 4.325  40.096 13.173  1.00 26.64 ? 204 PHE A CE2 1 
ATOM   66   C  CZ  . PHE A 1 13  ? 3.126  39.729 13.800  1.00 25.47 ? 204 PHE A CZ  1 
ATOM   67   N  N   . ASN A 1 14  ? 8.532  38.373 15.029  1.00 23.32 ? 205 ASN A N   1 
ATOM   68   C  CA  . ASN A 1 14  ? 8.733  37.403 13.955  1.00 22.97 ? 205 ASN A CA  1 
ATOM   69   C  C   . ASN A 1 14  ? 9.295  36.045 14.368  1.00 23.29 ? 205 ASN A C   1 
ATOM   70   O  O   . ASN A 1 14  ? 8.949  35.031 13.758  1.00 22.88 ? 205 ASN A O   1 
ATOM   71   C  CB  . ASN A 1 14  ? 9.562  38.021 12.840  1.00 22.90 ? 205 ASN A CB  1 
ATOM   72   C  CG  . ASN A 1 14  ? 8.753  39.020 12.008  1.00 22.69 ? 205 ASN A CG  1 
ATOM   73   O  OD1 . ASN A 1 14  ? 8.740  40.225 12.289  1.00 22.09 ? 205 ASN A OD1 1 
ATOM   74   N  ND2 . ASN A 1 14  ? 8.071  38.518 11.001  1.00 20.13 ? 205 ASN A ND2 1 
ATOM   75   N  N   . PHE A 1 15  ? 10.158 36.025 15.388  1.00 23.57 ? 206 PHE A N   1 
ATOM   76   C  CA  . PHE A 1 15  ? 10.826 34.789 15.822  1.00 23.83 ? 206 PHE A CA  1 
ATOM   77   C  C   . PHE A 1 15  ? 10.165 34.112 17.026  1.00 24.80 ? 206 PHE A C   1 
ATOM   78   O  O   . PHE A 1 15  ? 10.627 33.059 17.485  1.00 23.74 ? 206 PHE A O   1 
ATOM   79   C  CB  . PHE A 1 15  ? 12.318 35.039 16.085  1.00 23.59 ? 206 PHE A CB  1 
ATOM   80   C  CG  . PHE A 1 15  ? 13.137 35.202 14.820  1.00 22.11 ? 206 PHE A CG  1 
ATOM   81   C  CD1 . PHE A 1 15  ? 13.197 36.438 14.158  1.00 19.25 ? 206 PHE A CD1 1 
ATOM   82   C  CD2 . PHE A 1 15  ? 13.830 34.120 14.283  1.00 20.76 ? 206 PHE A CD2 1 
ATOM   83   C  CE1 . PHE A 1 15  ? 13.932 36.600 13.011  1.00 17.12 ? 206 PHE A CE1 1 
ATOM   84   C  CE2 . PHE A 1 15  ? 14.580 34.272 13.112  1.00 19.20 ? 206 PHE A CE2 1 
ATOM   85   C  CZ  . PHE A 1 15  ? 14.629 35.523 12.480  1.00 19.89 ? 206 PHE A CZ  1 
ATOM   86   N  N   . ASN A 1 16  ? 9.084  34.710 17.531  1.00 26.42 ? 207 ASN A N   1 
ATOM   87   C  CA  . ASN A 1 16  ? 8.302  34.086 18.602  1.00 27.96 ? 207 ASN A CA  1 
ATOM   88   C  C   . ASN A 1 16  ? 7.829  32.726 18.111  1.00 28.73 ? 207 ASN A C   1 
ATOM   89   O  O   . ASN A 1 16  ? 7.303  32.617 17.002  1.00 29.41 ? 207 ASN A O   1 
ATOM   90   C  CB  . ASN A 1 16  ? 7.144  34.994 19.018  1.00 27.82 ? 207 ASN A CB  1 
ATOM   91   C  CG  . ASN A 1 16  ? 6.195  34.330 20.004  1.00 29.43 ? 207 ASN A CG  1 
ATOM   92   O  OD1 . ASN A 1 16  ? 5.485  33.391 19.659  1.00 30.03 ? 207 ASN A OD1 1 
ATOM   93   N  ND2 . ASN A 1 16  ? 6.170  34.828 21.236  1.00 32.16 ? 207 ASN A ND2 1 
ATOM   94   N  N   . ASN A 1 17  ? 8.039  31.679 18.901  1.00 30.33 ? 208 ASN A N   1 
ATOM   95   C  CA  . ASN A 1 17  ? 7.721  30.322 18.421  1.00 31.82 ? 208 ASN A CA  1 
ATOM   96   C  C   . ASN A 1 17  ? 6.366  29.771 18.869  1.00 34.69 ? 208 ASN A C   1 
ATOM   97   O  O   . ASN A 1 17  ? 6.167  28.550 18.898  1.00 34.74 ? 208 ASN A O   1 
ATOM   98   C  CB  . ASN A 1 17  ? 8.870  29.333 18.690  1.00 30.84 ? 208 ASN A CB  1 
ATOM   99   C  CG  . ASN A 1 17  ? 9.203  29.165 20.181  1.00 27.82 ? 208 ASN A CG  1 
ATOM   100  O  OD1 . ASN A 1 17  ? 8.554  29.730 21.061  1.00 25.07 ? 208 ASN A OD1 1 
ATOM   101  N  ND2 . ASN A 1 17  ? 10.215 28.359 20.455  1.00 22.67 ? 208 ASN A ND2 1 
ATOM   102  N  N   . GLU A 1 18  ? 5.440  30.680 19.188  1.00 38.09 ? 209 GLU A N   1 
ATOM   103  C  CA  . GLU A 1 18  ? 4.064  30.316 19.549  1.00 41.50 ? 209 GLU A CA  1 
ATOM   104  C  C   . GLU A 1 18  ? 3.285  29.961 18.289  1.00 43.64 ? 209 GLU A C   1 
ATOM   105  O  O   . GLU A 1 18  ? 2.987  30.859 17.480  1.00 44.14 ? 209 GLU A O   1 
ATOM   106  C  CB  . GLU A 1 18  ? 3.369  31.460 20.291  1.00 41.66 ? 209 GLU A CB  1 
ATOM   107  C  CG  . GLU A 1 18  ? 3.992  31.800 21.642  1.00 43.65 ? 209 GLU A CG  1 
ATOM   108  C  CD  . GLU A 1 18  ? 3.276  32.932 22.368  1.00 46.16 ? 209 GLU A CD  1 
ATOM   109  O  OE1 . GLU A 1 18  ? 2.836  33.905 21.702  1.00 47.30 ? 209 GLU A OE1 1 
ATOM   110  O  OE2 . GLU A 1 18  ? 3.170  32.852 23.617  1.00 46.75 ? 209 GLU A OE2 1 
ATOM   111  N  N   . PRO A 1 19  ? 2.937  28.655 18.130  1.00 45.58 ? 210 PRO A N   1 
ATOM   112  C  CA  . PRO A 1 19  ? 2.414  27.992 16.909  1.00 48.83 ? 210 PRO A CA  1 
ATOM   113  C  C   . PRO A 1 19  ? 1.585  28.902 15.992  1.00 52.88 ? 210 PRO A C   1 
ATOM   114  O  O   . PRO A 1 19  ? 1.778  28.860 14.752  1.00 52.58 ? 210 PRO A O   1 
ATOM   115  C  CB  . PRO A 1 19  ? 1.540  26.849 17.474  1.00 48.87 ? 210 PRO A CB  1 
ATOM   116  C  CG  . PRO A 1 19  ? 2.322  26.443 18.706  1.00 48.11 ? 210 PRO A CG  1 
ATOM   117  C  CD  . PRO A 1 19  ? 3.016  27.685 19.245  1.00 46.06 ? 210 PRO A CD  1 
ATOM   118  N  N   . TRP A 1 20  ? 0.685  29.703 16.607  1.00 57.34 ? 211 TRP A N   1 
ATOM   119  C  CA  . TRP A 1 20  ? -0.186 30.642 15.886  1.00 61.63 ? 211 TRP A CA  1 
ATOM   120  C  C   . TRP A 1 20  ? 0.411  31.198 14.589  1.00 61.36 ? 211 TRP A C   1 
ATOM   121  O  O   . TRP A 1 20  ? 1.503  31.787 14.589  1.00 61.35 ? 211 TRP A O   1 
ATOM   122  C  CB  . TRP A 1 20  ? -0.591 31.827 16.783  1.00 67.75 ? 211 TRP A CB  1 
ATOM   123  C  CG  . TRP A 1 20  ? -1.878 31.701 17.604  1.00 74.19 ? 211 TRP A CG  1 
ATOM   124  C  CD1 . TRP A 1 20  ? -2.390 32.651 18.454  1.00 75.93 ? 211 TRP A CD1 1 
ATOM   125  C  CD2 . TRP A 1 20  ? -2.793 30.585 17.666  1.00 77.51 ? 211 TRP A CD2 1 
ATOM   126  N  NE1 . TRP A 1 20  ? -3.558 32.207 19.028  1.00 78.02 ? 211 TRP A NE1 1 
ATOM   127  C  CE2 . TRP A 1 20  ? -3.830 30.943 18.567  1.00 78.82 ? 211 TRP A CE2 1 
ATOM   128  C  CE3 . TRP A 1 20  ? -2.840 29.321 17.049  1.00 79.20 ? 211 TRP A CE3 1 
ATOM   129  C  CZ2 . TRP A 1 20  ? -4.900 30.084 18.866  1.00 80.14 ? 211 TRP A CZ2 1 
ATOM   130  C  CZ3 . TRP A 1 20  ? -3.909 28.468 17.348  1.00 80.40 ? 211 TRP A CZ3 1 
ATOM   131  C  CH2 . TRP A 1 20  ? -4.922 28.856 18.249  1.00 80.70 ? 211 TRP A CH2 1 
ATOM   132  N  N   . VAL A 1 21  ? -0.317 31.002 13.485  1.00 60.36 ? 212 VAL A N   1 
ATOM   133  C  CA  . VAL A 1 21  ? 0.008  31.680 12.231  1.00 59.52 ? 212 VAL A CA  1 
ATOM   134  C  C   . VAL A 1 21  ? -0.880 32.927 12.198  1.00 58.42 ? 212 VAL A C   1 
ATOM   135  O  O   . VAL A 1 21  ? -1.827 33.011 11.403  1.00 58.89 ? 212 VAL A O   1 
ATOM   136  C  CB  . VAL A 1 21  ? -0.242 30.781 10.991  1.00 60.15 ? 212 VAL A CB  1 
ATOM   137  C  CG1 . VAL A 1 21  ? 0.421  31.390 9.752   1.00 60.41 ? 212 VAL A CG1 1 
ATOM   138  C  CG2 . VAL A 1 21  ? 0.277  29.349 11.230  1.00 60.73 ? 212 VAL A CG2 1 
ATOM   139  N  N   . ARG A 1 22  ? -0.584 33.889 13.083  1.00 55.80 ? 213 ARG A N   1 
ATOM   140  C  CA  . ARG A 1 22  ? -1.456 35.054 13.251  1.00 52.41 ? 213 ARG A CA  1 
ATOM   141  C  C   . ARG A 1 22  ? -0.693 36.380 13.184  1.00 50.40 ? 213 ARG A C   1 
ATOM   142  O  O   . ARG A 1 22  ? -0.226 36.905 14.203  1.00 50.62 ? 213 ARG A O   1 
ATOM   143  C  CB  . ARG A 1 22  ? -2.282 34.932 14.542  1.00 54.04 ? 213 ARG A CB  1 
ATOM   144  C  CG  . ARG A 1 22  ? -3.607 35.725 14.522  1.00 55.31 ? 213 ARG A CG  1 
ATOM   145  C  CD  . ARG A 1 22  ? -3.455 37.111 15.155  1.00 56.31 ? 213 ARG A CD  1 
ATOM   146  N  NE  . ARG A 1 22  ? -3.138 37.014 16.578  1.00 58.28 ? 213 ARG A NE  1 
ATOM   147  C  CZ  . ARG A 1 22  ? -2.708 38.032 17.325  1.00 59.64 ? 213 ARG A CZ  1 
ATOM   148  N  NH1 . ARG A 1 22  ? -2.534 39.242 16.791  1.00 60.11 ? 213 ARG A NH1 1 
ATOM   149  N  NH2 . ARG A 1 22  ? -2.448 37.838 18.610  1.00 60.35 ? 213 ARG A NH2 1 
ATOM   150  N  N   . GLY A 1 23  ? -0.581 36.914 11.965  1.00 48.94 ? 214 GLY A N   1 
ATOM   151  C  CA  . GLY A 1 23  ? 0.092  38.188 11.733  1.00 47.09 ? 214 GLY A CA  1 
ATOM   152  C  C   . GLY A 1 23  ? 1.443  38.025 11.069  1.00 45.66 ? 214 GLY A C   1 
ATOM   153  O  O   . GLY A 1 23  ? 1.876  38.898 10.317  1.00 45.41 ? 214 GLY A O   1 
ATOM   154  N  N   . ARG A 1 24  ? 2.109  36.905 11.351  1.00 44.32 ? 215 ARG A N   1 
ATOM   155  C  CA  . ARG A 1 24  ? 3.451  36.658 10.823  1.00 42.79 ? 215 ARG A CA  1 
ATOM   156  C  C   . ARG A 1 24  ? 3.367  36.196 9.376   1.00 41.59 ? 215 ARG A C   1 
ATOM   157  O  O   . ARG A 1 24  ? 3.461  34.999 9.096   1.00 41.03 ? 215 ARG A O   1 
ATOM   158  C  CB  . ARG A 1 24  ? 4.204  35.625 11.678  1.00 42.83 ? 215 ARG A CB  1 
ATOM   159  C  CG  . ARG A 1 24  ? 4.825  36.182 12.952  1.00 42.84 ? 215 ARG A CG  1 
ATOM   160  C  CD  . ARG A 1 24  ? 3.865  36.133 14.151  1.00 42.92 ? 215 ARG A CD  1 
ATOM   161  N  NE  . ARG A 1 24  ? 3.561  34.768 14.583  1.00 43.88 ? 215 ARG A NE  1 
ATOM   162  C  CZ  . ARG A 1 24  ? 4.299  34.045 15.425  1.00 43.77 ? 215 ARG A CZ  1 
ATOM   163  N  NH1 . ARG A 1 24  ? 5.423  34.532 15.945  1.00 43.76 ? 215 ARG A NH1 1 
ATOM   164  N  NH2 . ARG A 1 24  ? 3.912  32.820 15.745  1.00 43.07 ? 215 ARG A NH2 1 
ATOM   165  N  N   . HIS A 1 25  ? 3.176  37.158 8.470   1.00 40.21 ? 216 HIS A N   1 
ATOM   166  C  CA  . HIS A 1 25  ? 3.027  36.878 7.038   1.00 38.98 ? 216 HIS A CA  1 
ATOM   167  C  C   . HIS A 1 25  ? 4.353  37.004 6.304   1.00 37.34 ? 216 HIS A C   1 
ATOM   168  O  O   . HIS A 1 25  ? 4.446  36.704 5.119   1.00 37.51 ? 216 HIS A O   1 
ATOM   169  C  CB  . HIS A 1 25  ? 2.004  37.820 6.400   1.00 39.69 ? 216 HIS A CB  1 
ATOM   170  C  CG  . HIS A 1 25  ? 0.658  37.770 7.046   1.00 40.91 ? 216 HIS A CG  1 
ATOM   171  N  ND1 . HIS A 1 25  ? 0.295  38.619 8.070   1.00 42.59 ? 216 HIS A ND1 1 
ATOM   172  C  CD2 . HIS A 1 25  ? -0.410 36.969 6.822   1.00 42.75 ? 216 HIS A CD2 1 
ATOM   173  C  CE1 . HIS A 1 25  ? -0.939 38.343 8.450   1.00 43.81 ? 216 HIS A CE1 1 
ATOM   174  N  NE2 . HIS A 1 25  ? -1.390 37.346 7.709   1.00 43.91 ? 216 HIS A NE2 1 
ATOM   175  N  N   . GLU A 1 26  ? 5.372  37.452 7.022   1.00 35.04 ? 217 GLU A N   1 
ATOM   176  C  CA  . GLU A 1 26  ? 6.708  37.563 6.480   1.00 33.00 ? 217 GLU A CA  1 
ATOM   177  C  C   . GLU A 1 26  ? 7.620  36.453 6.993   1.00 30.90 ? 217 GLU A C   1 
ATOM   178  O  O   . GLU A 1 26  ? 7.241  35.685 7.882   1.00 29.78 ? 217 GLU A O   1 
ATOM   179  C  CB  . GLU A 1 26  ? 7.269  38.937 6.809   1.00 33.71 ? 217 GLU A CB  1 
ATOM   180  C  CG  . GLU A 1 26  ? 6.472  40.033 6.091   1.00 36.73 ? 217 GLU A CG  1 
ATOM   181  C  CD  . GLU A 1 26  ? 6.840  41.385 6.615   1.00 41.48 ? 217 GLU A CD  1 
ATOM   182  O  OE1 . GLU A 1 26  ? 7.895  41.919 6.185   1.00 43.40 ? 217 GLU A OE1 1 
ATOM   183  O  OE2 . GLU A 1 26  ? 6.073  41.912 7.460   1.00 43.61 ? 217 GLU A OE2 1 
ATOM   184  N  N   . THR A 1 27  ? 8.809  36.360 6.396   1.00 28.78 ? 218 THR A N   1 
ATOM   185  C  CA  . THR A 1 27  ? 9.835  35.391 6.786   1.00 26.07 ? 218 THR A CA  1 
ATOM   186  C  C   . THR A 1 27  ? 11.147 36.151 6.896   1.00 25.22 ? 218 THR A C   1 
ATOM   187  O  O   . THR A 1 27  ? 11.658 36.629 5.897   1.00 25.45 ? 218 THR A O   1 
ATOM   188  C  CB  . THR A 1 27  ? 10.003 34.272 5.720   1.00 25.91 ? 218 THR A CB  1 
ATOM   189  O  OG1 . THR A 1 27  ? 8.820  33.467 5.661   1.00 23.04 ? 218 THR A OG1 1 
ATOM   190  C  CG2 . THR A 1 27  ? 11.208 33.375 6.041   1.00 25.11 ? 218 THR A CG2 1 
ATOM   191  N  N   . TYR A 1 28  ? 11.681 36.279 8.106   1.00 23.90 ? 219 TYR A N   1 
ATOM   192  C  CA  . TYR A 1 28  ? 12.994 36.894 8.281   1.00 22.68 ? 219 TYR A CA  1 
ATOM   193  C  C   . TYR A 1 28  ? 14.059 35.818 8.295   1.00 22.24 ? 219 TYR A C   1 
ATOM   194  O  O   . TYR A 1 28  ? 13.827 34.711 8.780   1.00 21.94 ? 219 TYR A O   1 
ATOM   195  C  CB  . TYR A 1 28  ? 13.051 37.755 9.546   1.00 22.95 ? 219 TYR A CB  1 
ATOM   196  C  CG  . TYR A 1 28  ? 12.388 39.091 9.355   1.00 22.32 ? 219 TYR A CG  1 
ATOM   197  C  CD1 . TYR A 1 28  ? 10.999 39.198 9.293   1.00 22.13 ? 219 TYR A CD1 1 
ATOM   198  C  CD2 . TYR A 1 28  ? 13.147 40.246 9.191   1.00 24.22 ? 219 TYR A CD2 1 
ATOM   199  C  CE1 . TYR A 1 28  ? 10.382 40.430 9.087   1.00 22.94 ? 219 TYR A CE1 1 
ATOM   200  C  CE2 . TYR A 1 28  ? 12.535 41.488 9.000   1.00 24.21 ? 219 TYR A CE2 1 
ATOM   201  C  CZ  . TYR A 1 28  ? 11.152 41.564 8.950   1.00 24.35 ? 219 TYR A CZ  1 
ATOM   202  O  OH  . TYR A 1 28  ? 10.536 42.786 8.761   1.00 28.26 ? 219 TYR A OH  1 
ATOM   203  N  N   . LEU A 1 29  ? 15.216 36.145 7.735   1.00 21.79 ? 220 LEU A N   1 
ATOM   204  C  CA  . LEU A 1 29  ? 16.293 35.188 7.577   1.00 21.43 ? 220 LEU A CA  1 
ATOM   205  C  C   . LEU A 1 29  ? 17.599 35.880 7.899   1.00 21.46 ? 220 LEU A C   1 
ATOM   206  O  O   . LEU A 1 29  ? 17.973 36.827 7.227   1.00 20.52 ? 220 LEU A O   1 
ATOM   207  C  CB  . LEU A 1 29  ? 16.308 34.645 6.129   1.00 21.25 ? 220 LEU A CB  1 
ATOM   208  C  CG  . LEU A 1 29  ? 17.343 33.579 5.738   1.00 21.09 ? 220 LEU A CG  1 
ATOM   209  C  CD1 . LEU A 1 29  ? 16.866 32.763 4.515   1.00 22.30 ? 220 LEU A CD1 1 
ATOM   210  C  CD2 . LEU A 1 29  ? 18.734 34.187 5.513   1.00 17.83 ? 220 LEU A CD2 1 
ATOM   211  N  N   . CYS A 1 30  ? 18.286 35.387 8.922   1.00 23.07 ? 221 CYS A N   1 
ATOM   212  C  CA  . CYS A 1 30  ? 19.619 35.840 9.300   1.00 24.76 ? 221 CYS A CA  1 
ATOM   213  C  C   . CYS A 1 30  ? 20.612 34.783 8.847   1.00 25.25 ? 221 CYS A C   1 
ATOM   214  O  O   . CYS A 1 30  ? 20.340 33.593 8.972   1.00 26.62 ? 221 CYS A O   1 
ATOM   215  C  CB  . CYS A 1 30  ? 19.711 35.981 10.821  1.00 24.88 ? 221 CYS A CB  1 
ATOM   216  S  SG  . CYS A 1 30  ? 18.366 36.948 11.589  1.00 28.15 ? 221 CYS A SG  1 
ATOM   217  N  N   . TYR A 1 31  ? 21.762 35.203 8.338   1.00 25.80 ? 222 TYR A N   1 
ATOM   218  C  CA  . TYR A 1 31  ? 22.781 34.262 7.864   1.00 26.32 ? 222 TYR A CA  1 
ATOM   219  C  C   . TYR A 1 31  ? 24.192 34.613 8.359   1.00 27.03 ? 222 TYR A C   1 
ATOM   220  O  O   . TYR A 1 31  ? 24.527 35.788 8.572   1.00 26.79 ? 222 TYR A O   1 
ATOM   221  C  CB  . TYR A 1 31  ? 22.761 34.172 6.329   1.00 26.42 ? 222 TYR A CB  1 
ATOM   222  C  CG  . TYR A 1 31  ? 22.969 35.510 5.658   1.00 26.90 ? 222 TYR A CG  1 
ATOM   223  C  CD1 . TYR A 1 31  ? 24.265 36.009 5.419   1.00 28.39 ? 222 TYR A CD1 1 
ATOM   224  C  CD2 . TYR A 1 31  ? 21.881 36.297 5.297   1.00 26.92 ? 222 TYR A CD2 1 
ATOM   225  C  CE1 . TYR A 1 31  ? 24.457 37.260 4.833   1.00 27.81 ? 222 TYR A CE1 1 
ATOM   226  C  CE2 . TYR A 1 31  ? 22.061 37.548 4.701   1.00 28.26 ? 222 TYR A CE2 1 
ATOM   227  C  CZ  . TYR A 1 31  ? 23.346 38.009 4.470   1.00 29.19 ? 222 TYR A CZ  1 
ATOM   228  O  OH  . TYR A 1 31  ? 23.514 39.229 3.887   1.00 32.00 ? 222 TYR A OH  1 
ATOM   229  N  N   . GLU A 1 32  ? 25.009 33.578 8.544   1.00 27.68 ? 223 GLU A N   1 
ATOM   230  C  CA  . GLU A 1 32  ? 26.410 33.743 8.903   1.00 28.56 ? 223 GLU A CA  1 
ATOM   231  C  C   . GLU A 1 32  ? 27.222 32.832 8.009   1.00 28.76 ? 223 GLU A C   1 
ATOM   232  O  O   . GLU A 1 32  ? 26.801 31.724 7.716   1.00 28.35 ? 223 GLU A O   1 
ATOM   233  C  CB  . GLU A 1 32  ? 26.638 33.410 10.382  1.00 28.43 ? 223 GLU A CB  1 
ATOM   234  C  CG  . GLU A 1 32  ? 26.017 34.442 11.326  1.00 31.05 ? 223 GLU A CG  1 
ATOM   235  C  CD  . GLU A 1 32  ? 26.349 34.215 12.787  1.00 33.74 ? 223 GLU A CD  1 
ATOM   236  O  OE1 . GLU A 1 32  ? 25.987 33.160 13.335  1.00 34.98 ? 223 GLU A OE1 1 
ATOM   237  O  OE2 . GLU A 1 32  ? 26.966 35.110 13.396  1.00 37.90 ? 223 GLU A OE2 1 
ATOM   238  N  N   . VAL A 1 33  ? 28.377 33.317 7.560   1.00 30.17 ? 224 VAL A N   1 
ATOM   239  C  CA  . VAL A 1 33  ? 29.254 32.558 6.669   1.00 31.63 ? 224 VAL A CA  1 
ATOM   240  C  C   . VAL A 1 33  ? 30.598 32.372 7.347   1.00 33.43 ? 224 VAL A C   1 
ATOM   241  O  O   . VAL A 1 33  ? 31.190 33.329 7.857   1.00 33.34 ? 224 VAL A O   1 
ATOM   242  C  CB  . VAL A 1 33  ? 29.466 33.234 5.275   1.00 31.51 ? 224 VAL A CB  1 
ATOM   243  C  CG1 . VAL A 1 33  ? 30.229 32.280 4.342   1.00 30.30 ? 224 VAL A CG1 1 
ATOM   244  C  CG2 . VAL A 1 33  ? 28.130 33.582 4.639   1.00 29.96 ? 224 VAL A CG2 1 
ATOM   245  N  N   . GLU A 1 34  ? 31.056 31.121 7.367   1.00 35.64 ? 225 GLU A N   1 
ATOM   246  C  CA  . GLU A 1 34  ? 32.336 30.773 7.956   1.00 37.88 ? 225 GLU A CA  1 
ATOM   247  C  C   . GLU A 1 34  ? 33.125 29.853 7.031   1.00 39.15 ? 225 GLU A C   1 
ATOM   248  O  O   . GLU A 1 34  ? 32.629 28.812 6.593   1.00 38.72 ? 225 GLU A O   1 
ATOM   249  C  CB  . GLU A 1 34  ? 32.121 30.134 9.327   1.00 37.66 ? 225 GLU A CB  1 
ATOM   250  C  CG  . GLU A 1 34  ? 31.722 31.161 10.389  1.00 39.86 ? 225 GLU A CG  1 
ATOM   251  C  CD  . GLU A 1 34  ? 30.893 30.553 11.516  1.00 42.30 ? 225 GLU A CD  1 
ATOM   252  O  OE1 . GLU A 1 34  ? 30.323 31.338 12.302  1.00 43.58 ? 225 GLU A OE1 1 
ATOM   253  O  OE2 . GLU A 1 34  ? 30.807 29.306 11.624  1.00 43.55 ? 225 GLU A OE2 1 
ATOM   254  N  N   . ARG A 1 35  ? 34.352 30.264 6.733   1.00 41.55 ? 226 ARG A N   1 
ATOM   255  C  CA  . ARG A 1 35  ? 35.266 29.484 5.911   1.00 43.90 ? 226 ARG A CA  1 
ATOM   256  C  C   . ARG A 1 35  ? 35.775 28.280 6.693   1.00 45.20 ? 226 ARG A C   1 
ATOM   257  O  O   . ARG A 1 35  ? 36.056 28.376 7.889   1.00 45.14 ? 226 ARG A O   1 
ATOM   258  C  CB  . ARG A 1 35  ? 36.437 30.351 5.454   1.00 44.16 ? 226 ARG A CB  1 
ATOM   259  C  CG  . ARG A 1 35  ? 37.330 29.722 4.388   1.00 45.57 ? 226 ARG A CG  1 
ATOM   260  C  CD  . ARG A 1 35  ? 38.303 30.803 3.858   1.00 47.79 ? 226 ARG A CD  1 
ATOM   261  N  NE  . ARG A 1 35  ? 39.531 30.210 3.334   1.00 50.22 ? 226 ARG A NE  1 
ATOM   262  C  CZ  . ARG A 1 35  ? 40.559 29.810 4.083   1.00 51.59 ? 226 ARG A CZ  1 
ATOM   263  N  NH1 . ARG A 1 35  ? 40.530 29.929 5.404   1.00 52.09 ? 226 ARG A NH1 1 
ATOM   264  N  NH2 . ARG A 1 35  ? 41.628 29.288 3.506   1.00 53.51 ? 226 ARG A NH2 1 
ATOM   265  N  N   . MET A 1 36  ? 35.898 27.156 5.991   1.00 47.47 ? 227 MET A N   1 
ATOM   266  C  CA  . MET A 1 36  ? 36.203 25.853 6.590   1.00 49.51 ? 227 MET A CA  1 
ATOM   267  C  C   . MET A 1 36  ? 37.601 25.715 7.183   1.00 50.81 ? 227 MET A C   1 
ATOM   268  O  O   . MET A 1 36  ? 37.765 25.052 8.201   1.00 51.40 ? 227 MET A O   1 
ATOM   269  C  CB  . MET A 1 36  ? 35.996 24.739 5.558   1.00 49.55 ? 227 MET A CB  1 
ATOM   270  C  CG  . MET A 1 36  ? 35.469 23.440 6.130   1.00 49.61 ? 227 MET A CG  1 
ATOM   271  S  SD  . MET A 1 36  ? 33.702 23.481 6.481   1.00 49.99 ? 227 MET A SD  1 
ATOM   272  C  CE  . MET A 1 36  ? 33.016 22.878 4.951   1.00 48.70 ? 227 MET A CE  1 
ATOM   273  N  N   . HIS A 1 37  ? 38.602 26.317 6.543   1.00 52.37 ? 228 HIS A N   1 
ATOM   274  C  CA  . HIS A 1 37  ? 40.012 26.155 6.948   1.00 53.81 ? 228 HIS A CA  1 
ATOM   275  C  C   . HIS A 1 37  ? 40.518 24.729 6.703   1.00 54.66 ? 228 HIS A C   1 
ATOM   276  O  O   . HIS A 1 37  ? 40.128 23.777 7.395   1.00 54.63 ? 228 HIS A O   1 
ATOM   277  C  CB  . HIS A 1 37  ? 40.250 26.567 8.412   1.00 53.79 ? 228 HIS A CB  1 
ATOM   278  C  CG  . HIS A 1 37  ? 41.697 26.755 8.758   1.00 54.16 ? 228 HIS A CG  1 
ATOM   279  N  ND1 . HIS A 1 37  ? 42.613 25.721 8.697   1.00 53.82 ? 228 HIS A ND1 1 
ATOM   280  C  CD2 . HIS A 1 37  ? 42.384 27.858 9.166   1.00 54.35 ? 228 HIS A CD2 1 
ATOM   281  C  CE1 . HIS A 1 37  ? 43.803 26.180 9.049   1.00 54.11 ? 228 HIS A CE1 1 
ATOM   282  N  NE2 . HIS A 1 37  ? 43.692 27.473 9.341   1.00 54.38 ? 228 HIS A NE2 1 
ATOM   283  N  N   . ASN A 1 38  ? 41.412 24.613 5.724   1.00 55.75 ? 229 ASN A N   1 
ATOM   284  C  CA  . ASN A 1 38  ? 41.850 23.321 5.188   1.00 56.80 ? 229 ASN A CA  1 
ATOM   285  C  C   . ASN A 1 38  ? 42.775 22.518 6.111   1.00 57.68 ? 229 ASN A C   1 
ATOM   286  O  O   . ASN A 1 38  ? 42.823 21.278 6.031   1.00 57.73 ? 229 ASN A O   1 
ATOM   287  C  CB  . ASN A 1 38  ? 42.490 23.509 3.793   1.00 56.67 ? 229 ASN A CB  1 
ATOM   288  C  CG  . ASN A 1 38  ? 41.650 24.421 2.884   1.00 56.54 ? 229 ASN A CG  1 
ATOM   289  O  OD1 . ASN A 1 38  ? 42.194 25.299 2.155   1.00 57.03 ? 229 ASN A OD1 1 
ATOM   290  N  ND2 . ASN A 1 38  ? 40.321 24.219 2.933   1.00 55.86 ? 229 ASN A ND2 1 
ATOM   291  N  N   . ASP A 1 39  ? 43.497 23.223 6.988   1.00 58.97 ? 230 ASP A N   1 
ATOM   292  C  CA  . ASP A 1 39  ? 44.436 22.563 7.904   1.00 60.14 ? 230 ASP A CA  1 
ATOM   293  C  C   . ASP A 1 39  ? 43.779 22.115 9.213   1.00 60.68 ? 230 ASP A C   1 
ATOM   294  O  O   . ASP A 1 39  ? 43.662 20.911 9.480   1.00 60.80 ? 230 ASP A O   1 
ATOM   295  C  CB  . ASP A 1 39  ? 45.646 23.466 8.195   1.00 60.37 ? 230 ASP A CB  1 
ATOM   296  C  CG  . ASP A 1 39  ? 46.623 23.536 7.035   1.00 60.99 ? 230 ASP A CG  1 
ATOM   297  O  OD1 . ASP A 1 39  ? 46.174 23.717 5.870   1.00 62.22 ? 230 ASP A OD1 1 
ATOM   298  O  OD2 . ASP A 1 39  ? 47.852 23.421 7.293   1.00 62.05 ? 230 ASP A OD2 1 
ATOM   299  N  N   . THR A 1 40  ? 43.352 23.095 10.020  1.00 61.36 ? 231 THR A N   1 
ATOM   300  C  CA  . THR A 1 40  ? 42.834 22.827 11.364  1.00 61.72 ? 231 THR A CA  1 
ATOM   301  C  C   . THR A 1 40  ? 41.322 22.558 11.395  1.00 61.88 ? 231 THR A C   1 
ATOM   302  O  O   . THR A 1 40  ? 40.675 22.409 10.352  1.00 61.91 ? 231 THR A O   1 
ATOM   303  C  CB  . THR A 1 40  ? 43.164 23.989 12.313  1.00 61.75 ? 231 THR A CB  1 
ATOM   304  O  OG1 . THR A 1 40  ? 42.571 25.189 11.810  1.00 62.36 ? 231 THR A OG1 1 
ATOM   305  C  CG2 . THR A 1 40  ? 44.673 24.191 12.434  1.00 62.11 ? 231 THR A CG2 1 
ATOM   306  N  N   . TRP A 1 41  ? 40.774 22.506 12.606  1.00 61.97 ? 232 TRP A N   1 
ATOM   307  C  CA  . TRP A 1 41  ? 39.369 22.186 12.831  1.00 62.17 ? 232 TRP A CA  1 
ATOM   308  C  C   . TRP A 1 41  ? 38.507 23.448 12.893  1.00 61.79 ? 232 TRP A C   1 
ATOM   309  O  O   . TRP A 1 41  ? 37.286 23.359 13.030  1.00 61.87 ? 232 TRP A O   1 
ATOM   310  C  CB  . TRP A 1 41  ? 39.201 21.408 14.149  1.00 62.55 ? 232 TRP A CB  1 
ATOM   311  C  CG  . TRP A 1 41  ? 39.987 20.110 14.269  1.00 63.93 ? 232 TRP A CG  1 
ATOM   312  C  CD1 . TRP A 1 41  ? 41.269 19.870 13.837  1.00 64.89 ? 232 TRP A CD1 1 
ATOM   313  C  CD2 . TRP A 1 41  ? 39.543 18.896 14.898  1.00 65.16 ? 232 TRP A CD2 1 
ATOM   314  N  NE1 . TRP A 1 41  ? 41.635 18.579 14.139  1.00 65.41 ? 232 TRP A NE1 1 
ATOM   315  C  CE2 . TRP A 1 41  ? 40.596 17.958 14.792  1.00 65.73 ? 232 TRP A CE2 1 
ATOM   316  C  CE3 . TRP A 1 41  ? 38.352 18.504 15.535  1.00 65.88 ? 232 TRP A CE3 1 
ATOM   317  C  CZ2 . TRP A 1 41  ? 40.495 16.652 15.300  1.00 66.23 ? 232 TRP A CZ2 1 
ATOM   318  C  CZ3 . TRP A 1 41  ? 38.252 17.203 16.041  1.00 66.21 ? 232 TRP A CZ3 1 
ATOM   319  C  CH2 . TRP A 1 41  ? 39.319 16.295 15.919  1.00 66.36 ? 232 TRP A CH2 1 
ATOM   320  N  N   . VAL A 1 42  ? 39.132 24.619 12.788  1.00 61.36 ? 233 VAL A N   1 
ATOM   321  C  CA  . VAL A 1 42  ? 38.435 25.886 13.078  1.00 60.80 ? 233 VAL A CA  1 
ATOM   322  C  C   . VAL A 1 42  ? 37.719 26.526 11.887  1.00 60.28 ? 233 VAL A C   1 
ATOM   323  O  O   . VAL A 1 42  ? 38.080 26.299 10.731  1.00 60.26 ? 233 VAL A O   1 
ATOM   324  C  CB  . VAL A 1 42  ? 39.357 26.934 13.776  1.00 60.85 ? 233 VAL A CB  1 
ATOM   325  C  CG1 . VAL A 1 42  ? 39.777 26.437 15.152  1.00 61.10 ? 233 VAL A CG1 1 
ATOM   326  C  CG2 . VAL A 1 42  ? 40.568 27.269 12.922  1.00 60.76 ? 233 VAL A CG2 1 
ATOM   327  N  N   . LEU A 1 43  ? 36.694 27.320 12.199  1.00 59.63 ? 234 LEU A N   1 
ATOM   328  C  CA  . LEU A 1 43  ? 35.961 28.090 11.199  1.00 58.98 ? 234 LEU A CA  1 
ATOM   329  C  C   . LEU A 1 43  ? 36.367 29.564 11.283  1.00 58.73 ? 234 LEU A C   1 
ATOM   330  O  O   . LEU A 1 43  ? 36.655 30.068 12.376  1.00 58.72 ? 234 LEU A O   1 
ATOM   331  C  CB  . LEU A 1 43  ? 34.452 27.934 11.421  1.00 58.85 ? 234 LEU A CB  1 
ATOM   332  C  CG  . LEU A 1 43  ? 33.863 26.515 11.387  1.00 58.60 ? 234 LEU A CG  1 
ATOM   333  C  CD1 . LEU A 1 43  ? 32.560 26.476 12.176  1.00 58.20 ? 234 LEU A CD1 1 
ATOM   334  C  CD2 . LEU A 1 43  ? 33.657 26.001 9.957   1.00 58.10 ? 234 LEU A CD2 1 
ATOM   335  N  N   . LEU A 1 44  ? 36.401 30.244 10.130  1.00 58.24 ? 235 LEU A N   1 
ATOM   336  C  CA  . LEU A 1 44  ? 36.770 31.668 10.075  1.00 57.67 ? 235 LEU A CA  1 
ATOM   337  C  C   . LEU A 1 44  ? 35.588 32.555 9.694   1.00 56.96 ? 235 LEU A C   1 
ATOM   338  O  O   . LEU A 1 44  ? 34.916 32.302 8.691   1.00 56.94 ? 235 LEU A O   1 
ATOM   339  C  CB  . LEU A 1 44  ? 37.943 31.903 9.100   1.00 57.92 ? 235 LEU A CB  1 
ATOM   340  C  CG  . LEU A 1 44  ? 38.394 33.351 8.807   1.00 58.20 ? 235 LEU A CG  1 
ATOM   341  C  CD1 . LEU A 1 44  ? 38.910 34.067 10.059  1.00 58.82 ? 235 LEU A CD1 1 
ATOM   342  C  CD2 . LEU A 1 44  ? 39.445 33.405 7.697   1.00 58.61 ? 235 LEU A CD2 1 
ATOM   343  N  N   . ASN A 1 45  ? 35.358 33.602 10.490  1.00 56.02 ? 236 ASN A N   1 
ATOM   344  C  CA  . ASN A 1 45  ? 34.287 34.570 10.233  1.00 55.00 ? 236 ASN A CA  1 
ATOM   345  C  C   . ASN A 1 45  ? 34.460 35.205 8.862   1.00 53.95 ? 236 ASN A C   1 
ATOM   346  O  O   . ASN A 1 45  ? 35.524 35.742 8.548   1.00 54.24 ? 236 ASN A O   1 
ATOM   347  C  CB  . ASN A 1 45  ? 34.270 35.678 11.301  1.00 55.39 ? 236 ASN A CB  1 
ATOM   348  C  CG  . ASN A 1 45  ? 34.380 35.127 12.720  1.00 56.05 ? 236 ASN A CG  1 
ATOM   349  O  OD1 . ASN A 1 45  ? 34.902 35.803 13.628  1.00 57.02 ? 236 ASN A OD1 1 
ATOM   350  N  ND2 . ASN A 1 45  ? 33.891 33.901 12.920  1.00 56.89 ? 236 ASN A ND2 1 
ATOM   351  N  N   . GLN A 1 46  ? 33.421 35.129 8.041   1.00 52.37 ? 237 GLN A N   1 
ATOM   352  C  CA  . GLN A 1 46  ? 33.483 35.679 6.695   1.00 50.79 ? 237 GLN A CA  1 
ATOM   353  C  C   . GLN A 1 46  ? 32.558 36.885 6.551   1.00 49.33 ? 237 GLN A C   1 
ATOM   354  O  O   . GLN A 1 46  ? 33.002 37.974 6.185   1.00 49.34 ? 237 GLN A O   1 
ATOM   355  C  CB  . GLN A 1 46  ? 33.157 34.602 5.653   1.00 51.08 ? 237 GLN A CB  1 
ATOM   356  C  CG  . GLN A 1 46  ? 34.148 33.446 5.616   1.00 51.97 ? 237 GLN A CG  1 
ATOM   357  C  CD  . GLN A 1 46  ? 35.542 33.880 5.178   1.00 53.42 ? 237 GLN A CD  1 
ATOM   358  O  OE1 . GLN A 1 46  ? 35.701 34.600 4.184   1.00 53.34 ? 237 GLN A OE1 1 
ATOM   359  N  NE2 . GLN A 1 46  ? 36.560 33.445 5.924   1.00 54.13 ? 237 GLN A NE2 1 
ATOM   360  N  N   . ARG A 1 47  ? 31.276 36.677 6.845   1.00 47.31 ? 238 ARG A N   1 
ATOM   361  C  CA  . ARG A 1 47  ? 30.267 37.734 6.785   1.00 45.23 ? 238 ARG A CA  1 
ATOM   362  C  C   . ARG A 1 47  ? 28.960 37.313 7.459   1.00 43.02 ? 238 ARG A C   1 
ATOM   363  O  O   . ARG A 1 47  ? 28.792 36.160 7.868   1.00 42.35 ? 238 ARG A O   1 
ATOM   364  C  CB  . ARG A 1 47  ? 30.008 38.187 5.337   1.00 45.85 ? 238 ARG A CB  1 
ATOM   365  C  CG  . ARG A 1 47  ? 29.650 37.072 4.361   1.00 47.29 ? 238 ARG A CG  1 
ATOM   366  C  CD  . ARG A 1 47  ? 30.495 37.185 3.091   1.00 50.63 ? 238 ARG A CD  1 
ATOM   367  N  NE  . ARG A 1 47  ? 31.930 37.072 3.371   1.00 52.76 ? 238 ARG A NE  1 
ATOM   368  C  CZ  . ARG A 1 47  ? 32.898 37.203 2.464   1.00 53.67 ? 238 ARG A CZ  1 
ATOM   369  N  NH1 . ARG A 1 47  ? 32.608 37.454 1.193   1.00 54.18 ? 238 ARG A NH1 1 
ATOM   370  N  NH2 . ARG A 1 47  ? 34.167 37.081 2.834   1.00 53.60 ? 238 ARG A NH2 1 
ATOM   371  N  N   . ARG A 1 48  ? 28.046 38.271 7.566   1.00 40.39 ? 239 ARG A N   1 
ATOM   372  C  CA  . ARG A 1 48  ? 26.760 38.062 8.205   1.00 38.09 ? 239 ARG A CA  1 
ATOM   373  C  C   . ARG A 1 48  ? 25.790 39.131 7.749   1.00 35.70 ? 239 ARG A C   1 
ATOM   374  O  O   . ARG A 1 48  ? 26.192 40.170 7.229   1.00 35.20 ? 239 ARG A O   1 
ATOM   375  C  CB  . ARG A 1 48  ? 26.892 38.083 9.742   1.00 38.81 ? 239 ARG A CB  1 
ATOM   376  C  CG  . ARG A 1 48  ? 27.429 39.397 10.324  1.00 41.12 ? 239 ARG A CG  1 
ATOM   377  C  CD  . ARG A 1 48  ? 27.293 39.459 11.844  1.00 44.79 ? 239 ARG A CD  1 
ATOM   378  N  NE  . ARG A 1 48  ? 27.799 38.236 12.486  1.00 48.54 ? 239 ARG A NE  1 
ATOM   379  C  CZ  . ARG A 1 48  ? 29.085 38.001 12.765  1.00 50.87 ? 239 ARG A CZ  1 
ATOM   380  N  NH1 . ARG A 1 48  ? 30.025 38.900 12.455  1.00 50.98 ? 239 ARG A NH1 1 
ATOM   381  N  NH2 . ARG A 1 48  ? 29.435 36.856 13.356  1.00 51.98 ? 239 ARG A NH2 1 
ATOM   382  N  N   . GLY A 1 49  ? 24.506 38.874 7.958   1.00 32.92 ? 240 GLY A N   1 
ATOM   383  C  CA  . GLY A 1 49  ? 23.478 39.799 7.543   1.00 29.90 ? 240 GLY A CA  1 
ATOM   384  C  C   . GLY A 1 49  ? 22.121 39.163 7.706   1.00 28.05 ? 240 GLY A C   1 
ATOM   385  O  O   . GLY A 1 49  ? 22.010 38.006 8.111   1.00 27.11 ? 240 GLY A O   1 
ATOM   386  N  N   . PHE A 1 50  ? 21.081 39.913 7.372   1.00 26.47 ? 241 PHE A N   1 
ATOM   387  C  CA  . PHE A 1 50  ? 19.743 39.377 7.450   1.00 25.64 ? 241 PHE A CA  1 
ATOM   388  C  C   . PHE A 1 50  ? 18.899 39.990 6.353   1.00 25.46 ? 241 PHE A C   1 
ATOM   389  O  O   . PHE A 1 50  ? 19.299 40.970 5.731   1.00 24.78 ? 241 PHE A O   1 
ATOM   390  C  CB  . PHE A 1 50  ? 19.124 39.654 8.836   1.00 25.14 ? 241 PHE A CB  1 
ATOM   391  C  CG  . PHE A 1 50  ? 18.557 41.041 8.983   1.00 24.92 ? 241 PHE A CG  1 
ATOM   392  C  CD1 . PHE A 1 50  ? 17.196 41.274 8.804   1.00 25.16 ? 241 PHE A CD1 1 
ATOM   393  C  CD2 . PHE A 1 50  ? 19.385 42.113 9.289   1.00 25.18 ? 241 PHE A CD2 1 
ATOM   394  C  CE1 . PHE A 1 50  ? 16.665 42.561 8.930   1.00 26.14 ? 241 PHE A CE1 1 
ATOM   395  C  CE2 . PHE A 1 50  ? 18.862 43.404 9.425   1.00 27.35 ? 241 PHE A CE2 1 
ATOM   396  C  CZ  . PHE A 1 50  ? 17.491 43.623 9.241   1.00 26.27 ? 241 PHE A CZ  1 
ATOM   397  N  N   . LEU A 1 51  ? 17.708 39.436 6.161   1.00 25.57 ? 242 LEU A N   1 
ATOM   398  C  CA  . LEU A 1 51  ? 16.786 39.910 5.144   1.00 26.33 ? 242 LEU A CA  1 
ATOM   399  C  C   . LEU A 1 51  ? 15.390 39.328 5.370   1.00 26.71 ? 242 LEU A C   1 
ATOM   400  O  O   . LEU A 1 51  ? 15.207 38.447 6.194   1.00 26.05 ? 242 LEU A O   1 
ATOM   401  C  CB  . LEU A 1 51  ? 17.306 39.523 3.751   1.00 26.25 ? 242 LEU A CB  1 
ATOM   402  C  CG  . LEU A 1 51  ? 17.500 38.040 3.421   1.00 25.62 ? 242 LEU A CG  1 
ATOM   403  C  CD1 . LEU A 1 51  ? 16.224 37.435 2.854   1.00 21.99 ? 242 LEU A CD1 1 
ATOM   404  C  CD2 . LEU A 1 51  ? 18.650 37.946 2.403   1.00 26.54 ? 242 LEU A CD2 1 
ATOM   405  N  N   . CYS A 1 52  ? 14.410 39.816 4.629   1.00 28.24 ? 243 CYS A N   1 
ATOM   406  C  CA  . CYS A 1 52  ? 13.073 39.234 4.688   1.00 30.60 ? 243 CYS A CA  1 
ATOM   407  C  C   . CYS A 1 52  ? 12.532 39.124 3.270   1.00 31.20 ? 243 CYS A C   1 
ATOM   408  O  O   . CYS A 1 52  ? 13.183 39.576 2.324   1.00 30.86 ? 243 CYS A O   1 
ATOM   409  C  CB  . CYS A 1 52  ? 12.153 40.059 5.596   1.00 30.62 ? 243 CYS A CB  1 
ATOM   410  S  SG  . CYS A 1 52  ? 11.611 41.622 4.885   1.00 36.22 ? 243 CYS A SG  1 
ATOM   411  N  N   . ASN A 1 53  ? 11.370 38.494 3.118   1.00 32.48 ? 244 ASN A N   1 
ATOM   412  C  CA  . ASN A 1 53  ? 10.772 38.308 1.810   1.00 34.41 ? 244 ASN A CA  1 
ATOM   413  C  C   . ASN A 1 53  ? 10.444 39.651 1.156   1.00 36.36 ? 244 ASN A C   1 
ATOM   414  O  O   . ASN A 1 53  ? 10.391 40.673 1.831   1.00 36.53 ? 244 ASN A O   1 
ATOM   415  C  CB  . ASN A 1 53  ? 9.505  37.489 1.947   1.00 34.11 ? 244 ASN A CB  1 
ATOM   416  C  CG  . ASN A 1 53  ? 8.453  38.212 2.734   1.00 33.52 ? 244 ASN A CG  1 
ATOM   417  O  OD1 . ASN A 1 53  ? 8.577  38.393 3.951   1.00 32.05 ? 244 ASN A OD1 1 
ATOM   418  N  ND2 . ASN A 1 53  ? 7.430  38.669 2.047   1.00 32.83 ? 244 ASN A ND2 1 
ATOM   419  N  N   . GLN A 1 54  ? 10.233 39.641 -0.159  1.00 38.93 ? 245 GLN A N   1 
ATOM   420  C  CA  . GLN A 1 54  ? 9.842  40.839 -0.898  1.00 41.11 ? 245 GLN A CA  1 
ATOM   421  C  C   . GLN A 1 54  ? 8.405  40.690 -1.378  1.00 42.08 ? 245 GLN A C   1 
ATOM   422  O  O   . GLN A 1 54  ? 8.154  40.073 -2.425  1.00 42.48 ? 245 GLN A O   1 
ATOM   423  C  CB  . GLN A 1 54  ? 10.776 41.081 -2.098  1.00 41.47 ? 245 GLN A CB  1 
ATOM   424  C  CG  . GLN A 1 54  ? 12.220 41.442 -1.733  1.00 43.51 ? 245 GLN A CG  1 
ATOM   425  C  CD  . GLN A 1 54  ? 12.299 42.645 -0.795  1.00 47.01 ? 245 GLN A CD  1 
ATOM   426  O  OE1 . GLN A 1 54  ? 11.983 43.774 -1.185  1.00 48.92 ? 245 GLN A OE1 1 
ATOM   427  N  NE2 . GLN A 1 54  ? 12.720 42.407 0.451   1.00 47.17 ? 245 GLN A NE2 1 
ATOM   428  N  N   . ALA A 1 55  ? 7.470  41.255 -0.604  1.00 43.36 ? 246 ALA A N   1 
ATOM   429  C  CA  . ALA A 1 55  ? 6.040  41.231 -0.929  1.00 44.90 ? 246 ALA A CA  1 
ATOM   430  C  C   . ALA A 1 55  ? 5.752  41.545 -2.406  1.00 46.04 ? 246 ALA A C   1 
ATOM   431  O  O   . ALA A 1 55  ? 6.468  42.346 -3.023  1.00 45.77 ? 246 ALA A O   1 
ATOM   432  C  CB  . ALA A 1 55  ? 5.279  42.190 -0.020  1.00 44.89 ? 246 ALA A CB  1 
ATOM   433  N  N   . PRO A 1 56  ? 4.723  40.888 -2.990  1.00 47.39 ? 247 PRO A N   1 
ATOM   434  C  CA  . PRO A 1 56  ? 4.349  41.198 -4.375  1.00 48.37 ? 247 PRO A CA  1 
ATOM   435  C  C   . PRO A 1 56  ? 4.176  42.705 -4.592  1.00 49.37 ? 247 PRO A C   1 
ATOM   436  O  O   . PRO A 1 56  ? 3.618  43.407 -3.732  1.00 49.42 ? 247 PRO A O   1 
ATOM   437  C  CB  . PRO A 1 56  ? 3.029  40.444 -4.558  1.00 48.40 ? 247 PRO A CB  1 
ATOM   438  C  CG  . PRO A 1 56  ? 3.159  39.272 -3.649  1.00 47.90 ? 247 PRO A CG  1 
ATOM   439  C  CD  . PRO A 1 56  ? 3.878  39.812 -2.425  1.00 47.49 ? 247 PRO A CD  1 
ATOM   440  N  N   . HIS A 1 57  ? 4.699  43.189 -5.721  1.00 50.54 ? 248 HIS A N   1 
ATOM   441  C  CA  . HIS A 1 57  ? 4.750  44.618 -5.993  1.00 51.54 ? 248 HIS A CA  1 
ATOM   442  C  C   . HIS A 1 57  ? 4.800  44.864 -7.493  1.00 52.09 ? 248 HIS A C   1 
ATOM   443  O  O   . HIS A 1 57  ? 5.539  44.192 -8.219  1.00 52.15 ? 248 HIS A O   1 
ATOM   444  C  CB  . HIS A 1 57  ? 5.981  45.229 -5.320  1.00 51.64 ? 248 HIS A CB  1 
ATOM   445  C  CG  . HIS A 1 57  ? 5.870  46.701 -5.077  1.00 52.70 ? 248 HIS A CG  1 
ATOM   446  N  ND1 . HIS A 1 57  ? 5.212  47.233 -3.975  1.00 53.33 ? 248 HIS A ND1 1 
ATOM   447  C  CD2 . HIS A 1 57  ? 6.342  47.756 -5.787  1.00 53.94 ? 248 HIS A CD2 1 
ATOM   448  C  CE1 . HIS A 1 57  ? 5.278  48.553 -4.020  1.00 54.30 ? 248 HIS A CE1 1 
ATOM   449  N  NE2 . HIS A 1 57  ? 5.961  48.895 -5.109  1.00 54.48 ? 248 HIS A NE2 1 
ATOM   450  N  N   . LYS A 1 58  ? 4.015  45.840 -7.944  1.00 52.87 ? 249 LYS A N   1 
ATOM   451  C  CA  . LYS A 1 58  ? 3.903  46.173 -9.365  1.00 53.54 ? 249 LYS A CA  1 
ATOM   452  C  C   . LYS A 1 58  ? 5.169  46.843 -9.902  1.00 53.90 ? 249 LYS A C   1 
ATOM   453  O  O   . LYS A 1 58  ? 5.442  46.796 -11.104 1.00 54.01 ? 249 LYS A O   1 
ATOM   454  C  CB  . LYS A 1 58  ? 2.669  47.046 -9.610  1.00 53.68 ? 249 LYS A CB  1 
ATOM   455  C  CG  . LYS A 1 58  ? 1.373  46.369 -9.186  1.00 54.05 ? 249 LYS A CG  1 
ATOM   456  C  CD  . LYS A 1 58  ? 0.164  47.262 -9.382  1.00 54.72 ? 249 LYS A CD  1 
ATOM   457  C  CE  . LYS A 1 58  ? -1.085 46.655 -8.730  1.00 54.74 ? 249 LYS A CE  1 
ATOM   458  N  NZ  . LYS A 1 58  ? -1.537 45.424 -9.481  1.00 54.75 ? 249 LYS A NZ  1 
ATOM   459  N  N   . HIS A 1 59  ? 5.938  47.447 -8.996  1.00 54.27 ? 250 HIS A N   1 
ATOM   460  C  CA  . HIS A 1 59  ? 7.201  48.104 -9.335  1.00 54.41 ? 250 HIS A CA  1 
ATOM   461  C  C   . HIS A 1 59  ? 8.411  47.231 -9.005  1.00 54.34 ? 250 HIS A C   1 
ATOM   462  O  O   . HIS A 1 59  ? 9.556  47.668 -9.144  1.00 54.21 ? 250 HIS A O   1 
ATOM   463  C  CB  . HIS A 1 59  ? 7.298  49.447 -8.614  1.00 54.47 ? 250 HIS A CB  1 
ATOM   464  C  CG  . HIS A 1 59  ? 6.236  50.425 -9.013  1.00 55.01 ? 250 HIS A CG  1 
ATOM   465  N  ND1 . HIS A 1 59  ? 6.498  51.526 -9.804  1.00 55.78 ? 250 HIS A ND1 1 
ATOM   466  C  CD2 . HIS A 1 59  ? 4.911  50.471 -8.728  1.00 55.14 ? 250 HIS A CD2 1 
ATOM   467  C  CE1 . HIS A 1 59  ? 5.381  52.205 -9.994  1.00 55.77 ? 250 HIS A CE1 1 
ATOM   468  N  NE2 . HIS A 1 59  ? 4.403  51.586 -9.351  1.00 55.35 ? 250 HIS A NE2 1 
ATOM   469  N  N   . GLY A 1 60  ? 8.143  45.997 -8.572  1.00 54.44 ? 251 GLY A N   1 
ATOM   470  C  CA  . GLY A 1 60  ? 9.191  45.024 -8.253  1.00 54.43 ? 251 GLY A CA  1 
ATOM   471  C  C   . GLY A 1 60  ? 8.829  43.638 -8.750  1.00 54.45 ? 251 GLY A C   1 
ATOM   472  O  O   . GLY A 1 60  ? 8.280  43.491 -9.857  1.00 54.50 ? 251 GLY A O   1 
ATOM   473  N  N   . PHE A 1 61  ? 9.141  42.621 -7.929  1.00 54.41 ? 252 PHE A N   1 
ATOM   474  C  CA  . PHE A 1 61  ? 8.732  41.241 -8.225  1.00 54.30 ? 252 PHE A CA  1 
ATOM   475  C  C   . PHE A 1 61  ? 7.202  41.103 -8.149  1.00 53.87 ? 252 PHE A C   1 
ATOM   476  O  O   . PHE A 1 61  ? 6.598  41.099 -7.041  1.00 53.77 ? 252 PHE A O   1 
ATOM   477  C  CB  . PHE A 1 61  ? 9.413  40.246 -7.273  1.00 54.57 ? 252 PHE A CB  1 
ATOM   478  C  CG  . PHE A 1 61  ? 10.918 40.368 -7.221  1.00 56.01 ? 252 PHE A CG  1 
ATOM   479  C  CD1 . PHE A 1 61  ? 11.529 41.126 -6.171  1.00 56.49 ? 252 PHE A CD1 1 
ATOM   480  C  CD2 . PHE A 1 61  ? 11.722 39.716 -8.211  1.00 56.83 ? 252 PHE A CD2 1 
ATOM   481  C  CE1 . PHE A 1 61  ? 12.919 41.238 -6.114  1.00 57.19 ? 252 PHE A CE1 1 
ATOM   482  C  CE2 . PHE A 1 61  ? 13.115 39.821 -8.162  1.00 57.13 ? 252 PHE A CE2 1 
ATOM   483  C  CZ  . PHE A 1 61  ? 13.713 40.585 -7.112  1.00 57.02 ? 252 PHE A CZ  1 
ATOM   484  N  N   . LEU A 1 62  ? 6.588  41.008 -9.343  1.00 53.30 ? 253 LEU A N   1 
ATOM   485  C  CA  . LEU A 1 62  ? 5.126  40.936 -9.465  1.00 52.67 ? 253 LEU A CA  1 
ATOM   486  C  C   . LEU A 1 62  ? 4.529  39.771 -8.676  1.00 51.76 ? 253 LEU A C   1 
ATOM   487  O  O   . LEU A 1 62  ? 3.548  39.944 -7.940  1.00 51.89 ? 253 LEU A O   1 
ATOM   488  C  CB  . LEU A 1 62  ? 4.721  40.839 -10.950 1.00 54.46 ? 253 LEU A CB  1 
ATOM   489  C  CG  . LEU A 1 62  ? 3.255  40.611 -11.341 1.00 55.45 ? 253 LEU A CG  1 
ATOM   490  C  CD1 . LEU A 1 62  ? 2.394  41.843 -11.069 1.00 56.55 ? 253 LEU A CD1 1 
ATOM   491  C  CD2 . LEU A 1 62  ? 3.164  40.193 -12.806 1.00 56.37 ? 253 LEU A CD2 1 
ATOM   492  N  N   . GLU A 1 63  ? 5.143  38.596 -8.834  1.00 50.47 ? 254 GLU A N   1 
ATOM   493  C  CA  . GLU A 1 63  ? 4.681  37.364 -8.200  1.00 49.08 ? 254 GLU A CA  1 
ATOM   494  C  C   . GLU A 1 63  ? 5.327  37.157 -6.821  1.00 47.65 ? 254 GLU A C   1 
ATOM   495  O  O   . GLU A 1 63  ? 5.221  36.079 -6.225  1.00 47.91 ? 254 GLU A O   1 
ATOM   496  C  CB  . GLU A 1 63  ? 4.956  36.166 -9.129  1.00 49.41 ? 254 GLU A CB  1 
ATOM   497  C  CG  . GLU A 1 63  ? 4.044  34.945 -8.913  1.00 51.94 ? 254 GLU A CG  1 
ATOM   498  C  CD  . GLU A 1 63  ? 2.595  35.189 -9.321  1.00 53.03 ? 254 GLU A CD  1 
ATOM   499  O  OE1 . GLU A 1 63  ? 1.685  34.485 -8.778  1.00 54.68 ? 254 GLU A OE1 1 
ATOM   500  O  OE2 . GLU A 1 63  ? 2.357  36.087 -10.171 1.00 53.51 ? 254 GLU A OE2 1 
ATOM   501  N  N   . GLY A 1 64  ? 5.988  38.199 -6.314  1.00 45.64 ? 255 GLY A N   1 
ATOM   502  C  CA  . GLY A 1 64  ? 6.604  38.149 -4.988  1.00 42.63 ? 255 GLY A CA  1 
ATOM   503  C  C   . GLY A 1 64  ? 7.943  37.435 -4.995  1.00 40.49 ? 255 GLY A C   1 
ATOM   504  O  O   . GLY A 1 64  ? 8.236  36.633 -5.903  1.00 40.96 ? 255 GLY A O   1 
ATOM   505  N  N   . ARG A 1 65  ? 8.753  37.723 -3.971  1.00 37.38 ? 256 ARG A N   1 
ATOM   506  C  CA  . ARG A 1 65  ? 10.088 37.150 -3.858  1.00 34.15 ? 256 ARG A CA  1 
ATOM   507  C  C   . ARG A 1 65  ? 10.305 36.649 -2.436  1.00 32.04 ? 256 ARG A C   1 
ATOM   508  O  O   . ARG A 1 65  ? 10.439 37.438 -1.498  1.00 30.99 ? 256 ARG A O   1 
ATOM   509  C  CB  . ARG A 1 65  ? 11.144 38.196 -4.237  1.00 34.27 ? 256 ARG A CB  1 
ATOM   510  C  CG  . ARG A 1 65  ? 12.541 37.652 -4.451  1.00 33.73 ? 256 ARG A CG  1 
ATOM   511  C  CD  . ARG A 1 65  ? 12.644 36.993 -5.797  1.00 32.53 ? 256 ARG A CD  1 
ATOM   512  N  NE  . ARG A 1 65  ? 13.969 36.443 -6.094  1.00 29.39 ? 256 ARG A NE  1 
ATOM   513  C  CZ  . ARG A 1 65  ? 14.184 35.645 -7.127  1.00 26.52 ? 256 ARG A CZ  1 
ATOM   514  N  NH1 . ARG A 1 65  ? 13.158 35.337 -7.906  1.00 26.03 ? 256 ARG A NH1 1 
ATOM   515  N  NH2 . ARG A 1 65  ? 15.395 35.156 -7.383  1.00 25.72 ? 256 ARG A NH2 1 
ATOM   516  N  N   . HIS A 1 66  ? 10.335 35.329 -2.283  1.00 29.60 ? 257 HIS A N   1 
ATOM   517  C  CA  . HIS A 1 66  ? 10.446 34.724 -0.965  1.00 27.68 ? 257 HIS A CA  1 
ATOM   518  C  C   . HIS A 1 66  ? 11.836 34.923 -0.396  1.00 26.33 ? 257 HIS A C   1 
ATOM   519  O  O   . HIS A 1 66  ? 12.810 35.035 -1.147  1.00 25.94 ? 257 HIS A O   1 
ATOM   520  C  CB  . HIS A 1 66  ? 10.051 33.242 -0.992  1.00 27.91 ? 257 HIS A CB  1 
ATOM   521  C  CG  . HIS A 1 66  ? 8.594  33.018 -1.240  1.00 28.09 ? 257 HIS A CG  1 
ATOM   522  N  ND1 . HIS A 1 66  ? 8.043  31.761 -1.365  1.00 29.18 ? 257 HIS A ND1 1 
ATOM   523  C  CD2 . HIS A 1 66  ? 7.568  33.895 -1.376  1.00 27.65 ? 257 HIS A CD2 1 
ATOM   524  C  CE1 . HIS A 1 66  ? 6.742  31.871 -1.570  1.00 28.97 ? 257 HIS A CE1 1 
ATOM   525  N  NE2 . HIS A 1 66  ? 6.429  33.157 -1.587  1.00 29.42 ? 257 HIS A NE2 1 
ATOM   526  N  N   . ALA A 1 67  ? 11.906 34.995 0.932   1.00 23.98 ? 258 ALA A N   1 
ATOM   527  C  CA  . ALA A 1 67  ? 13.129 35.300 1.627   1.00 22.95 ? 258 ALA A CA  1 
ATOM   528  C  C   . ALA A 1 67  ? 14.247 34.364 1.227   1.00 22.66 ? 258 ALA A C   1 
ATOM   529  O  O   . ALA A 1 67  ? 15.416 34.768 1.141   1.00 22.01 ? 258 ALA A O   1 
ATOM   530  C  CB  . ALA A 1 67  ? 12.906 35.221 3.118   1.00 22.67 ? 258 ALA A CB  1 
ATOM   531  N  N   . GLU A 1 68  ? 13.870 33.104 1.004   1.00 22.34 ? 259 GLU A N   1 
ATOM   532  C  CA  . GLU A 1 68  ? 14.799 32.050 0.669   1.00 21.85 ? 259 GLU A CA  1 
ATOM   533  C  C   . GLU A 1 68  ? 15.398 32.303 -0.706  1.00 21.76 ? 259 GLU A C   1 
ATOM   534  O  O   . GLU A 1 68  ? 16.598 32.082 -0.912  1.00 20.91 ? 259 GLU A O   1 
ATOM   535  C  CB  . GLU A 1 68  ? 14.097 30.693 0.723   1.00 22.32 ? 259 GLU A CB  1 
ATOM   536  C  CG  . GLU A 1 68  ? 13.679 30.248 2.127   1.00 22.52 ? 259 GLU A CG  1 
ATOM   537  C  CD  . GLU A 1 68  ? 12.340 30.811 2.569   1.00 24.04 ? 259 GLU A CD  1 
ATOM   538  O  OE1 . GLU A 1 68  ? 11.841 30.400 3.636   1.00 24.05 ? 259 GLU A OE1 1 
ATOM   539  O  OE2 . GLU A 1 68  ? 11.788 31.685 1.870   1.00 25.14 ? 259 GLU A OE2 1 
ATOM   540  N  N   . LEU A 1 69  ? 14.563 32.794 -1.626  1.00 21.00 ? 260 LEU A N   1 
ATOM   541  C  CA  . LEU A 1 69  ? 15.033 33.153 -2.962  1.00 21.61 ? 260 LEU A CA  1 
ATOM   542  C  C   . LEU A 1 69  ? 15.915 34.393 -2.944  1.00 21.96 ? 260 LEU A C   1 
ATOM   543  O  O   . LEU A 1 69  ? 16.921 34.450 -3.679  1.00 21.28 ? 260 LEU A O   1 
ATOM   544  C  CB  . LEU A 1 69  ? 13.876 33.334 -3.942  1.00 21.57 ? 260 LEU A CB  1 
ATOM   545  C  CG  . LEU A 1 69  ? 13.058 32.095 -4.328  1.00 22.54 ? 260 LEU A CG  1 
ATOM   546  C  CD1 . LEU A 1 69  ? 12.007 32.458 -5.372  1.00 22.61 ? 260 LEU A CD1 1 
ATOM   547  C  CD2 . LEU A 1 69  ? 13.953 30.965 -4.828  1.00 21.27 ? 260 LEU A CD2 1 
ATOM   548  N  N   . CYS A 1 70  ? 15.544 35.373 -2.108  1.00 21.50 ? 261 CYS A N   1 
ATOM   549  C  CA  . CYS A 1 70  ? 16.361 36.576 -1.928  1.00 22.56 ? 261 CYS A CA  1 
ATOM   550  C  C   . CYS A 1 70  ? 17.719 36.239 -1.332  1.00 22.19 ? 261 CYS A C   1 
ATOM   551  O  O   . CYS A 1 70  ? 18.726 36.834 -1.701  1.00 22.52 ? 261 CYS A O   1 
ATOM   552  C  CB  . CYS A 1 70  ? 15.673 37.605 -1.025  1.00 22.78 ? 261 CYS A CB  1 
ATOM   553  S  SG  . CYS A 1 70  ? 14.150 38.259 -1.655  1.00 25.62 ? 261 CYS A SG  1 
ATOM   554  N  N   . PHE A 1 71  ? 17.733 35.313 -0.379  1.00 21.50 ? 262 PHE A N   1 
ATOM   555  C  CA  . PHE A 1 71  ? 18.985 34.836 0.201   1.00 21.04 ? 262 PHE A CA  1 
ATOM   556  C  C   . PHE A 1 71  ? 19.918 34.277 -0.874  1.00 20.74 ? 262 PHE A C   1 
ATOM   557  O  O   . PHE A 1 71  ? 21.088 34.672 -0.962  1.00 20.52 ? 262 PHE A O   1 
ATOM   558  C  CB  . PHE A 1 71  ? 18.691 33.790 1.289   1.00 20.68 ? 262 PHE A CB  1 
ATOM   559  C  CG  . PHE A 1 71  ? 19.904 33.061 1.779   1.00 21.02 ? 262 PHE A CG  1 
ATOM   560  C  CD1 . PHE A 1 71  ? 20.964 33.750 2.370   1.00 20.66 ? 262 PHE A CD1 1 
ATOM   561  C  CD2 . PHE A 1 71  ? 19.968 31.670 1.688   1.00 22.14 ? 262 PHE A CD2 1 
ATOM   562  C  CE1 . PHE A 1 71  ? 22.089 33.072 2.839   1.00 22.81 ? 262 PHE A CE1 1 
ATOM   563  C  CE2 . PHE A 1 71  ? 21.086 30.974 2.161   1.00 22.70 ? 262 PHE A CE2 1 
ATOM   564  C  CZ  . PHE A 1 71  ? 22.154 31.683 2.739   1.00 23.99 ? 262 PHE A CZ  1 
ATOM   565  N  N   . LEU A 1 72  ? 19.410 33.357 -1.696  1.00 21.03 ? 263 LEU A N   1 
ATOM   566  C  CA  . LEU A 1 72  ? 20.209 32.797 -2.798  1.00 21.65 ? 263 LEU A CA  1 
ATOM   567  C  C   . LEU A 1 72  ? 20.654 33.887 -3.797  1.00 22.02 ? 263 LEU A C   1 
ATOM   568  O  O   . LEU A 1 72  ? 21.701 33.774 -4.406  1.00 21.89 ? 263 LEU A O   1 
ATOM   569  C  CB  . LEU A 1 72  ? 19.455 31.667 -3.507  1.00 21.46 ? 263 LEU A CB  1 
ATOM   570  C  CG  . LEU A 1 72  ? 19.250 30.339 -2.760  1.00 21.27 ? 263 LEU A CG  1 
ATOM   571  C  CD1 . LEU A 1 72  ? 18.405 29.442 -3.596  1.00 19.74 ? 263 LEU A CD1 1 
ATOM   572  C  CD2 . LEU A 1 72  ? 20.586 29.662 -2.436  1.00 21.74 ? 263 LEU A CD2 1 
ATOM   573  N  N   . ASP A 1 73  ? 19.855 34.944 -3.937  1.00 23.03 ? 264 ASP A N   1 
ATOM   574  C  CA  . ASP A 1 73  ? 20.204 36.092 -4.779  1.00 24.00 ? 264 ASP A CA  1 
ATOM   575  C  C   . ASP A 1 73  ? 21.453 36.822 -4.323  1.00 24.29 ? 264 ASP A C   1 
ATOM   576  O  O   . ASP A 1 73  ? 22.190 37.344 -5.151  1.00 24.70 ? 264 ASP A O   1 
ATOM   577  C  CB  . ASP A 1 73  ? 19.046 37.096 -4.871  1.00 24.13 ? 264 ASP A CB  1 
ATOM   578  C  CG  . ASP A 1 73  ? 17.845 36.539 -5.601  1.00 26.96 ? 264 ASP A CG  1 
ATOM   579  O  OD1 . ASP A 1 73  ? 18.025 35.654 -6.472  1.00 26.84 ? 264 ASP A OD1 1 
ATOM   580  O  OD2 . ASP A 1 73  ? 16.709 36.977 -5.296  1.00 30.75 ? 264 ASP A OD2 1 
ATOM   581  N  N   . VAL A 1 74  ? 21.705 36.865 -3.017  1.00 24.53 ? 265 VAL A N   1 
ATOM   582  C  CA  . VAL A 1 74  ? 22.821 37.673 -2.519  1.00 25.35 ? 265 VAL A CA  1 
ATOM   583  C  C   . VAL A 1 74  ? 24.120 36.908 -2.461  1.00 26.43 ? 265 VAL A C   1 
ATOM   584  O  O   . VAL A 1 74  ? 25.200 37.510 -2.460  1.00 25.54 ? 265 VAL A O   1 
ATOM   585  C  CB  . VAL A 1 74  ? 22.531 38.379 -1.167  1.00 24.89 ? 265 VAL A CB  1 
ATOM   586  C  CG1 . VAL A 1 74  ? 21.335 39.275 -1.283  1.00 24.46 ? 265 VAL A CG1 1 
ATOM   587  C  CG2 . VAL A 1 74  ? 22.388 37.365 -0.023  1.00 25.17 ? 265 VAL A CG2 1 
ATOM   588  N  N   . ILE A 1 75  ? 24.147 35.547 -2.325  1.00 29.02 ? 266 ILE A N   1 
ATOM   589  C  CA  . ILE A 1 75  ? 25.355 34.744 -2.220  1.00 31.76 ? 266 ILE A CA  1 
ATOM   590  C  C   . ILE A 1 75  ? 26.385 35.110 -3.292  1.00 34.14 ? 266 ILE A C   1 
ATOM   591  O  O   . ILE A 1 75  ? 27.568 35.191 -3.000  1.00 33.50 ? 266 ILE A O   1 
ATOM   592  C  CB  . ILE A 1 75  ? 25.024 33.236 -2.274  1.00 31.60 ? 266 ILE A CB  1 
ATOM   593  C  CG1 . ILE A 1 75  ? 24.128 32.876 -1.082  1.00 30.87 ? 266 ILE A CG1 1 
ATOM   594  C  CG2 . ILE A 1 75  ? 26.318 32.397 -2.248  1.00 31.73 ? 266 ILE A CG2 1 
ATOM   595  C  CD1 . ILE A 1 75  ? 23.633 31.440 -1.096  1.00 33.41 ? 266 ILE A CD1 1 
ATOM   596  N  N   . PRO A 1 76  ? 25.952 35.337 -4.544  1.00 37.01 ? 267 PRO A N   1 
ATOM   597  C  CA  . PRO A 1 76  ? 26.939 35.700 -5.570  1.00 39.02 ? 267 PRO A CA  1 
ATOM   598  C  C   . PRO A 1 76  ? 27.767 36.924 -5.162  1.00 41.33 ? 267 PRO A C   1 
ATOM   599  O  O   . PRO A 1 76  ? 28.965 36.995 -5.434  1.00 42.11 ? 267 PRO A O   1 
ATOM   600  C  CB  . PRO A 1 76  ? 26.073 35.975 -6.798  1.00 38.73 ? 267 PRO A CB  1 
ATOM   601  C  CG  . PRO A 1 76  ? 24.937 34.998 -6.633  1.00 38.15 ? 267 PRO A CG  1 
ATOM   602  C  CD  . PRO A 1 76  ? 24.624 35.095 -5.147  1.00 37.27 ? 267 PRO A CD  1 
ATOM   603  N  N   . PHE A 1 77  ? 27.118 37.877 -4.496  1.00 43.81 ? 268 PHE A N   1 
ATOM   604  C  CA  . PHE A 1 77  ? 27.774 39.105 -4.044  1.00 45.93 ? 268 PHE A CA  1 
ATOM   605  C  C   . PHE A 1 77  ? 28.755 38.910 -2.898  1.00 46.99 ? 268 PHE A C   1 
ATOM   606  O  O   . PHE A 1 77  ? 29.413 39.861 -2.482  1.00 47.68 ? 268 PHE A O   1 
ATOM   607  C  CB  . PHE A 1 77  ? 26.735 40.149 -3.634  1.00 46.16 ? 268 PHE A CB  1 
ATOM   608  C  CG  . PHE A 1 77  ? 25.878 40.619 -4.765  1.00 47.64 ? 268 PHE A CG  1 
ATOM   609  C  CD1 . PHE A 1 77  ? 24.514 40.372 -4.767  1.00 49.01 ? 268 PHE A CD1 1 
ATOM   610  C  CD2 . PHE A 1 77  ? 26.441 41.290 -5.845  1.00 49.71 ? 268 PHE A CD2 1 
ATOM   611  C  CE1 . PHE A 1 77  ? 23.720 40.784 -5.827  1.00 49.82 ? 268 PHE A CE1 1 
ATOM   612  C  CE2 . PHE A 1 77  ? 25.658 41.707 -6.911  1.00 50.34 ? 268 PHE A CE2 1 
ATOM   613  C  CZ  . PHE A 1 77  ? 24.293 41.454 -6.904  1.00 50.22 ? 268 PHE A CZ  1 
ATOM   614  N  N   . TRP A 1 78  ? 28.846 37.690 -2.376  1.00 48.29 ? 269 TRP A N   1 
ATOM   615  C  CA  . TRP A 1 78  ? 29.784 37.412 -1.295  1.00 49.32 ? 269 TRP A CA  1 
ATOM   616  C  C   . TRP A 1 78  ? 31.156 37.152 -1.899  1.00 49.81 ? 269 TRP A C   1 
ATOM   617  O  O   . TRP A 1 78  ? 32.180 37.434 -1.283  1.00 50.28 ? 269 TRP A O   1 
ATOM   618  C  CB  . TRP A 1 78  ? 29.351 36.189 -0.480  1.00 49.59 ? 269 TRP A CB  1 
ATOM   619  C  CG  . TRP A 1 78  ? 28.062 36.362 0.263   1.00 50.96 ? 269 TRP A CG  1 
ATOM   620  C  CD1 . TRP A 1 78  ? 27.396 37.530 0.495   1.00 52.85 ? 269 TRP A CD1 1 
ATOM   621  C  CD2 . TRP A 1 78  ? 27.279 35.330 0.872   1.00 52.61 ? 269 TRP A CD2 1 
ATOM   622  N  NE1 . TRP A 1 78  ? 26.248 37.290 1.203   1.00 53.83 ? 269 TRP A NE1 1 
ATOM   623  C  CE2 . TRP A 1 78  ? 26.150 35.947 1.450   1.00 53.09 ? 269 TRP A CE2 1 
ATOM   624  C  CE3 . TRP A 1 78  ? 27.421 33.940 0.985   1.00 53.94 ? 269 TRP A CE3 1 
ATOM   625  C  CZ2 . TRP A 1 78  ? 25.165 35.223 2.133   1.00 53.48 ? 269 TRP A CZ2 1 
ATOM   626  C  CZ3 . TRP A 1 78  ? 26.441 33.220 1.664   1.00 54.71 ? 269 TRP A CZ3 1 
ATOM   627  C  CH2 . TRP A 1 78  ? 25.330 33.864 2.228   1.00 54.39 ? 269 TRP A CH2 1 
ATOM   628  N  N   . LYS A 1 79  ? 31.171 36.620 -3.116  1.00 50.38 ? 270 LYS A N   1 
ATOM   629  C  CA  . LYS A 1 79  ? 32.419 36.312 -3.807  1.00 50.92 ? 270 LYS A CA  1 
ATOM   630  C  C   . LYS A 1 79  ? 33.342 35.435 -2.980  1.00 51.99 ? 270 LYS A C   1 
ATOM   631  O  O   . LYS A 1 79  ? 34.508 35.767 -2.767  1.00 52.72 ? 270 LYS A O   1 
ATOM   632  C  CB  . LYS A 1 79  ? 33.161 37.593 -4.191  1.00 50.43 ? 270 LYS A CB  1 
ATOM   633  C  CG  . LYS A 1 79  ? 32.679 38.213 -5.477  1.00 48.42 ? 270 LYS A CG  1 
ATOM   634  C  CD  . LYS A 1 79  ? 33.794 38.988 -6.116  1.00 44.39 ? 270 LYS A CD  1 
ATOM   635  C  CE  . LYS A 1 79  ? 33.464 39.311 -7.544  1.00 41.39 ? 270 LYS A CE  1 
ATOM   636  N  NZ  . LYS A 1 79  ? 34.588 40.036 -8.172  1.00 41.51 ? 270 LYS A NZ  1 
ATOM   637  N  N   . LEU A 1 80  ? 32.808 34.317 -2.513  1.00 52.93 ? 271 LEU A N   1 
ATOM   638  C  CA  . LEU A 1 80  ? 33.586 33.376 -1.731  1.00 53.56 ? 271 LEU A CA  1 
ATOM   639  C  C   . LEU A 1 80  ? 34.576 32.733 -2.697  1.00 53.92 ? 271 LEU A C   1 
ATOM   640  O  O   . LEU A 1 80  ? 34.243 32.523 -3.864  1.00 54.30 ? 271 LEU A O   1 
ATOM   641  C  CB  . LEU A 1 80  ? 32.661 32.296 -1.158  1.00 53.85 ? 271 LEU A CB  1 
ATOM   642  C  CG  . LEU A 1 80  ? 31.389 32.767 -0.444  1.00 54.30 ? 271 LEU A CG  1 
ATOM   643  C  CD1 . LEU A 1 80  ? 30.493 31.584 -0.157  1.00 54.76 ? 271 LEU A CD1 1 
ATOM   644  C  CD2 . LEU A 1 80  ? 31.756 33.492 0.834   1.00 54.72 ? 271 LEU A CD2 1 
ATOM   645  N  N   . ASP A 1 81  ? 35.789 32.435 -2.238  1.00 54.09 ? 272 ASP A N   1 
ATOM   646  C  CA  . ASP A 1 81  ? 36.745 31.773 -3.115  1.00 54.12 ? 272 ASP A CA  1 
ATOM   647  C  C   . ASP A 1 81  ? 35.999 30.529 -3.569  1.00 53.90 ? 272 ASP A C   1 
ATOM   648  O  O   . ASP A 1 81  ? 35.539 29.744 -2.747  1.00 54.33 ? 272 ASP A O   1 
ATOM   649  C  CB  . ASP A 1 81  ? 38.015 31.374 -2.362  1.00 54.32 ? 272 ASP A CB  1 
ATOM   650  C  CG  . ASP A 1 81  ? 38.791 32.575 -1.846  1.00 55.24 ? 272 ASP A CG  1 
ATOM   651  O  OD1 . ASP A 1 81  ? 38.996 33.536 -2.621  1.00 55.97 ? 272 ASP A OD1 1 
ATOM   652  O  OD2 . ASP A 1 81  ? 39.209 32.555 -0.668  1.00 55.71 ? 272 ASP A OD2 1 
ATOM   653  N  N   . LEU A 1 82  ? 35.873 30.361 -4.878  1.00 53.23 ? 273 LEU A N   1 
ATOM   654  C  CA  . LEU A 1 82  ? 35.140 29.239 -5.433  1.00 52.33 ? 273 LEU A CA  1 
ATOM   655  C  C   . LEU A 1 82  ? 35.721 27.847 -5.186  1.00 51.39 ? 273 LEU A C   1 
ATOM   656  O  O   . LEU A 1 82  ? 35.047 26.846 -5.414  1.00 51.44 ? 273 LEU A O   1 
ATOM   657  C  CB  . LEU A 1 82  ? 34.923 29.469 -6.932  1.00 52.46 ? 273 LEU A CB  1 
ATOM   658  C  CG  . LEU A 1 82  ? 34.166 30.764 -7.263  1.00 52.82 ? 273 LEU A CG  1 
ATOM   659  C  CD1 . LEU A 1 82  ? 33.888 30.838 -8.759  1.00 53.35 ? 273 LEU A CD1 1 
ATOM   660  C  CD2 . LEU A 1 82  ? 32.862 30.814 -6.479  1.00 53.64 ? 273 LEU A CD2 1 
ATOM   661  N  N   . ASP A 1 83  ? 36.961 27.773 -4.721  1.00 49.92 ? 274 ASP A N   1 
ATOM   662  C  CA  . ASP A 1 83  ? 37.569 26.476 -4.447  1.00 48.34 ? 274 ASP A CA  1 
ATOM   663  C  C   . ASP A 1 83  ? 37.886 26.375 -2.960  1.00 47.01 ? 274 ASP A C   1 
ATOM   664  O  O   . ASP A 1 83  ? 38.944 25.901 -2.556  1.00 46.78 ? 274 ASP A O   1 
ATOM   665  C  CB  . ASP A 1 83  ? 38.838 26.282 -5.292  1.00 48.79 ? 274 ASP A CB  1 
ATOM   666  C  CG  . ASP A 1 83  ? 39.823 27.424 -5.146  1.00 49.51 ? 274 ASP A CG  1 
ATOM   667  O  OD1 . ASP A 1 83  ? 40.969 27.276 -5.625  1.00 50.63 ? 274 ASP A OD1 1 
ATOM   668  O  OD2 . ASP A 1 83  ? 39.451 28.466 -4.560  1.00 49.69 ? 274 ASP A OD2 1 
ATOM   669  N  N   . GLN A 1 84  ? 36.824 27.018 -2.178  1.00 44.99 ? 275 GLN A N   1 
ATOM   670  C  CA  . GLN A 1 84  ? 37.024 26.766 -0.749  1.00 43.09 ? 275 GLN A CA  1 
ATOM   671  C  C   . GLN A 1 84  ? 35.749 26.211 -0.123  1.00 41.23 ? 275 GLN A C   1 
ATOM   672  O  O   . GLN A 1 84  ? 34.664 26.327 -0.703  1.00 41.24 ? 275 GLN A O   1 
ATOM   673  C  CB  . GLN A 1 84  ? 37.448 28.054 -0.035  1.00 43.44 ? 275 GLN A CB  1 
ATOM   674  C  CG  . GLN A 1 84  ? 38.369 27.840 1.142   1.00 45.02 ? 275 GLN A CG  1 
ATOM   675  C  CD  . GLN A 1 84  ? 39.701 27.239 0.733   1.00 46.33 ? 275 GLN A CD  1 
ATOM   676  O  OE1 . GLN A 1 84  ? 39.756 26.203 0.067   1.00 47.73 ? 275 GLN A OE1 1 
ATOM   677  N  NE2 . GLN A 1 84  ? 40.780 27.885 1.137   1.00 46.34 ? 275 GLN A NE2 1 
ATOM   678  N  N   . ASP A 1 85  ? 35.879 25.615 1.059   1.00 38.49 ? 276 ASP A N   1 
ATOM   679  C  CA  . ASP A 1 85  ? 34.724 25.072 1.762   1.00 36.33 ? 276 ASP A CA  1 
ATOM   680  C  C   . ASP A 1 85  ? 34.170 26.080 2.772   1.00 34.92 ? 276 ASP A C   1 
ATOM   681  O  O   . ASP A 1 85  ? 34.924 26.719 3.517   1.00 34.44 ? 276 ASP A O   1 
ATOM   682  C  CB  . ASP A 1 85  ? 35.070 23.738 2.438   1.00 36.31 ? 276 ASP A CB  1 
ATOM   683  C  CG  . ASP A 1 85  ? 35.590 22.689 1.454   1.00 36.44 ? 276 ASP A CG  1 
ATOM   684  O  OD1 . ASP A 1 85  ? 35.010 22.511 0.366   1.00 35.89 ? 276 ASP A OD1 1 
ATOM   685  O  OD2 . ASP A 1 85  ? 36.594 22.026 1.778   1.00 39.33 ? 276 ASP A OD2 1 
ATOM   686  N  N   . TYR A 1 86  ? 32.848 26.232 2.782   1.00 33.14 ? 277 TYR A N   1 
ATOM   687  C  CA  . TYR A 1 86  ? 32.216 27.214 3.659   1.00 31.25 ? 277 TYR A CA  1 
ATOM   688  C  C   . TYR A 1 86  ? 31.067 26.628 4.436   1.00 30.42 ? 277 TYR A C   1 
ATOM   689  O  O   . TYR A 1 86  ? 30.343 25.750 3.950   1.00 30.16 ? 277 TYR A O   1 
ATOM   690  C  CB  . TYR A 1 86  ? 31.694 28.421 2.867   1.00 30.98 ? 277 TYR A CB  1 
ATOM   691  C  CG  . TYR A 1 86  ? 32.755 29.283 2.236   1.00 29.85 ? 277 TYR A CG  1 
ATOM   692  C  CD1 . TYR A 1 86  ? 33.225 29.010 0.947   1.00 30.38 ? 277 TYR A CD1 1 
ATOM   693  C  CD2 . TYR A 1 86  ? 33.280 30.385 2.912   1.00 29.98 ? 277 TYR A CD2 1 
ATOM   694  C  CE1 . TYR A 1 86  ? 34.208 29.812 0.347   1.00 29.64 ? 277 TYR A CE1 1 
ATOM   695  C  CE2 . TYR A 1 86  ? 34.267 31.197 2.321   1.00 30.63 ? 277 TYR A CE2 1 
ATOM   696  C  CZ  . TYR A 1 86  ? 34.721 30.898 1.034   1.00 29.25 ? 277 TYR A CZ  1 
ATOM   697  O  OH  . TYR A 1 86  ? 35.688 31.692 0.447   1.00 29.14 ? 277 TYR A OH  1 
ATOM   698  N  N   . ARG A 1 87  ? 30.900 27.149 5.650   1.00 29.22 ? 278 ARG A N   1 
ATOM   699  C  CA  . ARG A 1 87  ? 29.738 26.834 6.459   1.00 28.26 ? 278 ARG A CA  1 
ATOM   700  C  C   . ARG A 1 87  ? 28.756 27.991 6.364   1.00 26.52 ? 278 ARG A C   1 
ATOM   701  O  O   . ARG A 1 87  ? 29.087 29.127 6.701   1.00 25.87 ? 278 ARG A O   1 
ATOM   702  C  CB  . ARG A 1 87  ? 30.158 26.607 7.914   1.00 28.73 ? 278 ARG A CB  1 
ATOM   703  C  CG  . ARG A 1 87  ? 29.206 25.759 8.698   1.00 31.39 ? 278 ARG A CG  1 
ATOM   704  C  CD  . ARG A 1 87  ? 29.287 26.148 10.146  1.00 38.47 ? 278 ARG A CD  1 
ATOM   705  N  NE  . ARG A 1 87  ? 28.832 25.076 11.020  1.00 42.43 ? 278 ARG A NE  1 
ATOM   706  C  CZ  . ARG A 1 87  ? 28.839 25.139 12.352  1.00 45.13 ? 278 ARG A CZ  1 
ATOM   707  N  NH1 . ARG A 1 87  ? 29.277 26.233 12.970  1.00 45.37 ? 278 ARG A NH1 1 
ATOM   708  N  NH2 . ARG A 1 87  ? 28.401 24.103 13.064  1.00 46.27 ? 278 ARG A NH2 1 
ATOM   709  N  N   . VAL A 1 88  ? 27.549 27.699 5.900   1.00 25.08 ? 279 VAL A N   1 
ATOM   710  C  CA  . VAL A 1 88  ? 26.507 28.717 5.818   1.00 24.38 ? 279 VAL A CA  1 
ATOM   711  C  C   . VAL A 1 88  ? 25.402 28.331 6.785   1.00 23.46 ? 279 VAL A C   1 
ATOM   712  O  O   . VAL A 1 88  ? 24.879 27.221 6.710   1.00 22.64 ? 279 VAL A O   1 
ATOM   713  C  CB  . VAL A 1 88  ? 25.949 28.872 4.366   1.00 24.65 ? 279 VAL A CB  1 
ATOM   714  C  CG1 . VAL A 1 88  ? 24.930 29.996 4.308   1.00 24.35 ? 279 VAL A CG1 1 
ATOM   715  C  CG2 . VAL A 1 88  ? 27.079 29.175 3.379   1.00 25.02 ? 279 VAL A CG2 1 
ATOM   716  N  N   . THR A 1 89  ? 25.076 29.238 7.710   1.00 22.44 ? 280 THR A N   1 
ATOM   717  C  CA  . THR A 1 89  ? 24.019 28.993 8.695   1.00 21.92 ? 280 THR A CA  1 
ATOM   718  C  C   . THR A 1 89  ? 22.904 30.010 8.465   1.00 21.90 ? 280 THR A C   1 
ATOM   719  O  O   . THR A 1 89  ? 23.183 31.188 8.261   1.00 21.16 ? 280 THR A O   1 
ATOM   720  C  CB  . THR A 1 89  ? 24.573 29.033 10.154  1.00 21.65 ? 280 THR A CB  1 
ATOM   721  O  OG1 . THR A 1 89  ? 25.698 28.150 10.253  1.00 20.20 ? 280 THR A OG1 1 
ATOM   722  C  CG2 . THR A 1 89  ? 23.523 28.582 11.170  1.00 21.76 ? 280 THR A CG2 1 
ATOM   723  N  N   . CYS A 1 90  ? 21.654 29.546 8.445   1.00 21.82 ? 281 CYS A N   1 
ATOM   724  C  CA  . CYS A 1 90  ? 20.499 30.454 8.328   1.00 22.90 ? 281 CYS A CA  1 
ATOM   725  C  C   . CYS A 1 90  ? 19.558 30.288 9.514   1.00 22.40 ? 281 CYS A C   1 
ATOM   726  O  O   . CYS A 1 90  ? 19.259 29.165 9.917   1.00 23.05 ? 281 CYS A O   1 
ATOM   727  C  CB  . CYS A 1 90  ? 19.714 30.202 7.035   1.00 22.67 ? 281 CYS A CB  1 
ATOM   728  S  SG  . CYS A 1 90  ? 20.638 30.486 5.536   1.00 27.05 ? 281 CYS A SG  1 
ATOM   729  N  N   . PHE A 1 91  ? 19.115 31.413 10.079  1.00 21.88 ? 282 PHE A N   1 
ATOM   730  C  CA  . PHE A 1 91  ? 18.073 31.425 11.098  1.00 20.53 ? 282 PHE A CA  1 
ATOM   731  C  C   . PHE A 1 91  ? 16.883 32.088 10.458  1.00 20.21 ? 282 PHE A C   1 
ATOM   732  O  O   . PHE A 1 91  ? 16.939 33.261 10.088  1.00 20.31 ? 282 PHE A O   1 
ATOM   733  C  CB  . PHE A 1 91  ? 18.519 32.190 12.345  1.00 20.69 ? 282 PHE A CB  1 
ATOM   734  C  CG  . PHE A 1 91  ? 19.869 31.748 12.880  1.00 21.53 ? 282 PHE A CG  1 
ATOM   735  C  CD1 . PHE A 1 91  ? 21.050 32.303 12.381  1.00 21.12 ? 282 PHE A CD1 1 
ATOM   736  C  CD2 . PHE A 1 91  ? 19.958 30.778 13.881  1.00 20.39 ? 282 PHE A CD2 1 
ATOM   737  C  CE1 . PHE A 1 91  ? 22.286 31.890 12.865  1.00 21.89 ? 282 PHE A CE1 1 
ATOM   738  C  CE2 . PHE A 1 91  ? 21.185 30.376 14.374  1.00 20.19 ? 282 PHE A CE2 1 
ATOM   739  C  CZ  . PHE A 1 91  ? 22.348 30.918 13.868  1.00 20.84 ? 282 PHE A CZ  1 
ATOM   740  N  N   . THR A 1 92  ? 15.818 31.322 10.286  1.00 19.63 ? 283 THR A N   1 
ATOM   741  C  CA  . THR A 1 92  ? 14.631 31.797 9.599   1.00 20.00 ? 283 THR A CA  1 
ATOM   742  C  C   . THR A 1 92  ? 13.458 31.757 10.562  1.00 19.65 ? 283 THR A C   1 
ATOM   743  O  O   . THR A 1 92  ? 13.387 30.888 11.414  1.00 18.59 ? 283 THR A O   1 
ATOM   744  C  CB  . THR A 1 92  ? 14.315 30.913 8.377   1.00 19.73 ? 283 THR A CB  1 
ATOM   745  O  OG1 . THR A 1 92  ? 14.103 29.564 8.817   1.00 20.53 ? 283 THR A OG1 1 
ATOM   746  C  CG2 . THR A 1 92  ? 15.474 30.916 7.410   1.00 20.88 ? 283 THR A CG2 1 
ATOM   747  N  N   . SER A 1 93  ? 12.535 32.706 10.419  1.00 20.61 ? 284 SER A N   1 
ATOM   748  C  CA  . SER A 1 93  ? 11.372 32.767 11.295  1.00 20.59 ? 284 SER A CA  1 
ATOM   749  C  C   . SER A 1 93  ? 10.355 31.683 10.917  1.00 21.03 ? 284 SER A C   1 
ATOM   750  O  O   . SER A 1 93  ? 9.684  31.130 11.787  1.00 21.47 ? 284 SER A O   1 
ATOM   751  C  CB  . SER A 1 93  ? 10.780 34.177 11.285  1.00 20.61 ? 284 SER A CB  1 
ATOM   752  O  OG  . SER A 1 93  ? 10.408 34.579 9.991   1.00 21.45 ? 284 SER A OG  1 
ATOM   753  N  N   . TRP A 1 94  ? 10.287 31.357 9.621   1.00 21.23 ? 285 TRP A N   1 
ATOM   754  C  CA  . TRP A 1 94  ? 9.503  30.241 9.095   1.00 20.55 ? 285 TRP A CA  1 
ATOM   755  C  C   . TRP A 1 94  ? 10.443 29.335 8.291   1.00 21.03 ? 285 TRP A C   1 
ATOM   756  O  O   . TRP A 1 94  ? 11.434 29.816 7.720   1.00 20.64 ? 285 TRP A O   1 
ATOM   757  C  CB  . TRP A 1 94  ? 8.446  30.763 8.128   1.00 21.69 ? 285 TRP A CB  1 
ATOM   758  C  CG  . TRP A 1 94  ? 7.236  31.414 8.723   1.00 20.95 ? 285 TRP A CG  1 
ATOM   759  C  CD1 . TRP A 1 94  ? 6.887  32.727 8.614   1.00 20.52 ? 285 TRP A CD1 1 
ATOM   760  C  CD2 . TRP A 1 94  ? 6.191  30.776 9.469   1.00 20.32 ? 285 TRP A CD2 1 
ATOM   761  N  NE1 . TRP A 1 94  ? 5.697  32.957 9.271   1.00 21.74 ? 285 TRP A NE1 1 
ATOM   762  C  CE2 . TRP A 1 94  ? 5.251  31.775 9.807   1.00 22.16 ? 285 TRP A CE2 1 
ATOM   763  C  CE3 . TRP A 1 94  ? 5.968  29.463 9.903   1.00 20.50 ? 285 TRP A CE3 1 
ATOM   764  C  CZ2 . TRP A 1 94  ? 4.092  31.497 10.554  1.00 21.63 ? 285 TRP A CZ2 1 
ATOM   765  C  CZ3 . TRP A 1 94  ? 4.829  29.186 10.639  1.00 20.19 ? 285 TRP A CZ3 1 
ATOM   766  C  CH2 . TRP A 1 94  ? 3.906  30.200 10.964  1.00 20.98 ? 285 TRP A CH2 1 
ATOM   767  N  N   . SER A 1 95  ? 10.141 28.033 8.232   1.00 20.51 ? 286 SER A N   1 
ATOM   768  C  CA  . SER A 1 95  ? 10.903 27.106 7.389   1.00 20.73 ? 286 SER A CA  1 
ATOM   769  C  C   . SER A 1 95  ? 10.517 27.353 5.911   1.00 21.83 ? 286 SER A C   1 
ATOM   770  O  O   . SER A 1 95  ? 9.448  27.933 5.654   1.00 21.94 ? 286 SER A O   1 
ATOM   771  C  CB  . SER A 1 95  ? 10.685 25.640 7.806   1.00 20.70 ? 286 SER A CB  1 
ATOM   772  O  OG  . SER A 1 95  ? 9.325  25.244 7.678   1.00 17.13 ? 286 SER A OG  1 
ATOM   773  N  N   . PRO A 1 96  ? 11.397 26.967 4.950   1.00 21.70 ? 287 PRO A N   1 
ATOM   774  C  CA  . PRO A 1 96  ? 11.134 27.159 3.507   1.00 22.37 ? 287 PRO A CA  1 
ATOM   775  C  C   . PRO A 1 96  ? 9.910  26.446 2.930   1.00 22.59 ? 287 PRO A C   1 
ATOM   776  O  O   . PRO A 1 96  ? 9.617  25.310 3.299   1.00 21.72 ? 287 PRO A O   1 
ATOM   777  C  CB  . PRO A 1 96  ? 12.412 26.615 2.827   1.00 22.01 ? 287 PRO A CB  1 
ATOM   778  C  CG  . PRO A 1 96  ? 13.087 25.791 3.855   1.00 22.86 ? 287 PRO A CG  1 
ATOM   779  C  CD  . PRO A 1 96  ? 12.733 26.383 5.184   1.00 22.18 ? 287 PRO A CD  1 
ATOM   780  N  N   . CYS A 1 97  ? 9.222  27.105 2.001   1.00 23.44 ? 288 CYS A N   1 
ATOM   781  C  CA  . CYS A 1 97  ? 8.136  26.449 1.251   1.00 24.04 ? 288 CYS A CA  1 
ATOM   782  C  C   . CYS A 1 97  ? 8.725  25.386 0.309   1.00 24.48 ? 288 CYS A C   1 
ATOM   783  O  O   . CYS A 1 97  ? 9.951  25.352 0.069   1.00 23.40 ? 288 CYS A O   1 
ATOM   784  C  CB  . CYS A 1 97  ? 7.311  27.473 0.456   1.00 23.15 ? 288 CYS A CB  1 
ATOM   785  S  SG  . CYS A 1 97  ? 8.036  27.860 -1.161  1.00 24.70 ? 288 CYS A SG  1 
ATOM   786  N  N   . PHE A 1 98  ? 7.846  24.542 -0.228  1.00 25.24 ? 289 PHE A N   1 
ATOM   787  C  CA  . PHE A 1 98  ? 8.210  23.463 -1.146  1.00 27.09 ? 289 PHE A CA  1 
ATOM   788  C  C   . PHE A 1 98  ? 9.130  23.940 -2.279  1.00 26.99 ? 289 PHE A C   1 
ATOM   789  O  O   . PHE A 1 98  ? 10.161 23.315 -2.560  1.00 26.98 ? 289 PHE A O   1 
ATOM   790  C  CB  . PHE A 1 98  ? 6.942  22.813 -1.722  1.00 28.05 ? 289 PHE A CB  1 
ATOM   791  C  CG  . PHE A 1 98  ? 5.830  23.798 -1.989  1.00 31.83 ? 289 PHE A CG  1 
ATOM   792  C  CD1 . PHE A 1 98  ? 5.754  24.475 -3.215  1.00 34.00 ? 289 PHE A CD1 1 
ATOM   793  C  CD2 . PHE A 1 98  ? 4.873  24.074 -1.002  1.00 34.72 ? 289 PHE A CD2 1 
ATOM   794  C  CE1 . PHE A 1 98  ? 4.743  25.401 -3.460  1.00 36.02 ? 289 PHE A CE1 1 
ATOM   795  C  CE2 . PHE A 1 98  ? 3.850  24.995 -1.237  1.00 36.54 ? 289 PHE A CE2 1 
ATOM   796  C  CZ  . PHE A 1 98  ? 3.784  25.663 -2.469  1.00 37.18 ? 289 PHE A CZ  1 
ATOM   797  N  N   . SER A 1 99  ? 8.775  25.072 -2.885  1.00 26.80 ? 290 SER A N   1 
ATOM   798  C  CA  . SER A 1 99  ? 9.504  25.614 -4.023  1.00 26.89 ? 290 SER A CA  1 
ATOM   799  C  C   . SER A 1 99  ? 10.882 26.139 -3.623  1.00 26.39 ? 290 SER A C   1 
ATOM   800  O  O   . SER A 1 99  ? 11.867 25.900 -4.320  1.00 26.15 ? 290 SER A O   1 
ATOM   801  C  CB  . SER A 1 99  ? 8.674  26.711 -4.706  1.00 27.43 ? 290 SER A CB  1 
ATOM   802  O  OG  . SER A 1 99  ? 9.425  27.331 -5.731  1.00 30.28 ? 290 SER A OG  1 
ATOM   803  N  N   . CYS A 1 100 ? 10.958 26.841 -2.495  1.00 25.54 ? 291 CYS A N   1 
ATOM   804  C  CA  . CYS A 1 100 ? 12.240 27.355 -2.017  1.00 24.89 ? 291 CYS A CA  1 
ATOM   805  C  C   . CYS A 1 100 ? 13.139 26.254 -1.461  1.00 24.98 ? 291 CYS A C   1 
ATOM   806  O  O   . CYS A 1 100 ? 14.366 26.364 -1.524  1.00 26.13 ? 291 CYS A O   1 
ATOM   807  C  CB  . CYS A 1 100 ? 12.037 28.470 -0.995  1.00 24.49 ? 291 CYS A CB  1 
ATOM   808  S  SG  . CYS A 1 100 ? 11.322 29.983 -1.717  1.00 22.80 ? 291 CYS A SG  1 
ATOM   809  N  N   . ALA A 1 101 ? 12.542 25.186 -0.938  1.00 24.22 ? 292 ALA A N   1 
ATOM   810  C  CA  . ALA A 1 101 ? 13.328 24.045 -0.454  1.00 23.32 ? 292 ALA A CA  1 
ATOM   811  C  C   . ALA A 1 101 ? 14.078 23.345 -1.588  1.00 23.15 ? 292 ALA A C   1 
ATOM   812  O  O   . ALA A 1 101 ? 15.255 22.986 -1.440  1.00 22.50 ? 292 ALA A O   1 
ATOM   813  C  CB  . ALA A 1 101 ? 12.444 23.062 0.306   1.00 23.13 ? 292 ALA A CB  1 
ATOM   814  N  N   . GLN A 1 102 ? 13.405 23.160 -2.720  1.00 23.64 ? 293 GLN A N   1 
ATOM   815  C  CA  . GLN A 1 102 ? 14.035 22.532 -3.889  1.00 24.69 ? 293 GLN A CA  1 
ATOM   816  C  C   . GLN A 1 102 ? 15.133 23.413 -4.465  1.00 23.97 ? 293 GLN A C   1 
ATOM   817  O  O   . GLN A 1 102 ? 16.175 22.919 -4.882  1.00 24.29 ? 293 GLN A O   1 
ATOM   818  C  CB  . GLN A 1 102 ? 13.011 22.126 -4.963  1.00 25.36 ? 293 GLN A CB  1 
ATOM   819  C  CG  . GLN A 1 102 ? 12.232 23.271 -5.604  1.00 28.36 ? 293 GLN A CG  1 
ATOM   820  C  CD  . GLN A 1 102 ? 11.309 22.831 -6.754  1.00 32.58 ? 293 GLN A CD  1 
ATOM   821  O  OE1 . GLN A 1 102 ? 10.780 23.676 -7.495  1.00 34.19 ? 293 GLN A OE1 1 
ATOM   822  N  NE2 . GLN A 1 102 ? 11.113 21.514 -6.903  1.00 32.72 ? 293 GLN A NE2 1 
ATOM   823  N  N   . GLU A 1 103 ? 14.892 24.723 -4.454  1.00 23.66 ? 294 GLU A N   1 
ATOM   824  C  CA  . GLU A 1 103 ? 15.864 25.708 -4.902  1.00 22.82 ? 294 GLU A CA  1 
ATOM   825  C  C   . GLU A 1 103 ? 17.117 25.682 -4.038  1.00 22.27 ? 294 GLU A C   1 
ATOM   826  O  O   . GLU A 1 103 ? 18.221 25.709 -4.570  1.00 21.94 ? 294 GLU A O   1 
ATOM   827  C  CB  . GLU A 1 103 ? 15.231 27.090 -4.889  1.00 23.10 ? 294 GLU A CB  1 
ATOM   828  C  CG  . GLU A 1 103 ? 15.718 27.999 -5.964  1.00 26.03 ? 294 GLU A CG  1 
ATOM   829  C  CD  . GLU A 1 103 ? 15.534 27.402 -7.335  1.00 28.16 ? 294 GLU A CD  1 
ATOM   830  O  OE1 . GLU A 1 103 ? 14.433 26.898 -7.637  1.00 29.61 ? 294 GLU A OE1 1 
ATOM   831  O  OE2 . GLU A 1 103 ? 16.508 27.422 -8.101  1.00 30.82 ? 294 GLU A OE2 1 
ATOM   832  N  N   . MET A 1 104 ? 16.952 25.625 -2.711  1.00 21.59 ? 295 MET A N   1 
ATOM   833  C  CA  . MET A 1 104 ? 18.118 25.552 -1.808  1.00 21.41 ? 295 MET A CA  1 
ATOM   834  C  C   . MET A 1 104 ? 18.840 24.209 -1.952  1.00 21.46 ? 295 MET A C   1 
ATOM   835  O  O   . MET A 1 104 ? 20.077 24.149 -1.946  1.00 21.55 ? 295 MET A O   1 
ATOM   836  C  CB  . MET A 1 104 ? 17.721 25.817 -0.347  1.00 21.21 ? 295 MET A CB  1 
ATOM   837  C  CG  . MET A 1 104 ? 17.004 27.162 -0.106  1.00 20.75 ? 295 MET A CG  1 
ATOM   838  S  SD  . MET A 1 104 ? 16.369 27.367 1.587   1.00 20.45 ? 295 MET A SD  1 
ATOM   839  C  CE  . MET A 1 104 ? 17.614 28.509 2.193   1.00 22.82 ? 295 MET A CE  1 
ATOM   840  N  N   . ALA A 1 105 ? 18.062 23.142 -2.111  1.00 22.06 ? 296 ALA A N   1 
ATOM   841  C  CA  . ALA A 1 105 ? 18.598 21.780 -2.300  1.00 23.23 ? 296 ALA A CA  1 
ATOM   842  C  C   . ALA A 1 105 ? 19.415 21.683 -3.583  1.00 24.13 ? 296 ALA A C   1 
ATOM   843  O  O   . ALA A 1 105 ? 20.455 21.024 -3.620  1.00 24.89 ? 296 ALA A O   1 
ATOM   844  C  CB  . ALA A 1 105 ? 17.456 20.751 -2.301  1.00 22.93 ? 296 ALA A CB  1 
ATOM   845  N  N   . LYS A 1 106 ? 18.940 22.362 -4.626  1.00 25.14 ? 297 LYS A N   1 
ATOM   846  C  CA  . LYS A 1 106 ? 19.676 22.545 -5.874  1.00 26.01 ? 297 LYS A CA  1 
ATOM   847  C  C   . LYS A 1 106 ? 21.026 23.205 -5.638  1.00 26.42 ? 297 LYS A C   1 
ATOM   848  O  O   . LYS A 1 106 ? 22.064 22.685 -6.057  1.00 25.90 ? 297 LYS A O   1 
ATOM   849  C  CB  . LYS A 1 106 ? 18.854 23.424 -6.811  1.00 26.64 ? 297 LYS A CB  1 
ATOM   850  C  CG  . LYS A 1 106 ? 19.317 23.433 -8.256  1.00 28.15 ? 297 LYS A CG  1 
ATOM   851  C  CD  . LYS A 1 106 ? 18.418 24.325 -9.098  1.00 29.77 ? 297 LYS A CD  1 
ATOM   852  C  CE  . LYS A 1 106 ? 17.134 23.624 -9.524  1.00 28.88 ? 297 LYS A CE  1 
ATOM   853  N  NZ  . LYS A 1 106 ? 16.337 23.183 -8.361  1.00 30.04 ? 297 LYS A NZ  1 
ATOM   854  N  N   . PHE A 1 107 ? 21.005 24.357 -4.970  1.00 26.96 ? 298 PHE A N   1 
ATOM   855  C  CA  . PHE A 1 107 ? 22.221 25.106 -4.674  1.00 27.55 ? 298 PHE A CA  1 
ATOM   856  C  C   . PHE A 1 107 ? 23.293 24.238 -4.009  1.00 28.13 ? 298 PHE A C   1 
ATOM   857  O  O   . PHE A 1 107 ? 24.414 24.149 -4.501  1.00 27.85 ? 298 PHE A O   1 
ATOM   858  C  CB  . PHE A 1 107 ? 21.900 26.349 -3.824  1.00 27.53 ? 298 PHE A CB  1 
ATOM   859  C  CG  . PHE A 1 107 ? 23.113 27.017 -3.257  1.00 29.11 ? 298 PHE A CG  1 
ATOM   860  C  CD1 . PHE A 1 107 ? 24.012 27.684 -4.088  1.00 31.22 ? 298 PHE A CD1 1 
ATOM   861  C  CD2 . PHE A 1 107 ? 23.365 26.981 -1.896  1.00 30.88 ? 298 PHE A CD2 1 
ATOM   862  C  CE1 . PHE A 1 107 ? 25.151 28.297 -3.569  1.00 31.82 ? 298 PHE A CE1 1 
ATOM   863  C  CE2 . PHE A 1 107 ? 24.504 27.602 -1.364  1.00 31.79 ? 298 PHE A CE2 1 
ATOM   864  C  CZ  . PHE A 1 107 ? 25.392 28.260 -2.204  1.00 31.70 ? 298 PHE A CZ  1 
ATOM   865  N  N   . ILE A 1 108 ? 22.945 23.582 -2.902  1.00 29.42 ? 299 ILE A N   1 
ATOM   866  C  CA  . ILE A 1 108 ? 23.933 22.795 -2.156  1.00 31.06 ? 299 ILE A CA  1 
ATOM   867  C  C   . ILE A 1 108 ? 24.408 21.557 -2.932  1.00 32.48 ? 299 ILE A C   1 
ATOM   868  O  O   . ILE A 1 108 ? 25.561 21.146 -2.789  1.00 32.76 ? 299 ILE A O   1 
ATOM   869  C  CB  . ILE A 1 108 ? 23.442 22.416 -0.729  1.00 31.12 ? 299 ILE A CB  1 
ATOM   870  C  CG1 . ILE A 1 108 ? 22.163 21.572 -0.788  1.00 31.18 ? 299 ILE A CG1 1 
ATOM   871  C  CG2 . ILE A 1 108 ? 23.242 23.686 0.109   1.00 30.49 ? 299 ILE A CG2 1 
ATOM   872  C  CD1 . ILE A 1 108 ? 21.791 20.875 0.519   1.00 33.23 ? 299 ILE A CD1 1 
ATOM   873  N  N   . SER A 1 109 ? 23.522 20.997 -3.760  1.00 33.90 ? 300 SER A N   1 
ATOM   874  C  CA  . SER A 1 109 ? 23.850 19.859 -4.628  1.00 35.78 ? 300 SER A CA  1 
ATOM   875  C  C   . SER A 1 109 ? 24.849 20.200 -5.728  1.00 37.27 ? 300 SER A C   1 
ATOM   876  O  O   . SER A 1 109 ? 25.686 19.372 -6.084  1.00 37.46 ? 300 SER A O   1 
ATOM   877  C  CB  . SER A 1 109 ? 22.583 19.303 -5.276  1.00 35.23 ? 300 SER A CB  1 
ATOM   878  O  OG  . SER A 1 109 ? 21.728 18.763 -4.287  1.00 35.97 ? 300 SER A OG  1 
ATOM   879  N  N   . LYS A 1 110 ? 24.748 21.412 -6.269  1.00 39.07 ? 301 LYS A N   1 
ATOM   880  C  CA  . LYS A 1 110 ? 25.604 21.832 -7.383  1.00 40.87 ? 301 LYS A CA  1 
ATOM   881  C  C   . LYS A 1 110 ? 26.869 22.527 -6.922  1.00 41.47 ? 301 LYS A C   1 
ATOM   882  O  O   . LYS A 1 110 ? 27.721 22.864 -7.742  1.00 42.23 ? 301 LYS A O   1 
ATOM   883  C  CB  . LYS A 1 110 ? 24.829 22.726 -8.364  1.00 41.16 ? 301 LYS A CB  1 
ATOM   884  C  CG  . LYS A 1 110 ? 23.608 22.051 -8.971  1.00 42.63 ? 301 LYS A CG  1 
ATOM   885  C  CD  . LYS A 1 110 ? 23.087 22.808 -10.186 1.00 45.60 ? 301 LYS A CD  1 
ATOM   886  C  CE  . LYS A 1 110 ? 21.768 22.164 -10.670 1.00 46.59 ? 301 LYS A CE  1 
ATOM   887  N  NZ  . LYS A 1 110 ? 21.368 22.740 -12.029 1.00 48.12 ? 301 LYS A NZ  1 
ATOM   888  N  N   . ASN A 1 111 ? 26.997 22.736 -5.614  1.00 42.41 ? 302 ASN A N   1 
ATOM   889  C  CA  . ASN A 1 111 ? 28.135 23.461 -5.069  1.00 43.22 ? 302 ASN A CA  1 
ATOM   890  C  C   . ASN A 1 111 ? 29.153 22.630 -4.291  1.00 43.48 ? 302 ASN A C   1 
ATOM   891  O  O   . ASN A 1 111 ? 30.355 22.815 -4.470  1.00 44.49 ? 302 ASN A O   1 
ATOM   892  C  CB  . ASN A 1 111 ? 27.668 24.659 -4.246  1.00 43.70 ? 302 ASN A CB  1 
ATOM   893  C  CG  . ASN A 1 111 ? 27.316 25.853 -5.113  1.00 45.20 ? 302 ASN A CG  1 
ATOM   894  O  OD1 . ASN A 1 111 ? 26.357 25.816 -5.895  1.00 46.49 ? 302 ASN A OD1 1 
ATOM   895  N  ND2 . ASN A 1 111 ? 28.097 26.925 -4.979  1.00 46.94 ? 302 ASN A ND2 1 
ATOM   896  N  N   . LYS A 1 112 ? 28.687 21.733 -3.426  1.00 43.30 ? 303 LYS A N   1 
ATOM   897  C  CA  . LYS A 1 112 ? 29.573 20.821 -2.682  1.00 43.02 ? 303 LYS A CA  1 
ATOM   898  C  C   . LYS A 1 112 ? 30.499 21.528 -1.678  1.00 42.20 ? 303 LYS A C   1 
ATOM   899  O  O   . LYS A 1 112 ? 30.775 20.994 -0.588  1.00 42.32 ? 303 LYS A O   1 
ATOM   900  C  CB  . LYS A 1 112 ? 30.386 19.945 -3.645  1.00 43.58 ? 303 LYS A CB  1 
ATOM   901  C  CG  . LYS A 1 112 ? 31.029 18.712 -3.015  1.00 45.41 ? 303 LYS A CG  1 
ATOM   902  C  CD  . LYS A 1 112 ? 31.923 17.971 -4.016  1.00 48.04 ? 303 LYS A CD  1 
ATOM   903  C  CE  . LYS A 1 112 ? 31.117 17.386 -5.189  1.00 49.73 ? 303 LYS A CE  1 
ATOM   904  N  NZ  . LYS A 1 112 ? 31.994 16.615 -6.134  1.00 50.42 ? 303 LYS A NZ  1 
ATOM   905  N  N   . HIS A 1 113 ? 30.961 22.727 -2.049  1.00 40.85 ? 304 HIS A N   1 
ATOM   906  C  CA  . HIS A 1 113 ? 31.824 23.535 -1.194  1.00 39.67 ? 304 HIS A CA  1 
ATOM   907  C  C   . HIS A 1 113 ? 31.053 24.426 -0.226  1.00 38.17 ? 304 HIS A C   1 
ATOM   908  O  O   . HIS A 1 113 ? 31.614 25.379 0.312   1.00 38.84 ? 304 HIS A O   1 
ATOM   909  C  CB  . HIS A 1 113 ? 32.766 24.400 -2.041  1.00 40.17 ? 304 HIS A CB  1 
ATOM   910  C  CG  . HIS A 1 113 ? 33.738 23.613 -2.864  1.00 41.30 ? 304 HIS A CG  1 
ATOM   911  N  ND1 . HIS A 1 113 ? 34.507 22.594 -2.341  1.00 42.36 ? 304 HIS A ND1 1 
ATOM   912  C  CD2 . HIS A 1 113 ? 34.075 23.705 -4.173  1.00 42.27 ? 304 HIS A CD2 1 
ATOM   913  C  CE1 . HIS A 1 113 ? 35.263 22.081 -3.296  1.00 43.14 ? 304 HIS A CE1 1 
ATOM   914  N  NE2 . HIS A 1 113 ? 35.022 22.739 -4.416  1.00 43.35 ? 304 HIS A NE2 1 
ATOM   915  N  N   . VAL A 1 114 ? 29.780 24.111 -0.003  1.00 36.12 ? 305 VAL A N   1 
ATOM   916  C  CA  . VAL A 1 114 ? 28.929 24.862 0.925   1.00 33.86 ? 305 VAL A CA  1 
ATOM   917  C  C   . VAL A 1 114 ? 28.157 23.891 1.834   1.00 32.44 ? 305 VAL A C   1 
ATOM   918  O  O   . VAL A 1 114 ? 27.339 23.097 1.348   1.00 32.00 ? 305 VAL A O   1 
ATOM   919  C  CB  . VAL A 1 114 ? 27.897 25.782 0.176   1.00 33.98 ? 305 VAL A CB  1 
ATOM   920  C  CG1 . VAL A 1 114 ? 26.905 26.392 1.164   1.00 33.35 ? 305 VAL A CG1 1 
ATOM   921  C  CG2 . VAL A 1 114 ? 28.599 26.897 -0.618  1.00 33.69 ? 305 VAL A CG2 1 
ATOM   922  N  N   . SER A 1 115 ? 28.442 23.967 3.136   1.00 30.06 ? 306 SER A N   1 
ATOM   923  C  CA  . SER A 1 115 ? 27.686 23.285 4.174   1.00 28.70 ? 306 SER A CA  1 
ATOM   924  C  C   . SER A 1 115 ? 26.573 24.204 4.672   1.00 26.91 ? 306 SER A C   1 
ATOM   925  O  O   . SER A 1 115 ? 26.849 25.166 5.368   1.00 26.76 ? 306 SER A O   1 
ATOM   926  C  CB  . SER A 1 115 ? 28.582 22.965 5.386   1.00 28.98 ? 306 SER A CB  1 
ATOM   927  O  OG  . SER A 1 115 ? 29.762 22.272 5.026   1.00 31.59 ? 306 SER A OG  1 
ATOM   928  N  N   . LEU A 1 116 ? 25.327 23.870 4.358   1.00 25.32 ? 307 LEU A N   1 
ATOM   929  C  CA  . LEU A 1 116 ? 24.163 24.646 4.774   1.00 23.73 ? 307 LEU A CA  1 
ATOM   930  C  C   . LEU A 1 116 ? 23.472 24.078 6.022   1.00 23.10 ? 307 LEU A C   1 
ATOM   931  O  O   . LEU A 1 116 ? 23.094 22.905 6.058   1.00 22.47 ? 307 LEU A O   1 
ATOM   932  C  CB  . LEU A 1 116 ? 23.157 24.723 3.619   1.00 23.47 ? 307 LEU A CB  1 
ATOM   933  C  CG  . LEU A 1 116 ? 21.886 25.555 3.815   1.00 23.16 ? 307 LEU A CG  1 
ATOM   934  C  CD1 . LEU A 1 116 ? 22.198 27.043 4.056   1.00 21.33 ? 307 LEU A CD1 1 
ATOM   935  C  CD2 . LEU A 1 116 ? 20.939 25.357 2.617   1.00 21.61 ? 307 LEU A CD2 1 
ATOM   936  N  N   . CYS A 1 117 ? 23.343 24.914 7.043   1.00 22.00 ? 308 CYS A N   1 
ATOM   937  C  CA  . CYS A 1 117 ? 22.598 24.585 8.246   1.00 23.79 ? 308 CYS A CA  1 
ATOM   938  C  C   . CYS A 1 117 ? 21.471 25.603 8.392   1.00 22.49 ? 308 CYS A C   1 
ATOM   939  O  O   . CYS A 1 117 ? 21.718 26.805 8.480   1.00 22.52 ? 308 CYS A O   1 
ATOM   940  C  CB  . CYS A 1 117 ? 23.499 24.612 9.493   1.00 23.68 ? 308 CYS A CB  1 
ATOM   941  S  SG  . CYS A 1 117 ? 25.000 23.584 9.335   1.00 31.74 ? 308 CYS A SG  1 
ATOM   942  N  N   . ILE A 1 118 ? 20.239 25.115 8.374   1.00 21.98 ? 309 ILE A N   1 
ATOM   943  C  CA  . ILE A 1 118 ? 19.052 25.971 8.485   1.00 21.96 ? 309 ILE A CA  1 
ATOM   944  C  C   . ILE A 1 118 ? 18.398 25.729 9.834   1.00 21.60 ? 309 ILE A C   1 
ATOM   945  O  O   . ILE A 1 118 ? 17.978 24.614 10.125  1.00 21.95 ? 309 ILE A O   1 
ATOM   946  C  CB  . ILE A 1 118 ? 18.022 25.659 7.379   1.00 22.24 ? 309 ILE A CB  1 
ATOM   947  C  CG1 . ILE A 1 118 ? 18.640 25.849 5.989   1.00 23.38 ? 309 ILE A CG1 1 
ATOM   948  C  CG2 . ILE A 1 118 ? 16.784 26.544 7.519   1.00 22.85 ? 309 ILE A CG2 1 
ATOM   949  C  CD1 . ILE A 1 118 ? 19.183 27.260 5.635   1.00 33.23 ? 309 ILE A CD1 1 
ATOM   950  N  N   . PHE A 1 119 ? 18.333 26.779 10.651  1.00 21.03 ? 310 PHE A N   1 
ATOM   951  C  CA  . PHE A 1 119 ? 17.632 26.746 11.924  1.00 20.46 ? 310 PHE A CA  1 
ATOM   952  C  C   . PHE A 1 119 ? 16.381 27.588 11.746  1.00 20.24 ? 310 PHE A C   1 
ATOM   953  O  O   . PHE A 1 119 ? 16.484 28.739 11.347  1.00 19.29 ? 310 PHE A O   1 
ATOM   954  C  CB  . PHE A 1 119 ? 18.493 27.336 13.046  1.00 20.57 ? 310 PHE A CB  1 
ATOM   955  C  CG  . PHE A 1 119 ? 19.667 26.488 13.431  1.00 20.66 ? 310 PHE A CG  1 
ATOM   956  C  CD1 . PHE A 1 119 ? 20.905 26.668 12.812  1.00 20.73 ? 310 PHE A CD1 1 
ATOM   957  C  CD2 . PHE A 1 119 ? 19.546 25.523 14.431  1.00 20.57 ? 310 PHE A CD2 1 
ATOM   958  C  CE1 . PHE A 1 119 ? 22.005 25.888 13.171  1.00 21.86 ? 310 PHE A CE1 1 
ATOM   959  C  CE2 . PHE A 1 119 ? 20.638 24.735 14.804  1.00 22.62 ? 310 PHE A CE2 1 
ATOM   960  C  CZ  . PHE A 1 119 ? 21.877 24.916 14.170  1.00 21.69 ? 310 PHE A CZ  1 
ATOM   961  N  N   . THR A 1 120 ? 15.213 27.014 12.030  1.00 19.66 ? 311 THR A N   1 
ATOM   962  C  CA  . THR A 1 120 ? 13.944 27.707 11.837  1.00 19.92 ? 311 THR A CA  1 
ATOM   963  C  C   . THR A 1 120 ? 13.184 27.847 13.144  1.00 20.53 ? 311 THR A C   1 
ATOM   964  O  O   . THR A 1 120 ? 13.268 26.982 14.024  1.00 19.93 ? 311 THR A O   1 
ATOM   965  C  CB  . THR A 1 120 ? 13.036 27.003 10.801  1.00 20.23 ? 311 THR A CB  1 
ATOM   966  O  OG1 . THR A 1 120 ? 11.840 27.782 10.598  1.00 21.04 ? 311 THR A OG1 1 
ATOM   967  C  CG2 . THR A 1 120 ? 12.656 25.583 11.269  1.00 18.77 ? 311 THR A CG2 1 
ATOM   968  N  N   . ALA A 1 121 ? 12.430 28.933 13.262  1.00 20.83 ? 312 ALA A N   1 
ATOM   969  C  CA  . ALA A 1 121 ? 11.686 29.189 14.501  1.00 22.02 ? 312 ALA A CA  1 
ATOM   970  C  C   . ALA A 1 121 ? 10.350 28.426 14.587  1.00 22.37 ? 312 ALA A C   1 
ATOM   971  O  O   . ALA A 1 121 ? 9.992  27.961 15.679  1.00 22.14 ? 312 ALA A O   1 
ATOM   972  C  CB  . ALA A 1 121 ? 11.495 30.708 14.733  1.00 20.88 ? 312 ALA A CB  1 
ATOM   973  N  N   . ARG A 1 122 ? 9.654  28.238 13.454  1.00 23.70 ? 313 ARG A N   1 
ATOM   974  C  CA  . ARG A 1 122 ? 8.266  27.734 13.488  1.00 25.26 ? 313 ARG A CA  1 
ATOM   975  C  C   . ARG A 1 122 ? 8.511  26.973 12.173  1.00 27.21 ? 313 ARG A C   1 
ATOM   976  O  O   . ARG A 1 122 ? 9.566  27.175 11.540  1.00 29.13 ? 313 ARG A O   1 
ATOM   977  C  CB  . ARG A 1 122 ? 7.282  28.893 13.357  1.00 25.08 ? 313 ARG A CB  1 
ATOM   978  C  CG  . ARG A 1 122 ? 7.080  29.703 14.611  1.00 23.80 ? 313 ARG A CG  1 
ATOM   979  C  CD  . ARG A 1 122 ? 5.963  30.670 14.341  1.00 22.09 ? 313 ARG A CD  1 
ATOM   980  N  NE  . ARG A 1 122 ? 6.197  31.477 13.147  1.00 18.27 ? 313 ARG A NE  1 
ATOM   981  C  CZ  . ARG A 1 122 ? 6.980  32.546 13.126  1.00 18.92 ? 313 ARG A CZ  1 
ATOM   982  N  NH1 . ARG A 1 122 ? 7.612  32.925 14.220  1.00 16.90 ? 313 ARG A NH1 1 
ATOM   983  N  NH2 . ARG A 1 122 ? 7.145  33.230 12.006  1.00 21.12 ? 313 ARG A NH2 1 
ATOM   984  N  N   . ILE A 1 123 ? 7.638  26.077 11.760  1.00 28.43 ? 314 ILE A N   1 
ATOM   985  C  CA  . ILE A 1 123 ? 7.935  25.322 10.515  1.00 30.42 ? 314 ILE A CA  1 
ATOM   986  C  C   . ILE A 1 123 ? 6.714  25.820 9.738   1.00 31.65 ? 314 ILE A C   1 
ATOM   987  O  O   . ILE A 1 123 ? 5.586  25.852 10.265  1.00 30.74 ? 314 ILE A O   1 
ATOM   988  C  CB  . ILE A 1 123 ? 7.554  23.944 11.180  1.00 29.75 ? 314 ILE A CB  1 
ATOM   989  C  CG1 . ILE A 1 123 ? 8.756  23.267 11.827  1.00 30.11 ? 314 ILE A CG1 1 
ATOM   990  C  CG2 . ILE A 1 123 ? 6.955  22.977 10.129  1.00 30.18 ? 314 ILE A CG2 1 
ATOM   991  C  CD1 . ILE A 1 123 ? 8.471  22.153 12.870  1.00 33.23 ? 314 ILE A CD1 1 
ATOM   992  N  N   . TYR A 1 124 ? 6.954  26.181 8.482   1.00 33.80 ? 315 TYR A N   1 
ATOM   993  C  CA  . TYR A 1 124 ? 5.904  26.638 7.599   1.00 36.84 ? 315 TYR A CA  1 
ATOM   994  C  C   . TYR A 1 124 ? 5.698  25.230 7.030   1.00 38.52 ? 315 TYR A C   1 
ATOM   995  O  O   . TYR A 1 124 ? 6.627  24.669 6.443   1.00 39.62 ? 315 TYR A O   1 
ATOM   996  C  CB  . TYR A 1 124 ? 6.474  27.139 6.249   1.00 36.96 ? 315 TYR A CB  1 
ATOM   997  C  CG  . TYR A 1 124 ? 5.410  27.529 5.238   1.00 38.80 ? 315 TYR A CG  1 
ATOM   998  C  CD1 . TYR A 1 124 ? 5.580  27.270 3.880   1.00 39.87 ? 315 TYR A CD1 1 
ATOM   999  C  CD2 . TYR A 1 124 ? 4.230  28.150 5.644   1.00 40.92 ? 315 TYR A CD2 1 
ATOM   1000 C  CE1 . TYR A 1 124 ? 4.602  27.624 2.949   1.00 41.27 ? 315 TYR A CE1 1 
ATOM   1001 C  CE2 . TYR A 1 124 ? 3.248  28.503 4.727   1.00 42.63 ? 315 TYR A CE2 1 
ATOM   1002 C  CZ  . TYR A 1 124 ? 3.436  28.237 3.386   1.00 42.33 ? 315 TYR A CZ  1 
ATOM   1003 O  OH  . TYR A 1 124 ? 2.451  28.597 2.493   1.00 43.33 ? 315 TYR A OH  1 
ATOM   1004 N  N   . ASP A 1 125 ? 4.501  24.669 7.171   1.00 40.13 ? 316 ASP A N   1 
ATOM   1005 C  CA  . ASP A 1 125 ? 4.225  23.333 6.611   1.00 42.36 ? 316 ASP A CA  1 
ATOM   1006 C  C   . ASP A 1 125 ? 2.848  23.772 6.087   1.00 43.31 ? 316 ASP A C   1 
ATOM   1007 O  O   . ASP A 1 125 ? 1.938  24.057 6.874   1.00 43.36 ? 316 ASP A O   1 
ATOM   1008 C  CB  . ASP A 1 125 ? 4.038  22.550 7.923   1.00 42.31 ? 316 ASP A CB  1 
ATOM   1009 C  CG  . ASP A 1 125 ? 3.371  21.197 7.711   1.00 44.05 ? 316 ASP A CG  1 
ATOM   1010 O  OD1 . ASP A 1 125 ? 3.006  20.546 8.721   1.00 46.03 ? 316 ASP A OD1 1 
ATOM   1011 O  OD2 . ASP A 1 125 ? 3.218  20.775 6.543   1.00 44.65 ? 316 ASP A OD2 1 
ATOM   1012 N  N   . ASP A 1 126 ? 2.697  23.801 4.760   1.00 44.47 ? 317 ASP A N   1 
ATOM   1013 C  CA  . ASP A 1 126 ? 1.387  24.059 4.143   1.00 45.36 ? 317 ASP A CA  1 
ATOM   1014 C  C   . ASP A 1 126 ? 0.514  22.797 4.131   1.00 45.64 ? 317 ASP A C   1 
ATOM   1015 O  O   . ASP A 1 126 ? -0.542 22.766 3.484   1.00 45.82 ? 317 ASP A O   1 
ATOM   1016 C  CB  . ASP A 1 126 ? 1.567  24.599 2.719   1.00 45.54 ? 317 ASP A CB  1 
ATOM   1017 C  CG  . ASP A 1 126 ? 1.943  23.503 1.723   1.00 45.98 ? 317 ASP A CG  1 
ATOM   1018 O  OD1 . ASP A 1 126 ? 2.576  22.499 2.120   1.00 44.92 ? 317 ASP A OD1 1 
ATOM   1019 O  OD2 . ASP A 1 126 ? 1.596  23.657 0.532   1.00 48.46 ? 317 ASP A OD2 1 
ATOM   1020 N  N   . GLN A 1 127 ? 0.986  21.756 4.830   1.00 46.16 ? 318 GLN A N   1 
ATOM   1021 C  CA  . GLN A 1 127 ? 0.302  20.457 4.930   1.00 46.51 ? 318 GLN A CA  1 
ATOM   1022 C  C   . GLN A 1 127 ? 0.314  19.681 3.608   1.00 46.39 ? 318 GLN A C   1 
ATOM   1023 O  O   . GLN A 1 127 ? -0.120 18.523 3.541   1.00 46.94 ? 318 GLN A O   1 
ATOM   1024 C  CB  . GLN A 1 127 ? -1.127 20.628 5.469   1.00 46.82 ? 318 GLN A CB  1 
ATOM   1025 C  CG  . GLN A 1 127 ? -1.190 21.230 6.876   1.00 48.02 ? 318 GLN A CG  1 
ATOM   1026 C  CD  . GLN A 1 127 ? -2.560 21.804 7.222   1.00 50.15 ? 318 GLN A CD  1 
ATOM   1027 O  OE1 . GLN A 1 127 ? -2.788 22.273 8.342   1.00 51.61 ? 318 GLN A OE1 1 
ATOM   1028 N  NE2 . GLN A 1 127 ? -3.477 21.778 6.262   1.00 50.64 ? 318 GLN A NE2 1 
ATOM   1029 N  N   . GLY A 1 128 ? 0.839  20.318 2.565   1.00 45.87 ? 319 GLY A N   1 
ATOM   1030 C  CA  . GLY A 1 128 ? 0.924  19.706 1.254   1.00 44.41 ? 319 GLY A CA  1 
ATOM   1031 C  C   . GLY A 1 128 ? 2.297  19.167 0.889   1.00 43.52 ? 319 GLY A C   1 
ATOM   1032 O  O   . GLY A 1 128 ? 2.667  18.053 1.284   1.00 43.47 ? 319 GLY A O   1 
ATOM   1033 N  N   . ARG A 1 129 ? 3.047  19.964 0.129   1.00 42.12 ? 320 ARG A N   1 
ATOM   1034 C  CA  . ARG A 1 129 ? 4.350  19.559 -0.376  1.00 40.60 ? 320 ARG A CA  1 
ATOM   1035 C  C   . ARG A 1 129 ? 5.520  20.079 0.467   1.00 39.01 ? 320 ARG A C   1 
ATOM   1036 O  O   . ARG A 1 129 ? 6.671  19.731 0.202   1.00 38.87 ? 320 ARG A O   1 
ATOM   1037 C  CB  . ARG A 1 129 ? 4.497  20.023 -1.826  1.00 41.11 ? 320 ARG A CB  1 
ATOM   1038 C  CG  . ARG A 1 129 ? 4.994  18.956 -2.763  1.00 43.10 ? 320 ARG A CG  1 
ATOM   1039 C  CD  . ARG A 1 129 ? 4.717  19.339 -4.210  1.00 46.35 ? 320 ARG A CD  1 
ATOM   1040 N  NE  . ARG A 1 129 ? 5.159  18.306 -5.149  1.00 49.49 ? 320 ARG A NE  1 
ATOM   1041 C  CZ  . ARG A 1 129 ? 6.438  18.087 -5.492  1.00 51.17 ? 320 ARG A CZ  1 
ATOM   1042 N  NH1 . ARG A 1 129 ? 7.429  18.816 -4.961  1.00 53.08 ? 320 ARG A NH1 1 
ATOM   1043 N  NH2 . ARG A 1 129 ? 6.729  17.123 -6.359  1.00 49.88 ? 320 ARG A NH2 1 
ATOM   1044 N  N   . CYS A 1 130 ? 5.230  20.911 1.468   1.00 37.12 ? 321 CYS A N   1 
ATOM   1045 C  CA  . CYS A 1 130 ? 6.271  21.467 2.359   1.00 35.33 ? 321 CYS A CA  1 
ATOM   1046 C  C   . CYS A 1 130 ? 7.067  20.395 3.078   1.00 33.61 ? 321 CYS A C   1 
ATOM   1047 O  O   . CYS A 1 130 ? 8.303  20.454 3.114   1.00 33.33 ? 321 CYS A O   1 
ATOM   1048 C  CB  . CYS A 1 130 ? 5.683  22.448 3.375   1.00 34.88 ? 321 CYS A CB  1 
ATOM   1049 S  SG  . CYS A 1 130 ? 5.210  24.060 2.684   1.00 37.03 ? 321 CYS A SG  1 
ATOM   1050 N  N   . GLN A 1 131 ? 6.356  19.414 3.635   1.00 32.14 ? 322 GLN A N   1 
ATOM   1051 C  CA  . GLN A 1 131 ? 6.967  18.274 4.326   1.00 30.95 ? 322 GLN A CA  1 
ATOM   1052 C  C   . GLN A 1 131 ? 7.940  17.543 3.417   1.00 29.99 ? 322 GLN A C   1 
ATOM   1053 O  O   . GLN A 1 131 ? 9.051  17.202 3.831   1.00 29.52 ? 322 GLN A O   1 
ATOM   1054 C  CB  . GLN A 1 131 ? 5.892  17.307 4.818   1.00 31.46 ? 322 GLN A CB  1 
ATOM   1055 C  CG  . GLN A 1 131 ? 5.016  17.882 5.932   1.00 32.30 ? 322 GLN A CG  1 
ATOM   1056 C  CD  . GLN A 1 131 ? 4.272  16.817 6.715   1.00 32.38 ? 322 GLN A CD  1 
ATOM   1057 O  OE1 . GLN A 1 131 ? 4.693  15.667 6.776   1.00 32.97 ? 322 GLN A OE1 1 
ATOM   1058 N  NE2 . GLN A 1 131 ? 3.157  17.203 7.328   1.00 33.48 ? 322 GLN A NE2 1 
ATOM   1059 N  N   . GLU A 1 132 ? 7.520  17.334 2.171   1.00 28.73 ? 323 GLU A N   1 
ATOM   1060 C  CA  . GLU A 1 132 ? 8.349  16.707 1.157   1.00 28.36 ? 323 GLU A CA  1 
ATOM   1061 C  C   . GLU A 1 132 ? 9.574  17.564 0.829   1.00 27.36 ? 323 GLU A C   1 
ATOM   1062 O  O   . GLU A 1 132 ? 10.667 17.032 0.643   1.00 27.11 ? 323 GLU A O   1 
ATOM   1063 C  CB  . GLU A 1 132 ? 7.516  16.435 -0.092  1.00 29.11 ? 323 GLU A CB  1 
ATOM   1064 C  CG  . GLU A 1 132 ? 8.268  15.720 -1.205  1.00 31.82 ? 323 GLU A CG  1 
ATOM   1065 C  CD  . GLU A 1 132 ? 7.505  15.730 -2.517  1.00 35.58 ? 323 GLU A CD  1 
ATOM   1066 O  OE1 . GLU A 1 132 ? 8.172  15.605 -3.584  1.00 38.13 ? 323 GLU A OE1 1 
ATOM   1067 O  OE2 . GLU A 1 132 ? 6.254  15.850 -2.484  1.00 35.59 ? 323 GLU A OE2 1 
ATOM   1068 N  N   . GLY A 1 133 ? 9.381  18.885 0.783   1.00 26.25 ? 324 GLY A N   1 
ATOM   1069 C  CA  . GLY A 1 133 ? 10.456 19.846 0.560   1.00 24.58 ? 324 GLY A CA  1 
ATOM   1070 C  C   . GLY A 1 133 ? 11.548 19.790 1.612   1.00 24.11 ? 324 GLY A C   1 
ATOM   1071 O  O   . GLY A 1 133 ? 12.734 19.786 1.283   1.00 23.96 ? 324 GLY A O   1 
ATOM   1072 N  N   . LEU A 1 134 ? 11.153 19.733 2.885   1.00 23.45 ? 325 LEU A N   1 
ATOM   1073 C  CA  . LEU A 1 134 ? 12.112 19.555 3.984   1.00 22.75 ? 325 LEU A CA  1 
ATOM   1074 C  C   . LEU A 1 134 ? 12.877 18.229 3.889   1.00 22.60 ? 325 LEU A C   1 
ATOM   1075 O  O   . LEU A 1 134 ? 14.078 18.194 4.131   1.00 22.70 ? 325 LEU A O   1 
ATOM   1076 C  CB  . LEU A 1 134 ? 11.427 19.700 5.356   1.00 22.84 ? 325 LEU A CB  1 
ATOM   1077 C  CG  . LEU A 1 134 ? 10.648 20.997 5.664   1.00 23.06 ? 325 LEU A CG  1 
ATOM   1078 C  CD1 . LEU A 1 134 ? 10.133 21.007 7.093   1.00 22.37 ? 325 LEU A CD1 1 
ATOM   1079 C  CD2 . LEU A 1 134 ? 11.461 22.256 5.404   1.00 21.96 ? 325 LEU A CD2 1 
ATOM   1080 N  N   . ARG A 1 135 ? 12.190 17.138 3.544   1.00 22.64 ? 326 ARG A N   1 
ATOM   1081 C  CA  . ARG A 1 135 ? 12.865 15.862 3.303   1.00 22.78 ? 326 ARG A CA  1 
ATOM   1082 C  C   . ARG A 1 135 ? 13.855 15.923 2.140   1.00 22.73 ? 326 ARG A C   1 
ATOM   1083 O  O   . ARG A 1 135 ? 14.904 15.271 2.192   1.00 22.25 ? 326 ARG A O   1 
ATOM   1084 C  CB  . ARG A 1 135 ? 11.852 14.745 3.064   1.00 22.89 ? 326 ARG A CB  1 
ATOM   1085 C  CG  . ARG A 1 135 ? 11.058 14.387 4.305   1.00 23.66 ? 326 ARG A CG  1 
ATOM   1086 C  CD  . ARG A 1 135 ? 10.315 13.092 4.121   1.00 24.40 ? 326 ARG A CD  1 
ATOM   1087 N  NE  . ARG A 1 135 ? 9.194  13.249 3.195   1.00 26.60 ? 326 ARG A NE  1 
ATOM   1088 C  CZ  . ARG A 1 135 ? 7.964  13.586 3.569   1.00 28.26 ? 326 ARG A CZ  1 
ATOM   1089 N  NH1 . ARG A 1 135 ? 7.683  13.808 4.853   1.00 30.41 ? 326 ARG A NH1 1 
ATOM   1090 N  NH2 . ARG A 1 135 ? 7.009  13.702 2.655   1.00 30.67 ? 326 ARG A NH2 1 
ATOM   1091 N  N   . THR A 1 136 ? 13.516 16.702 1.109   1.00 22.65 ? 327 THR A N   1 
ATOM   1092 C  CA  . THR A 1 136 ? 14.391 16.929 -0.058  1.00 23.15 ? 327 THR A CA  1 
ATOM   1093 C  C   . THR A 1 136 ? 15.645 17.718 0.285   1.00 22.95 ? 327 THR A C   1 
ATOM   1094 O  O   . THR A 1 136 ? 16.742 17.400 -0.183  1.00 23.00 ? 327 THR A O   1 
ATOM   1095 C  CB  . THR A 1 136 ? 13.640 17.655 -1.201  1.00 23.31 ? 327 THR A CB  1 
ATOM   1096 O  OG1 . THR A 1 136 ? 12.495 16.880 -1.572  1.00 25.02 ? 327 THR A OG1 1 
ATOM   1097 C  CG2 . THR A 1 136 ? 14.545 17.833 -2.426  1.00 23.27 ? 327 THR A CG2 1 
ATOM   1098 N  N   . LEU A 1 137 ? 15.483 18.742 1.112   1.00 22.76 ? 328 LEU A N   1 
ATOM   1099 C  CA  . LEU A 1 137 ? 16.611 19.537 1.556   1.00 22.69 ? 328 LEU A CA  1 
ATOM   1100 C  C   . LEU A 1 137 ? 17.575 18.699 2.402   1.00 22.50 ? 328 LEU A C   1 
ATOM   1101 O  O   . LEU A 1 137 ? 18.792 18.800 2.236   1.00 22.27 ? 328 LEU A O   1 
ATOM   1102 C  CB  . LEU A 1 137 ? 16.110 20.753 2.356   1.00 23.20 ? 328 LEU A CB  1 
ATOM   1103 C  CG  . LEU A 1 137 ? 16.498 22.151 1.893   1.00 23.36 ? 328 LEU A CG  1 
ATOM   1104 C  CD1 . LEU A 1 137 ? 16.062 23.166 2.935   1.00 23.81 ? 328 LEU A CD1 1 
ATOM   1105 C  CD2 . LEU A 1 137 ? 17.999 22.278 1.592   1.00 23.52 ? 328 LEU A CD2 1 
ATOM   1106 N  N   . ALA A 1 138 ? 17.034 17.879 3.310   1.00 21.75 ? 329 ALA A N   1 
ATOM   1107 C  CA  . ALA A 1 138 ? 17.864 16.996 4.122   1.00 21.60 ? 329 ALA A CA  1 
ATOM   1108 C  C   . ALA A 1 138 ? 18.532 15.942 3.256   1.00 21.80 ? 329 ALA A C   1 
ATOM   1109 O  O   . ALA A 1 138 ? 19.697 15.581 3.480   1.00 21.27 ? 329 ALA A O   1 
ATOM   1110 C  CB  . ALA A 1 138 ? 17.049 16.331 5.203   1.00 21.55 ? 329 ALA A CB  1 
ATOM   1111 N  N   . GLU A 1 139 ? 17.792 15.446 2.268   1.00 21.73 ? 330 GLU A N   1 
ATOM   1112 C  CA  . GLU A 1 139 ? 18.338 14.455 1.354   1.00 22.61 ? 330 GLU A CA  1 
ATOM   1113 C  C   . GLU A 1 139 ? 19.532 15.062 0.632   1.00 21.64 ? 330 GLU A C   1 
ATOM   1114 O  O   . GLU A 1 139 ? 20.534 14.395 0.402   1.00 21.02 ? 330 GLU A O   1 
ATOM   1115 C  CB  . GLU A 1 139 ? 17.278 14.011 0.355   1.00 23.13 ? 330 GLU A CB  1 
ATOM   1116 C  CG  . GLU A 1 139 ? 17.694 12.823 -0.497  1.00 27.41 ? 330 GLU A CG  1 
ATOM   1117 C  CD  . GLU A 1 139 ? 16.503 12.118 -1.116  1.00 30.34 ? 330 GLU A CD  1 
ATOM   1118 O  OE1 . GLU A 1 139 ? 15.449 12.034 -0.450  1.00 32.87 ? 330 GLU A OE1 1 
ATOM   1119 O  OE2 . GLU A 1 139 ? 16.616 11.663 -2.268  1.00 31.48 ? 330 GLU A OE2 1 
ATOM   1120 N  N   . ALA A 1 140 ? 19.418 16.355 0.330   1.00 21.29 ? 331 ALA A N   1 
ATOM   1121 C  CA  . ALA A 1 140 ? 20.461 17.106 -0.349  1.00 20.70 ? 331 ALA A CA  1 
ATOM   1122 C  C   . ALA A 1 140 ? 21.667 17.378 0.544   1.00 20.80 ? 331 ALA A C   1 
ATOM   1123 O  O   . ALA A 1 140 ? 22.693 17.844 0.062   1.00 20.41 ? 331 ALA A O   1 
ATOM   1124 C  CB  . ALA A 1 140 ? 19.898 18.387 -0.912  1.00 19.66 ? 331 ALA A CB  1 
ATOM   1125 N  N   . GLY A 1 141 ? 21.550 17.063 1.835   1.00 21.19 ? 332 GLY A N   1 
ATOM   1126 C  CA  . GLY A 1 141 ? 22.663 17.240 2.763   1.00 21.82 ? 332 GLY A CA  1 
ATOM   1127 C  C   . GLY A 1 141 ? 22.591 18.451 3.688   1.00 22.35 ? 332 GLY A C   1 
ATOM   1128 O  O   . GLY A 1 141 ? 23.448 18.607 4.565   1.00 23.05 ? 332 GLY A O   1 
ATOM   1129 N  N   . ALA A 1 142 ? 21.594 19.315 3.511   1.00 22.17 ? 333 ALA A N   1 
ATOM   1130 C  CA  . ALA A 1 142 ? 21.397 20.435 4.444   1.00 22.24 ? 333 ALA A CA  1 
ATOM   1131 C  C   . ALA A 1 142 ? 21.010 19.949 5.844   1.00 22.50 ? 333 ALA A C   1 
ATOM   1132 O  O   . ALA A 1 142 ? 20.224 19.009 5.991   1.00 23.18 ? 333 ALA A O   1 
ATOM   1133 C  CB  . ALA A 1 142 ? 20.346 21.390 3.927   1.00 22.02 ? 333 ALA A CB  1 
ATOM   1134 N  N   . LYS A 1 143 ? 21.567 20.584 6.871   1.00 22.40 ? 334 LYS A N   1 
ATOM   1135 C  CA  . LYS A 1 143 ? 21.084 20.344 8.224   1.00 21.90 ? 334 LYS A CA  1 
ATOM   1136 C  C   . LYS A 1 143 ? 19.907 21.264 8.479   1.00 21.55 ? 334 LYS A C   1 
ATOM   1137 O  O   . LYS A 1 143 ? 20.038 22.494 8.418   1.00 20.62 ? 334 LYS A O   1 
ATOM   1138 C  CB  . LYS A 1 143 ? 22.168 20.565 9.271   1.00 21.90 ? 334 LYS A CB  1 
ATOM   1139 C  CG  . LYS A 1 143 ? 21.693 20.193 10.685  1.00 22.33 ? 334 LYS A CG  1 
ATOM   1140 C  CD  . LYS A 1 143 ? 22.722 20.564 11.723  1.00 23.15 ? 334 LYS A CD  1 
ATOM   1141 C  CE  . LYS A 1 143 ? 22.311 20.070 13.097  1.00 22.75 ? 334 LYS A CE  1 
ATOM   1142 N  NZ  . LYS A 1 143 ? 23.427 20.271 14.078  1.00 21.48 ? 334 LYS A NZ  1 
ATOM   1143 N  N   . ILE A 1 144 ? 18.750 20.655 8.724   1.00 21.67 ? 335 ILE A N   1 
ATOM   1144 C  CA  . ILE A 1 144 ? 17.545 21.396 9.073   1.00 21.84 ? 335 ILE A CA  1 
ATOM   1145 C  C   . ILE A 1 144 ? 17.187 21.096 10.521  1.00 21.81 ? 335 ILE A C   1 
ATOM   1146 O  O   . ILE A 1 144 ? 16.986 19.941 10.903  1.00 21.78 ? 335 ILE A O   1 
ATOM   1147 C  CB  . ILE A 1 144 ? 16.345 21.046 8.178   1.00 21.95 ? 335 ILE A CB  1 
ATOM   1148 C  CG1 . ILE A 1 144 ? 16.726 21.115 6.694   1.00 22.34 ? 335 ILE A CG1 1 
ATOM   1149 C  CG2 . ILE A 1 144 ? 15.144 21.976 8.516   1.00 21.90 ? 335 ILE A CG2 1 
ATOM   1150 C  CD1 . ILE A 1 144 ? 15.710 20.493 5.741   1.00 33.23 ? 335 ILE A CD1 1 
ATOM   1151 N  N   . SER A 1 145 ? 17.109 22.150 11.321  1.00 21.73 ? 336 SER A N   1 
ATOM   1152 C  CA  . SER A 1 145 ? 16.828 22.001 12.737  1.00 21.69 ? 336 SER A CA  1 
ATOM   1153 C  C   . SER A 1 145 ? 15.913 23.123 13.252  1.00 20.70 ? 336 SER A C   1 
ATOM   1154 O  O   . SER A 1 145 ? 15.715 24.140 12.583  1.00 21.23 ? 336 SER A O   1 
ATOM   1155 C  CB  . SER A 1 145 ? 18.150 21.945 13.502  1.00 21.19 ? 336 SER A CB  1 
ATOM   1156 O  OG  . SER A 1 145 ? 17.936 22.221 14.864  1.00 25.55 ? 336 SER A OG  1 
ATOM   1157 N  N   . ILE A 1 146 ? 15.355 22.912 14.437  1.00 19.00 ? 337 ILE A N   1 
ATOM   1158 C  CA  . ILE A 1 146 ? 14.482 23.883 15.086  1.00 17.59 ? 337 ILE A CA  1 
ATOM   1159 C  C   . ILE A 1 146 ? 15.307 24.721 16.052  1.00 16.62 ? 337 ILE A C   1 
ATOM   1160 O  O   . ILE A 1 146 ? 16.164 24.179 16.776  1.00 15.64 ? 337 ILE A O   1 
ATOM   1161 C  CB  . ILE A 1 146 ? 13.373 23.165 15.865  1.00 17.77 ? 337 ILE A CB  1 
ATOM   1162 C  CG1 . ILE A 1 146 ? 12.585 22.213 14.936  1.00 16.91 ? 337 ILE A CG1 1 
ATOM   1163 C  CG2 . ILE A 1 146 ? 12.464 24.161 16.548  1.00 17.92 ? 337 ILE A CG2 1 
ATOM   1164 C  CD1 . ILE A 1 146 ? 11.832 22.856 13.744  1.00 33.23 ? 337 ILE A CD1 1 
ATOM   1165 N  N   . MET A 1 147 ? 15.043 26.030 16.051  1.00 15.55 ? 338 MET A N   1 
ATOM   1166 C  CA  . MET A 1 147 ? 15.693 26.995 16.941  1.00 15.34 ? 338 MET A CA  1 
ATOM   1167 C  C   . MET A 1 147 ? 15.293 26.728 18.393  1.00 16.40 ? 338 MET A C   1 
ATOM   1168 O  O   . MET A 1 147 ? 14.114 26.500 18.683  1.00 15.96 ? 338 MET A O   1 
ATOM   1169 C  CB  . MET A 1 147 ? 15.308 28.437 16.553  1.00 14.46 ? 338 MET A CB  1 
ATOM   1170 C  CG  . MET A 1 147 ? 15.924 28.965 15.214  1.00 11.93 ? 338 MET A CG  1 
ATOM   1171 S  SD  . MET A 1 147 ? 15.461 30.686 14.795  1.00 5.71  ? 338 MET A SD  1 
ATOM   1172 C  CE  . MET A 1 147 ? 16.531 31.626 15.880  1.00 12.08 ? 338 MET A CE  1 
ATOM   1173 N  N   . THR A 1 148 ? 16.287 26.730 19.281  1.00 17.43 ? 339 THR A N   1 
ATOM   1174 C  CA  . THR A 1 148 ? 16.068 26.596 20.726  1.00 18.48 ? 339 THR A CA  1 
ATOM   1175 C  C   . THR A 1 148 ? 16.555 27.867 21.392  1.00 18.74 ? 339 THR A C   1 
ATOM   1176 O  O   . THR A 1 148 ? 16.898 28.844 20.709  1.00 19.50 ? 339 THR A O   1 
ATOM   1177 C  CB  . THR A 1 148 ? 16.841 25.404 21.331  1.00 18.50 ? 339 THR A CB  1 
ATOM   1178 O  OG1 . THR A 1 148 ? 18.205 25.461 20.906  1.00 20.19 ? 339 THR A OG1 1 
ATOM   1179 C  CG2 . THR A 1 148 ? 16.236 24.089 20.890  1.00 19.74 ? 339 THR A CG2 1 
ATOM   1180 N  N   . TYR A 1 149 ? 16.570 27.868 22.720  1.00 19.09 ? 340 TYR A N   1 
ATOM   1181 C  CA  . TYR A 1 149 ? 17.059 28.998 23.485  1.00 18.75 ? 340 TYR A CA  1 
ATOM   1182 C  C   . TYR A 1 149 ? 18.394 29.511 22.939  1.00 18.37 ? 340 TYR A C   1 
ATOM   1183 O  O   . TYR A 1 149 ? 18.599 30.712 22.816  1.00 18.21 ? 340 TYR A O   1 
ATOM   1184 C  CB  . TYR A 1 149 ? 17.220 28.628 24.972  1.00 19.56 ? 340 TYR A CB  1 
ATOM   1185 C  CG  . TYR A 1 149 ? 17.870 29.753 25.749  1.00 20.19 ? 340 TYR A CG  1 
ATOM   1186 C  CD1 . TYR A 1 149 ? 17.134 30.853 26.146  1.00 20.17 ? 340 TYR A CD1 1 
ATOM   1187 C  CD2 . TYR A 1 149 ? 19.245 29.738 26.024  1.00 21.71 ? 340 TYR A CD2 1 
ATOM   1188 C  CE1 . TYR A 1 149 ? 17.731 31.900 26.828  1.00 22.81 ? 340 TYR A CE1 1 
ATOM   1189 C  CE2 . TYR A 1 149 ? 19.847 30.776 26.706  1.00 22.97 ? 340 TYR A CE2 1 
ATOM   1190 C  CZ  . TYR A 1 149 ? 19.082 31.853 27.100  1.00 23.29 ? 340 TYR A CZ  1 
ATOM   1191 O  OH  . TYR A 1 149 ? 19.670 32.898 27.778  1.00 27.39 ? 340 TYR A OH  1 
ATOM   1192 N  N   . SER A 1 150 ? 19.297 28.591 22.615  1.00 18.48 ? 341 SER A N   1 
ATOM   1193 C  CA  . SER A 1 150 ? 20.628 28.945 22.109  1.00 18.94 ? 341 SER A CA  1 
ATOM   1194 C  C   . SER A 1 150 ? 20.638 29.713 20.788  1.00 18.15 ? 341 SER A C   1 
ATOM   1195 O  O   . SER A 1 150 ? 21.352 30.699 20.645  1.00 18.39 ? 341 SER A O   1 
ATOM   1196 C  CB  . SER A 1 150 ? 21.484 27.697 21.981  1.00 18.84 ? 341 SER A CB  1 
ATOM   1197 O  OG  . SER A 1 150 ? 21.764 27.241 23.271  1.00 21.82 ? 341 SER A OG  1 
ATOM   1198 N  N   . GLU A 1 151 ? 19.852 29.255 19.826  1.00 18.03 ? 342 GLU A N   1 
ATOM   1199 C  CA  . GLU A 1 151 ? 19.785 29.922 18.536  1.00 17.24 ? 342 GLU A CA  1 
ATOM   1200 C  C   . GLU A 1 151 ? 19.087 31.276 18.656  1.00 17.43 ? 342 GLU A C   1 
ATOM   1201 O  O   . GLU A 1 151 ? 19.523 32.239 18.049  1.00 16.80 ? 342 GLU A O   1 
ATOM   1202 C  CB  . GLU A 1 151 ? 19.067 29.038 17.520  1.00 17.72 ? 342 GLU A CB  1 
ATOM   1203 C  CG  . GLU A 1 151 ? 19.901 27.826 17.047  1.00 17.36 ? 342 GLU A CG  1 
ATOM   1204 C  CD  . GLU A 1 151 ? 20.030 26.757 18.105  1.00 17.92 ? 342 GLU A CD  1 
ATOM   1205 O  OE1 . GLU A 1 151 ? 19.011 26.397 18.728  1.00 16.98 ? 342 GLU A OE1 1 
ATOM   1206 O  OE2 . GLU A 1 151 ? 21.165 26.298 18.345  1.00 19.26 ? 342 GLU A OE2 1 
ATOM   1207 N  N   . PHE A 1 152 ? 18.014 31.349 19.456  1.00 17.75 ? 343 PHE A N   1 
ATOM   1208 C  CA  . PHE A 1 152 ? 17.294 32.613 19.680  1.00 17.35 ? 343 PHE A CA  1 
ATOM   1209 C  C   . PHE A 1 152 ? 18.191 33.678 20.317  1.00 17.08 ? 343 PHE A C   1 
ATOM   1210 O  O   . PHE A 1 152 ? 18.230 34.828 19.863  1.00 16.49 ? 343 PHE A O   1 
ATOM   1211 C  CB  . PHE A 1 152 ? 16.069 32.393 20.548  1.00 17.55 ? 343 PHE A CB  1 
ATOM   1212 C  CG  . PHE A 1 152 ? 14.952 31.633 19.868  1.00 18.31 ? 343 PHE A CG  1 
ATOM   1213 C  CD1 . PHE A 1 152 ? 14.475 30.449 20.410  1.00 16.96 ? 343 PHE A CD1 1 
ATOM   1214 C  CD2 . PHE A 1 152 ? 14.361 32.118 18.701  1.00 19.44 ? 343 PHE A CD2 1 
ATOM   1215 C  CE1 . PHE A 1 152 ? 13.424 29.761 19.807  1.00 18.03 ? 343 PHE A CE1 1 
ATOM   1216 C  CE2 . PHE A 1 152 ? 13.306 31.436 18.092  1.00 18.92 ? 343 PHE A CE2 1 
ATOM   1217 C  CZ  . PHE A 1 152 ? 12.841 30.251 18.642  1.00 18.09 ? 343 PHE A CZ  1 
ATOM   1218 N  N   . LYS A 1 153 ? 18.922 33.280 21.355  1.00 17.25 ? 344 LYS A N   1 
ATOM   1219 C  CA  . LYS A 1 153 ? 19.857 34.174 22.045  1.00 18.10 ? 344 LYS A CA  1 
ATOM   1220 C  C   . LYS A 1 153 ? 20.993 34.626 21.120  1.00 18.64 ? 344 LYS A C   1 
ATOM   1221 O  O   . LYS A 1 153 ? 21.352 35.804 21.098  1.00 18.98 ? 344 LYS A O   1 
ATOM   1222 C  CB  . LYS A 1 153 ? 20.418 33.496 23.306  1.00 17.68 ? 344 LYS A CB  1 
ATOM   1223 C  CG  . LYS A 1 153 ? 21.438 34.331 24.078  1.00 19.94 ? 344 LYS A CG  1 
ATOM   1224 C  CD  . LYS A 1 153 ? 22.152 33.502 25.146  1.00 25.20 ? 344 LYS A CD  1 
ATOM   1225 C  CE  . LYS A 1 153 ? 22.997 34.376 26.069  1.00 28.35 ? 344 LYS A CE  1 
ATOM   1226 N  NZ  . LYS A 1 153 ? 24.386 34.594 25.548  1.00 31.21 ? 344 LYS A NZ  1 
ATOM   1227 N  N   . HIS A 1 154 ? 21.576 33.684 20.384  1.00 19.43 ? 345 HIS A N   1 
ATOM   1228 C  CA  . HIS A 1 154 ? 22.583 34.009 19.375  1.00 20.28 ? 345 HIS A CA  1 
ATOM   1229 C  C   . HIS A 1 154 ? 22.106 35.093 18.409  1.00 20.32 ? 345 HIS A C   1 
ATOM   1230 O  O   . HIS A 1 154 ? 22.779 36.116 18.225  1.00 19.80 ? 345 HIS A O   1 
ATOM   1231 C  CB  . HIS A 1 154 ? 23.000 32.757 18.584  1.00 20.33 ? 345 HIS A CB  1 
ATOM   1232 C  CG  . HIS A 1 154 ? 24.046 33.043 17.558  1.00 21.56 ? 345 HIS A CG  1 
ATOM   1233 N  ND1 . HIS A 1 154 ? 25.377 33.190 17.881  1.00 22.16 ? 345 HIS A ND1 1 
ATOM   1234 C  CD2 . HIS A 1 154 ? 23.952 33.273 16.226  1.00 21.73 ? 345 HIS A CD2 1 
ATOM   1235 C  CE1 . HIS A 1 154 ? 26.062 33.485 16.791  1.00 23.14 ? 345 HIS A CE1 1 
ATOM   1236 N  NE2 . HIS A 1 154 ? 25.221 33.538 15.773  1.00 23.51 ? 345 HIS A NE2 1 
ATOM   1237 N  N   . CYS A 1 155 ? 20.942 34.872 17.799  1.00 20.70 ? 346 CYS A N   1 
ATOM   1238 C  CA  . CYS A 1 155 ? 20.378 35.850 16.869  1.00 21.54 ? 346 CYS A CA  1 
ATOM   1239 C  C   . CYS A 1 155 ? 20.132 37.192 17.526  1.00 21.01 ? 346 CYS A C   1 
ATOM   1240 O  O   . CYS A 1 155 ? 20.396 38.235 16.920  1.00 20.21 ? 346 CYS A O   1 
ATOM   1241 C  CB  . CYS A 1 155 ? 19.086 35.340 16.248  1.00 21.35 ? 346 CYS A CB  1 
ATOM   1242 S  SG  . CYS A 1 155 ? 19.351 33.925 15.198  1.00 30.21 ? 346 CYS A SG  1 
ATOM   1243 N  N   . TRP A 1 156 ? 19.601 37.176 18.752  1.00 21.42 ? 347 TRP A N   1 
ATOM   1244 C  CA  . TRP A 1 156 ? 19.387 38.422 19.509  1.00 21.72 ? 347 TRP A CA  1 
ATOM   1245 C  C   . TRP A 1 156 ? 20.702 39.194 19.649  1.00 22.10 ? 347 TRP A C   1 
ATOM   1246 O  O   . TRP A 1 156 ? 20.758 40.400 19.381  1.00 22.25 ? 347 TRP A O   1 
ATOM   1247 C  CB  . TRP A 1 156 ? 18.768 38.135 20.886  1.00 21.51 ? 347 TRP A CB  1 
ATOM   1248 C  CG  . TRP A 1 156 ? 18.627 39.347 21.761  1.00 21.37 ? 347 TRP A CG  1 
ATOM   1249 C  CD1 . TRP A 1 156 ? 19.567 39.853 22.624  1.00 21.59 ? 347 TRP A CD1 1 
ATOM   1250 C  CD2 . TRP A 1 156 ? 17.487 40.200 21.866  1.00 21.82 ? 347 TRP A CD2 1 
ATOM   1251 N  NE1 . TRP A 1 156 ? 19.085 40.976 23.248  1.00 22.42 ? 347 TRP A NE1 1 
ATOM   1252 C  CE2 . TRP A 1 156 ? 17.808 41.213 22.803  1.00 23.80 ? 347 TRP A CE2 1 
ATOM   1253 C  CE3 . TRP A 1 156 ? 16.232 40.226 21.244  1.00 22.81 ? 347 TRP A CE3 1 
ATOM   1254 C  CZ2 . TRP A 1 156 ? 16.903 42.232 23.151  1.00 23.72 ? 347 TRP A CZ2 1 
ATOM   1255 C  CZ3 . TRP A 1 156 ? 15.331 41.241 21.589  1.00 24.60 ? 347 TRP A CZ3 1 
ATOM   1256 C  CH2 . TRP A 1 156 ? 15.677 42.230 22.535  1.00 23.53 ? 347 TRP A CH2 1 
ATOM   1257 N  N   . ASP A 1 157 ? 21.756 38.495 20.065  1.00 22.34 ? 348 ASP A N   1 
ATOM   1258 C  CA  . ASP A 1 157 ? 23.054 39.122 20.334  1.00 22.77 ? 348 ASP A CA  1 
ATOM   1259 C  C   . ASP A 1 157 ? 23.774 39.539 19.062  1.00 23.40 ? 348 ASP A C   1 
ATOM   1260 O  O   . ASP A 1 157 ? 24.607 40.433 19.090  1.00 24.18 ? 348 ASP A O   1 
ATOM   1261 C  CB  . ASP A 1 157 ? 23.958 38.172 21.126  1.00 22.87 ? 348 ASP A CB  1 
ATOM   1262 C  CG  . ASP A 1 157 ? 23.402 37.839 22.504  1.00 22.69 ? 348 ASP A CG  1 
ATOM   1263 O  OD1 . ASP A 1 157 ? 22.485 38.535 22.981  1.00 22.96 ? 348 ASP A OD1 1 
ATOM   1264 O  OD2 . ASP A 1 157 ? 23.892 36.879 23.116  1.00 21.70 ? 348 ASP A OD2 1 
ATOM   1265 N  N   . THR A 1 158 ? 23.444 38.897 17.945  1.00 23.53 ? 349 THR A N   1 
ATOM   1266 C  CA  . THR A 1 158 ? 24.176 39.115 16.708  1.00 23.45 ? 349 THR A CA  1 
ATOM   1267 C  C   . THR A 1 158 ? 23.461 40.008 15.705  1.00 23.50 ? 349 THR A C   1 
ATOM   1268 O  O   . THR A 1 158 ? 24.110 40.811 15.037  1.00 23.63 ? 349 THR A O   1 
ATOM   1269 C  CB  . THR A 1 158 ? 24.617 37.781 16.064  1.00 23.57 ? 349 THR A CB  1 
ATOM   1270 O  OG1 . THR A 1 158 ? 25.293 36.991 17.052  1.00 23.08 ? 349 THR A OG1 1 
ATOM   1271 C  CG2 . THR A 1 158 ? 25.549 38.033 14.899  1.00 23.61 ? 349 THR A CG2 1 
ATOM   1272 N  N   . PHE A 1 159 ? 22.141 39.871 15.614  1.00 23.19 ? 350 PHE A N   1 
ATOM   1273 C  CA  . PHE A 1 159 ? 21.358 40.534 14.579  1.00 23.44 ? 350 PHE A CA  1 
ATOM   1274 C  C   . PHE A 1 159 ? 20.348 41.573 15.065  1.00 24.09 ? 350 PHE A C   1 
ATOM   1275 O  O   . PHE A 1 159 ? 19.658 42.174 14.229  1.00 24.73 ? 350 PHE A O   1 
ATOM   1276 C  CB  . PHE A 1 159 ? 20.627 39.492 13.725  1.00 23.38 ? 350 PHE A CB  1 
ATOM   1277 C  CG  . PHE A 1 159 ? 21.547 38.568 12.991  1.00 22.15 ? 350 PHE A CG  1 
ATOM   1278 C  CD1 . PHE A 1 159 ? 21.787 37.281 13.472  1.00 21.60 ? 350 PHE A CD1 1 
ATOM   1279 C  CD2 . PHE A 1 159 ? 22.208 38.993 11.845  1.00 20.47 ? 350 PHE A CD2 1 
ATOM   1280 C  CE1 . PHE A 1 159 ? 22.665 36.415 12.802  1.00 20.71 ? 350 PHE A CE1 1 
ATOM   1281 C  CE2 . PHE A 1 159 ? 23.084 38.143 11.176  1.00 21.96 ? 350 PHE A CE2 1 
ATOM   1282 C  CZ  . PHE A 1 159 ? 23.311 36.855 11.661  1.00 21.75 ? 350 PHE A CZ  1 
ATOM   1283 N  N   . VAL A 1 160 ? 20.246 41.786 16.385  1.00 23.58 ? 351 VAL A N   1 
ATOM   1284 C  CA  . VAL A 1 160 ? 19.254 42.728 16.936  1.00 23.38 ? 351 VAL A CA  1 
ATOM   1285 C  C   . VAL A 1 160 ? 19.926 43.960 17.568  1.00 23.61 ? 351 VAL A C   1 
ATOM   1286 O  O   . VAL A 1 160 ? 20.991 43.856 18.190  1.00 22.83 ? 351 VAL A O   1 
ATOM   1287 C  CB  . VAL A 1 160 ? 18.266 42.033 17.917  1.00 23.77 ? 351 VAL A CB  1 
ATOM   1288 C  CG1 . VAL A 1 160 ? 17.204 43.002 18.454  1.00 22.54 ? 351 VAL A CG1 1 
ATOM   1289 C  CG2 . VAL A 1 160 ? 17.580 40.832 17.255  1.00 23.49 ? 351 VAL A CG2 1 
ATOM   1290 N  N   . ASP A 1 161 ? 19.315 45.130 17.357  1.00 23.73 ? 352 ASP A N   1 
ATOM   1291 C  CA  . ASP A 1 161 ? 19.764 46.382 17.978  1.00 23.48 ? 352 ASP A CA  1 
ATOM   1292 C  C   . ASP A 1 161 ? 19.259 46.384 19.410  1.00 21.89 ? 352 ASP A C   1 
ATOM   1293 O  O   . ASP A 1 161 ? 18.397 47.168 19.761  1.00 21.69 ? 352 ASP A O   1 
ATOM   1294 C  CB  . ASP A 1 161 ? 19.197 47.572 17.198  1.00 24.57 ? 352 ASP A CB  1 
ATOM   1295 C  CG  . ASP A 1 161 ? 19.857 48.915 17.562  1.00 27.90 ? 352 ASP A CG  1 
ATOM   1296 O  OD1 . ASP A 1 161 ? 19.688 49.866 16.776  1.00 29.49 ? 352 ASP A OD1 1 
ATOM   1297 O  OD2 . ASP A 1 161 ? 20.523 49.044 18.624  1.00 34.56 ? 352 ASP A OD2 1 
ATOM   1298 N  N   . HIS A 1 162 ? 19.798 45.482 20.229  1.00 21.14 ? 353 HIS A N   1 
ATOM   1299 C  CA  . HIS A 1 162 ? 19.354 45.297 21.615  1.00 19.82 ? 353 HIS A CA  1 
ATOM   1300 C  C   . HIS A 1 162 ? 19.745 46.475 22.516  1.00 19.49 ? 353 HIS A C   1 
ATOM   1301 O  O   . HIS A 1 162 ? 19.257 46.599 23.637  1.00 20.39 ? 353 HIS A O   1 
ATOM   1302 C  CB  . HIS A 1 162 ? 19.919 43.987 22.190  1.00 19.03 ? 353 HIS A CB  1 
ATOM   1303 C  CG  . HIS A 1 162 ? 21.400 43.841 22.032  1.00 17.96 ? 353 HIS A CG  1 
ATOM   1304 N  ND1 . HIS A 1 162 ? 21.972 42.896 21.204  1.00 18.76 ? 353 HIS A ND1 1 
ATOM   1305 C  CD2 . HIS A 1 162 ? 22.429 44.521 22.588  1.00 16.96 ? 353 HIS A CD2 1 
ATOM   1306 C  CE1 . HIS A 1 162 ? 23.290 43.013 21.243  1.00 16.88 ? 353 HIS A CE1 1 
ATOM   1307 N  NE2 . HIS A 1 162 ? 23.592 43.992 22.077  1.00 19.61 ? 353 HIS A NE2 1 
ATOM   1308 N  N   . GLN A 1 163 ? 20.655 47.312 22.034  1.00 18.73 ? 354 GLN A N   1 
ATOM   1309 C  CA  . GLN A 1 163 ? 21.092 48.495 22.760  1.00 18.73 ? 354 GLN A CA  1 
ATOM   1310 C  C   . GLN A 1 163 ? 21.607 48.114 24.150  1.00 19.13 ? 354 GLN A C   1 
ATOM   1311 O  O   . GLN A 1 163 ? 21.528 48.892 25.083  1.00 17.73 ? 354 GLN A O   1 
ATOM   1312 C  CB  . GLN A 1 163 ? 19.947 49.516 22.866  1.00 18.25 ? 354 GLN A CB  1 
ATOM   1313 C  CG  . GLN A 1 163 ? 19.389 49.959 21.543  1.00 17.07 ? 354 GLN A CG  1 
ATOM   1314 C  CD  . GLN A 1 163 ? 18.377 51.063 21.719  1.00 20.13 ? 354 GLN A CD  1 
ATOM   1315 O  OE1 . GLN A 1 163 ? 18.559 51.979 22.548  1.00 22.01 ? 354 GLN A OE1 1 
ATOM   1316 N  NE2 . GLN A 1 163 ? 17.303 51.000 20.941  1.00 19.06 ? 354 GLN A NE2 1 
ATOM   1317 N  N   . GLY A 1 164 ? 22.144 46.903 24.260  1.00 20.04 ? 355 GLY A N   1 
ATOM   1318 C  CA  . GLY A 1 164 ? 22.794 46.458 25.485  1.00 20.99 ? 355 GLY A CA  1 
ATOM   1319 C  C   . GLY A 1 164 ? 21.925 45.546 26.317  1.00 21.71 ? 355 GLY A C   1 
ATOM   1320 O  O   . GLY A 1 164 ? 22.416 44.926 27.251  1.00 22.74 ? 355 GLY A O   1 
ATOM   1321 N  N   . CYS A 1 165 ? 20.643 45.450 25.974  1.00 22.32 ? 356 CYS A N   1 
ATOM   1322 C  CA  . CYS A 1 165 ? 19.721 44.595 26.710  1.00 23.84 ? 356 CYS A CA  1 
ATOM   1323 C  C   . CYS A 1 165 ? 19.959 43.126 26.416  1.00 23.53 ? 356 CYS A C   1 
ATOM   1324 O  O   . CYS A 1 165 ? 19.906 42.708 25.263  1.00 23.14 ? 356 CYS A O   1 
ATOM   1325 C  CB  . CYS A 1 165 ? 18.255 44.953 26.438  1.00 24.20 ? 356 CYS A CB  1 
ATOM   1326 S  SG  . CYS A 1 165 ? 17.775 46.596 27.029  1.00 28.70 ? 356 CYS A SG  1 
ATOM   1327 N  N   . PRO A 1 166 ? 20.260 42.341 27.465  1.00 23.82 ? 357 PRO A N   1 
ATOM   1328 C  CA  . PRO A 1 166 ? 20.409 40.901 27.282  1.00 24.02 ? 357 PRO A CA  1 
ATOM   1329 C  C   . PRO A 1 166 ? 19.113 40.255 26.801  1.00 24.50 ? 357 PRO A C   1 
ATOM   1330 O  O   . PRO A 1 166 ? 18.037 40.870 26.884  1.00 24.53 ? 357 PRO A O   1 
ATOM   1331 C  CB  . PRO A 1 166 ? 20.800 40.405 28.677  1.00 24.41 ? 357 PRO A CB  1 
ATOM   1332 C  CG  . PRO A 1 166 ? 21.395 41.618 29.373  1.00 23.39 ? 357 PRO A CG  1 
ATOM   1333 C  CD  . PRO A 1 166 ? 20.543 42.754 28.857  1.00 24.04 ? 357 PRO A CD  1 
ATOM   1334 N  N   . PHE A 1 167 ? 19.232 39.044 26.259  1.00 24.47 ? 358 PHE A N   1 
ATOM   1335 C  CA  . PHE A 1 167 ? 18.101 38.338 25.693  1.00 25.36 ? 358 PHE A CA  1 
ATOM   1336 C  C   . PHE A 1 167 ? 17.192 37.837 26.804  1.00 25.79 ? 358 PHE A C   1 
ATOM   1337 O  O   . PHE A 1 167 ? 17.660 37.252 27.775  1.00 26.25 ? 358 PHE A O   1 
ATOM   1338 C  CB  . PHE A 1 167 ? 18.584 37.172 24.814  1.00 25.24 ? 358 PHE A CB  1 
ATOM   1339 C  CG  . PHE A 1 167 ? 17.486 36.290 24.342  1.00 25.32 ? 358 PHE A CG  1 
ATOM   1340 C  CD1 . PHE A 1 167 ? 16.484 36.790 23.506  1.00 24.91 ? 358 PHE A CD1 1 
ATOM   1341 C  CD2 . PHE A 1 167 ? 17.431 34.956 24.742  1.00 23.43 ? 358 PHE A CD2 1 
ATOM   1342 C  CE1 . PHE A 1 167 ? 15.456 35.967 23.076  1.00 23.06 ? 358 PHE A CE1 1 
ATOM   1343 C  CE2 . PHE A 1 167 ? 16.410 34.138 24.315  1.00 21.83 ? 358 PHE A CE2 1 
ATOM   1344 C  CZ  . PHE A 1 167 ? 15.422 34.641 23.481  1.00 21.99 ? 358 PHE A CZ  1 
ATOM   1345 N  N   . GLN A 1 168 ? 15.897 38.073 26.649  1.00 26.74 ? 359 GLN A N   1 
ATOM   1346 C  CA  . GLN A 1 168 ? 14.905 37.674 27.638  1.00 27.69 ? 359 GLN A CA  1 
ATOM   1347 C  C   . GLN A 1 168 ? 13.893 36.745 26.980  1.00 27.49 ? 359 GLN A C   1 
ATOM   1348 O  O   . GLN A 1 168 ? 13.031 37.192 26.231  1.00 27.63 ? 359 GLN A O   1 
ATOM   1349 C  CB  . GLN A 1 168 ? 14.200 38.909 28.215  1.00 28.71 ? 359 GLN A CB  1 
ATOM   1350 C  CG  . GLN A 1 168 ? 15.053 39.761 29.155  1.00 31.61 ? 359 GLN A CG  1 
ATOM   1351 C  CD  . GLN A 1 168 ? 14.509 41.181 29.328  1.00 35.91 ? 359 GLN A CD  1 
ATOM   1352 O  OE1 . GLN A 1 168 ? 13.293 41.394 29.512  1.00 37.88 ? 359 GLN A OE1 1 
ATOM   1353 N  NE2 . GLN A 1 168 ? 15.419 42.161 29.284  1.00 37.74 ? 359 GLN A NE2 1 
ATOM   1354 N  N   . PRO A 1 169 ? 13.991 35.442 27.266  1.00 27.48 ? 360 PRO A N   1 
ATOM   1355 C  CA  . PRO A 1 169 ? 13.098 34.445 26.696  1.00 27.03 ? 360 PRO A CA  1 
ATOM   1356 C  C   . PRO A 1 169 ? 11.640 34.642 27.135  1.00 26.96 ? 360 PRO A C   1 
ATOM   1357 O  O   . PRO A 1 169 ? 11.362 34.836 28.330  1.00 26.72 ? 360 PRO A O   1 
ATOM   1358 C  CB  . PRO A 1 169 ? 13.628 33.132 27.272  1.00 27.21 ? 360 PRO A CB  1 
ATOM   1359 C  CG  . PRO A 1 169 ? 14.995 33.446 27.746  1.00 28.35 ? 360 PRO A CG  1 
ATOM   1360 C  CD  . PRO A 1 169 ? 14.959 34.840 28.194  1.00 27.11 ? 360 PRO A CD  1 
ATOM   1361 N  N   . TRP A 1 170 ? 10.740 34.586 26.157  1.00 26.41 ? 361 TRP A N   1 
ATOM   1362 C  CA  . TRP A 1 170 ? 9.312  34.590 26.383  1.00 25.99 ? 361 TRP A CA  1 
ATOM   1363 C  C   . TRP A 1 170 ? 8.909  33.262 27.011  1.00 26.13 ? 361 TRP A C   1 
ATOM   1364 O  O   . TRP A 1 170 ? 9.561  32.232 26.803  1.00 25.46 ? 361 TRP A O   1 
ATOM   1365 C  CB  . TRP A 1 170 ? 8.563  34.816 25.064  1.00 25.79 ? 361 TRP A CB  1 
ATOM   1366 C  CG  . TRP A 1 170 ? 9.036  33.957 23.911  1.00 25.34 ? 361 TRP A CG  1 
ATOM   1367 C  CD1 . TRP A 1 170 ? 8.637  32.686 23.614  1.00 25.19 ? 361 TRP A CD1 1 
ATOM   1368 C  CD2 . TRP A 1 170 ? 9.984  34.327 22.895  1.00 24.53 ? 361 TRP A CD2 1 
ATOM   1369 N  NE1 . TRP A 1 170 ? 9.277  32.235 22.478  1.00 22.91 ? 361 TRP A NE1 1 
ATOM   1370 C  CE2 . TRP A 1 170 ? 10.114 33.223 22.020  1.00 24.22 ? 361 TRP A CE2 1 
ATOM   1371 C  CE3 . TRP A 1 170 ? 10.738 35.482 22.640  1.00 23.16 ? 361 TRP A CE3 1 
ATOM   1372 C  CZ2 . TRP A 1 170 ? 10.979 33.241 20.904  1.00 23.62 ? 361 TRP A CZ2 1 
ATOM   1373 C  CZ3 . TRP A 1 170 ? 11.592 35.497 21.526  1.00 21.87 ? 361 TRP A CZ3 1 
ATOM   1374 C  CH2 . TRP A 1 170 ? 11.701 34.388 20.678  1.00 20.65 ? 361 TRP A CH2 1 
ATOM   1375 N  N   . ASP A 1 171 ? 7.840  33.288 27.796  1.00 26.18 ? 362 ASP A N   1 
ATOM   1376 C  CA  . ASP A 1 171 ? 7.374  32.081 28.474  1.00 26.39 ? 362 ASP A CA  1 
ATOM   1377 C  C   . ASP A 1 171 ? 6.971  31.017 27.450  1.00 26.25 ? 362 ASP A C   1 
ATOM   1378 O  O   . ASP A 1 171 ? 6.398  31.329 26.411  1.00 25.96 ? 362 ASP A O   1 
ATOM   1379 C  CB  . ASP A 1 171 ? 6.217  32.415 29.418  1.00 26.66 ? 362 ASP A CB  1 
ATOM   1380 C  CG  . ASP A 1 171 ? 6.659  33.257 30.601  1.00 26.88 ? 362 ASP A CG  1 
ATOM   1381 O  OD1 . ASP A 1 171 ? 6.221  34.409 30.719  1.00 28.55 ? 362 ASP A OD1 1 
ATOM   1382 O  OD2 . ASP A 1 171 ? 7.466  32.777 31.407  1.00 28.95 ? 362 ASP A OD2 1 
ATOM   1383 N  N   . GLY A 1 172 ? 7.305  29.769 27.751  1.00 26.48 ? 363 GLY A N   1 
ATOM   1384 C  CA  . GLY A 1 172 ? 6.974  28.647 26.893  1.00 27.02 ? 363 GLY A CA  1 
ATOM   1385 C  C   . GLY A 1 172 ? 7.956  28.434 25.749  1.00 27.38 ? 363 GLY A C   1 
ATOM   1386 O  O   . GLY A 1 172 ? 7.804  27.473 24.995  1.00 28.17 ? 363 GLY A O   1 
ATOM   1387 N  N   . LEU A 1 173 ? 8.958  29.312 25.611  1.00 26.72 ? 364 LEU A N   1 
ATOM   1388 C  CA  . LEU A 1 173 ? 9.920  29.205 24.496  1.00 26.63 ? 364 LEU A CA  1 
ATOM   1389 C  C   . LEU A 1 173 ? 10.433 27.774 24.380  1.00 26.65 ? 364 LEU A C   1 
ATOM   1390 O  O   . LEU A 1 173 ? 10.412 27.179 23.294  1.00 25.60 ? 364 LEU A O   1 
ATOM   1391 C  CB  . LEU A 1 173 ? 11.102 30.195 24.627  1.00 25.47 ? 364 LEU A CB  1 
ATOM   1392 C  CG  . LEU A 1 173 ? 12.201 30.165 23.534  1.00 25.95 ? 364 LEU A CG  1 
ATOM   1393 C  CD1 . LEU A 1 173 ? 13.049 31.433 23.561  1.00 23.12 ? 364 LEU A CD1 1 
ATOM   1394 C  CD2 . LEU A 1 173 ? 13.113 28.925 23.629  1.00 23.88 ? 364 LEU A CD2 1 
ATOM   1395 N  N   . ASP A 1 174 ? 10.877 27.230 25.506  1.00 27.01 ? 365 ASP A N   1 
ATOM   1396 C  CA  . ASP A 1 174 ? 11.451 25.887 25.539  1.00 28.04 ? 365 ASP A CA  1 
ATOM   1397 C  C   . ASP A 1 174 ? 10.414 24.833 25.155  1.00 28.17 ? 365 ASP A C   1 
ATOM   1398 O  O   . ASP A 1 174 ? 10.715 23.875 24.443  1.00 28.72 ? 365 ASP A O   1 
ATOM   1399 C  CB  . ASP A 1 174 ? 12.042 25.607 26.925  1.00 28.70 ? 365 ASP A CB  1 
ATOM   1400 C  CG  . ASP A 1 174 ? 13.441 26.165 27.089  1.00 29.85 ? 365 ASP A CG  1 
ATOM   1401 O  OD1 . ASP A 1 174 ? 13.748 27.226 26.510  1.00 30.40 ? 365 ASP A OD1 1 
ATOM   1402 O  OD2 . ASP A 1 174 ? 14.252 25.528 27.798  1.00 34.13 ? 365 ASP A OD2 1 
ATOM   1403 N  N   . GLU A 1 175 ? 9.187  25.043 25.612  1.00 28.03 ? 366 GLU A N   1 
ATOM   1404 C  CA  . GLU A 1 175 ? 8.085  24.111 25.402  1.00 28.23 ? 366 GLU A CA  1 
ATOM   1405 C  C   . GLU A 1 175 ? 7.735  23.991 23.920  1.00 26.87 ? 366 GLU A C   1 
ATOM   1406 O  O   . GLU A 1 175 ? 7.638  22.887 23.402  1.00 26.27 ? 366 GLU A O   1 
ATOM   1407 C  CB  . GLU A 1 175 ? 6.860  24.560 26.220  1.00 28.41 ? 366 GLU A CB  1 
ATOM   1408 C  CG  . GLU A 1 175 ? 5.635  23.671 26.073  1.00 33.12 ? 366 GLU A CG  1 
ATOM   1409 C  CD  . GLU A 1 175 ? 4.575  23.919 27.157  1.00 39.18 ? 366 GLU A CD  1 
ATOM   1410 O  OE1 . GLU A 1 175 ? 3.654  23.078 27.282  1.00 41.69 ? 366 GLU A OE1 1 
ATOM   1411 O  OE2 . GLU A 1 175 ? 4.656  24.946 27.879  1.00 41.44 ? 366 GLU A OE2 1 
ATOM   1412 N  N   . HIS A 1 176 ? 7.528  25.136 23.271  1.00 25.92 ? 367 HIS A N   1 
ATOM   1413 C  CA  . HIS A 1 176 ? 7.196  25.207 21.857  1.00 25.46 ? 367 HIS A CA  1 
ATOM   1414 C  C   . HIS A 1 176 ? 8.383  24.689 21.047  1.00 25.25 ? 367 HIS A C   1 
ATOM   1415 O  O   . HIS A 1 176 ? 8.218  23.954 20.077  1.00 24.37 ? 367 HIS A O   1 
ATOM   1416 C  CB  . HIS A 1 176 ? 6.928  26.657 21.428  1.00 25.94 ? 367 HIS A CB  1 
ATOM   1417 C  CG  . HIS A 1 176 ? 5.808  27.336 22.159  1.00 26.24 ? 367 HIS A CG  1 
ATOM   1418 N  ND1 . HIS A 1 176 ? 4.639  26.694 22.511  1.00 26.92 ? 367 HIS A ND1 1 
ATOM   1419 C  CD2 . HIS A 1 176 ? 5.657  28.625 22.544  1.00 25.61 ? 367 HIS A CD2 1 
ATOM   1420 C  CE1 . HIS A 1 176 ? 3.826  27.552 23.100  1.00 24.31 ? 367 HIS A CE1 1 
ATOM   1421 N  NE2 . HIS A 1 176 ? 4.419  28.731 23.129  1.00 25.96 ? 367 HIS A NE2 1 
ATOM   1422 N  N   . SER A 1 177 ? 9.587  25.082 21.454  1.00 24.91 ? 368 SER A N   1 
ATOM   1423 C  CA  . SER A 1 177 ? 10.804 24.582 20.825  1.00 25.38 ? 368 SER A CA  1 
ATOM   1424 C  C   . SER A 1 177 ? 10.863 23.037 20.845  1.00 25.13 ? 368 SER A C   1 
ATOM   1425 O  O   . SER A 1 177 ? 11.194 22.414 19.820  1.00 25.31 ? 368 SER A O   1 
ATOM   1426 C  CB  . SER A 1 177 ? 12.030 25.239 21.465  1.00 25.06 ? 368 SER A CB  1 
ATOM   1427 O  OG  . SER A 1 177 ? 13.218 24.692 20.966  1.00 27.50 ? 368 SER A OG  1 
ATOM   1428 N  N   . GLN A 1 178 ? 10.498 22.427 21.981  1.00 24.95 ? 369 GLN A N   1 
ATOM   1429 C  CA  . GLN A 1 178 ? 10.460 20.952 22.110  1.00 25.03 ? 369 GLN A CA  1 
ATOM   1430 C  C   . GLN A 1 178 ? 9.412  20.304 21.217  1.00 24.90 ? 369 GLN A C   1 
ATOM   1431 O  O   . GLN A 1 178 ? 9.687  19.290 20.575  1.00 25.01 ? 369 GLN A O   1 
ATOM   1432 C  CB  . GLN A 1 178 ? 10.213 20.497 23.556  1.00 24.80 ? 369 GLN A CB  1 
ATOM   1433 C  CG  . GLN A 1 178 ? 10.134 18.958 23.695  1.00 26.67 ? 369 GLN A CG  1 
ATOM   1434 C  CD  . GLN A 1 178 ? 9.884  18.484 25.118  1.00 30.90 ? 369 GLN A CD  1 
ATOM   1435 O  OE1 . GLN A 1 178 ? 8.910  18.893 25.773  1.00 31.89 ? 369 GLN A OE1 1 
ATOM   1436 N  NE2 . GLN A 1 178 ? 10.768 17.615 25.609  1.00 30.33 ? 369 GLN A NE2 1 
ATOM   1437 N  N   . ASP A 1 179 ? 8.203  20.861 21.228  1.00 24.62 ? 370 ASP A N   1 
ATOM   1438 C  CA  . ASP A 1 179 ? 7.106  20.354 20.423  1.00 25.20 ? 370 ASP A CA  1 
ATOM   1439 C  C   . ASP A 1 179 ? 7.454  20.434 18.930  1.00 24.14 ? 370 ASP A C   1 
ATOM   1440 O  O   . ASP A 1 179 ? 7.308  19.458 18.194  1.00 24.21 ? 370 ASP A O   1 
ATOM   1441 C  CB  . ASP A 1 179 ? 5.833  21.157 20.704  1.00 26.10 ? 370 ASP A CB  1 
ATOM   1442 C  CG  . ASP A 1 179 ? 4.657  20.667 19.894  1.00 30.25 ? 370 ASP A CG  1 
ATOM   1443 O  OD1 . ASP A 1 179 ? 4.168  19.540 20.163  1.00 33.59 ? 370 ASP A OD1 1 
ATOM   1444 O  OD2 . ASP A 1 179 ? 4.227  21.408 18.977  1.00 35.35 ? 370 ASP A OD2 1 
ATOM   1445 N  N   . LEU A 1 180 ? 7.932  21.594 18.488  1.00 22.43 ? 371 LEU A N   1 
ATOM   1446 C  CA  . LEU A 1 180 ? 8.313  21.758 17.084  1.00 21.65 ? 371 LEU A CA  1 
ATOM   1447 C  C   . LEU A 1 180 ? 9.388  20.769 16.641  1.00 21.80 ? 371 LEU A C   1 
ATOM   1448 O  O   . LEU A 1 180 ? 9.332  20.272 15.519  1.00 20.96 ? 371 LEU A O   1 
ATOM   1449 C  CB  . LEU A 1 180 ? 8.756  23.181 16.803  1.00 21.70 ? 371 LEU A CB  1 
ATOM   1450 C  CG  . LEU A 1 180 ? 7.632  24.210 16.710  1.00 20.30 ? 371 LEU A CG  1 
ATOM   1451 C  CD1 . LEU A 1 180 ? 8.248  25.588 16.757  1.00 18.26 ? 371 LEU A CD1 1 
ATOM   1452 C  CD2 . LEU A 1 180 ? 6.812  23.994 15.431  1.00 21.56 ? 371 LEU A CD2 1 
ATOM   1453 N  N   . SER A 1 181 ? 10.344 20.489 17.538  1.00 21.42 ? 372 SER A N   1 
ATOM   1454 C  CA  . SER A 1 181 ? 11.377 19.495 17.309  1.00 21.59 ? 372 SER A CA  1 
ATOM   1455 C  C   . SER A 1 181 ? 10.802 18.104 17.070  1.00 22.49 ? 372 SER A C   1 
ATOM   1456 O  O   . SER A 1 181 ? 11.296 17.373 16.221  1.00 21.23 ? 372 SER A O   1 
ATOM   1457 C  CB  . SER A 1 181 ? 12.344 19.463 18.498  1.00 21.23 ? 372 SER A CB  1 
ATOM   1458 O  OG  . SER A 1 181 ? 12.998 20.713 18.592  1.00 20.37 ? 372 SER A OG  1 
ATOM   1459 N  N   . GLY A 1 182 ? 9.768  17.740 17.842  1.00 23.83 ? 373 GLY A N   1 
ATOM   1460 C  CA  . GLY A 1 182 ? 9.093  16.443 17.683  1.00 24.46 ? 373 GLY A CA  1 
ATOM   1461 C  C   . GLY A 1 182 ? 8.387  16.337 16.341  1.00 25.15 ? 373 GLY A C   1 
ATOM   1462 O  O   . GLY A 1 182 ? 8.376  15.275 15.712  1.00 25.62 ? 373 GLY A O   1 
ATOM   1463 N  N   . ARG A 1 183 ? 7.796  17.443 15.906  1.00 25.82 ? 374 ARG A N   1 
ATOM   1464 C  CA  . ARG A 1 183 ? 7.086  17.483 14.628  1.00 26.97 ? 374 ARG A CA  1 
ATOM   1465 C  C   . ARG A 1 183 ? 8.037  17.393 13.446  1.00 26.90 ? 374 ARG A C   1 
ATOM   1466 O  O   . ARG A 1 183 ? 7.729  16.716 12.462  1.00 27.85 ? 374 ARG A O   1 
ATOM   1467 C  CB  . ARG A 1 183 ? 6.227  18.752 14.502  1.00 27.69 ? 374 ARG A CB  1 
ATOM   1468 C  CG  . ARG A 1 183 ? 5.163  18.910 15.579  1.00 29.71 ? 374 ARG A CG  1 
ATOM   1469 C  CD  . ARG A 1 183 ? 4.305  20.156 15.325  1.00 35.04 ? 374 ARG A CD  1 
ATOM   1470 N  NE  . ARG A 1 183 ? 3.451  20.466 16.474  1.00 38.48 ? 374 ARG A NE  1 
ATOM   1471 C  CZ  . ARG A 1 183 ? 2.509  21.409 16.495  1.00 42.02 ? 374 ARG A CZ  1 
ATOM   1472 N  NH1 . ARG A 1 183 ? 2.271  22.161 15.421  1.00 42.95 ? 374 ARG A NH1 1 
ATOM   1473 N  NH2 . ARG A 1 183 ? 1.794  21.601 17.606  1.00 43.53 ? 374 ARG A NH2 1 
ATOM   1474 N  N   . LEU A 1 184 ? 9.180  18.073 13.538  1.00 26.25 ? 375 LEU A N   1 
ATOM   1475 C  CA  . LEU A 1 184 ? 10.154 18.082 12.463  1.00 26.18 ? 375 LEU A CA  1 
ATOM   1476 C  C   . LEU A 1 184 ? 10.784 16.698 12.303  1.00 26.90 ? 375 LEU A C   1 
ATOM   1477 O  O   . LEU A 1 184 ? 10.935 16.212 11.182  1.00 26.77 ? 375 LEU A O   1 
ATOM   1478 C  CB  . LEU A 1 184 ? 11.240 19.144 12.685  1.00 24.68 ? 375 LEU A CB  1 
ATOM   1479 C  CG  . LEU A 1 184 ? 12.405 19.161 11.677  1.00 22.67 ? 375 LEU A CG  1 
ATOM   1480 C  CD1 . LEU A 1 184 ? 11.943 19.277 10.229  1.00 22.46 ? 375 LEU A CD1 1 
ATOM   1481 C  CD2 . LEU A 1 184 ? 13.344 20.291 11.963  1.00 19.12 ? 375 LEU A CD2 1 
ATOM   1482 N  N   . ARG A 1 185 ? 11.148 16.082 13.425  1.00 27.67 ? 376 ARG A N   1 
ATOM   1483 C  CA  . ARG A 1 185 ? 11.733 14.749 13.419  1.00 29.12 ? 376 ARG A CA  1 
ATOM   1484 C  C   . ARG A 1 185 ? 10.779 13.724 12.791  1.00 29.06 ? 376 ARG A C   1 
ATOM   1485 O  O   . ARG A 1 185 ? 11.219 12.800 12.117  1.00 29.15 ? 376 ARG A O   1 
ATOM   1486 C  CB  . ARG A 1 185 ? 12.113 14.321 14.833  1.00 29.62 ? 376 ARG A CB  1 
ATOM   1487 C  CG  . ARG A 1 185 ? 12.919 13.019 14.882  1.00 31.94 ? 376 ARG A CG  1 
ATOM   1488 C  CD  . ARG A 1 185 ? 12.305 12.095 15.913  1.00 37.26 ? 376 ARG A CD  1 
ATOM   1489 N  NE  . ARG A 1 185 ? 12.610 10.684 15.664  1.00 42.02 ? 376 ARG A NE  1 
ATOM   1490 C  CZ  . ARG A 1 185 ? 12.169 9.967  14.625  1.00 43.91 ? 376 ARG A CZ  1 
ATOM   1491 N  NH1 . ARG A 1 185 ? 11.403 10.509 13.687  1.00 46.07 ? 376 ARG A NH1 1 
ATOM   1492 N  NH2 . ARG A 1 185 ? 12.507 8.692  14.516  1.00 45.14 ? 376 ARG A NH2 1 
ATOM   1493 N  N   . ALA A 1 186 ? 9.482  13.908 13.011  1.00 29.25 ? 377 ALA A N   1 
ATOM   1494 C  CA  . ALA A 1 186 ? 8.461  13.053 12.427  1.00 29.68 ? 377 ALA A CA  1 
ATOM   1495 C  C   . ALA A 1 186 ? 8.270  13.343 10.931  1.00 29.95 ? 377 ALA A C   1 
ATOM   1496 O  O   . ALA A 1 186 ? 7.997  12.439 10.140  1.00 29.86 ? 377 ALA A O   1 
ATOM   1497 C  CB  . ALA A 1 186 ? 7.134  13.225 13.178  1.00 29.32 ? 377 ALA A CB  1 
ATOM   1498 N  N   . ILE A 1 187 ? 8.380  14.609 10.556  1.00 30.21 ? 378 ILE A N   1 
ATOM   1499 C  CA  . ILE A 1 187 ? 8.263  15.004 9.157   1.00 30.58 ? 378 ILE A CA  1 
ATOM   1500 C  C   . ILE A 1 187 ? 9.389  14.386 8.336   1.00 31.66 ? 378 ILE A C   1 
ATOM   1501 O  O   . ILE A 1 187 ? 9.144  13.821 7.265   1.00 31.97 ? 378 ILE A O   1 
ATOM   1502 C  CB  . ILE A 1 187 ? 8.244  16.547 8.996   1.00 29.97 ? 378 ILE A CB  1 
ATOM   1503 C  CG1 . ILE A 1 187 ? 6.919  17.119 9.490   1.00 27.28 ? 378 ILE A CG1 1 
ATOM   1504 C  CG2 . ILE A 1 187 ? 8.491  16.955 7.540   1.00 29.53 ? 378 ILE A CG2 1 
ATOM   1505 C  CD1 . ILE A 1 187 ? 6.920  18.626 9.742   1.00 33.23 ? 378 ILE A CD1 1 
ATOM   1506 N  N   . LEU A 1 188 ? 10.611 14.487 8.850   1.00 32.81 ? 379 LEU A N   1 
ATOM   1507 C  CA  . LEU A 1 188 ? 11.787 13.963 8.169   1.00 34.47 ? 379 LEU A CA  1 
ATOM   1508 C  C   . LEU A 1 188 ? 11.745 12.432 8.137   1.00 36.05 ? 379 LEU A C   1 
ATOM   1509 O  O   . LEU A 1 188 ? 11.951 11.829 7.078   1.00 36.63 ? 379 LEU A O   1 
ATOM   1510 C  CB  . LEU A 1 188 ? 13.070 14.484 8.836   1.00 34.06 ? 379 LEU A CB  1 
ATOM   1511 C  CG  . LEU A 1 188 ? 13.741 15.815 8.400   1.00 34.22 ? 379 LEU A CG  1 
ATOM   1512 C  CD1 . LEU A 1 188 ? 12.816 16.819 7.713   1.00 33.64 ? 379 LEU A CD1 1 
ATOM   1513 C  CD2 . LEU A 1 188 ? 14.417 16.485 9.585   1.00 32.83 ? 379 LEU A CD2 1 
ATOM   1514 N  N   . GLN A 1 189 ? 11.442 11.828 9.290   1.00 37.43 ? 380 GLN A N   1 
ATOM   1515 C  CA  . GLN A 1 189 ? 11.373 10.375 9.458   1.00 39.02 ? 380 GLN A CA  1 
ATOM   1516 C  C   . GLN A 1 189 ? 10.196 9.940  10.361  1.00 39.98 ? 380 GLN A C   1 
ATOM   1517 O  O   . GLN A 1 189 ? 10.462 9.521  11.509  1.00 33.23 ? 380 GLN A O   1 
ATOM   1518 C  CB  . GLN A 1 189 ? 12.703 9.834  10.009  1.00 39.06 ? 380 GLN A CB  1 
ATOM   1519 C  CG  . GLN A 1 189 ? 13.855 9.920  9.005   1.00 39.38 ? 380 GLN A CG  1 
ATOM   1520 C  CD  . GLN A 1 189 ? 15.167 9.385  9.548   1.00 39.24 ? 380 GLN A CD  1 
ATOM   1521 O  OE1 . GLN A 1 189 ? 15.195 8.487  10.402  1.00 39.18 ? 380 GLN A OE1 1 
ATOM   1522 N  NE2 . GLN A 1 189 ? 16.270 9.918  9.030   1.00 37.33 ? 380 GLN A NE2 1 
ATOM   1523 O  OXT . GLN A 1 189 ? 9.024  10.005 9.961   1.00 40.56 ? 380 GLN A OXT 1 
HETATM 1524 ZN ZN  . ZN  B 2 .   ? 9.194  29.898 -0.856  1.00 31.77 ? 400 ZN  A ZN  1 
HETATM 1525 O  O   . HOH C 3 .   ? 8.981  31.113 4.232   1.00 26.07 ? 401 HOH A O   1 
HETATM 1526 O  O   . HOH C 3 .   ? 22.148 20.619 16.448  1.00 34.64 ? 402 HOH A O   1 
HETATM 1527 O  O   . HOH C 3 .   ? 11.047 28.512 28.165  1.00 26.59 ? 403 HOH A O   1 
HETATM 1528 O  O   . HOH C 3 .   ? 11.372 27.168 18.039  1.00 23.31 ? 405 HOH A O   1 
HETATM 1529 O  O   . HOH C 3 .   ? 15.822 53.047 19.871  1.00 31.08 ? 406 HOH A O   1 
HETATM 1530 O  O   . HOH C 3 .   ? 7.878  35.766 10.593  1.00 24.77 ? 407 HOH A O   1 
HETATM 1531 O  O   . HOH C 3 .   ? 13.274 29.358 5.477   1.00 30.38 ? 408 HOH A O   1 
HETATM 1532 O  O   . HOH C 3 .   ? 7.316  9.438  11.872  1.00 32.14 ? 409 HOH A O   1 
HETATM 1533 O  O   . HOH C 3 .   ? 43.442 28.507 1.817   1.00 39.96 ? 410 HOH A O   1 
HETATM 1534 O  O   . HOH C 3 .   ? 25.374 22.313 14.226  1.00 48.54 ? 411 HOH A O   1 
HETATM 1535 O  O   . HOH C 3 .   ? 31.662 20.100 4.362   1.00 33.26 ? 412 HOH A O   1 
HETATM 1536 O  O   . HOH C 3 .   ? 15.026 40.955 0.607   1.00 33.99 ? 414 HOH A O   1 
HETATM 1537 O  O   . HOH C 3 .   ? 9.449  33.803 2.336   1.00 23.07 ? 415 HOH A O   1 
HETATM 1538 O  O   . HOH C 3 .   ? 18.097 34.427 29.157  1.00 39.11 ? 417 HOH A O   1 
HETATM 1539 O  O   . HOH C 3 .   ? 24.826 20.965 3.089   1.00 29.24 ? 418 HOH A O   1 
HETATM 1540 O  O   . HOH C 3 .   ? 10.287 33.411 30.242  1.00 36.14 ? 419 HOH A O   1 
HETATM 1541 O  O   . HOH C 3 .   ? 27.918 29.526 9.478   1.00 30.30 ? 421 HOH A O   1 
HETATM 1542 O  O   . HOH C 3 .   ? 28.983 31.492 14.544  1.00 44.39 ? 422 HOH A O   1 
HETATM 1543 O  O   . HOH C 3 .   ? 17.044 7.395  12.256  1.00 35.92 ? 423 HOH A O   1 
HETATM 1544 O  O   . HOH C 3 .   ? 9.485  29.899 1.644   1.00 25.36 ? 426 HOH A O   1 
HETATM 1545 O  O   . HOH C 3 .   ? 38.050 26.393 3.738   1.00 36.21 ? 427 HOH A O   1 
HETATM 1546 O  O   . HOH C 3 .   ? 6.866  31.139 2.627   1.00 41.99 ? 428 HOH A O   1 
HETATM 1547 O  O   . HOH C 3 .   ? 39.081 31.147 -7.182  1.00 42.88 ? 429 HOH A O   1 
HETATM 1548 O  O   . HOH C 3 .   ? 7.056  36.630 28.757  1.00 39.35 ? 430 HOH A O   1 
HETATM 1549 O  O   . HOH C 3 .   ? 13.063 24.771 -8.207  1.00 43.98 ? 434 HOH A O   1 
HETATM 1550 O  O   . HOH C 3 .   ? 23.168 22.952 17.378  1.00 44.99 ? 436 HOH A O   1 
HETATM 1551 O  O   . HOH C 3 .   ? 18.966 18.342 -5.411  1.00 25.30 ? 437 HOH A O   1 
HETATM 1552 O  O   . HOH C 3 .   ? 19.303 26.048 23.705  1.00 35.54 ? 438 HOH A O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   192 ?   ?   ?   A . n 
A 1 2   PRO 2   193 ?   ?   ?   A . n 
A 1 3   LEU 3   194 ?   ?   ?   A . n 
A 1 4   GLY 4   195 ?   ?   ?   A . n 
A 1 5   SER 5   196 ?   ?   ?   A . n 
A 1 6   MET 6   197 197 MET MET A . n 
A 1 7   ASP 7   198 198 ASP ASP A . n 
A 1 8   PRO 8   199 199 PRO PRO A . n 
A 1 9   PRO 9   200 200 PRO PRO A . n 
A 1 10  THR 10  201 201 THR THR A . n 
A 1 11  PHE 11  202 202 PHE PHE A . n 
A 1 12  THR 12  203 203 THR THR A . n 
A 1 13  PHE 13  204 204 PHE PHE A . n 
A 1 14  ASN 14  205 205 ASN ASN A . n 
A 1 15  PHE 15  206 206 PHE PHE A . n 
A 1 16  ASN 16  207 207 ASN ASN A . n 
A 1 17  ASN 17  208 208 ASN ASN A . n 
A 1 18  GLU 18  209 209 GLU GLU A . n 
A 1 19  PRO 19  210 210 PRO PRO A . n 
A 1 20  TRP 20  211 211 TRP TRP A . n 
A 1 21  VAL 21  212 212 VAL VAL A . n 
A 1 22  ARG 22  213 213 ARG ARG A . n 
A 1 23  GLY 23  214 214 GLY GLY A . n 
A 1 24  ARG 24  215 215 ARG ARG A . n 
A 1 25  HIS 25  216 216 HIS HIS A . n 
A 1 26  GLU 26  217 217 GLU GLU A . n 
A 1 27  THR 27  218 218 THR THR A . n 
A 1 28  TYR 28  219 219 TYR TYR A . n 
A 1 29  LEU 29  220 220 LEU LEU A . n 
A 1 30  CYS 30  221 221 CYS CYS A . n 
A 1 31  TYR 31  222 222 TYR TYR A . n 
A 1 32  GLU 32  223 223 GLU GLU A . n 
A 1 33  VAL 33  224 224 VAL VAL A . n 
A 1 34  GLU 34  225 225 GLU GLU A . n 
A 1 35  ARG 35  226 226 ARG ARG A . n 
A 1 36  MET 36  227 227 MET MET A . n 
A 1 37  HIS 37  228 228 HIS HIS A . n 
A 1 38  ASN 38  229 229 ASN ASN A . n 
A 1 39  ASP 39  230 230 ASP ASP A . n 
A 1 40  THR 40  231 231 THR THR A . n 
A 1 41  TRP 41  232 232 TRP TRP A . n 
A 1 42  VAL 42  233 233 VAL VAL A . n 
A 1 43  LEU 43  234 234 LEU LEU A . n 
A 1 44  LEU 44  235 235 LEU LEU A . n 
A 1 45  ASN 45  236 236 ASN ASN A . n 
A 1 46  GLN 46  237 237 GLN GLN A . n 
A 1 47  ARG 47  238 238 ARG ARG A . n 
A 1 48  ARG 48  239 239 ARG ARG A . n 
A 1 49  GLY 49  240 240 GLY GLY A . n 
A 1 50  PHE 50  241 241 PHE PHE A . n 
A 1 51  LEU 51  242 242 LEU LEU A . n 
A 1 52  CYS 52  243 243 CYS CYS A . n 
A 1 53  ASN 53  244 244 ASN ASN A . n 
A 1 54  GLN 54  245 245 GLN GLN A . n 
A 1 55  ALA 55  246 246 ALA ALA A . n 
A 1 56  PRO 56  247 247 PRO PRO A . n 
A 1 57  HIS 57  248 248 HIS HIS A . n 
A 1 58  LYS 58  249 249 LYS LYS A . n 
A 1 59  HIS 59  250 250 HIS HIS A . n 
A 1 60  GLY 60  251 251 GLY GLY A . n 
A 1 61  PHE 61  252 252 PHE PHE A . n 
A 1 62  LEU 62  253 253 LEU LEU A . n 
A 1 63  GLU 63  254 254 GLU GLU A . n 
A 1 64  GLY 64  255 255 GLY GLY A . n 
A 1 65  ARG 65  256 256 ARG ARG A . n 
A 1 66  HIS 66  257 257 HIS HIS A . n 
A 1 67  ALA 67  258 258 ALA ALA A . n 
A 1 68  GLU 68  259 259 GLU GLU A . n 
A 1 69  LEU 69  260 260 LEU LEU A . n 
A 1 70  CYS 70  261 261 CYS CYS A . n 
A 1 71  PHE 71  262 262 PHE PHE A . n 
A 1 72  LEU 72  263 263 LEU LEU A . n 
A 1 73  ASP 73  264 264 ASP ASP A . n 
A 1 74  VAL 74  265 265 VAL VAL A . n 
A 1 75  ILE 75  266 266 ILE ILE A . n 
A 1 76  PRO 76  267 267 PRO PRO A . n 
A 1 77  PHE 77  268 268 PHE PHE A . n 
A 1 78  TRP 78  269 269 TRP TRP A . n 
A 1 79  LYS 79  270 270 LYS LYS A . n 
A 1 80  LEU 80  271 271 LEU LEU A . n 
A 1 81  ASP 81  272 272 ASP ASP A . n 
A 1 82  LEU 82  273 273 LEU LEU A . n 
A 1 83  ASP 83  274 274 ASP ASP A . n 
A 1 84  GLN 84  275 275 GLN GLN A . n 
A 1 85  ASP 85  276 276 ASP ASP A . n 
A 1 86  TYR 86  277 277 TYR TYR A . n 
A 1 87  ARG 87  278 278 ARG ARG A . n 
A 1 88  VAL 88  279 279 VAL VAL A . n 
A 1 89  THR 89  280 280 THR THR A . n 
A 1 90  CYS 90  281 281 CYS CYS A . n 
A 1 91  PHE 91  282 282 PHE PHE A . n 
A 1 92  THR 92  283 283 THR THR A . n 
A 1 93  SER 93  284 284 SER SER A . n 
A 1 94  TRP 94  285 285 TRP TRP A . n 
A 1 95  SER 95  286 286 SER SER A . n 
A 1 96  PRO 96  287 287 PRO PRO A . n 
A 1 97  CYS 97  288 288 CYS CYS A . n 
A 1 98  PHE 98  289 289 PHE PHE A . n 
A 1 99  SER 99  290 290 SER SER A . n 
A 1 100 CYS 100 291 291 CYS CYS A . n 
A 1 101 ALA 101 292 292 ALA ALA A . n 
A 1 102 GLN 102 293 293 GLN GLN A . n 
A 1 103 GLU 103 294 294 GLU GLU A . n 
A 1 104 MET 104 295 295 MET MET A . n 
A 1 105 ALA 105 296 296 ALA ALA A . n 
A 1 106 LYS 106 297 297 LYS LYS A . n 
A 1 107 PHE 107 298 298 PHE PHE A . n 
A 1 108 ILE 108 299 299 ILE ILE A . n 
A 1 109 SER 109 300 300 SER SER A . n 
A 1 110 LYS 110 301 301 LYS LYS A . n 
A 1 111 ASN 111 302 302 ASN ASN A . n 
A 1 112 LYS 112 303 303 LYS LYS A . n 
A 1 113 HIS 113 304 304 HIS HIS A . n 
A 1 114 VAL 114 305 305 VAL VAL A . n 
A 1 115 SER 115 306 306 SER SER A . n 
A 1 116 LEU 116 307 307 LEU LEU A . n 
A 1 117 CYS 117 308 308 CYS CYS A . n 
A 1 118 ILE 118 309 309 ILE ILE A . n 
A 1 119 PHE 119 310 310 PHE PHE A . n 
A 1 120 THR 120 311 311 THR THR A . n 
A 1 121 ALA 121 312 312 ALA ALA A . n 
A 1 122 ARG 122 313 313 ARG ARG A . n 
A 1 123 ILE 123 314 314 ILE ILE A . n 
A 1 124 TYR 124 315 315 TYR TYR A . n 
A 1 125 ASP 125 316 316 ASP ASP A . n 
A 1 126 ASP 126 317 317 ASP ASP A . n 
A 1 127 GLN 127 318 318 GLN GLN A . n 
A 1 128 GLY 128 319 319 GLY GLY A . n 
A 1 129 ARG 129 320 320 ARG ARG A . n 
A 1 130 CYS 130 321 321 CYS CYS A . n 
A 1 131 GLN 131 322 322 GLN GLN A . n 
A 1 132 GLU 132 323 323 GLU GLU A . n 
A 1 133 GLY 133 324 324 GLY GLY A . n 
A 1 134 LEU 134 325 325 LEU LEU A . n 
A 1 135 ARG 135 326 326 ARG ARG A . n 
A 1 136 THR 136 327 327 THR THR A . n 
A 1 137 LEU 137 328 328 LEU LEU A . n 
A 1 138 ALA 138 329 329 ALA ALA A . n 
A 1 139 GLU 139 330 330 GLU GLU A . n 
A 1 140 ALA 140 331 331 ALA ALA A . n 
A 1 141 GLY 141 332 332 GLY GLY A . n 
A 1 142 ALA 142 333 333 ALA ALA A . n 
A 1 143 LYS 143 334 334 LYS LYS A . n 
A 1 144 ILE 144 335 335 ILE ILE A . n 
A 1 145 SER 145 336 336 SER SER A . n 
A 1 146 ILE 146 337 337 ILE ILE A . n 
A 1 147 MET 147 338 338 MET MET A . n 
A 1 148 THR 148 339 339 THR THR A . n 
A 1 149 TYR 149 340 340 TYR TYR A . n 
A 1 150 SER 150 341 341 SER SER A . n 
A 1 151 GLU 151 342 342 GLU GLU A . n 
A 1 152 PHE 152 343 343 PHE PHE A . n 
A 1 153 LYS 153 344 344 LYS LYS A . n 
A 1 154 HIS 154 345 345 HIS HIS A . n 
A 1 155 CYS 155 346 346 CYS CYS A . n 
A 1 156 TRP 156 347 347 TRP TRP A . n 
A 1 157 ASP 157 348 348 ASP ASP A . n 
A 1 158 THR 158 349 349 THR THR A . n 
A 1 159 PHE 159 350 350 PHE PHE A . n 
A 1 160 VAL 160 351 351 VAL VAL A . n 
A 1 161 ASP 161 352 352 ASP ASP A . n 
A 1 162 HIS 162 353 353 HIS HIS A . n 
A 1 163 GLN 163 354 354 GLN GLN A . n 
A 1 164 GLY 164 355 355 GLY GLY A . n 
A 1 165 CYS 165 356 356 CYS CYS A . n 
A 1 166 PRO 166 357 357 PRO PRO A . n 
A 1 167 PHE 167 358 358 PHE PHE A . n 
A 1 168 GLN 168 359 359 GLN GLN A . n 
A 1 169 PRO 169 360 360 PRO PRO A . n 
A 1 170 TRP 170 361 361 TRP TRP A . n 
A 1 171 ASP 171 362 362 ASP ASP A . n 
A 1 172 GLY 172 363 363 GLY GLY A . n 
A 1 173 LEU 173 364 364 LEU LEU A . n 
A 1 174 ASP 174 365 365 ASP ASP A . n 
A 1 175 GLU 175 366 366 GLU GLU A . n 
A 1 176 HIS 176 367 367 HIS HIS A . n 
A 1 177 SER 177 368 368 SER SER A . n 
A 1 178 GLN 178 369 369 GLN GLN A . n 
A 1 179 ASP 179 370 370 ASP ASP A . n 
A 1 180 LEU 180 371 371 LEU LEU A . n 
A 1 181 SER 181 372 372 SER SER A . n 
A 1 182 GLY 182 373 373 GLY GLY A . n 
A 1 183 ARG 183 374 374 ARG ARG A . n 
A 1 184 LEU 184 375 375 LEU LEU A . n 
A 1 185 ARG 185 376 376 ARG ARG A . n 
A 1 186 ALA 186 377 377 ALA ALA A . n 
A 1 187 ILE 187 378 378 ILE ILE A . n 
A 1 188 LEU 188 379 379 LEU LEU A . n 
A 1 189 GLN 189 380 380 GLN GLN A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 ND1 ? A HIS 66 ? A HIS 257 ? 1_555 ZN ? B ZN . ? A ZN 400 ? 1_555 SG ? A CYS 97  ? A CYS 288 ? 1_555 115.7 ? 
2 ND1 ? A HIS 66 ? A HIS 257 ? 1_555 ZN ? B ZN . ? A ZN 400 ? 1_555 SG ? A CYS 100 ? A CYS 291 ? 1_555 111.0 ? 
3 SG  ? A CYS 97 ? A CYS 288 ? 1_555 ZN ? B ZN . ? A ZN 400 ? 1_555 SG ? A CYS 100 ? A CYS 291 ? 1_555 115.9 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-11-10 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' . ? 1 
SHARP    phasing           . ? 2 
CNS      refinement        . ? 3 
HKL-2000 'data reduction'  . ? 4 
HKL-2000 'data scaling'    . ? 5 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1 1 N  A ARG 313 ? ? CA A ARG 313 ? ? C  A ARG 313 ? ? 89.97 111.00 -21.03 2.70 N 
2 1 N  A ILE 314 ? ? CA A ILE 314 ? ? CB A ILE 314 ? ? 92.43 110.80 -18.37 2.30 N 
3 1 CB A TYR 315 ? ? CA A TYR 315 ? ? C  A TYR 315 ? ? 91.32 110.40 -19.08 2.00 N 
4 1 N  A TYR 315 ? ? CA A TYR 315 ? ? C  A TYR 315 ? ? 91.95 111.00 -19.05 2.70 N 
5 1 N  A ASP 316 ? ? CA A ASP 316 ? ? CB A ASP 316 ? ? 99.20 110.60 -11.40 1.80 N 
6 1 N  A ASP 316 ? ? CA A ASP 316 ? ? C  A ASP 316 ? ? 92.20 111.00 -18.80 2.70 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 TRP A 211 ? ? -30.00 123.62 
2 1 HIS A 228 ? ? 67.78  110.33 
3 1 LYS A 303 ? ? 65.96  -35.74 
4 1 GLN A 318 ? ? 69.50  -4.67  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A GLY 192 ? A GLY 1 
2 1 Y 1 A PRO 193 ? A PRO 2 
3 1 Y 1 A LEU 194 ? A LEU 3 
4 1 Y 1 A GLY 195 ? A GLY 4 
5 1 Y 1 A SER 196 ? A SER 5 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'ZINC ION' ZN  
3 water      HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 ZN  1  400 1001 ZN  ZN  A . 
C 3 HOH 1  401 1    HOH HOH A . 
C 3 HOH 2  402 2    HOH HOH A . 
C 3 HOH 3  403 3    HOH HOH A . 
C 3 HOH 4  405 5    HOH HOH A . 
C 3 HOH 5  406 6    HOH HOH A . 
C 3 HOH 6  407 7    HOH HOH A . 
C 3 HOH 7  408 8    HOH HOH A . 
C 3 HOH 8  409 9    HOH HOH A . 
C 3 HOH 9  410 10   HOH HOH A . 
C 3 HOH 10 411 11   HOH HOH A . 
C 3 HOH 11 412 12   HOH HOH A . 
C 3 HOH 12 414 14   HOH HOH A . 
C 3 HOH 13 415 15   HOH HOH A . 
C 3 HOH 14 417 17   HOH HOH A . 
C 3 HOH 15 418 18   HOH HOH A . 
C 3 HOH 16 419 19   HOH HOH A . 
C 3 HOH 17 421 21   HOH HOH A . 
C 3 HOH 18 422 22   HOH HOH A . 
C 3 HOH 19 423 23   HOH HOH A . 
C 3 HOH 20 426 26   HOH HOH A . 
C 3 HOH 21 427 27   HOH HOH A . 
C 3 HOH 22 428 28   HOH HOH A . 
C 3 HOH 23 429 29   HOH HOH A . 
C 3 HOH 24 430 30   HOH HOH A . 
C 3 HOH 25 434 34   HOH HOH A . 
C 3 HOH 26 436 36   HOH HOH A . 
C 3 HOH 27 437 37   HOH HOH A . 
C 3 HOH 28 438 38   HOH HOH A . 
#