data_3ISL
# 
_entry.id   3ISL 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3ISL         
RCSB  RCSB054813   
WWPDB D_1000054813 
# 
_pdbx_database_related.db_name        PDB 
_pdbx_database_related.db_id          1VJO 
_pdbx_database_related.details        'Alanine-glyoxylate aminotransferase from Nostc sp.' 
_pdbx_database_related.content_type   unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3ISL 
_pdbx_database_status.recvd_initial_deposition_date   2009-08-26 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Costa, R.'     1 
'Cendron, L.'   2 
'Ramazzina, I.' 3 
'Berni, R.'     4 
'Peracchi, A.'  5 
'Percudani, R.' 6 
'Zanotti, G.'   7 
# 
_citation.id                        primary 
_citation.title                     'Amino acids from purines in GUT bacteria' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Costa, R.'     1 
primary 'Cendron, L.'   2 
primary 'Ramazzina, I.' 3 
primary 'Berni, R.'     4 
primary 'Peracchi, A.'  5 
primary 'Zanotti, G.'   6 
primary 'Percudani, R.' 7 
# 
_cell.entry_id           3ISL 
_cell.length_a           102.400 
_cell.length_b           95.990 
_cell.length_c           101.290 
_cell.angle_alpha        90.00 
_cell.angle_beta         114.23 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3ISL 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Purine catabolism protein pucG' 45798.621 2   2.-.-.- ? ? ? 
2 non-polymer syn "PYRIDOXAL-5'-PHOSPHATE"         247.142   2   ?       ? ? ? 
3 water       nat water                            18.015    306 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Ureidoglycine-glyoxylate aminotransferase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MSGRRELCTPLRTIMTPGPVEVDPRVLRVMSTPVVGQFDPAFTGIMNETMEMLRELFQTKNRWAYPIDGTSRAGIEAVLA
SVIEPEDDVLIPIYGRFGYLLTEIAERYGANVHMLECEWGTVFDPEDIIREIKKVKPKIVAMVHGETSTGRIHPLKAIGE
ACRTEDALFIVDAVATIGGCEVKVDEWKIDAAIGGTQKCLSVPSGMAPITYNERVADVIAARKKVERGIATQADRAALSG
NRPITSNYFDLSQLEDYWSERRLNHHTEATTMLYALREGVRLVLEEGLETRFERHRHHEAALAAGIKAMGLRLFGDDSCK
MPVVTCVEIPGGIDGESVRDMLLAQFGIEIASSFGPLAGKIWRIGTMGYSCRKENVLFVLAGLEAVLLRHNAGIEAGKAL
QAALDVYENAGRQAAV
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MSGRRELCTPLRTIMTPGPVEVDPRVLRVMSTPVVGQFDPAFTGIMNETMEMLRELFQTKNRWAYPIDGTSRAGIEAVLA
SVIEPEDDVLIPIYGRFGYLLTEIAERYGANVHMLECEWGTVFDPEDIIREIKKVKPKIVAMVHGETSTGRIHPLKAIGE
ACRTEDALFIVDAVATIGGCEVKVDEWKIDAAIGGTQKCLSVPSGMAPITYNERVADVIAARKKVERGIATQADRAALSG
NRPITSNYFDLSQLEDYWSERRLNHHTEATTMLYALREGVRLVLEEGLETRFERHRHHEAALAAGIKAMGLRLFGDDSCK
MPVVTCVEIPGGIDGESVRDMLLAQFGIEIASSFGPLAGKIWRIGTMGYSCRKENVLFVLAGLEAVLLRHNAGIEAGKAL
QAALDVYENAGRQAAV
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   SER n 
1 3   GLY n 
1 4   ARG n 
1 5   ARG n 
1 6   GLU n 
1 7   LEU n 
1 8   CYS n 
1 9   THR n 
1 10  PRO n 
1 11  LEU n 
1 12  ARG n 
1 13  THR n 
1 14  ILE n 
1 15  MET n 
1 16  THR n 
1 17  PRO n 
1 18  GLY n 
1 19  PRO n 
1 20  VAL n 
1 21  GLU n 
1 22  VAL n 
1 23  ASP n 
1 24  PRO n 
1 25  ARG n 
1 26  VAL n 
1 27  LEU n 
1 28  ARG n 
1 29  VAL n 
1 30  MET n 
1 31  SER n 
1 32  THR n 
1 33  PRO n 
1 34  VAL n 
1 35  VAL n 
1 36  GLY n 
1 37  GLN n 
1 38  PHE n 
1 39  ASP n 
1 40  PRO n 
1 41  ALA n 
1 42  PHE n 
1 43  THR n 
1 44  GLY n 
1 45  ILE n 
1 46  MET n 
1 47  ASN n 
1 48  GLU n 
1 49  THR n 
1 50  MET n 
1 51  GLU n 
1 52  MET n 
1 53  LEU n 
1 54  ARG n 
1 55  GLU n 
1 56  LEU n 
1 57  PHE n 
1 58  GLN n 
1 59  THR n 
1 60  LYS n 
1 61  ASN n 
1 62  ARG n 
1 63  TRP n 
1 64  ALA n 
1 65  TYR n 
1 66  PRO n 
1 67  ILE n 
1 68  ASP n 
1 69  GLY n 
1 70  THR n 
1 71  SER n 
1 72  ARG n 
1 73  ALA n 
1 74  GLY n 
1 75  ILE n 
1 76  GLU n 
1 77  ALA n 
1 78  VAL n 
1 79  LEU n 
1 80  ALA n 
1 81  SER n 
1 82  VAL n 
1 83  ILE n 
1 84  GLU n 
1 85  PRO n 
1 86  GLU n 
1 87  ASP n 
1 88  ASP n 
1 89  VAL n 
1 90  LEU n 
1 91  ILE n 
1 92  PRO n 
1 93  ILE n 
1 94  TYR n 
1 95  GLY n 
1 96  ARG n 
1 97  PHE n 
1 98  GLY n 
1 99  TYR n 
1 100 LEU n 
1 101 LEU n 
1 102 THR n 
1 103 GLU n 
1 104 ILE n 
1 105 ALA n 
1 106 GLU n 
1 107 ARG n 
1 108 TYR n 
1 109 GLY n 
1 110 ALA n 
1 111 ASN n 
1 112 VAL n 
1 113 HIS n 
1 114 MET n 
1 115 LEU n 
1 116 GLU n 
1 117 CYS n 
1 118 GLU n 
1 119 TRP n 
1 120 GLY n 
1 121 THR n 
1 122 VAL n 
1 123 PHE n 
1 124 ASP n 
1 125 PRO n 
1 126 GLU n 
1 127 ASP n 
1 128 ILE n 
1 129 ILE n 
1 130 ARG n 
1 131 GLU n 
1 132 ILE n 
1 133 LYS n 
1 134 LYS n 
1 135 VAL n 
1 136 LYS n 
1 137 PRO n 
1 138 LYS n 
1 139 ILE n 
1 140 VAL n 
1 141 ALA n 
1 142 MET n 
1 143 VAL n 
1 144 HIS n 
1 145 GLY n 
1 146 GLU n 
1 147 THR n 
1 148 SER n 
1 149 THR n 
1 150 GLY n 
1 151 ARG n 
1 152 ILE n 
1 153 HIS n 
1 154 PRO n 
1 155 LEU n 
1 156 LYS n 
1 157 ALA n 
1 158 ILE n 
1 159 GLY n 
1 160 GLU n 
1 161 ALA n 
1 162 CYS n 
1 163 ARG n 
1 164 THR n 
1 165 GLU n 
1 166 ASP n 
1 167 ALA n 
1 168 LEU n 
1 169 PHE n 
1 170 ILE n 
1 171 VAL n 
1 172 ASP n 
1 173 ALA n 
1 174 VAL n 
1 175 ALA n 
1 176 THR n 
1 177 ILE n 
1 178 GLY n 
1 179 GLY n 
1 180 CYS n 
1 181 GLU n 
1 182 VAL n 
1 183 LYS n 
1 184 VAL n 
1 185 ASP n 
1 186 GLU n 
1 187 TRP n 
1 188 LYS n 
1 189 ILE n 
1 190 ASP n 
1 191 ALA n 
1 192 ALA n 
1 193 ILE n 
1 194 GLY n 
1 195 GLY n 
1 196 THR n 
1 197 GLN n 
1 198 LYS n 
1 199 CYS n 
1 200 LEU n 
1 201 SER n 
1 202 VAL n 
1 203 PRO n 
1 204 SER n 
1 205 GLY n 
1 206 MET n 
1 207 ALA n 
1 208 PRO n 
1 209 ILE n 
1 210 THR n 
1 211 TYR n 
1 212 ASN n 
1 213 GLU n 
1 214 ARG n 
1 215 VAL n 
1 216 ALA n 
1 217 ASP n 
1 218 VAL n 
1 219 ILE n 
1 220 ALA n 
1 221 ALA n 
1 222 ARG n 
1 223 LYS n 
1 224 LYS n 
1 225 VAL n 
1 226 GLU n 
1 227 ARG n 
1 228 GLY n 
1 229 ILE n 
1 230 ALA n 
1 231 THR n 
1 232 GLN n 
1 233 ALA n 
1 234 ASP n 
1 235 ARG n 
1 236 ALA n 
1 237 ALA n 
1 238 LEU n 
1 239 SER n 
1 240 GLY n 
1 241 ASN n 
1 242 ARG n 
1 243 PRO n 
1 244 ILE n 
1 245 THR n 
1 246 SER n 
1 247 ASN n 
1 248 TYR n 
1 249 PHE n 
1 250 ASP n 
1 251 LEU n 
1 252 SER n 
1 253 GLN n 
1 254 LEU n 
1 255 GLU n 
1 256 ASP n 
1 257 TYR n 
1 258 TRP n 
1 259 SER n 
1 260 GLU n 
1 261 ARG n 
1 262 ARG n 
1 263 LEU n 
1 264 ASN n 
1 265 HIS n 
1 266 HIS n 
1 267 THR n 
1 268 GLU n 
1 269 ALA n 
1 270 THR n 
1 271 THR n 
1 272 MET n 
1 273 LEU n 
1 274 TYR n 
1 275 ALA n 
1 276 LEU n 
1 277 ARG n 
1 278 GLU n 
1 279 GLY n 
1 280 VAL n 
1 281 ARG n 
1 282 LEU n 
1 283 VAL n 
1 284 LEU n 
1 285 GLU n 
1 286 GLU n 
1 287 GLY n 
1 288 LEU n 
1 289 GLU n 
1 290 THR n 
1 291 ARG n 
1 292 PHE n 
1 293 GLU n 
1 294 ARG n 
1 295 HIS n 
1 296 ARG n 
1 297 HIS n 
1 298 HIS n 
1 299 GLU n 
1 300 ALA n 
1 301 ALA n 
1 302 LEU n 
1 303 ALA n 
1 304 ALA n 
1 305 GLY n 
1 306 ILE n 
1 307 LYS n 
1 308 ALA n 
1 309 MET n 
1 310 GLY n 
1 311 LEU n 
1 312 ARG n 
1 313 LEU n 
1 314 PHE n 
1 315 GLY n 
1 316 ASP n 
1 317 ASP n 
1 318 SER n 
1 319 CYS n 
1 320 LYS n 
1 321 MET n 
1 322 PRO n 
1 323 VAL n 
1 324 VAL n 
1 325 THR n 
1 326 CYS n 
1 327 VAL n 
1 328 GLU n 
1 329 ILE n 
1 330 PRO n 
1 331 GLY n 
1 332 GLY n 
1 333 ILE n 
1 334 ASP n 
1 335 GLY n 
1 336 GLU n 
1 337 SER n 
1 338 VAL n 
1 339 ARG n 
1 340 ASP n 
1 341 MET n 
1 342 LEU n 
1 343 LEU n 
1 344 ALA n 
1 345 GLN n 
1 346 PHE n 
1 347 GLY n 
1 348 ILE n 
1 349 GLU n 
1 350 ILE n 
1 351 ALA n 
1 352 SER n 
1 353 SER n 
1 354 PHE n 
1 355 GLY n 
1 356 PRO n 
1 357 LEU n 
1 358 ALA n 
1 359 GLY n 
1 360 LYS n 
1 361 ILE n 
1 362 TRP n 
1 363 ARG n 
1 364 ILE n 
1 365 GLY n 
1 366 THR n 
1 367 MET n 
1 368 GLY n 
1 369 TYR n 
1 370 SER n 
1 371 CYS n 
1 372 ARG n 
1 373 LYS n 
1 374 GLU n 
1 375 ASN n 
1 376 VAL n 
1 377 LEU n 
1 378 PHE n 
1 379 VAL n 
1 380 LEU n 
1 381 ALA n 
1 382 GLY n 
1 383 LEU n 
1 384 GLU n 
1 385 ALA n 
1 386 VAL n 
1 387 LEU n 
1 388 LEU n 
1 389 ARG n 
1 390 HIS n 
1 391 ASN n 
1 392 ALA n 
1 393 GLY n 
1 394 ILE n 
1 395 GLU n 
1 396 ALA n 
1 397 GLY n 
1 398 LYS n 
1 399 ALA n 
1 400 LEU n 
1 401 GLN n 
1 402 ALA n 
1 403 ALA n 
1 404 LEU n 
1 405 ASP n 
1 406 VAL n 
1 407 TYR n 
1 408 GLU n 
1 409 ASN n 
1 410 ALA n 
1 411 GLY n 
1 412 ARG n 
1 413 GLN n 
1 414 ALA n 
1 415 ALA n 
1 416 VAL n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               ? 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'pucG, yurG, BSU32520' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Bacillus subtilis' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     1423 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'Bl21 DE3' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PUCG_BACSU 
_struct_ref.pdbx_db_accession          O32148 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MSGRRELCTPLRTIMTPGPVEVDPRVLRVMSTPVVGQFDPAFTGIMNETMEMLRELFQTKNRWAYPIDGTSRAGIEAVLA
SVIEPEDDVLIPIYGRFGYLLTEIAERYGANVHMLECEWGTVFDPEDIIREIKKVKPKIVAMVHGETSTGRIHPLKAIGE
ACRTEDALFIVDAVATIGGCEVKVDEWKIDAAIGGTQKCLSVPSGMAPITYNERVADVIAARKKVERGIATQADRAALSG
NRPITSNYFDLSQLEDYWSERRLNHHTEATTMLYALREGVRLVLEEGLETRFERHRHHEAALAAGIKAMGLRLFGDDSCK
MPVVTCVEIPGGIDGESVRDMLLAQFGIEIASSFGPLAGKIWRIGTMGYSCRKENVLFVLAGLEAVLLRHNAGIEAGKAL
QAALDVYENAGRQAAV
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3ISL A 1 ? 416 ? O32148 1 ? 416 ? 3 418 
2 1 3ISL B 1 ? 416 ? O32148 1 ? 416 ? 3 418 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                  ?                      'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                 ?                      'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE               ?                      'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'          ?                      'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                 ?                      'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                ?                      'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'          ?                      'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                  ?                      'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                ?                      'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                    ?                      'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE               ?                      'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                  ?                      'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                   ?                      'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE               ?                      'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE            ?                      'C9 H11 N O2'    165.189 
PLP non-polymer         . "PYRIDOXAL-5'-PHOSPHATE" 'VITAMIN B6 Phosphate' 'C8 H10 N O6 P'  247.142 
PRO 'L-peptide linking' y PROLINE                  ?                      'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                   ?                      'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                ?                      'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN               ?                      'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                 ?                      'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                   ?                      'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3ISL 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.48 
_exptl_crystal.density_percent_sol   50.36 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              9.0 
_exptl_crystal_grow.pdbx_details    '30% PEG MME550, 0.1M NaCl, 0.1M Bicine, pH9.0, VAPOR DIFFUSION, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MAR CCD 165 mm' 
_diffrn_detector.pdbx_collection_date   2009-07-15 
_diffrn_detector.details                Mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.2 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ELETTRA BEAMLINE 5.2R' 
_diffrn_source.pdbx_synchrotron_site       ELETTRA 
_diffrn_source.pdbx_synchrotron_beamline   5.2R 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.2 
# 
_reflns.entry_id                     3ISL 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             27.69 
_reflns.d_resolution_high            2.05 
_reflns.number_obs                   54886 
_reflns.number_all                   54886 
_reflns.percent_possible_obs         97.9 
_reflns.pdbx_Rmerge_I_obs            0.056 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        9.6 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              3.7 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.05 
_reflns_shell.d_res_low              2.16 
_reflns_shell.percent_possible_all   85.8 
_reflns_shell.Rmerge_I_obs           0.409 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.5 
_reflns_shell.pdbx_redundancy        3.4 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      6971 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3ISL 
_refine.ls_number_reflns_obs                     52089 
_refine.ls_number_reflns_all                     54886 
_refine.pdbx_ls_sigma_I                          0 
_refine.pdbx_ls_sigma_F                          ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             27.69 
_refine.ls_d_res_high                            2.06 
_refine.ls_percent_reflns_obs                    99.51 
_refine.ls_R_factor_obs                          0.19610 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.19341 
_refine.ls_R_factor_R_free                       0.24689 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.1 
_refine.ls_number_reflns_R_free                  2787 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               0.950 
_refine.correlation_coeff_Fo_to_Fc_free          0.921 
_refine.B_iso_mean                               28.436 
_refine.aniso_B[1][1]                            -1.81 
_refine.aniso_B[2][2]                            2.22 
_refine.aniso_B[3][3]                            -1.80 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            -1.70 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      'PDB ENTRY 1JVO' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.198 
_refine.pdbx_overall_ESU_R_Free                  0.181 
_refine.overall_SU_ML                            0.132 
_refine.overall_SU_B                             10.713 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        6002 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         30 
_refine_hist.number_atoms_solvent             306 
_refine_hist.number_atoms_total               6338 
_refine_hist.d_res_high                       2.06 
_refine_hist.d_res_low                        27.69 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.024  0.022  ? 6148 'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          2.052  1.974  ? 8330 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.964  5.000  ? 770  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       34.265 23.284 ? 268  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       17.524 15.000 ? 1054 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       21.270 15.000 ? 54   'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.196  0.200  ? 944  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.010  0.021  ? 4618 'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcbond_it                  1.015  1.500  ? 3836 'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_mcangle_it                 1.744  2.000  ? 6184 'X-RAY DIFFRACTION' ? 
r_scbond_it                  3.219  3.000  ? 2312 'X-RAY DIFFRACTION' ? 
r_scangle_it                 4.731  4.500  ? 2146 'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?    'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_restr_ncs.dom_id 
_refine_ls_restr_ncs.pdbx_auth_asym_id 
_refine_ls_restr_ncs.pdbx_number 
_refine_ls_restr_ncs.rms_dev_position 
_refine_ls_restr_ncs.weight_position 
_refine_ls_restr_ncs.pdbx_type 
_refine_ls_restr_ncs.pdbx_ens_id 
_refine_ls_restr_ncs.pdbx_ordinal 
_refine_ls_restr_ncs.pdbx_refine_id 
_refine_ls_restr_ncs.ncs_model_details 
_refine_ls_restr_ncs.rms_dev_B_iso 
_refine_ls_restr_ncs.weight_B_iso 
1 A 1544 0.11 0.50  'medium positional' 1 1 'X-RAY DIFFRACTION' ? ? ? 
1 A 1446 0.48 5.00  'loose positional'  1 2 'X-RAY DIFFRACTION' ? ? ? 
1 A 1544 0.81 2.00  'medium thermal'    1 3 'X-RAY DIFFRACTION' ? ? ? 
1 A 1446 1.25 10.00 'loose thermal'     1 4 'X-RAY DIFFRACTION' ? ? ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.061 
_refine_ls_shell.d_res_low                        2.115 
_refine_ls_shell.number_reflns_R_work             3616 
_refine_ls_shell.R_factor_R_work                  0.261 
_refine_ls_shell.percent_reflns_obs               94.08 
_refine_ls_shell.R_factor_R_free                  0.321 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             200 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                3616 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
loop_
_struct_ncs_dom.id 
_struct_ncs_dom.details 
_struct_ncs_dom.pdbx_ens_id 
1 A 1 
2 B 1 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  3ISL 
_struct.title                     'Crystal structure of ureidoglycine-glyoxylate aminotransferase (pucG) from Bacillus subtilis' 
_struct.pdbx_descriptor           'Purine catabolism protein pucG' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3ISL 
_struct_keywords.pdbx_keywords   TRANSFERASE 
_struct_keywords.text            
;Pyridoxalphosphate, PLP dependent enzymes, purine metabolism, transaminases, aminotransferases, Aminotransferase, Pyridoxal phosphate, Transferase
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 2 ? 
E N N 3 ? 
F N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  ASP A 23  ? MET A 30  ? ASP A 25  MET A 32  1 ? 8  
HELX_P HELX_P2  2  ASP A 39  ? PHE A 57  ? ASP A 41  PHE A 59  1 ? 19 
HELX_P HELX_P3  3  THR A 70  ? ILE A 83  ? THR A 72  ILE A 85  1 ? 14 
HELX_P HELX_P4  4  GLY A 95  ? TYR A 108 ? GLY A 97  TYR A 110 1 ? 14 
HELX_P HELX_P5  5  ASP A 124 ? LYS A 136 ? ASP A 126 LYS A 138 1 ? 13 
HELX_P HELX_P6  6  LEU A 155 ? GLU A 165 ? LEU A 157 GLU A 167 1 ? 11 
HELX_P HELX_P7  7  ASN A 212 ? ALA A 221 ? ASN A 214 ALA A 223 1 ? 10 
HELX_P HELX_P8  8  ASP A 250 ? TRP A 258 ? ASP A 252 TRP A 260 1 ? 9  
HELX_P HELX_P9  9  ALA A 269 ? GLY A 287 ? ALA A 271 GLY A 289 1 ? 19 
HELX_P HELX_P10 10 GLY A 287 ? MET A 309 ? GLY A 289 MET A 311 1 ? 23 
HELX_P HELX_P11 11 ASP A 316 ? LYS A 320 ? ASP A 318 LYS A 322 5 ? 5  
HELX_P HELX_P12 12 ASP A 334 ? GLY A 347 ? ASP A 336 GLY A 349 1 ? 14 
HELX_P HELX_P13 13 MET A 367 ? CYS A 371 ? MET A 369 CYS A 373 5 ? 5  
HELX_P HELX_P14 14 ARG A 372 ? HIS A 390 ? ARG A 374 HIS A 392 1 ? 19 
HELX_P HELX_P15 15 GLY A 397 ? ASN A 409 ? GLY A 399 ASN A 411 1 ? 13 
HELX_P HELX_P16 16 ASP B 23  ? MET B 30  ? ASP B 25  MET B 32  1 ? 8  
HELX_P HELX_P17 17 ASP B 39  ? PHE B 57  ? ASP B 41  PHE B 59  1 ? 19 
HELX_P HELX_P18 18 THR B 70  ? ILE B 83  ? THR B 72  ILE B 85  1 ? 14 
HELX_P HELX_P19 19 GLY B 95  ? TYR B 108 ? GLY B 97  TYR B 110 1 ? 14 
HELX_P HELX_P20 20 ASP B 124 ? LYS B 136 ? ASP B 126 LYS B 138 1 ? 13 
HELX_P HELX_P21 21 LEU B 155 ? GLU B 165 ? LEU B 157 GLU B 167 1 ? 11 
HELX_P HELX_P22 22 ASN B 212 ? ALA B 221 ? ASN B 214 ALA B 223 1 ? 10 
HELX_P HELX_P23 23 ASP B 250 ? TRP B 258 ? ASP B 252 TRP B 260 1 ? 9  
HELX_P HELX_P24 24 ALA B 269 ? GLY B 287 ? ALA B 271 GLY B 289 1 ? 19 
HELX_P HELX_P25 25 GLY B 287 ? MET B 309 ? GLY B 289 MET B 311 1 ? 23 
HELX_P HELX_P26 26 ASP B 316 ? LYS B 320 ? ASP B 318 LYS B 322 5 ? 5  
HELX_P HELX_P27 27 ASP B 334 ? GLY B 347 ? ASP B 336 GLY B 349 1 ? 14 
HELX_P HELX_P28 28 MET B 367 ? CYS B 371 ? MET B 369 CYS B 373 5 ? 5  
HELX_P HELX_P29 29 ARG B 372 ? HIS B 390 ? ARG B 374 HIS B 392 1 ? 19 
HELX_P HELX_P30 30 GLY B 397 ? ASN B 409 ? GLY B 399 ASN B 411 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1 covale ? ? A LYS 198 NZ ? ? ? 1_555 C PLP . C4A ? ? A LYS 200 A PLP 419 1_555 ? ? ? ? ? ? ? 1.298 ? 
covale2 covale ? ? B LYS 198 NZ ? ? ? 1_555 D PLP . C4A ? ? B LYS 200 B PLP 419 1_555 ? ? ? ? ? ? ? 1.315 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 GLY 18 A . ? GLY 20 A PRO 19 A ? PRO 21 A 1 -4.17 
2 GLY 18 B . ? GLY 20 B PRO 19 B ? PRO 21 B 1 -4.95 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 7 ? 
C ? 2 ? 
D ? 2 ? 
E ? 2 ? 
F ? 7 ? 
G ? 2 ? 
H ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? parallel      
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? parallel      
B 4 5 ? parallel      
B 5 6 ? parallel      
B 6 7 ? parallel      
C 1 2 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? parallel      
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? parallel      
F 4 5 ? parallel      
F 5 6 ? parallel      
F 6 7 ? parallel      
G 1 2 ? anti-parallel 
H 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 THR A 13  ? ILE A 14  ? THR A 15  ILE A 16  
A 2 ILE A 348 ? GLU A 349 ? ILE A 350 GLU A 351 
B 1 TRP A 63  ? ASP A 68  ? TRP A 65  ASP A 70  
B 2 MET A 206 ? TYR A 211 ? MET A 208 TYR A 213 
B 3 ALA A 191 ? ILE A 193 ? ALA A 193 ILE A 195 
B 4 LEU A 168 ? ASP A 172 ? LEU A 170 ASP A 174 
B 5 ILE A 139 ? VAL A 143 ? ILE A 141 VAL A 145 
B 6 ASP A 88  ? ILE A 93  ? ASP A 90  ILE A 95  
B 7 ASN A 111 ? GLU A 116 ? ASN A 113 GLU A 118 
C 1 GLY A 145 ? GLU A 146 ? GLY A 147 GLU A 148 
C 2 ARG A 151 ? ILE A 152 ? ARG A 153 ILE A 154 
D 1 VAL A 324 ? GLU A 328 ? VAL A 326 GLU A 330 
D 2 ILE A 361 ? GLY A 365 ? ILE A 363 GLY A 367 
E 1 THR B 13  ? ILE B 14  ? THR B 15  ILE B 16  
E 2 ILE B 348 ? GLU B 349 ? ILE B 350 GLU B 351 
F 1 TRP B 63  ? ILE B 67  ? TRP B 65  ILE B 69  
F 2 ALA B 207 ? TYR B 211 ? ALA B 209 TYR B 213 
F 3 ALA B 191 ? ILE B 193 ? ALA B 193 ILE B 195 
F 4 LEU B 168 ? ASP B 172 ? LEU B 170 ASP B 174 
F 5 ILE B 139 ? VAL B 143 ? ILE B 141 VAL B 145 
F 6 ASP B 88  ? ILE B 93  ? ASP B 90  ILE B 95  
F 7 ASN B 111 ? GLU B 116 ? ASN B 113 GLU B 118 
G 1 GLY B 145 ? GLU B 146 ? GLY B 147 GLU B 148 
G 2 ARG B 151 ? ILE B 152 ? ARG B 153 ILE B 154 
H 1 VAL B 324 ? GLU B 328 ? VAL B 326 GLU B 330 
H 2 ILE B 361 ? GLY B 365 ? ILE B 363 GLY B 367 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N THR A 13  ? N THR A 15  O GLU A 349 ? O GLU A 351 
B 1 2 N ILE A 67  ? N ILE A 69  O ALA A 207 ? O ALA A 209 
B 2 3 O THR A 210 ? O THR A 212 N ALA A 192 ? N ALA A 194 
B 3 4 O ALA A 191 ? O ALA A 193 N VAL A 171 ? N VAL A 173 
B 4 5 O LEU A 168 ? O LEU A 170 N VAL A 140 ? N VAL A 142 
B 5 6 O ILE A 139 ? O ILE A 141 N LEU A 90  ? N LEU A 92  
B 6 7 N ILE A 93  ? N ILE A 95  O LEU A 115 ? O LEU A 117 
C 1 2 N GLU A 146 ? N GLU A 148 O ARG A 151 ? O ARG A 153 
D 1 2 N THR A 325 ? N THR A 327 O ILE A 364 ? O ILE A 366 
E 1 2 N THR B 13  ? N THR B 15  O GLU B 349 ? O GLU B 351 
F 1 2 N TYR B 65  ? N TYR B 67  O ILE B 209 ? O ILE B 211 
F 2 3 O THR B 210 ? O THR B 212 N ALA B 192 ? N ALA B 194 
F 3 4 O ALA B 191 ? O ALA B 193 N VAL B 171 ? N VAL B 173 
F 4 5 O ILE B 170 ? O ILE B 172 N VAL B 140 ? N VAL B 142 
F 5 6 O ILE B 139 ? O ILE B 141 N LEU B 90  ? N LEU B 92  
F 6 7 N ILE B 93  ? N ILE B 95  O LEU B 115 ? O LEU B 117 
G 1 2 N GLU B 146 ? N GLU B 148 O ARG B 151 ? O ARG B 153 
H 1 2 N THR B 325 ? N THR B 327 O ILE B 364 ? O ILE B 366 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 11 'BINDING SITE FOR RESIDUE PLP A 419' 
AC2 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE PLP B 419' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 11 THR A 70  ? THR A 72  . ? 1_555 ? 
2  AC1 11 SER A 71  ? SER A 73  . ? 1_555 ? 
3  AC1 11 ARG A 72  ? ARG A 74  . ? 1_555 ? 
4  AC1 11 PHE A 97  ? PHE A 99  . ? 1_555 ? 
5  AC1 11 GLY A 145 ? GLY A 147 . ? 1_555 ? 
6  AC1 11 THR A 147 ? THR A 149 . ? 1_555 ? 
7  AC1 11 ASP A 172 ? ASP A 174 . ? 1_555 ? 
8  AC1 11 GLN A 197 ? GLN A 199 . ? 1_555 ? 
9  AC1 11 LYS A 198 ? LYS A 200 . ? 1_555 ? 
10 AC1 11 HIS B 266 ? HIS B 268 . ? 1_555 ? 
11 AC1 11 THR B 267 ? THR B 269 . ? 1_555 ? 
12 AC2 10 THR A 267 ? THR A 269 . ? 1_555 ? 
13 AC2 10 THR B 70  ? THR B 72  . ? 1_555 ? 
14 AC2 10 SER B 71  ? SER B 73  . ? 1_555 ? 
15 AC2 10 ARG B 72  ? ARG B 74  . ? 1_555 ? 
16 AC2 10 PHE B 97  ? PHE B 99  . ? 1_555 ? 
17 AC2 10 GLY B 145 ? GLY B 147 . ? 1_555 ? 
18 AC2 10 THR B 147 ? THR B 149 . ? 1_555 ? 
19 AC2 10 ASP B 172 ? ASP B 174 . ? 1_555 ? 
20 AC2 10 GLN B 197 ? GLN B 199 . ? 1_555 ? 
21 AC2 10 LYS B 198 ? LYS B 200 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3ISL 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3ISL 
_atom_sites.fract_transf_matrix[1][1]   0.009766 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.004395 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.010418 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.010826 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . ARG A 1 5   ? -17.420 -13.052 5.745  1.00 31.91 ? 7   ARG A N   1 
ATOM   2    C CA  . ARG A 1 5   ? -17.000 -13.105 7.161  1.00 30.55 ? 7   ARG A CA  1 
ATOM   3    C C   . ARG A 1 5   ? -15.458 -13.429 7.248  1.00 29.00 ? 7   ARG A C   1 
ATOM   4    O O   . ARG A 1 5   ? -14.872 -13.269 8.321  1.00 26.48 ? 7   ARG A O   1 
ATOM   5    C CB  . ARG A 1 5   ? -17.940 -14.064 7.958  1.00 31.35 ? 7   ARG A CB  1 
ATOM   6    C CG  . ARG A 1 5   ? -18.175 -13.616 9.359  1.00 35.64 ? 7   ARG A CG  1 
ATOM   7    C CD  . ARG A 1 5   ? -19.464 -14.257 9.949  1.00 44.10 ? 7   ARG A CD  1 
ATOM   8    N NE  . ARG A 1 5   ? -19.264 -14.602 11.366 1.00 49.41 ? 7   ARG A NE  1 
ATOM   9    C CZ  . ARG A 1 5   ? -18.090 -14.515 12.009 1.00 50.78 ? 7   ARG A CZ  1 
ATOM   10   N NH1 . ARG A 1 5   ? -17.022 -14.089 11.348 1.00 49.77 ? 7   ARG A NH1 1 
ATOM   11   N NH2 . ARG A 1 5   ? -17.970 -14.857 13.301 1.00 49.13 ? 7   ARG A NH2 1 
ATOM   12   N N   . GLU A 1 6   ? -14.811 -13.781 6.107  1.00 26.69 ? 8   GLU A N   1 
ATOM   13   C CA  . GLU A 1 6   ? -13.328 -13.752 5.958  1.00 26.32 ? 8   GLU A CA  1 
ATOM   14   C C   . GLU A 1 6   ? -12.737 -12.399 6.410  1.00 25.87 ? 8   GLU A C   1 
ATOM   15   O O   . GLU A 1 6   ? -13.398 -11.388 6.337  1.00 23.30 ? 8   GLU A O   1 
ATOM   16   C CB  . GLU A 1 6   ? -12.834 -14.029 4.507  1.00 27.01 ? 8   GLU A CB  1 
ATOM   17   C CG  . GLU A 1 6   ? -13.596 -13.259 3.402  1.00 31.03 ? 8   GLU A CG  1 
ATOM   18   C CD  . GLU A 1 6   ? -12.884 -13.252 2.072  1.00 38.73 ? 8   GLU A CD  1 
ATOM   19   O OE1 . GLU A 1 6   ? -11.839 -13.951 1.884  1.00 41.15 ? 8   GLU A OE1 1 
ATOM   20   O OE2 . GLU A 1 6   ? -13.401 -12.543 1.189  1.00 39.37 ? 8   GLU A OE2 1 
ATOM   21   N N   . LEU A 1 7   ? -11.491 -12.419 6.867  1.00 25.30 ? 9   LEU A N   1 
ATOM   22   C CA  . LEU A 1 7   ? -10.842 -11.219 7.371  1.00 26.65 ? 9   LEU A CA  1 
ATOM   23   C C   . LEU A 1 7   ? -10.831 -10.158 6.282  1.00 25.42 ? 9   LEU A C   1 
ATOM   24   O O   . LEU A 1 7   ? -10.570 -10.454 5.110  1.00 25.33 ? 9   LEU A O   1 
ATOM   25   C CB  . LEU A 1 7   ? -9.415  -11.538 7.759  1.00 26.20 ? 9   LEU A CB  1 
ATOM   26   C CG  . LEU A 1 7   ? -8.650  -10.425 8.437  1.00 30.71 ? 9   LEU A CG  1 
ATOM   27   C CD1 . LEU A 1 7   ? -9.061  -10.407 9.866  1.00 30.76 ? 9   LEU A CD1 1 
ATOM   28   C CD2 . LEU A 1 7   ? -7.174  -10.679 8.340  1.00 34.75 ? 9   LEU A CD2 1 
ATOM   29   N N   . CYS A 1 8   ? -11.129 -8.944  6.676  1.00 26.49 ? 10  CYS A N   1 
ATOM   30   C CA  . CYS A 1 8   ? -11.012 -7.768  5.785  1.00 26.18 ? 10  CYS A CA  1 
ATOM   31   C C   . CYS A 1 8   ? -10.429 -6.624  6.600  1.00 25.61 ? 10  CYS A C   1 
ATOM   32   O O   . CYS A 1 8   ? -10.995 -6.191  7.613  1.00 25.31 ? 10  CYS A O   1 
ATOM   33   C CB  . CYS A 1 8   ? -12.394 -7.368  5.185  1.00 27.04 ? 10  CYS A CB  1 
ATOM   34   S SG  . CYS A 1 8   ? -12.270 -5.986  3.930  1.00 30.01 ? 10  CYS A SG  1 
ATOM   35   N N   . THR A 1 9   ? -9.370  -6.036  6.064  1.00 24.66 ? 11  THR A N   1 
ATOM   36   C CA  . THR A 1 9   ? -8.567  -5.120  6.807  1.00 24.06 ? 11  THR A CA  1 
ATOM   37   C C   . THR A 1 9   ? -8.078  -4.006  5.824  1.00 23.51 ? 11  THR A C   1 
ATOM   38   O O   . THR A 1 9   ? -7.758  -4.318  4.668  1.00 21.86 ? 11  THR A O   1 
ATOM   39   C CB  . THR A 1 9   ? -7.469  -6.080  7.444  1.00 25.80 ? 11  THR A CB  1 
ATOM   40   O OG1 . THR A 1 9   ? -7.048  -5.702  8.763  1.00 30.74 ? 11  THR A OG1 1 
ATOM   41   C CG2 . THR A 1 9   ? -6.388  -6.465  6.520  1.00 17.96 ? 11  THR A CG2 1 
ATOM   42   N N   . PRO A 1 10  ? -8.045  -2.704  6.258  1.00 22.71 ? 12  PRO A N   1 
ATOM   43   C CA  . PRO A 1 10  ? -7.575  -1.642  5.358  1.00 22.23 ? 12  PRO A CA  1 
ATOM   44   C C   . PRO A 1 10  ? -6.088  -1.758  5.128  1.00 22.75 ? 12  PRO A C   1 
ATOM   45   O O   . PRO A 1 10  ? -5.385  -2.429  5.909  1.00 23.53 ? 12  PRO A O   1 
ATOM   46   C CB  . PRO A 1 10  ? -7.903  -0.336  6.133  1.00 22.43 ? 12  PRO A CB  1 
ATOM   47   C CG  . PRO A 1 10  ? -7.755  -0.749  7.557  1.00 22.39 ? 12  PRO A CG  1 
ATOM   48   C CD  . PRO A 1 10  ? -8.300  -2.180  7.613  1.00 23.52 ? 12  PRO A CD  1 
ATOM   49   N N   . LEU A 1 11  ? -5.583  -1.181  4.029  1.00 21.71 ? 13  LEU A N   1 
ATOM   50   C CA  . LEU A 1 11  ? -4.140  -1.132  3.874  1.00 22.54 ? 13  LEU A CA  1 
ATOM   51   C C   . LEU A 1 11  ? -3.617  0.182   4.438  1.00 22.71 ? 13  LEU A C   1 
ATOM   52   O O   . LEU A 1 11  ? -3.899  1.255   3.883  1.00 22.29 ? 13  LEU A O   1 
ATOM   53   C CB  . LEU A 1 11  ? -3.679  -1.285  2.400  1.00 22.23 ? 13  LEU A CB  1 
ATOM   54   C CG  . LEU A 1 11  ? -4.016  -2.557  1.657  1.00 25.03 ? 13  LEU A CG  1 
ATOM   55   C CD1 . LEU A 1 11  ? -3.630  -2.395  0.151  1.00 23.00 ? 13  LEU A CD1 1 
ATOM   56   C CD2 . LEU A 1 11  ? -3.298  -3.744  2.268  1.00 21.60 ? 13  LEU A CD2 1 
ATOM   57   N N   . ARG A 1 12  ? -2.859  0.092   5.536  1.00 21.97 ? 14  ARG A N   1 
ATOM   58   C CA  . ARG A 1 12  ? -2.395  1.320   6.245  1.00 20.23 ? 14  ARG A CA  1 
ATOM   59   C C   . ARG A 1 12  ? -1.066  1.748   5.725  1.00 19.23 ? 14  ARG A C   1 
ATOM   60   O O   . ARG A 1 12  ? -0.321  0.977   5.111  1.00 17.71 ? 14  ARG A O   1 
ATOM   61   C CB  . ARG A 1 12  ? -2.264  1.074   7.775  1.00 19.70 ? 14  ARG A CB  1 
ATOM   62   C CG  . ARG A 1 12  ? -3.549  0.645   8.491  1.00 18.56 ? 14  ARG A CG  1 
ATOM   63   C CD  . ARG A 1 12  ? -4.681  1.545   8.179  1.00 18.30 ? 14  ARG A CD  1 
ATOM   64   N NE  . ARG A 1 12  ? -5.712  1.576   9.229  1.00 20.72 ? 14  ARG A NE  1 
ATOM   65   C CZ  . ARG A 1 12  ? -6.885  2.195   9.099  1.00 19.76 ? 14  ARG A CZ  1 
ATOM   66   N NH1 . ARG A 1 12  ? -7.228  2.750   7.924  1.00 19.37 ? 14  ARG A NH1 1 
ATOM   67   N NH2 . ARG A 1 12  ? -7.712  2.265   10.124 1.00 13.99 ? 14  ARG A NH2 1 
ATOM   68   N N   . THR A 1 13  ? -0.768  3.014   5.980  1.00 20.31 ? 15  THR A N   1 
ATOM   69   C CA  . THR A 1 13  ? 0.567   3.540   5.809  1.00 18.38 ? 15  THR A CA  1 
ATOM   70   C C   . THR A 1 13  ? 1.089   3.686   7.204  1.00 18.16 ? 15  THR A C   1 
ATOM   71   O O   . THR A 1 13  ? 0.678   4.580   7.902  1.00 19.93 ? 15  THR A O   1 
ATOM   72   C CB  . THR A 1 13  ? 0.478   4.899   5.165  1.00 18.76 ? 15  THR A CB  1 
ATOM   73   O OG1 . THR A 1 13  ? -0.062  4.701   3.849  1.00 21.45 ? 15  THR A OG1 1 
ATOM   74   C CG2 . THR A 1 13  ? 1.865   5.571   5.079  1.00 16.77 ? 15  THR A CG2 1 
ATOM   75   N N   . ILE A 1 14  ? 2.031   2.855   7.623  1.00 16.76 ? 16  ILE A N   1 
ATOM   76   C CA  . ILE A 1 14  ? 2.388   2.849   9.040  1.00 18.73 ? 16  ILE A CA  1 
ATOM   77   C C   . ILE A 1 14  ? 3.684   3.579   9.322  1.00 18.43 ? 16  ILE A C   1 
ATOM   78   O O   . ILE A 1 14  ? 4.792   3.148   8.903  1.00 17.45 ? 16  ILE A O   1 
ATOM   79   C CB  . ILE A 1 14  ? 2.486   1.438   9.662  1.00 18.54 ? 16  ILE A CB  1 
ATOM   80   C CG1 . ILE A 1 14  ? 1.145   0.720   9.490  1.00 20.68 ? 16  ILE A CG1 1 
ATOM   81   C CG2 . ILE A 1 14  ? 2.862   1.563   11.191 1.00 19.57 ? 16  ILE A CG2 1 
ATOM   82   C CD1 . ILE A 1 14  ? 1.157   -0.809  9.956  1.00 18.52 ? 16  ILE A CD1 1 
ATOM   83   N N   . MET A 1 15  ? 3.529   4.674   10.066 1.00 16.77 ? 17  MET A N   1 
ATOM   84   C CA  . MET A 1 15  ? 4.639   5.528   10.362 1.00 19.13 ? 17  MET A CA  1 
ATOM   85   C C   . MET A 1 15  ? 4.755   5.772   11.879 1.00 19.49 ? 17  MET A C   1 
ATOM   86   O O   . MET A 1 15  ? 5.060   6.898   12.308 1.00 21.07 ? 17  MET A O   1 
ATOM   87   C CB  . MET A 1 15  ? 4.504   6.876   9.536  1.00 17.77 ? 17  MET A CB  1 
ATOM   88   C CG  . MET A 1 15  ? 4.794   6.655   7.977  1.00 19.82 ? 17  MET A CG  1 
ATOM   89   S SD  . MET A 1 15  ? 6.378   5.779   7.560  1.00 21.05 ? 17  MET A SD  1 
ATOM   90   C CE  . MET A 1 15  ? 7.501   7.156   7.292  1.00 21.09 ? 17  MET A CE  1 
ATOM   91   N N   . THR A 1 16  ? 4.510   4.731   12.669 1.00 20.90 ? 18  THR A N   1 
ATOM   92   C CA  . THR A 1 16  ? 4.716   4.763   14.120 1.00 20.76 ? 18  THR A CA  1 
ATOM   93   C C   . THR A 1 16  ? 6.108   4.161   14.391 1.00 20.93 ? 18  THR A C   1 
ATOM   94   O O   . THR A 1 16  ? 6.749   3.661   13.464 1.00 21.54 ? 18  THR A O   1 
ATOM   95   C CB  . THR A 1 16  ? 3.720   3.852   14.806 1.00 22.19 ? 18  THR A CB  1 
ATOM   96   O OG1 . THR A 1 16  ? 3.962   2.484   14.403 1.00 19.28 ? 18  THR A OG1 1 
ATOM   97   C CG2 . THR A 1 16  ? 2.271   4.265   14.473 1.00 21.24 ? 18  THR A CG2 1 
ATOM   98   N N   . PRO A 1 17  ? 6.559   4.182   15.661 1.00 21.17 ? 19  PRO A N   1 
ATOM   99   C CA  . PRO A 1 17  ? 7.735   3.397   16.064 1.00 20.98 ? 19  PRO A CA  1 
ATOM   100  C C   . PRO A 1 17  ? 7.513   1.890   16.307 1.00 21.46 ? 19  PRO A C   1 
ATOM   101  O O   . PRO A 1 17  ? 8.345   1.251   16.950 1.00 22.47 ? 19  PRO A O   1 
ATOM   102  C CB  . PRO A 1 17  ? 8.197   4.088   17.366 1.00 21.30 ? 19  PRO A CB  1 
ATOM   103  C CG  . PRO A 1 17  ? 7.635   5.499   17.326 1.00 19.56 ? 19  PRO A CG  1 
ATOM   104  C CD  . PRO A 1 17  ? 6.251   5.263   16.635 1.00 19.46 ? 19  PRO A CD  1 
ATOM   105  N N   . GLY A 1 18  ? 6.431   1.317   15.769 1.00 22.33 ? 20  GLY A N   1 
ATOM   106  C CA  . GLY A 1 18  ? 6.183   -0.109  15.820 1.00 22.22 ? 20  GLY A CA  1 
ATOM   107  C C   . GLY A 1 18  ? 4.809   -0.393  16.367 1.00 22.81 ? 20  GLY A C   1 
ATOM   108  O O   . GLY A 1 18  ? 4.308   0.362   17.191 1.00 23.10 ? 20  GLY A O   1 
ATOM   109  N N   . PRO A 1 19  ? 4.179   -1.471  15.889 1.00 22.90 ? 21  PRO A N   1 
ATOM   110  C CA  . PRO A 1 19  ? 4.698   -2.317  14.829 1.00 22.35 ? 21  PRO A CA  1 
ATOM   111  C C   . PRO A 1 19  ? 4.543   -1.651  13.437 1.00 22.18 ? 21  PRO A C   1 
ATOM   112  O O   . PRO A 1 19  ? 3.497   -1.008  13.176 1.00 20.16 ? 21  PRO A O   1 
ATOM   113  C CB  . PRO A 1 19  ? 3.803   -3.568  14.920 1.00 23.82 ? 21  PRO A CB  1 
ATOM   114  C CG  . PRO A 1 19  ? 2.507   -3.023  15.500 1.00 23.84 ? 21  PRO A CG  1 
ATOM   115  C CD  . PRO A 1 19  ? 2.922   -1.988  16.460 1.00 22.87 ? 21  PRO A CD  1 
ATOM   116  N N   . VAL A 1 20  ? 5.557   -1.838  12.571 1.00 18.98 ? 22  VAL A N   1 
ATOM   117  C CA  . VAL A 1 20  ? 5.560   -1.240  11.266 1.00 19.74 ? 22  VAL A CA  1 
ATOM   118  C C   . VAL A 1 20  ? 5.197   -2.199  10.124 1.00 19.31 ? 22  VAL A C   1 
ATOM   119  O O   . VAL A 1 20  ? 4.883   -3.380  10.358 1.00 21.19 ? 22  VAL A O   1 
ATOM   120  C CB  . VAL A 1 20  ? 6.925   -0.495  11.016 1.00 20.73 ? 22  VAL A CB  1 
ATOM   121  C CG1 . VAL A 1 20  ? 7.166   0.520   12.168 1.00 20.39 ? 22  VAL A CG1 1 
ATOM   122  C CG2 . VAL A 1 20  ? 8.100   -1.511  10.932 1.00 17.59 ? 22  VAL A CG2 1 
ATOM   123  N N   . GLU A 1 21  ? 5.230   -1.726  8.898  1.00 20.83 ? 23  GLU A N   1 
ATOM   124  C CA  . GLU A 1 21  ? 4.786   -2.540  7.756  1.00 22.01 ? 23  GLU A CA  1 
ATOM   125  C C   . GLU A 1 21  ? 5.830   -3.617  7.539  1.00 22.05 ? 23  GLU A C   1 
ATOM   126  O O   . GLU A 1 21  ? 7.039   -3.403  7.782  1.00 22.10 ? 23  GLU A O   1 
ATOM   127  C CB  . GLU A 1 21  ? 4.727   -1.690  6.496  1.00 20.69 ? 23  GLU A CB  1 
ATOM   128  C CG  . GLU A 1 21  ? 3.635   -0.723  6.410  1.00 22.55 ? 23  GLU A CG  1 
ATOM   129  C CD  . GLU A 1 21  ? 3.908   0.317   5.371  1.00 24.57 ? 23  GLU A CD  1 
ATOM   130  O OE1 . GLU A 1 21  ? 4.603   0.032   4.345  1.00 22.59 ? 23  GLU A OE1 1 
ATOM   131  O OE2 . GLU A 1 21  ? 3.433   1.437   5.594  1.00 22.73 ? 23  GLU A OE2 1 
ATOM   132  N N   . VAL A 1 22  ? 5.382   -4.770  7.062  1.00 22.22 ? 24  VAL A N   1 
ATOM   133  C CA  . VAL A 1 22  ? 6.238   -5.919  6.754  1.00 20.75 ? 24  VAL A CA  1 
ATOM   134  C C   . VAL A 1 22  ? 6.590   -5.965  5.274  1.00 21.91 ? 24  VAL A C   1 
ATOM   135  O O   . VAL A 1 22  ? 5.658   -5.824  4.402  1.00 20.81 ? 24  VAL A O   1 
ATOM   136  C CB  . VAL A 1 22  ? 5.492   -7.160  7.201  1.00 22.79 ? 24  VAL A CB  1 
ATOM   137  C CG1 . VAL A 1 22  ? 6.216   -8.445  6.850  1.00 20.58 ? 24  VAL A CG1 1 
ATOM   138  C CG2 . VAL A 1 22  ? 5.374   -7.064  8.740  1.00 23.64 ? 24  VAL A CG2 1 
ATOM   139  N N   . ASP A 1 23  ? 7.869   -6.213  4.937  1.00 20.40 ? 25  ASP A N   1 
ATOM   140  C CA  . ASP A 1 23  ? 8.193   -6.393  3.503  1.00 24.23 ? 25  ASP A CA  1 
ATOM   141  C C   . ASP A 1 23  ? 7.268   -7.475  2.893  1.00 25.19 ? 25  ASP A C   1 
ATOM   142  O O   . ASP A 1 23  ? 7.056   -8.524  3.519  1.00 25.97 ? 25  ASP A O   1 
ATOM   143  C CB  . ASP A 1 23  ? 9.685   -6.801  3.287  1.00 25.60 ? 25  ASP A CB  1 
ATOM   144  C CG  . ASP A 1 23  ? 10.129  -6.716  1.793  1.00 27.13 ? 25  ASP A CG  1 
ATOM   145  O OD1 . ASP A 1 23  ? 9.589   -7.445  0.936  1.00 28.65 ? 25  ASP A OD1 1 
ATOM   146  O OD2 . ASP A 1 23  ? 11.007  -5.907  1.430  1.00 24.94 ? 25  ASP A OD2 1 
ATOM   147  N N   . PRO A 1 24  ? 6.746   -7.237  1.670  1.00 25.47 ? 26  PRO A N   1 
ATOM   148  C CA  . PRO A 1 24  ? 5.955   -8.178  0.946  1.00 25.75 ? 26  PRO A CA  1 
ATOM   149  C C   . PRO A 1 24  ? 6.639   -9.516  0.758  1.00 26.27 ? 26  PRO A C   1 
ATOM   150  O O   . PRO A 1 24  ? 5.936   -10.532 0.731  1.00 25.00 ? 26  PRO A O   1 
ATOM   151  C CB  . PRO A 1 24  ? 5.745   -7.470  -0.404 1.00 25.10 ? 26  PRO A CB  1 
ATOM   152  C CG  . PRO A 1 24  ? 5.577   -6.083  0.008  1.00 26.15 ? 26  PRO A CG  1 
ATOM   153  C CD  . PRO A 1 24  ? 6.789   -5.951  0.929  1.00 26.48 ? 26  PRO A CD  1 
ATOM   154  N N   . ARG A 1 25  ? 7.975   -9.528  0.635  1.00 26.49 ? 27  ARG A N   1 
ATOM   155  C CA  . ARG A 1 25  ? 8.667   -10.823 0.569  1.00 28.28 ? 27  ARG A CA  1 
ATOM   156  C C   . ARG A 1 25  ? 8.533   -11.641 1.881  1.00 27.37 ? 27  ARG A C   1 
ATOM   157  O O   . ARG A 1 25  ? 8.562   -12.856 1.858  1.00 30.13 ? 27  ARG A O   1 
ATOM   158  C CB  . ARG A 1 25  ? 10.131  -10.662 0.202  1.00 28.49 ? 27  ARG A CB  1 
ATOM   159  C CG  . ARG A 1 25  ? 10.343  -10.225 -1.232 1.00 30.81 ? 27  ARG A CG  1 
ATOM   160  C CD  . ARG A 1 25  ? 10.944  -8.843  -1.155 1.00 37.27 ? 27  ARG A CD  1 
ATOM   161  N NE  . ARG A 1 25  ? 12.324  -8.925  -1.525 1.00 36.58 ? 27  ARG A NE  1 
ATOM   162  C CZ  . ARG A 1 25  ? 13.270  -8.045  -1.214 1.00 34.36 ? 27  ARG A CZ  1 
ATOM   163  N NH1 . ARG A 1 25  ? 13.072  -6.973  -0.395 1.00 31.29 ? 27  ARG A NH1 1 
ATOM   164  N NH2 . ARG A 1 25  ? 14.454  -8.301  -1.711 1.00 29.38 ? 27  ARG A NH2 1 
ATOM   165  N N   . VAL A 1 26  ? 8.455   -10.952 3.024  1.00 26.54 ? 28  VAL A N   1 
ATOM   166  C CA  . VAL A 1 26  ? 8.209   -11.624 4.306  1.00 23.86 ? 28  VAL A CA  1 
ATOM   167  C C   . VAL A 1 26  ? 6.758   -12.024 4.402  1.00 23.11 ? 28  VAL A C   1 
ATOM   168  O O   . VAL A 1 26  ? 6.444   -13.183 4.762  1.00 23.52 ? 28  VAL A O   1 
ATOM   169  C CB  . VAL A 1 26  ? 8.668   -10.734 5.500  1.00 23.03 ? 28  VAL A CB  1 
ATOM   170  C CG1 . VAL A 1 26  ? 8.188   -11.288 6.774  1.00 20.82 ? 28  VAL A CG1 1 
ATOM   171  C CG2 . VAL A 1 26  ? 10.230  -10.635 5.517  1.00 23.60 ? 28  VAL A CG2 1 
ATOM   172  N N   . LEU A 1 27  ? 5.844   -11.093 4.115  1.00 22.03 ? 29  LEU A N   1 
ATOM   173  C CA  . LEU A 1 27  ? 4.431   -11.501 4.051  1.00 21.44 ? 29  LEU A CA  1 
ATOM   174  C C   . LEU A 1 27  ? 4.130   -12.764 3.214  1.00 21.32 ? 29  LEU A C   1 
ATOM   175  O O   . LEU A 1 27  ? 3.397   -13.653 3.715  1.00 20.07 ? 29  LEU A O   1 
ATOM   176  C CB  . LEU A 1 27  ? 3.525   -10.367 3.593  1.00 22.03 ? 29  LEU A CB  1 
ATOM   177  C CG  . LEU A 1 27  ? 3.472   -9.189  4.546  1.00 22.68 ? 29  LEU A CG  1 
ATOM   178  C CD1 . LEU A 1 27  ? 2.726   -8.055  3.849  1.00 24.00 ? 29  LEU A CD1 1 
ATOM   179  C CD2 . LEU A 1 27  ? 2.840   -9.639  5.882  1.00 21.29 ? 29  LEU A CD2 1 
ATOM   180  N N   . ARG A 1 28  ? 4.585   -12.817 1.950  1.00 21.88 ? 30  ARG A N   1 
ATOM   181  C CA  . ARG A 1 28  ? 4.197   -13.932 1.052  1.00 23.77 ? 30  ARG A CA  1 
ATOM   182  C C   . ARG A 1 28  ? 4.732   -15.225 1.653  1.00 21.65 ? 30  ARG A C   1 
ATOM   183  O O   . ARG A 1 28  ? 4.150   -16.247 1.460  1.00 21.78 ? 30  ARG A O   1 
ATOM   184  C CB  . ARG A 1 28  ? 4.699   -13.784 -0.444 1.00 24.90 ? 30  ARG A CB  1 
ATOM   185  C CG  . ARG A 1 28  ? 6.274   -13.911 -0.560 1.00 29.10 ? 30  ARG A CG  1 
ATOM   186  C CD  . ARG A 1 28  ? 6.993   -13.882 -1.955 1.00 31.31 ? 30  ARG A CD  1 
ATOM   187  N NE  . ARG A 1 28  ? 6.913   -12.546 -2.442 1.00 31.96 ? 30  ARG A NE  1 
ATOM   188  C CZ  . ARG A 1 28  ? 7.755   -11.887 -3.247 1.00 30.36 ? 30  ARG A CZ  1 
ATOM   189  N NH1 . ARG A 1 28  ? 8.933   -12.385 -3.716 1.00 28.65 ? 30  ARG A NH1 1 
ATOM   190  N NH2 . ARG A 1 28  ? 7.406   -10.638 -3.527 1.00 28.54 ? 30  ARG A NH2 1 
ATOM   191  N N   . VAL A 1 29  ? 5.847   -15.201 2.380  1.00 20.31 ? 31  VAL A N   1 
ATOM   192  C CA  . VAL A 1 29  ? 6.371   -16.485 2.867  1.00 21.36 ? 31  VAL A CA  1 
ATOM   193  C C   . VAL A 1 29  ? 5.529   -17.113 4.023  1.00 20.75 ? 31  VAL A C   1 
ATOM   194  O O   . VAL A 1 29  ? 5.666   -18.317 4.326  1.00 21.15 ? 31  VAL A O   1 
ATOM   195  C CB  . VAL A 1 29  ? 7.885   -16.463 3.285  1.00 19.78 ? 31  VAL A CB  1 
ATOM   196  C CG1 . VAL A 1 29  ? 8.031   -16.057 4.797  1.00 21.42 ? 31  VAL A CG1 1 
ATOM   197  C CG2 . VAL A 1 29  ? 8.464   -17.845 3.062  1.00 23.51 ? 31  VAL A CG2 1 
ATOM   198  N N   . MET A 1 30  ? 4.595   -16.339 4.580  1.00 20.56 ? 32  MET A N   1 
ATOM   199  C CA  . MET A 1 30  ? 3.864   -16.828 5.795  1.00 19.33 ? 32  MET A CA  1 
ATOM   200  C C   . MET A 1 30  ? 2.667   -17.719 5.377  1.00 20.56 ? 32  MET A C   1 
ATOM   201  O O   . MET A 1 30  ? 2.063   -18.380 6.202  1.00 19.50 ? 32  MET A O   1 
ATOM   202  C CB  . MET A 1 30  ? 3.459   -15.646 6.670  1.00 20.40 ? 32  MET A CB  1 
ATOM   203  C CG  . MET A 1 30  ? 4.714   -15.041 7.317  1.00 18.13 ? 32  MET A CG  1 
ATOM   204  S SD  . MET A 1 30  ? 4.296   -13.962 8.697  1.00 24.14 ? 32  MET A SD  1 
ATOM   205  C CE  . MET A 1 30  ? 3.780   -12.519 7.770  1.00 18.67 ? 32  MET A CE  1 
ATOM   206  N N   . SER A 1 31  ? 2.419   -17.780 4.070  1.00 19.27 ? 33  SER A N   1 
ATOM   207  C CA  . SER A 1 31  ? 1.446   -18.701 3.508  1.00 21.19 ? 33  SER A CA  1 
ATOM   208  C C   . SER A 1 31  ? 2.113   -20.091 3.218  1.00 19.77 ? 33  SER A C   1 
ATOM   209  O O   . SER A 1 31  ? 1.449   -20.983 2.781  1.00 21.01 ? 33  SER A O   1 
ATOM   210  C CB  . SER A 1 31  ? 0.822   -18.066 2.223  1.00 20.72 ? 33  SER A CB  1 
ATOM   211  O OG  . SER A 1 31  ? 1.561   -18.315 1.011  1.00 24.73 ? 33  SER A OG  1 
ATOM   212  N N   . THR A 1 32  ? 3.384   -20.286 3.548  1.00 19.88 ? 34  THR A N   1 
ATOM   213  C CA  . THR A 1 32  ? 4.047   -21.601 3.301  1.00 18.72 ? 34  THR A CA  1 
ATOM   214  C C   . THR A 1 32  ? 3.529   -22.684 4.278  1.00 18.13 ? 34  THR A C   1 
ATOM   215  O O   . THR A 1 32  ? 3.427   -22.426 5.450  1.00 19.53 ? 34  THR A O   1 
ATOM   216  C CB  . THR A 1 32  ? 5.530   -21.463 3.494  1.00 19.24 ? 34  THR A CB  1 
ATOM   217  O OG1 . THR A 1 32  ? 6.035   -20.410 2.648  1.00 19.72 ? 34  THR A OG1 1 
ATOM   218  C CG2 . THR A 1 32  ? 6.264   -22.766 3.166  1.00 20.49 ? 34  THR A CG2 1 
ATOM   219  N N   . PRO A 1 33  ? 3.236   -23.912 3.791  1.00 18.61 ? 35  PRO A N   1 
ATOM   220  C CA  . PRO A 1 33  ? 2.807   -24.958 4.749  1.00 17.92 ? 35  PRO A CA  1 
ATOM   221  C C   . PRO A 1 33  ? 3.901   -25.248 5.813  1.00 17.92 ? 35  PRO A C   1 
ATOM   222  O O   . PRO A 1 33  ? 5.102   -25.310 5.515  1.00 18.47 ? 35  PRO A O   1 
ATOM   223  C CB  . PRO A 1 33  ? 2.475   -26.158 3.853  1.00 17.84 ? 35  PRO A CB  1 
ATOM   224  C CG  . PRO A 1 33  ? 1.881   -25.435 2.512  1.00 20.20 ? 35  PRO A CG  1 
ATOM   225  C CD  . PRO A 1 33  ? 2.974   -24.281 2.373  1.00 17.22 ? 35  PRO A CD  1 
ATOM   226  N N   . VAL A 1 34  ? 3.457   -25.463 7.034  1.00 17.53 ? 36  VAL A N   1 
ATOM   227  C CA  . VAL A 1 34  ? 4.338   -25.661 8.174  1.00 18.88 ? 36  VAL A CA  1 
ATOM   228  C C   . VAL A 1 34  ? 5.002   -27.043 8.098  1.00 19.17 ? 36  VAL A C   1 
ATOM   229  O O   . VAL A 1 34  ? 4.493   -27.935 7.412  1.00 19.99 ? 36  VAL A O   1 
ATOM   230  C CB  . VAL A 1 34  ? 3.605   -25.562 9.502  1.00 19.63 ? 36  VAL A CB  1 
ATOM   231  C CG1 . VAL A 1 34  ? 2.934   -24.190 9.705  1.00 21.41 ? 36  VAL A CG1 1 
ATOM   232  C CG2 . VAL A 1 34  ? 2.597   -26.641 9.618  1.00 20.12 ? 36  VAL A CG2 1 
ATOM   233  N N   . VAL A 1 35  ? 6.169   -27.155 8.733  1.00 20.00 ? 37  VAL A N   1 
ATOM   234  C CA  . VAL A 1 35  ? 6.851   -28.416 8.997  1.00 21.73 ? 37  VAL A CA  1 
ATOM   235  C C   . VAL A 1 35  ? 7.014   -28.464 10.534 1.00 23.20 ? 37  VAL A C   1 
ATOM   236  O O   . VAL A 1 35  ? 6.891   -27.440 11.150 1.00 24.63 ? 37  VAL A O   1 
ATOM   237  C CB  . VAL A 1 35  ? 8.273   -28.464 8.305  1.00 21.67 ? 37  VAL A CB  1 
ATOM   238  C CG1 . VAL A 1 35  ? 8.173   -28.429 6.756  1.00 19.08 ? 37  VAL A CG1 1 
ATOM   239  C CG2 . VAL A 1 35  ? 9.256   -27.383 8.845  1.00 18.97 ? 37  VAL A CG2 1 
ATOM   240  N N   . GLY A 1 36  ? 7.328   -29.618 11.130 1.00 26.10 ? 38  GLY A N   1 
ATOM   241  C CA  . GLY A 1 36  ? 7.426   -29.741 12.618 1.00 26.22 ? 38  GLY A CA  1 
ATOM   242  C C   . GLY A 1 36  ? 8.764   -29.391 13.198 1.00 26.48 ? 38  GLY A C   1 
ATOM   243  O O   . GLY A 1 36  ? 9.679   -29.188 12.412 1.00 24.97 ? 38  GLY A O   1 
ATOM   244  N N   . GLN A 1 37  ? 8.875   -29.290 14.554 1.00 28.37 ? 39  GLN A N   1 
ATOM   245  C CA  . GLN A 1 37  ? 10.083  -28.750 15.232 1.00 29.57 ? 39  GLN A CA  1 
ATOM   246  C C   . GLN A 1 37  ? 11.171  -29.733 15.032 1.00 29.47 ? 39  GLN A C   1 
ATOM   247  O O   . GLN A 1 37  ? 12.292  -29.352 14.982 1.00 30.86 ? 39  GLN A O   1 
ATOM   248  C CB  . GLN A 1 37  ? 9.935   -28.559 16.798 1.00 31.77 ? 39  GLN A CB  1 
ATOM   249  C CG  . GLN A 1 37  ? 8.763   -29.324 17.483 1.00 31.02 ? 39  GLN A CG  1 
ATOM   250  C CD  . GLN A 1 37  ? 8.861   -29.500 19.050 1.00 35.47 ? 39  GLN A CD  1 
ATOM   251  O OE1 . GLN A 1 37  ? 9.599   -28.800 19.781 1.00 34.74 ? 39  GLN A OE1 1 
ATOM   252  N NE2 . GLN A 1 37  ? 8.093   -30.473 19.552 1.00 33.35 ? 39  GLN A NE2 1 
ATOM   253  N N   . PHE A 1 38  ? 10.843  -31.010 14.959 1.00 28.82 ? 40  PHE A N   1 
ATOM   254  C CA  . PHE A 1 38  ? 11.885  -32.029 14.835 1.00 30.63 ? 40  PHE A CA  1 
ATOM   255  C C   . PHE A 1 38  ? 12.067  -32.548 13.413 1.00 28.46 ? 40  PHE A C   1 
ATOM   256  O O   . PHE A 1 38  ? 12.581  -33.643 13.211 1.00 30.40 ? 40  PHE A O   1 
ATOM   257  C CB  . PHE A 1 38  ? 11.566  -33.239 15.726 1.00 31.33 ? 40  PHE A CB  1 
ATOM   258  C CG  . PHE A 1 38  ? 11.257  -32.871 17.147 1.00 37.75 ? 40  PHE A CG  1 
ATOM   259  C CD1 . PHE A 1 38  ? 10.048  -33.293 17.736 1.00 41.19 ? 40  PHE A CD1 1 
ATOM   260  C CD2 . PHE A 1 38  ? 12.139  -32.008 17.873 1.00 41.13 ? 40  PHE A CD2 1 
ATOM   261  C CE1 . PHE A 1 38  ? 9.733   -32.906 19.050 1.00 44.51 ? 40  PHE A CE1 1 
ATOM   262  C CE2 . PHE A 1 38  ? 11.848  -31.610 19.186 1.00 42.59 ? 40  PHE A CE2 1 
ATOM   263  C CZ  . PHE A 1 38  ? 10.641  -32.071 19.786 1.00 45.25 ? 40  PHE A CZ  1 
ATOM   264  N N   . ASP A 1 39  ? 11.577  -31.825 12.448 1.00 24.49 ? 41  ASP A N   1 
ATOM   265  C CA  . ASP A 1 39  ? 11.770  -32.221 11.065 1.00 23.14 ? 41  ASP A CA  1 
ATOM   266  C C   . ASP A 1 39  ? 13.086  -31.555 10.625 1.00 21.26 ? 41  ASP A C   1 
ATOM   267  O O   . ASP A 1 39  ? 13.303  -30.391 10.904 1.00 20.65 ? 41  ASP A O   1 
ATOM   268  C CB  . ASP A 1 39  ? 10.576  -31.654 10.310 1.00 22.89 ? 41  ASP A CB  1 
ATOM   269  C CG  . ASP A 1 39  ? 10.615  -31.944 8.812  1.00 26.47 ? 41  ASP A CG  1 
ATOM   270  O OD1 . ASP A 1 39  ? 11.709  -31.857 8.175  1.00 24.07 ? 41  ASP A OD1 1 
ATOM   271  O OD2 . ASP A 1 39  ? 9.529   -32.213 8.263  1.00 24.99 ? 41  ASP A OD2 1 
ATOM   272  N N   . PRO A 1 40  ? 13.988  -32.296 9.973  1.00 21.90 ? 42  PRO A N   1 
ATOM   273  C CA  . PRO A 1 40  ? 15.308  -31.751 9.483  1.00 21.33 ? 42  PRO A CA  1 
ATOM   274  C C   . PRO A 1 40  ? 15.129  -30.476 8.672  1.00 20.38 ? 42  PRO A C   1 
ATOM   275  O O   . PRO A 1 40  ? 15.992  -29.569 8.704  1.00 19.26 ? 42  PRO A O   1 
ATOM   276  C CB  . PRO A 1 40  ? 15.835  -32.901 8.587  1.00 22.39 ? 42  PRO A CB  1 
ATOM   277  C CG  . PRO A 1 40  ? 15.209  -34.150 9.244  1.00 23.37 ? 42  PRO A CG  1 
ATOM   278  C CD  . PRO A 1 40  ? 13.859  -33.741 9.709  1.00 20.57 ? 42  PRO A CD  1 
ATOM   279  N N   . ALA A 1 41  ? 14.008  -30.357 7.965  1.00 19.36 ? 43  ALA A N   1 
ATOM   280  C CA  . ALA A 1 41  ? 13.778  -29.074 7.273  1.00 21.34 ? 43  ALA A CA  1 
ATOM   281  C C   . ALA A 1 41  ? 13.728  -27.927 8.295  1.00 21.73 ? 43  ALA A C   1 
ATOM   282  O O   . ALA A 1 41  ? 14.205  -26.800 8.020  1.00 21.35 ? 43  ALA A O   1 
ATOM   283  C CB  . ALA A 1 41  ? 12.510  -29.115 6.470  1.00 21.46 ? 43  ALA A CB  1 
ATOM   284  N N   . PHE A 1 42  ? 13.173  -28.201 9.492  1.00 21.06 ? 44  PHE A N   1 
ATOM   285  C CA  . PHE A 1 42  ? 13.013  -27.110 10.446 1.00 21.11 ? 44  PHE A CA  1 
ATOM   286  C C   . PHE A 1 42  ? 14.348  -26.885 11.192 1.00 20.21 ? 44  PHE A C   1 
ATOM   287  O O   . PHE A 1 42  ? 14.755  -25.770 11.408 1.00 19.46 ? 44  PHE A O   1 
ATOM   288  C CB  . PHE A 1 42  ? 11.870  -27.377 11.431 1.00 20.61 ? 44  PHE A CB  1 
ATOM   289  C CG  . PHE A 1 42  ? 11.337  -26.134 12.124 1.00 23.96 ? 44  PHE A CG  1 
ATOM   290  C CD1 . PHE A 1 42  ? 10.687  -25.118 11.406 1.00 31.25 ? 44  PHE A CD1 1 
ATOM   291  C CD2 . PHE A 1 42  ? 11.510  -25.965 13.479 1.00 27.49 ? 44  PHE A CD2 1 
ATOM   292  C CE1 . PHE A 1 42  ? 10.191  -23.950 12.078 1.00 33.62 ? 44  PHE A CE1 1 
ATOM   293  C CE2 . PHE A 1 42  ? 10.988  -24.864 14.167 1.00 24.76 ? 44  PHE A CE2 1 
ATOM   294  C CZ  . PHE A 1 42  ? 10.349  -23.852 13.474 1.00 30.66 ? 44  PHE A CZ  1 
ATOM   295  N N   . THR A 1 43  ? 15.045  -27.941 11.528 1.00 20.24 ? 45  THR A N   1 
ATOM   296  C CA  . THR A 1 43  ? 16.344  -27.773 12.178 1.00 21.16 ? 45  THR A CA  1 
ATOM   297  C C   . THR A 1 43  ? 17.316  -27.015 11.256 1.00 19.20 ? 45  THR A C   1 
ATOM   298  O O   . THR A 1 43  ? 18.051  -26.172 11.739 1.00 18.81 ? 45  THR A O   1 
ATOM   299  C CB  . THR A 1 43  ? 16.928  -29.075 12.674 1.00 21.69 ? 45  THR A CB  1 
ATOM   300  O OG1 . THR A 1 43  ? 16.815  -30.026 11.655 1.00 28.22 ? 45  THR A OG1 1 
ATOM   301  C CG2 . THR A 1 43  ? 16.142  -29.653 13.876 1.00 25.48 ? 45  THR A CG2 1 
ATOM   302  N N   . GLY A 1 44  ? 17.204  -27.211 9.945  1.00 18.79 ? 46  GLY A N   1 
ATOM   303  C CA  . GLY A 1 44  ? 18.018  -26.493 8.957  1.00 21.03 ? 46  GLY A CA  1 
ATOM   304  C C   . GLY A 1 44  ? 17.700  -24.993 8.968  1.00 20.60 ? 46  GLY A C   1 
ATOM   305  O O   . GLY A 1 44  ? 18.614  -24.171 8.952  1.00 19.88 ? 46  GLY A O   1 
ATOM   306  N N   . ILE A 1 45  ? 16.412  -24.653 8.984  1.00 21.08 ? 47  ILE A N   1 
ATOM   307  C CA  . ILE A 1 45  ? 16.003  -23.246 9.128  1.00 22.94 ? 47  ILE A CA  1 
ATOM   308  C C   . ILE A 1 45  ? 16.503  -22.753 10.471 1.00 22.91 ? 47  ILE A C   1 
ATOM   309  O O   . ILE A 1 45  ? 17.002  -21.630 10.533 1.00 23.05 ? 47  ILE A O   1 
ATOM   310  C CB  . ILE A 1 45  ? 14.448  -23.105 9.017  1.00 23.86 ? 47  ILE A CB  1 
ATOM   311  C CG1 . ILE A 1 45  ? 13.980  -23.525 7.601  1.00 27.07 ? 47  ILE A CG1 1 
ATOM   312  C CG2 . ILE A 1 45  ? 13.941  -21.654 9.449  1.00 22.93 ? 47  ILE A CG2 1 
ATOM   313  C CD1 . ILE A 1 45  ? 12.422  -23.925 7.524  1.00 27.30 ? 47  ILE A CD1 1 
ATOM   314  N N   . MET A 1 46  ? 16.377  -23.561 11.565 1.00 21.88 ? 48  MET A N   1 
ATOM   315  C CA  . MET A 1 46  ? 16.900  -23.057 12.859 1.00 22.87 ? 48  MET A CA  1 
ATOM   316  C C   . MET A 1 46  ? 18.381  -22.629 12.747 1.00 24.06 ? 48  MET A C   1 
ATOM   317  O O   . MET A 1 46  ? 18.779  -21.503 13.171 1.00 22.97 ? 48  MET A O   1 
ATOM   318  C CB  . MET A 1 46  ? 16.717  -24.012 14.064 1.00 20.35 ? 48  MET A CB  1 
ATOM   319  C CG  . MET A 1 46  ? 15.225  -24.228 14.484 1.00 29.50 ? 48  MET A CG  1 
ATOM   320  S SD  . MET A 1 46  ? 14.971  -25.693 15.662 1.00 36.66 ? 48  MET A SD  1 
ATOM   321  C CE  . MET A 1 46  ? 13.172  -25.786 15.474 1.00 38.01 ? 48  MET A CE  1 
ATOM   322  N N   . ASN A 1 47  ? 19.182  -23.532 12.195 1.00 23.20 ? 49  ASN A N   1 
ATOM   323  C CA  . ASN A 1 47  ? 20.613  -23.337 12.199 1.00 24.86 ? 49  ASN A CA  1 
ATOM   324  C C   . ASN A 1 47  ? 21.063  -22.154 11.367 1.00 24.71 ? 49  ASN A C   1 
ATOM   325  O O   . ASN A 1 47  ? 21.956  -21.444 11.742 1.00 23.51 ? 49  ASN A O   1 
ATOM   326  C CB  . ASN A 1 47  ? 21.383  -24.602 11.792 1.00 23.06 ? 49  ASN A CB  1 
ATOM   327  C CG  . ASN A 1 47  ? 21.193  -25.803 12.793 1.00 26.89 ? 49  ASN A CG  1 
ATOM   328  O OD1 . ASN A 1 47  ? 20.879  -25.653 13.988 1.00 26.11 ? 49  ASN A OD1 1 
ATOM   329  N ND2 . ASN A 1 47  ? 21.390  -27.020 12.258 1.00 23.97 ? 49  ASN A ND2 1 
ATOM   330  N N   . GLU A 1 48  ? 20.435  -21.958 10.227 1.00 24.62 ? 50  GLU A N   1 
ATOM   331  C CA  . GLU A 1 48  ? 20.783  -20.807 9.408  1.00 26.11 ? 50  GLU A CA  1 
ATOM   332  C C   . GLU A 1 48  ? 20.288  -19.511 10.037 1.00 23.87 ? 50  GLU A C   1 
ATOM   333  O O   . GLU A 1 48  ? 20.897  -18.429 9.890  1.00 23.21 ? 50  GLU A O   1 
ATOM   334  C CB  . GLU A 1 48  ? 20.085  -20.969 8.067  1.00 26.68 ? 50  GLU A CB  1 
ATOM   335  C CG  . GLU A 1 48  ? 20.562  -19.991 7.026  1.00 33.23 ? 50  GLU A CG  1 
ATOM   336  C CD  . GLU A 1 48  ? 20.182  -20.487 5.646  1.00 38.90 ? 50  GLU A CD  1 
ATOM   337  O OE1 . GLU A 1 48  ? 19.230  -21.340 5.579  1.00 35.58 ? 50  GLU A OE1 1 
ATOM   338  O OE2 . GLU A 1 48  ? 20.875  -20.041 4.676  1.00 40.52 ? 50  GLU A OE2 1 
ATOM   339  N N   . THR A 1 49  ? 19.169  -19.598 10.732 1.00 22.14 ? 51  THR A N   1 
ATOM   340  C CA  . THR A 1 49  ? 18.664  -18.366 11.378 1.00 22.05 ? 51  THR A CA  1 
ATOM   341  C C   . THR A 1 49  ? 19.677  -17.903 12.452 1.00 22.27 ? 51  THR A C   1 
ATOM   342  O O   . THR A 1 49  ? 19.929  -16.698 12.571 1.00 21.60 ? 51  THR A O   1 
ATOM   343  C CB  . THR A 1 49  ? 17.272  -18.521 11.993 1.00 22.10 ? 51  THR A CB  1 
ATOM   344  O OG1 . THR A 1 49  ? 16.326  -18.772 10.932 1.00 23.35 ? 51  THR A OG1 1 
ATOM   345  C CG2 . THR A 1 49  ? 16.857  -17.175 12.723 1.00 22.51 ? 51  THR A CG2 1 
ATOM   346  N N   . MET A 1 50  ? 20.225  -18.844 13.230 1.00 20.87 ? 52  MET A N   1 
ATOM   347  C CA  . MET A 1 50  ? 21.207  -18.528 14.264 1.00 20.68 ? 52  MET A CA  1 
ATOM   348  C C   . MET A 1 50  ? 22.484  -17.904 13.650 1.00 21.31 ? 52  MET A C   1 
ATOM   349  O O   . MET A 1 50  ? 22.961  -16.891 14.155 1.00 22.12 ? 52  MET A O   1 
ATOM   350  C CB  . MET A 1 50  ? 21.549  -19.753 15.154 1.00 21.65 ? 52  MET A CB  1 
ATOM   351  C CG  . MET A 1 50  ? 20.386  -20.486 15.961 1.00 20.75 ? 52  MET A CG  1 
ATOM   352  S SD  . MET A 1 50  ? 21.238  -21.771 16.855 1.00 24.63 ? 52  MET A SD  1 
ATOM   353  C CE  . MET A 1 50  ? 20.026  -23.025 17.227 1.00 35.06 ? 52  MET A CE  1 
ATOM   354  N N   . GLU A 1 51  ? 23.017  -18.438 12.537 1.00 22.11 ? 53  GLU A N   1 
ATOM   355  C CA  . GLU A 1 51  ? 24.132  -17.789 11.853 1.00 23.70 ? 53  GLU A CA  1 
ATOM   356  C C   . GLU A 1 51  ? 23.801  -16.354 11.435 1.00 22.28 ? 53  GLU A C   1 
ATOM   357  O O   . GLU A 1 51  ? 24.637  -15.493 11.434 1.00 23.10 ? 53  GLU A O   1 
ATOM   358  C CB  . GLU A 1 51  ? 24.571  -18.561 10.580 1.00 25.12 ? 53  GLU A CB  1 
ATOM   359  C CG  . GLU A 1 51  ? 25.325  -19.913 10.848 1.00 33.43 ? 53  GLU A CG  1 
ATOM   360  C CD  . GLU A 1 51  ? 26.830  -19.763 11.365 1.00 44.24 ? 53  GLU A CD  1 
ATOM   361  O OE1 . GLU A 1 51  ? 27.289  -18.681 11.938 1.00 43.23 ? 53  GLU A OE1 1 
ATOM   362  O OE2 . GLU A 1 51  ? 27.569  -20.784 11.179 1.00 46.18 ? 53  GLU A OE2 1 
ATOM   363  N N   . MET A 1 52  ? 22.607  -16.136 10.930 1.00 22.37 ? 54  MET A N   1 
ATOM   364  C CA  . MET A 1 52  ? 22.248  -14.817 10.420 1.00 21.94 ? 54  MET A CA  1 
ATOM   365  C C   . MET A 1 52  ? 22.098  -13.844 11.586 1.00 19.91 ? 54  MET A C   1 
ATOM   366  O O   . MET A 1 52  ? 22.425  -12.647 11.469 1.00 17.48 ? 54  MET A O   1 
ATOM   367  C CB  . MET A 1 52  ? 20.937  -14.889 9.580  1.00 21.66 ? 54  MET A CB  1 
ATOM   368  C CG  . MET A 1 52  ? 21.209  -15.400 8.143  1.00 24.80 ? 54  MET A CG  1 
ATOM   369  S SD  . MET A 1 52  ? 19.758  -15.224 7.022  1.00 27.77 ? 54  MET A SD  1 
ATOM   370  C CE  . MET A 1 52  ? 18.468  -16.097 7.877  1.00 19.99 ? 54  MET A CE  1 
ATOM   371  N N   . LEU A 1 53  ? 21.580  -14.352 12.710 1.00 19.33 ? 55  LEU A N   1 
ATOM   372  C CA  . LEU A 1 53  ? 21.456  -13.507 13.920 1.00 20.20 ? 55  LEU A CA  1 
ATOM   373  C C   . LEU A 1 53  ? 22.848  -13.122 14.449 1.00 21.24 ? 55  LEU A C   1 
ATOM   374  O O   . LEU A 1 53  ? 23.039  -12.009 14.900 1.00 20.10 ? 55  LEU A O   1 
ATOM   375  C CB  . LEU A 1 53  ? 20.637  -14.155 15.050 1.00 20.55 ? 55  LEU A CB  1 
ATOM   376  C CG  . LEU A 1 53  ? 19.158  -14.360 14.670 1.00 22.91 ? 55  LEU A CG  1 
ATOM   377  C CD1 . LEU A 1 53  ? 18.446  -15.021 15.859 1.00 19.92 ? 55  LEU A CD1 1 
ATOM   378  C CD2 . LEU A 1 53  ? 18.481  -13.031 14.307 1.00 19.98 ? 55  LEU A CD2 1 
ATOM   379  N N   . ARG A 1 54  ? 23.832  -14.013 14.319 1.00 20.55 ? 56  ARG A N   1 
ATOM   380  C CA  . ARG A 1 54  ? 25.230  -13.622 14.671 1.00 21.52 ? 56  ARG A CA  1 
ATOM   381  C C   . ARG A 1 54  ? 25.659  -12.389 13.886 1.00 22.21 ? 56  ARG A C   1 
ATOM   382  O O   . ARG A 1 54  ? 26.178  -11.435 14.476 1.00 22.45 ? 56  ARG A O   1 
ATOM   383  C CB  . ARG A 1 54  ? 26.199  -14.791 14.470 1.00 22.14 ? 56  ARG A CB  1 
ATOM   384  C CG  . ARG A 1 54  ? 25.848  -16.038 15.329 1.00 22.51 ? 56  ARG A CG  1 
ATOM   385  C CD  . ARG A 1 54  ? 26.919  -17.170 15.246 1.00 24.69 ? 56  ARG A CD  1 
ATOM   386  N NE  . ARG A 1 54  ? 26.460  -18.196 16.151 1.00 23.26 ? 56  ARG A NE  1 
ATOM   387  C CZ  . ARG A 1 54  ? 25.850  -19.311 15.771 1.00 27.31 ? 56  ARG A CZ  1 
ATOM   388  N NH1 . ARG A 1 54  ? 25.690  -19.589 14.493 1.00 26.99 ? 56  ARG A NH1 1 
ATOM   389  N NH2 . ARG A 1 54  ? 25.390  -20.159 16.667 1.00 26.17 ? 56  ARG A NH2 1 
ATOM   390  N N   . GLU A 1 55  ? 25.361  -12.354 12.578 1.00 21.73 ? 57  GLU A N   1 
ATOM   391  C CA  . GLU A 1 55  ? 25.738  -11.227 11.725 1.00 22.25 ? 57  GLU A CA  1 
ATOM   392  C C   . GLU A 1 55  ? 24.960  -9.968  12.041 1.00 21.51 ? 57  GLU A C   1 
ATOM   393  O O   . GLU A 1 55  ? 25.557  -8.893  12.076 1.00 20.99 ? 57  GLU A O   1 
ATOM   394  C CB  . GLU A 1 55  ? 25.543  -11.511 10.209 1.00 21.97 ? 57  GLU A CB  1 
ATOM   395  C CG  . GLU A 1 55  ? 26.497  -12.465 9.645  1.00 27.66 ? 57  GLU A CG  1 
ATOM   396  C CD  . GLU A 1 55  ? 26.315  -12.579 8.137  1.00 34.43 ? 57  GLU A CD  1 
ATOM   397  O OE1 . GLU A 1 55  ? 26.103  -13.725 7.727  1.00 36.80 ? 57  GLU A OE1 1 
ATOM   398  O OE2 . GLU A 1 55  ? 26.343  -11.543 7.379  1.00 33.41 ? 57  GLU A OE2 1 
ATOM   399  N N   . LEU A 1 56  ? 23.657  -10.127 12.292 1.00 19.22 ? 58  LEU A N   1 
ATOM   400  C CA  . LEU A 1 56  ? 22.762  -9.039  12.530 1.00 19.82 ? 58  LEU A CA  1 
ATOM   401  C C   . LEU A 1 56  ? 23.255  -8.334  13.762 1.00 19.03 ? 58  LEU A C   1 
ATOM   402  O O   . LEU A 1 56  ? 23.271  -7.148  13.762 1.00 18.49 ? 58  LEU A O   1 
ATOM   403  C CB  . LEU A 1 56  ? 21.363  -9.562  12.859 1.00 20.41 ? 58  LEU A CB  1 
ATOM   404  C CG  . LEU A 1 56  ? 20.112  -8.693  12.742 1.00 23.58 ? 58  LEU A CG  1 
ATOM   405  C CD1 . LEU A 1 56  ? 19.049  -8.946  13.821 1.00 22.66 ? 58  LEU A CD1 1 
ATOM   406  C CD2 . LEU A 1 56  ? 20.271  -7.286  12.420 1.00 22.07 ? 58  LEU A CD2 1 
ATOM   407  N N   . PHE A 1 57  ? 23.619  -9.086  14.813 1.00 19.32 ? 59  PHE A N   1 
ATOM   408  C CA  . PHE A 1 57  ? 24.069  -8.480  16.078 1.00 19.12 ? 59  PHE A CA  1 
ATOM   409  C C   . PHE A 1 57  ? 25.536  -8.072  16.112 1.00 18.57 ? 59  PHE A C   1 
ATOM   410  O O   . PHE A 1 57  ? 25.992  -7.493  17.114 1.00 18.04 ? 59  PHE A O   1 
ATOM   411  C CB  . PHE A 1 57  ? 23.798  -9.397  17.283 1.00 19.06 ? 59  PHE A CB  1 
ATOM   412  C CG  . PHE A 1 57  ? 22.360  -9.394  17.767 1.00 22.02 ? 59  PHE A CG  1 
ATOM   413  C CD1 . PHE A 1 57  ? 21.833  -8.297  18.490 1.00 16.84 ? 59  PHE A CD1 1 
ATOM   414  C CD2 . PHE A 1 57  ? 21.565  -10.540 17.592 1.00 21.37 ? 59  PHE A CD2 1 
ATOM   415  C CE1 . PHE A 1 57  ? 20.515  -8.321  18.972 1.00 21.34 ? 59  PHE A CE1 1 
ATOM   416  C CE2 . PHE A 1 57  ? 20.243  -10.583 18.067 1.00 21.38 ? 59  PHE A CE2 1 
ATOM   417  C CZ  . PHE A 1 57  ? 19.723  -9.504  18.776 1.00 20.60 ? 59  PHE A CZ  1 
ATOM   418  N N   . GLN A 1 58  ? 26.250  -8.364  15.024 1.00 19.22 ? 60  GLN A N   1 
ATOM   419  C CA  . GLN A 1 58  ? 27.694  -8.152  14.881 1.00 18.68 ? 60  GLN A CA  1 
ATOM   420  C C   . GLN A 1 58  ? 28.407  -8.825  15.996 1.00 20.69 ? 60  GLN A C   1 
ATOM   421  O O   . GLN A 1 58  ? 29.141  -8.155  16.793 1.00 19.55 ? 60  GLN A O   1 
ATOM   422  C CB  . GLN A 1 58  ? 28.069  -6.647  14.714 1.00 19.42 ? 60  GLN A CB  1 
ATOM   423  C CG  . GLN A 1 58  ? 27.276  -6.004  13.536 1.00 17.85 ? 60  GLN A CG  1 
ATOM   424  C CD  . GLN A 1 58  ? 27.687  -4.543  13.209 1.00 25.21 ? 60  GLN A CD  1 
ATOM   425  O OE1 . GLN A 1 58  ? 26.839  -3.663  13.008 1.00 28.05 ? 60  GLN A OE1 1 
ATOM   426  N NE2 . GLN A 1 58  ? 28.984  -4.293  13.148 1.00 22.94 ? 60  GLN A NE2 1 
ATOM   427  N N   . THR A 1 59  ? 28.210  -10.179 16.064 1.00 21.29 ? 61  THR A N   1 
ATOM   428  C CA  . THR A 1 59  ? 28.831  -10.961 17.123 1.00 21.05 ? 61  THR A CA  1 
ATOM   429  C C   . THR A 1 59  ? 29.291  -12.348 16.681 1.00 22.40 ? 61  THR A C   1 
ATOM   430  O O   . THR A 1 59  ? 28.754  -12.941 15.736 1.00 21.60 ? 61  THR A O   1 
ATOM   431  C CB  . THR A 1 59  ? 27.877  -11.130 18.322 1.00 21.08 ? 61  THR A CB  1 
ATOM   432  O OG1 . THR A 1 59  ? 28.577  -11.758 19.376 1.00 18.70 ? 61  THR A OG1 1 
ATOM   433  C CG2 . THR A 1 59  ? 26.626  -12.032 17.970 1.00 21.06 ? 61  THR A CG2 1 
ATOM   434  N N   . LYS A 1 60  ? 30.289  -12.866 17.391 1.00 23.27 ? 62  LYS A N   1 
ATOM   435  C CA  . LYS A 1 60  ? 30.723  -14.235 17.202 1.00 25.25 ? 62  LYS A CA  1 
ATOM   436  C C   . LYS A 1 60  ? 30.057  -15.204 18.169 1.00 24.48 ? 62  LYS A C   1 
ATOM   437  O O   . LYS A 1 60  ? 30.392  -16.415 18.161 1.00 25.55 ? 62  LYS A O   1 
ATOM   438  C CB  . LYS A 1 60  ? 32.252  -14.327 17.349 1.00 26.77 ? 62  LYS A CB  1 
ATOM   439  C CG  . LYS A 1 60  ? 32.977  -13.493 16.298 1.00 30.28 ? 62  LYS A CG  1 
ATOM   440  C CD  . LYS A 1 60  ? 32.573  -13.882 14.854 1.00 35.66 ? 62  LYS A CD  1 
ATOM   441  C CE  . LYS A 1 60  ? 33.294  -12.946 13.840 1.00 38.04 ? 62  LYS A CE  1 
ATOM   442  N NZ  . LYS A 1 60  ? 32.388  -12.535 12.727 1.00 37.40 ? 62  LYS A NZ  1 
ATOM   443  N N   . ASN A 1 61  ? 29.194  -14.690 19.036 1.00 23.42 ? 63  ASN A N   1 
ATOM   444  C CA  . ASN A 1 61  ? 28.617  -15.512 20.128 1.00 25.33 ? 63  ASN A CA  1 
ATOM   445  C C   . ASN A 1 61  ? 28.022  -16.814 19.573 1.00 26.29 ? 63  ASN A C   1 
ATOM   446  O O   . ASN A 1 61  ? 27.251  -16.769 18.581 1.00 25.90 ? 63  ASN A O   1 
ATOM   447  C CB  . ASN A 1 61  ? 27.434  -14.777 20.799 1.00 24.14 ? 63  ASN A CB  1 
ATOM   448  C CG  . ASN A 1 61  ? 27.862  -13.668 21.729 1.00 23.77 ? 63  ASN A CG  1 
ATOM   449  O OD1 . ASN A 1 61  ? 28.988  -13.651 22.207 1.00 20.31 ? 63  ASN A OD1 1 
ATOM   450  N ND2 . ASN A 1 61  ? 26.934  -12.722 22.006 1.00 19.82 ? 63  ASN A ND2 1 
ATOM   451  N N   . ARG A 1 62  ? 28.309  -17.932 20.224 1.00 27.44 ? 64  ARG A N   1 
ATOM   452  C CA  . ARG A 1 62  ? 27.621  -19.197 19.966 1.00 29.80 ? 64  ARG A CA  1 
ATOM   453  C C   . ARG A 1 62  ? 26.133  -19.032 20.174 1.00 30.33 ? 64  ARG A C   1 
ATOM   454  O O   . ARG A 1 62  ? 25.328  -19.626 19.439 1.00 30.90 ? 64  ARG A O   1 
ATOM   455  C CB  . ARG A 1 62  ? 28.167  -20.332 20.867 1.00 31.51 ? 64  ARG A CB  1 
ATOM   456  C CG  . ARG A 1 62  ? 27.819  -21.780 20.341 1.00 37.81 ? 64  ARG A CG  1 
ATOM   457  C CD  . ARG A 1 62  ? 28.645  -22.956 21.011 1.00 44.87 ? 64  ARG A CD  1 
ATOM   458  N NE  . ARG A 1 62  ? 30.106  -22.863 20.762 1.00 50.02 ? 64  ARG A NE  1 
ATOM   459  C CZ  . ARG A 1 62  ? 31.005  -22.408 21.647 1.00 51.73 ? 64  ARG A CZ  1 
ATOM   460  N NH1 . ARG A 1 62  ? 30.621  -22.001 22.870 1.00 51.70 ? 64  ARG A NH1 1 
ATOM   461  N NH2 . ARG A 1 62  ? 32.294  -22.352 21.313 1.00 51.48 ? 64  ARG A NH2 1 
ATOM   462  N N   . TRP A 1 63  ? 25.742  -18.230 21.169 1.00 29.57 ? 65  TRP A N   1 
ATOM   463  C CA  . TRP A 1 63  ? 24.316  -18.130 21.533 1.00 28.87 ? 65  TRP A CA  1 
ATOM   464  C C   . TRP A 1 63  ? 23.634  -16.909 20.816 1.00 28.63 ? 65  TRP A C   1 
ATOM   465  O O   . TRP A 1 63  ? 23.881  -15.731 21.182 1.00 27.44 ? 65  TRP A O   1 
ATOM   466  C CB  . TRP A 1 63  ? 24.147  -18.147 23.067 1.00 28.59 ? 65  TRP A CB  1 
ATOM   467  C CG  . TRP A 1 63  ? 24.815  -19.393 23.736 1.00 31.60 ? 65  TRP A CG  1 
ATOM   468  C CD1 . TRP A 1 63  ? 24.234  -20.614 23.929 1.00 33.14 ? 65  TRP A CD1 1 
ATOM   469  C CD2 . TRP A 1 63  ? 26.195  -19.544 24.179 1.00 33.74 ? 65  TRP A CD2 1 
ATOM   470  N NE1 . TRP A 1 63  ? 25.145  -21.510 24.476 1.00 29.19 ? 65  TRP A NE1 1 
ATOM   471  C CE2 . TRP A 1 63  ? 26.353  -20.885 24.626 1.00 34.97 ? 65  TRP A CE2 1 
ATOM   472  C CE3 . TRP A 1 63  ? 27.322  -18.680 24.217 1.00 39.64 ? 65  TRP A CE3 1 
ATOM   473  C CZ2 . TRP A 1 63  ? 27.602  -21.386 25.173 1.00 38.10 ? 65  TRP A CZ2 1 
ATOM   474  C CZ3 . TRP A 1 63  ? 28.582  -19.184 24.743 1.00 35.06 ? 65  TRP A CZ3 1 
ATOM   475  C CH2 . TRP A 1 63  ? 28.693  -20.519 25.205 1.00 40.11 ? 65  TRP A CH2 1 
ATOM   476  N N   . ALA A 1 64  ? 22.838  -17.208 19.773 1.00 25.91 ? 66  ALA A N   1 
ATOM   477  C CA  . ALA A 1 64  ? 22.008  -16.222 19.087 1.00 24.54 ? 66  ALA A CA  1 
ATOM   478  C C   . ALA A 1 64  ? 20.835  -16.955 18.441 1.00 24.45 ? 66  ALA A C   1 
ATOM   479  O O   . ALA A 1 64  ? 21.037  -17.729 17.543 1.00 24.55 ? 66  ALA A O   1 
ATOM   480  C CB  . ALA A 1 64  ? 22.817  -15.455 18.050 1.00 22.77 ? 66  ALA A CB  1 
ATOM   481  N N   . TYR A 1 65  ? 19.631  -16.705 18.926 1.00 24.92 ? 67  TYR A N   1 
ATOM   482  C CA  . TYR A 1 65  ? 18.457  -17.530 18.605 1.00 26.64 ? 67  TYR A CA  1 
ATOM   483  C C   . TYR A 1 65  ? 17.269  -16.805 19.110 1.00 26.71 ? 67  TYR A C   1 
ATOM   484  O O   . TYR A 1 65  ? 17.400  -15.994 20.012 1.00 27.61 ? 67  TYR A O   1 
ATOM   485  C CB  . TYR A 1 65  ? 18.573  -18.961 19.196 1.00 27.03 ? 67  TYR A CB  1 
ATOM   486  C CG  . TYR A 1 65  ? 18.717  -19.059 20.730 1.00 28.42 ? 67  TYR A CG  1 
ATOM   487  C CD1 . TYR A 1 65  ? 19.978  -19.187 21.334 1.00 29.05 ? 67  TYR A CD1 1 
ATOM   488  C CD2 . TYR A 1 65  ? 17.603  -19.032 21.551 1.00 29.65 ? 67  TYR A CD2 1 
ATOM   489  C CE1 . TYR A 1 65  ? 20.115  -19.304 22.753 1.00 28.55 ? 67  TYR A CE1 1 
ATOM   490  C CE2 . TYR A 1 65  ? 17.722  -19.127 22.953 1.00 26.76 ? 67  TYR A CE2 1 
ATOM   491  C CZ  . TYR A 1 65  ? 18.972  -19.251 23.527 1.00 29.19 ? 67  TYR A CZ  1 
ATOM   492  O OH  . TYR A 1 65  ? 19.037  -19.350 24.890 1.00 29.78 ? 67  TYR A OH  1 
ATOM   493  N N   . PRO A 1 66  ? 16.092  -17.025 18.506 1.00 27.52 ? 68  PRO A N   1 
ATOM   494  C CA  . PRO A 1 66  ? 14.934  -16.275 18.993 1.00 28.68 ? 68  PRO A CA  1 
ATOM   495  C C   . PRO A 1 66  ? 14.204  -16.978 20.166 1.00 29.94 ? 68  PRO A C   1 
ATOM   496  O O   . PRO A 1 66  ? 14.267  -18.164 20.304 1.00 28.51 ? 68  PRO A O   1 
ATOM   497  C CB  . PRO A 1 66  ? 13.985  -16.255 17.780 1.00 27.99 ? 68  PRO A CB  1 
ATOM   498  C CG  . PRO A 1 66  ? 14.349  -17.418 17.011 1.00 27.48 ? 68  PRO A CG  1 
ATOM   499  C CD  . PRO A 1 66  ? 15.798  -17.770 17.276 1.00 28.96 ? 68  PRO A CD  1 
ATOM   500  N N   . ILE A 1 67  ? 13.503  -16.226 20.979 1.00 32.24 ? 69  ILE A N   1 
ATOM   501  C CA  . ILE A 1 67  ? 12.585  -16.872 21.898 1.00 35.40 ? 69  ILE A CA  1 
ATOM   502  C C   . ILE A 1 67  ? 11.163  -16.477 21.437 1.00 34.41 ? 69  ILE A C   1 
ATOM   503  O O   . ILE A 1 67  ? 10.957  -15.447 20.747 1.00 34.22 ? 69  ILE A O   1 
ATOM   504  C CB  . ILE A 1 67  ? 12.850  -16.524 23.442 1.00 36.23 ? 69  ILE A CB  1 
ATOM   505  C CG1 . ILE A 1 67  ? 12.485  -15.103 23.739 1.00 39.04 ? 69  ILE A CG1 1 
ATOM   506  C CG2 . ILE A 1 67  ? 14.276  -16.801 23.972 1.00 36.81 ? 69  ILE A CG2 1 
ATOM   507  C CD1 . ILE A 1 67  ? 11.147  -15.055 24.548 1.00 40.24 ? 69  ILE A CD1 1 
ATOM   508  N N   . ASP A 1 68  ? 10.175  -17.262 21.847 1.00 35.06 ? 70  ASP A N   1 
ATOM   509  C CA  . ASP A 1 68  ? 8.863   -17.143 21.242 1.00 34.43 ? 70  ASP A CA  1 
ATOM   510  C C   . ASP A 1 68  ? 8.142   -16.264 22.230 1.00 34.85 ? 70  ASP A C   1 
ATOM   511  O O   . ASP A 1 68  ? 7.873   -16.669 23.353 1.00 37.63 ? 70  ASP A O   1 
ATOM   512  C CB  . ASP A 1 68  ? 8.230   -18.542 21.108 1.00 34.68 ? 70  ASP A CB  1 
ATOM   513  C CG  . ASP A 1 68  ? 8.890   -19.396 20.033 1.00 36.34 ? 70  ASP A CG  1 
ATOM   514  O OD1 . ASP A 1 68  ? 8.497   -20.578 19.867 1.00 29.91 ? 70  ASP A OD1 1 
ATOM   515  O OD2 . ASP A 1 68  ? 9.846   -18.879 19.385 1.00 41.73 ? 70  ASP A OD2 1 
ATOM   516  N N   . GLY A 1 69  ? 7.876   -15.026 21.878 1.00 33.26 ? 71  GLY A N   1 
ATOM   517  C CA  . GLY A 1 69  ? 7.270   -14.133 22.851 1.00 30.96 ? 71  GLY A CA  1 
ATOM   518  C C   . GLY A 1 69  ? 7.514   -12.822 22.203 1.00 29.50 ? 71  GLY A C   1 
ATOM   519  O O   . GLY A 1 69  ? 8.364   -12.735 21.293 1.00 28.80 ? 71  GLY A O   1 
ATOM   520  N N   . THR A 1 70  ? 6.793   -11.801 22.633 1.00 29.01 ? 72  THR A N   1 
ATOM   521  C CA  . THR A 1 70  ? 7.162   -10.471 22.186 1.00 29.41 ? 72  THR A CA  1 
ATOM   522  C C   . THR A 1 70  ? 8.577   -10.098 22.703 1.00 28.69 ? 72  THR A C   1 
ATOM   523  O O   . THR A 1 70  ? 9.241   -10.878 23.468 1.00 26.47 ? 72  THR A O   1 
ATOM   524  C CB  . THR A 1 70  ? 6.004   -9.389  22.424 1.00 31.61 ? 72  THR A CB  1 
ATOM   525  O OG1 . THR A 1 70  ? 6.165   -8.689  23.671 1.00 32.31 ? 72  THR A OG1 1 
ATOM   526  C CG2 . THR A 1 70  ? 4.634   -10.053 22.377 1.00 31.31 ? 72  THR A CG2 1 
ATOM   527  N N   . SER A 1 71  ? 9.056   -8.938  22.251 1.00 26.02 ? 73  SER A N   1 
ATOM   528  C CA  . SER A 1 71  ? 10.390  -8.505  22.581 1.00 26.54 ? 73  SER A CA  1 
ATOM   529  C C   . SER A 1 71  ? 10.639  -8.552  24.086 1.00 25.33 ? 73  SER A C   1 
ATOM   530  O O   . SER A 1 71  ? 11.703  -8.946  24.548 1.00 22.51 ? 73  SER A O   1 
ATOM   531  C CB  . SER A 1 71  ? 10.549  -7.093  22.106 1.00 26.46 ? 73  SER A CB  1 
ATOM   532  O OG  . SER A 1 71  ? 10.018  -6.983  20.818 1.00 31.76 ? 73  SER A OG  1 
ATOM   533  N N   . ARG A 1 72  ? 9.644   -8.117  24.844 1.00 25.68 ? 74  ARG A N   1 
ATOM   534  C CA  . ARG A 1 72  ? 9.810   -7.985  26.287 1.00 27.21 ? 74  ARG A CA  1 
ATOM   535  C C   . ARG A 1 72  ? 9.714   -9.316  27.046 1.00 26.89 ? 74  ARG A C   1 
ATOM   536  O O   . ARG A 1 72  ? 10.152  -9.386  28.190 1.00 26.65 ? 74  ARG A O   1 
ATOM   537  C CB  . ARG A 1 72  ? 8.850   -6.936  26.884 1.00 28.33 ? 74  ARG A CB  1 
ATOM   538  C CG  . ARG A 1 72  ? 7.473   -7.403  27.179 1.00 29.90 ? 74  ARG A CG  1 
ATOM   539  C CD  . ARG A 1 72  ? 6.627   -6.139  27.501 1.00 34.74 ? 74  ARG A CD  1 
ATOM   540  N NE  . ARG A 1 72  ? 6.525   -5.191  26.367 1.00 35.30 ? 74  ARG A NE  1 
ATOM   541  C CZ  . ARG A 1 72  ? 6.024   -3.942  26.442 1.00 38.56 ? 74  ARG A CZ  1 
ATOM   542  N NH1 . ARG A 1 72  ? 5.610   -3.427  27.599 1.00 30.49 ? 74  ARG A NH1 1 
ATOM   543  N NH2 . ARG A 1 72  ? 5.954   -3.179  25.344 1.00 40.47 ? 74  ARG A NH2 1 
ATOM   544  N N   . ALA A 1 73  ? 9.204   -10.364 26.390 1.00 26.05 ? 75  ALA A N   1 
ATOM   545  C CA  . ALA A 1 73  ? 9.368   -11.730 26.895 1.00 27.01 ? 75  ALA A CA  1 
ATOM   546  C C   . ALA A 1 73  ? 10.835  -12.131 26.673 1.00 27.91 ? 75  ALA A C   1 
ATOM   547  O O   . ALA A 1 73  ? 11.384  -12.879 27.473 1.00 28.40 ? 75  ALA A O   1 
ATOM   548  C CB  . ALA A 1 73  ? 8.447   -12.684 26.152 1.00 25.47 ? 75  ALA A CB  1 
ATOM   549  N N   . GLY A 1 74  ? 11.432  -11.684 25.560 1.00 25.41 ? 76  GLY A N   1 
ATOM   550  C CA  . GLY A 1 74  ? 12.842  -11.911 25.334 1.00 26.09 ? 76  GLY A CA  1 
ATOM   551  C C   . GLY A 1 74  ? 13.673  -11.255 26.421 1.00 26.14 ? 76  GLY A C   1 
ATOM   552  O O   . GLY A 1 74  ? 14.602  -11.844 26.952 1.00 24.20 ? 76  GLY A O   1 
ATOM   553  N N   . ILE A 1 75  ? 13.353  -9.998  26.717 1.00 26.95 ? 77  ILE A N   1 
ATOM   554  C CA  . ILE A 1 75  ? 14.049  -9.268  27.757 1.00 26.16 ? 77  ILE A CA  1 
ATOM   555  C C   . ILE A 1 75  ? 13.895  -9.956  29.125 1.00 26.63 ? 77  ILE A C   1 
ATOM   556  O O   . ILE A 1 75  ? 14.868  -10.124 29.857 1.00 25.55 ? 77  ILE A O   1 
ATOM   557  C CB  . ILE A 1 75  ? 13.523  -7.844  27.850 1.00 26.81 ? 77  ILE A CB  1 
ATOM   558  C CG1 . ILE A 1 75  ? 13.812  -7.073  26.527 1.00 26.99 ? 77  ILE A CG1 1 
ATOM   559  C CG2 . ILE A 1 75  ? 14.104  -7.177  29.148 1.00 26.20 ? 77  ILE A CG2 1 
ATOM   560  C CD1 . ILE A 1 75  ? 13.200  -5.612  26.508 1.00 25.77 ? 77  ILE A CD1 1 
ATOM   561  N N   . GLU A 1 76  ? 12.659  -10.351 29.457 1.00 26.15 ? 78  GLU A N   1 
ATOM   562  C CA  . GLU A 1 76  ? 12.374  -11.057 30.676 1.00 26.42 ? 78  GLU A CA  1 
ATOM   563  C C   . GLU A 1 76  ? 13.133  -12.397 30.797 1.00 27.37 ? 78  GLU A C   1 
ATOM   564  O O   . GLU A 1 76  ? 13.718  -12.695 31.878 1.00 26.81 ? 78  GLU A O   1 
ATOM   565  C CB  . GLU A 1 76  ? 10.842  -11.218 30.880 1.00 26.62 ? 78  GLU A CB  1 
ATOM   566  C CG  . GLU A 1 76  ? 10.482  -11.917 32.235 1.00 26.68 ? 78  GLU A CG  1 
ATOM   567  C CD  . GLU A 1 76  ? 9.036   -11.712 32.645 1.00 30.91 ? 78  GLU A CD  1 
ATOM   568  O OE1 . GLU A 1 76  ? 8.566   -12.424 33.547 1.00 34.56 ? 78  GLU A OE1 1 
ATOM   569  O OE2 . GLU A 1 76  ? 8.363   -10.821 32.090 1.00 33.85 ? 78  GLU A OE2 1 
ATOM   570  N N   . ALA A 1 77  ? 13.179  -13.176 29.711 1.00 27.56 ? 79  ALA A N   1 
ATOM   571  C CA  . ALA A 1 77  ? 13.881  -14.472 29.753 1.00 27.47 ? 79  ALA A CA  1 
ATOM   572  C C   . ALA A 1 77  ? 15.376  -14.249 30.056 1.00 27.50 ? 79  ALA A C   1 
ATOM   573  O O   . ALA A 1 77  ? 15.946  -14.949 30.894 1.00 26.56 ? 79  ALA A O   1 
ATOM   574  C CB  . ALA A 1 77  ? 13.693  -15.272 28.466 1.00 28.12 ? 79  ALA A CB  1 
ATOM   575  N N   . VAL A 1 78  ? 16.009  -13.268 29.394 1.00 26.86 ? 80  VAL A N   1 
ATOM   576  C CA  . VAL A 1 78  ? 17.401  -12.988 29.704 1.00 25.51 ? 80  VAL A CA  1 
ATOM   577  C C   . VAL A 1 78  ? 17.491  -12.569 31.185 1.00 26.24 ? 80  VAL A C   1 
ATOM   578  O O   . VAL A 1 78  ? 18.239  -13.184 31.944 1.00 26.19 ? 80  VAL A O   1 
ATOM   579  C CB  . VAL A 1 78  ? 18.041  -11.955 28.771 1.00 25.58 ? 80  VAL A CB  1 
ATOM   580  C CG1 . VAL A 1 78  ? 19.462  -11.585 29.283 1.00 25.85 ? 80  VAL A CG1 1 
ATOM   581  C CG2 . VAL A 1 78  ? 18.126  -12.485 27.303 1.00 22.31 ? 80  VAL A CG2 1 
ATOM   582  N N   . LEU A 1 79  ? 16.717  -11.571 31.624 1.00 26.06 ? 81  LEU A N   1 
ATOM   583  C CA  . LEU A 1 79  ? 16.890  -11.093 33.010 1.00 25.45 ? 81  LEU A CA  1 
ATOM   584  C C   . LEU A 1 79  ? 16.530  -12.168 34.063 1.00 26.65 ? 81  LEU A C   1 
ATOM   585  O O   . LEU A 1 79  ? 17.214  -12.287 35.085 1.00 27.49 ? 81  LEU A O   1 
ATOM   586  C CB  . LEU A 1 79  ? 16.098  -9.822  33.236 1.00 25.36 ? 81  LEU A CB  1 
ATOM   587  C CG  . LEU A 1 79  ? 16.629  -8.601  32.473 1.00 25.80 ? 81  LEU A CG  1 
ATOM   588  C CD1 . LEU A 1 79  ? 15.632  -7.519  32.568 1.00 25.72 ? 81  LEU A CD1 1 
ATOM   589  C CD2 . LEU A 1 79  ? 17.990  -8.192  33.089 1.00 26.84 ? 81  LEU A CD2 1 
ATOM   590  N N   . ALA A 1 80  ? 15.478  -12.927 33.821 1.00 26.32 ? 82  ALA A N   1 
ATOM   591  C CA  . ALA A 1 80  ? 15.110  -14.070 34.669 1.00 27.85 ? 82  ALA A CA  1 
ATOM   592  C C   . ALA A 1 80  ? 16.273  -15.060 34.829 1.00 28.17 ? 82  ALA A C   1 
ATOM   593  O O   . ALA A 1 80  ? 16.499  -15.600 35.910 1.00 27.95 ? 82  ALA A O   1 
ATOM   594  C CB  . ALA A 1 80  ? 13.871  -14.809 34.095 1.00 27.43 ? 82  ALA A CB  1 
ATOM   595  N N   . SER A 1 81  ? 17.008  -15.291 33.759 1.00 27.44 ? 83  SER A N   1 
ATOM   596  C CA  . SER A 1 81  ? 17.960  -16.393 33.778 1.00 28.04 ? 83  SER A CA  1 
ATOM   597  C C   . SER A 1 81  ? 19.255  -15.975 34.498 1.00 28.05 ? 83  SER A C   1 
ATOM   598  O O   . SER A 1 81  ? 19.978  -16.801 34.977 1.00 27.78 ? 83  SER A O   1 
ATOM   599  C CB  . SER A 1 81  ? 18.223  -16.876 32.353 1.00 28.78 ? 83  SER A CB  1 
ATOM   600  O OG  . SER A 1 81  ? 18.987  -15.884 31.652 1.00 36.08 ? 83  SER A OG  1 
ATOM   601  N N   . VAL A 1 82  ? 19.463  -14.673 34.647 1.00 26.86 ? 84  VAL A N   1 
ATOM   602  C CA  . VAL A 1 82  ? 20.705  -14.129 35.159 1.00 28.83 ? 84  VAL A CA  1 
ATOM   603  C C   . VAL A 1 82  ? 20.562  -13.451 36.561 1.00 28.77 ? 84  VAL A C   1 
ATOM   604  O O   . VAL A 1 82  ? 21.547  -13.079 37.167 1.00 29.02 ? 84  VAL A O   1 
ATOM   605  C CB  . VAL A 1 82  ? 21.253  -13.239 34.017 1.00 29.68 ? 84  VAL A CB  1 
ATOM   606  C CG1 . VAL A 1 82  ? 21.298  -11.822 34.325 1.00 29.90 ? 84  VAL A CG1 1 
ATOM   607  C CG2 . VAL A 1 82  ? 22.425  -13.915 33.276 1.00 28.52 ? 84  VAL A CG2 1 
ATOM   608  N N   . ILE A 1 83  ? 19.331  -13.385 37.098 1.00 27.77 ? 85  ILE A N   1 
ATOM   609  C CA  . ILE A 1 83  ? 19.035  -12.724 38.358 1.00 26.88 ? 85  ILE A CA  1 
ATOM   610  C C   . ILE A 1 83  ? 18.593  -13.683 39.402 1.00 27.71 ? 85  ILE A C   1 
ATOM   611  O O   . ILE A 1 83  ? 17.612  -14.391 39.197 1.00 27.35 ? 85  ILE A O   1 
ATOM   612  C CB  . ILE A 1 83  ? 17.960  -11.645 38.223 1.00 25.72 ? 85  ILE A CB  1 
ATOM   613  C CG1 . ILE A 1 83  ? 18.549  -10.463 37.440 1.00 25.05 ? 85  ILE A CG1 1 
ATOM   614  C CG2 . ILE A 1 83  ? 17.528  -11.150 39.641 1.00 24.75 ? 85  ILE A CG2 1 
ATOM   615  C CD1 . ILE A 1 83  ? 17.547  -9.401  37.077 1.00 23.19 ? 85  ILE A CD1 1 
ATOM   616  N N   . GLU A 1 84  ? 19.330  -13.730 40.507 1.00 28.22 ? 86  GLU A N   1 
ATOM   617  C CA  . GLU A 1 84  ? 18.875  -14.435 41.719 1.00 30.73 ? 86  GLU A CA  1 
ATOM   618  C C   . GLU A 1 84  ? 18.459  -13.370 42.751 1.00 30.65 ? 86  GLU A C   1 
ATOM   619  O O   . GLU A 1 84  ? 19.007  -12.271 42.747 1.00 29.93 ? 86  GLU A O   1 
ATOM   620  C CB  . GLU A 1 84  ? 20.015  -15.295 42.298 1.00 31.42 ? 86  GLU A CB  1 
ATOM   621  C CG  . GLU A 1 84  ? 20.191  -16.694 41.640 1.00 35.96 ? 86  GLU A CG  1 
ATOM   622  C CD  . GLU A 1 84  ? 21.654  -17.208 41.781 1.00 42.91 ? 86  GLU A CD  1 
ATOM   623  O OE1 . GLU A 1 84  ? 22.365  -16.690 42.662 1.00 43.09 ? 86  GLU A OE1 1 
ATOM   624  O OE2 . GLU A 1 84  ? 22.099  -18.096 40.992 1.00 44.82 ? 86  GLU A OE2 1 
ATOM   625  N N   . PRO A 1 85  ? 17.493  -13.689 43.638 1.00 30.42 ? 87  PRO A N   1 
ATOM   626  C CA  . PRO A 1 85  ? 17.105  -12.681 44.622 1.00 30.69 ? 87  PRO A CA  1 
ATOM   627  C C   . PRO A 1 85  ? 18.336  -12.051 45.255 1.00 30.35 ? 87  PRO A C   1 
ATOM   628  O O   . PRO A 1 85  ? 19.326  -12.754 45.469 1.00 29.07 ? 87  PRO A O   1 
ATOM   629  C CB  . PRO A 1 85  ? 16.321  -13.515 45.686 1.00 29.89 ? 87  PRO A CB  1 
ATOM   630  C CG  . PRO A 1 85  ? 15.641  -14.548 44.810 1.00 32.48 ? 87  PRO A CG  1 
ATOM   631  C CD  . PRO A 1 85  ? 16.764  -14.951 43.843 1.00 30.62 ? 87  PRO A CD  1 
ATOM   632  N N   . GLU A 1 86  ? 18.264  -10.743 45.523 1.00 30.86 ? 88  GLU A N   1 
ATOM   633  C CA  . GLU A 1 86  ? 19.357  -9.930  46.120 1.00 32.11 ? 88  GLU A CA  1 
ATOM   634  C C   . GLU A 1 86  ? 20.577  -9.592  45.223 1.00 31.37 ? 88  GLU A C   1 
ATOM   635  O O   . GLU A 1 86  ? 21.400  -8.754  45.607 1.00 31.23 ? 88  GLU A O   1 
ATOM   636  C CB  . GLU A 1 86  ? 19.765  -10.408 47.546 1.00 33.04 ? 88  GLU A CB  1 
ATOM   637  C CG  . GLU A 1 86  ? 18.538  -10.526 48.516 1.00 38.11 ? 88  GLU A CG  1 
ATOM   638  C CD  . GLU A 1 86  ? 18.862  -11.161 49.861 1.00 45.42 ? 88  GLU A CD  1 
ATOM   639  O OE1 . GLU A 1 86  ? 20.067  -11.255 50.196 1.00 49.22 ? 88  GLU A OE1 1 
ATOM   640  O OE2 . GLU A 1 86  ? 17.911  -11.550 50.609 1.00 48.36 ? 88  GLU A OE2 1 
ATOM   641  N N   . ASP A 1 87  ? 20.684  -10.156 44.018 1.00 30.49 ? 89  ASP A N   1 
ATOM   642  C CA  . ASP A 1 87  ? 21.655  -9.568  43.069 1.00 30.36 ? 89  ASP A CA  1 
ATOM   643  C C   . ASP A 1 87  ? 21.444  -8.045  42.892 1.00 28.90 ? 89  ASP A C   1 
ATOM   644  O O   . ASP A 1 87  ? 20.321  -7.550  42.794 1.00 29.22 ? 89  ASP A O   1 
ATOM   645  C CB  . ASP A 1 87  ? 21.626  -10.257 41.699 1.00 30.29 ? 89  ASP A CB  1 
ATOM   646  C CG  . ASP A 1 87  ? 22.091  -11.706 41.766 1.00 32.32 ? 89  ASP A CG  1 
ATOM   647  O OD1 . ASP A 1 87  ? 22.836  -12.073 42.718 1.00 29.50 ? 89  ASP A OD1 1 
ATOM   648  O OD2 . ASP A 1 87  ? 21.707  -12.475 40.859 1.00 28.75 ? 89  ASP A OD2 1 
ATOM   649  N N   . ASP A 1 88  ? 22.539  -7.304  42.870 1.00 28.14 ? 90  ASP A N   1 
ATOM   650  C CA  . ASP A 1 88  ? 22.488  -5.875  42.575 1.00 27.19 ? 90  ASP A CA  1 
ATOM   651  C C   . ASP A 1 88  ? 22.401  -5.655  41.054 1.00 26.82 ? 90  ASP A C   1 
ATOM   652  O O   . ASP A 1 88  ? 23.159  -6.262  40.303 1.00 26.63 ? 90  ASP A O   1 
ATOM   653  C CB  . ASP A 1 88  ? 23.742  -5.222  43.101 1.00 26.89 ? 90  ASP A CB  1 
ATOM   654  C CG  . ASP A 1 88  ? 23.762  -5.113  44.623 1.00 28.66 ? 90  ASP A CG  1 
ATOM   655  O OD1 . ASP A 1 88  ? 22.767  -4.665  45.214 1.00 28.42 ? 90  ASP A OD1 1 
ATOM   656  O OD2 . ASP A 1 88  ? 24.819  -5.410  45.210 1.00 31.49 ? 90  ASP A OD2 1 
ATOM   657  N N   . VAL A 1 89  ? 21.485  -4.784  40.626 1.00 25.72 ? 91  VAL A N   1 
ATOM   658  C CA  . VAL A 1 89  ? 21.248  -4.509  39.222 1.00 24.55 ? 91  VAL A CA  1 
ATOM   659  C C   . VAL A 1 89  ? 21.129  -2.997  39.050 1.00 24.49 ? 91  VAL A C   1 
ATOM   660  O O   . VAL A 1 89  ? 20.252  -2.356  39.626 1.00 23.51 ? 91  VAL A O   1 
ATOM   661  C CB  . VAL A 1 89  ? 19.942  -5.225  38.715 1.00 26.85 ? 91  VAL A CB  1 
ATOM   662  C CG1 . VAL A 1 89  ? 19.627  -4.849  37.232 1.00 25.89 ? 91  VAL A CG1 1 
ATOM   663  C CG2 . VAL A 1 89  ? 19.992  -6.803  38.921 1.00 21.99 ? 91  VAL A CG2 1 
ATOM   664  N N   . LEU A 1 90  ? 22.022  -2.445  38.236 1.00 23.73 ? 92  LEU A N   1 
ATOM   665  C CA  . LEU A 1 90  ? 22.072  -1.016  37.978 1.00 23.08 ? 92  LEU A CA  1 
ATOM   666  C C   . LEU A 1 90  ? 21.293  -0.758  36.672 1.00 21.24 ? 92  LEU A C   1 
ATOM   667  O O   . LEU A 1 90  ? 21.617  -1.315  35.647 1.00 20.13 ? 92  LEU A O   1 
ATOM   668  C CB  . LEU A 1 90  ? 23.506  -0.578  37.714 1.00 21.15 ? 92  LEU A CB  1 
ATOM   669  C CG  . LEU A 1 90  ? 23.980  0.844   38.061 1.00 24.11 ? 92  LEU A CG  1 
ATOM   670  C CD1 . LEU A 1 90  ? 25.015  1.375   37.066 1.00 22.05 ? 92  LEU A CD1 1 
ATOM   671  C CD2 . LEU A 1 90  ? 22.975  1.925   38.520 1.00 22.74 ? 92  LEU A CD2 1 
ATOM   672  N N   . ILE A 1 91  ? 20.336  0.140   36.710 1.00 20.61 ? 93  ILE A N   1 
ATOM   673  C CA  . ILE A 1 91  ? 19.560  0.422   35.518 1.00 21.32 ? 93  ILE A CA  1 
ATOM   674  C C   . ILE A 1 91  ? 19.532  1.934   35.323 1.00 21.90 ? 93  ILE A C   1 
ATOM   675  O O   . ILE A 1 91  ? 18.831  2.634   36.040 1.00 20.07 ? 93  ILE A O   1 
ATOM   676  C CB  . ILE A 1 91  ? 18.135  -0.127  35.643 1.00 22.81 ? 93  ILE A CB  1 
ATOM   677  C CG1 . ILE A 1 91  ? 18.186  -1.590  36.130 1.00 25.94 ? 93  ILE A CG1 1 
ATOM   678  C CG2 . ILE A 1 91  ? 17.384  -0.009  34.272 1.00 19.71 ? 93  ILE A CG2 1 
ATOM   679  C CD1 . ILE A 1 91  ? 16.816  -2.278  36.353 1.00 30.01 ? 93  ILE A CD1 1 
ATOM   680  N N   . PRO A 1 92  ? 20.280  2.431   34.348 1.00 22.09 ? 94  PRO A N   1 
ATOM   681  C CA  . PRO A 1 92  ? 20.161  3.858   34.075 1.00 23.94 ? 94  PRO A CA  1 
ATOM   682  C C   . PRO A 1 92  ? 18.965  4.048   33.152 1.00 25.28 ? 94  PRO A C   1 
ATOM   683  O O   . PRO A 1 92  ? 18.957  3.517   32.067 1.00 26.46 ? 94  PRO A O   1 
ATOM   684  C CB  . PRO A 1 92  ? 21.490  4.223   33.350 1.00 22.22 ? 94  PRO A CB  1 
ATOM   685  C CG  . PRO A 1 92  ? 22.356  2.997   33.384 1.00 23.94 ? 94  PRO A CG  1 
ATOM   686  C CD  . PRO A 1 92  ? 21.344  1.801   33.555 1.00 23.14 ? 94  PRO A CD  1 
ATOM   687  N N   . ILE A 1 93  ? 18.008  4.861   33.582 1.00 26.13 ? 95  ILE A N   1 
ATOM   688  C CA  . ILE A 1 93  ? 16.727  5.051   32.934 1.00 26.05 ? 95  ILE A CA  1 
ATOM   689  C C   . ILE A 1 93  ? 16.572  6.442   32.332 1.00 25.91 ? 95  ILE A C   1 
ATOM   690  O O   . ILE A 1 93  ? 16.696  7.450   33.027 1.00 24.10 ? 95  ILE A O   1 
ATOM   691  C CB  . ILE A 1 93  ? 15.647  4.841   33.968 1.00 26.49 ? 95  ILE A CB  1 
ATOM   692  C CG1 . ILE A 1 93  ? 15.638  3.360   34.414 1.00 24.51 ? 95  ILE A CG1 1 
ATOM   693  C CG2 . ILE A 1 93  ? 14.232  5.234   33.413 1.00 25.19 ? 95  ILE A CG2 1 
ATOM   694  C CD1 . ILE A 1 93  ? 14.967  3.239   35.818 1.00 23.39 ? 95  ILE A CD1 1 
ATOM   695  N N   . TYR A 1 94  ? 16.340  6.511   31.022 1.00 25.90 ? 96  TYR A N   1 
ATOM   696  C CA  . TYR A 1 94  ? 16.146  7.840   30.398 1.00 27.09 ? 96  TYR A CA  1 
ATOM   697  C C   . TYR A 1 94  ? 14.836  7.878   29.579 1.00 27.60 ? 96  TYR A C   1 
ATOM   698  O O   . TYR A 1 94  ? 14.544  8.841   28.845 1.00 27.09 ? 96  TYR A O   1 
ATOM   699  C CB  . TYR A 1 94  ? 17.376  8.239   29.572 1.00 25.78 ? 96  TYR A CB  1 
ATOM   700  C CG  . TYR A 1 94  ? 17.738  7.262   28.476 1.00 28.16 ? 96  TYR A CG  1 
ATOM   701  C CD1 . TYR A 1 94  ? 18.445  6.074   28.754 1.00 27.59 ? 96  TYR A CD1 1 
ATOM   702  C CD2 . TYR A 1 94  ? 17.321  7.492   27.166 1.00 25.77 ? 96  TYR A CD2 1 
ATOM   703  C CE1 . TYR A 1 94  ? 18.739  5.206   27.745 1.00 26.78 ? 96  TYR A CE1 1 
ATOM   704  C CE2 . TYR A 1 94  ? 17.610  6.636   26.157 1.00 26.71 ? 96  TYR A CE2 1 
ATOM   705  C CZ  . TYR A 1 94  ? 18.321  5.512   26.426 1.00 26.11 ? 96  TYR A CZ  1 
ATOM   706  O OH  . TYR A 1 94  ? 18.536  4.673   25.376 1.00 24.78 ? 96  TYR A OH  1 
ATOM   707  N N   . GLY A 1 95  ? 14.036  6.823   29.726 1.00 27.23 ? 97  GLY A N   1 
ATOM   708  C CA  . GLY A 1 95  ? 12.705  6.825   29.132 1.00 28.27 ? 97  GLY A CA  1 
ATOM   709  C C   . GLY A 1 95  ? 11.852  5.681   29.614 1.00 27.69 ? 97  GLY A C   1 
ATOM   710  O O   . GLY A 1 95  ? 12.206  5.014   30.575 1.00 27.80 ? 97  GLY A O   1 
ATOM   711  N N   . ARG A 1 96  ? 10.717  5.467   28.947 1.00 28.17 ? 98  ARG A N   1 
ATOM   712  C CA  . ARG A 1 96  ? 9.715   4.540   29.447 1.00 28.13 ? 98  ARG A CA  1 
ATOM   713  C C   . ARG A 1 96  ? 10.207  3.111   29.541 1.00 27.24 ? 98  ARG A C   1 
ATOM   714  O O   . ARG A 1 96  ? 9.855   2.409   30.466 1.00 26.71 ? 98  ARG A O   1 
ATOM   715  C CB  . ARG A 1 96  ? 8.416   4.595   28.610 1.00 29.19 ? 98  ARG A CB  1 
ATOM   716  C CG  . ARG A 1 96  ? 7.568   3.284   28.689 1.00 30.91 ? 98  ARG A CG  1 
ATOM   717  C CD  . ARG A 1 96  ? 6.782   3.008   27.353 1.00 42.99 ? 98  ARG A CD  1 
ATOM   718  N NE  . ARG A 1 96  ? 6.095   4.232   26.805 1.00 46.31 ? 98  ARG A NE  1 
ATOM   719  C CZ  . ARG A 1 96  ? 6.020   4.605   25.507 1.00 46.03 ? 98  ARG A CZ  1 
ATOM   720  N NH1 . ARG A 1 96  ? 6.572   3.885   24.517 1.00 44.96 ? 98  ARG A NH1 1 
ATOM   721  N NH2 . ARG A 1 96  ? 5.402   5.739   25.199 1.00 43.64 ? 98  ARG A NH2 1 
ATOM   722  N N   . PHE A 1 97  ? 10.997  2.656   28.582 1.00 27.77 ? 99  PHE A N   1 
ATOM   723  C CA  . PHE A 1 97  ? 11.414  1.244   28.592 1.00 27.91 ? 99  PHE A CA  1 
ATOM   724  C C   . PHE A 1 97  ? 12.480  0.934   29.677 1.00 26.82 ? 99  PHE A C   1 
ATOM   725  O O   . PHE A 1 97  ? 12.595  -0.208  30.125 1.00 27.33 ? 99  PHE A O   1 
ATOM   726  C CB  . PHE A 1 97  ? 11.721  0.754   27.139 1.00 29.56 ? 99  PHE A CB  1 
ATOM   727  C CG  . PHE A 1 97  ? 10.507  0.876   26.209 1.00 33.17 ? 99  PHE A CG  1 
ATOM   728  C CD1 . PHE A 1 97  ? 9.537   -0.141  26.168 1.00 38.03 ? 99  PHE A CD1 1 
ATOM   729  C CD2 . PHE A 1 97  ? 10.274  2.058   25.460 1.00 37.41 ? 99  PHE A CD2 1 
ATOM   730  C CE1 . PHE A 1 97  ? 8.378   -0.029  25.382 1.00 36.69 ? 99  PHE A CE1 1 
ATOM   731  C CE2 . PHE A 1 97  ? 9.109   2.181   24.650 1.00 38.52 ? 99  PHE A CE2 1 
ATOM   732  C CZ  . PHE A 1 97  ? 8.162   1.123   24.625 1.00 40.01 ? 99  PHE A CZ  1 
ATOM   733  N N   . GLY A 1 98  ? 13.225  1.940   30.134 1.00 26.25 ? 100 GLY A N   1 
ATOM   734  C CA  . GLY A 1 98  ? 14.052  1.788   31.364 1.00 26.01 ? 100 GLY A CA  1 
ATOM   735  C C   . GLY A 1 98  ? 13.249  1.283   32.583 1.00 25.68 ? 100 GLY A C   1 
ATOM   736  O O   . GLY A 1 98  ? 13.722  0.449   33.336 1.00 25.14 ? 100 GLY A O   1 
ATOM   737  N N   . TYR A 1 99  ? 12.040  1.794   32.773 1.00 26.40 ? 101 TYR A N   1 
ATOM   738  C CA  . TYR A 1 99  ? 11.130  1.326   33.837 1.00 27.12 ? 101 TYR A CA  1 
ATOM   739  C C   . TYR A 1 99  ? 10.591  -0.088  33.650 1.00 27.35 ? 101 TYR A C   1 
ATOM   740  O O   . TYR A 1 99  ? 10.309  -0.773  34.636 1.00 26.27 ? 101 TYR A O   1 
ATOM   741  C CB  . TYR A 1 99  ? 9.968   2.293   33.987 1.00 28.55 ? 101 TYR A CB  1 
ATOM   742  C CG  . TYR A 1 99  ? 10.477  3.648   34.446 1.00 31.93 ? 101 TYR A CG  1 
ATOM   743  C CD1 . TYR A 1 99  ? 11.083  3.791   35.689 1.00 29.63 ? 101 TYR A CD1 1 
ATOM   744  C CD2 . TYR A 1 99  ? 10.336  4.775   33.645 1.00 33.72 ? 101 TYR A CD2 1 
ATOM   745  C CE1 . TYR A 1 99  ? 11.565  5.023   36.121 1.00 35.53 ? 101 TYR A CE1 1 
ATOM   746  C CE2 . TYR A 1 99  ? 10.810  6.014   34.078 1.00 36.92 ? 101 TYR A CE2 1 
ATOM   747  C CZ  . TYR A 1 99  ? 11.435  6.129   35.311 1.00 34.43 ? 101 TYR A CZ  1 
ATOM   748  O OH  . TYR A 1 99  ? 11.921  7.357   35.737 1.00 37.93 ? 101 TYR A OH  1 
ATOM   749  N N   . LEU A 1 100 ? 10.453  -0.546  32.409 1.00 25.36 ? 102 LEU A N   1 
ATOM   750  C CA  . LEU A 1 100 ? 10.135  -1.942  32.253 1.00 26.11 ? 102 LEU A CA  1 
ATOM   751  C C   . LEU A 1 100 ? 11.293  -2.835  32.726 1.00 25.80 ? 102 LEU A C   1 
ATOM   752  O O   . LEU A 1 100 ? 11.079  -3.868  33.334 1.00 25.02 ? 102 LEU A O   1 
ATOM   753  C CB  . LEU A 1 100 ? 9.860   -2.236  30.770 1.00 27.28 ? 102 LEU A CB  1 
ATOM   754  C CG  . LEU A 1 100 ? 9.539   -3.616  30.236 1.00 29.73 ? 102 LEU A CG  1 
ATOM   755  C CD1 . LEU A 1 100 ? 8.231   -4.165  30.820 1.00 32.86 ? 102 LEU A CD1 1 
ATOM   756  C CD2 . LEU A 1 100 ? 9.498   -3.501  28.621 1.00 32.89 ? 102 LEU A CD2 1 
ATOM   757  N N   . LEU A 1 101 ? 12.531  -2.449  32.423 1.00 25.51 ? 103 LEU A N   1 
ATOM   758  C CA  . LEU A 1 101 ? 13.653  -3.230  32.906 1.00 26.56 ? 103 LEU A CA  1 
ATOM   759  C C   . LEU A 1 101 ? 13.618  -3.293  34.439 1.00 26.75 ? 103 LEU A C   1 
ATOM   760  O O   . LEU A 1 101 ? 13.917  -4.340  34.999 1.00 25.83 ? 103 LEU A O   1 
ATOM   761  C CB  . LEU A 1 101 ? 14.990  -2.593  32.485 1.00 27.25 ? 103 LEU A CB  1 
ATOM   762  C CG  . LEU A 1 101 ? 15.318  -2.541  30.995 1.00 27.62 ? 103 LEU A CG  1 
ATOM   763  C CD1 . LEU A 1 101 ? 16.727  -1.939  30.887 1.00 22.32 ? 103 LEU A CD1 1 
ATOM   764  C CD2 . LEU A 1 101 ? 15.208  -3.919  30.308 1.00 25.59 ? 103 LEU A CD2 1 
ATOM   765  N N   . THR A 1 102 ? 13.278  -2.175  35.115 1.00 27.77 ? 104 THR A N   1 
ATOM   766  C CA  . THR A 1 102 ? 13.324  -2.192  36.572 1.00 29.28 ? 104 THR A CA  1 
ATOM   767  C C   . THR A 1 102 ? 12.195  -3.074  37.138 1.00 29.07 ? 104 THR A C   1 
ATOM   768  O O   . THR A 1 102 ? 12.385  -3.832  38.104 1.00 29.31 ? 104 THR A O   1 
ATOM   769  C CB  . THR A 1 102 ? 13.375  -0.774  37.257 1.00 30.70 ? 104 THR A CB  1 
ATOM   770  O OG1 . THR A 1 102 ? 12.088  -0.155  37.250 1.00 35.85 ? 104 THR A OG1 1 
ATOM   771  C CG2 . THR A 1 102 ? 14.377  0.150   36.615 1.00 28.32 ? 104 THR A CG2 1 
ATOM   772  N N   . GLU A 1 103 ? 11.029  -2.985  36.521 1.00 27.98 ? 105 GLU A N   1 
ATOM   773  C CA  . GLU A 1 103 ? 9.907   -3.877  36.852 1.00 29.74 ? 105 GLU A CA  1 
ATOM   774  C C   . GLU A 1 103 ? 10.270  -5.361  36.842 1.00 28.65 ? 105 GLU A C   1 
ATOM   775  O O   . GLU A 1 103 ? 10.034  -6.082  37.808 1.00 28.41 ? 105 GLU A O   1 
ATOM   776  C CB  . GLU A 1 103 ? 8.826   -3.653  35.814 1.00 30.50 ? 105 GLU A CB  1 
ATOM   777  C CG  . GLU A 1 103 ? 7.890   -2.601  36.142 1.00 35.63 ? 105 GLU A CG  1 
ATOM   778  C CD  . GLU A 1 103 ? 6.867   -3.161  37.039 1.00 43.47 ? 105 GLU A CD  1 
ATOM   779  O OE1 . GLU A 1 103 ? 6.640   -4.382  36.851 1.00 47.93 ? 105 GLU A OE1 1 
ATOM   780  O OE2 . GLU A 1 103 ? 6.336   -2.433  37.919 1.00 42.90 ? 105 GLU A OE2 1 
ATOM   781  N N   . ILE A 1 104 ? 10.815  -5.800  35.715 1.00 28.50 ? 106 ILE A N   1 
ATOM   782  C CA  . ILE A 1 104 ? 11.236  -7.177  35.516 1.00 28.14 ? 106 ILE A CA  1 
ATOM   783  C C   . ILE A 1 104 ? 12.290  -7.588  36.553 1.00 28.61 ? 106 ILE A C   1 
ATOM   784  O O   . ILE A 1 104 ? 12.150  -8.625  37.228 1.00 27.88 ? 106 ILE A O   1 
ATOM   785  C CB  . ILE A 1 104 ? 11.756  -7.375  34.056 1.00 27.23 ? 106 ILE A CB  1 
ATOM   786  C CG1 . ILE A 1 104 ? 10.586  -7.338  33.059 1.00 26.14 ? 106 ILE A CG1 1 
ATOM   787  C CG2 . ILE A 1 104 ? 12.429  -8.697  33.944 1.00 27.55 ? 106 ILE A CG2 1 
ATOM   788  C CD1 . ILE A 1 104 ? 10.958  -6.919  31.651 1.00 26.91 ? 106 ILE A CD1 1 
ATOM   789  N N   . ALA A 1 105 ? 13.359  -6.787  36.688 1.00 29.28 ? 107 ALA A N   1 
ATOM   790  C CA  . ALA A 1 105 ? 14.405  -7.110  37.637 1.00 29.25 ? 107 ALA A CA  1 
ATOM   791  C C   . ALA A 1 105 ? 13.869  -7.223  39.064 1.00 29.67 ? 107 ALA A C   1 
ATOM   792  O O   . ALA A 1 105 ? 14.256  -8.139  39.813 1.00 28.36 ? 107 ALA A O   1 
ATOM   793  C CB  . ALA A 1 105 ? 15.583  -6.062  37.573 1.00 29.04 ? 107 ALA A CB  1 
ATOM   794  N N   . GLU A 1 106 ? 12.999  -6.295  39.457 1.00 30.29 ? 108 GLU A N   1 
ATOM   795  C CA  . GLU A 1 106 ? 12.471  -6.298  40.855 1.00 31.25 ? 108 GLU A CA  1 
ATOM   796  C C   . GLU A 1 106 ? 11.634  -7.521  41.116 1.00 30.93 ? 108 GLU A C   1 
ATOM   797  O O   . GLU A 1 106 ? 11.782  -8.181  42.137 1.00 30.40 ? 108 GLU A O   1 
ATOM   798  C CB  . GLU A 1 106 ? 11.627  -5.064  41.138 1.00 30.76 ? 108 GLU A CB  1 
ATOM   799  C CG  . GLU A 1 106 ? 12.292  -4.197  42.148 1.00 36.84 ? 108 GLU A CG  1 
ATOM   800  C CD  . GLU A 1 106 ? 11.925  -2.738  42.031 1.00 43.34 ? 108 GLU A CD  1 
ATOM   801  O OE1 . GLU A 1 106 ? 10.869  -2.425  41.412 1.00 40.17 ? 108 GLU A OE1 1 
ATOM   802  O OE2 . GLU A 1 106 ? 12.720  -1.918  42.579 1.00 45.76 ? 108 GLU A OE2 1 
ATOM   803  N N   . ARG A 1 107 ? 10.769  -7.817  40.145 1.00 31.09 ? 109 ARG A N   1 
ATOM   804  C CA  . ARG A 1 107 ? 9.944   -8.996  40.175 1.00 31.37 ? 109 ARG A CA  1 
ATOM   805  C C   . ARG A 1 107 ? 10.770  -10.277 40.321 1.00 29.93 ? 109 ARG A C   1 
ATOM   806  O O   . ARG A 1 107 ? 10.312  -11.208 40.969 1.00 29.37 ? 109 ARG A O   1 
ATOM   807  C CB  . ARG A 1 107 ? 8.974   -9.030  38.968 1.00 32.49 ? 109 ARG A CB  1 
ATOM   808  C CG  . ARG A 1 107 ? 7.917   -7.865  39.027 1.00 35.35 ? 109 ARG A CG  1 
ATOM   809  C CD  . ARG A 1 107 ? 6.594   -8.249  38.318 1.00 38.05 ? 109 ARG A CD  1 
ATOM   810  N NE  . ARG A 1 107 ? 5.689   -7.109  38.068 1.00 40.07 ? 109 ARG A NE  1 
ATOM   811  C CZ  . ARG A 1 107 ? 4.400   -7.200  37.679 1.00 40.97 ? 109 ARG A CZ  1 
ATOM   812  N NH1 . ARG A 1 107 ? 3.777   -8.378  37.531 1.00 39.20 ? 109 ARG A NH1 1 
ATOM   813  N NH2 . ARG A 1 107 ? 3.704   -6.092  37.467 1.00 40.57 ? 109 ARG A NH2 1 
ATOM   814  N N   . TYR A 1 108 ? 11.986  -10.319 39.774 1.00 27.95 ? 110 TYR A N   1 
ATOM   815  C CA  . TYR A 1 108 ? 12.852  -11.504 40.009 1.00 26.77 ? 110 TYR A CA  1 
ATOM   816  C C   . TYR A 1 108 ? 13.699  -11.433 41.293 1.00 25.39 ? 110 TYR A C   1 
ATOM   817  O O   . TYR A 1 108 ? 14.573  -12.258 41.531 1.00 24.36 ? 110 TYR A O   1 
ATOM   818  C CB  . TYR A 1 108 ? 13.659  -11.902 38.755 1.00 26.76 ? 110 TYR A CB  1 
ATOM   819  C CG  . TYR A 1 108 ? 12.727  -12.497 37.720 1.00 25.08 ? 110 TYR A CG  1 
ATOM   820  C CD1 . TYR A 1 108 ? 12.316  -13.843 37.826 1.00 27.83 ? 110 TYR A CD1 1 
ATOM   821  C CD2 . TYR A 1 108 ? 12.166  -11.709 36.712 1.00 26.53 ? 110 TYR A CD2 1 
ATOM   822  C CE1 . TYR A 1 108 ? 11.393  -14.396 36.948 1.00 22.70 ? 110 TYR A CE1 1 
ATOM   823  C CE2 . TYR A 1 108 ? 11.267  -12.252 35.805 1.00 27.48 ? 110 TYR A CE2 1 
ATOM   824  C CZ  . TYR A 1 108 ? 10.872  -13.637 35.958 1.00 24.07 ? 110 TYR A CZ  1 
ATOM   825  O OH  . TYR A 1 108 ? 10.004  -14.251 35.095 1.00 23.01 ? 110 TYR A OH  1 
ATOM   826  N N   . GLY A 1 109 ? 13.422  -10.445 42.129 1.00 25.85 ? 111 GLY A N   1 
ATOM   827  C CA  . GLY A 1 109 ? 14.082  -10.395 43.458 1.00 27.16 ? 111 GLY A CA  1 
ATOM   828  C C   . GLY A 1 109 ? 15.394  -9.593  43.517 1.00 27.88 ? 111 GLY A C   1 
ATOM   829  O O   . GLY A 1 109 ? 16.074  -9.583  44.547 1.00 27.10 ? 111 GLY A O   1 
ATOM   830  N N   . ALA A 1 110 ? 15.736  -8.917  42.425 1.00 26.80 ? 112 ALA A N   1 
ATOM   831  C CA  . ALA A 1 110 ? 16.931  -8.060  42.395 1.00 27.95 ? 112 ALA A CA  1 
ATOM   832  C C   . ALA A 1 110 ? 16.790  -6.860  43.313 1.00 28.46 ? 112 ALA A C   1 
ATOM   833  O O   . ALA A 1 110 ? 15.708  -6.314  43.449 1.00 29.34 ? 112 ALA A O   1 
ATOM   834  C CB  . ALA A 1 110 ? 17.203  -7.565  40.974 1.00 25.94 ? 112 ALA A CB  1 
ATOM   835  N N   . ASN A 1 111 ? 17.891  -6.449  43.934 1.00 29.00 ? 113 ASN A N   1 
ATOM   836  C CA  . ASN A 1 111 ? 17.983  -5.120  44.496 1.00 30.09 ? 113 ASN A CA  1 
ATOM   837  C C   . ASN A 1 111 ? 18.318  -4.150  43.340 1.00 30.11 ? 113 ASN A C   1 
ATOM   838  O O   . ASN A 1 111 ? 19.433  -4.131  42.856 1.00 29.68 ? 113 ASN A O   1 
ATOM   839  C CB  . ASN A 1 111 ? 19.052  -5.129  45.602 1.00 31.24 ? 113 ASN A CB  1 
ATOM   840  C CG  . ASN A 1 111 ? 19.270  -3.760  46.269 1.00 35.95 ? 113 ASN A CG  1 
ATOM   841  O OD1 . ASN A 1 111 ? 20.241  -3.598  47.024 1.00 41.35 ? 113 ASN A OD1 1 
ATOM   842  N ND2 . ASN A 1 111 ? 18.373  -2.785  46.030 1.00 40.59 ? 113 ASN A ND2 1 
ATOM   843  N N   . VAL A 1 112 ? 17.343  -3.356  42.908 1.00 29.84 ? 114 VAL A N   1 
ATOM   844  C CA  . VAL A 1 112 ? 17.531  -2.433  41.804 1.00 30.31 ? 114 VAL A CA  1 
ATOM   845  C C   . VAL A 1 112 ? 18.142  -1.087  42.244 1.00 30.59 ? 114 VAL A C   1 
ATOM   846  O O   . VAL A 1 112 ? 17.619  -0.427  43.162 1.00 31.69 ? 114 VAL A O   1 
ATOM   847  C CB  . VAL A 1 112 ? 16.192  -2.208  41.051 1.00 30.23 ? 114 VAL A CB  1 
ATOM   848  C CG1 . VAL A 1 112 ? 16.327  -1.160  39.978 1.00 31.26 ? 114 VAL A CG1 1 
ATOM   849  C CG2 . VAL A 1 112 ? 15.718  -3.485  40.427 1.00 29.69 ? 114 VAL A CG2 1 
ATOM   850  N N   . HIS A 1 113 ? 19.238  -0.682  41.598 1.00 29.98 ? 115 HIS A N   1 
ATOM   851  C CA  . HIS A 1 113 ? 19.780  0.696   41.743 1.00 30.01 ? 115 HIS A CA  1 
ATOM   852  C C   . HIS A 1 113 ? 19.429  1.449   40.453 1.00 30.58 ? 115 HIS A C   1 
ATOM   853  O O   . HIS A 1 113 ? 19.884  1.053   39.349 1.00 30.60 ? 115 HIS A O   1 
ATOM   854  C CB  . HIS A 1 113 ? 21.302  0.661   42.010 1.00 29.05 ? 115 HIS A CB  1 
ATOM   855  C CG  . HIS A 1 113 ? 21.699  -0.249  43.140 1.00 32.04 ? 115 HIS A CG  1 
ATOM   856  N ND1 . HIS A 1 113 ? 21.668  -1.633  43.043 1.00 36.16 ? 115 HIS A ND1 1 
ATOM   857  C CD2 . HIS A 1 113 ? 22.165  0.023   44.382 1.00 33.46 ? 115 HIS A CD2 1 
ATOM   858  C CE1 . HIS A 1 113 ? 22.094  -2.168  44.175 1.00 31.46 ? 115 HIS A CE1 1 
ATOM   859  N NE2 . HIS A 1 113 ? 22.394  -1.187  45.005 1.00 34.68 ? 115 HIS A NE2 1 
ATOM   860  N N   . MET A 1 114 ? 18.538  2.439   40.533 1.00 30.29 ? 116 MET A N   1 
ATOM   861  C CA  . MET A 1 114 ? 18.238  3.194   39.323 1.00 31.12 ? 116 MET A CA  1 
ATOM   862  C C   . MET A 1 114 ? 18.907  4.552   39.302 1.00 30.83 ? 116 MET A C   1 
ATOM   863  O O   . MET A 1 114 ? 19.116  5.162   40.356 1.00 30.82 ? 116 MET A O   1 
ATOM   864  C CB  . MET A 1 114 ? 16.743  3.259   38.993 1.00 32.53 ? 116 MET A CB  1 
ATOM   865  C CG  . MET A 1 114 ? 15.798  3.806   40.031 1.00 37.14 ? 116 MET A CG  1 
ATOM   866  S SD  . MET A 1 114 ? 14.093  3.342   39.551 1.00 45.28 ? 116 MET A SD  1 
ATOM   867  C CE  . MET A 1 114 ? 13.649  2.157   40.811 1.00 44.77 ? 116 MET A CE  1 
ATOM   868  N N   . LEU A 1 115 ? 19.347  4.970   38.128 1.00 28.63 ? 117 LEU A N   1 
ATOM   869  C CA  . LEU A 1 115 ? 19.686  6.352   37.893 1.00 29.00 ? 117 LEU A CA  1 
ATOM   870  C C   . LEU A 1 115 ? 18.597  6.862   36.954 1.00 29.63 ? 117 LEU A C   1 
ATOM   871  O O   . LEU A 1 115 ? 18.116  6.096   36.095 1.00 29.25 ? 117 LEU A O   1 
ATOM   872  C CB  . LEU A 1 115 ? 21.022  6.458   37.176 1.00 27.80 ? 117 LEU A CB  1 
ATOM   873  C CG  . LEU A 1 115 ? 22.341  6.208   37.875 1.00 31.53 ? 117 LEU A CG  1 
ATOM   874  C CD1 . LEU A 1 115 ? 23.416  5.891   36.802 1.00 33.04 ? 117 LEU A CD1 1 
ATOM   875  C CD2 . LEU A 1 115 ? 22.712  7.440   38.734 1.00 36.44 ? 117 LEU A CD2 1 
ATOM   876  N N   . GLU A 1 116 ? 18.212  8.124   37.064 1.00 29.55 ? 118 GLU A N   1 
ATOM   877  C CA  . GLU A 1 116 ? 17.184  8.642   36.158 1.00 30.15 ? 118 GLU A CA  1 
ATOM   878  C C   . GLU A 1 116 ? 17.570  10.026  35.673 1.00 30.90 ? 118 GLU A C   1 
ATOM   879  O O   . GLU A 1 116 ? 17.948  10.884  36.468 1.00 31.23 ? 118 GLU A O   1 
ATOM   880  C CB  . GLU A 1 116 ? 15.829  8.704   36.849 1.00 30.64 ? 118 GLU A CB  1 
ATOM   881  C CG  . GLU A 1 116 ? 15.236  7.335   37.332 1.00 29.25 ? 118 GLU A CG  1 
ATOM   882  C CD  . GLU A 1 116 ? 14.133  7.551   38.398 1.00 32.72 ? 118 GLU A CD  1 
ATOM   883  O OE1 . GLU A 1 116 ? 14.457  7.817   39.577 1.00 36.38 ? 118 GLU A OE1 1 
ATOM   884  O OE2 . GLU A 1 116 ? 12.937  7.497   38.085 1.00 29.21 ? 118 GLU A OE2 1 
ATOM   885  N N   . CYS A 1 117 ? 17.459  10.256  34.371 1.00 30.81 ? 119 CYS A N   1 
ATOM   886  C CA  . CYS A 1 117 ? 17.632  11.603  33.859 1.00 31.08 ? 119 CYS A CA  1 
ATOM   887  C C   . CYS A 1 117 ? 16.402  12.115  33.122 1.00 30.55 ? 119 CYS A C   1 
ATOM   888  O O   . CYS A 1 117 ? 15.457  11.355  32.871 1.00 28.89 ? 119 CYS A O   1 
ATOM   889  C CB  . CYS A 1 117 ? 18.894  11.753  32.975 1.00 31.92 ? 119 CYS A CB  1 
ATOM   890  S SG  . CYS A 1 117 ? 18.841  10.820  31.460 1.00 32.53 ? 119 CYS A SG  1 
ATOM   891  N N   . GLU A 1 118 ? 16.457  13.406  32.761 1.00 29.05 ? 120 GLU A N   1 
ATOM   892  C CA  . GLU A 1 118 ? 15.367  14.047  32.087 1.00 29.40 ? 120 GLU A CA  1 
ATOM   893  C C   . GLU A 1 118 ? 15.001  13.400  30.750 1.00 28.61 ? 120 GLU A C   1 
ATOM   894  O O   . GLU A 1 118 ? 15.849  13.213  29.890 1.00 26.07 ? 120 GLU A O   1 
ATOM   895  C CB  . GLU A 1 118 ? 15.668  15.536  31.838 1.00 30.04 ? 120 GLU A CB  1 
ATOM   896  C CG  . GLU A 1 118 ? 14.443  16.353  32.111 1.00 35.36 ? 120 GLU A CG  1 
ATOM   897  C CD  . GLU A 1 118 ? 14.375  17.695  31.416 1.00 41.75 ? 120 GLU A CD  1 
ATOM   898  O OE1 . GLU A 1 118 ? 13.878  18.636  32.080 1.00 44.68 ? 120 GLU A OE1 1 
ATOM   899  O OE2 . GLU A 1 118 ? 14.748  17.818  30.228 1.00 41.97 ? 120 GLU A OE2 1 
ATOM   900  N N   . TRP A 1 119 ? 13.704  13.171  30.561 1.00 28.58 ? 121 TRP A N   1 
ATOM   901  C CA  . TRP A 1 119 ? 13.216  12.640  29.310 1.00 29.72 ? 121 TRP A CA  1 
ATOM   902  C C   . TRP A 1 119 ? 13.517  13.641  28.205 1.00 28.87 ? 121 TRP A C   1 
ATOM   903  O O   . TRP A 1 119 ? 13.207  14.833  28.333 1.00 29.49 ? 121 TRP A O   1 
ATOM   904  C CB  . TRP A 1 119 ? 11.739  12.246  29.375 1.00 29.77 ? 121 TRP A CB  1 
ATOM   905  C CG  . TRP A 1 119 ? 11.494  11.000  30.143 1.00 29.56 ? 121 TRP A CG  1 
ATOM   906  C CD1 . TRP A 1 119 ? 12.283  10.467  31.120 1.00 30.13 ? 121 TRP A CD1 1 
ATOM   907  C CD2 . TRP A 1 119 ? 10.371  10.120  30.006 1.00 29.79 ? 121 TRP A CD2 1 
ATOM   908  N NE1 . TRP A 1 119 ? 11.710  9.310   31.611 1.00 31.58 ? 121 TRP A NE1 1 
ATOM   909  C CE2 . TRP A 1 119 ? 10.555  9.058   30.919 1.00 31.14 ? 121 TRP A CE2 1 
ATOM   910  C CE3 . TRP A 1 119 ? 9.240   10.113  29.182 1.00 33.03 ? 121 TRP A CE3 1 
ATOM   911  C CZ2 . TRP A 1 119 ? 9.639   8.012   31.054 1.00 29.96 ? 121 TRP A CZ2 1 
ATOM   912  C CZ3 . TRP A 1 119 ? 8.332   9.048   29.296 1.00 31.23 ? 121 TRP A CZ3 1 
ATOM   913  C CH2 . TRP A 1 119 ? 8.545   8.025   30.241 1.00 32.51 ? 121 TRP A CH2 1 
ATOM   914  N N   . GLY A 1 120 ? 14.194  13.139  27.170 1.00 28.26 ? 122 GLY A N   1 
ATOM   915  C CA  . GLY A 1 120 ? 14.624  13.938  26.028 1.00 27.34 ? 122 GLY A CA  1 
ATOM   916  C C   . GLY A 1 120 ? 16.129  14.140  26.037 1.00 28.36 ? 122 GLY A C   1 
ATOM   917  O O   . GLY A 1 120 ? 16.689  14.686  25.084 1.00 27.26 ? 122 GLY A O   1 
ATOM   918  N N   . THR A 1 121 ? 16.790  13.731  27.122 1.00 27.61 ? 123 THR A N   1 
ATOM   919  C CA  . THR A 1 121 ? 18.246  13.798  27.187 1.00 28.71 ? 123 THR A CA  1 
ATOM   920  C C   . THR A 1 121 ? 18.765  12.366  27.450 1.00 28.21 ? 123 THR A C   1 
ATOM   921  O O   . THR A 1 121 ? 17.942  11.404  27.577 1.00 28.18 ? 123 THR A O   1 
ATOM   922  C CB  . THR A 1 121 ? 18.756  14.794  28.304 1.00 29.20 ? 123 THR A CB  1 
ATOM   923  O OG1 . THR A 1 121 ? 18.648  14.175  29.586 1.00 27.29 ? 123 THR A OG1 1 
ATOM   924  C CG2 . THR A 1 121 ? 17.953  16.139  28.328 1.00 31.44 ? 123 THR A CG2 1 
ATOM   925  N N   . VAL A 1 122 ? 20.091  12.214  27.533 1.00 26.62 ? 124 VAL A N   1 
ATOM   926  C CA  . VAL A 1 122 ? 20.732  10.928  27.906 1.00 26.35 ? 124 VAL A CA  1 
ATOM   927  C C   . VAL A 1 122 ? 21.778  11.214  29.015 1.00 27.08 ? 124 VAL A C   1 
ATOM   928  O O   . VAL A 1 122 ? 22.119  12.351  29.236 1.00 26.67 ? 124 VAL A O   1 
ATOM   929  C CB  . VAL A 1 122 ? 21.407  10.168  26.683 1.00 27.14 ? 124 VAL A CB  1 
ATOM   930  C CG1 . VAL A 1 122 ? 20.398  9.863   25.536 1.00 23.59 ? 124 VAL A CG1 1 
ATOM   931  C CG2 . VAL A 1 122 ? 22.674  10.915  26.134 1.00 26.17 ? 124 VAL A CG2 1 
ATOM   932  N N   . PHE A 1 123 ? 22.327  10.174  29.635 1.00 26.21 ? 125 PHE A N   1 
ATOM   933  C CA  . PHE A 1 123 ? 23.447  10.294  30.591 1.00 27.66 ? 125 PHE A CA  1 
ATOM   934  C C   . PHE A 1 123 ? 24.806  10.598  29.935 1.00 27.41 ? 125 PHE A C   1 
ATOM   935  O O   . PHE A 1 123 ? 25.063  10.153  28.831 1.00 27.48 ? 125 PHE A O   1 
ATOM   936  C CB  . PHE A 1 123 ? 23.586  8.984   31.377 1.00 27.06 ? 125 PHE A CB  1 
ATOM   937  C CG  . PHE A 1 123 ? 22.379  8.675   32.237 1.00 27.28 ? 125 PHE A CG  1 
ATOM   938  C CD1 . PHE A 1 123 ? 22.277  9.208   33.510 1.00 26.19 ? 125 PHE A CD1 1 
ATOM   939  C CD2 . PHE A 1 123 ? 21.354  7.870   31.753 1.00 27.23 ? 125 PHE A CD2 1 
ATOM   940  C CE1 . PHE A 1 123 ? 21.165  8.914   34.325 1.00 26.86 ? 125 PHE A CE1 1 
ATOM   941  C CE2 . PHE A 1 123 ? 20.245  7.538   32.530 1.00 26.73 ? 125 PHE A CE2 1 
ATOM   942  C CZ  . PHE A 1 123 ? 20.141  8.080   33.839 1.00 25.67 ? 125 PHE A CZ  1 
ATOM   943  N N   . ASP A 1 124 ? 25.665  11.341  30.630 1.00 27.47 ? 126 ASP A N   1 
ATOM   944  C CA  . ASP A 1 124 ? 27.080  11.320  30.325 1.00 26.73 ? 126 ASP A CA  1 
ATOM   945  C C   . ASP A 1 124 ? 27.539  9.926   30.763 1.00 25.74 ? 126 ASP A C   1 
ATOM   946  O O   . ASP A 1 124 ? 27.330  9.621   31.910 1.00 24.44 ? 126 ASP A O   1 
ATOM   947  C CB  . ASP A 1 124 ? 27.791  12.340  31.207 1.00 27.22 ? 126 ASP A CB  1 
ATOM   948  C CG  . ASP A 1 124 ? 29.230  12.479  30.841 1.00 27.60 ? 126 ASP A CG  1 
ATOM   949  O OD1 . ASP A 1 124 ? 29.891  11.470  30.554 1.00 27.97 ? 126 ASP A OD1 1 
ATOM   950  O OD2 . ASP A 1 124 ? 29.709  13.596  30.788 1.00 30.23 ? 126 ASP A OD2 1 
ATOM   951  N N   . PRO A 1 125 ? 28.193  9.108   29.870 1.00 25.88 ? 127 PRO A N   1 
ATOM   952  C CA  . PRO A 1 125 ? 28.598  7.773   30.301 1.00 25.45 ? 127 PRO A CA  1 
ATOM   953  C C   . PRO A 1 125 ? 29.515  7.778   31.525 1.00 24.47 ? 127 PRO A C   1 
ATOM   954  O O   . PRO A 1 125 ? 29.516  6.781   32.264 1.00 24.41 ? 127 PRO A O   1 
ATOM   955  C CB  . PRO A 1 125 ? 29.370  7.197   29.060 1.00 24.58 ? 127 PRO A CB  1 
ATOM   956  C CG  . PRO A 1 125 ? 28.722  7.908   27.869 1.00 26.33 ? 127 PRO A CG  1 
ATOM   957  C CD  . PRO A 1 125 ? 28.540  9.327   28.442 1.00 25.41 ? 127 PRO A CD  1 
ATOM   958  N N   . GLU A 1 126 ? 30.278  8.843   31.726 1.00 22.63 ? 128 GLU A N   1 
ATOM   959  C CA  . GLU A 1 126 ? 31.124  8.959   32.932 1.00 23.91 ? 128 GLU A CA  1 
ATOM   960  C C   . GLU A 1 126 ? 30.334  8.900   34.229 1.00 24.34 ? 128 GLU A C   1 
ATOM   961  O O   . GLU A 1 126 ? 30.835  8.304   35.224 1.00 25.51 ? 128 GLU A O   1 
ATOM   962  C CB  . GLU A 1 126 ? 32.000  10.249  32.910 1.00 24.56 ? 128 GLU A CB  1 
ATOM   963  C CG  . GLU A 1 126 ? 33.139  10.226  31.860 1.00 27.15 ? 128 GLU A CG  1 
ATOM   964  C CD  . GLU A 1 126 ? 34.032  11.467  31.919 1.00 30.68 ? 128 GLU A CD  1 
ATOM   965  O OE1 . GLU A 1 126 ? 34.537  11.829  33.015 1.00 24.95 ? 128 GLU A OE1 1 
ATOM   966  O OE2 . GLU A 1 126 ? 34.217  12.087  30.851 1.00 34.99 ? 128 GLU A OE2 1 
ATOM   967  N N   . ASP A 1 127 ? 29.139  9.513   34.268 1.00 23.93 ? 129 ASP A N   1 
ATOM   968  C CA  . ASP A 1 127 ? 28.217  9.305   35.462 1.00 23.36 ? 129 ASP A CA  1 
ATOM   969  C C   . ASP A 1 127 ? 27.778  7.861   35.670 1.00 23.23 ? 129 ASP A C   1 
ATOM   970  O O   . ASP A 1 127 ? 27.800  7.343   36.807 1.00 23.03 ? 129 ASP A O   1 
ATOM   971  C CB  . ASP A 1 127 ? 27.026  10.256  35.433 1.00 23.17 ? 129 ASP A CB  1 
ATOM   972  C CG  . ASP A 1 127 ? 27.482  11.739  35.415 1.00 23.64 ? 129 ASP A CG  1 
ATOM   973  O OD1 . ASP A 1 127 ? 28.453  12.060  36.101 1.00 21.76 ? 129 ASP A OD1 1 
ATOM   974  O OD2 . ASP A 1 127 ? 26.940  12.574  34.691 1.00 26.27 ? 129 ASP A OD2 1 
ATOM   975  N N   . ILE A 1 128 ? 27.449  7.173   34.589 1.00 22.50 ? 130 ILE A N   1 
ATOM   976  C CA  . ILE A 1 128 ? 27.073  5.752   34.709 1.00 22.03 ? 130 ILE A CA  1 
ATOM   977  C C   . ILE A 1 128 ? 28.259  4.884   35.231 1.00 23.46 ? 130 ILE A C   1 
ATOM   978  O O   . ILE A 1 128 ? 28.127  4.052   36.191 1.00 22.96 ? 130 ILE A O   1 
ATOM   979  C CB  . ILE A 1 128 ? 26.472  5.225   33.364 1.00 21.61 ? 130 ILE A CB  1 
ATOM   980  C CG1 . ILE A 1 128 ? 25.200  6.031   33.034 1.00 18.86 ? 130 ILE A CG1 1 
ATOM   981  C CG2 . ILE A 1 128 ? 26.188  3.659   33.447 1.00 18.64 ? 130 ILE A CG2 1 
ATOM   982  C CD1 . ILE A 1 128 ? 24.484  5.699   31.743 1.00 20.87 ? 130 ILE A CD1 1 
ATOM   983  N N   . ILE A 1 129 ? 29.401  5.054   34.564 1.00 23.19 ? 131 ILE A N   1 
ATOM   984  C CA  . ILE A 1 129 ? 30.626  4.304   34.880 1.00 23.72 ? 131 ILE A CA  1 
ATOM   985  C C   . ILE A 1 129 ? 31.006  4.553   36.381 1.00 24.86 ? 131 ILE A C   1 
ATOM   986  O O   . ILE A 1 129 ? 31.299  3.604   37.122 1.00 24.70 ? 131 ILE A O   1 
ATOM   987  C CB  . ILE A 1 129 ? 31.715  4.691   33.893 1.00 23.94 ? 131 ILE A CB  1 
ATOM   988  C CG1 . ILE A 1 129 ? 31.330  4.185   32.476 1.00 21.98 ? 131 ILE A CG1 1 
ATOM   989  C CG2 . ILE A 1 129 ? 33.104  4.257   34.407 1.00 23.88 ? 131 ILE A CG2 1 
ATOM   990  C CD1 . ILE A 1 129 ? 32.174  4.860   31.390 1.00 26.07 ? 131 ILE A CD1 1 
ATOM   991  N N   . ARG A 1 130 ? 30.887  5.786   36.853 1.00 24.01 ? 132 ARG A N   1 
ATOM   992  C CA  . ARG A 1 130 ? 31.069  6.038   38.303 1.00 26.78 ? 132 ARG A CA  1 
ATOM   993  C C   . ARG A 1 130 ? 30.097  5.206   39.228 1.00 26.96 ? 132 ARG A C   1 
ATOM   994  O O   . ARG A 1 130 ? 30.535  4.676   40.281 1.00 26.78 ? 132 ARG A O   1 
ATOM   995  C CB  . ARG A 1 130 ? 30.972  7.531   38.561 1.00 27.19 ? 132 ARG A CB  1 
ATOM   996  C CG  . ARG A 1 130 ? 31.181  7.974   39.967 1.00 33.08 ? 132 ARG A CG  1 
ATOM   997  C CD  . ARG A 1 130 ? 32.609  8.486   40.124 1.00 38.70 ? 132 ARG A CD  1 
ATOM   998  N NE  . ARG A 1 130 ? 32.675  9.447   41.208 1.00 39.84 ? 132 ARG A NE  1 
ATOM   999  C CZ  . ARG A 1 130 ? 33.410  9.296   42.297 1.00 37.05 ? 132 ARG A CZ  1 
ATOM   1000 N NH1 . ARG A 1 130 ? 34.195  8.220   42.448 1.00 36.56 ? 132 ARG A NH1 1 
ATOM   1001 N NH2 . ARG A 1 130 ? 33.371  10.256  43.202 1.00 38.40 ? 132 ARG A NH2 1 
ATOM   1002 N N   . GLU A 1 131 ? 28.821  5.075   38.839 1.00 25.32 ? 133 GLU A N   1 
ATOM   1003 C CA  . GLU A 1 131 ? 27.877  4.231   39.607 1.00 26.52 ? 133 GLU A CA  1 
ATOM   1004 C C   . GLU A 1 131 ? 28.188  2.784   39.523 1.00 25.00 ? 133 GLU A C   1 
ATOM   1005 O O   . GLU A 1 131 ? 27.977  2.064   40.501 1.00 27.19 ? 133 GLU A O   1 
ATOM   1006 C CB  . GLU A 1 131 ? 26.420  4.427   39.194 1.00 27.00 ? 133 GLU A CB  1 
ATOM   1007 C CG  . GLU A 1 131 ? 26.003  5.833   39.522 1.00 31.94 ? 133 GLU A CG  1 
ATOM   1008 C CD  . GLU A 1 131 ? 25.853  6.071   41.024 1.00 31.13 ? 133 GLU A CD  1 
ATOM   1009 O OE1 . GLU A 1 131 ? 25.283  5.220   41.721 1.00 32.97 ? 133 GLU A OE1 1 
ATOM   1010 O OE2 . GLU A 1 131 ? 26.260  7.150   41.478 1.00 39.79 ? 133 GLU A OE2 1 
ATOM   1011 N N   . ILE A 1 132 ? 28.641  2.336   38.366 1.00 23.38 ? 134 ILE A N   1 
ATOM   1012 C CA  . ILE A 1 132 ? 29.122  0.992   38.215 1.00 23.57 ? 134 ILE A CA  1 
ATOM   1013 C C   . ILE A 1 132 ? 30.222  0.729   39.248 1.00 24.36 ? 134 ILE A C   1 
ATOM   1014 O O   . ILE A 1 132 ? 30.141  -0.255  39.978 1.00 24.14 ? 134 ILE A O   1 
ATOM   1015 C CB  . ILE A 1 132 ? 29.565  0.655   36.759 1.00 23.60 ? 134 ILE A CB  1 
ATOM   1016 C CG1 . ILE A 1 132 ? 28.344  0.774   35.771 1.00 22.26 ? 134 ILE A CG1 1 
ATOM   1017 C CG2 . ILE A 1 132 ? 30.187  -0.788  36.696 1.00 24.31 ? 134 ILE A CG2 1 
ATOM   1018 C CD1 . ILE A 1 132 ? 28.755  0.591   34.303 1.00 20.55 ? 134 ILE A CD1 1 
ATOM   1019 N N   . LYS A 1 133 ? 31.210  1.632   39.350 1.00 23.83 ? 135 LYS A N   1 
ATOM   1020 C CA  . LYS A 1 133 ? 32.351  1.383   40.212 1.00 26.37 ? 135 LYS A CA  1 
ATOM   1021 C C   . LYS A 1 133 ? 31.932  1.378   41.681 1.00 26.29 ? 135 LYS A C   1 
ATOM   1022 O O   . LYS A 1 133 ? 32.439  0.637   42.491 1.00 27.21 ? 135 LYS A O   1 
ATOM   1023 C CB  . LYS A 1 133 ? 33.508  2.354   39.942 1.00 26.53 ? 135 LYS A CB  1 
ATOM   1024 C CG  . LYS A 1 133 ? 34.334  2.039   38.656 1.00 29.32 ? 135 LYS A CG  1 
ATOM   1025 C CD  . LYS A 1 133 ? 35.217  3.265   38.213 1.00 34.09 ? 135 LYS A CD  1 
ATOM   1026 C CE  . LYS A 1 133 ? 34.271  4.571   37.881 1.00 37.45 ? 135 LYS A CE  1 
ATOM   1027 N NZ  . LYS A 1 133 ? 34.808  6.000   37.397 1.00 22.23 ? 135 LYS A NZ  1 
ATOM   1028 N N   . LYS A 1 134 ? 30.959  2.202   41.989 1.00 27.61 ? 136 LYS A N   1 
ATOM   1029 C CA  . LYS A 1 134 ? 30.460  2.377   43.293 1.00 27.48 ? 136 LYS A CA  1 
ATOM   1030 C C   . LYS A 1 134 ? 29.539  1.218   43.714 1.00 27.82 ? 136 LYS A C   1 
ATOM   1031 O O   . LYS A 1 134 ? 29.657  0.708   44.816 1.00 27.70 ? 136 LYS A O   1 
ATOM   1032 C CB  . LYS A 1 134 ? 29.690  3.680   43.305 1.00 28.82 ? 136 LYS A CB  1 
ATOM   1033 C CG  . LYS A 1 134 ? 29.077  4.035   44.624 1.00 33.65 ? 136 LYS A CG  1 
ATOM   1034 C CD  . LYS A 1 134 ? 28.285  5.298   44.484 1.00 41.64 ? 136 LYS A CD  1 
ATOM   1035 C CE  . LYS A 1 134 ? 27.044  5.206   45.334 1.00 45.46 ? 136 LYS A CE  1 
ATOM   1036 N NZ  . LYS A 1 134 ? 25.991  5.873   44.495 1.00 49.21 ? 136 LYS A NZ  1 
ATOM   1037 N N   . VAL A 1 135 ? 28.606  0.827   42.858 1.00 26.79 ? 137 VAL A N   1 
ATOM   1038 C CA  . VAL A 1 135 ? 27.620  -0.154  43.263 1.00 28.02 ? 137 VAL A CA  1 
ATOM   1039 C C   . VAL A 1 135 ? 28.171  -1.587  43.098 1.00 28.34 ? 137 VAL A C   1 
ATOM   1040 O O   . VAL A 1 135 ? 27.788  -2.512  43.848 1.00 29.10 ? 137 VAL A O   1 
ATOM   1041 C CB  . VAL A 1 135 ? 26.284  0.060   42.476 1.00 28.08 ? 137 VAL A CB  1 
ATOM   1042 C CG1 . VAL A 1 135 ? 25.286  -1.065  42.730 1.00 25.68 ? 137 VAL A CG1 1 
ATOM   1043 C CG2 . VAL A 1 135 ? 25.683  1.435   42.878 1.00 28.43 ? 137 VAL A CG2 1 
ATOM   1044 N N   . LYS A 1 136 ? 29.053  -1.768  42.111 1.00 27.53 ? 138 LYS A N   1 
ATOM   1045 C CA  . LYS A 1 136 ? 29.592  -3.091  41.787 1.00 27.74 ? 138 LYS A CA  1 
ATOM   1046 C C   . LYS A 1 136 ? 28.471  -4.057  41.543 1.00 26.79 ? 138 LYS A C   1 
ATOM   1047 O O   . LYS A 1 136 ? 28.314  -5.045  42.292 1.00 25.20 ? 138 LYS A O   1 
ATOM   1048 C CB  . LYS A 1 136 ? 30.463  -3.603  42.958 1.00 29.76 ? 138 LYS A CB  1 
ATOM   1049 C CG  . LYS A 1 136 ? 31.945  -3.559  42.625 1.00 33.38 ? 138 LYS A CG  1 
ATOM   1050 C CD  . LYS A 1 136 ? 32.682  -2.556  43.468 1.00 39.86 ? 138 LYS A CD  1 
ATOM   1051 C CE  . LYS A 1 136 ? 32.797  -3.058  44.904 1.00 39.62 ? 138 LYS A CE  1 
ATOM   1052 N NZ  . LYS A 1 136 ? 33.683  -2.132  45.665 1.00 44.02 ? 138 LYS A NZ  1 
ATOM   1053 N N   . PRO A 1 137 ? 27.626  -3.758  40.531 1.00 25.96 ? 139 PRO A N   1 
ATOM   1054 C CA  . PRO A 1 137 ? 26.465  -4.621  40.317 1.00 25.39 ? 139 PRO A CA  1 
ATOM   1055 C C   . PRO A 1 137 ? 26.852  -5.931  39.623 1.00 24.91 ? 139 PRO A C   1 
ATOM   1056 O O   . PRO A 1 137 ? 27.819  -5.978  38.834 1.00 24.29 ? 139 PRO A O   1 
ATOM   1057 C CB  . PRO A 1 137 ? 25.591  -3.757  39.395 1.00 25.50 ? 139 PRO A CB  1 
ATOM   1058 C CG  . PRO A 1 137 ? 26.580  -3.075  38.556 1.00 24.77 ? 139 PRO A CG  1 
ATOM   1059 C CD  . PRO A 1 137 ? 27.701  -2.693  39.522 1.00 25.43 ? 139 PRO A CD  1 
ATOM   1060 N N   . LYS A 1 138 ? 26.113  -6.996  39.873 1.00 24.79 ? 140 LYS A N   1 
ATOM   1061 C CA  . LYS A 1 138 ? 26.264  -8.190  39.025 1.00 25.08 ? 140 LYS A CA  1 
ATOM   1062 C C   . LYS A 1 138 ? 25.858  -7.822  37.562 1.00 24.65 ? 140 LYS A C   1 
ATOM   1063 O O   . LYS A 1 138 ? 26.446  -8.297  36.567 1.00 24.67 ? 140 LYS A O   1 
ATOM   1064 C CB  . LYS A 1 138 ? 25.414  -9.370  39.590 1.00 24.52 ? 140 LYS A CB  1 
ATOM   1065 C CG  . LYS A 1 138 ? 25.379  -10.600 38.715 1.00 26.92 ? 140 LYS A CG  1 
ATOM   1066 C CD  . LYS A 1 138 ? 24.532  -11.747 39.350 1.00 29.11 ? 140 LYS A CD  1 
ATOM   1067 C CE  . LYS A 1 138 ? 24.619  -13.025 38.570 1.00 26.97 ? 140 LYS A CE  1 
ATOM   1068 N NZ  . LYS A 1 138 ? 23.715  -14.062 39.159 1.00 27.41 ? 140 LYS A NZ  1 
ATOM   1069 N N   . ILE A 1 139 ? 24.873  -6.949  37.444 1.00 24.55 ? 141 ILE A N   1 
ATOM   1070 C CA  . ILE A 1 139 ? 24.254  -6.695  36.146 1.00 25.34 ? 141 ILE A CA  1 
ATOM   1071 C C   . ILE A 1 139 ? 24.008  -5.202  35.931 1.00 25.75 ? 141 ILE A C   1 
ATOM   1072 O O   . ILE A 1 139 ? 23.516  -4.489  36.851 1.00 23.66 ? 141 ILE A O   1 
ATOM   1073 C CB  . ILE A 1 139 ? 22.859  -7.363  36.038 1.00 25.75 ? 141 ILE A CB  1 
ATOM   1074 C CG1 . ILE A 1 139 ? 23.012  -8.877  36.192 1.00 27.11 ? 141 ILE A CG1 1 
ATOM   1075 C CG2 . ILE A 1 139 ? 22.122  -6.943  34.674 1.00 23.91 ? 141 ILE A CG2 1 
ATOM   1076 C CD1 . ILE A 1 139 ? 21.834  -9.510  36.670 1.00 26.66 ? 141 ILE A CD1 1 
ATOM   1077 N N   . VAL A 1 140 ? 24.338  -4.743  34.722 1.00 24.88 ? 142 VAL A N   1 
ATOM   1078 C CA  . VAL A 1 140 ? 23.805  -3.473  34.288 1.00 24.03 ? 142 VAL A CA  1 
ATOM   1079 C C   . VAL A 1 140 ? 22.927  -3.644  33.078 1.00 24.44 ? 142 VAL A C   1 
ATOM   1080 O O   . VAL A 1 140 ? 23.318  -4.254  32.084 1.00 22.07 ? 142 VAL A O   1 
ATOM   1081 C CB  . VAL A 1 140 ? 24.854  -2.306  34.254 1.00 25.91 ? 142 VAL A CB  1 
ATOM   1082 C CG1 . VAL A 1 140 ? 26.275  -2.668  34.746 1.00 26.30 ? 142 VAL A CG1 1 
ATOM   1083 C CG2 . VAL A 1 140 ? 24.696  -1.281  33.128 1.00 22.34 ? 142 VAL A CG2 1 
ATOM   1084 N N   . ALA A 1 141 ? 21.689  -3.153  33.230 1.00 24.93 ? 143 ALA A N   1 
ATOM   1085 C CA  . ALA A 1 141 ? 20.639  -3.360  32.245 1.00 24.63 ? 143 ALA A CA  1 
ATOM   1086 C C   . ALA A 1 141 ? 20.286  -2.015  31.692 1.00 24.27 ? 143 ALA A C   1 
ATOM   1087 O O   . ALA A 1 141 ? 19.995  -1.089  32.455 1.00 24.96 ? 143 ALA A O   1 
ATOM   1088 C CB  . ALA A 1 141 ? 19.376  -4.028  32.884 1.00 23.48 ? 143 ALA A CB  1 
ATOM   1089 N N   . MET A 1 142 ? 20.227  -1.911  30.375 1.00 23.07 ? 144 MET A N   1 
ATOM   1090 C CA  . MET A 1 142 ? 19.959  -0.621  29.776 1.00 25.18 ? 144 MET A CA  1 
ATOM   1091 C C   . MET A 1 142 ? 19.272  -0.676  28.393 1.00 24.07 ? 144 MET A C   1 
ATOM   1092 O O   . MET A 1 142 ? 19.494  -1.608  27.639 1.00 23.43 ? 144 MET A O   1 
ATOM   1093 C CB  . MET A 1 142 ? 21.299  0.083   29.607 1.00 25.69 ? 144 MET A CB  1 
ATOM   1094 C CG  . MET A 1 142 ? 21.219  1.567   29.712 1.00 29.04 ? 144 MET A CG  1 
ATOM   1095 S SD  . MET A 1 142 ? 22.903  2.193   29.449 1.00 34.39 ? 144 MET A SD  1 
ATOM   1096 C CE  . MET A 1 142 ? 22.437  3.870   29.053 1.00 28.85 ? 144 MET A CE  1 
ATOM   1097 N N   . VAL A 1 143 ? 18.473  0.349   28.073 1.00 24.49 ? 145 VAL A N   1 
ATOM   1098 C CA  . VAL A 1 143 ? 17.808  0.464   26.768 1.00 23.69 ? 145 VAL A CA  1 
ATOM   1099 C C   . VAL A 1 143 ? 18.810  1.174   25.802 1.00 24.03 ? 145 VAL A C   1 
ATOM   1100 O O   . VAL A 1 143 ? 19.396  2.192   26.151 1.00 24.87 ? 145 VAL A O   1 
ATOM   1101 C CB  . VAL A 1 143 ? 16.498  1.270   26.845 1.00 23.55 ? 145 VAL A CB  1 
ATOM   1102 C CG1 . VAL A 1 143 ? 15.804  1.338   25.412 1.00 21.86 ? 145 VAL A CG1 1 
ATOM   1103 C CG2 . VAL A 1 143 ? 15.539  0.697   27.877 1.00 25.09 ? 145 VAL A CG2 1 
ATOM   1104 N N   . HIS A 1 144 ? 19.037  0.604   24.623 1.00 23.13 ? 146 HIS A N   1 
ATOM   1105 C CA  . HIS A 1 144 ? 19.849  1.297   23.570 1.00 23.60 ? 146 HIS A CA  1 
ATOM   1106 C C   . HIS A 1 144 ? 19.159  2.534   23.022 1.00 23.65 ? 146 HIS A C   1 
ATOM   1107 O O   . HIS A 1 144 ? 19.746  3.664   23.015 1.00 25.36 ? 146 HIS A O   1 
ATOM   1108 C CB  . HIS A 1 144 ? 20.198  0.304   22.400 1.00 21.40 ? 146 HIS A CB  1 
ATOM   1109 C CG  . HIS A 1 144 ? 21.219  0.830   21.421 1.00 23.03 ? 146 HIS A CG  1 
ATOM   1110 N ND1 . HIS A 1 144 ? 21.357  0.301   20.155 1.00 17.79 ? 146 HIS A ND1 1 
ATOM   1111 C CD2 . HIS A 1 144 ? 22.091  1.880   21.495 1.00 21.36 ? 146 HIS A CD2 1 
ATOM   1112 C CE1 . HIS A 1 144 ? 22.296  0.973   19.497 1.00 21.35 ? 146 HIS A CE1 1 
ATOM   1113 N NE2 . HIS A 1 144 ? 22.797  1.905   20.303 1.00 20.16 ? 146 HIS A NE2 1 
ATOM   1114 N N   . GLY A 1 145 ? 17.942  2.344   22.525 1.00 23.21 ? 147 GLY A N   1 
ATOM   1115 C CA  . GLY A 1 145 ? 17.175  3.451   21.931 1.00 24.12 ? 147 GLY A CA  1 
ATOM   1116 C C   . GLY A 1 145 ? 15.786  3.491   22.602 1.00 26.12 ? 147 GLY A C   1 
ATOM   1117 O O   . GLY A 1 145 ? 15.041  2.490   22.564 1.00 22.92 ? 147 GLY A O   1 
ATOM   1118 N N   . GLU A 1 146 ? 15.435  4.618   23.234 1.00 25.42 ? 148 GLU A N   1 
ATOM   1119 C CA  . GLU A 1 146 ? 14.073  4.767   23.849 1.00 25.92 ? 148 GLU A CA  1 
ATOM   1120 C C   . GLU A 1 146 ? 13.184  5.429   22.848 1.00 26.87 ? 148 GLU A C   1 
ATOM   1121 O O   . GLU A 1 146 ? 13.394  6.642   22.565 1.00 26.10 ? 148 GLU A O   1 
ATOM   1122 C CB  . GLU A 1 146 ? 14.077  5.788   25.021 1.00 26.81 ? 148 GLU A CB  1 
ATOM   1123 C CG  . GLU A 1 146 ? 14.481  5.276   26.360 1.00 26.79 ? 148 GLU A CG  1 
ATOM   1124 C CD  . GLU A 1 146 ? 13.431  4.402   26.993 1.00 27.24 ? 148 GLU A CD  1 
ATOM   1125 O OE1 . GLU A 1 146 ? 12.267  4.426   26.559 1.00 24.32 ? 148 GLU A OE1 1 
ATOM   1126 O OE2 . GLU A 1 146 ? 13.760  3.709   27.962 1.00 30.20 ? 148 GLU A OE2 1 
ATOM   1127 N N   . THR A 1 147 ? 12.174  4.700   22.347 1.00 27.38 ? 149 THR A N   1 
ATOM   1128 C CA  . THR A 1 147 ? 11.275  5.250   21.395 1.00 29.28 ? 149 THR A CA  1 
ATOM   1129 C C   . THR A 1 147 ? 10.365  6.200   22.097 1.00 27.97 ? 149 THR A C   1 
ATOM   1130 O O   . THR A 1 147 ? 9.824   7.083   21.439 1.00 28.37 ? 149 THR A O   1 
ATOM   1131 C CB  . THR A 1 147 ? 10.379  4.195   20.672 1.00 29.33 ? 149 THR A CB  1 
ATOM   1132 O OG1 . THR A 1 147 ? 9.732   3.387   21.655 1.00 34.11 ? 149 THR A OG1 1 
ATOM   1133 C CG2 . THR A 1 147 ? 11.215  3.309   19.801 1.00 34.35 ? 149 THR A CG2 1 
ATOM   1134 N N   . SER A 1 148 ? 10.176  6.016   23.406 1.00 27.39 ? 150 SER A N   1 
ATOM   1135 C CA  . SER A 1 148 ? 9.282   6.869   24.172 1.00 26.21 ? 150 SER A CA  1 
ATOM   1136 C C   . SER A 1 148 ? 9.780   8.318   24.141 1.00 24.72 ? 150 SER A C   1 
ATOM   1137 O O   . SER A 1 148 ? 9.010   9.238   24.181 1.00 24.56 ? 150 SER A O   1 
ATOM   1138 C CB  . SER A 1 148 ? 9.155   6.361   25.641 1.00 26.49 ? 150 SER A CB  1 
ATOM   1139 O OG  . SER A 1 148 ? 10.432  6.417   26.313 1.00 25.04 ? 150 SER A OG  1 
ATOM   1140 N N   . THR A 1 149 ? 11.083  8.506   24.101 1.00 25.43 ? 151 THR A N   1 
ATOM   1141 C CA  . THR A 1 149 ? 11.672  9.848   24.152 1.00 24.35 ? 151 THR A CA  1 
ATOM   1142 C C   . THR A 1 149 ? 12.411  10.207  22.852 1.00 24.31 ? 151 THR A C   1 
ATOM   1143 O O   . THR A 1 149 ? 12.720  11.342  22.614 1.00 25.34 ? 151 THR A O   1 
ATOM   1144 C CB  . THR A 1 149 ? 12.581  10.058  25.380 1.00 23.87 ? 151 THR A CB  1 
ATOM   1145 O OG1 . THR A 1 149 ? 13.822  9.358   25.246 1.00 23.43 ? 151 THR A OG1 1 
ATOM   1146 C CG2 . THR A 1 149 ? 11.858  9.660   26.726 1.00 25.36 ? 151 THR A CG2 1 
ATOM   1147 N N   . GLY A 1 150 ? 12.634  9.227   21.996 1.00 24.47 ? 152 GLY A N   1 
ATOM   1148 C CA  . GLY A 1 150 ? 13.388  9.416   20.746 1.00 24.02 ? 152 GLY A CA  1 
ATOM   1149 C C   . GLY A 1 150 ? 14.898  9.559   20.891 1.00 24.04 ? 152 GLY A C   1 
ATOM   1150 O O   . GLY A 1 150 ? 15.547  10.071  19.972 1.00 24.33 ? 152 GLY A O   1 
ATOM   1151 N N   . ARG A 1 151 ? 15.467  9.149   22.030 1.00 24.09 ? 153 ARG A N   1 
ATOM   1152 C CA  . ARG A 1 151 ? 16.912  9.292   22.261 1.00 24.59 ? 153 ARG A CA  1 
ATOM   1153 C C   . ARG A 1 151 ? 17.560  7.951   22.137 1.00 24.36 ? 153 ARG A C   1 
ATOM   1154 O O   . ARG A 1 151 ? 16.956  6.966   22.467 1.00 22.87 ? 153 ARG A O   1 
ATOM   1155 C CB  . ARG A 1 151 ? 17.240  9.889   23.651 1.00 24.05 ? 153 ARG A CB  1 
ATOM   1156 C CG  . ARG A 1 151 ? 16.649  11.285  23.865 1.00 27.37 ? 153 ARG A CG  1 
ATOM   1157 C CD  . ARG A 1 151 ? 17.259  12.306  22.903 1.00 28.86 ? 153 ARG A CD  1 
ATOM   1158 N NE  . ARG A 1 151 ? 16.535  12.611  21.676 1.00 36.53 ? 153 ARG A NE  1 
ATOM   1159 C CZ  . ARG A 1 151 ? 15.281  13.026  21.638 1.00 34.02 ? 153 ARG A CZ  1 
ATOM   1160 N NH1 . ARG A 1 151 ? 14.639  13.052  22.769 1.00 36.89 ? 153 ARG A NH1 1 
ATOM   1161 N NH2 . ARG A 1 151 ? 14.663  13.366  20.522 1.00 25.89 ? 153 ARG A NH2 1 
ATOM   1162 N N   . ILE A 1 152 ? 18.745  7.958   21.536 1.00 24.30 ? 154 ILE A N   1 
ATOM   1163 C CA  . ILE A 1 152 ? 19.628  6.826   21.468 1.00 24.02 ? 154 ILE A CA  1 
ATOM   1164 C C   . ILE A 1 152 ? 20.837  7.132   22.353 1.00 23.65 ? 154 ILE A C   1 
ATOM   1165 O O   . ILE A 1 152 ? 21.380  8.271   22.360 1.00 23.54 ? 154 ILE A O   1 
ATOM   1166 C CB  . ILE A 1 152 ? 19.977  6.436   19.985 1.00 23.64 ? 154 ILE A CB  1 
ATOM   1167 C CG1 . ILE A 1 152 ? 20.666  5.073   19.920 1.00 22.69 ? 154 ILE A CG1 1 
ATOM   1168 C CG2 . ILE A 1 152 ? 20.705  7.508   19.251 1.00 22.88 ? 154 ILE A CG2 1 
ATOM   1169 C CD1 . ILE A 1 152 ? 20.820  4.510   18.415 1.00 22.42 ? 154 ILE A CD1 1 
ATOM   1170 N N   . HIS A 1 153 ? 21.213  6.127   23.134 1.00 23.84 ? 155 HIS A N   1 
ATOM   1171 C CA  . HIS A 1 153 ? 22.314  6.231   24.148 1.00 23.96 ? 155 HIS A CA  1 
ATOM   1172 C C   . HIS A 1 153 ? 23.630  5.565   23.690 1.00 23.03 ? 155 HIS A C   1 
ATOM   1173 O O   . HIS A 1 153 ? 23.576  4.416   23.234 1.00 22.82 ? 155 HIS A O   1 
ATOM   1174 C CB  . HIS A 1 153 ? 21.870  5.550   25.443 1.00 24.93 ? 155 HIS A CB  1 
ATOM   1175 C CG  . HIS A 1 153 ? 22.522  6.125   26.646 1.00 27.29 ? 155 HIS A CG  1 
ATOM   1176 N ND1 . HIS A 1 153 ? 21.826  6.835   27.602 1.00 32.39 ? 155 HIS A ND1 1 
ATOM   1177 C CD2 . HIS A 1 153 ? 23.824  6.202   26.990 1.00 25.75 ? 155 HIS A CD2 1 
ATOM   1178 C CE1 . HIS A 1 153 ? 22.667  7.286   28.509 1.00 27.99 ? 155 HIS A CE1 1 
ATOM   1179 N NE2 . HIS A 1 153 ? 23.887  6.924   28.155 1.00 31.46 ? 155 HIS A NE2 1 
ATOM   1180 N N   . PRO A 1 154 ? 24.807  6.275   23.788 1.00 22.87 ? 156 PRO A N   1 
ATOM   1181 C CA  . PRO A 1 154 ? 26.108  5.657   23.553 1.00 23.20 ? 156 PRO A CA  1 
ATOM   1182 C C   . PRO A 1 154 ? 26.328  4.483   24.514 1.00 23.92 ? 156 PRO A C   1 
ATOM   1183 O O   . PRO A 1 154 ? 26.059  4.593   25.758 1.00 24.60 ? 156 PRO A O   1 
ATOM   1184 C CB  . PRO A 1 154 ? 27.111  6.813   23.856 1.00 22.76 ? 156 PRO A CB  1 
ATOM   1185 C CG  . PRO A 1 154 ? 26.329  8.012   23.457 1.00 25.85 ? 156 PRO A CG  1 
ATOM   1186 C CD  . PRO A 1 154 ? 24.956  7.739   23.978 1.00 21.72 ? 156 PRO A CD  1 
ATOM   1187 N N   . LEU A 1 155 ? 26.764  3.357   23.963 1.00 24.16 ? 157 LEU A N   1 
ATOM   1188 C CA  . LEU A 1 155 ? 26.961  2.154   24.782 1.00 25.19 ? 157 LEU A CA  1 
ATOM   1189 C C   . LEU A 1 155 ? 28.410  1.663   25.022 1.00 23.95 ? 157 LEU A C   1 
ATOM   1190 O O   . LEU A 1 155 ? 28.616  0.868   25.907 1.00 23.50 ? 157 LEU A O   1 
ATOM   1191 C CB  . LEU A 1 155 ? 26.126  0.977   24.227 1.00 25.19 ? 157 LEU A CB  1 
ATOM   1192 C CG  . LEU A 1 155 ? 24.619  1.220   24.073 1.00 25.54 ? 157 LEU A CG  1 
ATOM   1193 C CD1 . LEU A 1 155 ? 24.016  -0.032  23.469 1.00 29.71 ? 157 LEU A CD1 1 
ATOM   1194 C CD2 . LEU A 1 155 ? 23.883  1.680   25.384 1.00 28.53 ? 157 LEU A CD2 1 
ATOM   1195 N N   . LYS A 1 156 ? 29.364  2.044   24.186 1.00 22.72 ? 158 LYS A N   1 
ATOM   1196 C CA  . LYS A 1 156 ? 30.681  1.414   24.198 1.00 24.28 ? 158 LYS A CA  1 
ATOM   1197 C C   . LYS A 1 156 ? 31.412  1.674   25.544 1.00 24.25 ? 158 LYS A C   1 
ATOM   1198 O O   . LYS A 1 156 ? 32.000  0.752   26.139 1.00 22.92 ? 158 LYS A O   1 
ATOM   1199 C CB  . LYS A 1 156 ? 31.568  1.929   23.020 1.00 24.07 ? 158 LYS A CB  1 
ATOM   1200 C CG  . LYS A 1 156 ? 33.032  1.339   22.857 1.00 26.59 ? 158 LYS A CG  1 
ATOM   1201 C CD  . LYS A 1 156 ? 33.601  1.788   21.425 1.00 29.76 ? 158 LYS A CD  1 
ATOM   1202 C CE  . LYS A 1 156 ? 35.077  1.407   21.106 1.00 35.28 ? 158 LYS A CE  1 
ATOM   1203 N NZ  . LYS A 1 156 ? 35.241  0.021   21.579 1.00 37.54 ? 158 LYS A NZ  1 
ATOM   1204 N N   . ALA A 1 157 ? 31.423  2.929   25.970 1.00 24.69 ? 159 ALA A N   1 
ATOM   1205 C CA  . ALA A 1 157 ? 32.198  3.278   27.195 1.00 25.92 ? 159 ALA A CA  1 
ATOM   1206 C C   . ALA A 1 157 ? 31.593  2.504   28.404 1.00 25.46 ? 159 ALA A C   1 
ATOM   1207 O O   . ALA A 1 157 ? 32.315  1.988   29.295 1.00 26.65 ? 159 ALA A O   1 
ATOM   1208 C CB  . ALA A 1 157 ? 32.239  4.832   27.397 1.00 25.41 ? 159 ALA A CB  1 
ATOM   1209 N N   . ILE A 1 158 ? 30.286  2.334   28.357 1.00 24.44 ? 160 ILE A N   1 
ATOM   1210 C CA  . ILE A 1 158 ? 29.577  1.652   29.438 1.00 24.36 ? 160 ILE A CA  1 
ATOM   1211 C C   . ILE A 1 158 ? 29.899  0.142   29.445 1.00 23.76 ? 160 ILE A C   1 
ATOM   1212 O O   . ILE A 1 158 ? 30.249  -0.407  30.461 1.00 23.12 ? 160 ILE A O   1 
ATOM   1213 C CB  . ILE A 1 158 ? 28.051  1.924   29.347 1.00 24.06 ? 160 ILE A CB  1 
ATOM   1214 C CG1 . ILE A 1 158 ? 27.810  3.380   29.730 1.00 23.61 ? 160 ILE A CG1 1 
ATOM   1215 C CG2 . ILE A 1 158 ? 27.249  0.929   30.335 1.00 21.92 ? 160 ILE A CG2 1 
ATOM   1216 C CD1 . ILE A 1 158 ? 26.428  3.915   29.294 1.00 23.52 ? 160 ILE A CD1 1 
ATOM   1217 N N   . GLY A 1 159 ? 29.823  -0.499  28.298 1.00 22.73 ? 161 GLY A N   1 
ATOM   1218 C CA  . GLY A 1 159 ? 30.221  -1.902  28.179 1.00 23.95 ? 161 GLY A CA  1 
ATOM   1219 C C   . GLY A 1 159 ? 31.669  -2.163  28.557 1.00 24.44 ? 161 GLY A C   1 
ATOM   1220 O O   . GLY A 1 159 ? 31.955  -3.122  29.268 1.00 25.71 ? 161 GLY A O   1 
ATOM   1221 N N   . GLU A 1 160 ? 32.578  -1.296  28.136 1.00 24.21 ? 162 GLU A N   1 
ATOM   1222 C CA  . GLU A 1 160 ? 33.968  -1.397  28.583 1.00 25.63 ? 162 GLU A CA  1 
ATOM   1223 C C   . GLU A 1 160 ? 34.139  -1.351  30.090 1.00 24.78 ? 162 GLU A C   1 
ATOM   1224 O O   . GLU A 1 160 ? 34.931  -2.143  30.653 1.00 25.17 ? 162 GLU A O   1 
ATOM   1225 C CB  . GLU A 1 160 ? 34.852  -0.357  27.887 1.00 26.08 ? 162 GLU A CB  1 
ATOM   1226 C CG  . GLU A 1 160 ? 35.253  -1.012  26.557 1.00 30.90 ? 162 GLU A CG  1 
ATOM   1227 C CD  . GLU A 1 160 ? 35.744  -0.077  25.513 1.00 38.57 ? 162 GLU A CD  1 
ATOM   1228 O OE1 . GLU A 1 160 ? 35.664  1.164   25.691 1.00 39.00 ? 162 GLU A OE1 1 
ATOM   1229 O OE2 . GLU A 1 160 ? 36.225  -0.622  24.486 1.00 42.17 ? 162 GLU A OE2 1 
ATOM   1230 N N   . ALA A 1 161 ? 33.376  -0.499  30.763 1.00 22.77 ? 163 ALA A N   1 
ATOM   1231 C CA  . ALA A 1 161 ? 33.498  -0.442  32.236 1.00 22.64 ? 163 ALA A CA  1 
ATOM   1232 C C   . ALA A 1 161 ? 32.882  -1.736  32.828 1.00 22.08 ? 163 ALA A C   1 
ATOM   1233 O O   . ALA A 1 161 ? 33.379  -2.220  33.824 1.00 21.65 ? 163 ALA A O   1 
ATOM   1234 C CB  . ALA A 1 161 ? 32.805  0.818   32.803 1.00 21.39 ? 163 ALA A CB  1 
ATOM   1235 N N   . CYS A 1 162 ? 31.825  -2.281  32.206 1.00 21.19 ? 164 CYS A N   1 
ATOM   1236 C CA  . CYS A 1 162 ? 31.089  -3.467  32.759 1.00 23.06 ? 164 CYS A CA  1 
ATOM   1237 C C   . CYS A 1 162 ? 32.039  -4.643  32.726 1.00 23.51 ? 164 CYS A C   1 
ATOM   1238 O O   . CYS A 1 162 ? 32.191  -5.338  33.727 1.00 25.26 ? 164 CYS A O   1 
ATOM   1239 C CB  . CYS A 1 162 ? 29.798  -3.810  31.973 1.00 21.02 ? 164 CYS A CB  1 
ATOM   1240 S SG  . CYS A 1 162 ? 28.437  -2.649  32.262 1.00 23.84 ? 164 CYS A SG  1 
ATOM   1241 N N   . ARG A 1 163 ? 32.755  -4.799  31.613 1.00 24.11 ? 165 ARG A N   1 
ATOM   1242 C CA  . ARG A 1 163 ? 33.745  -5.867  31.456 1.00 25.66 ? 165 ARG A CA  1 
ATOM   1243 C C   . ARG A 1 163 ? 34.888  -5.800  32.528 1.00 27.53 ? 165 ARG A C   1 
ATOM   1244 O O   . ARG A 1 163 ? 35.228  -6.791  33.163 1.00 27.44 ? 165 ARG A O   1 
ATOM   1245 C CB  . ARG A 1 163 ? 34.325  -5.823  30.006 1.00 24.71 ? 165 ARG A CB  1 
ATOM   1246 C CG  . ARG A 1 163 ? 35.140  -7.078  29.575 1.00 25.86 ? 165 ARG A CG  1 
ATOM   1247 C CD  . ARG A 1 163 ? 34.277  -8.390  29.574 1.00 25.34 ? 165 ARG A CD  1 
ATOM   1248 N NE  . ARG A 1 163 ? 33.019  -8.271  28.798 1.00 27.62 ? 165 ARG A NE  1 
ATOM   1249 C CZ  . ARG A 1 163 ? 32.846  -8.627  27.507 1.00 29.10 ? 165 ARG A CZ  1 
ATOM   1250 N NH1 . ARG A 1 163 ? 33.834  -9.144  26.777 1.00 30.01 ? 165 ARG A NH1 1 
ATOM   1251 N NH2 . ARG A 1 163 ? 31.669  -8.480  26.932 1.00 23.14 ? 165 ARG A NH2 1 
ATOM   1252 N N   . THR A 1 164 ? 35.489  -4.637  32.704 1.00 28.95 ? 166 THR A N   1 
ATOM   1253 C CA  . THR A 1 164 ? 36.522  -4.483  33.738 1.00 30.55 ? 166 THR A CA  1 
ATOM   1254 C C   . THR A 1 164 ? 36.008  -4.663  35.170 1.00 29.84 ? 166 THR A C   1 
ATOM   1255 O O   . THR A 1 164 ? 36.696  -5.249  35.985 1.00 30.78 ? 166 THR A O   1 
ATOM   1256 C CB  . THR A 1 164 ? 37.391  -3.177  33.597 1.00 31.33 ? 166 THR A CB  1 
ATOM   1257 O OG1 . THR A 1 164 ? 36.769  -2.091  34.269 1.00 38.28 ? 166 THR A OG1 1 
ATOM   1258 C CG2 . THR A 1 164 ? 37.621  -2.784  32.183 1.00 29.52 ? 166 THR A CG2 1 
ATOM   1259 N N   . GLU A 1 165 ? 34.794  -4.200  35.461 1.00 28.83 ? 167 GLU A N   1 
ATOM   1260 C CA  . GLU A 1 165 ? 34.184  -4.386  36.774 1.00 28.88 ? 167 GLU A CA  1 
ATOM   1261 C C   . GLU A 1 165 ? 33.474  -5.730  36.927 1.00 29.02 ? 167 GLU A C   1 
ATOM   1262 O O   . GLU A 1 165 ? 32.862  -5.992  37.975 1.00 28.34 ? 167 GLU A O   1 
ATOM   1263 C CB  . GLU A 1 165 ? 33.214  -3.248  37.121 1.00 27.67 ? 167 GLU A CB  1 
ATOM   1264 C CG  . GLU A 1 165 ? 33.855  -1.855  37.077 1.00 32.25 ? 167 GLU A CG  1 
ATOM   1265 C CD  . GLU A 1 165 ? 34.885  -1.640  38.191 1.00 32.95 ? 167 GLU A CD  1 
ATOM   1266 O OE1 . GLU A 1 165 ? 34.684  -2.087  39.338 1.00 34.77 ? 167 GLU A OE1 1 
ATOM   1267 O OE2 . GLU A 1 165 ? 35.911  -1.038  37.895 1.00 35.19 ? 167 GLU A OE2 1 
ATOM   1268 N N   . ASP A 1 166 ? 33.522  -6.553  35.876 1.00 28.89 ? 168 ASP A N   1 
ATOM   1269 C CA  . ASP A 1 166 ? 32.942  -7.894  35.915 1.00 29.88 ? 168 ASP A CA  1 
ATOM   1270 C C   . ASP A 1 166 ? 31.451  -7.814  36.227 1.00 29.54 ? 168 ASP A C   1 
ATOM   1271 O O   . ASP A 1 166 ? 30.920  -8.601  36.989 1.00 30.30 ? 168 ASP A O   1 
ATOM   1272 C CB  . ASP A 1 166 ? 33.747  -8.812  36.875 1.00 31.57 ? 168 ASP A CB  1 
ATOM   1273 C CG  . ASP A 1 166 ? 33.481  -10.341 36.637 1.00 35.01 ? 168 ASP A CG  1 
ATOM   1274 O OD1 . ASP A 1 166 ? 33.080  -10.777 35.508 1.00 32.76 ? 168 ASP A OD1 1 
ATOM   1275 O OD2 . ASP A 1 166 ? 33.702  -11.087 37.631 1.00 34.05 ? 168 ASP A OD2 1 
ATOM   1276 N N   . ALA A 1 167 ? 30.766  -6.847  35.614 1.00 29.59 ? 169 ALA A N   1 
ATOM   1277 C CA  . ALA A 1 167 ? 29.289  -6.842  35.512 1.00 28.53 ? 169 ALA A CA  1 
ATOM   1278 C C   . ALA A 1 167 ? 28.813  -7.358  34.126 1.00 28.43 ? 169 ALA A C   1 
ATOM   1279 O O   . ALA A 1 167 ? 29.511  -7.163  33.107 1.00 26.71 ? 169 ALA A O   1 
ATOM   1280 C CB  . ALA A 1 167 ? 28.731  -5.397  35.764 1.00 28.39 ? 169 ALA A CB  1 
ATOM   1281 N N   . LEU A 1 168 ? 27.602  -7.947  34.082 1.00 25.86 ? 170 LEU A N   1 
ATOM   1282 C CA  . LEU A 1 168 ? 26.985  -8.307  32.824 1.00 25.86 ? 170 LEU A CA  1 
ATOM   1283 C C   . LEU A 1 168 ? 26.233  -7.143  32.230 1.00 25.79 ? 170 LEU A C   1 
ATOM   1284 O O   . LEU A 1 168 ? 25.374  -6.565  32.889 1.00 26.44 ? 170 LEU A O   1 
ATOM   1285 C CB  . LEU A 1 168 ? 26.046  -9.514  32.989 1.00 25.77 ? 170 LEU A CB  1 
ATOM   1286 C CG  . LEU A 1 168 ? 26.698  -10.651 33.782 1.00 24.44 ? 170 LEU A CG  1 
ATOM   1287 C CD1 . LEU A 1 168 ? 25.575  -11.623 34.152 1.00 26.06 ? 170 LEU A CD1 1 
ATOM   1288 C CD2 . LEU A 1 168 ? 27.798  -11.328 32.876 1.00 23.64 ? 170 LEU A CD2 1 
ATOM   1289 N N   . PHE A 1 169 ? 26.577  -6.765  31.009 1.00 24.57 ? 171 PHE A N   1 
ATOM   1290 C CA  . PHE A 1 169 ? 25.917  -5.617  30.391 1.00 25.66 ? 171 PHE A CA  1 
ATOM   1291 C C   . PHE A 1 169 ? 24.812  -6.159  29.485 1.00 25.27 ? 171 PHE A C   1 
ATOM   1292 O O   . PHE A 1 169 ? 25.112  -6.804  28.493 1.00 25.55 ? 171 PHE A O   1 
ATOM   1293 C CB  . PHE A 1 169 ? 26.971  -4.838  29.581 1.00 23.99 ? 171 PHE A CB  1 
ATOM   1294 C CG  . PHE A 1 169 ? 26.475  -3.568  28.943 1.00 22.40 ? 171 PHE A CG  1 
ATOM   1295 C CD1 . PHE A 1 169 ? 25.505  -2.788  29.536 1.00 26.19 ? 171 PHE A CD1 1 
ATOM   1296 C CD2 . PHE A 1 169 ? 27.115  -3.085  27.813 1.00 25.19 ? 171 PHE A CD2 1 
ATOM   1297 C CE1 . PHE A 1 169 ? 25.124  -1.606  29.003 1.00 25.59 ? 171 PHE A CE1 1 
ATOM   1298 C CE2 . PHE A 1 169 ? 26.756  -1.872  27.252 1.00 23.78 ? 171 PHE A CE2 1 
ATOM   1299 C CZ  . PHE A 1 169 ? 25.769  -1.117  27.864 1.00 23.23 ? 171 PHE A CZ  1 
ATOM   1300 N N   . ILE A 1 170 ? 23.547  -5.929  29.854 1.00 26.72 ? 172 ILE A N   1 
ATOM   1301 C CA  . ILE A 1 170 ? 22.397  -6.515  29.150 1.00 26.76 ? 172 ILE A CA  1 
ATOM   1302 C C   . ILE A 1 170 ? 21.632  -5.367  28.535 1.00 26.82 ? 172 ILE A C   1 
ATOM   1303 O O   . ILE A 1 170 ? 21.212  -4.472  29.248 1.00 26.90 ? 172 ILE A O   1 
ATOM   1304 C CB  . ILE A 1 170 ? 21.537  -7.351  30.120 1.00 28.05 ? 172 ILE A CB  1 
ATOM   1305 C CG1 . ILE A 1 170 ? 22.389  -8.553  30.621 1.00 27.39 ? 172 ILE A CG1 1 
ATOM   1306 C CG2 . ILE A 1 170 ? 20.164  -7.855  29.448 1.00 27.24 ? 172 ILE A CG2 1 
ATOM   1307 C CD1 . ILE A 1 170 ? 21.907  -9.085  31.846 1.00 33.54 ? 172 ILE A CD1 1 
ATOM   1308 N N   . VAL A 1 171 ? 21.459  -5.415  27.217 1.00 24.22 ? 173 VAL A N   1 
ATOM   1309 C CA  . VAL A 1 171 ? 20.984  -4.274  26.469 1.00 23.94 ? 173 VAL A CA  1 
ATOM   1310 C C   . VAL A 1 171 ? 19.654  -4.562  25.772 1.00 24.00 ? 173 VAL A C   1 
ATOM   1311 O O   . VAL A 1 171 ? 19.505  -5.550  25.138 1.00 22.91 ? 173 VAL A O   1 
ATOM   1312 C CB  . VAL A 1 171 ? 22.077  -3.751  25.433 1.00 21.91 ? 173 VAL A CB  1 
ATOM   1313 C CG1 . VAL A 1 171 ? 21.461  -2.705  24.485 1.00 20.41 ? 173 VAL A CG1 1 
ATOM   1314 C CG2 . VAL A 1 171 ? 23.259  -3.086  26.183 1.00 23.19 ? 173 VAL A CG2 1 
ATOM   1315 N N   . ASP A 1 172 ? 18.666  -3.681  25.928 1.00 24.70 ? 174 ASP A N   1 
ATOM   1316 C CA  . ASP A 1 172 ? 17.457  -3.810  25.153 1.00 24.99 ? 174 ASP A CA  1 
ATOM   1317 C C   . ASP A 1 172 ? 17.762  -3.054  23.840 1.00 25.56 ? 174 ASP A C   1 
ATOM   1318 O O   . ASP A 1 172 ? 17.827  -1.810  23.849 1.00 27.12 ? 174 ASP A O   1 
ATOM   1319 C CB  . ASP A 1 172 ? 16.288  -3.217  25.993 1.00 24.95 ? 174 ASP A CB  1 
ATOM   1320 C CG  . ASP A 1 172 ? 15.087  -2.766  25.176 1.00 25.57 ? 174 ASP A CG  1 
ATOM   1321 O OD1 . ASP A 1 172 ? 15.084  -2.729  23.941 1.00 25.31 ? 174 ASP A OD1 1 
ATOM   1322 O OD2 . ASP A 1 172 ? 14.119  -2.360  25.800 1.00 24.28 ? 174 ASP A OD2 1 
ATOM   1323 N N   . ALA A 1 173 ? 18.017  -3.793  22.736 1.00 25.03 ? 175 ALA A N   1 
ATOM   1324 C CA  . ALA A 1 173 ? 18.219  -3.177  21.411 1.00 22.26 ? 175 ALA A CA  1 
ATOM   1325 C C   . ALA A 1 173 ? 16.950  -3.369  20.532 1.00 22.67 ? 175 ALA A C   1 
ATOM   1326 O O   . ALA A 1 173 ? 17.036  -3.501  19.329 1.00 22.20 ? 175 ALA A O   1 
ATOM   1327 C CB  . ALA A 1 173 ? 19.506  -3.715  20.713 1.00 21.11 ? 175 ALA A CB  1 
ATOM   1328 N N   . VAL A 1 174 ? 15.778  -3.401  21.143 1.00 22.37 ? 176 VAL A N   1 
ATOM   1329 C CA  . VAL A 1 174 ? 14.568  -3.819  20.445 1.00 23.87 ? 176 VAL A CA  1 
ATOM   1330 C C   . VAL A 1 174 ? 14.225  -2.825  19.300 1.00 23.47 ? 176 VAL A C   1 
ATOM   1331 O O   . VAL A 1 174 ? 13.803  -3.224  18.232 1.00 22.97 ? 176 VAL A O   1 
ATOM   1332 C CB  . VAL A 1 174 ? 13.384  -3.980  21.449 1.00 24.63 ? 176 VAL A CB  1 
ATOM   1333 C CG1 . VAL A 1 174 ? 12.061  -3.783  20.759 1.00 25.75 ? 176 VAL A CG1 1 
ATOM   1334 C CG2 . VAL A 1 174 ? 13.445  -5.334  22.226 1.00 23.42 ? 176 VAL A CG2 1 
ATOM   1335 N N   . ALA A 1 175 ? 14.379  -1.529  19.570 1.00 25.05 ? 177 ALA A N   1 
ATOM   1336 C CA  . ALA A 1 175 ? 14.022  -0.507  18.622 1.00 25.23 ? 177 ALA A CA  1 
ATOM   1337 C C   . ALA A 1 175 ? 15.131  -0.183  17.660 1.00 24.65 ? 177 ALA A C   1 
ATOM   1338 O O   . ALA A 1 175 ? 14.896  0.572   16.735 1.00 26.54 ? 177 ALA A O   1 
ATOM   1339 C CB  . ALA A 1 175 ? 13.663  0.793   19.357 1.00 25.11 ? 177 ALA A CB  1 
ATOM   1340 N N   . THR A 1 176 ? 16.355  -0.571  17.969 1.00 23.36 ? 178 THR A N   1 
ATOM   1341 C CA  . THR A 1 176 ? 17.513  -0.166  17.139 1.00 23.81 ? 178 THR A CA  1 
ATOM   1342 C C   . THR A 1 176 ? 17.994  -1.318  16.237 1.00 22.92 ? 178 THR A C   1 
ATOM   1343 O O   . THR A 1 176 ? 18.520  -1.074  15.167 1.00 24.08 ? 178 THR A O   1 
ATOM   1344 C CB  . THR A 1 176 ? 18.704  0.344   17.969 1.00 21.87 ? 178 THR A CB  1 
ATOM   1345 O OG1 . THR A 1 176 ? 18.999  -0.658  18.919 1.00 22.11 ? 178 THR A OG1 1 
ATOM   1346 C CG2 . THR A 1 176 ? 18.298  1.610   18.722 1.00 24.20 ? 178 THR A CG2 1 
ATOM   1347 N N   . ILE A 1 177 ? 17.785  -2.571  16.644 1.00 22.15 ? 179 ILE A N   1 
ATOM   1348 C CA  . ILE A 1 177 ? 18.419  -3.631  15.859 1.00 20.68 ? 179 ILE A CA  1 
ATOM   1349 C C   . ILE A 1 177 ? 17.895  -3.611  14.403 1.00 22.32 ? 179 ILE A C   1 
ATOM   1350 O O   . ILE A 1 177 ? 16.652  -3.520  14.163 1.00 21.95 ? 179 ILE A O   1 
ATOM   1351 C CB  . ILE A 1 177 ? 18.139  -5.037  16.501 1.00 21.88 ? 179 ILE A CB  1 
ATOM   1352 C CG1 . ILE A 1 177 ? 19.128  -6.141  15.972 1.00 18.47 ? 179 ILE A CG1 1 
ATOM   1353 C CG2 . ILE A 1 177 ? 16.578  -5.465  16.374 1.00 18.64 ? 179 ILE A CG2 1 
ATOM   1354 C CD1 . ILE A 1 177 ? 20.671  -5.779  16.074 1.00 16.34 ? 179 ILE A CD1 1 
ATOM   1355 N N   . GLY A 1 178 ? 18.821  -3.725  13.425 1.00 21.12 ? 180 GLY A N   1 
ATOM   1356 C CA  . GLY A 1 178 ? 18.501  -3.684  11.988 1.00 22.13 ? 180 GLY A CA  1 
ATOM   1357 C C   . GLY A 1 178 ? 18.215  -2.286  11.397 1.00 21.82 ? 180 GLY A C   1 
ATOM   1358 O O   . GLY A 1 178 ? 17.953  -2.150  10.198 1.00 22.51 ? 180 GLY A O   1 
ATOM   1359 N N   . GLY A 1 179 ? 18.309  -1.264  12.228 1.00 22.83 ? 181 GLY A N   1 
ATOM   1360 C CA  . GLY A 1 179 ? 18.022  0.124   11.809 1.00 22.05 ? 181 GLY A CA  1 
ATOM   1361 C C   . GLY A 1 179 ? 19.153  1.093   12.121 1.00 22.14 ? 181 GLY A C   1 
ATOM   1362 O O   . GLY A 1 179 ? 19.445  1.990   11.322 1.00 21.91 ? 181 GLY A O   1 
ATOM   1363 N N   . CYS A 1 180 ? 19.745  0.915   13.296 1.00 23.47 ? 182 CYS A N   1 
ATOM   1364 C CA  . CYS A 1 180 ? 20.876  1.697   13.798 1.00 26.98 ? 182 CYS A CA  1 
ATOM   1365 C C   . CYS A 1 180 ? 21.952  0.718   14.170 1.00 26.52 ? 182 CYS A C   1 
ATOM   1366 O O   . CYS A 1 180 ? 21.656  -0.428  14.576 1.00 27.70 ? 182 CYS A O   1 
ATOM   1367 C CB  . CYS A 1 180 ? 20.536  2.490   15.104 1.00 25.28 ? 182 CYS A CB  1 
ATOM   1368 S SG  . CYS A 1 180 ? 18.899  3.304   15.044 1.00 35.52 ? 182 CYS A SG  1 
ATOM   1369 N N   . GLU A 1 181 ? 23.190  1.209   14.186 1.00 26.15 ? 183 GLU A N   1 
ATOM   1370 C CA  . GLU A 1 181 ? 24.320  0.348   14.481 1.00 27.01 ? 183 GLU A CA  1 
ATOM   1371 C C   . GLU A 1 181 ? 24.086  -0.329  15.800 1.00 25.00 ? 183 GLU A C   1 
ATOM   1372 O O   . GLU A 1 181 ? 23.803  0.339   16.762 1.00 23.81 ? 183 GLU A O   1 
ATOM   1373 C CB  . GLU A 1 181 ? 25.579  1.195   14.637 1.00 27.51 ? 183 GLU A CB  1 
ATOM   1374 C CG  . GLU A 1 181 ? 26.508  1.051   13.529 1.00 33.75 ? 183 GLU A CG  1 
ATOM   1375 C CD  . GLU A 1 181 ? 27.774  1.791   13.849 1.00 40.73 ? 183 GLU A CD  1 
ATOM   1376 O OE1 . GLU A 1 181 ? 27.998  2.130   15.056 1.00 40.11 ? 183 GLU A OE1 1 
ATOM   1377 O OE2 . GLU A 1 181 ? 28.513  2.079   12.883 1.00 45.19 ? 183 GLU A OE2 1 
ATOM   1378 N N   . VAL A 1 182 ? 24.207  -1.643  15.841 1.00 25.93 ? 184 VAL A N   1 
ATOM   1379 C CA  . VAL A 1 182 ? 24.429  -2.315  17.124 1.00 26.75 ? 184 VAL A CA  1 
ATOM   1380 C C   . VAL A 1 182 ? 25.630  -3.239  17.055 1.00 26.56 ? 184 VAL A C   1 
ATOM   1381 O O   . VAL A 1 182 ? 25.719  -4.060  16.183 1.00 26.12 ? 184 VAL A O   1 
ATOM   1382 C CB  . VAL A 1 182 ? 23.143  -2.804  17.910 1.00 27.37 ? 184 VAL A CB  1 
ATOM   1383 C CG1 . VAL A 1 182 ? 21.840  -2.504  17.268 1.00 26.25 ? 184 VAL A CG1 1 
ATOM   1384 C CG2 . VAL A 1 182 ? 23.263  -4.113  18.746 1.00 24.60 ? 184 VAL A CG2 1 
ATOM   1385 N N   . LYS A 1 183 ? 26.595  -3.057  17.941 1.00 24.75 ? 185 LYS A N   1 
ATOM   1386 C CA  . LYS A 1 183 ? 27.801  -3.821  17.737 1.00 25.35 ? 185 LYS A CA  1 
ATOM   1387 C C   . LYS A 1 183 ? 28.051  -4.555  19.035 1.00 24.76 ? 185 LYS A C   1 
ATOM   1388 O O   . LYS A 1 183 ? 28.684  -4.015  19.934 1.00 24.08 ? 185 LYS A O   1 
ATOM   1389 C CB  . LYS A 1 183 ? 28.969  -2.868  17.311 1.00 25.06 ? 185 LYS A CB  1 
ATOM   1390 C CG  . LYS A 1 183 ? 28.692  -1.989  16.071 1.00 24.14 ? 185 LYS A CG  1 
ATOM   1391 C CD  . LYS A 1 183 ? 29.887  -0.936  15.932 1.00 29.60 ? 185 LYS A CD  1 
ATOM   1392 C CE  . LYS A 1 183 ? 30.371  -0.735  14.473 1.00 33.89 ? 185 LYS A CE  1 
ATOM   1393 N NZ  . LYS A 1 183 ? 31.614  0.294   14.413 1.00 40.03 ? 185 LYS A NZ  1 
ATOM   1394 N N   . VAL A 1 184 ? 27.514  -5.763  19.177 1.00 26.18 ? 186 VAL A N   1 
ATOM   1395 C CA  . VAL A 1 184 ? 27.656  -6.379  20.453 1.00 25.87 ? 186 VAL A CA  1 
ATOM   1396 C C   . VAL A 1 184 ? 29.066  -6.770  20.873 1.00 26.31 ? 186 VAL A C   1 
ATOM   1397 O O   . VAL A 1 184 ? 29.393  -6.588  22.057 1.00 26.05 ? 186 VAL A O   1 
ATOM   1398 C CB  . VAL A 1 184 ? 26.545  -7.439  20.908 1.00 27.54 ? 186 VAL A CB  1 
ATOM   1399 C CG1 . VAL A 1 184 ? 25.097  -7.189  20.358 1.00 22.86 ? 186 VAL A CG1 1 
ATOM   1400 C CG2 . VAL A 1 184 ? 27.048  -8.879  20.998 1.00 26.55 ? 186 VAL A CG2 1 
ATOM   1401 N N   . ASP A 1 185 ? 29.884  -7.325  19.974 1.00 26.22 ? 187 ASP A N   1 
ATOM   1402 C CA  . ASP A 1 185 ? 31.282  -7.593  20.360 1.00 26.93 ? 187 ASP A CA  1 
ATOM   1403 C C   . ASP A 1 185 ? 32.071  -6.337  20.643 1.00 27.50 ? 187 ASP A C   1 
ATOM   1404 O O   . ASP A 1 185 ? 32.681  -6.212  21.728 1.00 26.42 ? 187 ASP A O   1 
ATOM   1405 C CB  . ASP A 1 185 ? 32.020  -8.502  19.369 1.00 27.44 ? 187 ASP A CB  1 
ATOM   1406 C CG  . ASP A 1 185 ? 31.466  -9.928  19.414 1.00 26.99 ? 187 ASP A CG  1 
ATOM   1407 O OD1 . ASP A 1 185 ? 30.557  -10.166 20.228 1.00 25.39 ? 187 ASP A OD1 1 
ATOM   1408 O OD2 . ASP A 1 185 ? 31.889  -10.789 18.647 1.00 29.98 ? 187 ASP A OD2 1 
ATOM   1409 N N   . GLU A 1 186 ? 32.012  -5.398  19.707 1.00 25.93 ? 188 GLU A N   1 
ATOM   1410 C CA  . GLU A 1 186 ? 32.783  -4.169  19.851 1.00 28.37 ? 188 GLU A CA  1 
ATOM   1411 C C   . GLU A 1 186 ? 32.414  -3.362  21.101 1.00 26.92 ? 188 GLU A C   1 
ATOM   1412 O O   . GLU A 1 186 ? 33.273  -2.708  21.670 1.00 26.61 ? 188 GLU A O   1 
ATOM   1413 C CB  . GLU A 1 186 ? 32.622  -3.274  18.624 1.00 27.67 ? 188 GLU A CB  1 
ATOM   1414 C CG  . GLU A 1 186 ? 33.744  -3.491  17.670 1.00 37.93 ? 188 GLU A CG  1 
ATOM   1415 C CD  . GLU A 1 186 ? 33.746  -2.505  16.478 1.00 44.83 ? 188 GLU A CD  1 
ATOM   1416 O OE1 . GLU A 1 186 ? 33.653  -3.021  15.324 1.00 45.84 ? 188 GLU A OE1 1 
ATOM   1417 O OE2 . GLU A 1 186 ? 33.805  -1.250  16.714 1.00 41.82 ? 188 GLU A OE2 1 
ATOM   1418 N N   . TRP A 1 187 ? 31.143  -3.401  21.515 1.00 26.00 ? 189 TRP A N   1 
ATOM   1419 C CA  . TRP A 1 187 ? 30.715  -2.560  22.623 1.00 24.99 ? 189 TRP A CA  1 
ATOM   1420 C C   . TRP A 1 187 ? 30.710  -3.327  23.935 1.00 24.99 ? 189 TRP A C   1 
ATOM   1421 O O   . TRP A 1 187 ? 30.237  -2.819  24.944 1.00 25.88 ? 189 TRP A O   1 
ATOM   1422 C CB  . TRP A 1 187 ? 29.341  -1.957  22.314 1.00 23.80 ? 189 TRP A CB  1 
ATOM   1423 C CG  . TRP A 1 187 ? 29.350  -1.031  21.148 1.00 27.88 ? 189 TRP A CG  1 
ATOM   1424 C CD1 . TRP A 1 187 ? 30.440  -0.483  20.520 1.00 25.80 ? 189 TRP A CD1 1 
ATOM   1425 C CD2 . TRP A 1 187 ? 28.198  -0.505  20.477 1.00 28.26 ? 189 TRP A CD2 1 
ATOM   1426 N NE1 . TRP A 1 187 ? 30.037  0.342   19.521 1.00 26.09 ? 189 TRP A NE1 1 
ATOM   1427 C CE2 . TRP A 1 187 ? 28.668  0.359   19.468 1.00 28.18 ? 189 TRP A CE2 1 
ATOM   1428 C CE3 . TRP A 1 187 ? 26.824  -0.692  20.632 1.00 26.05 ? 189 TRP A CE3 1 
ATOM   1429 C CZ2 . TRP A 1 187 ? 27.797  1.036   18.558 1.00 29.59 ? 189 TRP A CZ2 1 
ATOM   1430 C CZ3 . TRP A 1 187 ? 25.947  -0.006  19.748 1.00 29.90 ? 189 TRP A CZ3 1 
ATOM   1431 C CH2 . TRP A 1 187 ? 26.458  0.866   18.735 1.00 28.81 ? 189 TRP A CH2 1 
ATOM   1432 N N   . LYS A 1 188 ? 31.200  -4.577  23.900 1.00 24.57 ? 190 LYS A N   1 
ATOM   1433 C CA  . LYS A 1 188 ? 31.339  -5.408  25.064 1.00 25.24 ? 190 LYS A CA  1 
ATOM   1434 C C   . LYS A 1 188 ? 29.968  -5.558  25.723 1.00 25.16 ? 190 LYS A C   1 
ATOM   1435 O O   . LYS A 1 188 ? 29.822  -5.452  26.943 1.00 25.67 ? 190 LYS A O   1 
ATOM   1436 C CB  . LYS A 1 188 ? 32.347  -4.812  26.079 1.00 24.54 ? 190 LYS A CB  1 
ATOM   1437 C CG  . LYS A 1 188 ? 33.778  -4.509  25.537 1.00 28.40 ? 190 LYS A CG  1 
ATOM   1438 C CD  . LYS A 1 188 ? 34.500  -5.684  24.929 1.00 30.55 ? 190 LYS A CD  1 
ATOM   1439 C CE  . LYS A 1 188 ? 36.030  -5.569  25.096 1.00 34.28 ? 190 LYS A CE  1 
ATOM   1440 N NZ  . LYS A 1 188 ? 36.484  -4.253  24.615 1.00 34.86 ? 190 LYS A NZ  1 
ATOM   1441 N N   . ILE A 1 189 ? 28.971  -5.776  24.895 1.00 25.35 ? 191 ILE A N   1 
ATOM   1442 C CA  . ILE A 1 189 ? 27.648  -6.170  25.374 1.00 24.62 ? 191 ILE A CA  1 
ATOM   1443 C C   . ILE A 1 189 ? 27.651  -7.671  25.620 1.00 24.44 ? 191 ILE A C   1 
ATOM   1444 O O   . ILE A 1 189 ? 28.059  -8.487  24.739 1.00 23.41 ? 191 ILE A O   1 
ATOM   1445 C CB  . ILE A 1 189 ? 26.553  -5.767  24.336 1.00 25.52 ? 191 ILE A CB  1 
ATOM   1446 C CG1 . ILE A 1 189 ? 26.543  -4.246  24.148 1.00 23.58 ? 191 ILE A CG1 1 
ATOM   1447 C CG2 . ILE A 1 189 ? 25.161  -6.397  24.677 1.00 23.24 ? 191 ILE A CG2 1 
ATOM   1448 C CD1 . ILE A 1 189 ? 25.507  -3.748  22.997 1.00 20.42 ? 191 ILE A CD1 1 
ATOM   1449 N N   . ASP A 1 190 ? 27.211  -8.036  26.818 1.00 25.38 ? 192 ASP A N   1 
ATOM   1450 C CA  . ASP A 1 190 ? 27.144  -9.435  27.211 1.00 25.76 ? 192 ASP A CA  1 
ATOM   1451 C C   . ASP A 1 190 ? 25.870  -10.156 26.767 1.00 26.06 ? 192 ASP A C   1 
ATOM   1452 O O   . ASP A 1 190 ? 25.905  -11.352 26.452 1.00 27.21 ? 192 ASP A O   1 
ATOM   1453 C CB  . ASP A 1 190 ? 27.346  -9.555  28.731 1.00 26.21 ? 192 ASP A CB  1 
ATOM   1454 C CG  . ASP A 1 190 ? 28.668  -8.984  29.197 1.00 26.43 ? 192 ASP A CG  1 
ATOM   1455 O OD1 . ASP A 1 190 ? 29.703  -9.604  28.843 1.00 22.90 ? 192 ASP A OD1 1 
ATOM   1456 O OD2 . ASP A 1 190 ? 28.661  -7.939  29.928 1.00 25.90 ? 192 ASP A OD2 1 
ATOM   1457 N N   . ALA A 1 191 ? 24.738  -9.461  26.797 1.00 25.25 ? 193 ALA A N   1 
ATOM   1458 C CA  . ALA A 1 191 ? 23.525  -9.963  26.242 1.00 24.81 ? 193 ALA A CA  1 
ATOM   1459 C C   . ALA A 1 191 ? 22.764  -8.839  25.600 1.00 26.30 ? 193 ALA A C   1 
ATOM   1460 O O   . ALA A 1 191 ? 22.732  -7.683  26.145 1.00 27.61 ? 193 ALA A O   1 
ATOM   1461 C CB  . ALA A 1 191 ? 22.640  -10.696 27.346 1.00 26.55 ? 193 ALA A CB  1 
ATOM   1462 N N   . ALA A 1 192 ? 22.157  -9.131  24.426 1.00 25.98 ? 194 ALA A N   1 
ATOM   1463 C CA  . ALA A 1 192 ? 21.357  -8.126  23.697 1.00 25.56 ? 194 ALA A CA  1 
ATOM   1464 C C   . ALA A 1 192 ? 20.061  -8.806  23.300 1.00 25.08 ? 194 ALA A C   1 
ATOM   1465 O O   . ALA A 1 192 ? 20.066  -9.947  22.928 1.00 23.12 ? 194 ALA A O   1 
ATOM   1466 C CB  . ALA A 1 192 ? 22.065  -7.618  22.434 1.00 23.44 ? 194 ALA A CB  1 
ATOM   1467 N N   . ILE A 1 193 ? 18.956  -8.069  23.349 1.00 25.56 ? 195 ILE A N   1 
ATOM   1468 C CA  . ILE A 1 193 ? 17.714  -8.638  22.934 1.00 24.71 ? 195 ILE A CA  1 
ATOM   1469 C C   . ILE A 1 193 ? 17.159  -7.716  21.901 1.00 24.83 ? 195 ILE A C   1 
ATOM   1470 O O   . ILE A 1 193 ? 17.089  -6.487  22.092 1.00 25.64 ? 195 ILE A O   1 
ATOM   1471 C CB  . ILE A 1 193 ? 16.686  -8.693  24.121 1.00 25.03 ? 195 ILE A CB  1 
ATOM   1472 C CG1 . ILE A 1 193 ? 17.250  -9.445  25.348 1.00 24.25 ? 195 ILE A CG1 1 
ATOM   1473 C CG2 . ILE A 1 193 ? 15.313  -9.169  23.600 1.00 24.09 ? 195 ILE A CG2 1 
ATOM   1474 C CD1 . ILE A 1 193 ? 17.803  -8.505  26.557 1.00 26.14 ? 195 ILE A CD1 1 
ATOM   1475 N N   . GLY A 1 194 ? 16.718  -8.307  20.807 1.00 26.11 ? 196 GLY A N   1 
ATOM   1476 C CA  . GLY A 1 194 ? 16.029  -7.538  19.758 1.00 24.06 ? 196 GLY A CA  1 
ATOM   1477 C C   . GLY A 1 194 ? 14.545  -7.770  19.752 1.00 22.43 ? 196 GLY A C   1 
ATOM   1478 O O   . GLY A 1 194 ? 14.020  -8.569  20.542 1.00 23.82 ? 196 GLY A O   1 
ATOM   1479 N N   . GLY A 1 195 ? 13.847  -7.068  18.865 1.00 21.93 ? 197 GLY A N   1 
ATOM   1480 C CA  . GLY A 1 195 ? 12.457  -7.402  18.532 1.00 20.71 ? 197 GLY A CA  1 
ATOM   1481 C C   . GLY A 1 195 ? 12.280  -7.436  17.035 1.00 21.04 ? 197 GLY A C   1 
ATOM   1482 O O   . GLY A 1 195 ? 13.173  -7.043  16.272 1.00 21.18 ? 197 GLY A O   1 
ATOM   1483 N N   . THR A 1 196 ? 11.155  -7.940  16.571 1.00 21.15 ? 198 THR A N   1 
ATOM   1484 C CA  . THR A 1 196 ? 10.986  -8.168  15.139 1.00 21.84 ? 198 THR A CA  1 
ATOM   1485 C C   . THR A 1 196 ? 10.189  -7.078  14.405 1.00 21.16 ? 198 THR A C   1 
ATOM   1486 O O   . THR A 1 196 ? 10.424  -6.859  13.206 1.00 20.57 ? 198 THR A O   1 
ATOM   1487 C CB  . THR A 1 196 ? 10.236  -9.505  14.913 1.00 23.31 ? 198 THR A CB  1 
ATOM   1488 O OG1 . THR A 1 196 ? 9.207   -9.638  15.909 1.00 22.87 ? 198 THR A OG1 1 
ATOM   1489 C CG2 . THR A 1 196 ? 11.178  -10.667 15.104 1.00 27.79 ? 198 THR A CG2 1 
ATOM   1490 N N   . GLN A 1 197 ? 9.251   -6.411  15.084 1.00 20.54 ? 199 GLN A N   1 
ATOM   1491 C CA  . GLN A 1 197 ? 8.214   -5.645  14.416 1.00 21.91 ? 199 GLN A CA  1 
ATOM   1492 C C   . GLN A 1 197 ? 8.626   -4.191  14.205 1.00 23.21 ? 199 GLN A C   1 
ATOM   1493 O O   . GLN A 1 197 ? 7.781   -3.349  13.792 1.00 23.66 ? 199 GLN A O   1 
ATOM   1494 C CB  . GLN A 1 197 ? 6.886   -5.700  15.196 1.00 24.22 ? 199 GLN A CB  1 
ATOM   1495 C CG  . GLN A 1 197 ? 6.933   -4.810  16.563 1.00 25.86 ? 199 GLN A CG  1 
ATOM   1496 C CD  . GLN A 1 197 ? 7.430   -5.596  17.797 1.00 27.85 ? 199 GLN A CD  1 
ATOM   1497 O OE1 . GLN A 1 197 ? 8.007   -6.676  17.659 1.00 25.74 ? 199 GLN A OE1 1 
ATOM   1498 N NE2 . GLN A 1 197 ? 7.182   -5.062  18.995 1.00 25.35 ? 199 GLN A NE2 1 
ATOM   1499 N N   . LYS A 1 198 ? 9.890   -3.897  14.528 1.00 22.28 ? 200 LYS A N   1 
ATOM   1500 C CA  . LYS A 1 198 ? 10.504  -2.571  14.392 1.00 21.93 ? 200 LYS A CA  1 
ATOM   1501 C C   . LYS A 1 198 ? 11.434  -2.515  13.183 1.00 21.74 ? 200 LYS A C   1 
ATOM   1502 O O   . LYS A 1 198 ? 10.981  -2.809  12.108 1.00 21.29 ? 200 LYS A O   1 
ATOM   1503 C CB  . LYS A 1 198 ? 11.105  -2.093  15.711 1.00 21.69 ? 200 LYS A CB  1 
ATOM   1504 C CG  . LYS A 1 198 ? 9.890   -1.846  16.748 1.00 23.84 ? 200 LYS A CG  1 
ATOM   1505 C CD  . LYS A 1 198 ? 10.267  -1.290  18.154 1.00 26.80 ? 200 LYS A CD  1 
ATOM   1506 C CE  . LYS A 1 198 ? 9.093   -1.538  19.090 1.00 27.95 ? 200 LYS A CE  1 
ATOM   1507 N NZ  . LYS A 1 198 ? 8.976   -0.733  20.293 1.00 40.07 ? 200 LYS A NZ  1 
ATOM   1508 N N   . CYS A 1 199 ? 12.698  -2.149  13.317 1.00 19.79 ? 201 CYS A N   1 
ATOM   1509 C CA  . CYS A 1 199 ? 13.496  -2.049  12.127 1.00 21.39 ? 201 CYS A CA  1 
ATOM   1510 C C   . CYS A 1 199 ? 13.646  -3.305  11.247 1.00 23.09 ? 201 CYS A C   1 
ATOM   1511 O O   . CYS A 1 199 ? 14.099  -3.190  10.084 1.00 23.17 ? 201 CYS A O   1 
ATOM   1512 C CB  . CYS A 1 199 ? 14.859  -1.484  12.512 1.00 20.12 ? 201 CYS A CB  1 
ATOM   1513 S SG  . CYS A 1 199 ? 14.629  0.122   13.224 1.00 23.33 ? 201 CYS A SG  1 
ATOM   1514 N N   . LEU A 1 200 ? 13.380  -4.480  11.824 1.00 20.65 ? 202 LEU A N   1 
ATOM   1515 C CA  . LEU A 1 200 ? 13.377  -5.765  11.109 1.00 22.65 ? 202 LEU A CA  1 
ATOM   1516 C C   . LEU A 1 200 ? 12.127  -6.024  10.219 1.00 22.34 ? 202 LEU A C   1 
ATOM   1517 O O   . LEU A 1 200 ? 12.161  -6.832  9.299  1.00 22.61 ? 202 LEU A O   1 
ATOM   1518 C CB  . LEU A 1 200 ? 13.594  -6.969  12.110 1.00 21.49 ? 202 LEU A CB  1 
ATOM   1519 C CG  . LEU A 1 200 ? 14.964  -6.892  12.872 1.00 21.27 ? 202 LEU A CG  1 
ATOM   1520 C CD1 . LEU A 1 200 ? 15.067  -8.218  13.639 1.00 22.22 ? 202 LEU A CD1 1 
ATOM   1521 C CD2 . LEU A 1 200 ? 16.207  -6.692  11.914 1.00 20.61 ? 202 LEU A CD2 1 
ATOM   1522 N N   . SER A 1 201 ? 11.040  -5.307  10.480 1.00 23.48 ? 203 SER A N   1 
ATOM   1523 C CA  . SER A 1 201 ? 9.812   -5.444  9.676  1.00 22.30 ? 203 SER A CA  1 
ATOM   1524 C C   . SER A 1 201 ? 9.406   -6.918  9.563  1.00 21.36 ? 203 SER A C   1 
ATOM   1525 O O   . SER A 1 201 ? 9.088   -7.429  8.475  1.00 19.00 ? 203 SER A O   1 
ATOM   1526 C CB  . SER A 1 201 ? 10.008  -4.814  8.273  1.00 22.12 ? 203 SER A CB  1 
ATOM   1527 O OG  . SER A 1 201 ? 9.888   -3.419  8.430  1.00 24.77 ? 203 SER A OG  1 
ATOM   1528 N N   . VAL A 1 202 ? 9.449   -7.588  10.702 1.00 22.53 ? 204 VAL A N   1 
ATOM   1529 C CA  . VAL A 1 202 ? 8.893   -8.937  10.841 1.00 24.74 ? 204 VAL A CA  1 
ATOM   1530 C C   . VAL A 1 202 ? 7.702   -8.927  11.774 1.00 25.71 ? 204 VAL A C   1 
ATOM   1531 O O   . VAL A 1 202 ? 7.741   -8.232  12.738 1.00 27.92 ? 204 VAL A O   1 
ATOM   1532 C CB  . VAL A 1 202 ? 10.023  -9.915  11.261 1.00 24.69 ? 204 VAL A CB  1 
ATOM   1533 C CG1 . VAL A 1 202 ? 9.502   -11.277 11.749 1.00 21.31 ? 204 VAL A CG1 1 
ATOM   1534 C CG2 . VAL A 1 202 ? 10.993  -10.033 10.091 1.00 21.79 ? 204 VAL A CG2 1 
ATOM   1535 N N   . PRO A 1 203 ? 6.611   -9.685  11.469 1.00 26.44 ? 205 PRO A N   1 
ATOM   1536 C CA  . PRO A 1 203 ? 5.449   -9.620  12.397 1.00 27.04 ? 205 PRO A CA  1 
ATOM   1537 C C   . PRO A 1 203 ? 5.891   -9.756  13.847 1.00 27.83 ? 205 PRO A C   1 
ATOM   1538 O O   . PRO A 1 203 ? 6.773   -10.583 14.136 1.00 27.68 ? 205 PRO A O   1 
ATOM   1539 C CB  . PRO A 1 203 ? 4.597   -10.827 11.986 1.00 25.86 ? 205 PRO A CB  1 
ATOM   1540 C CG  . PRO A 1 203 ? 4.861   -10.877 10.529 1.00 28.65 ? 205 PRO A CG  1 
ATOM   1541 C CD  . PRO A 1 203 ? 6.367   -10.606 10.368 1.00 24.44 ? 205 PRO A CD  1 
ATOM   1542 N N   . SER A 1 204 ? 5.266   -8.965  14.741 1.00 30.33 ? 206 SER A N   1 
ATOM   1543 C CA  . SER A 1 204 ? 5.654   -8.934  16.162 1.00 33.13 ? 206 SER A CA  1 
ATOM   1544 C C   . SER A 1 204 ? 5.327   -10.289 16.717 1.00 32.72 ? 206 SER A C   1 
ATOM   1545 O O   . SER A 1 204 ? 4.507   -10.995 16.126 1.00 32.87 ? 206 SER A O   1 
ATOM   1546 C CB  . SER A 1 204 ? 4.875   -7.863  16.892 1.00 32.83 ? 206 SER A CB  1 
ATOM   1547 O OG  . SER A 1 204 ? 3.652   -7.775  16.183 1.00 39.77 ? 206 SER A OG  1 
ATOM   1548 N N   . GLY A 1 205 ? 5.925   -10.620 17.849 1.00 33.00 ? 207 GLY A N   1 
ATOM   1549 C CA  . GLY A 1 205 ? 5.755   -11.949 18.422 1.00 34.92 ? 207 GLY A CA  1 
ATOM   1550 C C   . GLY A 1 205 ? 6.953   -12.886 18.373 1.00 35.20 ? 207 GLY A C   1 
ATOM   1551 O O   . GLY A 1 205 ? 6.818   -14.102 18.601 1.00 34.26 ? 207 GLY A O   1 
ATOM   1552 N N   . MET A 1 206 ? 8.158   -12.328 18.143 1.00 36.43 ? 208 MET A N   1 
ATOM   1553 C CA  . MET A 1 206 ? 9.362   -13.100 18.488 1.00 36.82 ? 208 MET A CA  1 
ATOM   1554 C C   . MET A 1 206 ? 10.428  -12.147 18.897 1.00 37.14 ? 208 MET A C   1 
ATOM   1555 O O   . MET A 1 206 ? 10.335  -10.951 18.544 1.00 37.32 ? 208 MET A O   1 
ATOM   1556 C CB  . MET A 1 206 ? 9.825   -14.027 17.353 1.00 38.92 ? 208 MET A CB  1 
ATOM   1557 C CG  . MET A 1 206 ? 9.594   -15.566 17.579 1.00 33.58 ? 208 MET A CG  1 
ATOM   1558 S SD  . MET A 1 206 ? 10.386  -16.179 16.107 1.00 43.37 ? 208 MET A SD  1 
ATOM   1559 C CE  . MET A 1 206 ? 10.595  -17.947 16.302 1.00 30.70 ? 208 MET A CE  1 
ATOM   1560 N N   . ALA A 1 207 ? 11.393  -12.655 19.690 1.00 35.65 ? 209 ALA A N   1 
ATOM   1561 C CA  . ALA A 1 207 ? 12.417  -11.833 20.268 1.00 34.10 ? 209 ALA A CA  1 
ATOM   1562 C C   . ALA A 1 207 ? 13.801  -12.508 20.077 1.00 32.70 ? 209 ALA A C   1 
ATOM   1563 O O   . ALA A 1 207 ? 14.152  -13.418 20.798 1.00 35.22 ? 209 ALA A O   1 
ATOM   1564 C CB  . ALA A 1 207 ? 12.122  -11.605 21.744 1.00 34.56 ? 209 ALA A CB  1 
ATOM   1565 N N   . PRO A 1 208 ? 14.561  -12.084 19.079 1.00 30.12 ? 210 PRO A N   1 
ATOM   1566 C CA  . PRO A 1 208 ? 15.947  -12.573 18.859 1.00 28.82 ? 210 PRO A CA  1 
ATOM   1567 C C   . PRO A 1 208 ? 16.859  -12.112 19.997 1.00 26.22 ? 210 PRO A C   1 
ATOM   1568 O O   . PRO A 1 208 ? 16.850  -10.924 20.362 1.00 25.71 ? 210 PRO A O   1 
ATOM   1569 C CB  . PRO A 1 208 ? 16.407  -11.863 17.566 1.00 27.78 ? 210 PRO A CB  1 
ATOM   1570 C CG  . PRO A 1 208 ? 15.206  -11.255 16.971 1.00 29.52 ? 210 PRO A CG  1 
ATOM   1571 C CD  . PRO A 1 208 ? 14.140  -11.105 18.072 1.00 30.06 ? 210 PRO A CD  1 
ATOM   1572 N N   . ILE A 1 209 ? 17.641  -13.038 20.515 1.00 25.80 ? 211 ILE A N   1 
ATOM   1573 C CA  . ILE A 1 209 ? 18.553  -12.728 21.619 1.00 25.94 ? 211 ILE A CA  1 
ATOM   1574 C C   . ILE A 1 209 ? 19.909  -13.202 21.261 1.00 24.70 ? 211 ILE A C   1 
ATOM   1575 O O   . ILE A 1 209 ? 20.043  -14.118 20.464 1.00 25.66 ? 211 ILE A O   1 
ATOM   1576 C CB  . ILE A 1 209 ? 18.130  -13.346 22.988 1.00 25.17 ? 211 ILE A CB  1 
ATOM   1577 C CG1 . ILE A 1 209 ? 18.160  -14.863 22.945 1.00 26.08 ? 211 ILE A CG1 1 
ATOM   1578 C CG2 . ILE A 1 209 ? 16.743  -12.880 23.401 1.00 27.33 ? 211 ILE A CG2 1 
ATOM   1579 C CD1 . ILE A 1 209 ? 17.835  -15.544 24.346 1.00 28.15 ? 211 ILE A CD1 1 
ATOM   1580 N N   . THR A 1 210 ? 20.916  -12.590 21.863 1.00 24.65 ? 212 THR A N   1 
ATOM   1581 C CA  . THR A 1 210 ? 22.234  -13.111 21.797 1.00 23.67 ? 212 THR A CA  1 
ATOM   1582 C C   . THR A 1 210 ? 22.940  -12.871 23.128 1.00 25.10 ? 212 THR A C   1 
ATOM   1583 O O   . THR A 1 210 ? 22.701  -11.856 23.829 1.00 24.80 ? 212 THR A O   1 
ATOM   1584 C CB  . THR A 1 210 ? 23.060  -12.486 20.592 1.00 25.22 ? 212 THR A CB  1 
ATOM   1585 O OG1 . THR A 1 210 ? 24.269  -13.213 20.386 1.00 21.73 ? 212 THR A OG1 1 
ATOM   1586 C CG2 . THR A 1 210 ? 23.363  -11.033 20.785 1.00 20.03 ? 212 THR A CG2 1 
ATOM   1587 N N   . TYR A 1 211 ? 23.873  -13.763 23.436 1.00 25.17 ? 213 TYR A N   1 
ATOM   1588 C CA  . TYR A 1 211 ? 24.710  -13.591 24.605 1.00 26.31 ? 213 TYR A CA  1 
ATOM   1589 C C   . TYR A 1 211 ? 25.986  -14.437 24.526 1.00 26.79 ? 213 TYR A C   1 
ATOM   1590 O O   . TYR A 1 211 ? 26.060  -15.353 23.722 1.00 26.84 ? 213 TYR A O   1 
ATOM   1591 C CB  . TYR A 1 211 ? 23.916  -13.890 25.866 1.00 24.24 ? 213 TYR A CB  1 
ATOM   1592 C CG  . TYR A 1 211 ? 23.341  -15.280 25.924 1.00 27.49 ? 213 TYR A CG  1 
ATOM   1593 C CD1 . TYR A 1 211 ? 24.098  -16.378 26.389 1.00 28.94 ? 213 TYR A CD1 1 
ATOM   1594 C CD2 . TYR A 1 211 ? 22.024  -15.507 25.546 1.00 24.59 ? 213 TYR A CD2 1 
ATOM   1595 C CE1 . TYR A 1 211 ? 23.512  -17.674 26.486 1.00 25.52 ? 213 TYR A CE1 1 
ATOM   1596 C CE2 . TYR A 1 211 ? 21.459  -16.766 25.629 1.00 27.24 ? 213 TYR A CE2 1 
ATOM   1597 C CZ  . TYR A 1 211 ? 22.202  -17.834 26.068 1.00 27.47 ? 213 TYR A CZ  1 
ATOM   1598 O OH  . TYR A 1 211 ? 21.581  -19.034 26.118 1.00 25.41 ? 213 TYR A OH  1 
ATOM   1599 N N   . ASN A 1 212 ? 26.980  -14.063 25.343 1.00 28.07 ? 214 ASN A N   1 
ATOM   1600 C CA  . ASN A 1 212 ? 28.347  -14.644 25.357 1.00 28.41 ? 214 ASN A CA  1 
ATOM   1601 C C   . ASN A 1 212 ? 28.515  -15.686 26.439 1.00 29.14 ? 214 ASN A C   1 
ATOM   1602 O O   . ASN A 1 212 ? 27.543  -16.068 27.098 1.00 29.60 ? 214 ASN A O   1 
ATOM   1603 C CB  . ASN A 1 212 ? 29.452  -13.534 25.466 1.00 27.48 ? 214 ASN A CB  1 
ATOM   1604 C CG  . ASN A 1 212 ? 29.357  -12.672 26.762 1.00 26.52 ? 214 ASN A CG  1 
ATOM   1605 O OD1 . ASN A 1 212 ? 28.644  -12.994 27.703 1.00 26.78 ? 214 ASN A OD1 1 
ATOM   1606 N ND2 . ASN A 1 212 ? 30.097  -11.580 26.789 1.00 25.18 ? 214 ASN A ND2 1 
ATOM   1607 N N   . GLU A 1 213 ? 29.754  -16.164 26.606 1.00 31.76 ? 215 GLU A N   1 
ATOM   1608 C CA  . GLU A 1 213 ? 30.142  -17.236 27.540 1.00 31.13 ? 215 GLU A CA  1 
ATOM   1609 C C   . GLU A 1 213 ? 30.064  -16.735 28.997 1.00 30.87 ? 215 GLU A C   1 
ATOM   1610 O O   . GLU A 1 213 ? 29.675  -17.494 29.889 1.00 30.75 ? 215 GLU A O   1 
ATOM   1611 C CB  . GLU A 1 213 ? 31.537  -17.777 27.155 1.00 32.42 ? 215 GLU A CB  1 
ATOM   1612 C CG  . GLU A 1 213 ? 32.397  -18.306 28.329 1.00 39.37 ? 215 GLU A CG  1 
ATOM   1613 C CD  . GLU A 1 213 ? 33.754  -19.055 27.935 1.00 48.17 ? 215 GLU A CD  1 
ATOM   1614 O OE1 . GLU A 1 213 ? 33.962  -20.193 28.435 1.00 47.03 ? 215 GLU A OE1 1 
ATOM   1615 O OE2 . GLU A 1 213 ? 34.597  -18.507 27.157 1.00 49.07 ? 215 GLU A OE2 1 
ATOM   1616 N N   . ARG A 1 214 ? 30.356  -15.443 29.226 1.00 30.59 ? 216 ARG A N   1 
ATOM   1617 C CA  . ARG A 1 214 ? 30.082  -14.828 30.557 1.00 30.22 ? 216 ARG A CA  1 
ATOM   1618 C C   . ARG A 1 214 ? 28.629  -15.037 30.978 1.00 28.07 ? 216 ARG A C   1 
ATOM   1619 O O   . ARG A 1 214 ? 28.366  -15.516 32.082 1.00 26.34 ? 216 ARG A O   1 
ATOM   1620 C CB  . ARG A 1 214 ? 30.434  -13.331 30.610 1.00 29.22 ? 216 ARG A CB  1 
ATOM   1621 C CG  . ARG A 1 214 ? 31.912  -13.027 30.340 1.00 31.06 ? 216 ARG A CG  1 
ATOM   1622 C CD  . ARG A 1 214 ? 32.470  -11.954 31.311 1.00 34.97 ? 216 ARG A CD  1 
ATOM   1623 N NE  . ARG A 1 214 ? 31.846  -10.711 30.993 1.00 34.33 ? 216 ARG A NE  1 
ATOM   1624 C CZ  . ARG A 1 214 ? 31.411  -9.804  31.840 1.00 30.70 ? 216 ARG A CZ  1 
ATOM   1625 N NH1 . ARG A 1 214 ? 31.602  -9.907  33.126 1.00 27.15 ? 216 ARG A NH1 1 
ATOM   1626 N NH2 . ARG A 1 214 ? 30.810  -8.736  31.337 1.00 32.35 ? 216 ARG A NH2 1 
ATOM   1627 N N   . VAL A 1 215 ? 27.695  -14.684 30.087 1.00 26.70 ? 217 VAL A N   1 
ATOM   1628 C CA  . VAL A 1 215 ? 26.243  -14.933 30.320 1.00 24.93 ? 217 VAL A CA  1 
ATOM   1629 C C   . VAL A 1 215 ? 25.897  -16.430 30.428 1.00 23.90 ? 217 VAL A C   1 
ATOM   1630 O O   . VAL A 1 215 ? 25.181  -16.835 31.352 1.00 22.20 ? 217 VAL A O   1 
ATOM   1631 C CB  . VAL A 1 215 ? 25.318  -14.220 29.329 1.00 25.64 ? 217 VAL A CB  1 
ATOM   1632 C CG1 . VAL A 1 215 ? 23.829  -14.473 29.692 1.00 23.27 ? 217 VAL A CG1 1 
ATOM   1633 C CG2 . VAL A 1 215 ? 25.567  -12.737 29.393 1.00 24.71 ? 217 VAL A CG2 1 
ATOM   1634 N N   . ALA A 1 216 ? 26.472  -17.238 29.546 1.00 23.75 ? 218 ALA A N   1 
ATOM   1635 C CA  . ALA A 1 216 ? 26.124  -18.664 29.490 1.00 25.85 ? 218 ALA A CA  1 
ATOM   1636 C C   . ALA A 1 216 ? 26.596  -19.392 30.769 1.00 25.85 ? 218 ALA A C   1 
ATOM   1637 O O   . ALA A 1 216 ? 25.851  -20.178 31.337 1.00 26.55 ? 218 ALA A O   1 
ATOM   1638 C CB  . ALA A 1 216 ? 26.672  -19.371 28.181 1.00 25.47 ? 218 ALA A CB  1 
ATOM   1639 N N   . ASP A 1 217 ? 27.800  -19.087 31.258 1.00 27.52 ? 219 ASP A N   1 
ATOM   1640 C CA  . ASP A 1 217 ? 28.253  -19.711 32.531 1.00 27.47 ? 219 ASP A CA  1 
ATOM   1641 C C   . ASP A 1 217 ? 27.357  -19.398 33.757 1.00 27.93 ? 219 ASP A C   1 
ATOM   1642 O O   . ASP A 1 217 ? 27.176  -20.264 34.616 1.00 27.60 ? 219 ASP A O   1 
ATOM   1643 C CB  . ASP A 1 217 ? 29.716  -19.358 32.821 1.00 27.99 ? 219 ASP A CB  1 
ATOM   1644 C CG  . ASP A 1 217 ? 30.650  -19.899 31.753 1.00 28.42 ? 219 ASP A CG  1 
ATOM   1645 O OD1 . ASP A 1 217 ? 31.789  -19.475 31.711 1.00 31.46 ? 219 ASP A OD1 1 
ATOM   1646 O OD2 . ASP A 1 217 ? 30.203  -20.708 30.907 1.00 33.10 ? 219 ASP A OD2 1 
ATOM   1647 N N   . VAL A 1 218 ? 26.829  -18.177 33.861 1.00 26.40 ? 220 VAL A N   1 
ATOM   1648 C CA  . VAL A 1 218 ? 25.899  -17.848 34.942 1.00 26.52 ? 220 VAL A CA  1 
ATOM   1649 C C   . VAL A 1 218 ? 24.597  -18.660 34.777 1.00 27.95 ? 220 VAL A C   1 
ATOM   1650 O O   . VAL A 1 218 ? 24.041  -19.109 35.753 1.00 28.44 ? 220 VAL A O   1 
ATOM   1651 C CB  . VAL A 1 218 ? 25.576  -16.340 34.955 1.00 26.60 ? 220 VAL A CB  1 
ATOM   1652 C CG1 . VAL A 1 218 ? 24.347  -16.047 35.843 1.00 28.04 ? 220 VAL A CG1 1 
ATOM   1653 C CG2 . VAL A 1 218 ? 26.779  -15.530 35.375 1.00 25.15 ? 220 VAL A CG2 1 
ATOM   1654 N N   . ILE A 1 219 ? 24.147  -18.878 33.533 1.00 28.04 ? 221 ILE A N   1 
ATOM   1655 C CA  . ILE A 1 219 ? 22.934  -19.632 33.265 1.00 27.98 ? 221 ILE A CA  1 
ATOM   1656 C C   . ILE A 1 219 ? 23.200  -21.107 33.608 1.00 29.46 ? 221 ILE A C   1 
ATOM   1657 O O   . ILE A 1 219 ? 22.372  -21.781 34.204 1.00 29.23 ? 221 ILE A O   1 
ATOM   1658 C CB  . ILE A 1 219 ? 22.556  -19.476 31.791 1.00 27.88 ? 221 ILE A CB  1 
ATOM   1659 C CG1 . ILE A 1 219 ? 22.205  -18.010 31.452 1.00 26.08 ? 221 ILE A CG1 1 
ATOM   1660 C CG2 . ILE A 1 219 ? 21.437  -20.404 31.432 1.00 27.46 ? 221 ILE A CG2 1 
ATOM   1661 C CD1 . ILE A 1 219 ? 21.682  -17.835 30.047 1.00 25.64 ? 221 ILE A CD1 1 
ATOM   1662 N N   . ALA A 1 220 ? 24.378  -21.600 33.249 1.00 30.39 ? 222 ALA A N   1 
ATOM   1663 C CA  . ALA A 1 220 ? 24.710  -22.982 33.547 1.00 31.39 ? 222 ALA A CA  1 
ATOM   1664 C C   . ALA A 1 220 ? 24.733  -23.222 35.046 1.00 32.23 ? 222 ALA A C   1 
ATOM   1665 O O   . ALA A 1 220 ? 24.317  -24.298 35.498 1.00 33.18 ? 222 ALA A O   1 
ATOM   1666 C CB  . ALA A 1 220 ? 26.038  -23.367 32.919 1.00 31.01 ? 222 ALA A CB  1 
ATOM   1667 N N   . ALA A 1 221 ? 25.206  -22.251 35.831 1.00 33.16 ? 223 ALA A N   1 
ATOM   1668 C CA  . ALA A 1 221 ? 25.244  -22.448 37.304 1.00 34.71 ? 223 ALA A CA  1 
ATOM   1669 C C   . ALA A 1 221 ? 23.832  -22.632 37.924 1.00 36.21 ? 223 ALA A C   1 
ATOM   1670 O O   . ALA A 1 221 ? 23.698  -22.828 39.142 1.00 37.18 ? 223 ALA A O   1 
ATOM   1671 C CB  . ALA A 1 221 ? 26.023  -21.345 37.995 1.00 33.41 ? 223 ALA A CB  1 
ATOM   1672 N N   . ARG A 1 222 ? 22.796  -22.634 37.070 1.00 36.76 ? 224 ARG A N   1 
ATOM   1673 C CA  . ARG A 1 222 ? 21.389  -22.706 37.496 1.00 37.13 ? 224 ARG A CA  1 
ATOM   1674 C C   . ARG A 1 222 ? 20.451  -23.775 36.808 1.00 36.29 ? 224 ARG A C   1 
ATOM   1675 O O   . ARG A 1 222 ? 20.701  -24.291 35.708 1.00 35.28 ? 224 ARG A O   1 
ATOM   1676 C CB  . ARG A 1 222 ? 20.737  -21.325 37.363 1.00 36.73 ? 224 ARG A CB  1 
ATOM   1677 C CG  . ARG A 1 222 ? 21.411  -20.158 38.106 1.00 39.05 ? 224 ARG A CG  1 
ATOM   1678 C CD  . ARG A 1 222 ? 20.607  -18.829 37.808 1.00 39.04 ? 224 ARG A CD  1 
ATOM   1679 N NE  . ARG A 1 222 ? 19.325  -18.853 38.514 1.00 36.95 ? 224 ARG A NE  1 
ATOM   1680 C CZ  . ARG A 1 222 ? 18.427  -17.874 38.566 1.00 37.75 ? 224 ARG A CZ  1 
ATOM   1681 N NH1 . ARG A 1 222 ? 18.626  -16.721 37.930 1.00 34.57 ? 224 ARG A NH1 1 
ATOM   1682 N NH2 . ARG A 1 222 ? 17.302  -18.071 39.267 1.00 38.26 ? 224 ARG A NH2 1 
ATOM   1683 N N   . ASN A 1 241 ? 21.915  -25.438 41.258 1.00 53.05 ? 243 ASN A N   1 
ATOM   1684 C CA  . ASN A 1 241 ? 21.457  -24.361 42.150 1.00 52.96 ? 243 ASN A CA  1 
ATOM   1685 C C   . ASN A 1 241 ? 20.008  -23.944 41.917 1.00 52.69 ? 243 ASN A C   1 
ATOM   1686 O O   . ASN A 1 241 ? 19.209  -24.708 41.350 1.00 53.06 ? 243 ASN A O   1 
ATOM   1687 C CB  . ASN A 1 241 ? 22.348  -23.115 42.029 1.00 52.97 ? 243 ASN A CB  1 
ATOM   1688 C CG  . ASN A 1 241 ? 23.814  -23.408 42.259 1.00 52.77 ? 243 ASN A CG  1 
ATOM   1689 O OD1 . ASN A 1 241 ? 24.203  -24.540 42.546 1.00 52.72 ? 243 ASN A OD1 1 
ATOM   1690 N ND2 . ASN A 1 241 ? 24.643  -22.382 42.121 1.00 52.47 ? 243 ASN A ND2 1 
ATOM   1691 N N   . ARG A 1 242 ? 19.696  -22.721 42.353 1.00 51.99 ? 244 ARG A N   1 
ATOM   1692 C CA  . ARG A 1 242 ? 18.358  -22.140 42.242 1.00 51.49 ? 244 ARG A CA  1 
ATOM   1693 C C   . ARG A 1 242 ? 17.977  -22.023 40.772 1.00 50.62 ? 244 ARG A C   1 
ATOM   1694 O O   . ARG A 1 242 ? 18.641  -21.271 40.026 1.00 50.14 ? 244 ARG A O   1 
ATOM   1695 C CB  . ARG A 1 242 ? 18.347  -20.745 42.881 1.00 52.24 ? 244 ARG A CB  1 
ATOM   1696 C CG  . ARG A 1 242 ? 16.972  -20.145 43.239 1.00 53.01 ? 244 ARG A CG  1 
ATOM   1697 C CD  . ARG A 1 242 ? 17.169  -18.879 44.117 1.00 54.18 ? 244 ARG A CD  1 
ATOM   1698 N NE  . ARG A 1 242 ? 18.585  -18.695 44.480 1.00 56.01 ? 244 ARG A NE  1 
ATOM   1699 C CZ  . ARG A 1 242 ? 19.069  -17.851 45.404 1.00 56.68 ? 244 ARG A CZ  1 
ATOM   1700 N NH1 . ARG A 1 242 ? 18.270  -17.069 46.129 1.00 56.92 ? 244 ARG A NH1 1 
ATOM   1701 N NH2 . ARG A 1 242 ? 20.379  -17.795 45.614 1.00 56.19 ? 244 ARG A NH2 1 
ATOM   1702 N N   . PRO A 1 243 ? 16.922  -22.771 40.347 1.00 49.52 ? 245 PRO A N   1 
ATOM   1703 C CA  . PRO A 1 243 ? 16.442  -22.668 38.966 1.00 48.52 ? 245 PRO A CA  1 
ATOM   1704 C C   . PRO A 1 243 ? 15.853  -21.283 38.654 1.00 47.41 ? 245 PRO A C   1 
ATOM   1705 O O   . PRO A 1 243 ? 15.385  -20.579 39.554 1.00 46.89 ? 245 PRO A O   1 
ATOM   1706 C CB  . PRO A 1 243 ? 15.339  -23.740 38.883 1.00 48.78 ? 245 PRO A CB  1 
ATOM   1707 C CG  . PRO A 1 243 ? 14.851  -23.929 40.301 1.00 49.58 ? 245 PRO A CG  1 
ATOM   1708 C CD  . PRO A 1 243 ? 16.101  -23.705 41.156 1.00 49.74 ? 245 PRO A CD  1 
ATOM   1709 N N   . ILE A 1 244 ? 15.910  -20.908 37.376 1.00 46.24 ? 246 ILE A N   1 
ATOM   1710 C CA  . ILE A 1 244 ? 15.195  -19.750 36.821 1.00 44.92 ? 246 ILE A CA  1 
ATOM   1711 C C   . ILE A 1 244 ? 13.665  -19.955 37.048 1.00 44.93 ? 246 ILE A C   1 
ATOM   1712 O O   . ILE A 1 244 ? 13.123  -21.058 36.747 1.00 44.97 ? 246 ILE A O   1 
ATOM   1713 C CB  . ILE A 1 244 ? 15.565  -19.601 35.328 1.00 44.55 ? 246 ILE A CB  1 
ATOM   1714 C CG1 . ILE A 1 244 ? 17.064  -19.274 35.208 1.00 45.64 ? 246 ILE A CG1 1 
ATOM   1715 C CG2 . ILE A 1 244 ? 14.657  -18.621 34.612 1.00 42.11 ? 246 ILE A CG2 1 
ATOM   1716 C CD1 . ILE A 1 244 ? 17.770  -19.922 34.011 1.00 47.55 ? 246 ILE A CD1 1 
ATOM   1717 N N   . THR A 1 245 ? 13.000  -18.920 37.595 1.00 43.63 ? 247 THR A N   1 
ATOM   1718 C CA  . THR A 1 245 ? 11.572  -18.972 38.022 1.00 43.15 ? 247 THR A CA  1 
ATOM   1719 C C   . THR A 1 245 ? 10.579  -19.301 36.871 1.00 43.12 ? 247 THR A C   1 
ATOM   1720 O O   . THR A 1 245 ? 9.690   -20.169 37.006 1.00 43.27 ? 247 THR A O   1 
ATOM   1721 C CB  . THR A 1 245 ? 11.182  -17.665 38.795 1.00 43.46 ? 247 THR A CB  1 
ATOM   1722 O OG1 . THR A 1 245 ? 12.104  -17.473 39.878 1.00 42.18 ? 247 THR A OG1 1 
ATOM   1723 C CG2 . THR A 1 245 ? 9.720   -17.680 39.335 1.00 42.10 ? 247 THR A CG2 1 
ATOM   1724 N N   . SER A 1 246 ? 10.760  -18.641 35.728 1.00 42.44 ? 248 SER A N   1 
ATOM   1725 C CA  . SER A 1 246 ? 9.998   -19.006 34.535 1.00 42.14 ? 248 SER A CA  1 
ATOM   1726 C C   . SER A 1 246 ? 10.566  -20.284 33.862 1.00 42.11 ? 248 SER A C   1 
ATOM   1727 O O   . SER A 1 246 ? 11.732  -20.311 33.429 1.00 42.23 ? 248 SER A O   1 
ATOM   1728 C CB  . SER A 1 246 ? 9.964   -17.826 33.549 1.00 42.14 ? 248 SER A CB  1 
ATOM   1729 O OG  . SER A 1 246 ? 9.217   -18.144 32.394 1.00 39.07 ? 248 SER A OG  1 
ATOM   1730 N N   . ASN A 1 247 ? 9.756   -21.343 33.818 1.00 41.20 ? 249 ASN A N   1 
ATOM   1731 C CA  . ASN A 1 247 ? 10.079  -22.491 32.976 1.00 40.62 ? 249 ASN A CA  1 
ATOM   1732 C C   . ASN A 1 247 ? 10.184  -22.110 31.478 1.00 40.19 ? 249 ASN A C   1 
ATOM   1733 O O   . ASN A 1 247 ? 11.139  -22.511 30.787 1.00 38.52 ? 249 ASN A O   1 
ATOM   1734 C CB  . ASN A 1 247 ? 9.043   -23.623 33.162 1.00 40.44 ? 249 ASN A CB  1 
ATOM   1735 C CG  . ASN A 1 247 ? 9.251   -24.767 32.156 1.00 41.20 ? 249 ASN A CG  1 
ATOM   1736 O OD1 . ASN A 1 247 ? 10.089  -25.656 32.371 1.00 41.09 ? 249 ASN A OD1 1 
ATOM   1737 N ND2 . ASN A 1 247 ? 8.506   -24.730 31.040 1.00 39.37 ? 249 ASN A ND2 1 
ATOM   1738 N N   . TYR A 1 248 ? 9.197   -21.336 30.985 1.00 39.65 ? 250 TYR A N   1 
ATOM   1739 C CA  . TYR A 1 248 ? 9.134   -20.949 29.564 1.00 39.73 ? 250 TYR A CA  1 
ATOM   1740 C C   . TYR A 1 248 ? 10.314  -20.029 29.176 1.00 40.00 ? 250 TYR A C   1 
ATOM   1741 O O   . TYR A 1 248 ? 10.900  -20.192 28.092 1.00 41.04 ? 250 TYR A O   1 
ATOM   1742 C CB  . TYR A 1 248 ? 7.788   -20.282 29.250 1.00 39.05 ? 250 TYR A CB  1 
ATOM   1743 C CG  . TYR A 1 248 ? 7.524   -19.954 27.794 1.00 40.09 ? 250 TYR A CG  1 
ATOM   1744 C CD1 . TYR A 1 248 ? 7.025   -20.937 26.911 1.00 37.98 ? 250 TYR A CD1 1 
ATOM   1745 C CD2 . TYR A 1 248 ? 7.773   -18.652 27.296 1.00 39.61 ? 250 TYR A CD2 1 
ATOM   1746 C CE1 . TYR A 1 248 ? 6.740   -20.631 25.593 1.00 39.88 ? 250 TYR A CE1 1 
ATOM   1747 C CE2 . TYR A 1 248 ? 7.500   -18.310 25.974 1.00 39.09 ? 250 TYR A CE2 1 
ATOM   1748 C CZ  . TYR A 1 248 ? 6.984   -19.300 25.107 1.00 42.75 ? 250 TYR A CZ  1 
ATOM   1749 O OH  . TYR A 1 248 ? 6.701   -18.971 23.768 1.00 40.87 ? 250 TYR A OH  1 
ATOM   1750 N N   . PHE A 1 249 ? 10.703  -19.123 30.077 1.00 39.66 ? 251 PHE A N   1 
ATOM   1751 C CA  . PHE A 1 249 ? 11.881  -18.237 29.858 1.00 39.56 ? 251 PHE A CA  1 
ATOM   1752 C C   . PHE A 1 249 ? 13.233  -18.798 30.368 1.00 39.54 ? 251 PHE A C   1 
ATOM   1753 O O   . PHE A 1 249 ? 14.194  -18.043 30.553 1.00 39.54 ? 251 PHE A O   1 
ATOM   1754 C CB  . PHE A 1 249 ? 11.593  -16.825 30.434 1.00 40.39 ? 251 PHE A CB  1 
ATOM   1755 C CG  . PHE A 1 249 ? 10.380  -16.132 29.815 1.00 40.01 ? 251 PHE A CG  1 
ATOM   1756 C CD1 . PHE A 1 249 ? 10.128  -16.207 28.429 1.00 39.73 ? 251 PHE A CD1 1 
ATOM   1757 C CD2 . PHE A 1 249 ? 9.495   -15.421 30.620 1.00 41.80 ? 251 PHE A CD2 1 
ATOM   1758 C CE1 . PHE A 1 249 ? 9.004   -15.582 27.856 1.00 39.97 ? 251 PHE A CE1 1 
ATOM   1759 C CE2 . PHE A 1 249 ? 8.364   -14.782 30.063 1.00 41.92 ? 251 PHE A CE2 1 
ATOM   1760 C CZ  . PHE A 1 249 ? 8.113   -14.885 28.682 1.00 41.22 ? 251 PHE A CZ  1 
ATOM   1761 N N   . ASP A 1 250 ? 13.305  -20.125 30.603 1.00 39.73 ? 252 ASP A N   1 
ATOM   1762 C CA  . ASP A 1 250 ? 14.533  -20.775 31.118 1.00 39.31 ? 252 ASP A CA  1 
ATOM   1763 C C   . ASP A 1 250 ? 15.587  -20.958 29.975 1.00 39.59 ? 252 ASP A C   1 
ATOM   1764 O O   . ASP A 1 250 ? 15.542  -21.961 29.230 1.00 39.53 ? 252 ASP A O   1 
ATOM   1765 C CB  . ASP A 1 250 ? 14.187  -22.117 31.813 1.00 38.98 ? 252 ASP A CB  1 
ATOM   1766 C CG  . ASP A 1 250 ? 15.416  -22.774 32.542 1.00 40.41 ? 252 ASP A CG  1 
ATOM   1767 O OD1 . ASP A 1 250 ? 15.184  -23.725 33.362 1.00 32.95 ? 252 ASP A OD1 1 
ATOM   1768 O OD2 . ASP A 1 250 ? 16.591  -22.323 32.309 1.00 36.22 ? 252 ASP A OD2 1 
ATOM   1769 N N   . LEU A 1 251 ? 16.500  -19.990 29.818 1.00 38.58 ? 253 LEU A N   1 
ATOM   1770 C CA  . LEU A 1 251 ? 17.484  -20.024 28.696 1.00 39.35 ? 253 LEU A CA  1 
ATOM   1771 C C   . LEU A 1 251 ? 18.372  -21.274 28.702 1.00 39.12 ? 253 LEU A C   1 
ATOM   1772 O O   . LEU A 1 251 ? 18.922  -21.658 27.683 1.00 38.81 ? 253 LEU A O   1 
ATOM   1773 C CB  . LEU A 1 251 ? 18.366  -18.743 28.659 1.00 37.85 ? 253 LEU A CB  1 
ATOM   1774 C CG  . LEU A 1 251 ? 17.628  -17.418 28.485 1.00 38.43 ? 253 LEU A CG  1 
ATOM   1775 C CD1 . LEU A 1 251 ? 18.611  -16.289 28.293 1.00 37.34 ? 253 LEU A CD1 1 
ATOM   1776 C CD2 . LEU A 1 251 ? 16.595  -17.416 27.328 1.00 40.04 ? 253 LEU A CD2 1 
ATOM   1777 N N   . SER A 1 252 ? 18.533  -21.867 29.888 1.00 40.12 ? 254 SER A N   1 
ATOM   1778 C CA  . SER A 1 252 ? 19.302  -23.107 30.095 1.00 41.33 ? 254 SER A CA  1 
ATOM   1779 C C   . SER A 1 252 ? 18.652  -24.318 29.415 1.00 42.23 ? 254 SER A C   1 
ATOM   1780 O O   . SER A 1 252 ? 19.357  -25.231 28.975 1.00 43.14 ? 254 SER A O   1 
ATOM   1781 C CB  . SER A 1 252 ? 19.408  -23.439 31.581 1.00 40.73 ? 254 SER A CB  1 
ATOM   1782 O OG  . SER A 1 252 ? 20.304  -24.492 31.723 1.00 42.49 ? 254 SER A OG  1 
ATOM   1783 N N   . GLN A 1 253 ? 17.316  -24.332 29.401 1.00 42.23 ? 255 GLN A N   1 
ATOM   1784 C CA  . GLN A 1 253 ? 16.552  -25.306 28.641 1.00 43.47 ? 255 GLN A CA  1 
ATOM   1785 C C   . GLN A 1 253 ? 16.459  -24.856 27.197 1.00 43.85 ? 255 GLN A C   1 
ATOM   1786 O O   . GLN A 1 253 ? 16.553  -25.702 26.297 1.00 44.69 ? 255 GLN A O   1 
ATOM   1787 C CB  . GLN A 1 253 ? 15.150  -25.489 29.219 1.00 43.07 ? 255 GLN A CB  1 
ATOM   1788 C CG  . GLN A 1 253 ? 15.176  -25.942 30.685 1.00 42.49 ? 255 GLN A CG  1 
ATOM   1789 C CD  . GLN A 1 253 ? 13.803  -26.256 31.192 1.00 43.06 ? 255 GLN A CD  1 
ATOM   1790 O OE1 . GLN A 1 253 ? 13.226  -27.297 30.841 1.00 45.30 ? 255 GLN A OE1 1 
ATOM   1791 N NE2 . GLN A 1 253 ? 13.270  -25.384 32.058 1.00 40.16 ? 255 GLN A NE2 1 
ATOM   1792 N N   . LEU A 1 254 ? 16.286  -23.545 26.971 1.00 43.66 ? 256 LEU A N   1 
ATOM   1793 C CA  . LEU A 1 254 ? 16.242  -23.006 25.593 1.00 43.19 ? 256 LEU A CA  1 
ATOM   1794 C C   . LEU A 1 254 ? 17.564  -23.213 24.804 1.00 43.58 ? 256 LEU A C   1 
ATOM   1795 O O   . LEU A 1 254 ? 17.534  -23.367 23.563 1.00 43.87 ? 256 LEU A O   1 
ATOM   1796 C CB  . LEU A 1 254 ? 15.759  -21.560 25.571 1.00 42.77 ? 256 LEU A CB  1 
ATOM   1797 C CG  . LEU A 1 254 ? 14.237  -21.615 25.732 1.00 43.85 ? 256 LEU A CG  1 
ATOM   1798 C CD1 . LEU A 1 254 ? 13.637  -20.318 26.217 1.00 42.95 ? 256 LEU A CD1 1 
ATOM   1799 C CD2 . LEU A 1 254 ? 13.603  -22.076 24.405 1.00 41.81 ? 256 LEU A CD2 1 
ATOM   1800 N N   . GLU A 1 255 ? 18.705  -23.268 25.510 1.00 42.61 ? 257 GLU A N   1 
ATOM   1801 C CA  . GLU A 1 255 ? 19.948  -23.584 24.815 1.00 42.03 ? 257 GLU A CA  1 
ATOM   1802 C C   . GLU A 1 255 ? 20.063  -25.052 24.344 1.00 42.88 ? 257 GLU A C   1 
ATOM   1803 O O   . GLU A 1 255 ? 20.646  -25.308 23.278 1.00 42.77 ? 257 GLU A O   1 
ATOM   1804 C CB  . GLU A 1 255 ? 21.201  -23.007 25.475 1.00 41.07 ? 257 GLU A CB  1 
ATOM   1805 C CG  . GLU A 1 255 ? 21.432  -23.153 26.948 1.00 39.63 ? 257 GLU A CG  1 
ATOM   1806 C CD  . GLU A 1 255 ? 22.665  -22.348 27.389 1.00 34.43 ? 257 GLU A CD  1 
ATOM   1807 O OE1 . GLU A 1 255 ? 23.655  -22.913 27.908 1.00 40.05 ? 257 GLU A OE1 1 
ATOM   1808 O OE2 . GLU A 1 255 ? 22.661  -21.132 27.175 1.00 31.89 ? 257 GLU A OE2 1 
ATOM   1809 N N   . ASP A 1 256 ? 19.477  -25.997 25.096 1.00 43.57 ? 258 ASP A N   1 
ATOM   1810 C CA  . ASP A 1 256 ? 19.446  -27.422 24.707 1.00 44.09 ? 258 ASP A CA  1 
ATOM   1811 C C   . ASP A 1 256 ? 18.401  -27.633 23.575 1.00 44.35 ? 258 ASP A C   1 
ATOM   1812 O O   . ASP A 1 256 ? 18.546  -28.543 22.735 1.00 44.41 ? 258 ASP A O   1 
ATOM   1813 C CB  . ASP A 1 256 ? 19.174  -28.338 25.928 1.00 44.46 ? 258 ASP A CB  1 
ATOM   1814 C CG  . ASP A 1 256 ? 20.469  -28.675 26.774 1.00 45.33 ? 258 ASP A CG  1 
ATOM   1815 O OD1 . ASP A 1 256 ? 21.618  -28.220 26.496 1.00 45.81 ? 258 ASP A OD1 1 
ATOM   1816 O OD2 . ASP A 1 256 ? 20.315  -29.416 27.757 1.00 39.87 ? 258 ASP A OD2 1 
ATOM   1817 N N   . TYR A 1 257 ? 17.362  -26.780 23.565 1.00 44.70 ? 259 TYR A N   1 
ATOM   1818 C CA  . TYR A 1 257 ? 16.405  -26.659 22.442 1.00 44.81 ? 259 TYR A CA  1 
ATOM   1819 C C   . TYR A 1 257 ? 17.088  -26.252 21.117 1.00 44.25 ? 259 TYR A C   1 
ATOM   1820 O O   . TYR A 1 257 ? 16.824  -26.841 20.050 1.00 43.75 ? 259 TYR A O   1 
ATOM   1821 C CB  . TYR A 1 257 ? 15.233  -25.682 22.753 1.00 44.87 ? 259 TYR A CB  1 
ATOM   1822 C CG  . TYR A 1 257 ? 14.088  -25.886 21.787 1.00 45.37 ? 259 TYR A CG  1 
ATOM   1823 C CD1 . TYR A 1 257 ? 13.146  -26.865 22.031 1.00 47.61 ? 259 TYR A CD1 1 
ATOM   1824 C CD2 . TYR A 1 257 ? 13.965  -25.118 20.594 1.00 48.06 ? 259 TYR A CD2 1 
ATOM   1825 C CE1 . TYR A 1 257 ? 12.107  -27.125 21.135 1.00 46.90 ? 259 TYR A CE1 1 
ATOM   1826 C CE2 . TYR A 1 257 ? 12.912  -25.350 19.688 1.00 46.85 ? 259 TYR A CE2 1 
ATOM   1827 C CZ  . TYR A 1 257 ? 11.996  -26.376 19.973 1.00 45.88 ? 259 TYR A CZ  1 
ATOM   1828 O OH  . TYR A 1 257 ? 10.956  -26.673 19.155 1.00 40.97 ? 259 TYR A OH  1 
ATOM   1829 N N   . TRP A 1 258 ? 17.953  -25.238 21.194 1.00 44.14 ? 260 TRP A N   1 
ATOM   1830 C CA  . TRP A 1 258 ? 18.535  -24.606 20.010 1.00 43.73 ? 260 TRP A CA  1 
ATOM   1831 C C   . TRP A 1 258 ? 19.997  -25.121 19.821 1.00 44.60 ? 260 TRP A C   1 
ATOM   1832 O O   . TRP A 1 258 ? 20.919  -24.333 19.583 1.00 44.80 ? 260 TRP A O   1 
ATOM   1833 C CB  . TRP A 1 258 ? 18.496  -23.060 20.146 1.00 43.07 ? 260 TRP A CB  1 
ATOM   1834 C CG  . TRP A 1 258 ? 17.171  -22.392 19.788 1.00 40.80 ? 260 TRP A CG  1 
ATOM   1835 C CD1 . TRP A 1 258 ? 16.160  -22.032 20.666 1.00 40.94 ? 260 TRP A CD1 1 
ATOM   1836 C CD2 . TRP A 1 258 ? 16.718  -21.973 18.466 1.00 36.98 ? 260 TRP A CD2 1 
ATOM   1837 N NE1 . TRP A 1 258 ? 15.109  -21.439 19.968 1.00 39.82 ? 260 TRP A NE1 1 
ATOM   1838 C CE2 . TRP A 1 258 ? 15.430  -21.386 18.627 1.00 37.74 ? 260 TRP A CE2 1 
ATOM   1839 C CE3 . TRP A 1 258 ? 17.273  -22.037 17.160 1.00 34.19 ? 260 TRP A CE3 1 
ATOM   1840 C CZ2 . TRP A 1 258 ? 14.689  -20.895 17.525 1.00 34.58 ? 260 TRP A CZ2 1 
ATOM   1841 C CZ3 . TRP A 1 258 ? 16.504  -21.547 16.049 1.00 23.79 ? 260 TRP A CZ3 1 
ATOM   1842 C CH2 . TRP A 1 258 ? 15.264  -20.981 16.250 1.00 31.25 ? 260 TRP A CH2 1 
ATOM   1843 N N   . SER A 1 259 ? 20.198  -26.431 20.002 1.00 44.80 ? 261 SER A N   1 
ATOM   1844 C CA  . SER A 1 259 ? 21.459  -27.120 19.639 1.00 45.73 ? 261 SER A CA  1 
ATOM   1845 C C   . SER A 1 259 ? 21.233  -28.642 19.476 1.00 45.78 ? 261 SER A C   1 
ATOM   1846 O O   . SER A 1 259 ? 20.085  -29.106 19.526 1.00 45.75 ? 261 SER A O   1 
ATOM   1847 C CB  . SER A 1 259 ? 22.635  -26.770 20.587 1.00 45.44 ? 261 SER A CB  1 
ATOM   1848 O OG  . SER A 1 259 ? 22.323  -27.074 21.935 1.00 44.99 ? 261 SER A OG  1 
ATOM   1849 N N   . GLU A 1 260 ? 22.324  -29.381 19.266 1.00 46.72 ? 262 GLU A N   1 
ATOM   1850 C CA  . GLU A 1 260 ? 22.337  -30.818 18.904 1.00 48.14 ? 262 GLU A CA  1 
ATOM   1851 C C   . GLU A 1 260 ? 21.312  -31.726 19.610 1.00 48.07 ? 262 GLU A C   1 
ATOM   1852 O O   . GLU A 1 260 ? 20.722  -32.618 18.968 1.00 48.37 ? 262 GLU A O   1 
ATOM   1853 C CB  . GLU A 1 260 ? 23.752  -31.415 19.100 1.00 48.56 ? 262 GLU A CB  1 
ATOM   1854 C CG  . GLU A 1 260 ? 24.782  -31.057 18.006 1.00 51.16 ? 262 GLU A CG  1 
ATOM   1855 C CD  . GLU A 1 260 ? 25.397  -29.634 18.108 1.00 53.71 ? 262 GLU A CD  1 
ATOM   1856 O OE1 . GLU A 1 260 ? 24.877  -28.721 18.825 1.00 51.33 ? 262 GLU A OE1 1 
ATOM   1857 O OE2 . GLU A 1 260 ? 26.432  -29.447 17.427 1.00 54.21 ? 262 GLU A OE2 1 
ATOM   1858 N N   . ARG A 1 261 ? 21.103  -31.512 20.913 1.00 47.80 ? 263 ARG A N   1 
ATOM   1859 C CA  . ARG A 1 261 ? 20.296  -32.457 21.699 1.00 48.42 ? 263 ARG A CA  1 
ATOM   1860 C C   . ARG A 1 261 ? 18.757  -32.383 21.499 1.00 47.60 ? 263 ARG A C   1 
ATOM   1861 O O   . ARG A 1 261 ? 18.032  -33.343 21.841 1.00 46.98 ? 263 ARG A O   1 
ATOM   1862 C CB  . ARG A 1 261 ? 20.790  -32.548 23.166 1.00 49.10 ? 263 ARG A CB  1 
ATOM   1863 C CG  . ARG A 1 261 ? 22.078  -33.470 23.247 1.00 50.68 ? 263 ARG A CG  1 
ATOM   1864 C CD  . ARG A 1 261 ? 22.777  -33.559 24.610 1.00 53.12 ? 263 ARG A CD  1 
ATOM   1865 N NE  . ARG A 1 261 ? 21.977  -34.261 25.622 1.00 54.79 ? 263 ARG A NE  1 
ATOM   1866 C CZ  . ARG A 1 261 ? 22.448  -35.129 26.522 1.00 56.14 ? 263 ARG A CZ  1 
ATOM   1867 N NH1 . ARG A 1 261 ? 23.743  -35.477 26.547 1.00 55.62 ? 263 ARG A NH1 1 
ATOM   1868 N NH2 . ARG A 1 261 ? 21.606  -35.673 27.399 1.00 56.05 ? 263 ARG A NH2 1 
ATOM   1869 N N   . ARG A 1 262 ? 18.320  -31.282 20.863 1.00 46.61 ? 264 ARG A N   1 
ATOM   1870 C CA  . ARG A 1 262 ? 16.913  -30.947 20.562 1.00 46.29 ? 264 ARG A CA  1 
ATOM   1871 C C   . ARG A 1 262 ? 15.984  -31.261 21.732 1.00 46.33 ? 264 ARG A C   1 
ATOM   1872 O O   . ARG A 1 262 ? 15.031  -32.051 21.601 1.00 45.49 ? 264 ARG A O   1 
ATOM   1873 C CB  . ARG A 1 262 ? 16.411  -31.561 19.223 1.00 46.02 ? 264 ARG A CB  1 
ATOM   1874 C CG  . ARG A 1 262 ? 17.281  -31.227 17.950 1.00 44.67 ? 264 ARG A CG  1 
ATOM   1875 C CD  . ARG A 1 262 ? 17.426  -29.698 17.714 1.00 42.84 ? 264 ARG A CD  1 
ATOM   1876 N NE  . ARG A 1 262 ? 18.347  -29.318 16.631 1.00 40.31 ? 264 ARG A NE  1 
ATOM   1877 C CZ  . ARG A 1 262 ? 18.747  -28.060 16.368 1.00 41.02 ? 264 ARG A CZ  1 
ATOM   1878 N NH1 . ARG A 1 262 ? 18.342  -27.025 17.122 1.00 36.81 ? 264 ARG A NH1 1 
ATOM   1879 N NH2 . ARG A 1 262 ? 19.586  -27.820 15.356 1.00 38.55 ? 264 ARG A NH2 1 
ATOM   1880 N N   . LEU A 1 263 ? 16.291  -30.641 22.882 1.00 46.32 ? 265 LEU A N   1 
ATOM   1881 C CA  . LEU A 1 263 ? 15.435  -30.770 24.078 1.00 46.43 ? 265 LEU A CA  1 
ATOM   1882 C C   . LEU A 1 263 ? 14.008  -30.276 23.778 1.00 46.20 ? 265 LEU A C   1 
ATOM   1883 O O   . LEU A 1 263 ? 13.839  -29.125 23.340 1.00 45.62 ? 265 LEU A O   1 
ATOM   1884 C CB  . LEU A 1 263 ? 16.038  -30.041 25.305 1.00 46.13 ? 265 LEU A CB  1 
ATOM   1885 C CG  . LEU A 1 263 ? 15.287  -30.158 26.656 1.00 45.47 ? 265 LEU A CG  1 
ATOM   1886 C CD1 . LEU A 1 263 ? 15.552  -31.523 27.373 1.00 44.00 ? 265 LEU A CD1 1 
ATOM   1887 C CD2 . LEU A 1 263 ? 15.616  -28.983 27.584 1.00 43.85 ? 265 LEU A CD2 1 
ATOM   1888 N N   . ASN A 1 264 ? 13.000  -31.145 23.984 1.00 46.08 ? 266 ASN A N   1 
ATOM   1889 C CA  . ASN A 1 264 ? 11.585  -30.735 23.824 1.00 46.37 ? 266 ASN A CA  1 
ATOM   1890 C C   . ASN A 1 264 ? 11.137  -29.764 24.917 1.00 45.78 ? 266 ASN A C   1 
ATOM   1891 O O   . ASN A 1 264 ? 10.410  -30.148 25.846 1.00 46.48 ? 266 ASN A O   1 
ATOM   1892 C CB  . ASN A 1 264 ? 10.587  -31.913 23.774 1.00 46.74 ? 266 ASN A CB  1 
ATOM   1893 C CG  . ASN A 1 264 ? 9.145   -31.429 23.473 1.00 50.40 ? 266 ASN A CG  1 
ATOM   1894 O OD1 . ASN A 1 264 ? 8.861   -31.028 22.334 1.00 50.07 ? 266 ASN A OD1 1 
ATOM   1895 N ND2 . ASN A 1 264 ? 8.234   -31.423 24.520 1.00 52.72 ? 266 ASN A ND2 1 
ATOM   1896 N N   . HIS A 1 265 ? 11.567  -28.505 24.795 1.00 45.13 ? 267 HIS A N   1 
ATOM   1897 C CA  . HIS A 1 265 ? 11.231  -27.488 25.788 1.00 43.81 ? 267 HIS A CA  1 
ATOM   1898 C C   . HIS A 1 265 ? 9.888   -26.775 25.449 1.00 42.47 ? 267 HIS A C   1 
ATOM   1899 O O   . HIS A 1 265 ? 9.139   -26.409 26.368 1.00 42.08 ? 267 HIS A O   1 
ATOM   1900 C CB  . HIS A 1 265 ? 12.377  -26.464 25.999 1.00 43.85 ? 267 HIS A CB  1 
ATOM   1901 C CG  . HIS A 1 265 ? 11.946  -25.256 26.786 1.00 45.14 ? 267 HIS A CG  1 
ATOM   1902 N ND1 . HIS A 1 265 ? 11.410  -24.130 26.192 1.00 44.92 ? 267 HIS A ND1 1 
ATOM   1903 C CD2 . HIS A 1 265 ? 11.908  -25.028 28.126 1.00 45.33 ? 267 HIS A CD2 1 
ATOM   1904 C CE1 . HIS A 1 265 ? 11.085  -23.253 27.126 1.00 46.49 ? 267 HIS A CE1 1 
ATOM   1905 N NE2 . HIS A 1 265 ? 11.373  -23.776 28.309 1.00 45.96 ? 267 HIS A NE2 1 
ATOM   1906 N N   . HIS A 1 266 ? 9.602   -26.592 24.151 1.00 39.95 ? 268 HIS A N   1 
ATOM   1907 C CA  . HIS A 1 266 ? 8.380   -25.907 23.668 1.00 38.98 ? 268 HIS A CA  1 
ATOM   1908 C C   . HIS A 1 266 ? 8.321   -26.163 22.139 1.00 37.24 ? 268 HIS A C   1 
ATOM   1909 O O   . HIS A 1 266 ? 9.376   -26.386 21.497 1.00 37.53 ? 268 HIS A O   1 
ATOM   1910 C CB  . HIS A 1 266 ? 8.456   -24.369 23.894 1.00 38.56 ? 268 HIS A CB  1 
ATOM   1911 C CG  . HIS A 1 266 ? 9.564   -23.706 23.106 1.00 43.45 ? 268 HIS A CG  1 
ATOM   1912 N ND1 . HIS A 1 266 ? 9.328   -22.887 22.015 1.00 47.03 ? 268 HIS A ND1 1 
ATOM   1913 C CD2 . HIS A 1 266 ? 10.914  -23.817 23.204 1.00 40.43 ? 268 HIS A CD2 1 
ATOM   1914 C CE1 . HIS A 1 266 ? 10.485  -22.509 21.496 1.00 48.62 ? 268 HIS A CE1 1 
ATOM   1915 N NE2 . HIS A 1 266 ? 11.464  -23.070 22.191 1.00 49.02 ? 268 HIS A NE2 1 
ATOM   1916 N N   . THR A 1 267 ? 7.112   -26.105 21.574 1.00 34.08 ? 269 THR A N   1 
ATOM   1917 C CA  . THR A 1 267 ? 6.897   -26.151 20.121 1.00 30.46 ? 269 THR A CA  1 
ATOM   1918 C C   . THR A 1 267 ? 7.288   -24.799 19.569 1.00 29.79 ? 269 THR A C   1 
ATOM   1919 O O   . THR A 1 267 ? 6.543   -23.802 19.720 1.00 27.31 ? 269 THR A O   1 
ATOM   1920 C CB  . THR A 1 267 ? 5.392   -26.528 19.761 1.00 30.69 ? 269 THR A CB  1 
ATOM   1921 O OG1 . THR A 1 267 ? 5.090   -27.813 20.340 1.00 28.29 ? 269 THR A OG1 1 
ATOM   1922 C CG2 . THR A 1 267 ? 5.097   -26.536 18.208 1.00 25.48 ? 269 THR A CG2 1 
ATOM   1923 N N   . GLU A 1 268 ? 8.464   -24.760 18.967 1.00 28.08 ? 270 GLU A N   1 
ATOM   1924 C CA  . GLU A 1 268 ? 8.844   -23.549 18.249 1.00 28.55 ? 270 GLU A CA  1 
ATOM   1925 C C   . GLU A 1 268 ? 7.670   -23.040 17.333 1.00 27.89 ? 270 GLU A C   1 
ATOM   1926 O O   . GLU A 1 268 ? 6.859   -23.864 16.846 1.00 29.22 ? 270 GLU A O   1 
ATOM   1927 C CB  . GLU A 1 268 ? 10.139  -23.795 17.441 1.00 30.08 ? 270 GLU A CB  1 
ATOM   1928 C CG  . GLU A 1 268 ? 10.788  -22.484 16.910 1.00 26.85 ? 270 GLU A CG  1 
ATOM   1929 C CD  . GLU A 1 268 ? 11.060  -21.470 18.024 1.00 32.24 ? 270 GLU A CD  1 
ATOM   1930 O OE1 . GLU A 1 268 ? 11.221  -20.217 17.734 1.00 31.83 ? 270 GLU A OE1 1 
ATOM   1931 O OE2 . GLU A 1 268 ? 11.107  -21.926 19.192 1.00 31.98 ? 270 GLU A OE2 1 
ATOM   1932 N N   . ALA A 1 269 ? 7.554   -21.725 17.163 1.00 24.22 ? 271 ALA A N   1 
ATOM   1933 C CA  . ALA A 1 269 ? 6.505   -21.153 16.372 1.00 23.38 ? 271 ALA A CA  1 
ATOM   1934 C C   . ALA A 1 269 ? 6.950   -21.196 14.911 1.00 23.68 ? 271 ALA A C   1 
ATOM   1935 O O   . ALA A 1 269 ? 7.802   -20.357 14.483 1.00 23.57 ? 271 ALA A O   1 
ATOM   1936 C CB  . ALA A 1 269 ? 6.249   -19.738 16.774 1.00 22.82 ? 271 ALA A CB  1 
ATOM   1937 N N   . THR A 1 270 ? 6.381   -22.136 14.177 1.00 20.21 ? 272 THR A N   1 
ATOM   1938 C CA  . THR A 1 270 ? 6.809   -22.462 12.813 1.00 19.66 ? 272 THR A CA  1 
ATOM   1939 C C   . THR A 1 270 ? 6.786   -21.340 11.838 1.00 16.62 ? 272 THR A C   1 
ATOM   1940 O O   . THR A 1 270 ? 7.829   -21.000 11.275 1.00 17.73 ? 272 THR A O   1 
ATOM   1941 C CB  . THR A 1 270 ? 6.014   -23.597 12.199 1.00 20.10 ? 272 THR A CB  1 
ATOM   1942 O OG1 . THR A 1 270 ? 5.850   -24.626 13.188 1.00 25.99 ? 272 THR A OG1 1 
ATOM   1943 C CG2 . THR A 1 270 ? 6.792   -24.132 10.817 1.00 20.75 ? 272 THR A CG2 1 
ATOM   1944 N N   . THR A 1 271 ? 5.626   -20.701 11.694 1.00 16.49 ? 273 THR A N   1 
ATOM   1945 C CA  . THR A 1 271 ? 5.437   -19.658 10.740 1.00 15.88 ? 273 THR A CA  1 
ATOM   1946 C C   . THR A 1 271 ? 6.227   -18.396 11.142 1.00 16.21 ? 273 THR A C   1 
ATOM   1947 O O   . THR A 1 271 ? 6.746   -17.696 10.271 1.00 15.92 ? 273 THR A O   1 
ATOM   1948 C CB  . THR A 1 271 ? 3.942   -19.335 10.553 1.00 15.07 ? 273 THR A CB  1 
ATOM   1949 O OG1 . THR A 1 271 ? 3.300   -20.464 9.987  1.00 16.43 ? 273 THR A OG1 1 
ATOM   1950 C CG2 . THR A 1 271 ? 3.778   -18.079 9.647  1.00 11.76 ? 273 THR A CG2 1 
ATOM   1951 N N   . MET A 1 272 ? 6.314   -18.100 12.439 1.00 15.05 ? 274 MET A N   1 
ATOM   1952 C CA  . MET A 1 272 ? 7.040   -16.899 12.894 1.00 17.36 ? 274 MET A CA  1 
ATOM   1953 C C   . MET A 1 272 ? 8.543   -17.043 12.633 1.00 17.02 ? 274 MET A C   1 
ATOM   1954 O O   . MET A 1 272 ? 9.218   -16.072 12.392 1.00 17.79 ? 274 MET A O   1 
ATOM   1955 C CB  . MET A 1 272 ? 6.792   -16.580 14.387 1.00 16.10 ? 274 MET A CB  1 
ATOM   1956 C CG  . MET A 1 272 ? 5.406   -15.917 14.619 1.00 22.16 ? 274 MET A CG  1 
ATOM   1957 S SD  . MET A 1 272 ? 5.139   -14.400 13.625 1.00 28.27 ? 274 MET A SD  1 
ATOM   1958 C CE  . MET A 1 272 ? 6.575   -13.363 14.030 1.00 30.46 ? 274 MET A CE  1 
ATOM   1959 N N   . LEU A 1 273 ? 9.028   -18.271 12.699 1.00 17.34 ? 275 LEU A N   1 
ATOM   1960 C CA  . LEU A 1 273 ? 10.414  -18.593 12.327 1.00 18.43 ? 275 LEU A CA  1 
ATOM   1961 C C   . LEU A 1 273 ? 10.689  -18.439 10.832 1.00 17.83 ? 275 LEU A C   1 
ATOM   1962 O O   . LEU A 1 273 ? 11.728  -17.884 10.471 1.00 19.66 ? 275 LEU A O   1 
ATOM   1963 C CB  . LEU A 1 273 ? 10.787  -20.041 12.769 1.00 17.26 ? 275 LEU A CB  1 
ATOM   1964 C CG  . LEU A 1 273 ? 12.299  -20.327 12.538 1.00 20.59 ? 275 LEU A CG  1 
ATOM   1965 C CD1 . LEU A 1 273 ? 13.140  -19.405 13.359 1.00 20.96 ? 275 LEU A CD1 1 
ATOM   1966 C CD2 . LEU A 1 273 ? 12.730  -21.766 12.777 1.00 21.04 ? 275 LEU A CD2 1 
ATOM   1967 N N   . TYR A 1 274 ? 9.754   -18.892 9.966  1.00 16.38 ? 276 TYR A N   1 
ATOM   1968 C CA  . TYR A 1 274 ? 9.837   -18.623 8.543  1.00 15.45 ? 276 TYR A CA  1 
ATOM   1969 C C   . TYR A 1 274 ? 10.043  -17.122 8.336  1.00 16.23 ? 276 TYR A C   1 
ATOM   1970 O O   . TYR A 1 274 ? 10.939  -16.691 7.546  1.00 14.24 ? 276 TYR A O   1 
ATOM   1971 C CB  . TYR A 1 274 ? 8.537   -19.041 7.773  1.00 15.87 ? 276 TYR A CB  1 
ATOM   1972 C CG  . TYR A 1 274 ? 8.265   -20.541 7.606  1.00 17.74 ? 276 TYR A CG  1 
ATOM   1973 C CD1 . TYR A 1 274 ? 9.254   -21.501 7.861  1.00 16.44 ? 276 TYR A CD1 1 
ATOM   1974 C CD2 . TYR A 1 274 ? 7.009   -20.983 7.140  1.00 20.52 ? 276 TYR A CD2 1 
ATOM   1975 C CE1 . TYR A 1 274 ? 8.989   -22.877 7.662  1.00 13.31 ? 276 TYR A CE1 1 
ATOM   1976 C CE2 . TYR A 1 274 ? 6.729   -22.303 6.967  1.00 13.54 ? 276 TYR A CE2 1 
ATOM   1977 C CZ  . TYR A 1 274 ? 7.722   -23.269 7.216  1.00 15.24 ? 276 TYR A CZ  1 
ATOM   1978 O OH  . TYR A 1 274 ? 7.401   -24.642 7.048  1.00 15.21 ? 276 TYR A OH  1 
ATOM   1979 N N   . ALA A 1 275 ? 9.174   -16.356 9.006  1.00 15.31 ? 277 ALA A N   1 
ATOM   1980 C CA  . ALA A 1 275 ? 9.127   -14.913 8.844  1.00 15.49 ? 277 ALA A CA  1 
ATOM   1981 C C   . ALA A 1 275 ? 10.421  -14.260 9.343  1.00 14.71 ? 277 ALA A C   1 
ATOM   1982 O O   . ALA A 1 275 ? 10.974  -13.446 8.666  1.00 15.57 ? 277 ALA A O   1 
ATOM   1983 C CB  . ALA A 1 275 ? 7.868   -14.311 9.489  1.00 12.54 ? 277 ALA A CB  1 
ATOM   1984 N N   . LEU A 1 276 ? 10.939  -14.686 10.476 1.00 15.09 ? 278 LEU A N   1 
ATOM   1985 C CA  . LEU A 1 276 ? 12.202  -14.163 10.984 1.00 14.50 ? 278 LEU A CA  1 
ATOM   1986 C C   . LEU A 1 276 ? 13.381  -14.477 10.043 1.00 14.64 ? 278 LEU A C   1 
ATOM   1987 O O   . LEU A 1 276 ? 14.188  -13.592 9.685  1.00 16.04 ? 278 LEU A O   1 
ATOM   1988 C CB  . LEU A 1 276 ? 12.482  -14.772 12.401 1.00 12.23 ? 278 LEU A CB  1 
ATOM   1989 C CG  . LEU A 1 276 ? 13.750  -14.286 13.047 1.00 13.38 ? 278 LEU A CG  1 
ATOM   1990 C CD1 . LEU A 1 276 ? 13.783  -12.676 13.220 1.00 11.33 ? 278 LEU A CD1 1 
ATOM   1991 C CD2 . LEU A 1 276 ? 13.937  -14.962 14.374 1.00 14.20 ? 278 LEU A CD2 1 
ATOM   1992 N N   . ARG A 1 277 ? 13.512  -15.749 9.702  1.00 15.89 ? 279 ARG A N   1 
ATOM   1993 C CA  . ARG A 1 277 ? 14.482  -16.174 8.692  1.00 17.12 ? 279 ARG A CA  1 
ATOM   1994 C C   . ARG A 1 277 ? 14.464  -15.268 7.456  1.00 16.73 ? 279 ARG A C   1 
ATOM   1995 O O   . ARG A 1 277 ? 15.499  -14.669 7.075  1.00 15.79 ? 279 ARG A O   1 
ATOM   1996 C CB  . ARG A 1 277 ? 14.188  -17.639 8.348  1.00 17.48 ? 279 ARG A CB  1 
ATOM   1997 C CG  . ARG A 1 277 ? 15.347  -18.464 7.623  1.00 19.79 ? 279 ARG A CG  1 
ATOM   1998 C CD  . ARG A 1 277 ? 15.285  -18.280 6.135  1.00 22.78 ? 279 ARG A CD  1 
ATOM   1999 N NE  . ARG A 1 277 ? 16.246  -19.162 5.470  1.00 22.53 ? 279 ARG A NE  1 
ATOM   2000 C CZ  . ARG A 1 277 ? 16.559  -19.126 4.181  1.00 22.45 ? 279 ARG A CZ  1 
ATOM   2001 N NH1 . ARG A 1 277 ? 15.926  -18.270 3.371  1.00 23.24 ? 279 ARG A NH1 1 
ATOM   2002 N NH2 . ARG A 1 277 ? 17.481  -19.985 3.695  1.00 17.89 ? 279 ARG A NH2 1 
ATOM   2003 N N   . GLU A 1 278 ? 13.284  -15.097 6.842  1.00 16.81 ? 280 GLU A N   1 
ATOM   2004 C CA  . GLU A 1 278 ? 13.237  -14.243 5.661  1.00 17.76 ? 280 GLU A CA  1 
ATOM   2005 C C   . GLU A 1 278 ? 13.535  -12.784 5.968  1.00 16.14 ? 280 GLU A C   1 
ATOM   2006 O O   . GLU A 1 278 ? 14.208  -12.148 5.187  1.00 16.72 ? 280 GLU A O   1 
ATOM   2007 C CB  . GLU A 1 278 ? 11.941  -14.380 4.865  1.00 17.35 ? 280 GLU A CB  1 
ATOM   2008 C CG  . GLU A 1 278 ? 11.689  -15.757 4.338  1.00 22.02 ? 280 GLU A CG  1 
ATOM   2009 C CD  . GLU A 1 278 ? 12.710  -16.217 3.262  1.00 25.51 ? 280 GLU A CD  1 
ATOM   2010 O OE1 . GLU A 1 278 ? 12.346  -16.391 2.076  1.00 26.07 ? 280 GLU A OE1 1 
ATOM   2011 O OE2 . GLU A 1 278 ? 13.868  -16.452 3.626  1.00 26.64 ? 280 GLU A OE2 1 
ATOM   2012 N N   . GLY A 1 279 ? 13.028  -12.263 7.083  1.00 15.81 ? 281 GLY A N   1 
ATOM   2013 C CA  . GLY A 1 279 ? 13.281  -10.856 7.457  1.00 16.23 ? 281 GLY A CA  1 
ATOM   2014 C C   . GLY A 1 279 ? 14.753  -10.533 7.705  1.00 16.45 ? 281 GLY A C   1 
ATOM   2015 O O   . GLY A 1 279 ? 15.270  -9.550  7.179  1.00 15.97 ? 281 GLY A O   1 
ATOM   2016 N N   . VAL A 1 280 ? 15.451  -11.406 8.446  1.00 15.82 ? 282 VAL A N   1 
ATOM   2017 C CA  . VAL A 1 280 ? 16.880  -11.229 8.612  1.00 16.73 ? 282 VAL A CA  1 
ATOM   2018 C C   . VAL A 1 280 ? 17.619  -11.479 7.284  1.00 17.03 ? 282 VAL A C   1 
ATOM   2019 O O   . VAL A 1 280 ? 18.589  -10.791 6.943  1.00 15.58 ? 282 VAL A O   1 
ATOM   2020 C CB  . VAL A 1 280 ? 17.443  -12.149 9.700  1.00 16.29 ? 282 VAL A CB  1 
ATOM   2021 C CG1 . VAL A 1 280 ? 18.810  -11.704 10.030 1.00 17.30 ? 282 VAL A CG1 1 
ATOM   2022 C CG2 . VAL A 1 280 ? 16.555  -11.955 10.942 1.00 17.71 ? 282 VAL A CG2 1 
ATOM   2023 N N   . ARG A 1 281 ? 17.157  -12.420 6.490  1.00 16.58 ? 283 ARG A N   1 
ATOM   2024 C CA  . ARG A 1 281 ? 17.898  -12.562 5.210  1.00 17.80 ? 283 ARG A CA  1 
ATOM   2025 C C   . ARG A 1 281 ? 17.844  -11.238 4.411  1.00 18.21 ? 283 ARG A C   1 
ATOM   2026 O O   . ARG A 1 281 ? 18.802  -10.905 3.753  1.00 19.61 ? 283 ARG A O   1 
ATOM   2027 C CB  . ARG A 1 281 ? 17.349  -13.723 4.367  1.00 17.08 ? 283 ARG A CB  1 
ATOM   2028 C CG  . ARG A 1 281 ? 17.782  -13.745 2.917  1.00 17.00 ? 283 ARG A CG  1 
ATOM   2029 C CD  . ARG A 1 281 ? 17.204  -14.916 2.192  1.00 25.50 ? 283 ARG A CD  1 
ATOM   2030 N NE  . ARG A 1 281 ? 15.760  -14.833 1.952  1.00 22.70 ? 283 ARG A NE  1 
ATOM   2031 C CZ  . ARG A 1 281 ? 15.184  -14.217 0.919  1.00 21.86 ? 283 ARG A CZ  1 
ATOM   2032 N NH1 . ARG A 1 281 ? 15.886  -13.501 0.031  1.00 17.90 ? 283 ARG A NH1 1 
ATOM   2033 N NH2 . ARG A 1 281 ? 13.870  -14.286 0.812  1.00 20.63 ? 283 ARG A NH2 1 
ATOM   2034 N N   . LEU A 1 282 ? 16.705  -10.534 4.429  1.00 18.25 ? 284 LEU A N   1 
ATOM   2035 C CA  . LEU A 1 282 ? 16.555  -9.291  3.684  1.00 18.38 ? 284 LEU A CA  1 
ATOM   2036 C C   . LEU A 1 282 ? 17.411  -8.201  4.228  1.00 18.44 ? 284 LEU A C   1 
ATOM   2037 O O   . LEU A 1 282 ? 17.964  -7.382  3.437  1.00 18.05 ? 284 LEU A O   1 
ATOM   2038 C CB  . LEU A 1 282 ? 15.112  -8.789  3.582  1.00 17.33 ? 284 LEU A CB  1 
ATOM   2039 C CG  . LEU A 1 282 ? 14.146  -9.737  2.877  1.00 22.57 ? 284 LEU A CG  1 
ATOM   2040 C CD1 . LEU A 1 282 ? 12.771  -9.075  2.658  1.00 26.54 ? 284 LEU A CD1 1 
ATOM   2041 C CD2 . LEU A 1 282 ? 14.662  -10.308 1.569  1.00 21.80 ? 284 LEU A CD2 1 
ATOM   2042 N N   . VAL A 1 283 ? 17.549  -8.154  5.548  1.00 18.04 ? 285 VAL A N   1 
ATOM   2043 C CA  . VAL A 1 283 ? 18.490  -7.159  6.066  1.00 18.64 ? 285 VAL A CA  1 
ATOM   2044 C C   . VAL A 1 283 ? 19.917  -7.385  5.605  1.00 18.29 ? 285 VAL A C   1 
ATOM   2045 O O   . VAL A 1 283 ? 20.601  -6.470  5.218  1.00 16.88 ? 285 VAL A O   1 
ATOM   2046 C CB  . VAL A 1 283 ? 18.333  -6.765  7.578  1.00 19.73 ? 285 VAL A CB  1 
ATOM   2047 C CG1 . VAL A 1 283 ? 17.100  -7.250  8.229  1.00 19.49 ? 285 VAL A CG1 1 
ATOM   2048 C CG2 . VAL A 1 283 ? 19.687  -6.547  8.418  1.00 16.55 ? 285 VAL A CG2 1 
ATOM   2049 N N   . LEU A 1 284 ? 20.328  -8.619  5.626  1.00 17.45 ? 286 LEU A N   1 
ATOM   2050 C CA  . LEU A 1 284 ? 21.681  -8.966  5.234  1.00 18.94 ? 286 LEU A CA  1 
ATOM   2051 C C   . LEU A 1 284 ? 21.898  -8.800  3.733  1.00 18.40 ? 286 LEU A C   1 
ATOM   2052 O O   . LEU A 1 284 ? 23.007  -8.596  3.328  1.00 18.50 ? 286 LEU A O   1 
ATOM   2053 C CB  . LEU A 1 284 ? 21.962  -10.409 5.690  1.00 18.33 ? 286 LEU A CB  1 
ATOM   2054 C CG  . LEU A 1 284 ? 22.666  -10.631 7.042  1.00 22.16 ? 286 LEU A CG  1 
ATOM   2055 C CD1 . LEU A 1 284 ? 22.970  -9.420  8.058  1.00 18.68 ? 286 LEU A CD1 1 
ATOM   2056 C CD2 . LEU A 1 284 ? 22.189  -11.824 7.743  1.00 16.99 ? 286 LEU A CD2 1 
ATOM   2057 N N   . GLU A 1 285 ? 20.850  -8.922  2.902  1.00 19.62 ? 287 GLU A N   1 
ATOM   2058 C CA  . GLU A 1 285 ? 21.021  -8.731  1.487  1.00 20.15 ? 287 GLU A CA  1 
ATOM   2059 C C   . GLU A 1 285 ? 21.196  -7.262  1.195  1.00 21.03 ? 287 GLU A C   1 
ATOM   2060 O O   . GLU A 1 285 ? 21.971  -6.908  0.311  1.00 19.34 ? 287 GLU A O   1 
ATOM   2061 C CB  . GLU A 1 285 ? 19.888  -9.299  0.650  1.00 20.01 ? 287 GLU A CB  1 
ATOM   2062 C CG  . GLU A 1 285 ? 19.710  -10.822 0.834  1.00 26.30 ? 287 GLU A CG  1 
ATOM   2063 C CD  . GLU A 1 285 ? 18.699  -11.468 -0.140 1.00 29.67 ? 287 GLU A CD  1 
ATOM   2064 O OE1 . GLU A 1 285 ? 17.910  -10.717 -0.755 1.00 26.95 ? 287 GLU A OE1 1 
ATOM   2065 O OE2 . GLU A 1 285 ? 18.731  -12.743 -0.298 1.00 29.24 ? 287 GLU A OE2 1 
ATOM   2066 N N   . GLU A 1 286 ? 20.469  -6.417  1.942  1.00 20.77 ? 288 GLU A N   1 
ATOM   2067 C CA  . GLU A 1 286 ? 20.661  -5.003  1.873  1.00 19.42 ? 288 GLU A CA  1 
ATOM   2068 C C   . GLU A 1 286 ? 22.089  -4.609  2.285  1.00 20.99 ? 288 GLU A C   1 
ATOM   2069 O O   . GLU A 1 286 ? 22.767  -3.794  1.611  1.00 19.08 ? 288 GLU A O   1 
ATOM   2070 C CB  . GLU A 1 286 ? 19.602  -4.251  2.705  1.00 18.76 ? 288 GLU A CB  1 
ATOM   2071 C CG  . GLU A 1 286 ? 19.718  -2.687  2.461  1.00 17.89 ? 288 GLU A CG  1 
ATOM   2072 C CD  . GLU A 1 286 ? 18.604  -1.863  3.096  1.00 18.48 ? 288 GLU A CD  1 
ATOM   2073 O OE1 . GLU A 1 286 ? 17.783  -2.444  3.842  1.00 15.61 ? 288 GLU A OE1 1 
ATOM   2074 O OE2 . GLU A 1 286 ? 18.496  -0.609  2.842  1.00 18.12 ? 288 GLU A OE2 1 
ATOM   2075 N N   . GLY A 1 287 ? 22.587  -5.212  3.362  1.00 19.82 ? 289 GLY A N   1 
ATOM   2076 C CA  . GLY A 1 287 ? 23.850  -4.761  3.887  1.00 19.58 ? 289 GLY A CA  1 
ATOM   2077 C C   . GLY A 1 287 ? 23.538  -3.914  5.106  1.00 19.36 ? 289 GLY A C   1 
ATOM   2078 O O   . GLY A 1 287 ? 22.767  -2.910  5.022  1.00 19.46 ? 289 GLY A O   1 
ATOM   2079 N N   . LEU A 1 288 ? 24.141  -4.292  6.245  1.00 18.93 ? 290 LEU A N   1 
ATOM   2080 C CA  . LEU A 1 288 ? 23.918  -3.571  7.485  1.00 19.99 ? 290 LEU A CA  1 
ATOM   2081 C C   . LEU A 1 288 ? 24.288  -2.081  7.337  1.00 18.97 ? 290 LEU A C   1 
ATOM   2082 O O   . LEU A 1 288 ? 23.452  -1.187  7.560  1.00 18.71 ? 290 LEU A O   1 
ATOM   2083 C CB  . LEU A 1 288 ? 24.715  -4.228  8.629  1.00 19.72 ? 290 LEU A CB  1 
ATOM   2084 C CG  . LEU A 1 288 ? 24.142  -5.527  9.173  1.00 24.19 ? 290 LEU A CG  1 
ATOM   2085 C CD1 . LEU A 1 288 ? 24.937  -5.925  10.431 1.00 25.48 ? 290 LEU A CD1 1 
ATOM   2086 C CD2 . LEU A 1 288 ? 22.682  -5.304  9.526  1.00 23.30 ? 290 LEU A CD2 1 
ATOM   2087 N N   . GLU A 1 289 ? 25.520  -1.789  6.916  1.00 19.39 ? 291 GLU A N   1 
ATOM   2088 C CA  . GLU A 1 289 ? 25.917  -0.376  6.762  1.00 19.28 ? 291 GLU A CA  1 
ATOM   2089 C C   . GLU A 1 289 ? 25.072  0.422   5.733  1.00 19.77 ? 291 GLU A C   1 
ATOM   2090 O O   . GLU A 1 289 ? 24.614  1.518   6.050  1.00 16.80 ? 291 GLU A O   1 
ATOM   2091 C CB  . GLU A 1 289 ? 27.431  -0.223  6.538  1.00 20.61 ? 291 GLU A CB  1 
ATOM   2092 C CG  . GLU A 1 289 ? 28.113  0.489   7.738  1.00 28.94 ? 291 GLU A CG  1 
ATOM   2093 C CD  . GLU A 1 289 ? 28.777  -0.444  8.681  1.00 38.00 ? 291 GLU A CD  1 
ATOM   2094 O OE1 . GLU A 1 289 ? 28.076  -1.213  9.336  1.00 42.59 ? 291 GLU A OE1 1 
ATOM   2095 O OE2 . GLU A 1 289 ? 30.034  -0.407  8.801  1.00 45.73 ? 291 GLU A OE2 1 
ATOM   2096 N N   . THR A 1 290 ? 24.795  -0.174  4.554  1.00 19.98 ? 292 THR A N   1 
ATOM   2097 C CA  . THR A 1 290 ? 23.831  0.356   3.580  1.00 20.10 ? 292 THR A CA  1 
ATOM   2098 C C   . THR A 1 290 ? 22.472  0.571   4.231  1.00 19.41 ? 292 THR A C   1 
ATOM   2099 O O   . THR A 1 290 ? 21.884  1.647   4.138  1.00 19.53 ? 292 THR A O   1 
ATOM   2100 C CB  . THR A 1 290 ? 23.680  -0.602  2.362  1.00 20.24 ? 292 THR A CB  1 
ATOM   2101 O OG1 . THR A 1 290 ? 24.957  -0.809  1.808  1.00 23.07 ? 292 THR A OG1 1 
ATOM   2102 C CG2 . THR A 1 290 ? 22.774  -0.046  1.237  1.00 23.04 ? 292 THR A CG2 1 
ATOM   2103 N N   . ARG A 1 291 ? 21.948  -0.449  4.903  1.00 19.21 ? 293 ARG A N   1 
ATOM   2104 C CA  . ARG A 1 291 ? 20.700  -0.265  5.604  1.00 18.44 ? 293 ARG A CA  1 
ATOM   2105 C C   . ARG A 1 291 ? 20.725  0.854   6.632  1.00 17.19 ? 293 ARG A C   1 
ATOM   2106 O O   . ARG A 1 291 ? 19.768  1.610   6.692  1.00 18.13 ? 293 ARG A O   1 
ATOM   2107 C CB  . ARG A 1 291 ? 20.231  -1.587  6.243  1.00 16.20 ? 293 ARG A CB  1 
ATOM   2108 C CG  . ARG A 1 291 ? 18.901  -1.525  6.835  1.00 16.03 ? 293 ARG A CG  1 
ATOM   2109 C CD  . ARG A 1 291 ? 18.433  -2.958  7.058  1.00 18.84 ? 293 ARG A CD  1 
ATOM   2110 N NE  . ARG A 1 291 ? 17.080  -3.131  7.589  1.00 16.18 ? 293 ARG A NE  1 
ATOM   2111 C CZ  . ARG A 1 291 ? 16.052  -3.633  6.869  1.00 17.67 ? 293 ARG A CZ  1 
ATOM   2112 N NH1 . ARG A 1 291 ? 16.221  -3.942  5.591  1.00 16.46 ? 293 ARG A NH1 1 
ATOM   2113 N NH2 . ARG A 1 291 ? 14.867  -3.849  7.435  1.00 14.53 ? 293 ARG A NH2 1 
ATOM   2114 N N   . PHE A 1 292 ? 21.777  0.981   7.440  1.00 18.05 ? 294 PHE A N   1 
ATOM   2115 C CA  . PHE A 1 292 ? 21.789  2.112   8.413  1.00 18.37 ? 294 PHE A CA  1 
ATOM   2116 C C   . PHE A 1 292 ? 21.811  3.470   7.727  1.00 20.06 ? 294 PHE A C   1 
ATOM   2117 O O   . PHE A 1 292 ? 21.165  4.447   8.194  1.00 20.36 ? 294 PHE A O   1 
ATOM   2118 C CB  . PHE A 1 292 ? 22.986  2.066   9.385  1.00 18.31 ? 294 PHE A CB  1 
ATOM   2119 C CG  . PHE A 1 292 ? 23.179  0.722   10.108 1.00 17.97 ? 294 PHE A CG  1 
ATOM   2120 C CD1 . PHE A 1 292 ? 22.086  -0.094  10.458 1.00 18.44 ? 294 PHE A CD1 1 
ATOM   2121 C CD2 . PHE A 1 292 ? 24.466  0.298   10.448 1.00 16.04 ? 294 PHE A CD2 1 
ATOM   2122 C CE1 . PHE A 1 292 ? 22.270  -1.331  11.106 1.00 14.32 ? 294 PHE A CE1 1 
ATOM   2123 C CE2 . PHE A 1 292 ? 24.658  -0.948  11.109 1.00 18.82 ? 294 PHE A CE2 1 
ATOM   2124 C CZ  . PHE A 1 292 ? 23.554  -1.733  11.465 1.00 16.70 ? 294 PHE A CZ  1 
ATOM   2125 N N   . GLU A 1 293 ? 22.588  3.554   6.642  1.00 19.80 ? 295 GLU A N   1 
ATOM   2126 C CA  . GLU A 1 293 ? 22.663  4.789   5.844  1.00 21.51 ? 295 GLU A CA  1 
ATOM   2127 C C   . GLU A 1 293 ? 21.286  5.093   5.182  1.00 19.87 ? 295 GLU A C   1 
ATOM   2128 O O   . GLU A 1 293 ? 20.837  6.251   5.139  1.00 19.37 ? 295 GLU A O   1 
ATOM   2129 C CB  . GLU A 1 293 ? 23.784  4.691   4.779  1.00 21.71 ? 295 GLU A CB  1 
ATOM   2130 C CG  . GLU A 1 293 ? 23.650  5.774   3.711  1.00 28.48 ? 295 GLU A CG  1 
ATOM   2131 C CD  . GLU A 1 293 ? 23.894  7.161   4.302  1.00 39.08 ? 295 GLU A CD  1 
ATOM   2132 O OE1 . GLU A 1 293 ? 23.303  8.167   3.815  1.00 41.92 ? 295 GLU A OE1 1 
ATOM   2133 O OE2 . GLU A 1 293 ? 24.693  7.239   5.277  1.00 43.30 ? 295 GLU A OE2 1 
ATOM   2134 N N   . ARG A 1 294 ? 20.595  4.047   4.727  1.00 17.83 ? 296 ARG A N   1 
ATOM   2135 C CA  . ARG A 1 294 ? 19.267  4.231   4.155  1.00 18.08 ? 296 ARG A CA  1 
ATOM   2136 C C   . ARG A 1 294 ? 18.261  4.782   5.205  1.00 17.39 ? 296 ARG A C   1 
ATOM   2137 O O   . ARG A 1 294 ? 17.386  5.570   4.899  1.00 16.71 ? 296 ARG A O   1 
ATOM   2138 C CB  . ARG A 1 294 ? 18.828  2.867   3.578  1.00 18.48 ? 296 ARG A CB  1 
ATOM   2139 C CG  . ARG A 1 294 ? 17.505  2.849   2.774  1.00 20.39 ? 296 ARG A CG  1 
ATOM   2140 C CD  . ARG A 1 294 ? 16.334  2.393   3.597  1.00 22.33 ? 296 ARG A CD  1 
ATOM   2141 N NE  . ARG A 1 294 ? 16.406  0.954   3.905  1.00 16.48 ? 296 ARG A NE  1 
ATOM   2142 C CZ  . ARG A 1 294 ? 15.436  0.241   4.456  1.00 19.35 ? 296 ARG A CZ  1 
ATOM   2143 N NH1 . ARG A 1 294 ? 14.323  0.836   4.800  1.00 14.00 ? 296 ARG A NH1 1 
ATOM   2144 N NH2 . ARG A 1 294 ? 15.644  -1.078  4.720  1.00 10.86 ? 296 ARG A NH2 1 
ATOM   2145 N N   . HIS A 1 295 ? 18.373  4.324   6.452  1.00 16.95 ? 297 HIS A N   1 
ATOM   2146 C CA  . HIS A 1 295 ? 17.523  4.858   7.535  1.00 16.76 ? 297 HIS A CA  1 
ATOM   2147 C C   . HIS A 1 295 ? 17.874  6.359   7.773  1.00 17.42 ? 297 HIS A C   1 
ATOM   2148 O O   . HIS A 1 295 ? 16.991  7.176   7.921  1.00 17.67 ? 297 HIS A O   1 
ATOM   2149 C CB  . HIS A 1 295 ? 17.648  4.007   8.802  1.00 14.85 ? 297 HIS A CB  1 
ATOM   2150 C CG  . HIS A 1 295 ? 16.827  2.723   8.735  1.00 18.46 ? 297 HIS A CG  1 
ATOM   2151 N ND1 . HIS A 1 295 ? 17.166  1.653   7.921  1.00 18.02 ? 297 HIS A ND1 1 
ATOM   2152 C CD2 . HIS A 1 295 ? 15.668  2.370   9.351  1.00 12.38 ? 297 HIS A CD2 1 
ATOM   2153 C CE1 . HIS A 1 295 ? 16.252  0.696   8.049  1.00 16.60 ? 297 HIS A CE1 1 
ATOM   2154 N NE2 . HIS A 1 295 ? 15.316  1.127   8.882  1.00 18.57 ? 297 HIS A NE2 1 
ATOM   2155 N N   . ARG A 1 296 ? 19.144  6.693   7.812  1.00 16.68 ? 298 ARG A N   1 
ATOM   2156 C CA  . ARG A 1 296 ? 19.527  8.113   7.865  1.00 18.32 ? 298 ARG A CA  1 
ATOM   2157 C C   . ARG A 1 296 ? 19.027  8.984   6.716  1.00 17.84 ? 298 ARG A C   1 
ATOM   2158 O O   . ARG A 1 296 ? 18.561  10.162  6.901  1.00 17.56 ? 298 ARG A O   1 
ATOM   2159 C CB  . ARG A 1 296 ? 21.031  8.212   7.952  1.00 18.02 ? 298 ARG A CB  1 
ATOM   2160 C CG  . ARG A 1 296 ? 21.525  7.761   9.364  1.00 22.03 ? 298 ARG A CG  1 
ATOM   2161 C CD  . ARG A 1 296 ? 22.968  8.222   9.597  1.00 25.92 ? 298 ARG A CD  1 
ATOM   2162 N NE  . ARG A 1 296 ? 23.884  7.660   8.588  1.00 29.42 ? 298 ARG A NE  1 
ATOM   2163 C CZ  . ARG A 1 296 ? 24.457  6.445   8.672  1.00 31.90 ? 298 ARG A CZ  1 
ATOM   2164 N NH1 . ARG A 1 296 ? 24.221  5.616   9.712  1.00 29.99 ? 298 ARG A NH1 1 
ATOM   2165 N NH2 . ARG A 1 296 ? 25.282  6.058   7.711  1.00 30.56 ? 298 ARG A NH2 1 
ATOM   2166 N N   . HIS A 1 297 ? 19.136  8.456   5.503  1.00 17.72 ? 299 HIS A N   1 
ATOM   2167 C CA  . HIS A 1 297 ? 18.683  9.227   4.356  1.00 18.61 ? 299 HIS A CA  1 
ATOM   2168 C C   . HIS A 1 297 ? 17.181  9.679   4.537  1.00 19.92 ? 299 HIS A C   1 
ATOM   2169 O O   . HIS A 1 297 ? 16.815  10.888  4.399  1.00 18.22 ? 299 HIS A O   1 
ATOM   2170 C CB  . HIS A 1 297 ? 18.893  8.353   3.101  1.00 19.65 ? 299 HIS A CB  1 
ATOM   2171 C CG  . HIS A 1 297 ? 18.483  9.021   1.825  1.00 22.19 ? 299 HIS A CG  1 
ATOM   2172 N ND1 . HIS A 1 297 ? 17.735  8.386   0.856  1.00 22.23 ? 299 HIS A ND1 1 
ATOM   2173 C CD2 . HIS A 1 297 ? 18.737  10.269  1.348  1.00 22.95 ? 299 HIS A CD2 1 
ATOM   2174 C CE1 . HIS A 1 297 ? 17.544  9.209   -0.156 1.00 20.67 ? 299 HIS A CE1 1 
ATOM   2175 N NE2 . HIS A 1 297 ? 18.102  10.367  0.137  1.00 20.22 ? 299 HIS A NE2 1 
ATOM   2176 N N   . HIS A 1 298 ? 16.298  8.710   4.856  1.00 18.28 ? 300 HIS A N   1 
ATOM   2177 C CA  . HIS A 1 298 ? 14.881  9.018   4.985  1.00 18.79 ? 300 HIS A CA  1 
ATOM   2178 C C   . HIS A 1 298 ? 14.601  9.883   6.206  1.00 18.72 ? 300 HIS A C   1 
ATOM   2179 O O   . HIS A 1 298 ? 13.687  10.729  6.190  1.00 19.54 ? 300 HIS A O   1 
ATOM   2180 C CB  . HIS A 1 298 ? 13.990  7.770   4.885  1.00 16.92 ? 300 HIS A CB  1 
ATOM   2181 C CG  . HIS A 1 298 ? 14.131  7.085   3.563  1.00 20.05 ? 300 HIS A CG  1 
ATOM   2182 N ND1 . HIS A 1 298 ? 13.657  7.618   2.381  1.00 18.46 ? 300 HIS A ND1 1 
ATOM   2183 C CD2 . HIS A 1 298 ? 14.781  5.951   3.223  1.00 20.98 ? 300 HIS A CD2 1 
ATOM   2184 C CE1 . HIS A 1 298 ? 13.981  6.817   1.381  1.00 16.76 ? 300 HIS A CE1 1 
ATOM   2185 N NE2 . HIS A 1 298 ? 14.655  5.799   1.868  1.00 20.70 ? 300 HIS A NE2 1 
ATOM   2186 N N   . GLU A 1 299 ? 15.406  9.699   7.245  1.00 18.06 ? 301 GLU A N   1 
ATOM   2187 C CA  . GLU A 1 299 ? 15.291  10.536  8.401  1.00 16.58 ? 301 GLU A CA  1 
ATOM   2188 C C   . GLU A 1 299 ? 15.532  11.989  7.986  1.00 16.70 ? 301 GLU A C   1 
ATOM   2189 O O   . GLU A 1 299 ? 14.798  12.876  8.441  1.00 15.38 ? 301 GLU A O   1 
ATOM   2190 C CB  . GLU A 1 299 ? 16.271  10.083  9.506  1.00 16.98 ? 301 GLU A CB  1 
ATOM   2191 C CG  . GLU A 1 299 ? 16.420  11.133  10.629 1.00 17.98 ? 301 GLU A CG  1 
ATOM   2192 C CD  . GLU A 1 299 ? 17.566  10.857  11.562 1.00 20.84 ? 301 GLU A CD  1 
ATOM   2193 O OE1 . GLU A 1 299 ? 18.568  10.173  11.145 1.00 14.77 ? 301 GLU A OE1 1 
ATOM   2194 O OE2 . GLU A 1 299 ? 17.410  11.319  12.731 1.00 17.58 ? 301 GLU A OE2 1 
ATOM   2195 N N   . ALA A 1 300 ? 16.533  12.218  7.125  1.00 16.42 ? 302 ALA A N   1 
ATOM   2196 C CA  . ALA A 1 300 ? 16.917  13.561  6.712  1.00 19.05 ? 302 ALA A CA  1 
ATOM   2197 C C   . ALA A 1 300 ? 15.803  14.218  5.852  1.00 19.45 ? 302 ALA A C   1 
ATOM   2198 O O   . ALA A 1 300 ? 15.421  15.344  6.124  1.00 19.68 ? 302 ALA A O   1 
ATOM   2199 C CB  . ALA A 1 300 ? 18.260  13.546  5.972  1.00 18.98 ? 302 ALA A CB  1 
ATOM   2200 N N   . ALA A 1 301 ? 15.260  13.488  4.870  1.00 18.70 ? 303 ALA A N   1 
ATOM   2201 C CA  . ALA A 1 301 ? 14.107  13.941  4.126  1.00 18.03 ? 303 ALA A CA  1 
ATOM   2202 C C   . ALA A 1 301 ? 12.854  14.276  5.013  1.00 18.89 ? 303 ALA A C   1 
ATOM   2203 O O   . ALA A 1 301 ? 12.284  15.349  4.849  1.00 17.26 ? 303 ALA A O   1 
ATOM   2204 C CB  . ALA A 1 301 ? 13.758  12.890  3.042  1.00 18.98 ? 303 ALA A CB  1 
ATOM   2205 N N   . LEU A 1 302 ? 12.419  13.346  5.912  1.00 18.43 ? 304 LEU A N   1 
ATOM   2206 C CA  . LEU A 1 302 ? 11.348  13.639  6.874  1.00 18.28 ? 304 LEU A CA  1 
ATOM   2207 C C   . LEU A 1 302 ? 11.602  14.948  7.649  1.00 19.53 ? 304 LEU A C   1 
ATOM   2208 O O   . LEU A 1 302 ? 10.731  15.835  7.711  1.00 20.69 ? 304 LEU A O   1 
ATOM   2209 C CB  . LEU A 1 302 ? 11.122  12.465  7.844  1.00 17.97 ? 304 LEU A CB  1 
ATOM   2210 C CG  . LEU A 1 302 ? 10.028  12.679  8.900  1.00 16.70 ? 304 LEU A CG  1 
ATOM   2211 C CD1 . LEU A 1 302 ? 8.658   12.754  8.209  1.00 18.08 ? 304 LEU A CD1 1 
ATOM   2212 C CD2 . LEU A 1 302 ? 9.980   11.563  9.937  1.00 17.12 ? 304 LEU A CD2 1 
ATOM   2213 N N   . ALA A 1 303 ? 12.818  15.062  8.214  1.00 21.00 ? 305 ALA A N   1 
ATOM   2214 C CA  . ALA A 1 303 ? 13.270  16.220  8.973  1.00 20.83 ? 305 ALA A CA  1 
ATOM   2215 C C   . ALA A 1 303 ? 13.164  17.535  8.209  1.00 20.18 ? 305 ALA A C   1 
ATOM   2216 O O   . ALA A 1 303 ? 12.625  18.555  8.758  1.00 19.19 ? 305 ALA A O   1 
ATOM   2217 C CB  . ALA A 1 303 ? 14.713  16.005  9.486  1.00 21.38 ? 305 ALA A CB  1 
ATOM   2218 N N   . ALA A 1 304 ? 13.649  17.540  6.959  1.00 19.71 ? 306 ALA A N   1 
ATOM   2219 C CA  . ALA A 1 304 ? 13.536  18.800  6.163  1.00 19.97 ? 306 ALA A CA  1 
ATOM   2220 C C   . ALA A 1 304 ? 12.045  19.042  5.873  1.00 20.19 ? 306 ALA A C   1 
ATOM   2221 O O   . ALA A 1 304 ? 11.611  20.167  5.936  1.00 18.18 ? 306 ALA A O   1 
ATOM   2222 C CB  . ALA A 1 304 ? 14.399  18.789  4.869  1.00 18.78 ? 306 ALA A CB  1 
ATOM   2223 N N   . GLY A 1 305 ? 11.233  17.988  5.673  1.00 18.89 ? 307 GLY A N   1 
ATOM   2224 C CA  . GLY A 1 305 ? 9.813   18.250  5.464  1.00 18.79 ? 307 GLY A CA  1 
ATOM   2225 C C   . GLY A 1 305 ? 9.117   18.839  6.685  1.00 20.59 ? 307 GLY A C   1 
ATOM   2226 O O   . GLY A 1 305 ? 8.329   19.844  6.571  1.00 22.50 ? 307 GLY A O   1 
ATOM   2227 N N   . ILE A 1 306 ? 9.391   18.263  7.862  1.00 20.48 ? 308 ILE A N   1 
ATOM   2228 C CA  . ILE A 1 306 ? 8.745   18.702  9.121  1.00 19.42 ? 308 ILE A CA  1 
ATOM   2229 C C   . ILE A 1 306 ? 9.136   20.148  9.393  1.00 20.84 ? 308 ILE A C   1 
ATOM   2230 O O   . ILE A 1 306 ? 8.311   20.974  9.811  1.00 20.89 ? 308 ILE A O   1 
ATOM   2231 C CB  . ILE A 1 306 ? 9.176   17.815  10.312 1.00 19.56 ? 308 ILE A CB  1 
ATOM   2232 C CG1 . ILE A 1 306 ? 8.541   16.399  10.212 1.00 18.76 ? 308 ILE A CG1 1 
ATOM   2233 C CG2 . ILE A 1 306 ? 8.903   18.502  11.665 1.00 16.95 ? 308 ILE A CG2 1 
ATOM   2234 C CD1 . ILE A 1 306 ? 6.922   16.378  10.110 1.00 19.23 ? 308 ILE A CD1 1 
ATOM   2235 N N   . LYS A 1 307 ? 10.406  20.455  9.147  1.00 21.66 ? 309 LYS A N   1 
ATOM   2236 C CA  . LYS A 1 307 ? 10.940  21.827  9.369  1.00 21.49 ? 309 LYS A CA  1 
ATOM   2237 C C   . LYS A 1 307 ? 10.321  22.892  8.475  1.00 22.63 ? 309 LYS A C   1 
ATOM   2238 O O   . LYS A 1 307 ? 9.953   23.991  8.937  1.00 24.21 ? 309 LYS A O   1 
ATOM   2239 C CB  . LYS A 1 307 ? 12.456  21.859  9.195  1.00 20.24 ? 309 LYS A CB  1 
ATOM   2240 C CG  . LYS A 1 307 ? 13.045  23.272  9.538  1.00 24.02 ? 309 LYS A CG  1 
ATOM   2241 C CD  . LYS A 1 307 ? 14.434  23.473  8.946  1.00 27.09 ? 309 LYS A CD  1 
ATOM   2242 C CE  . LYS A 1 307 ? 15.502  23.106  9.964  1.00 30.99 ? 309 LYS A CE  1 
ATOM   2243 N NZ  . LYS A 1 307 ? 16.563  24.199  9.912  1.00 32.20 ? 309 LYS A NZ  1 
ATOM   2244 N N   . ALA A 1 308 ? 10.256  22.590  7.180  1.00 23.52 ? 310 ALA A N   1 
ATOM   2245 C CA  . ALA A 1 308 ? 9.755   23.489  6.166  1.00 23.89 ? 310 ALA A CA  1 
ATOM   2246 C C   . ALA A 1 308 ? 8.264   23.696  6.411  1.00 24.39 ? 310 ALA A C   1 
ATOM   2247 O O   . ALA A 1 308 ? 7.692   24.756  6.103  1.00 24.61 ? 310 ALA A O   1 
ATOM   2248 C CB  . ALA A 1 308 ? 10.013  22.888  4.807  1.00 24.08 ? 310 ALA A CB  1 
ATOM   2249 N N   . MET A 1 309 ? 7.644   22.686  7.002  1.00 24.72 ? 311 MET A N   1 
ATOM   2250 C CA  . MET A 1 309 ? 6.265   22.808  7.440  1.00 25.05 ? 311 MET A CA  1 
ATOM   2251 C C   . MET A 1 309 ? 6.093   23.779  8.642  1.00 25.44 ? 311 MET A C   1 
ATOM   2252 O O   . MET A 1 309 ? 4.963   24.102  9.011  1.00 26.02 ? 311 MET A O   1 
ATOM   2253 C CB  . MET A 1 309 ? 5.703   21.439  7.773  1.00 23.49 ? 311 MET A CB  1 
ATOM   2254 C CG  . MET A 1 309 ? 4.203   21.372  7.812  1.00 23.00 ? 311 MET A CG  1 
ATOM   2255 S SD  . MET A 1 309 ? 3.745   19.665  8.013  1.00 26.64 ? 311 MET A SD  1 
ATOM   2256 C CE  . MET A 1 309 ? 2.227   19.643  8.885  1.00 25.86 ? 311 MET A CE  1 
ATOM   2257 N N   . GLY A 1 310 ? 7.191   24.216  9.266  1.00 25.86 ? 312 GLY A N   1 
ATOM   2258 C CA  . GLY A 1 310 ? 7.111   25.202  10.370 1.00 25.66 ? 312 GLY A CA  1 
ATOM   2259 C C   . GLY A 1 310 ? 6.964   24.516  11.732 1.00 26.75 ? 312 GLY A C   1 
ATOM   2260 O O   . GLY A 1 310 ? 6.657   25.179  12.738 1.00 26.93 ? 312 GLY A O   1 
ATOM   2261 N N   . LEU A 1 311 ? 7.186   23.203  11.772 1.00 25.11 ? 313 LEU A N   1 
ATOM   2262 C CA  . LEU A 1 311 ? 7.121   22.448  13.031 1.00 25.81 ? 313 LEU A CA  1 
ATOM   2263 C C   . LEU A 1 311 ? 8.501   22.302  13.699 1.00 25.38 ? 313 LEU A C   1 
ATOM   2264 O O   . LEU A 1 311 ? 9.530   22.390  13.045 1.00 25.04 ? 313 LEU A O   1 
ATOM   2265 C CB  . LEU A 1 311 ? 6.458   21.049  12.830 1.00 24.60 ? 313 LEU A CB  1 
ATOM   2266 C CG  . LEU A 1 311 ? 4.990   21.041  12.365 1.00 26.09 ? 313 LEU A CG  1 
ATOM   2267 C CD1 . LEU A 1 311 ? 4.549   19.687  11.899 1.00 25.30 ? 313 LEU A CD1 1 
ATOM   2268 C CD2 . LEU A 1 311 ? 4.043   21.526  13.412 1.00 26.33 ? 313 LEU A CD2 1 
ATOM   2269 N N   . ARG A 1 312 ? 8.514   22.058  15.000 1.00 26.42 ? 314 ARG A N   1 
ATOM   2270 C CA  . ARG A 1 312 ? 9.780   21.860  15.734 1.00 28.18 ? 314 ARG A CA  1 
ATOM   2271 C C   . ARG A 1 312 ? 9.931   20.427  16.258 1.00 28.15 ? 314 ARG A C   1 
ATOM   2272 O O   . ARG A 1 312 ? 8.935   19.771  16.586 1.00 29.23 ? 314 ARG A O   1 
ATOM   2273 C CB  . ARG A 1 312 ? 9.884   22.824  16.912 1.00 28.35 ? 314 ARG A CB  1 
ATOM   2274 C CG  . ARG A 1 312 ? 9.061   24.118  16.766 1.00 32.62 ? 314 ARG A CG  1 
ATOM   2275 C CD  . ARG A 1 312 ? 9.800   25.316  17.275 1.00 41.49 ? 314 ARG A CD  1 
ATOM   2276 N NE  . ARG A 1 312 ? 10.365  26.043  16.141 1.00 47.24 ? 314 ARG A NE  1 
ATOM   2277 C CZ  . ARG A 1 312 ? 11.351  26.938  16.213 1.00 50.72 ? 314 ARG A CZ  1 
ATOM   2278 N NH1 . ARG A 1 312 ? 11.916  27.265  17.384 1.00 50.33 ? 314 ARG A NH1 1 
ATOM   2279 N NH2 . ARG A 1 312 ? 11.772  27.517  15.093 1.00 51.23 ? 314 ARG A NH2 1 
ATOM   2280 N N   . LEU A 1 313 ? 11.160  19.945  16.355 1.00 28.26 ? 315 LEU A N   1 
ATOM   2281 C CA  . LEU A 1 313 ? 11.403  18.647  16.989 1.00 28.95 ? 315 LEU A CA  1 
ATOM   2282 C C   . LEU A 1 313 ? 11.602  18.789  18.507 1.00 28.39 ? 315 LEU A C   1 
ATOM   2283 O O   . LEU A 1 313 ? 12.188  19.756  18.975 1.00 28.40 ? 315 LEU A O   1 
ATOM   2284 C CB  . LEU A 1 313 ? 12.613  17.959  16.341 1.00 30.26 ? 315 LEU A CB  1 
ATOM   2285 C CG  . LEU A 1 313 ? 12.484  17.719  14.823 1.00 32.65 ? 315 LEU A CG  1 
ATOM   2286 C CD1 . LEU A 1 313 ? 13.690  16.911  14.289 1.00 32.61 ? 315 LEU A CD1 1 
ATOM   2287 C CD2 . LEU A 1 313 ? 11.172  17.020  14.483 1.00 32.70 ? 315 LEU A CD2 1 
ATOM   2288 N N   . PHE A 1 314 ? 11.093  17.823  19.259 1.00 28.09 ? 316 PHE A N   1 
ATOM   2289 C CA  . PHE A 1 314 ? 11.421  17.668  20.666 1.00 28.27 ? 316 PHE A CA  1 
ATOM   2290 C C   . PHE A 1 314 ? 12.806  17.049  20.840 1.00 28.95 ? 316 PHE A C   1 
ATOM   2291 O O   . PHE A 1 314 ? 13.241  16.196  20.022 1.00 26.25 ? 316 PHE A O   1 
ATOM   2292 C CB  . PHE A 1 314 ? 10.386  16.737  21.309 1.00 28.56 ? 316 PHE A CB  1 
ATOM   2293 C CG  . PHE A 1 314 ? 10.744  16.243  22.700 1.00 27.95 ? 316 PHE A CG  1 
ATOM   2294 C CD1 . PHE A 1 314 ? 10.614  17.076  23.797 1.00 29.57 ? 316 PHE A CD1 1 
ATOM   2295 C CD2 . PHE A 1 314 ? 11.174  14.936  22.897 1.00 28.26 ? 316 PHE A CD2 1 
ATOM   2296 C CE1 . PHE A 1 314 ? 10.939  16.620  25.114 1.00 31.35 ? 316 PHE A CE1 1 
ATOM   2297 C CE2 . PHE A 1 314 ? 11.480  14.456  24.192 1.00 32.63 ? 316 PHE A CE2 1 
ATOM   2298 C CZ  . PHE A 1 314 ? 11.373  15.283  25.292 1.00 30.59 ? 316 PHE A CZ  1 
ATOM   2299 N N   . GLY A 1 315 ? 13.497  17.471  21.906 1.00 28.46 ? 317 GLY A N   1 
ATOM   2300 C CA  . GLY A 1 315 ? 14.560  16.625  22.431 1.00 30.74 ? 317 GLY A CA  1 
ATOM   2301 C C   . GLY A 1 315 ? 15.962  17.050  22.045 1.00 31.83 ? 317 GLY A C   1 
ATOM   2302 O O   . GLY A 1 315 ? 16.134  17.924  21.172 1.00 31.53 ? 317 GLY A O   1 
ATOM   2303 N N   . ASP A 1 316 ? 16.949  16.441  22.726 1.00 32.37 ? 318 ASP A N   1 
ATOM   2304 C CA  . ASP A 1 316 ? 18.377  16.760  22.581 1.00 33.77 ? 318 ASP A CA  1 
ATOM   2305 C C   . ASP A 1 316 ? 18.811  16.270  21.200 1.00 33.89 ? 318 ASP A C   1 
ATOM   2306 O O   . ASP A 1 316 ? 18.848  15.057  20.953 1.00 33.05 ? 318 ASP A O   1 
ATOM   2307 C CB  . ASP A 1 316 ? 19.179  16.017  23.655 1.00 33.64 ? 318 ASP A CB  1 
ATOM   2308 C CG  . ASP A 1 316 ? 20.553  16.600  23.898 1.00 37.01 ? 318 ASP A CG  1 
ATOM   2309 O OD1 . ASP A 1 316 ? 21.365  16.754  22.949 1.00 38.34 ? 318 ASP A OD1 1 
ATOM   2310 O OD2 . ASP A 1 316 ? 20.839  16.876  25.085 1.00 40.16 ? 318 ASP A OD2 1 
ATOM   2311 N N   . ASP A 1 317 ? 19.149  17.229  20.328 1.00 34.56 ? 319 ASP A N   1 
ATOM   2312 C CA  . ASP A 1 317 ? 19.600  16.939  18.964 1.00 34.66 ? 319 ASP A CA  1 
ATOM   2313 C C   . ASP A 1 317 ? 20.903  16.103  18.932 1.00 33.05 ? 319 ASP A C   1 
ATOM   2314 O O   . ASP A 1 317 ? 21.150  15.403  17.975 1.00 35.42 ? 319 ASP A O   1 
ATOM   2315 C CB  . ASP A 1 317 ? 19.703  18.230  18.100 1.00 34.47 ? 319 ASP A CB  1 
ATOM   2316 C CG  . ASP A 1 317 ? 20.779  19.218  18.591 1.00 40.01 ? 319 ASP A CG  1 
ATOM   2317 O OD1 . ASP A 1 317 ? 21.818  18.834  19.204 1.00 42.37 ? 319 ASP A OD1 1 
ATOM   2318 O OD2 . ASP A 1 317 ? 20.589  20.440  18.352 1.00 44.23 ? 319 ASP A OD2 1 
ATOM   2319 N N   . SER A 1 318 ? 21.706  16.111  19.978 1.00 31.21 ? 320 SER A N   1 
ATOM   2320 C CA  . SER A 1 318 ? 22.968  15.343  19.919 1.00 30.12 ? 320 SER A CA  1 
ATOM   2321 C C   . SER A 1 318 ? 22.796  13.839  20.093 1.00 29.43 ? 320 SER A C   1 
ATOM   2322 O O   . SER A 1 318 ? 23.641  13.059  19.674 1.00 30.61 ? 320 SER A O   1 
ATOM   2323 C CB  . SER A 1 318 ? 24.004  15.875  20.913 1.00 30.12 ? 320 SER A CB  1 
ATOM   2324 O OG  . SER A 1 318 ? 23.526  15.741  22.235 1.00 30.93 ? 320 SER A OG  1 
ATOM   2325 N N   . CYS A 1 319 ? 21.696  13.421  20.672 1.00 27.34 ? 321 CYS A N   1 
ATOM   2326 C CA  . CYS A 1 319 ? 21.465  12.006  20.849 1.00 27.02 ? 321 CYS A CA  1 
ATOM   2327 C C   . CYS A 1 319 ? 20.110  11.644  20.209 1.00 25.82 ? 321 CYS A C   1 
ATOM   2328 O O   . CYS A 1 319 ? 19.344  10.892  20.797 1.00 26.75 ? 321 CYS A O   1 
ATOM   2329 C CB  . CYS A 1 319 ? 21.486  11.659  22.357 1.00 26.45 ? 321 CYS A CB  1 
ATOM   2330 S SG  . CYS A 1 319 ? 20.234  12.643  23.336 1.00 28.64 ? 321 CYS A SG  1 
ATOM   2331 N N   . LYS A 1 320 ? 19.821  12.140  19.004 1.00 23.63 ? 322 LYS A N   1 
ATOM   2332 C CA  . LYS A 1 320 ? 18.545  11.853  18.383 1.00 23.38 ? 322 LYS A CA  1 
ATOM   2333 C C   . LYS A 1 320 ? 18.556  10.416  17.818 1.00 23.44 ? 322 LYS A C   1 
ATOM   2334 O O   . LYS A 1 320 ? 19.400  10.073  17.019 1.00 22.83 ? 322 LYS A O   1 
ATOM   2335 C CB  . LYS A 1 320 ? 18.204  12.779  17.236 1.00 23.82 ? 322 LYS A CB  1 
ATOM   2336 C CG  . LYS A 1 320 ? 16.795  12.431  16.623 1.00 23.27 ? 322 LYS A CG  1 
ATOM   2337 C CD  . LYS A 1 320 ? 16.496  13.272  15.320 1.00 27.14 ? 322 LYS A CD  1 
ATOM   2338 C CE  . LYS A 1 320 ? 15.184  12.811  14.706 1.00 25.02 ? 322 LYS A CE  1 
ATOM   2339 N NZ  . LYS A 1 320 ? 15.335  11.423  14.120 1.00 25.39 ? 322 LYS A NZ  1 
ATOM   2340 N N   . MET A 1 321 ? 17.596  9.612   18.219 1.00 23.13 ? 323 MET A N   1 
ATOM   2341 C CA  . MET A 1 321 ? 17.439  8.286   17.602 1.00 23.56 ? 323 MET A CA  1 
ATOM   2342 C C   . MET A 1 321 ? 17.128  8.438   16.087 1.00 22.59 ? 323 MET A C   1 
ATOM   2343 O O   . MET A 1 321 ? 16.175  9.114   15.719 1.00 23.08 ? 323 MET A O   1 
ATOM   2344 C CB  . MET A 1 321 ? 16.305  7.525   18.304 1.00 23.54 ? 323 MET A CB  1 
ATOM   2345 C CG  . MET A 1 321 ? 16.322  6.009   18.050 1.00 28.26 ? 323 MET A CG  1 
ATOM   2346 S SD  . MET A 1 321 ? 15.148  5.008   19.054 1.00 34.76 ? 323 MET A SD  1 
ATOM   2347 C CE  . MET A 1 321 ? 14.126  6.238   19.663 1.00 35.15 ? 323 MET A CE  1 
ATOM   2348 N N   . PRO A 1 322 ? 17.880  7.773   15.206 1.00 23.48 ? 324 PRO A N   1 
ATOM   2349 C CA  . PRO A 1 322 ? 17.674  8.076   13.755 1.00 25.54 ? 324 PRO A CA  1 
ATOM   2350 C C   . PRO A 1 322 ? 16.279  7.636   13.264 1.00 26.21 ? 324 PRO A C   1 
ATOM   2351 O O   . PRO A 1 322 ? 15.657  8.364   12.456 1.00 26.18 ? 324 PRO A O   1 
ATOM   2352 C CB  . PRO A 1 322 ? 18.791  7.261   13.025 1.00 23.58 ? 324 PRO A CB  1 
ATOM   2353 C CG  . PRO A 1 322 ? 19.860  7.039   14.126 1.00 25.93 ? 324 PRO A CG  1 
ATOM   2354 C CD  . PRO A 1 322 ? 18.979  6.799   15.406 1.00 23.64 ? 324 PRO A CD  1 
ATOM   2355 N N   . VAL A 1 323 ? 15.760  6.570   13.866 1.00 24.37 ? 325 VAL A N   1 
ATOM   2356 C CA  . VAL A 1 323 ? 14.508  5.940   13.383 1.00 24.48 ? 325 VAL A CA  1 
ATOM   2357 C C   . VAL A 1 323 ? 13.211  6.440   14.015 1.00 25.06 ? 325 VAL A C   1 
ATOM   2358 O O   . VAL A 1 323 ? 12.136  5.920   13.713 1.00 25.63 ? 325 VAL A O   1 
ATOM   2359 C CB  . VAL A 1 323 ? 14.601  4.382   13.298 1.00 23.14 ? 325 VAL A CB  1 
ATOM   2360 C CG1 . VAL A 1 323 ? 15.820  3.978   12.401 1.00 20.97 ? 325 VAL A CG1 1 
ATOM   2361 C CG2 . VAL A 1 323 ? 14.749  3.741   14.703 1.00 23.14 ? 325 VAL A CG2 1 
ATOM   2362 N N   . VAL A 1 324 ? 13.282  7.492   14.830 1.00 25.32 ? 326 VAL A N   1 
ATOM   2363 C CA  . VAL A 1 324 ? 12.069  8.063   15.388 1.00 24.15 ? 326 VAL A CA  1 
ATOM   2364 C C   . VAL A 1 324 ? 12.310  9.535   15.341 1.00 25.26 ? 326 VAL A C   1 
ATOM   2365 O O   . VAL A 1 324 ? 13.424  9.983   15.570 1.00 24.81 ? 326 VAL A O   1 
ATOM   2366 C CB  . VAL A 1 324 ? 11.861  7.581   16.870 1.00 25.81 ? 326 VAL A CB  1 
ATOM   2367 C CG1 . VAL A 1 324 ? 10.737  8.313   17.549 1.00 26.50 ? 326 VAL A CG1 1 
ATOM   2368 C CG2 . VAL A 1 324 ? 11.553  6.056   16.901 1.00 22.46 ? 326 VAL A CG2 1 
ATOM   2369 N N   . THR A 1 325 ? 11.242  10.283  15.095 1.00 24.39 ? 327 THR A N   1 
ATOM   2370 C CA  . THR A 1 325 ? 11.305  11.719  15.001 1.00 24.06 ? 327 THR A CA  1 
ATOM   2371 C C   . THR A 1 325 ? 10.141  12.261  15.800 1.00 23.08 ? 327 THR A C   1 
ATOM   2372 O O   . THR A 1 325 ? 8.991   11.898  15.530 1.00 22.74 ? 327 THR A O   1 
ATOM   2373 C CB  . THR A 1 325 ? 11.189  12.108  13.511 1.00 23.82 ? 327 THR A CB  1 
ATOM   2374 O OG1 . THR A 1 325 ? 12.400  11.691  12.920 1.00 23.49 ? 327 THR A OG1 1 
ATOM   2375 C CG2 . THR A 1 325 ? 11.046  13.694  13.324 1.00 23.81 ? 327 THR A CG2 1 
ATOM   2376 N N   . CYS A 1 326 ? 10.446  13.037  16.829 1.00 23.16 ? 328 CYS A N   1 
ATOM   2377 C CA  . CYS A 1 326 ? 9.451   13.506  17.797 1.00 24.65 ? 328 CYS A CA  1 
ATOM   2378 C C   . CYS A 1 326 ? 9.095   14.928  17.406 1.00 24.50 ? 328 CYS A C   1 
ATOM   2379 O O   . CYS A 1 326 ? 9.940   15.833  17.496 1.00 24.29 ? 328 CYS A O   1 
ATOM   2380 C CB  . CYS A 1 326 ? 10.025  13.492  19.244 1.00 25.65 ? 328 CYS A CB  1 
ATOM   2381 S SG  . CYS A 1 326 ? 10.572  11.883  19.781 1.00 26.43 ? 328 CYS A SG  1 
ATOM   2382 N N   . VAL A 1 327 ? 7.848   15.120  16.975 1.00 24.62 ? 329 VAL A N   1 
ATOM   2383 C CA  . VAL A 1 327 ? 7.412   16.400  16.457 1.00 23.63 ? 329 VAL A CA  1 
ATOM   2384 C C   . VAL A 1 327 ? 6.572   17.058  17.527 1.00 24.99 ? 329 VAL A C   1 
ATOM   2385 O O   . VAL A 1 327 ? 5.645   16.436  18.046 1.00 24.56 ? 329 VAL A O   1 
ATOM   2386 C CB  . VAL A 1 327 ? 6.591   16.239  15.166 1.00 23.84 ? 329 VAL A CB  1 
ATOM   2387 C CG1 . VAL A 1 327 ? 6.102   17.633  14.599 1.00 23.36 ? 329 VAL A CG1 1 
ATOM   2388 C CG2 . VAL A 1 327 ? 7.385   15.437  14.116 1.00 24.70 ? 329 VAL A CG2 1 
ATOM   2389 N N   . GLU A 1 328 ? 6.882   18.326  17.830 1.00 25.07 ? 330 GLU A N   1 
ATOM   2390 C CA  . GLU A 1 328 ? 6.174   19.079  18.862 1.00 26.23 ? 330 GLU A CA  1 
ATOM   2391 C C   . GLU A 1 328 ? 4.791   19.451  18.347 1.00 26.34 ? 330 GLU A C   1 
ATOM   2392 O O   . GLU A 1 328 ? 4.660   20.012  17.244 1.00 25.74 ? 330 GLU A O   1 
ATOM   2393 C CB  . GLU A 1 328 ? 6.995   20.320  19.338 1.00 26.79 ? 330 GLU A CB  1 
ATOM   2394 C CG  . GLU A 1 328 ? 8.097   19.942  20.365 1.00 28.64 ? 330 GLU A CG  1 
ATOM   2395 C CD  . GLU A 1 328 ? 9.044   21.078  20.806 1.00 34.39 ? 330 GLU A CD  1 
ATOM   2396 O OE1 . GLU A 1 328 ? 9.897   20.794  21.699 1.00 34.99 ? 330 GLU A OE1 1 
ATOM   2397 O OE2 . GLU A 1 328 ? 8.941   22.228  20.288 1.00 32.59 ? 330 GLU A OE2 1 
ATOM   2398 N N   . ILE A 1 329 ? 3.772   19.105  19.140 1.00 25.90 ? 331 ILE A N   1 
ATOM   2399 C CA  . ILE A 1 329 ? 2.397   19.520  18.901 1.00 26.09 ? 331 ILE A CA  1 
ATOM   2400 C C   . ILE A 1 329 ? 2.262   21.012  19.224 1.00 26.16 ? 331 ILE A C   1 
ATOM   2401 O O   . ILE A 1 329 ? 2.456   21.452  20.347 1.00 26.16 ? 331 ILE A O   1 
ATOM   2402 C CB  . ILE A 1 329 ? 1.375   18.671  19.724 1.00 25.88 ? 331 ILE A CB  1 
ATOM   2403 C CG1 . ILE A 1 329 ? 1.518   17.170  19.357 1.00 24.96 ? 331 ILE A CG1 1 
ATOM   2404 C CG2 . ILE A 1 329 ? -0.082  19.193  19.523 1.00 25.70 ? 331 ILE A CG2 1 
ATOM   2405 C CD1 . ILE A 1 329 ? 0.885   16.192  20.371 1.00 18.22 ? 331 ILE A CD1 1 
ATOM   2406 N N   . PRO A 1 330 ? 1.930   21.804  18.222 1.00 26.78 ? 332 PRO A N   1 
ATOM   2407 C CA  . PRO A 1 330 ? 1.790   23.276  18.446 1.00 26.48 ? 332 PRO A CA  1 
ATOM   2408 C C   . PRO A 1 330 ? 0.659   23.612  19.426 1.00 27.43 ? 332 PRO A C   1 
ATOM   2409 O O   . PRO A 1 330 ? -0.341  22.878  19.503 1.00 26.81 ? 332 PRO A O   1 
ATOM   2410 C CB  . PRO A 1 330 ? 1.458   23.809  17.061 1.00 26.20 ? 332 PRO A CB  1 
ATOM   2411 C CG  . PRO A 1 330 ? 1.672   22.604  16.070 1.00 26.33 ? 332 PRO A CG  1 
ATOM   2412 C CD  . PRO A 1 330 ? 1.539   21.364  16.871 1.00 25.34 ? 332 PRO A CD  1 
ATOM   2413 N N   . GLY A 1 331 ? 0.813   24.693  20.184 1.00 28.24 ? 333 GLY A N   1 
ATOM   2414 C CA  . GLY A 1 331 ? -0.212  25.117  21.163 1.00 28.95 ? 333 GLY A CA  1 
ATOM   2415 C C   . GLY A 1 331 ? -1.582  25.288  20.516 1.00 30.43 ? 333 GLY A C   1 
ATOM   2416 O O   . GLY A 1 331 ? -1.672  25.756  19.368 1.00 31.08 ? 333 GLY A O   1 
ATOM   2417 N N   . GLY A 1 332 ? -2.652  24.899  21.219 1.00 30.64 ? 334 GLY A N   1 
ATOM   2418 C CA  . GLY A 1 332 ? -4.024  25.002  20.664 1.00 31.27 ? 334 GLY A CA  1 
ATOM   2419 C C   . GLY A 1 332 ? -4.441  23.952  19.609 1.00 32.43 ? 334 GLY A C   1 
ATOM   2420 O O   . GLY A 1 332 ? -5.482  24.095  18.919 1.00 31.12 ? 334 GLY A O   1 
ATOM   2421 N N   . ILE A 1 333 ? -3.639  22.894  19.461 1.00 32.33 ? 335 ILE A N   1 
ATOM   2422 C CA  . ILE A 1 333 ? -3.991  21.833  18.520 1.00 32.40 ? 335 ILE A CA  1 
ATOM   2423 C C   . ILE A 1 333 ? -4.115  20.533  19.296 1.00 31.94 ? 335 ILE A C   1 
ATOM   2424 O O   . ILE A 1 333 ? -3.214  20.164  20.041 1.00 32.22 ? 335 ILE A O   1 
ATOM   2425 C CB  . ILE A 1 333 ? -2.973  21.708  17.370 1.00 32.98 ? 335 ILE A CB  1 
ATOM   2426 C CG1 . ILE A 1 333 ? -3.222  22.804  16.330 1.00 35.41 ? 335 ILE A CG1 1 
ATOM   2427 C CG2 . ILE A 1 333 ? -3.099  20.351  16.686 1.00 30.75 ? 335 ILE A CG2 1 
ATOM   2428 C CD1 . ILE A 1 333 ? -2.007  23.157  15.494 1.00 39.32 ? 335 ILE A CD1 1 
ATOM   2429 N N   . ASP A 1 334 ? -5.250  19.858  19.133 1.00 30.58 ? 336 ASP A N   1 
ATOM   2430 C CA  . ASP A 1 334 ? -5.514  18.623  19.833 1.00 29.84 ? 336 ASP A CA  1 
ATOM   2431 C C   . ASP A 1 334 ? -4.750  17.519  19.065 1.00 28.55 ? 336 ASP A C   1 
ATOM   2432 O O   . ASP A 1 334 ? -5.080  17.189  17.940 1.00 26.93 ? 336 ASP A O   1 
ATOM   2433 C CB  . ASP A 1 334 ? -7.033  18.376  19.888 1.00 30.73 ? 336 ASP A CB  1 
ATOM   2434 C CG  . ASP A 1 334 ? -7.397  16.987  20.426 1.00 34.17 ? 336 ASP A CG  1 
ATOM   2435 O OD1 . ASP A 1 334 ? -6.490  16.140  20.622 1.00 36.45 ? 336 ASP A OD1 1 
ATOM   2436 O OD2 . ASP A 1 334 ? -8.607  16.749  20.644 1.00 37.25 ? 336 ASP A OD2 1 
ATOM   2437 N N   . GLY A 1 335 ? -3.692  17.019  19.675 1.00 28.01 ? 337 GLY A N   1 
ATOM   2438 C CA  . GLY A 1 335 ? -2.798  16.070  19.033 1.00 27.76 ? 337 GLY A CA  1 
ATOM   2439 C C   . GLY A 1 335 ? -3.480  14.734  18.770 1.00 28.93 ? 337 GLY A C   1 
ATOM   2440 O O   . GLY A 1 335 ? -3.131  14.011  17.799 1.00 28.83 ? 337 GLY A O   1 
ATOM   2441 N N   . GLU A 1 336 ? -4.435  14.385  19.625 1.00 28.19 ? 338 GLU A N   1 
ATOM   2442 C CA  . GLU A 1 336 ? -5.166  13.149  19.422 1.00 29.26 ? 338 GLU A CA  1 
ATOM   2443 C C   . GLU A 1 336 ? -6.105  13.286  18.208 1.00 28.36 ? 338 GLU A C   1 
ATOM   2444 O O   . GLU A 1 336 ? -6.317  12.319  17.487 1.00 25.93 ? 338 GLU A O   1 
ATOM   2445 C CB  . GLU A 1 336 ? -5.934  12.770  20.700 1.00 30.74 ? 338 GLU A CB  1 
ATOM   2446 C CG  . GLU A 1 336 ? -6.082  11.238  20.944 1.00 37.13 ? 338 GLU A CG  1 
ATOM   2447 C CD  . GLU A 1 336 ? -4.727  10.454  20.865 1.00 42.73 ? 338 GLU A CD  1 
ATOM   2448 O OE1 . GLU A 1 336 ? -3.667  11.037  21.198 1.00 42.45 ? 338 GLU A OE1 1 
ATOM   2449 O OE2 . GLU A 1 336 ? -4.738  9.253   20.465 1.00 46.39 ? 338 GLU A OE2 1 
ATOM   2450 N N   . SER A 1 337 ? -6.665  14.491  18.016 1.00 26.81 ? 339 SER A N   1 
ATOM   2451 C CA  . SER A 1 337 ? -7.644  14.723  16.951 1.00 26.94 ? 339 SER A CA  1 
ATOM   2452 C C   . SER A 1 337 ? -6.884  14.604  15.654 1.00 26.63 ? 339 SER A C   1 
ATOM   2453 O O   . SER A 1 337 ? -7.403  13.995  14.702 1.00 25.89 ? 339 SER A O   1 
ATOM   2454 C CB  . SER A 1 337 ? -8.285  16.108  17.062 1.00 27.27 ? 339 SER A CB  1 
ATOM   2455 O OG  . SER A 1 337 ? -8.993  16.474  15.886 1.00 26.76 ? 339 SER A OG  1 
ATOM   2456 N N   . VAL A 1 338 ? -5.665  15.175  15.630 1.00 24.62 ? 340 VAL A N   1 
ATOM   2457 C CA  . VAL A 1 338 ? -4.783  15.087  14.453 1.00 23.44 ? 340 VAL A CA  1 
ATOM   2458 C C   . VAL A 1 338 ? -4.421  13.669  14.098 1.00 25.56 ? 340 VAL A C   1 
ATOM   2459 O O   . VAL A 1 338 ? -4.479  13.308  12.939 1.00 26.55 ? 340 VAL A O   1 
ATOM   2460 C CB  . VAL A 1 338 ? -3.520  15.934  14.573 1.00 23.00 ? 340 VAL A CB  1 
ATOM   2461 C CG1 . VAL A 1 338 ? -2.525  15.491  13.489 1.00 18.57 ? 340 VAL A CG1 1 
ATOM   2462 C CG2 . VAL A 1 338 ? -3.898  17.492  14.461 1.00 15.46 ? 340 VAL A CG2 1 
ATOM   2463 N N   . ARG A 1 339 ? -4.105  12.858  15.102 1.00 26.56 ? 341 ARG A N   1 
ATOM   2464 C CA  . ARG A 1 339 ? -3.718  11.466  14.888 1.00 28.02 ? 341 ARG A CA  1 
ATOM   2465 C C   . ARG A 1 339 ? -4.892  10.612  14.368 1.00 27.26 ? 341 ARG A C   1 
ATOM   2466 O O   . ARG A 1 339 ? -4.724  9.776   13.428 1.00 26.73 ? 341 ARG A O   1 
ATOM   2467 C CB  . ARG A 1 339 ? -3.067  10.880  16.147 1.00 27.42 ? 341 ARG A CB  1 
ATOM   2468 C CG  . ARG A 1 339 ? -2.924  9.363   16.116 1.00 32.80 ? 341 ARG A CG  1 
ATOM   2469 C CD  . ARG A 1 339 ? -2.254  8.823   17.397 1.00 42.32 ? 341 ARG A CD  1 
ATOM   2470 N NE  . ARG A 1 339 ? -3.313  8.442   18.324 1.00 49.27 ? 341 ARG A NE  1 
ATOM   2471 C CZ  . ARG A 1 339 ? -3.966  7.284   18.254 1.00 53.54 ? 341 ARG A CZ  1 
ATOM   2472 N NH1 . ARG A 1 339 ? -3.611  6.378   17.331 1.00 52.86 ? 341 ARG A NH1 1 
ATOM   2473 N NH2 . ARG A 1 339 ? -4.964  7.034   19.112 1.00 53.99 ? 341 ARG A NH2 1 
ATOM   2474 N N   . ASP A 1 340 ? -6.051  10.789  14.997 1.00 26.91 ? 342 ASP A N   1 
ATOM   2475 C CA  . ASP A 1 340 ? -7.274  10.088  14.597 1.00 27.46 ? 342 ASP A CA  1 
ATOM   2476 C C   . ASP A 1 340 ? -7.659  10.422  13.137 1.00 26.41 ? 342 ASP A C   1 
ATOM   2477 O O   . ASP A 1 340 ? -8.046  9.526   12.394 1.00 25.95 ? 342 ASP A O   1 
ATOM   2478 C CB  . ASP A 1 340 ? -8.470  10.447  15.553 1.00 28.19 ? 342 ASP A CB  1 
ATOM   2479 C CG  . ASP A 1 340 ? -8.276  9.885   16.987 1.00 32.12 ? 342 ASP A CG  1 
ATOM   2480 O OD1 . ASP A 1 340 ? -9.046  10.299  17.897 1.00 34.31 ? 342 ASP A OD1 1 
ATOM   2481 O OD2 . ASP A 1 340 ? -7.361  9.019   17.194 1.00 33.44 ? 342 ASP A OD2 1 
ATOM   2482 N N   . MET A 1 341 ? -7.570  11.694  12.747 1.00 25.20 ? 343 MET A N   1 
ATOM   2483 C CA  . MET A 1 341 ? -7.944  12.116  11.382 1.00 25.59 ? 343 MET A CA  1 
ATOM   2484 C C   . MET A 1 341 ? -6.985  11.588  10.296 1.00 25.39 ? 343 MET A C   1 
ATOM   2485 O O   . MET A 1 341 ? -7.408  11.198  9.188  1.00 24.69 ? 343 MET A O   1 
ATOM   2486 C CB  . MET A 1 341 ? -8.112  13.654  11.271 1.00 25.94 ? 343 MET A CB  1 
ATOM   2487 C CG  . MET A 1 341 ? -8.677  14.085  9.904  1.00 27.24 ? 343 MET A CG  1 
ATOM   2488 S SD  . MET A 1 341 ? -8.731  15.901  9.703  1.00 33.98 ? 343 MET A SD  1 
ATOM   2489 C CE  . MET A 1 341 ? -10.145 16.262  10.769 1.00 31.83 ? 343 MET A CE  1 
ATOM   2490 N N   . LEU A 1 342 ? -5.686  11.643  10.572 1.00 25.69 ? 344 LEU A N   1 
ATOM   2491 C CA  . LEU A 1 342 ? -4.697  11.087  9.674  1.00 25.94 ? 344 LEU A CA  1 
ATOM   2492 C C   . LEU A 1 342 ? -5.041  9.628   9.375  1.00 25.53 ? 344 LEU A C   1 
ATOM   2493 O O   . LEU A 1 342 ? -4.989  9.194   8.226  1.00 25.66 ? 344 LEU A O   1 
ATOM   2494 C CB  . LEU A 1 342 ? -3.307  11.124  10.326 1.00 25.80 ? 344 LEU A CB  1 
ATOM   2495 C CG  . LEU A 1 342 ? -2.283  12.151  9.951  1.00 27.49 ? 344 LEU A CG  1 
ATOM   2496 C CD1 . LEU A 1 342 ? -0.851  11.555  10.341 1.00 28.56 ? 344 LEU A CD1 1 
ATOM   2497 C CD2 . LEU A 1 342 ? -2.352  12.343  8.449  1.00 27.86 ? 344 LEU A CD2 1 
ATOM   2498 N N   . LEU A 1 343 ? -5.364  8.893   10.442 1.00 25.22 ? 345 LEU A N   1 
ATOM   2499 C CA  . LEU A 1 343 ? -5.744  7.480   10.368 1.00 24.93 ? 345 LEU A CA  1 
ATOM   2500 C C   . LEU A 1 343 ? -7.043  7.289   9.611  1.00 25.02 ? 345 LEU A C   1 
ATOM   2501 O O   . LEU A 1 343 ? -7.102  6.509   8.678  1.00 25.30 ? 345 LEU A O   1 
ATOM   2502 C CB  . LEU A 1 343 ? -5.830  6.834   11.772 1.00 24.59 ? 345 LEU A CB  1 
ATOM   2503 C CG  . LEU A 1 343 ? -5.887  5.274   11.697 1.00 24.49 ? 345 LEU A CG  1 
ATOM   2504 C CD1 . LEU A 1 343 ? -4.746  4.667   10.842 1.00 20.71 ? 345 LEU A CD1 1 
ATOM   2505 C CD2 . LEU A 1 343 ? -5.904  4.607   13.122 1.00 23.47 ? 345 LEU A CD2 1 
ATOM   2506 N N   . ALA A 1 344 ? -8.080  8.008   10.002 1.00 25.40 ? 346 ALA A N   1 
ATOM   2507 C CA  . ALA A 1 344 ? -9.445  7.777   9.494  1.00 25.55 ? 346 ALA A CA  1 
ATOM   2508 C C   . ALA A 1 344 ? -9.512  8.192   8.023  1.00 25.55 ? 346 ALA A C   1 
ATOM   2509 O O   . ALA A 1 344 ? -10.190 7.558   7.225  1.00 24.96 ? 346 ALA A O   1 
ATOM   2510 C CB  . ALA A 1 344 ? -10.518 8.596   10.354 1.00 26.43 ? 346 ALA A CB  1 
ATOM   2511 N N   . GLN A 1 345 ? -8.764  9.205   7.627  1.00 24.70 ? 347 GLN A N   1 
ATOM   2512 C CA  . GLN A 1 345 ? -8.921  9.660   6.235  1.00 26.45 ? 347 GLN A CA  1 
ATOM   2513 C C   . GLN A 1 345 ? -7.842  9.157   5.288  1.00 27.38 ? 347 GLN A C   1 
ATOM   2514 O O   . GLN A 1 345 ? -8.137  8.764   4.149  1.00 27.36 ? 347 GLN A O   1 
ATOM   2515 C CB  . GLN A 1 345 ? -9.008  11.170  6.164  1.00 25.34 ? 347 GLN A CB  1 
ATOM   2516 C CG  . GLN A 1 345 ? -9.984  11.677  7.196  1.00 28.32 ? 347 GLN A CG  1 
ATOM   2517 C CD  . GLN A 1 345 ? -11.446 11.495  6.838  1.00 30.48 ? 347 GLN A CD  1 
ATOM   2518 O OE1 . GLN A 1 345 ? -12.279 11.305  7.724  1.00 32.15 ? 347 GLN A OE1 1 
ATOM   2519 N NE2 . GLN A 1 345 ? -11.782 11.615  5.565  1.00 27.36 ? 347 GLN A NE2 1 
ATOM   2520 N N   . PHE A 1 346 ? -6.592  9.240   5.729  1.00 26.99 ? 348 PHE A N   1 
ATOM   2521 C CA  . PHE A 1 346 ? -5.470  8.786   4.909  1.00 25.78 ? 348 PHE A CA  1 
ATOM   2522 C C   . PHE A 1 346 ? -5.010  7.383   5.188  1.00 25.43 ? 348 PHE A C   1 
ATOM   2523 O O   . PHE A 1 346 ? -4.199  6.859   4.443  1.00 25.66 ? 348 PHE A O   1 
ATOM   2524 C CB  . PHE A 1 346 ? -4.310  9.746   5.037  1.00 24.43 ? 348 PHE A CB  1 
ATOM   2525 C CG  . PHE A 1 346 ? -4.636  11.171  4.631  1.00 24.28 ? 348 PHE A CG  1 
ATOM   2526 C CD1 . PHE A 1 346 ? -4.100  11.703  3.447  1.00 23.41 ? 348 PHE A CD1 1 
ATOM   2527 C CD2 . PHE A 1 346 ? -5.395  12.015  5.457  1.00 25.02 ? 348 PHE A CD2 1 
ATOM   2528 C CE1 . PHE A 1 346 ? -4.376  13.013  3.039  1.00 25.72 ? 348 PHE A CE1 1 
ATOM   2529 C CE2 . PHE A 1 346 ? -5.647  13.335  5.049  1.00 27.68 ? 348 PHE A CE2 1 
ATOM   2530 C CZ  . PHE A 1 346 ? -5.114  13.832  3.835  1.00 23.45 ? 348 PHE A CZ  1 
ATOM   2531 N N   . GLY A 1 347 ? -5.517  6.737   6.234  1.00 25.68 ? 349 GLY A N   1 
ATOM   2532 C CA  . GLY A 1 347 ? -5.000  5.415   6.571  1.00 23.88 ? 349 GLY A CA  1 
ATOM   2533 C C   . GLY A 1 347 ? -3.556  5.525   7.064  1.00 24.69 ? 349 GLY A C   1 
ATOM   2534 O O   . GLY A 1 347 ? -2.833  4.527   7.098  1.00 23.67 ? 349 GLY A O   1 
ATOM   2535 N N   . ILE A 1 348 ? -3.116  6.738   7.398  1.00 22.40 ? 350 ILE A N   1 
ATOM   2536 C CA  . ILE A 1 348 ? -1.731  6.946   7.873  1.00 23.11 ? 350 ILE A CA  1 
ATOM   2537 C C   . ILE A 1 348 ? -1.636  6.835   9.382  1.00 23.28 ? 350 ILE A C   1 
ATOM   2538 O O   . ILE A 1 348 ? -2.427  7.463   10.086 1.00 23.46 ? 350 ILE A O   1 
ATOM   2539 C CB  . ILE A 1 348 ? -1.232  8.362   7.492  1.00 22.72 ? 350 ILE A CB  1 
ATOM   2540 C CG1 . ILE A 1 348 ? -1.043  8.436   5.966  1.00 25.35 ? 350 ILE A CG1 1 
ATOM   2541 C CG2 . ILE A 1 348 ? 0.063   8.714   8.268  1.00 23.43 ? 350 ILE A CG2 1 
ATOM   2542 C CD1 . ILE A 1 348 ? -0.719  9.942   5.492  1.00 26.09 ? 350 ILE A CD1 1 
ATOM   2543 N N   . GLU A 1 349 ? -0.687  6.050   9.893  1.00 22.70 ? 351 GLU A N   1 
ATOM   2544 C CA  . GLU A 1 349 ? -0.604  5.893   11.357 1.00 23.99 ? 351 GLU A CA  1 
ATOM   2545 C C   . GLU A 1 349 ? 0.665   6.501   11.899 1.00 24.14 ? 351 GLU A C   1 
ATOM   2546 O O   . GLU A 1 349 ? 1.733   6.131   11.459 1.00 24.12 ? 351 GLU A O   1 
ATOM   2547 C CB  . GLU A 1 349 ? -0.664  4.401   11.790 1.00 22.71 ? 351 GLU A CB  1 
ATOM   2548 C CG  . GLU A 1 349 ? -1.151  4.289   13.244 1.00 26.33 ? 351 GLU A CG  1 
ATOM   2549 C CD  . GLU A 1 349 ? -0.830  2.909   13.878 1.00 30.20 ? 351 GLU A CD  1 
ATOM   2550 O OE1 . GLU A 1 349 ? -0.279  2.061   13.173 1.00 23.77 ? 351 GLU A OE1 1 
ATOM   2551 O OE2 . GLU A 1 349 ? -1.144  2.680   15.063 1.00 33.35 ? 351 GLU A OE2 1 
ATOM   2552 N N   . ILE A 1 350 ? 0.513   7.450   12.822 1.00 23.90 ? 352 ILE A N   1 
ATOM   2553 C CA  . ILE A 1 350 ? 1.604   7.994   13.661 1.00 23.35 ? 352 ILE A CA  1 
ATOM   2554 C C   . ILE A 1 350 ? 1.247   7.773   15.130 1.00 22.99 ? 352 ILE A C   1 
ATOM   2555 O O   . ILE A 1 350 ? 0.109   7.494   15.467 1.00 21.82 ? 352 ILE A O   1 
ATOM   2556 C CB  . ILE A 1 350 ? 1.941   9.517   13.387 1.00 22.41 ? 352 ILE A CB  1 
ATOM   2557 C CG1 . ILE A 1 350 ? 0.803   10.432  13.884 1.00 21.30 ? 352 ILE A CG1 1 
ATOM   2558 C CG2 . ILE A 1 350 ? 2.367   9.693   11.873 1.00 24.00 ? 352 ILE A CG2 1 
ATOM   2559 C CD1 . ILE A 1 350 ? 1.032   12.034  13.595 1.00 20.98 ? 352 ILE A CD1 1 
ATOM   2560 N N   . ALA A 1 351 ? 2.239   7.896   15.992 1.00 24.60 ? 353 ALA A N   1 
ATOM   2561 C CA  . ALA A 1 351 ? 2.066   7.580   17.412 1.00 25.61 ? 353 ALA A CA  1 
ATOM   2562 C C   . ALA A 1 351 ? 1.837   8.838   18.239 1.00 27.41 ? 353 ALA A C   1 
ATOM   2563 O O   . ALA A 1 351 ? 2.443   9.874   17.976 1.00 27.48 ? 353 ALA A O   1 
ATOM   2564 C CB  . ALA A 1 351 ? 3.281   6.804   17.892 1.00 22.27 ? 353 ALA A CB  1 
ATOM   2565 N N   . SER A 1 352 ? 0.968   8.752   19.241 1.00 30.93 ? 354 SER A N   1 
ATOM   2566 C CA  . SER A 1 352 ? 0.908   9.785   20.271 1.00 35.17 ? 354 SER A CA  1 
ATOM   2567 C C   . SER A 1 352 ? 1.893   9.389   21.364 1.00 37.54 ? 354 SER A C   1 
ATOM   2568 O O   . SER A 1 352 ? 2.606   8.398   21.238 1.00 38.24 ? 354 SER A O   1 
ATOM   2569 C CB  . SER A 1 352 ? -0.500  9.900   20.876 1.00 35.40 ? 354 SER A CB  1 
ATOM   2570 O OG  . SER A 1 352 ? -1.316  10.811  20.139 1.00 40.50 ? 354 SER A OG  1 
ATOM   2571 N N   . SER A 1 353 ? 1.937   10.173  22.434 1.00 39.69 ? 355 SER A N   1 
ATOM   2572 C CA  . SER A 1 353 ? 2.640   9.794   23.645 1.00 41.56 ? 355 SER A CA  1 
ATOM   2573 C C   . SER A 1 353 ? 1.648   9.633   24.785 1.00 43.59 ? 355 SER A C   1 
ATOM   2574 O O   . SER A 1 353 ? 0.638   10.363  24.866 1.00 44.54 ? 355 SER A O   1 
ATOM   2575 C CB  . SER A 1 353 ? 3.632   10.870  24.015 1.00 41.50 ? 355 SER A CB  1 
ATOM   2576 O OG  . SER A 1 353 ? 4.706   10.870  23.111 1.00 39.40 ? 355 SER A OG  1 
ATOM   2577 N N   . PHE A 1 354 ? 1.921   8.675   25.662 1.00 45.65 ? 356 PHE A N   1 
ATOM   2578 C CA  . PHE A 1 354 ? 1.136   8.539   26.893 1.00 47.21 ? 356 PHE A CA  1 
ATOM   2579 C C   . PHE A 1 354 ? 2.087   8.669   28.095 1.00 46.62 ? 356 PHE A C   1 
ATOM   2580 O O   . PHE A 1 354 ? 3.288   8.377   27.973 1.00 47.84 ? 356 PHE A O   1 
ATOM   2581 C CB  . PHE A 1 354 ? 0.254   7.268   26.847 1.00 48.38 ? 356 PHE A CB  1 
ATOM   2582 C CG  . PHE A 1 354 ? -0.833  7.339   25.778 1.00 51.71 ? 356 PHE A CG  1 
ATOM   2583 C CD1 . PHE A 1 354 ? -1.978  8.157   25.968 1.00 54.46 ? 356 PHE A CD1 1 
ATOM   2584 C CD2 . PHE A 1 354 ? -0.696  6.642   24.556 1.00 54.64 ? 356 PHE A CD2 1 
ATOM   2585 C CE1 . PHE A 1 354 ? -2.994  8.254   24.958 1.00 56.08 ? 356 PHE A CE1 1 
ATOM   2586 C CE2 . PHE A 1 354 ? -1.700  6.731   23.530 1.00 55.26 ? 356 PHE A CE2 1 
ATOM   2587 C CZ  . PHE A 1 354 ? -2.845  7.544   23.732 1.00 55.67 ? 356 PHE A CZ  1 
ATOM   2588 N N   . GLY A 1 355 ? 1.612   9.182   29.225 1.00 45.24 ? 357 GLY A N   1 
ATOM   2589 C CA  . GLY A 1 355 ? 2.575   9.475   30.315 1.00 42.45 ? 357 GLY A CA  1 
ATOM   2590 C C   . GLY A 1 355 ? 3.101   10.894  30.160 1.00 40.32 ? 357 GLY A C   1 
ATOM   2591 O O   . GLY A 1 355 ? 2.428   11.723  29.568 1.00 39.98 ? 357 GLY A O   1 
ATOM   2592 N N   . PRO A 1 356 ? 4.325   11.168  30.644 1.00 38.61 ? 358 PRO A N   1 
ATOM   2593 C CA  . PRO A 1 356 ? 4.864   12.538  30.779 1.00 37.83 ? 358 PRO A CA  1 
ATOM   2594 C C   . PRO A 1 356 ? 4.883   13.389  29.489 1.00 37.72 ? 358 PRO A C   1 
ATOM   2595 O O   . PRO A 1 356 ? 4.728   14.630  29.553 1.00 38.03 ? 358 PRO A O   1 
ATOM   2596 C CB  . PRO A 1 356 ? 6.295   12.323  31.314 1.00 37.37 ? 358 PRO A CB  1 
ATOM   2597 C CG  . PRO A 1 356 ? 6.335   10.916  31.821 1.00 37.24 ? 358 PRO A CG  1 
ATOM   2598 C CD  . PRO A 1 356 ? 5.293   10.141  31.056 1.00 38.76 ? 358 PRO A CD  1 
ATOM   2599 N N   . LEU A 1 357 ? 5.077   12.736  28.347 1.00 36.38 ? 359 LEU A N   1 
ATOM   2600 C CA  . LEU A 1 357 ? 5.074   13.426  27.060 1.00 36.06 ? 359 LEU A CA  1 
ATOM   2601 C C   . LEU A 1 357 ? 3.675   13.463  26.412 1.00 35.83 ? 359 LEU A C   1 
ATOM   2602 O O   . LEU A 1 357 ? 3.516   13.974  25.292 1.00 35.70 ? 359 LEU A O   1 
ATOM   2603 C CB  . LEU A 1 357 ? 6.158   12.828  26.122 1.00 35.50 ? 359 LEU A CB  1 
ATOM   2604 C CG  . LEU A 1 357 ? 7.571   12.844  26.751 1.00 33.41 ? 359 LEU A CG  1 
ATOM   2605 C CD1 . LEU A 1 357 ? 8.630   12.450  25.756 1.00 30.16 ? 359 LEU A CD1 1 
ATOM   2606 C CD2 . LEU A 1 357 ? 7.901   14.224  27.336 1.00 31.15 ? 359 LEU A CD2 1 
ATOM   2607 N N   . ALA A 1 358 ? 2.661   12.967  27.139 1.00 35.56 ? 360 ALA A N   1 
ATOM   2608 C CA  . ALA A 1 358 ? 1.290   12.947  26.619 1.00 35.39 ? 360 ALA A CA  1 
ATOM   2609 C C   . ALA A 1 358 ? 0.908   14.376  26.249 1.00 34.08 ? 360 ALA A C   1 
ATOM   2610 O O   . ALA A 1 358 ? 1.110   15.299  27.045 1.00 34.03 ? 360 ALA A O   1 
ATOM   2611 C CB  . ALA A 1 358 ? 0.301   12.366  27.662 1.00 36.13 ? 360 ALA A CB  1 
ATOM   2612 N N   . GLY A 1 359 ? 0.448   14.539  25.016 1.00 33.01 ? 361 GLY A N   1 
ATOM   2613 C CA  . GLY A 1 359 ? 0.002   15.824  24.488 1.00 31.90 ? 361 GLY A CA  1 
ATOM   2614 C C   . GLY A 1 359 ? 1.119   16.757  24.046 1.00 31.42 ? 361 GLY A C   1 
ATOM   2615 O O   . GLY A 1 359 ? 0.852   17.865  23.574 1.00 32.94 ? 361 GLY A O   1 
ATOM   2616 N N   . LYS A 1 360 ? 2.373   16.363  24.217 1.00 30.04 ? 362 LYS A N   1 
ATOM   2617 C CA  . LYS A 1 360 ? 3.485   17.245  23.819 1.00 28.60 ? 362 LYS A CA  1 
ATOM   2618 C C   . LYS A 1 360 ? 4.008   16.923  22.436 1.00 27.07 ? 362 LYS A C   1 
ATOM   2619 O O   . LYS A 1 360 ? 4.481   17.799  21.744 1.00 25.70 ? 362 LYS A O   1 
ATOM   2620 C CB  . LYS A 1 360 ? 4.651   17.162  24.822 1.00 28.00 ? 362 LYS A CB  1 
ATOM   2621 C CG  . LYS A 1 360 ? 4.337   17.833  26.178 1.00 33.75 ? 362 LYS A CG  1 
ATOM   2622 C CD  . LYS A 1 360 ? 5.251   17.307  27.287 1.00 38.78 ? 362 LYS A CD  1 
ATOM   2623 C CE  . LYS A 1 360 ? 6.744   17.614  26.985 1.00 42.86 ? 362 LYS A CE  1 
ATOM   2624 N NZ  . LYS A 1 360 ? 7.322   18.801  27.703 1.00 43.90 ? 362 LYS A NZ  1 
ATOM   2625 N N   . ILE A 1 361 ? 3.978   15.642  22.062 1.00 25.18 ? 363 ILE A N   1 
ATOM   2626 C CA  . ILE A 1 361 ? 4.672   15.214  20.852 1.00 25.05 ? 363 ILE A CA  1 
ATOM   2627 C C   . ILE A 1 361 ? 3.905   14.178  20.087 1.00 24.31 ? 363 ILE A C   1 
ATOM   2628 O O   . ILE A 1 361 ? 3.180   13.361  20.669 1.00 23.04 ? 363 ILE A O   1 
ATOM   2629 C CB  . ILE A 1 361 ? 6.121   14.614  21.123 1.00 24.46 ? 363 ILE A CB  1 
ATOM   2630 C CG1 . ILE A 1 361 ? 6.128   13.550  22.234 1.00 24.01 ? 363 ILE A CG1 1 
ATOM   2631 C CG2 . ILE A 1 361 ? 7.142   15.693  21.356 1.00 23.14 ? 363 ILE A CG2 1 
ATOM   2632 C CD1 . ILE A 1 361 ? 7.409   12.608  22.226 1.00 23.30 ? 363 ILE A CD1 1 
ATOM   2633 N N   . TRP A 1 362 ? 4.074   14.194  18.776 1.00 24.29 ? 364 TRP A N   1 
ATOM   2634 C CA  . TRP A 1 362 ? 3.788   12.963  17.997 1.00 23.70 ? 364 TRP A CA  1 
ATOM   2635 C C   . TRP A 1 362 ? 5.100   12.324  17.749 1.00 24.36 ? 364 TRP A C   1 
ATOM   2636 O O   . TRP A 1 362 ? 6.084   13.026  17.688 1.00 24.78 ? 364 TRP A O   1 
ATOM   2637 C CB  . TRP A 1 362 ? 3.156   13.228  16.640 1.00 21.90 ? 364 TRP A CB  1 
ATOM   2638 C CG  . TRP A 1 362 ? 1.860   13.978  16.661 1.00 22.46 ? 364 TRP A CG  1 
ATOM   2639 C CD1 . TRP A 1 362 ? 0.592   13.494  16.988 1.00 20.77 ? 364 TRP A CD1 1 
ATOM   2640 C CD2 . TRP A 1 362 ? 1.680   15.344  16.252 1.00 20.83 ? 364 TRP A CD2 1 
ATOM   2641 N NE1 . TRP A 1 362 ? -0.362  14.520  16.814 1.00 21.97 ? 364 TRP A NE1 1 
ATOM   2642 C CE2 . TRP A 1 362 ? 0.283   15.653  16.369 1.00 21.91 ? 364 TRP A CE2 1 
ATOM   2643 C CE3 . TRP A 1 362 ? 2.567   16.347  15.823 1.00 22.55 ? 364 TRP A CE3 1 
ATOM   2644 C CZ2 . TRP A 1 362 ? -0.242  16.955  16.072 1.00 21.56 ? 364 TRP A CZ2 1 
ATOM   2645 C CZ3 . TRP A 1 362 ? 2.053   17.637  15.521 1.00 18.49 ? 364 TRP A CZ3 1 
ATOM   2646 C CH2 . TRP A 1 362 ? 0.656   17.930  15.673 1.00 21.41 ? 364 TRP A CH2 1 
ATOM   2647 N N   . ARG A 1 363 ? 5.116   10.995  17.581 1.00 25.06 ? 365 ARG A N   1 
ATOM   2648 C CA  . ARG A 1 363 ? 6.338   10.300  17.222 1.00 25.60 ? 365 ARG A CA  1 
ATOM   2649 C C   . ARG A 1 363 ? 6.181   9.651   15.852 1.00 24.36 ? 365 ARG A C   1 
ATOM   2650 O O   . ARG A 1 363 ? 5.309   8.819   15.641 1.00 23.40 ? 365 ARG A O   1 
ATOM   2651 C CB  . ARG A 1 363 ? 6.719   9.260   18.290 1.00 25.18 ? 365 ARG A CB  1 
ATOM   2652 C CG  . ARG A 1 363 ? 6.958   9.873   19.650 1.00 28.05 ? 365 ARG A CG  1 
ATOM   2653 C CD  . ARG A 1 363 ? 7.215   8.810   20.686 1.00 29.79 ? 365 ARG A CD  1 
ATOM   2654 N NE  . ARG A 1 363 ? 5.983   8.144   21.035 1.00 31.36 ? 365 ARG A NE  1 
ATOM   2655 C CZ  . ARG A 1 363 ? 5.876   6.838   21.254 1.00 30.33 ? 365 ARG A CZ  1 
ATOM   2656 N NH1 . ARG A 1 363 ? 6.925   6.042   21.190 1.00 28.08 ? 365 ARG A NH1 1 
ATOM   2657 N NH2 . ARG A 1 363 ? 4.702   6.337   21.567 1.00 29.43 ? 365 ARG A NH2 1 
ATOM   2658 N N   . ILE A 1 364 ? 7.048   10.015  14.911 1.00 23.85 ? 366 ILE A N   1 
ATOM   2659 C CA  . ILE A 1 364 ? 6.909   9.447   13.581 1.00 23.45 ? 366 ILE A CA  1 
ATOM   2660 C C   . ILE A 1 364 ? 8.104   8.484   13.448 1.00 24.55 ? 366 ILE A C   1 
ATOM   2661 O O   . ILE A 1 364 ? 9.243   8.925   13.552 1.00 24.40 ? 366 ILE A O   1 
ATOM   2662 C CB  . ILE A 1 364 ? 6.911   10.480  12.497 1.00 23.17 ? 366 ILE A CB  1 
ATOM   2663 C CG1 . ILE A 1 364 ? 5.827   11.559  12.782 1.00 24.05 ? 366 ILE A CG1 1 
ATOM   2664 C CG2 . ILE A 1 364 ? 6.812   9.808   11.052 1.00 20.37 ? 366 ILE A CG2 1 
ATOM   2665 C CD1 . ILE A 1 364 ? 5.710   12.682  11.736 1.00 23.19 ? 366 ILE A CD1 1 
ATOM   2666 N N   . GLY A 1 365 ? 7.799   7.192   13.253 1.00 22.63 ? 367 GLY A N   1 
ATOM   2667 C CA  . GLY A 1 365 ? 8.800   6.120   13.075 1.00 23.56 ? 367 GLY A CA  1 
ATOM   2668 C C   . GLY A 1 365 ? 9.171   6.062   11.602 1.00 23.83 ? 367 GLY A C   1 
ATOM   2669 O O   . GLY A 1 365 ? 8.305   6.344   10.729 1.00 25.70 ? 367 GLY A O   1 
ATOM   2670 N N   . THR A 1 366 ? 10.443  5.798   11.294 1.00 23.54 ? 368 THR A N   1 
ATOM   2671 C CA  . THR A 1 366 ? 10.890  5.552   9.897  1.00 22.24 ? 368 THR A CA  1 
ATOM   2672 C C   . THR A 1 366 ? 11.744  4.304   10.057 1.00 22.35 ? 368 THR A C   1 
ATOM   2673 O O   . THR A 1 366 ? 12.942  4.400   10.077 1.00 24.47 ? 368 THR A O   1 
ATOM   2674 C CB  . THR A 1 366 ? 11.775  6.729   9.309  1.00 22.74 ? 368 THR A CB  1 
ATOM   2675 O OG1 . THR A 1 366 ? 12.708  7.162   10.308 1.00 23.93 ? 368 THR A OG1 1 
ATOM   2676 C CG2 . THR A 1 366 ? 10.932  7.926   8.908  1.00 20.98 ? 368 THR A CG2 1 
ATOM   2677 N N   . MET A 1 367 ? 11.116  3.140   10.225 1.00 21.37 ? 369 MET A N   1 
ATOM   2678 C CA  . MET A 1 367 ? 11.803  1.898   10.535 1.00 21.31 ? 369 MET A CA  1 
ATOM   2679 C C   . MET A 1 367 ? 11.573  0.824   9.469  1.00 21.59 ? 369 MET A C   1 
ATOM   2680 O O   . MET A 1 367 ? 10.413  0.598   9.078  1.00 22.42 ? 369 MET A O   1 
ATOM   2681 C CB  . MET A 1 367 ? 11.211  1.301   11.857 1.00 21.22 ? 369 MET A CB  1 
ATOM   2682 C CG  . MET A 1 367 ? 11.447  2.199   13.128 1.00 17.91 ? 369 MET A CG  1 
ATOM   2683 S SD  . MET A 1 367 ? 10.439  1.567   14.449 1.00 22.73 ? 369 MET A SD  1 
ATOM   2684 C CE  . MET A 1 367 ? 11.418  2.095   15.887 1.00 16.06 ? 369 MET A CE  1 
ATOM   2685 N N   . GLY A 1 368 ? 12.632  0.088   9.066  1.00 20.03 ? 370 GLY A N   1 
ATOM   2686 C CA  . GLY A 1 368 ? 12.416  -1.055  8.252  1.00 20.80 ? 370 GLY A CA  1 
ATOM   2687 C C   . GLY A 1 368 ? 11.726  -0.751  6.930  1.00 21.13 ? 370 GLY A C   1 
ATOM   2688 O O   . GLY A 1 368 ? 12.060  0.232   6.235  1.00 22.02 ? 370 GLY A O   1 
ATOM   2689 N N   . TYR A 1 369 ? 10.747  -1.573  6.575  1.00 19.93 ? 371 TYR A N   1 
ATOM   2690 C CA  . TYR A 1 369 ? 10.086  -1.442  5.269  1.00 20.72 ? 371 TYR A CA  1 
ATOM   2691 C C   . TYR A 1 369 ? 9.295   -0.128  5.178  1.00 21.50 ? 371 TYR A C   1 
ATOM   2692 O O   . TYR A 1 369 ? 9.055   0.367   4.090  1.00 21.87 ? 371 TYR A O   1 
ATOM   2693 C CB  . TYR A 1 369 ? 9.134   -2.618  5.043  1.00 22.58 ? 371 TYR A CB  1 
ATOM   2694 C CG  . TYR A 1 369 ? 8.614   -2.616  3.613  1.00 23.86 ? 371 TYR A CG  1 
ATOM   2695 C CD1 . TYR A 1 369 ? 9.478   -2.959  2.539  1.00 25.73 ? 371 TYR A CD1 1 
ATOM   2696 C CD2 . TYR A 1 369 ? 7.324   -2.224  3.331  1.00 24.70 ? 371 TYR A CD2 1 
ATOM   2697 C CE1 . TYR A 1 369 ? 9.044   -2.932  1.236  1.00 27.36 ? 371 TYR A CE1 1 
ATOM   2698 C CE2 . TYR A 1 369 ? 6.871   -2.173  1.995  1.00 31.73 ? 371 TYR A CE2 1 
ATOM   2699 C CZ  . TYR A 1 369 ? 7.747   -2.512  0.961  1.00 29.20 ? 371 TYR A CZ  1 
ATOM   2700 O OH  . TYR A 1 369 ? 7.292   -2.497  -0.351 1.00 32.99 ? 371 TYR A OH  1 
ATOM   2701 N N   . SER A 1 370 ? 8.792   0.368   6.317  1.00 21.17 ? 372 SER A N   1 
ATOM   2702 C CA  . SER A 1 370 ? 8.143   1.700   6.423  1.00 22.68 ? 372 SER A CA  1 
ATOM   2703 C C   . SER A 1 370 ? 9.090   2.898   6.152  1.00 22.37 ? 372 SER A C   1 
ATOM   2704 O O   . SER A 1 370 ? 8.646   4.075   5.861  1.00 24.88 ? 372 SER A O   1 
ATOM   2705 C CB  . SER A 1 370 ? 7.561   1.805   7.850  1.00 22.08 ? 372 SER A CB  1 
ATOM   2706 O OG  . SER A 1 370 ? 6.300   1.095   7.931  1.00 22.22 ? 372 SER A OG  1 
ATOM   2707 N N   . CYS A 1 371 ? 10.394  2.626   6.252  1.00 21.52 ? 373 CYS A N   1 
ATOM   2708 C CA  . CYS A 1 371 ? 11.398  3.663   6.068  1.00 22.87 ? 373 CYS A CA  1 
ATOM   2709 C C   . CYS A 1 371 ? 11.674  3.745   4.562  1.00 23.05 ? 373 CYS A C   1 
ATOM   2710 O O   . CYS A 1 371 ? 12.682  3.185   4.062  1.00 22.76 ? 373 CYS A O   1 
ATOM   2711 C CB  . CYS A 1 371 ? 12.671  3.317   6.855  1.00 22.64 ? 373 CYS A CB  1 
ATOM   2712 S SG  . CYS A 1 371 ? 13.897  4.608   6.753  1.00 24.94 ? 373 CYS A SG  1 
ATOM   2713 N N   . ARG A 1 372 ? 10.756  4.383   3.825  1.00 22.50 ? 374 ARG A N   1 
ATOM   2714 C CA  . ARG A 1 372 ? 10.924  4.439   2.379  1.00 24.04 ? 374 ARG A CA  1 
ATOM   2715 C C   . ARG A 1 372 ? 10.346  5.717   1.848  1.00 24.98 ? 374 ARG A C   1 
ATOM   2716 O O   . ARG A 1 372 ? 9.461   6.329   2.462  1.00 26.57 ? 374 ARG A O   1 
ATOM   2717 C CB  . ARG A 1 372 ? 10.383  3.178   1.654  1.00 23.00 ? 374 ARG A CB  1 
ATOM   2718 C CG  . ARG A 1 372 ? 8.817   3.132   1.506  1.00 22.13 ? 374 ARG A CG  1 
ATOM   2719 C CD  . ARG A 1 372 ? 8.414   1.737   0.909  1.00 22.18 ? 374 ARG A CD  1 
ATOM   2720 N NE  . ARG A 1 372 ? 6.978   1.706   0.628  1.00 24.66 ? 374 ARG A NE  1 
ATOM   2721 C CZ  . ARG A 1 372 ? 6.100   1.345   1.538  1.00 26.23 ? 374 ARG A CZ  1 
ATOM   2722 N NH1 . ARG A 1 372 ? 6.573   0.979   2.735  1.00 25.94 ? 374 ARG A NH1 1 
ATOM   2723 N NH2 . ARG A 1 372 ? 4.789   1.269   1.254  1.00 24.42 ? 374 ARG A NH2 1 
ATOM   2724 N N   . LYS A 1 373 ? 10.878  6.167   0.710  1.00 27.65 ? 375 LYS A N   1 
ATOM   2725 C CA  . LYS A 1 373 ? 10.518  7.505   0.240  1.00 27.19 ? 375 LYS A CA  1 
ATOM   2726 C C   . LYS A 1 373 ? 9.031   7.734   0.039  1.00 26.21 ? 375 LYS A C   1 
ATOM   2727 O O   . LYS A 1 373 ? 8.543   8.805   0.370  1.00 27.19 ? 375 LYS A O   1 
ATOM   2728 C CB  . LYS A 1 373 ? 11.248  7.823   -1.028 1.00 29.67 ? 375 LYS A CB  1 
ATOM   2729 C CG  . LYS A 1 373 ? 10.603  7.286   -2.309 1.00 34.84 ? 375 LYS A CG  1 
ATOM   2730 C CD  . LYS A 1 373 ? 11.589  7.548   -3.512 1.00 38.53 ? 375 LYS A CD  1 
ATOM   2731 C CE  . LYS A 1 373 ? 11.730  9.038   -3.666 1.00 40.63 ? 375 LYS A CE  1 
ATOM   2732 N NZ  . LYS A 1 373 ? 11.034  9.559   -2.414 1.00 41.43 ? 375 LYS A NZ  1 
ATOM   2733 N N   . GLU A 1 374 ? 8.291   6.729   -0.433 1.00 25.65 ? 376 GLU A N   1 
ATOM   2734 C CA  . GLU A 1 374 ? 6.851   6.879   -0.652 1.00 25.99 ? 376 GLU A CA  1 
ATOM   2735 C C   . GLU A 1 374 ? 6.088   7.210   0.660  1.00 25.83 ? 376 GLU A C   1 
ATOM   2736 O O   . GLU A 1 374 ? 5.159   8.064   0.670  1.00 26.38 ? 376 GLU A O   1 
ATOM   2737 C CB  . GLU A 1 374 ? 6.238   5.608   -1.317 1.00 25.28 ? 376 GLU A CB  1 
ATOM   2738 C CG  . GLU A 1 374 ? 6.782   5.355   -2.762 1.00 27.75 ? 376 GLU A CG  1 
ATOM   2739 C CD  . GLU A 1 374 ? 8.007   4.418   -2.771 1.00 25.31 ? 376 GLU A CD  1 
ATOM   2740 O OE1 . GLU A 1 374 ? 8.731   4.270   -1.751 1.00 21.74 ? 376 GLU A OE1 1 
ATOM   2741 O OE2 . GLU A 1 374 ? 8.237   3.810   -3.810 1.00 29.24 ? 376 GLU A OE2 1 
ATOM   2742 N N   . ASN A 1 375 ? 6.478   6.526   1.739  1.00 24.94 ? 377 ASN A N   1 
ATOM   2743 C CA  . ASN A 1 375 ? 5.832   6.667   3.059  1.00 25.21 ? 377 ASN A CA  1 
ATOM   2744 C C   . ASN A 1 375 ? 6.257   8.019   3.679  1.00 25.62 ? 377 ASN A C   1 
ATOM   2745 O O   . ASN A 1 375 ? 5.450   8.756   4.283  1.00 27.29 ? 377 ASN A O   1 
ATOM   2746 C CB  . ASN A 1 375 ? 6.262   5.541   4.004  1.00 24.13 ? 377 ASN A CB  1 
ATOM   2747 C CG  . ASN A 1 375 ? 5.387   4.401   3.973  1.00 24.92 ? 377 ASN A CG  1 
ATOM   2748 O OD1 . ASN A 1 375 ? 5.308   3.623   4.963  1.00 26.61 ? 377 ASN A OD1 1 
ATOM   2749 N ND2 . ASN A 1 375 ? 4.682   4.233   2.868  1.00 17.45 ? 377 ASN A ND2 1 
ATOM   2750 N N   . VAL A 1 376 ? 7.529   8.370   3.498  1.00 25.09 ? 378 VAL A N   1 
ATOM   2751 C CA  . VAL A 1 376 ? 7.968   9.642   3.997  1.00 23.37 ? 378 VAL A CA  1 
ATOM   2752 C C   . VAL A 1 376 ? 7.220   10.775  3.296  1.00 24.49 ? 378 VAL A C   1 
ATOM   2753 O O   . VAL A 1 376 ? 6.735   11.683  3.916  1.00 23.98 ? 378 VAL A O   1 
ATOM   2754 C CB  . VAL A 1 376 ? 9.485   9.802   3.838  1.00 24.73 ? 378 VAL A CB  1 
ATOM   2755 C CG1 . VAL A 1 376 ? 9.829   11.267  3.947  1.00 20.58 ? 378 VAL A CG1 1 
ATOM   2756 C CG2 . VAL A 1 376 ? 10.171  9.024   4.970  1.00 22.38 ? 378 VAL A CG2 1 
ATOM   2757 N N   . LEU A 1 377 ? 7.091   10.707  1.981  1.00 25.44 ? 379 LEU A N   1 
ATOM   2758 C CA  . LEU A 1 377 ? 6.283   11.712  1.260  1.00 25.08 ? 379 LEU A CA  1 
ATOM   2759 C C   . LEU A 1 377 ? 4.796   11.717  1.689  1.00 25.61 ? 379 LEU A C   1 
ATOM   2760 O O   . LEU A 1 377 ? 4.210   12.786  1.902  1.00 26.53 ? 379 LEU A O   1 
ATOM   2761 C CB  . LEU A 1 377 ? 6.409   11.479  -0.254 1.00 24.27 ? 379 LEU A CB  1 
ATOM   2762 C CG  . LEU A 1 377 ? 7.498   12.143  -1.114 1.00 27.98 ? 379 LEU A CG  1 
ATOM   2763 C CD1 . LEU A 1 377 ? 8.504   13.063  -0.460 1.00 24.79 ? 379 LEU A CD1 1 
ATOM   2764 C CD2 . LEU A 1 377 ? 8.128   11.279  -2.198 1.00 23.79 ? 379 LEU A CD2 1 
ATOM   2765 N N   . PHE A 1 378 ? 4.175   10.549  1.823  1.00 25.15 ? 380 PHE A N   1 
ATOM   2766 C CA  . PHE A 1 378 ? 2.741   10.515  2.150  1.00 26.48 ? 380 PHE A CA  1 
ATOM   2767 C C   . PHE A 1 378 ? 2.458   10.988  3.567  1.00 26.07 ? 380 PHE A C   1 
ATOM   2768 O O   . PHE A 1 378 ? 1.439   11.645  3.815  1.00 27.00 ? 380 PHE A O   1 
ATOM   2769 C CB  . PHE A 1 378 ? 2.191   9.097   1.909  1.00 27.35 ? 380 PHE A CB  1 
ATOM   2770 C CG  . PHE A 1 378 ? 0.649   8.967   1.910  1.00 32.37 ? 380 PHE A CG  1 
ATOM   2771 C CD1 . PHE A 1 378 ? -0.207  10.021  1.552  1.00 35.09 ? 380 PHE A CD1 1 
ATOM   2772 C CD2 . PHE A 1 378 ? 0.052   7.712   2.218  1.00 35.75 ? 380 PHE A CD2 1 
ATOM   2773 C CE1 . PHE A 1 378 ? -1.626  9.819   1.544  1.00 36.82 ? 380 PHE A CE1 1 
ATOM   2774 C CE2 . PHE A 1 378 ? -1.364  7.526   2.191  1.00 35.25 ? 380 PHE A CE2 1 
ATOM   2775 C CZ  . PHE A 1 378 ? -2.175  8.577   1.860  1.00 34.42 ? 380 PHE A CZ  1 
ATOM   2776 N N   . VAL A 1 379 ? 3.335   10.660  4.509  1.00 25.57 ? 381 VAL A N   1 
ATOM   2777 C CA  . VAL A 1 379 ? 3.090   11.058  5.876  1.00 25.75 ? 381 VAL A CA  1 
ATOM   2778 C C   . VAL A 1 379 ? 3.171   12.595  5.988  1.00 25.70 ? 381 VAL A C   1 
ATOM   2779 O O   . VAL A 1 379 ? 2.395   13.223  6.753  1.00 23.16 ? 381 VAL A O   1 
ATOM   2780 C CB  . VAL A 1 379 ? 4.021   10.335  6.906  1.00 26.42 ? 381 VAL A CB  1 
ATOM   2781 C CG1 . VAL A 1 379 ? 5.429   10.969  6.880  1.00 27.16 ? 381 VAL A CG1 1 
ATOM   2782 C CG2 . VAL A 1 379 ? 3.409   10.423  8.346  1.00 25.68 ? 381 VAL A CG2 1 
ATOM   2783 N N   . LEU A 1 380 ? 4.081   13.217  5.228  1.00 26.98 ? 382 LEU A N   1 
ATOM   2784 C CA  . LEU A 1 380 ? 4.179   14.716  5.269  1.00 27.62 ? 382 LEU A CA  1 
ATOM   2785 C C   . LEU A 1 380 ? 2.953   15.321  4.573  1.00 26.78 ? 382 LEU A C   1 
ATOM   2786 O O   . LEU A 1 380 ? 2.388   16.326  5.042  1.00 27.58 ? 382 LEU A O   1 
ATOM   2787 C CB  . LEU A 1 380 ? 5.453   15.248  4.605  1.00 27.06 ? 382 LEU A CB  1 
ATOM   2788 C CG  . LEU A 1 380 ? 6.772   14.827  5.254  1.00 27.25 ? 382 LEU A CG  1 
ATOM   2789 C CD1 . LEU A 1 380 ? 7.865   15.001  4.234  1.00 25.09 ? 382 LEU A CD1 1 
ATOM   2790 C CD2 . LEU A 1 380 ? 7.021   15.706  6.478  1.00 24.92 ? 382 LEU A CD2 1 
ATOM   2791 N N   . ALA A 1 381 ? 2.539   14.724  3.461  1.00 25.60 ? 383 ALA A N   1 
ATOM   2792 C CA  . ALA A 1 381 ? 1.368   15.267  2.754  1.00 26.27 ? 383 ALA A CA  1 
ATOM   2793 C C   . ALA A 1 381 ? 0.118   15.164  3.656  1.00 26.17 ? 383 ALA A C   1 
ATOM   2794 O O   . ALA A 1 381 ? -0.586  16.120  3.820  1.00 26.69 ? 383 ALA A O   1 
ATOM   2795 C CB  . ALA A 1 381 ? 1.153   14.557  1.457  1.00 25.65 ? 383 ALA A CB  1 
ATOM   2796 N N   . GLY A 1 382 ? -0.101  13.995  4.252  1.00 26.43 ? 384 GLY A N   1 
ATOM   2797 C CA  . GLY A 1 382 ? -1.227  13.778  5.129  1.00 25.61 ? 384 GLY A CA  1 
ATOM   2798 C C   . GLY A 1 382 ? -1.189  14.680  6.345  1.00 26.50 ? 384 GLY A C   1 
ATOM   2799 O O   . GLY A 1 382 ? -2.232  15.286  6.724  1.00 26.14 ? 384 GLY A O   1 
ATOM   2800 N N   . LEU A 1 383 ? -0.024  14.771  6.976  1.00 25.27 ? 385 LEU A N   1 
ATOM   2801 C CA  . LEU A 1 383 ? 0.069   15.556  8.193  1.00 26.07 ? 385 LEU A CA  1 
ATOM   2802 C C   . LEU A 1 383 ? -0.097  17.042  7.853  1.00 26.56 ? 385 LEU A C   1 
ATOM   2803 O O   . LEU A 1 383 ? -0.744  17.752  8.609  1.00 25.36 ? 385 LEU A O   1 
ATOM   2804 C CB  . LEU A 1 383 ? 1.358   15.298  8.981  1.00 26.29 ? 385 LEU A CB  1 
ATOM   2805 C CG  . LEU A 1 383 ? 1.617   16.091  10.290 1.00 28.36 ? 385 LEU A CG  1 
ATOM   2806 C CD1 . LEU A 1 383 ? 0.816   15.602  11.486 1.00 26.16 ? 385 LEU A CD1 1 
ATOM   2807 C CD2 . LEU A 1 383 ? 3.121   15.957  10.598 1.00 32.44 ? 385 LEU A CD2 1 
ATOM   2808 N N   . GLU A 1 384 ? 0.425   17.491  6.705  1.00 26.20 ? 386 GLU A N   1 
ATOM   2809 C CA  . GLU A 1 384 ? 0.180   18.869  6.283  1.00 26.91 ? 386 GLU A CA  1 
ATOM   2810 C C   . GLU A 1 384 ? -1.353  19.130  6.155  1.00 27.06 ? 386 GLU A C   1 
ATOM   2811 O O   . GLU A 1 384 ? -1.878  20.103  6.730  1.00 27.33 ? 386 GLU A O   1 
ATOM   2812 C CB  . GLU A 1 384 ? 0.931   19.189  4.959  1.00 27.11 ? 386 GLU A CB  1 
ATOM   2813 C CG  . GLU A 1 384 ? 0.565   20.536  4.302  1.00 29.66 ? 386 GLU A CG  1 
ATOM   2814 C CD  . GLU A 1 384 ? 1.165   20.776  2.895  1.00 33.91 ? 386 GLU A CD  1 
ATOM   2815 O OE1 . GLU A 1 384 ? 2.381   20.975  2.751  1.00 30.78 ? 386 GLU A OE1 1 
ATOM   2816 O OE2 . GLU A 1 384 ? 0.378   20.828  1.903  1.00 41.08 ? 386 GLU A OE2 1 
ATOM   2817 N N   . ALA A 1 385 ? -2.065  18.280  5.393  1.00 26.44 ? 387 ALA A N   1 
ATOM   2818 C CA  . ALA A 1 385 ? -3.516  18.510  5.138  1.00 26.16 ? 387 ALA A CA  1 
ATOM   2819 C C   . ALA A 1 385 ? -4.335  18.465  6.427  1.00 25.85 ? 387 ALA A C   1 
ATOM   2820 O O   . ALA A 1 385 ? -5.235  19.294  6.595  1.00 26.62 ? 387 ALA A O   1 
ATOM   2821 C CB  . ALA A 1 385 ? -4.113  17.510  4.094  1.00 25.91 ? 387 ALA A CB  1 
ATOM   2822 N N   . VAL A 1 386 ? -4.001  17.557  7.346  1.00 24.75 ? 388 VAL A N   1 
ATOM   2823 C CA  . VAL A 1 386 ? -4.701  17.501  8.606  1.00 25.05 ? 388 VAL A CA  1 
ATOM   2824 C C   . VAL A 1 386 ? -4.430  18.721  9.506  1.00 27.22 ? 388 VAL A C   1 
ATOM   2825 O O   . VAL A 1 386 ? -5.345  19.263  10.178 1.00 27.54 ? 388 VAL A O   1 
ATOM   2826 C CB  . VAL A 1 386 ? -4.488  16.149  9.307  1.00 25.64 ? 388 VAL A CB  1 
ATOM   2827 C CG1 . VAL A 1 386 ? -5.079  16.158  10.719 1.00 23.97 ? 388 VAL A CG1 1 
ATOM   2828 C CG2 . VAL A 1 386 ? -5.131  15.049  8.482  1.00 23.23 ? 388 VAL A CG2 1 
ATOM   2829 N N   . LEU A 1 387 ? -3.199  19.225  9.476  1.00 28.18 ? 389 LEU A N   1 
ATOM   2830 C CA  . LEU A 1 387 ? -2.858  20.325  10.341 1.00 27.62 ? 389 LEU A CA  1 
ATOM   2831 C C   . LEU A 1 387 ? -3.547  21.578  9.818  1.00 27.95 ? 389 LEU A C   1 
ATOM   2832 O O   . LEU A 1 387 ? -4.174  22.322  10.594 1.00 27.64 ? 389 LEU A O   1 
ATOM   2833 C CB  . LEU A 1 387 ? -1.345  20.422  10.497 1.00 27.76 ? 389 LEU A CB  1 
ATOM   2834 C CG  . LEU A 1 387 ? -0.786  19.411  11.510 1.00 28.41 ? 389 LEU A CG  1 
ATOM   2835 C CD1 . LEU A 1 387 ? 0.733   19.427  11.548 1.00 27.20 ? 389 LEU A CD1 1 
ATOM   2836 C CD2 . LEU A 1 387 ? -1.271  19.706  12.914 1.00 28.31 ? 389 LEU A CD2 1 
ATOM   2837 N N   . LEU A 1 388 ? -3.491  21.794  8.503  1.00 27.96 ? 390 LEU A N   1 
ATOM   2838 C CA  . LEU A 1 388 ? -4.349  22.803  7.881  1.00 27.74 ? 390 LEU A CA  1 
ATOM   2839 C C   . LEU A 1 388 ? -5.834  22.666  8.261  1.00 28.06 ? 390 LEU A C   1 
ATOM   2840 O O   . LEU A 1 388 ? -6.485  23.695  8.582  1.00 26.93 ? 390 LEU A O   1 
ATOM   2841 C CB  . LEU A 1 388 ? -4.144  22.880  6.363  1.00 27.24 ? 390 LEU A CB  1 
ATOM   2842 C CG  . LEU A 1 388 ? -2.735  23.338  5.970  1.00 27.22 ? 390 LEU A CG  1 
ATOM   2843 C CD1 . LEU A 1 388 ? -2.423  22.843  4.573  1.00 24.32 ? 390 LEU A CD1 1 
ATOM   2844 C CD2 . LEU A 1 388 ? -2.536  24.910  6.100  1.00 26.63 ? 390 LEU A CD2 1 
ATOM   2845 N N   . ARG A 1 389 ? -6.382  21.429  8.245  1.00 27.59 ? 391 ARG A N   1 
ATOM   2846 C CA  . ARG A 1 389 ? -7.803  21.232  8.662  1.00 27.57 ? 391 ARG A CA  1 
ATOM   2847 C C   . ARG A 1 389 ? -8.067  21.688  10.117 1.00 27.71 ? 391 ARG A C   1 
ATOM   2848 O O   . ARG A 1 389 ? -9.132  22.204  10.408 1.00 28.75 ? 391 ARG A O   1 
ATOM   2849 C CB  . ARG A 1 389 ? -8.303  19.794  8.439  1.00 27.29 ? 391 ARG A CB  1 
ATOM   2850 C CG  . ARG A 1 389 ? -9.831  19.665  8.230  1.00 26.38 ? 391 ARG A CG  1 
ATOM   2851 C CD  . ARG A 1 389 ? -10.202 18.451  7.369  1.00 23.71 ? 391 ARG A CD  1 
ATOM   2852 N NE  . ARG A 1 389 ? -11.626 18.402  6.985  1.00 21.29 ? 391 ARG A NE  1 
ATOM   2853 C CZ  . ARG A 1 389 ? -12.165 19.119  5.990  1.00 21.92 ? 391 ARG A CZ  1 
ATOM   2854 N NH1 . ARG A 1 389 ? -11.428 19.967  5.252  1.00 17.45 ? 391 ARG A NH1 1 
ATOM   2855 N NH2 . ARG A 1 389 ? -13.461 19.001  5.734  1.00 22.26 ? 391 ARG A NH2 1 
ATOM   2856 N N   . HIS A 1 390 ? -7.084  21.521  10.999 1.00 27.89 ? 392 HIS A N   1 
ATOM   2857 C CA  . HIS A 1 390 ? -7.165  21.938  12.413 1.00 28.41 ? 392 HIS A CA  1 
ATOM   2858 C C   . HIS A 1 390 ? -6.746  23.366  12.665 1.00 29.45 ? 392 HIS A C   1 
ATOM   2859 O O   . HIS A 1 390 ? -6.685  23.766  13.835 1.00 28.65 ? 392 HIS A O   1 
ATOM   2860 C CB  . HIS A 1 390 ? -6.319  21.004  13.300 1.00 27.26 ? 392 HIS A CB  1 
ATOM   2861 C CG  . HIS A 1 390 ? -6.865  19.599  13.355 1.00 29.02 ? 392 HIS A CG  1 
ATOM   2862 N ND1 . HIS A 1 390 ? -7.396  19.035  14.499 1.00 27.32 ? 392 HIS A ND1 1 
ATOM   2863 C CD2 . HIS A 1 390 ? -7.054  18.692  12.374 1.00 26.53 ? 392 HIS A CD2 1 
ATOM   2864 C CE1 . HIS A 1 390 ? -7.847  17.830  14.232 1.00 29.85 ? 392 HIS A CE1 1 
ATOM   2865 N NE2 . HIS A 1 390 ? -7.624  17.582  12.952 1.00 32.55 ? 392 HIS A NE2 1 
ATOM   2866 N N   . ASN A 1 391 ? -6.395  24.100  11.597 1.00 30.99 ? 393 ASN A N   1 
ATOM   2867 C CA  . ASN A 1 391 ? -5.986  25.508  11.686 1.00 34.74 ? 393 ASN A CA  1 
ATOM   2868 C C   . ASN A 1 391 ? -4.786  25.862  12.633 1.00 35.92 ? 393 ASN A C   1 
ATOM   2869 O O   . ASN A 1 391 ? -4.982  26.735  13.512 1.00 36.22 ? 393 ASN A O   1 
ATOM   2870 C CB  . ASN A 1 391 ? -7.217  26.264  12.207 1.00 34.66 ? 393 ASN A CB  1 
ATOM   2871 C CG  . ASN A 1 391 ? -7.499  27.517  11.451 1.00 38.03 ? 393 ASN A CG  1 
ATOM   2872 O OD1 . ASN A 1 391 ? -6.972  28.600  11.773 1.00 39.47 ? 393 ASN A OD1 1 
ATOM   2873 N ND2 . ASN A 1 391 ? -8.392  27.408  10.462 1.00 40.98 ? 393 ASN A ND2 1 
ATOM   2874 N N   . ALA A 1 392 ? -3.542  25.356  12.471 1.00 37.00 ? 394 ALA A N   1 
ATOM   2875 C CA  . ALA A 1 392 ? -2.813  25.130  11.241 1.00 37.16 ? 394 ALA A CA  1 
ATOM   2876 C C   . ALA A 1 392 ? -2.085  26.383  10.760 1.00 37.63 ? 394 ALA A C   1 
ATOM   2877 O O   . ALA A 1 392 ? -2.297  26.800  9.611  1.00 37.83 ? 394 ALA A O   1 
ATOM   2878 C CB  . ALA A 1 392 ? -3.721  24.704  10.176 1.00 38.24 ? 394 ALA A CB  1 
ATOM   2879 N N   . GLY A 1 393 ? -1.242  26.990  11.588 1.00 37.21 ? 395 GLY A N   1 
ATOM   2880 C CA  . GLY A 1 393 ? -0.409  28.100  11.090 1.00 38.60 ? 395 GLY A CA  1 
ATOM   2881 C C   . GLY A 1 393 ? 0.859   27.652  10.363 1.00 39.43 ? 395 GLY A C   1 
ATOM   2882 O O   . GLY A 1 393 ? 1.973   27.916  10.858 1.00 40.17 ? 395 GLY A O   1 
ATOM   2883 N N   . ILE A 1 394 ? 0.684   26.946  9.225  1.00 38.76 ? 396 ILE A N   1 
ATOM   2884 C CA  . ILE A 1 394 ? 1.781   26.414  8.376  1.00 37.79 ? 396 ILE A CA  1 
ATOM   2885 C C   . ILE A 1 394 ? 1.660   26.902  6.920  1.00 36.96 ? 396 ILE A C   1 
ATOM   2886 O O   . ILE A 1 394 ? 0.632   27.419  6.515  1.00 36.66 ? 396 ILE A O   1 
ATOM   2887 C CB  . ILE A 1 394 ? 1.903   24.804  8.406  1.00 38.44 ? 396 ILE A CB  1 
ATOM   2888 C CG1 . ILE A 1 394 ? 0.980   24.112  7.411  1.00 36.82 ? 396 ILE A CG1 1 
ATOM   2889 C CG2 . ILE A 1 394 ? 1.684   24.208  9.818  1.00 38.65 ? 396 ILE A CG2 1 
ATOM   2890 C CD1 . ILE A 1 394 ? 0.681   22.661  7.808  1.00 38.25 ? 396 ILE A CD1 1 
ATOM   2891 N N   . GLU A 1 395 ? 2.699   26.705  6.118  1.00 36.76 ? 397 GLU A N   1 
ATOM   2892 C CA  . GLU A 1 395 ? 2.642   27.122  4.717  1.00 36.32 ? 397 GLU A CA  1 
ATOM   2893 C C   . GLU A 1 395 ? 2.736   25.959  3.700  1.00 34.99 ? 397 GLU A C   1 
ATOM   2894 O O   . GLU A 1 395 ? 3.741   25.248  3.659  1.00 35.87 ? 397 GLU A O   1 
ATOM   2895 C CB  . GLU A 1 395 ? 3.745   28.162  4.462  1.00 36.98 ? 397 GLU A CB  1 
ATOM   2896 C CG  . GLU A 1 395 ? 3.608   28.979  3.173  1.00 38.78 ? 397 GLU A CG  1 
ATOM   2897 C CD  . GLU A 1 395 ? 4.874   29.781  2.811  1.00 41.16 ? 397 GLU A CD  1 
ATOM   2898 O OE1 . GLU A 1 395 ? 5.797   29.931  3.663  1.00 39.71 ? 397 GLU A OE1 1 
ATOM   2899 O OE2 . GLU A 1 395 ? 4.932   30.264  1.657  1.00 40.98 ? 397 GLU A OE2 1 
ATOM   2900 N N   . ALA A 1 396 ? 1.667   25.744  2.930  1.00 33.52 ? 398 ALA A N   1 
ATOM   2901 C CA  . ALA A 1 396 ? 1.725   25.146  1.562  1.00 31.88 ? 398 ALA A CA  1 
ATOM   2902 C C   . ALA A 1 396 ? 2.292   23.770  1.293  1.00 32.16 ? 398 ALA A C   1 
ATOM   2903 O O   . ALA A 1 396 ? 2.330   22.868  2.129  1.00 33.27 ? 398 ALA A O   1 
ATOM   2904 C CB  . ALA A 1 396 ? 2.442   26.075  0.629  1.00 31.85 ? 398 ALA A CB  1 
ATOM   2905 N N   . GLY A 1 397 ? 2.673   23.635  0.035  1.00 31.46 ? 399 GLY A N   1 
ATOM   2906 C CA  . GLY A 1 397 ? 3.600   22.677  -0.433 1.00 30.63 ? 399 GLY A CA  1 
ATOM   2907 C C   . GLY A 1 397 ? 5.035   23.030  -0.087 1.00 29.97 ? 399 GLY A C   1 
ATOM   2908 O O   . GLY A 1 397 ? 5.912   22.730  -0.877 1.00 30.24 ? 399 GLY A O   1 
ATOM   2909 N N   . LYS A 1 398 ? 5.316   23.596  1.097  1.00 29.83 ? 400 LYS A N   1 
ATOM   2910 C CA  . LYS A 1 398 ? 6.754   23.731  1.513  1.00 29.34 ? 400 LYS A CA  1 
ATOM   2911 C C   . LYS A 1 398 ? 7.314   22.406  2.014  1.00 28.60 ? 400 LYS A C   1 
ATOM   2912 O O   . LYS A 1 398 ? 8.453   22.039  1.671  1.00 28.25 ? 400 LYS A O   1 
ATOM   2913 C CB  . LYS A 1 398 ? 7.036   24.892  2.506  1.00 29.66 ? 400 LYS A CB  1 
ATOM   2914 C CG  . LYS A 1 398 ? 6.631   26.293  1.992  1.00 30.19 ? 400 LYS A CG  1 
ATOM   2915 C CD  . LYS A 1 398 ? 7.711   27.152  1.216  1.00 35.50 ? 400 LYS A CD  1 
ATOM   2916 C CE  . LYS A 1 398 ? 8.491   26.474  0.052  1.00 40.25 ? 400 LYS A CE  1 
ATOM   2917 N NZ  . LYS A 1 398 ? 7.748   25.974  -1.185 1.00 42.11 ? 400 LYS A NZ  1 
ATOM   2918 N N   . ALA A 1 399 ? 6.512   21.672  2.793  1.00 27.97 ? 401 ALA A N   1 
ATOM   2919 C CA  . ALA A 1 399 ? 6.928   20.359  3.302  1.00 27.34 ? 401 ALA A CA  1 
ATOM   2920 C C   . ALA A 1 399 ? 7.420   19.455  2.150  1.00 27.02 ? 401 ALA A C   1 
ATOM   2921 O O   . ALA A 1 399 ? 8.606   19.077  2.111  1.00 25.72 ? 401 ALA A O   1 
ATOM   2922 C CB  . ALA A 1 399 ? 5.807   19.691  4.075  1.00 27.75 ? 401 ALA A CB  1 
ATOM   2923 N N   . LEU A 1 400 ? 6.569   19.193  1.163  1.00 26.35 ? 402 LEU A N   1 
ATOM   2924 C CA  . LEU A 1 400 ? 6.982   18.265  0.066  1.00 27.40 ? 402 LEU A CA  1 
ATOM   2925 C C   . LEU A 1 400 ? 8.204   18.698  -0.769 1.00 27.25 ? 402 LEU A C   1 
ATOM   2926 O O   . LEU A 1 400 ? 9.085   17.883  -1.074 1.00 27.56 ? 402 LEU A O   1 
ATOM   2927 C CB  . LEU A 1 400 ? 5.809   17.945  -0.849 1.00 26.88 ? 402 LEU A CB  1 
ATOM   2928 C CG  . LEU A 1 400 ? 4.743   17.229  -0.028 1.00 29.80 ? 402 LEU A CG  1 
ATOM   2929 C CD1 . LEU A 1 400 ? 3.616   16.740  -0.911 1.00 30.59 ? 402 LEU A CD1 1 
ATOM   2930 C CD2 . LEU A 1 400 ? 5.392   16.069  0.626  1.00 30.59 ? 402 LEU A CD2 1 
ATOM   2931 N N   . GLN A 1 401 ? 8.257   19.981  -1.143 1.00 26.75 ? 403 GLN A N   1 
ATOM   2932 C CA  . GLN A 1 401 ? 9.390   20.466  -1.935 1.00 26.72 ? 403 GLN A CA  1 
ATOM   2933 C C   . GLN A 1 401 ? 10.692  20.238  -1.157 1.00 25.80 ? 403 GLN A C   1 
ATOM   2934 O O   . GLN A 1 401 ? 11.740  19.880  -1.739 1.00 25.15 ? 403 GLN A O   1 
ATOM   2935 C CB  . GLN A 1 401 ? 9.236   21.974  -2.291 1.00 27.53 ? 403 GLN A CB  1 
ATOM   2936 C CG  . GLN A 1 401 ? 7.981   22.250  -3.138 1.00 29.61 ? 403 GLN A CG  1 
ATOM   2937 C CD  . GLN A 1 401 ? 7.809   21.232  -4.307 1.00 28.22 ? 403 GLN A CD  1 
ATOM   2938 O OE1 . GLN A 1 401 ? 8.742   21.025  -5.097 1.00 27.77 ? 403 GLN A OE1 1 
ATOM   2939 N NE2 . GLN A 1 401 ? 6.612   20.613  -4.414 1.00 24.79 ? 403 GLN A NE2 1 
ATOM   2940 N N   . ALA A 1 402 ? 10.627  20.417  0.157  1.00 24.96 ? 404 ALA A N   1 
ATOM   2941 C CA  . ALA A 1 402 ? 11.835  20.228  0.921  1.00 25.96 ? 404 ALA A CA  1 
ATOM   2942 C C   . ALA A 1 402 ? 12.231  18.752  1.073  1.00 25.56 ? 404 ALA A C   1 
ATOM   2943 O O   . ALA A 1 402 ? 13.418  18.434  0.949  1.00 26.83 ? 404 ALA A O   1 
ATOM   2944 C CB  . ALA A 1 402 ? 11.842  21.059  2.255  1.00 25.88 ? 404 ALA A CB  1 
ATOM   2945 N N   . ALA A 1 403 ? 11.270  17.834  1.243  1.00 25.15 ? 405 ALA A N   1 
ATOM   2946 C CA  . ALA A 1 403 ? 11.636  16.415  1.234  1.00 23.60 ? 405 ALA A CA  1 
ATOM   2947 C C   . ALA A 1 403 ? 12.070  16.014  -0.170 1.00 23.40 ? 405 ALA A C   1 
ATOM   2948 O O   . ALA A 1 403 ? 13.037  15.303  -0.295 1.00 23.45 ? 405 ALA A O   1 
ATOM   2949 C CB  . ALA A 1 403 ? 10.475  15.519  1.735  1.00 22.52 ? 405 ALA A CB  1 
ATOM   2950 N N   . LEU A 1 404 ? 11.410  16.536  -1.229 1.00 24.02 ? 406 LEU A N   1 
ATOM   2951 C CA  . LEU A 1 404 ? 11.818  16.235  -2.604 1.00 23.21 ? 406 LEU A CA  1 
ATOM   2952 C C   . LEU A 1 404 ? 13.218  16.749  -2.953 1.00 23.59 ? 406 LEU A C   1 
ATOM   2953 O O   . LEU A 1 404 ? 13.977  16.051  -3.611 1.00 24.66 ? 406 LEU A O   1 
ATOM   2954 C CB  . LEU A 1 404 ? 10.792  16.674  -3.654 1.00 22.65 ? 406 LEU A CB  1 
ATOM   2955 C CG  . LEU A 1 404 ? 9.491   15.839  -3.675 1.00 22.86 ? 406 LEU A CG  1 
ATOM   2956 C CD1 . LEU A 1 404 ? 8.352   16.565  -4.428 1.00 16.82 ? 406 LEU A CD1 1 
ATOM   2957 C CD2 . LEU A 1 404 ? 9.764   14.438  -4.241 1.00 17.75 ? 406 LEU A CD2 1 
ATOM   2958 N N   . ASP A 1 405 ? 13.532  17.986  -2.562 1.00 23.98 ? 407 ASP A N   1 
ATOM   2959 C CA  . ASP A 1 405 ? 14.912  18.459  -2.613 1.00 24.83 ? 407 ASP A CA  1 
ATOM   2960 C C   . ASP A 1 405 ? 15.908  17.476  -2.002 1.00 24.37 ? 407 ASP A C   1 
ATOM   2961 O O   . ASP A 1 405 ? 16.919  17.196  -2.606 1.00 24.39 ? 407 ASP A O   1 
ATOM   2962 C CB  . ASP A 1 405 ? 15.031  19.810  -1.944 1.00 23.77 ? 407 ASP A CB  1 
ATOM   2963 C CG  . ASP A 1 405 ? 14.279  20.892  -2.719 1.00 25.97 ? 407 ASP A CG  1 
ATOM   2964 O OD1 . ASP A 1 405 ? 13.921  20.625  -3.885 1.00 25.98 ? 407 ASP A OD1 1 
ATOM   2965 O OD2 . ASP A 1 405 ? 14.029  21.989  -2.172 1.00 27.90 ? 407 ASP A OD2 1 
ATOM   2966 N N   . VAL A 1 406 ? 15.653  16.968  -0.801 1.00 26.17 ? 408 VAL A N   1 
ATOM   2967 C CA  . VAL A 1 406 ? 16.642  16.030  -0.284 1.00 26.96 ? 408 VAL A CA  1 
ATOM   2968 C C   . VAL A 1 406 ? 16.732  14.744  -1.088 1.00 27.46 ? 408 VAL A C   1 
ATOM   2969 O O   . VAL A 1 406 ? 17.841  14.186  -1.251 1.00 26.72 ? 408 VAL A O   1 
ATOM   2970 C CB  . VAL A 1 406 ? 16.694  15.838  1.285  1.00 28.56 ? 408 VAL A CB  1 
ATOM   2971 C CG1 . VAL A 1 406 ? 15.662  16.628  2.024  1.00 29.00 ? 408 VAL A CG1 1 
ATOM   2972 C CG2 . VAL A 1 406 ? 16.772  14.388  1.681  1.00 27.02 ? 408 VAL A CG2 1 
ATOM   2973 N N   . TYR A 1 407 ? 15.600  14.299  -1.642 1.00 27.77 ? 409 TYR A N   1 
ATOM   2974 C CA  . TYR A 1 407 ? 15.604  13.052  -2.420 1.00 28.80 ? 409 TYR A CA  1 
ATOM   2975 C C   . TYR A 1 407 ? 16.285  13.272  -3.761 1.00 30.70 ? 409 TYR A C   1 
ATOM   2976 O O   . TYR A 1 407 ? 16.967  12.383  -4.253 1.00 31.00 ? 409 TYR A O   1 
ATOM   2977 C CB  . TYR A 1 407 ? 14.208  12.452  -2.621 1.00 27.05 ? 409 TYR A CB  1 
ATOM   2978 C CG  . TYR A 1 407 ? 13.694  11.751  -1.369 1.00 25.96 ? 409 TYR A CG  1 
ATOM   2979 C CD1 . TYR A 1 407 ? 14.476  10.773  -0.738 1.00 18.99 ? 409 TYR A CD1 1 
ATOM   2980 C CD2 . TYR A 1 407 ? 12.418  12.037  -0.841 1.00 21.86 ? 409 TYR A CD2 1 
ATOM   2981 C CE1 . TYR A 1 407 ? 14.032  10.131  0.440  1.00 19.04 ? 409 TYR A CE1 1 
ATOM   2982 C CE2 . TYR A 1 407 ? 11.961  11.390  0.325  1.00 21.15 ? 409 TYR A CE2 1 
ATOM   2983 C CZ  . TYR A 1 407 ? 12.747  10.446  0.938  1.00 21.38 ? 409 TYR A CZ  1 
ATOM   2984 O OH  . TYR A 1 407 ? 12.271  9.826   2.070  1.00 21.06 ? 409 TYR A OH  1 
ATOM   2985 N N   . GLU A 1 408 ? 16.097  14.455  -4.334 1.00 32.98 ? 410 GLU A N   1 
ATOM   2986 C CA  . GLU A 1 408 ? 16.797  14.834  -5.568 1.00 35.64 ? 410 GLU A CA  1 
ATOM   2987 C C   . GLU A 1 408 ? 18.343  14.917  -5.457 1.00 36.51 ? 410 GLU A C   1 
ATOM   2988 O O   . GLU A 1 408 ? 19.029  14.439  -6.352 1.00 36.42 ? 410 GLU A O   1 
ATOM   2989 C CB  . GLU A 1 408 ? 16.238  16.141  -6.102 1.00 35.76 ? 410 GLU A CB  1 
ATOM   2990 C CG  . GLU A 1 408 ? 16.437  16.322  -7.609 1.00 38.94 ? 410 GLU A CG  1 
ATOM   2991 C CD  . GLU A 1 408 ? 15.672  17.521  -8.147 1.00 41.55 ? 410 GLU A CD  1 
ATOM   2992 O OE1 . GLU A 1 408 ? 16.325  18.411  -8.727 1.00 42.12 ? 410 GLU A OE1 1 
ATOM   2993 O OE2 . GLU A 1 408 ? 14.427  17.570  -7.985 1.00 42.82 ? 410 GLU A OE2 1 
ATOM   2994 N N   . ASN A 1 409 ? 18.871  15.518  -4.373 1.00 38.10 ? 411 ASN A N   1 
ATOM   2995 C CA  . ASN A 1 409 ? 20.337  15.737  -4.197 1.00 39.50 ? 411 ASN A CA  1 
ATOM   2996 C C   . ASN A 1 409 ? 21.172  14.455  -4.244 1.00 39.73 ? 411 ASN A C   1 
ATOM   2997 O O   . ASN A 1 409 ? 22.258  14.384  -3.660 1.00 39.79 ? 411 ASN A O   1 
ATOM   2998 C CB  . ASN A 1 409 ? 20.677  16.483  -2.888 1.00 40.04 ? 411 ASN A CB  1 
ATOM   2999 C CG  . ASN A 1 409 ? 20.047  17.877  -2.793 1.00 41.82 ? 411 ASN A CG  1 
ATOM   3000 O OD1 . ASN A 1 409 ? 19.964  18.629  -3.773 1.00 42.69 ? 411 ASN A OD1 1 
ATOM   3001 N ND2 . ASN A 1 409 ? 19.610  18.230  -1.582 1.00 44.11 ? 411 ASN A ND2 1 
ATOM   3002 N N   . ARG B 1 5   ? 18.217  -18.640 -2.511 1.00 31.25 ? 7   ARG B N   1 
ATOM   3003 C CA  . ARG B 1 5   ? 18.235  -18.574 -1.018 1.00 28.49 ? 7   ARG B CA  1 
ATOM   3004 C C   . ARG B 1 5   ? 16.968  -18.058 -0.283 1.00 26.37 ? 7   ARG B C   1 
ATOM   3005 O O   . ARG B 1 5   ? 16.928  -18.158 0.938  1.00 24.97 ? 7   ARG B O   1 
ATOM   3006 C CB  . ARG B 1 5   ? 19.521  -17.954 -0.495 1.00 28.47 ? 7   ARG B CB  1 
ATOM   3007 C CG  . ARG B 1 5   ? 19.736  -16.501 -0.796 1.00 31.56 ? 7   ARG B CG  1 
ATOM   3008 C CD  . ARG B 1 5   ? 20.689  -15.958 0.212  1.00 44.53 ? 7   ARG B CD  1 
ATOM   3009 N NE  . ARG B 1 5   ? 20.522  -16.715 1.457  1.00 49.46 ? 7   ARG B NE  1 
ATOM   3010 C CZ  . ARG B 1 5   ? 21.257  -17.769 1.775  1.00 52.84 ? 7   ARG B CZ  1 
ATOM   3011 N NH1 . ARG B 1 5   ? 22.222  -18.177 0.948  1.00 54.97 ? 7   ARG B NH1 1 
ATOM   3012 N NH2 . ARG B 1 5   ? 21.031  -18.406 2.913  1.00 54.30 ? 7   ARG B NH2 1 
ATOM   3013 N N   . GLU B 1 6   ? 15.938  -17.591 -0.998 1.00 24.00 ? 8   GLU B N   1 
ATOM   3014 C CA  . GLU B 1 6   ? 14.560  -17.524 -0.424 1.00 25.24 ? 8   GLU B CA  1 
ATOM   3015 C C   . GLU B 1 6   ? 14.171  -18.930 0.171  1.00 24.40 ? 8   GLU B C   1 
ATOM   3016 O O   . GLU B 1 6   ? 14.721  -19.947 -0.218 1.00 23.74 ? 8   GLU B O   1 
ATOM   3017 C CB  . GLU B 1 6   ? 13.519  -17.218 -1.506 1.00 25.91 ? 8   GLU B CB  1 
ATOM   3018 C CG  . GLU B 1 6   ? 13.230  -18.530 -2.288 1.00 29.02 ? 8   GLU B CG  1 
ATOM   3019 C CD  . GLU B 1 6   ? 12.637  -18.356 -3.643 1.00 36.71 ? 8   GLU B CD  1 
ATOM   3020 O OE1 . GLU B 1 6   ? 11.438  -17.987 -3.735 1.00 38.43 ? 8   GLU B OE1 1 
ATOM   3021 O OE2 . GLU B 1 6   ? 13.359  -18.656 -4.609 1.00 38.90 ? 8   GLU B OE2 1 
ATOM   3022 N N   . LEU B 1 7   ? 13.260  -18.963 1.126  1.00 23.76 ? 9   LEU B N   1 
ATOM   3023 C CA  . LEU B 1 7   ? 12.983  -20.180 1.850  1.00 24.71 ? 9   LEU B CA  1 
ATOM   3024 C C   . LEU B 1 7   ? 12.448  -21.259 0.895  1.00 23.77 ? 9   LEU B C   1 
ATOM   3025 O O   . LEU B 1 7   ? 11.723  -20.977 -0.067 1.00 23.02 ? 9   LEU B O   1 
ATOM   3026 C CB  . LEU B 1 7   ? 11.972  -19.890 2.959  1.00 25.43 ? 9   LEU B CB  1 
ATOM   3027 C CG  . LEU B 1 7   ? 11.560  -20.966 3.943  1.00 27.79 ? 9   LEU B CG  1 
ATOM   3028 C CD1 . LEU B 1 7   ? 12.480  -21.019 5.075  1.00 28.49 ? 9   LEU B CD1 1 
ATOM   3029 C CD2 . LEU B 1 7   ? 10.170  -20.603 4.436  1.00 33.81 ? 9   LEU B CD2 1 
ATOM   3030 N N   . CYS B 1 8   ? 12.822  -22.496 1.155  1.00 24.75 ? 10  CYS B N   1 
ATOM   3031 C CA  . CYS B 1 8   ? 12.375  -23.603 0.335  1.00 24.04 ? 10  CYS B CA  1 
ATOM   3032 C C   . CYS B 1 8   ? 12.211  -24.707 1.333  1.00 24.46 ? 10  CYS B C   1 
ATOM   3033 O O   . CYS B 1 8   ? 13.176  -25.100 1.979  1.00 23.96 ? 10  CYS B O   1 
ATOM   3034 C CB  . CYS B 1 8   ? 13.430  -24.011 -0.704 1.00 25.59 ? 10  CYS B CB  1 
ATOM   3035 S SG  . CYS B 1 8   ? 12.796  -25.365 -1.827 1.00 27.82 ? 10  CYS B SG  1 
ATOM   3036 N N   . THR B 1 9   ? 10.978  -25.195 1.465  1.00 23.30 ? 11  THR B N   1 
ATOM   3037 C CA  . THR B 1 9   ? 10.647  -26.287 2.342  1.00 22.72 ? 11  THR B CA  1 
ATOM   3038 C C   . THR B 1 9   ? 9.830   -27.368 1.617  1.00 21.92 ? 11  THR B C   1 
ATOM   3039 O O   . THR B 1 9   ? 9.112   -27.082 0.685  1.00 20.91 ? 11  THR B O   1 
ATOM   3040 C CB  . THR B 1 9   ? 9.770   -25.797 3.556  1.00 22.48 ? 11  THR B CB  1 
ATOM   3041 O OG1 . THR B 1 9   ? 8.749   -24.982 3.039  1.00 21.87 ? 11  THR B OG1 1 
ATOM   3042 C CG2 . THR B 1 9   ? 10.579  -24.941 4.529  1.00 21.43 ? 11  THR B CG2 1 
ATOM   3043 N N   . PRO B 1 10  ? 9.932   -28.618 2.074  1.00 22.09 ? 12  PRO B N   1 
ATOM   3044 C CA  . PRO B 1 10  ? 9.157   -29.695 1.498  1.00 22.73 ? 12  PRO B CA  1 
ATOM   3045 C C   . PRO B 1 10  ? 7.668   -29.609 1.979  1.00 22.77 ? 12  PRO B C   1 
ATOM   3046 O O   . PRO B 1 10  ? 7.337   -28.941 3.001  1.00 24.56 ? 12  PRO B O   1 
ATOM   3047 C CB  . PRO B 1 10  ? 9.888   -30.948 2.004  1.00 22.65 ? 12  PRO B CB  1 
ATOM   3048 C CG  . PRO B 1 10  ? 10.389  -30.533 3.364  1.00 21.72 ? 12  PRO B CG  1 
ATOM   3049 C CD  . PRO B 1 10  ? 10.663  -29.047 3.280  1.00 22.88 ? 12  PRO B CD  1 
ATOM   3050 N N   . LEU B 1 11  ? 6.768   -30.198 1.206  1.00 21.40 ? 13  LEU B N   1 
ATOM   3051 C CA  . LEU B 1 11  ? 5.385   -30.287 1.627  1.00 21.53 ? 13  LEU B CA  1 
ATOM   3052 C C   . LEU B 1 11  ? 5.250   -31.595 2.384  1.00 20.63 ? 13  LEU B C   1 
ATOM   3053 O O   . LEU B 1 11  ? 5.347   -32.682 1.817  1.00 19.92 ? 13  LEU B O   1 
ATOM   3054 C CB  . LEU B 1 11  ? 4.420   -30.229 0.400  1.00 21.28 ? 13  LEU B CB  1 
ATOM   3055 C CG  . LEU B 1 11  ? 4.364   -28.829 -0.290 1.00 21.26 ? 13  LEU B CG  1 
ATOM   3056 C CD1 . LEU B 1 11  ? 3.418   -28.770 -1.472 1.00 19.71 ? 13  LEU B CD1 1 
ATOM   3057 C CD2 . LEU B 1 11  ? 3.799   -27.870 0.703  1.00 20.85 ? 13  LEU B CD2 1 
ATOM   3058 N N   . ARG B 1 12  ? 4.997   -31.482 3.676  1.00 20.75 ? 14  ARG B N   1 
ATOM   3059 C CA  . ARG B 1 12  ? 4.847   -32.652 4.512  1.00 19.91 ? 14  ARG B CA  1 
ATOM   3060 C C   . ARG B 1 12  ? 3.403   -33.091 4.597  1.00 19.69 ? 14  ARG B C   1 
ATOM   3061 O O   . ARG B 1 12  ? 2.458   -32.295 4.438  1.00 20.67 ? 14  ARG B O   1 
ATOM   3062 C CB  . ARG B 1 12  ? 5.390   -32.312 5.918  1.00 19.26 ? 14  ARG B CB  1 
ATOM   3063 C CG  . ARG B 1 12  ? 6.861   -31.972 5.956  1.00 20.55 ? 14  ARG B CG  1 
ATOM   3064 C CD  . ARG B 1 12  ? 7.760   -32.984 5.231  1.00 19.64 ? 14  ARG B CD  1 
ATOM   3065 N NE  . ARG B 1 12  ? 9.121   -32.895 5.733  1.00 21.43 ? 14  ARG B NE  1 
ATOM   3066 C CZ  . ARG B 1 12  ? 10.183  -33.449 5.147  1.00 21.70 ? 14  ARG B CZ  1 
ATOM   3067 N NH1 . ARG B 1 12  ? 10.065  -34.137 3.999  1.00 20.89 ? 14  ARG B NH1 1 
ATOM   3068 N NH2 . ARG B 1 12  ? 11.356  -33.344 5.742  1.00 14.62 ? 14  ARG B NH2 1 
ATOM   3069 N N   . THR B 1 13  ? 3.242   -34.365 4.908  1.00 20.21 ? 15  THR B N   1 
ATOM   3070 C CA  . THR B 1 13  ? 2.029   -34.893 5.425  1.00 19.39 ? 15  THR B CA  1 
ATOM   3071 C C   . THR B 1 13  ? 2.203   -35.086 6.919  1.00 19.28 ? 15  THR B C   1 
ATOM   3072 O O   . THR B 1 13  ? 2.860   -36.032 7.356  1.00 21.07 ? 15  THR B O   1 
ATOM   3073 C CB  . THR B 1 13  ? 1.738   -36.263 4.757  1.00 19.91 ? 15  THR B CB  1 
ATOM   3074 O OG1 . THR B 1 13  ? 1.702   -36.075 3.336  1.00 20.68 ? 15  THR B OG1 1 
ATOM   3075 C CG2 . THR B 1 13  ? 0.394   -36.832 5.217  1.00 16.00 ? 15  THR B CG2 1 
ATOM   3076 N N   . ILE B 1 14  ? 1.593   -34.231 7.735  1.00 18.10 ? 16  ILE B N   1 
ATOM   3077 C CA  . ILE B 1 14  ? 1.962   -34.221 9.164  1.00 18.53 ? 16  ILE B CA  1 
ATOM   3078 C C   . ILE B 1 14  ? 0.928   -34.970 10.019 1.00 18.28 ? 16  ILE B C   1 
ATOM   3079 O O   . ILE B 1 14  ? -0.220  -34.511 10.162 1.00 18.54 ? 16  ILE B O   1 
ATOM   3080 C CB  . ILE B 1 14  ? 2.092   -32.789 9.726  1.00 18.57 ? 16  ILE B CB  1 
ATOM   3081 C CG1 . ILE B 1 14  ? 3.164   -31.982 8.950  1.00 16.26 ? 16  ILE B CG1 1 
ATOM   3082 C CG2 . ILE B 1 14  ? 2.417   -32.854 11.268 1.00 17.68 ? 16  ILE B CG2 1 
ATOM   3083 C CD1 . ILE B 1 14  ? 3.387   -30.614 9.600  1.00 15.55 ? 16  ILE B CD1 1 
ATOM   3084 N N   . MET B 1 15  ? 1.347   -36.080 10.607 1.00 19.03 ? 17  MET B N   1 
ATOM   3085 C CA  . MET B 1 15  ? 0.434   -36.918 11.385 1.00 19.20 ? 17  MET B CA  1 
ATOM   3086 C C   . MET B 1 15  ? 1.025   -37.172 12.770 1.00 20.33 ? 17  MET B C   1 
ATOM   3087 O O   . MET B 1 15  ? 0.887   -38.253 13.365 1.00 21.53 ? 17  MET B O   1 
ATOM   3088 C CB  . MET B 1 15  ? 0.104   -38.202 10.636 1.00 19.29 ? 17  MET B CB  1 
ATOM   3089 C CG  . MET B 1 15  ? -0.722  -38.008 9.351  1.00 21.66 ? 17  MET B CG  1 
ATOM   3090 S SD  . MET B 1 15  ? -2.324  -37.128 9.570  1.00 20.08 ? 17  MET B SD  1 
ATOM   3091 C CE  . MET B 1 15  ? -3.344  -38.576 9.858  1.00 16.20 ? 17  MET B CE  1 
ATOM   3092 N N   . THR B 1 16  ? 1.645   -36.148 13.300 1.00 21.30 ? 18  THR B N   1 
ATOM   3093 C CA  . THR B 1 16  ? 1.985   -36.116 14.694 1.00 22.26 ? 18  THR B CA  1 
ATOM   3094 C C   . THR B 1 16  ? 0.811   -35.524 15.519 1.00 22.66 ? 18  THR B C   1 
ATOM   3095 O O   . THR B 1 16  ? -0.158  -35.037 14.949 1.00 23.94 ? 18  THR B O   1 
ATOM   3096 C CB  . THR B 1 16  ? 3.107   -35.182 14.891 1.00 22.34 ? 18  THR B CB  1 
ATOM   3097 O OG1 . THR B 1 16  ? 2.654   -33.849 14.564 1.00 20.64 ? 18  THR B OG1 1 
ATOM   3098 C CG2 . THR B 1 16  ? 4.281   -35.577 14.006 1.00 20.79 ? 18  THR B CG2 1 
ATOM   3099 N N   . PRO B 1 17  ? 0.948   -35.530 16.845 1.00 21.97 ? 19  PRO B N   1 
ATOM   3100 C CA  . PRO B 1 17  ? 0.140   -34.770 17.773 1.00 20.68 ? 19  PRO B CA  1 
ATOM   3101 C C   . PRO B 1 17  ? 0.463   -33.274 17.851 1.00 20.45 ? 19  PRO B C   1 
ATOM   3102 O O   . PRO B 1 17  ? 0.019   -32.628 18.778 1.00 20.80 ? 19  PRO B O   1 
ATOM   3103 C CB  . PRO B 1 17  ? 0.455   -35.445 19.124 1.00 21.81 ? 19  PRO B CB  1 
ATOM   3104 C CG  . PRO B 1 17  ? 0.807   -36.897 18.740 1.00 21.52 ? 19  PRO B CG  1 
ATOM   3105 C CD  . PRO B 1 17  ? 1.701   -36.616 17.554 1.00 21.31 ? 19  PRO B CD  1 
ATOM   3106 N N   . GLY B 1 18  ? 1.188   -32.716 16.883 1.00 20.50 ? 20  GLY B N   1 
ATOM   3107 C CA  . GLY B 1 18  ? 1.353   -31.278 16.796 1.00 20.59 ? 20  GLY B CA  1 
ATOM   3108 C C   . GLY B 1 18  ? 2.828   -30.926 16.758 1.00 22.21 ? 20  GLY B C   1 
ATOM   3109 O O   . GLY B 1 18  ? 3.644   -31.663 17.337 1.00 20.15 ? 20  GLY B O   1 
ATOM   3110 N N   . PRO B 1 19  ? 3.169   -29.789 16.092 1.00 21.70 ? 21  PRO B N   1 
ATOM   3111 C CA  . PRO B 1 19  ? 2.209   -28.964 15.335 1.00 20.48 ? 21  PRO B CA  1 
ATOM   3112 C C   . PRO B 1 19  ? 1.739   -29.658 14.106 1.00 18.81 ? 21  PRO B C   1 
ATOM   3113 O O   . PRO B 1 19  ? 2.538   -30.308 13.408 1.00 18.75 ? 21  PRO B O   1 
ATOM   3114 C CB  . PRO B 1 19  ? 3.043   -27.744 14.860 1.00 21.04 ? 21  PRO B CB  1 
ATOM   3115 C CG  . PRO B 1 19  ? 4.469   -28.281 14.826 1.00 21.47 ? 21  PRO B CG  1 
ATOM   3116 C CD  . PRO B 1 19  ? 4.553   -29.312 15.966 1.00 20.95 ? 21  PRO B CD  1 
ATOM   3117 N N   . VAL B 1 20  ? 0.497   -29.409 13.751 1.00 17.09 ? 22  VAL B N   1 
ATOM   3118 C CA  . VAL B 1 20  ? -0.115  -30.129 12.650 1.00 18.69 ? 22  VAL B CA  1 
ATOM   3119 C C   . VAL B 1 20  ? -0.284  -29.271 11.363 1.00 19.35 ? 22  VAL B C   1 
ATOM   3120 O O   . VAL B 1 20  ? 0.032   -28.081 11.385 1.00 19.85 ? 22  VAL B O   1 
ATOM   3121 C CB  . VAL B 1 20  ? -1.412  -30.646 13.357 1.00 19.25 ? 22  VAL B CB  1 
ATOM   3122 C CG1 . VAL B 1 20  ? -2.700  -30.097 12.912 1.00 18.06 ? 22  VAL B CG1 1 
ATOM   3123 C CG2 . VAL B 1 20  ? -1.309  -32.026 13.847 1.00 20.69 ? 22  VAL B CG2 1 
ATOM   3124 N N   . GLU B 1 21  ? -0.805  -29.798 10.237 1.00 19.25 ? 23  GLU B N   1 
ATOM   3125 C CA  . GLU B 1 21  ? -0.994  -28.881 9.087  1.00 18.59 ? 23  GLU B CA  1 
ATOM   3126 C C   . GLU B 1 21  ? -2.028  -27.759 9.362  1.00 20.02 ? 23  GLU B C   1 
ATOM   3127 O O   . GLU B 1 21  ? -2.927  -27.956 10.168 1.00 21.01 ? 23  GLU B O   1 
ATOM   3128 C CB  . GLU B 1 21  ? -1.350  -29.620 7.836  1.00 17.57 ? 23  GLU B CB  1 
ATOM   3129 C CG  . GLU B 1 21  ? -0.457  -30.860 7.574  1.00 17.09 ? 23  GLU B CG  1 
ATOM   3130 C CD  . GLU B 1 21  ? -1.058  -31.735 6.560  1.00 21.29 ? 23  GLU B CD  1 
ATOM   3131 O OE1 . GLU B 1 21  ? -1.975  -31.229 5.833  1.00 23.95 ? 23  GLU B OE1 1 
ATOM   3132 O OE2 . GLU B 1 21  ? -0.613  -32.906 6.424  1.00 17.89 ? 23  GLU B OE2 1 
ATOM   3133 N N   . VAL B 1 22  ? -1.890  -26.608 8.666  1.00 19.23 ? 24  VAL B N   1 
ATOM   3134 C CA  . VAL B 1 22  ? -2.760  -25.433 8.851  1.00 19.35 ? 24  VAL B CA  1 
ATOM   3135 C C   . VAL B 1 22  ? -3.665  -25.426 7.626  1.00 20.51 ? 24  VAL B C   1 
ATOM   3136 O O   . VAL B 1 22  ? -3.184  -25.629 6.475  1.00 19.41 ? 24  VAL B O   1 
ATOM   3137 C CB  . VAL B 1 22  ? -1.864  -24.180 8.959  1.00 20.11 ? 24  VAL B CB  1 
ATOM   3138 C CG1 . VAL B 1 22  ? -2.659  -22.849 8.953  1.00 21.94 ? 24  VAL B CG1 1 
ATOM   3139 C CG2 . VAL B 1 22  ? -1.032  -24.281 10.272 1.00 19.06 ? 24  VAL B CG2 1 
ATOM   3140 N N   . ASP B 1 23  ? -4.970  -25.231 7.834  1.00 19.99 ? 25  ASP B N   1 
ATOM   3141 C CA  . ASP B 1 23  ? -5.867  -25.060 6.673  1.00 22.41 ? 25  ASP B CA  1 
ATOM   3142 C C   . ASP B 1 23  ? -5.343  -23.965 5.720  1.00 22.80 ? 25  ASP B C   1 
ATOM   3143 O O   . ASP B 1 23  ? -5.001  -22.884 6.201  1.00 23.34 ? 25  ASP B O   1 
ATOM   3144 C CB  . ASP B 1 23  ? -7.266  -24.620 7.176  1.00 21.86 ? 25  ASP B CB  1 
ATOM   3145 C CG  . ASP B 1 23  ? -8.333  -24.753 6.102  1.00 22.24 ? 25  ASP B CG  1 
ATOM   3146 O OD1 . ASP B 1 23  ? -8.247  -24.058 5.098  1.00 24.90 ? 25  ASP B OD1 1 
ATOM   3147 O OD2 . ASP B 1 23  ? -9.265  -25.603 6.229  1.00 23.61 ? 25  ASP B OD2 1 
ATOM   3148 N N   . PRO B 1 24  ? -5.353  -24.211 4.383  1.00 23.13 ? 26  PRO B N   1 
ATOM   3149 C CA  . PRO B 1 24  ? -4.971  -23.221 3.397  1.00 24.21 ? 26  PRO B CA  1 
ATOM   3150 C C   . PRO B 1 24  ? -5.646  -21.885 3.598  1.00 24.37 ? 26  PRO B C   1 
ATOM   3151 O O   . PRO B 1 24  ? -5.051  -20.861 3.277  1.00 24.33 ? 26  PRO B O   1 
ATOM   3152 C CB  . PRO B 1 24  ? -5.421  -23.876 2.088  1.00 23.15 ? 26  PRO B CB  1 
ATOM   3153 C CG  . PRO B 1 24  ? -5.037  -25.262 2.369  1.00 25.32 ? 26  PRO B CG  1 
ATOM   3154 C CD  . PRO B 1 24  ? -5.615  -25.494 3.710  1.00 23.41 ? 26  PRO B CD  1 
ATOM   3155 N N   . ARG B 1 25  ? -6.882  -21.891 4.096  1.00 25.18 ? 27  ARG B N   1 
ATOM   3156 C CA  . ARG B 1 25  ? -7.559  -20.592 4.347  1.00 25.71 ? 27  ARG B CA  1 
ATOM   3157 C C   . ARG B 1 25  ? -6.912  -19.760 5.484  1.00 24.06 ? 27  ARG B C   1 
ATOM   3158 O O   . ARG B 1 25  ? -6.954  -18.526 5.457  1.00 27.17 ? 27  ARG B O   1 
ATOM   3159 C CB  . ARG B 1 25  ? -9.018  -20.761 4.617  1.00 25.55 ? 27  ARG B CB  1 
ATOM   3160 C CG  . ARG B 1 25  ? -9.824  -21.272 3.444  1.00 26.75 ? 27  ARG B CG  1 
ATOM   3161 C CD  . ARG B 1 25  ? -10.295 -22.629 3.926  1.00 34.75 ? 27  ARG B CD  1 
ATOM   3162 N NE  . ARG B 1 25  ? -11.656 -22.509 4.234  1.00 32.74 ? 27  ARG B NE  1 
ATOM   3163 C CZ  . ARG B 1 25  ? -12.440 -23.370 4.869  1.00 34.61 ? 27  ARG B CZ  1 
ATOM   3164 N NH1 . ARG B 1 25  ? -12.044 -24.528 5.466  1.00 30.47 ? 27  ARG B NH1 1 
ATOM   3165 N NH2 . ARG B 1 25  ? -13.688 -22.974 4.946  1.00 28.75 ? 27  ARG B NH2 1 
ATOM   3166 N N   . VAL B 1 26  ? -6.337  -20.423 6.466  1.00 21.51 ? 28  VAL B N   1 
ATOM   3167 C CA  . VAL B 1 26  ? -5.525  -19.754 7.502  1.00 19.73 ? 28  VAL B CA  1 
ATOM   3168 C C   . VAL B 1 26  ? -4.155  -19.359 6.922  1.00 20.60 ? 28  VAL B C   1 
ATOM   3169 O O   . VAL B 1 26  ? -3.724  -18.217 7.121  1.00 19.82 ? 28  VAL B O   1 
ATOM   3170 C CB  . VAL B 1 26  ? -5.337  -20.636 8.779  1.00 19.39 ? 28  VAL B CB  1 
ATOM   3171 C CG1 . VAL B 1 26  ? -4.451  -19.964 9.728  1.00 17.50 ? 28  VAL B CG1 1 
ATOM   3172 C CG2 . VAL B 1 26  ? -6.725  -20.951 9.516  1.00 18.61 ? 28  VAL B CG2 1 
ATOM   3173 N N   . LEU B 1 27  ? -3.464  -20.281 6.212  1.00 19.76 ? 29  LEU B N   1 
ATOM   3174 C CA  . LEU B 1 27  ? -2.200  -19.909 5.594  1.00 19.73 ? 29  LEU B CA  1 
ATOM   3175 C C   . LEU B 1 27  ? -2.279  -18.619 4.751  1.00 21.29 ? 29  LEU B C   1 
ATOM   3176 O O   . LEU B 1 27  ? -1.412  -17.758 4.900  1.00 21.03 ? 29  LEU B O   1 
ATOM   3177 C CB  . LEU B 1 27  ? -1.589  -21.036 4.760  1.00 19.61 ? 29  LEU B CB  1 
ATOM   3178 C CG  . LEU B 1 27  ? -1.198  -22.259 5.561  1.00 19.08 ? 29  LEU B CG  1 
ATOM   3179 C CD1 . LEU B 1 27  ? -0.815  -23.412 4.657  1.00 14.95 ? 29  LEU B CD1 1 
ATOM   3180 C CD2 . LEU B 1 27  ? -0.053  -21.881 6.532  1.00 16.60 ? 29  LEU B CD2 1 
ATOM   3181 N N   . ARG B 1 28  ? -3.301  -18.475 3.897  1.00 23.04 ? 30  ARG B N   1 
ATOM   3182 C CA  . ARG B 1 28  ? -3.338  -17.391 2.885  1.00 23.68 ? 30  ARG B CA  1 
ATOM   3183 C C   . ARG B 1 28  ? -3.530  -16.038 3.540  1.00 21.83 ? 30  ARG B C   1 
ATOM   3184 O O   . ARG B 1 28  ? -2.960  -15.058 3.071  1.00 24.38 ? 30  ARG B O   1 
ATOM   3185 C CB  . ARG B 1 28  ? -4.423  -17.633 1.808  1.00 24.22 ? 30  ARG B CB  1 
ATOM   3186 C CG  . ARG B 1 28  ? -5.887  -17.373 2.359  1.00 29.14 ? 30  ARG B CG  1 
ATOM   3187 C CD  . ARG B 1 28  ? -7.088  -17.401 1.322  1.00 32.25 ? 30  ARG B CD  1 
ATOM   3188 N NE  . ARG B 1 28  ? -7.243  -18.727 0.823  1.00 31.32 ? 30  ARG B NE  1 
ATOM   3189 C CZ  . ARG B 1 28  ? -8.385  -19.367 0.532  1.00 31.50 ? 30  ARG B CZ  1 
ATOM   3190 N NH1 . ARG B 1 28  ? -9.625  -18.847 0.653  1.00 23.73 ? 30  ARG B NH1 1 
ATOM   3191 N NH2 . ARG B 1 28  ? -8.243  -20.617 0.152  1.00 27.34 ? 30  ARG B NH2 1 
ATOM   3192 N N   . VAL B 1 29  ? -4.232  -15.988 4.660  1.00 20.62 ? 31  VAL B N   1 
ATOM   3193 C CA  . VAL B 1 29  ? -4.498  -14.741 5.434  1.00 22.70 ? 31  VAL B CA  1 
ATOM   3194 C C   . VAL B 1 29  ? -3.240  -14.175 6.057  1.00 22.05 ? 31  VAL B C   1 
ATOM   3195 O O   . VAL B 1 29  ? -3.189  -13.003 6.383  1.00 23.59 ? 31  VAL B O   1 
ATOM   3196 C CB  . VAL B 1 29  ? -5.572  -14.928 6.562  1.00 21.24 ? 31  VAL B CB  1 
ATOM   3197 C CG1 . VAL B 1 29  ? -4.957  -15.515 7.896  1.00 23.22 ? 31  VAL B CG1 1 
ATOM   3198 C CG2 . VAL B 1 29  ? -6.205  -13.602 6.896  1.00 26.96 ? 31  VAL B CG2 1 
ATOM   3199 N N   . MET B 1 30  ? -2.170  -14.978 6.112  1.00 21.82 ? 32  MET B N   1 
ATOM   3200 C CA  . MET B 1 30  ? -0.964  -14.529 6.886  1.00 20.57 ? 32  MET B CA  1 
ATOM   3201 C C   . MET B 1 30  ? -0.051  -13.673 6.026  1.00 20.89 ? 32  MET B C   1 
ATOM   3202 O O   . MET B 1 30  ? 0.853   -13.005 6.529  1.00 20.92 ? 32  MET B O   1 
ATOM   3203 C CB  . MET B 1 30  ? -0.240  -15.716 7.508  1.00 20.71 ? 32  MET B CB  1 
ATOM   3204 C CG  . MET B 1 30  ? -1.014  -16.279 8.702  1.00 20.08 ? 32  MET B CG  1 
ATOM   3205 S SD  . MET B 1 30  ? -0.005  -17.352 9.710  1.00 24.75 ? 32  MET B SD  1 
ATOM   3206 C CE  . MET B 1 30  ? 0.050   -18.774 8.615  1.00 20.63 ? 32  MET B CE  1 
ATOM   3207 N N   . SER B 1 31  ? -0.426  -13.542 4.751  1.00 20.29 ? 33  SER B N   1 
ATOM   3208 C CA  . SER B 1 31  ? 0.256   -12.660 3.804  1.00 21.69 ? 33  SER B CA  1 
ATOM   3209 C C   . SER B 1 31  ? -0.462  -11.266 3.823  1.00 21.32 ? 33  SER B C   1 
ATOM   3210 O O   . SER B 1 31  ? -0.078  -10.338 3.121  1.00 21.65 ? 33  SER B O   1 
ATOM   3211 C CB  . SER B 1 31  ? 0.217   -13.336 2.420  1.00 21.86 ? 33  SER B CB  1 
ATOM   3212 O OG  . SER B 1 31  ? -1.011  -13.108 1.756  1.00 25.00 ? 33  SER B OG  1 
ATOM   3213 N N   . THR B 1 32  ? -1.486  -11.113 4.655  1.00 20.53 ? 34  THR B N   1 
ATOM   3214 C CA  . THR B 1 32  ? -2.158  -9.794  4.765  1.00 19.87 ? 34  THR B CA  1 
ATOM   3215 C C   . THR B 1 32  ? -1.292  -8.759  5.451  1.00 19.40 ? 34  THR B C   1 
ATOM   3216 O O   . THR B 1 32  ? -0.699  -9.040  6.485  1.00 19.40 ? 34  THR B O   1 
ATOM   3217 C CB  . THR B 1 32  ? -3.461  -9.877  5.569  1.00 21.31 ? 34  THR B CB  1 
ATOM   3218 O OG1 . THR B 1 32  ? -4.288  -10.915 5.069  1.00 20.85 ? 34  THR B OG1 1 
ATOM   3219 C CG2 . THR B 1 32  ? -4.268  -8.525  5.497  1.00 20.03 ? 34  THR B CG2 1 
ATOM   3220 N N   . PRO B 1 33  ? -1.191  -7.533  4.864  1.00 20.10 ? 35  PRO B N   1 
ATOM   3221 C CA  . PRO B 1 33  ? -0.354  -6.473  5.524  1.00 19.01 ? 35  PRO B CA  1 
ATOM   3222 C C   . PRO B 1 33  ? -0.868  -6.130  6.915  1.00 20.21 ? 35  PRO B C   1 
ATOM   3223 O O   . PRO B 1 33  ? -2.113  -6.070  7.129  1.00 20.98 ? 35  PRO B O   1 
ATOM   3224 C CB  . PRO B 1 33  ? -0.480  -5.271  4.583  1.00 17.50 ? 35  PRO B CB  1 
ATOM   3225 C CG  . PRO B 1 33  ? -0.705  -6.006  3.077  1.00 19.63 ? 35  PRO B CG  1 
ATOM   3226 C CD  . PRO B 1 33  ? -1.457  -7.283  3.409  1.00 18.72 ? 35  PRO B CD  1 
ATOM   3227 N N   . VAL B 1 34  ? 0.054   -5.855  7.842  1.00 20.32 ? 36  VAL B N   1 
ATOM   3228 C CA  . VAL B 1 34  ? -0.286  -5.689  9.253  1.00 20.97 ? 36  VAL B CA  1 
ATOM   3229 C C   . VAL B 1 34  ? -0.951  -4.347  9.503  1.00 21.52 ? 36  VAL B C   1 
ATOM   3230 O O   . VAL B 1 34  ? -0.735  -3.380  8.759  1.00 20.81 ? 36  VAL B O   1 
ATOM   3231 C CB  . VAL B 1 34  ? 0.954   -5.804  10.145 1.00 22.59 ? 36  VAL B CB  1 
ATOM   3232 C CG1 . VAL B 1 34  ? 1.581   -7.270  10.033 1.00 24.38 ? 36  VAL B CG1 1 
ATOM   3233 C CG2 . VAL B 1 34  ? 1.992   -4.809  9.736  1.00 22.32 ? 36  VAL B CG2 1 
ATOM   3234 N N   . VAL B 1 35  ? -1.755  -4.311  10.557 1.00 21.66 ? 37  VAL B N   1 
ATOM   3235 C CA  . VAL B 1 35  ? -2.191  -3.056  11.165 1.00 22.09 ? 37  VAL B CA  1 
ATOM   3236 C C   . VAL B 1 35  ? -1.668  -2.966  12.642 1.00 23.42 ? 37  VAL B C   1 
ATOM   3237 O O   . VAL B 1 35  ? -1.378  -3.989  13.246 1.00 24.78 ? 37  VAL B O   1 
ATOM   3238 C CB  . VAL B 1 35  ? -3.780  -2.937  11.118 1.00 20.86 ? 37  VAL B CB  1 
ATOM   3239 C CG1 . VAL B 1 35  ? -4.287  -2.914  9.762  1.00 17.87 ? 37  VAL B CG1 1 
ATOM   3240 C CG2 . VAL B 1 35  ? -4.433  -4.047  11.867 1.00 18.16 ? 37  VAL B CG2 1 
ATOM   3241 N N   . GLY B 1 36  ? -1.603  -1.779  13.235 1.00 25.03 ? 38  GLY B N   1 
ATOM   3242 C CA  . GLY B 1 36  ? -0.999  -1.665  14.606 1.00 25.43 ? 38  GLY B CA  1 
ATOM   3243 C C   . GLY B 1 36  ? -1.940  -2.067  15.704 1.00 26.05 ? 38  GLY B C   1 
ATOM   3244 O O   . GLY B 1 36  ? -3.134  -2.275  15.410 1.00 24.09 ? 38  GLY B O   1 
ATOM   3245 N N   . GLN B 1 37  ? -1.440  -2.197  16.959 1.00 26.96 ? 39  GLN B N   1 
ATOM   3246 C CA  . GLN B 1 37  ? -2.281  -2.704  18.123 1.00 27.80 ? 39  GLN B CA  1 
ATOM   3247 C C   . GLN B 1 37  ? -3.376  -1.720  18.400 1.00 26.65 ? 39  GLN B C   1 
ATOM   3248 O O   . GLN B 1 37  ? -4.398  -2.073  18.889 1.00 27.79 ? 39  GLN B O   1 
ATOM   3249 C CB  . GLN B 1 37  ? -1.469  -2.890  19.487 1.00 29.22 ? 39  GLN B CB  1 
ATOM   3250 C CG  . GLN B 1 37  ? -0.197  -2.055  19.524 1.00 31.40 ? 39  GLN B CG  1 
ATOM   3251 C CD  . GLN B 1 37  ? 0.511   -1.840  20.895 1.00 35.40 ? 39  GLN B CD  1 
ATOM   3252 O OE1 . GLN B 1 37  ? 0.343   -2.566  21.908 1.00 31.90 ? 39  GLN B OE1 1 
ATOM   3253 N NE2 . GLN B 1 37  ? 1.349   -0.812  20.894 1.00 33.59 ? 39  GLN B NE2 1 
ATOM   3254 N N   . PHE B 1 38  ? -3.166  -0.458  18.135 1.00 26.15 ? 40  PHE B N   1 
ATOM   3255 C CA  . PHE B 1 38  ? -4.174  0.480   18.549 1.00 28.30 ? 40  PHE B CA  1 
ATOM   3256 C C   . PHE B 1 38  ? -5.074  0.922   17.395 1.00 27.21 ? 40  PHE B C   1 
ATOM   3257 O O   . PHE B 1 38  ? -5.947  1.760   17.565 1.00 28.54 ? 40  PHE B O   1 
ATOM   3258 C CB  . PHE B 1 38  ? -3.505  1.714   19.162 1.00 30.08 ? 40  PHE B CB  1 
ATOM   3259 C CG  . PHE B 1 38  ? -2.593  1.403   20.349 1.00 35.85 ? 40  PHE B CG  1 
ATOM   3260 C CD1 . PHE B 1 38  ? -1.276  1.901   20.381 1.00 39.26 ? 40  PHE B CD1 1 
ATOM   3261 C CD2 . PHE B 1 38  ? -3.042  0.597   21.403 1.00 40.21 ? 40  PHE B CD2 1 
ATOM   3262 C CE1 . PHE B 1 38  ? -0.444  1.643   21.448 1.00 41.14 ? 40  PHE B CE1 1 
ATOM   3263 C CE2 . PHE B 1 38  ? -2.216  0.302   22.489 1.00 42.17 ? 40  PHE B CE2 1 
ATOM   3264 C CZ  . PHE B 1 38  ? -0.914  0.847   22.517 1.00 44.52 ? 40  PHE B CZ  1 
ATOM   3265 N N   . ASP B 1 39  ? -4.835  0.397   16.220 1.00 24.61 ? 41  ASP B N   1 
ATOM   3266 C CA  . ASP B 1 39  ? -5.664  0.720   15.051 1.00 23.21 ? 41  ASP B CA  1 
ATOM   3267 C C   . ASP B 1 39  ? -7.062  0.115   15.306 1.00 23.29 ? 41  ASP B C   1 
ATOM   3268 O O   . ASP B 1 39  ? -7.148  -1.033  15.737 1.00 22.42 ? 41  ASP B O   1 
ATOM   3269 C CB  . ASP B 1 39  ? -4.986  0.046   13.838 1.00 21.67 ? 41  ASP B CB  1 
ATOM   3270 C CG  . ASP B 1 39  ? -5.593  0.453   12.511 1.00 23.04 ? 41  ASP B CG  1 
ATOM   3271 O OD1 . ASP B 1 39  ? -6.838  0.451   12.375 1.00 18.07 ? 41  ASP B OD1 1 
ATOM   3272 O OD2 . ASP B 1 39  ? -4.806  0.798   11.605 1.00 19.05 ? 41  ASP B OD2 1 
ATOM   3273 N N   . PRO B 1 40  ? -8.154  0.875   15.045 1.00 23.86 ? 42  PRO B N   1 
ATOM   3274 C CA  . PRO B 1 40  ? -9.535  0.371   15.211 1.00 24.06 ? 42  PRO B CA  1 
ATOM   3275 C C   . PRO B 1 40  ? -9.788  -0.909  14.466 1.00 22.71 ? 42  PRO B C   1 
ATOM   3276 O O   . PRO B 1 40  ? -10.492 -1.796  14.967 1.00 21.69 ? 42  PRO B O   1 
ATOM   3277 C CB  . PRO B 1 40  ? -10.423 1.509   14.619 1.00 24.80 ? 42  PRO B CB  1 
ATOM   3278 C CG  . PRO B 1 40  ? -9.598  2.706   14.733 1.00 25.32 ? 42  PRO B CG  1 
ATOM   3279 C CD  . PRO B 1 40  ? -8.145  2.255   14.546 1.00 24.21 ? 42  PRO B CD  1 
ATOM   3280 N N   . ALA B 1 41  ? -9.150  -1.092  13.316 1.00 22.01 ? 43  ALA B N   1 
ATOM   3281 C CA  . ALA B 1 41  ? -9.292  -2.411  12.679 1.00 22.48 ? 43  ALA B CA  1 
ATOM   3282 C C   . ALA B 1 41  ? -8.798  -3.528  13.574 1.00 21.73 ? 43  ALA B C   1 
ATOM   3283 O O   . ALA B 1 41  ? -9.368  -4.656  13.587 1.00 22.40 ? 43  ALA B O   1 
ATOM   3284 C CB  . ALA B 1 41  ? -8.599  -2.450  11.311 1.00 22.05 ? 43  ALA B CB  1 
ATOM   3285 N N   . PHE B 1 42  ? -7.743  -3.248  14.341 1.00 21.20 ? 44  PHE B N   1 
ATOM   3286 C CA  . PHE B 1 42  ? -7.151  -4.291  15.152 1.00 21.92 ? 44  PHE B CA  1 
ATOM   3287 C C   . PHE B 1 42  ? -8.014  -4.560  16.335 1.00 21.91 ? 44  PHE B C   1 
ATOM   3288 O O   . PHE B 1 42  ? -8.201  -5.705  16.698 1.00 22.26 ? 44  PHE B O   1 
ATOM   3289 C CB  . PHE B 1 42  ? -5.735  -3.944  15.640 1.00 22.85 ? 44  PHE B CB  1 
ATOM   3290 C CG  . PHE B 1 42  ? -4.877  -5.181  15.904 1.00 27.53 ? 44  PHE B CG  1 
ATOM   3291 C CD1 . PHE B 1 42  ? -4.600  -6.073  14.870 1.00 31.61 ? 44  PHE B CD1 1 
ATOM   3292 C CD2 . PHE B 1 42  ? -4.436  -5.471  17.173 1.00 26.96 ? 44  PHE B CD2 1 
ATOM   3293 C CE1 . PHE B 1 42  ? -3.847  -7.229  15.110 1.00 34.37 ? 44  PHE B CE1 1 
ATOM   3294 C CE2 . PHE B 1 42  ? -3.630  -6.551  17.416 1.00 28.20 ? 44  PHE B CE2 1 
ATOM   3295 C CZ  . PHE B 1 42  ? -3.364  -7.454  16.424 1.00 34.01 ? 44  PHE B CZ  1 
ATOM   3296 N N   . THR B 1 43  ? -8.506  -3.502  16.966 1.00 22.19 ? 45  THR B N   1 
ATOM   3297 C CA  . THR B 1 43  ? -9.393  -3.647  18.157 1.00 21.97 ? 45  THR B CA  1 
ATOM   3298 C C   . THR B 1 43  ? -10.692 -4.415  17.748 1.00 20.01 ? 45  THR B C   1 
ATOM   3299 O O   . THR B 1 43  ? -11.153 -5.250  18.478 1.00 20.59 ? 45  THR B O   1 
ATOM   3300 C CB  . THR B 1 43  ? -9.668  -2.280  18.875 1.00 20.68 ? 45  THR B CB  1 
ATOM   3301 O OG1 . THR B 1 43  ? -9.948  -1.326  17.912 1.00 26.94 ? 45  THR B OG1 1 
ATOM   3302 C CG2 . THR B 1 43  ? -8.425  -1.667  19.543 1.00 26.30 ? 45  THR B CG2 1 
ATOM   3303 N N   . GLY B 1 44  ? -11.203 -4.220  16.546 1.00 20.77 ? 46  GLY B N   1 
ATOM   3304 C CA  . GLY B 1 44  ? -12.372 -4.995  16.063 1.00 20.76 ? 46  GLY B CA  1 
ATOM   3305 C C   . GLY B 1 44  ? -12.026 -6.481  15.911 1.00 21.53 ? 46  GLY B C   1 
ATOM   3306 O O   . GLY B 1 44  ? -12.792 -7.378  16.303 1.00 21.39 ? 46  GLY B O   1 
ATOM   3307 N N   . ILE B 1 45  ? -10.845 -6.765  15.384 1.00 21.97 ? 47  ILE B N   1 
ATOM   3308 C CA  . ILE B 1 45  ? -10.401 -8.154  15.303 1.00 22.41 ? 47  ILE B CA  1 
ATOM   3309 C C   . ILE B 1 45  ? -10.307 -8.769  16.687 1.00 22.58 ? 47  ILE B C   1 
ATOM   3310 O O   . ILE B 1 45  ? -10.784 -9.902  16.898 1.00 22.91 ? 47  ILE B O   1 
ATOM   3311 C CB  . ILE B 1 45  ? -9.071  -8.298  14.518 1.00 22.21 ? 47  ILE B CB  1 
ATOM   3312 C CG1 . ILE B 1 45  ? -9.300  -7.922  13.040 1.00 25.01 ? 47  ILE B CG1 1 
ATOM   3313 C CG2 . ILE B 1 45  ? -8.494  -9.738  14.694 1.00 21.21 ? 47  ILE B CG2 1 
ATOM   3314 C CD1 . ILE B 1 45  ? -7.962  -7.485  12.230 1.00 24.50 ? 47  ILE B CD1 1 
ATOM   3315 N N   . MET B 1 46  ? -9.739  -8.019  17.638 1.00 22.10 ? 48  MET B N   1 
ATOM   3316 C CA  . MET B 1 46  ? -9.563  -8.491  19.030 1.00 23.32 ? 48  MET B CA  1 
ATOM   3317 C C   . MET B 1 46  ? -10.914 -8.849  19.645 1.00 24.71 ? 48  MET B C   1 
ATOM   3318 O O   . MET B 1 46  ? -11.085 -9.924  20.289 1.00 23.59 ? 48  MET B O   1 
ATOM   3319 C CB  . MET B 1 46  ? -8.875  -7.442  19.936 1.00 21.52 ? 48  MET B CB  1 
ATOM   3320 C CG  . MET B 1 46  ? -7.313  -7.250  19.617 1.00 28.69 ? 48  MET B CG  1 
ATOM   3321 S SD  . MET B 1 46  ? -6.394  -5.852  20.486 1.00 39.54 ? 48  MET B SD  1 
ATOM   3322 C CE  . MET B 1 46  ? -6.356  -6.479  22.185 1.00 35.43 ? 48  MET B CE  1 
ATOM   3323 N N   . ASN B 1 47  ? -11.846 -7.907  19.506 1.00 23.91 ? 49  ASN B N   1 
ATOM   3324 C CA  . ASN B 1 47  ? -13.149 -8.108  20.064 1.00 25.08 ? 49  ASN B CA  1 
ATOM   3325 C C   . ASN B 1 47  ? -13.865 -9.344  19.518 1.00 24.93 ? 49  ASN B C   1 
ATOM   3326 O O   . ASN B 1 47  ? -14.489 -10.065 20.299 1.00 23.54 ? 49  ASN B O   1 
ATOM   3327 C CB  . ASN B 1 47  ? -14.001 -6.850  19.906 1.00 24.98 ? 49  ASN B CB  1 
ATOM   3328 C CG  . ASN B 1 47  ? -13.484 -5.695  20.778 1.00 27.49 ? 49  ASN B CG  1 
ATOM   3329 O OD1 . ASN B 1 47  ? -12.679 -5.891  21.716 1.00 27.66 ? 49  ASN B OD1 1 
ATOM   3330 N ND2 . ASN B 1 47  ? -13.923 -4.495  20.455 1.00 27.43 ? 49  ASN B ND2 1 
ATOM   3331 N N   . GLU B 1 48  ? -13.785 -9.571  18.205 1.00 23.39 ? 50  GLU B N   1 
ATOM   3332 C CA  . GLU B 1 48  ? -14.460 -10.711 17.587 1.00 24.73 ? 50  GLU B CA  1 
ATOM   3333 C C   . GLU B 1 48  ? -13.800 -12.051 17.968 1.00 23.21 ? 50  GLU B C   1 
ATOM   3334 O O   . GLU B 1 48  ? -14.485 -13.100 18.234 1.00 23.69 ? 50  GLU B O   1 
ATOM   3335 C CB  . GLU B 1 48  ? -14.452 -10.552 16.036 1.00 24.63 ? 50  GLU B CB  1 
ATOM   3336 C CG  . GLU B 1 48  ? -15.436 -11.488 15.405 1.00 30.67 ? 50  GLU B CG  1 
ATOM   3337 C CD  . GLU B 1 48  ? -15.729 -11.118 13.983 1.00 38.49 ? 50  GLU B CD  1 
ATOM   3338 O OE1 . GLU B 1 48  ? -15.028 -10.176 13.436 1.00 39.80 ? 50  GLU B OE1 1 
ATOM   3339 O OE2 . GLU B 1 48  ? -16.655 -11.775 13.439 1.00 36.65 ? 50  GLU B OE2 1 
ATOM   3340 N N   . THR B 1 49  ? -12.482 -12.016 18.001 1.00 21.22 ? 51  THR B N   1 
ATOM   3341 C CA  . THR B 1 49  ? -11.722 -13.124 18.466 1.00 22.56 ? 51  THR B CA  1 
ATOM   3342 C C   . THR B 1 49  ? -12.155 -13.514 19.929 1.00 23.45 ? 51  THR B C   1 
ATOM   3343 O O   . THR B 1 49  ? -12.380 -14.698 20.203 1.00 23.61 ? 51  THR B O   1 
ATOM   3344 C CB  . THR B 1 49  ? -10.221 -12.940 18.344 1.00 22.47 ? 51  THR B CB  1 
ATOM   3345 O OG1 . THR B 1 49  ? -9.890  -12.580 16.992 1.00 23.27 ? 51  THR B OG1 1 
ATOM   3346 C CG2 . THR B 1 49  ? -9.506  -14.257 18.681 1.00 23.37 ? 51  THR B CG2 1 
ATOM   3347 N N   . MET B 1 50  ? -12.325 -12.548 20.819 1.00 23.09 ? 52  MET B N   1 
ATOM   3348 C CA  . MET B 1 50  ? -12.818 -12.891 22.192 1.00 23.88 ? 52  MET B CA  1 
ATOM   3349 C C   . MET B 1 50  ? -14.213 -13.586 22.172 1.00 22.94 ? 52  MET B C   1 
ATOM   3350 O O   . MET B 1 50  ? -14.387 -14.578 22.911 1.00 24.22 ? 52  MET B O   1 
ATOM   3351 C CB  . MET B 1 50  ? -12.851 -11.689 23.150 1.00 22.74 ? 52  MET B CB  1 
ATOM   3352 C CG  . MET B 1 50  ? -11.437 -11.069 23.416 1.00 25.17 ? 52  MET B CG  1 
ATOM   3353 S SD  . MET B 1 50  ? -11.508 -9.674  24.536 1.00 24.36 ? 52  MET B SD  1 
ATOM   3354 C CE  . MET B 1 50  ? -11.512 -10.466 26.202 1.00 28.59 ? 52  MET B CE  1 
ATOM   3355 N N   . GLU B 1 51  ? -15.166 -13.083 21.372 1.00 23.12 ? 53  GLU B N   1 
ATOM   3356 C CA  . GLU B 1 51  ? -16.491 -13.737 21.212 1.00 24.10 ? 53  GLU B CA  1 
ATOM   3357 C C   . GLU B 1 51  ? -16.389 -15.179 20.672 1.00 22.55 ? 53  GLU B C   1 
ATOM   3358 O O   . GLU B 1 51  ? -17.134 -16.066 21.070 1.00 21.83 ? 53  GLU B O   1 
ATOM   3359 C CB  . GLU B 1 51  ? -17.408 -13.017 20.224 1.00 25.06 ? 53  GLU B CB  1 
ATOM   3360 C CG  . GLU B 1 51  ? -17.698 -11.566 20.417 1.00 33.61 ? 53  GLU B CG  1 
ATOM   3361 C CD  . GLU B 1 51  ? -18.667 -11.075 19.335 1.00 43.27 ? 53  GLU B CD  1 
ATOM   3362 O OE1 . GLU B 1 51  ? -18.483 -11.412 18.126 1.00 43.08 ? 53  GLU B OE1 1 
ATOM   3363 O OE2 . GLU B 1 51  ? -19.640 -10.383 19.712 1.00 47.67 ? 53  GLU B OE2 1 
ATOM   3364 N N   . MET B 1 52  ? -15.530 -15.377 19.692 1.00 21.74 ? 54  MET B N   1 
ATOM   3365 C CA  . MET B 1 52  ? -15.366 -16.694 19.115 1.00 21.25 ? 54  MET B CA  1 
ATOM   3366 C C   . MET B 1 52  ? -14.724 -17.650 20.127 1.00 21.02 ? 54  MET B C   1 
ATOM   3367 O O   . MET B 1 52  ? -15.073 -18.853 20.180 1.00 20.24 ? 54  MET B O   1 
ATOM   3368 C CB  . MET B 1 52  ? -14.613 -16.609 17.774 1.00 21.13 ? 54  MET B CB  1 
ATOM   3369 C CG  . MET B 1 52  ? -15.470 -15.935 16.612 1.00 23.68 ? 54  MET B CG  1 
ATOM   3370 S SD  . MET B 1 52  ? -14.628 -16.331 15.055 1.00 28.07 ? 54  MET B SD  1 
ATOM   3371 C CE  . MET B 1 52  ? -13.148 -15.347 15.292 1.00 23.68 ? 54  MET B CE  1 
ATOM   3372 N N   . LEU B 1 53  ? -13.814 -17.124 20.945 1.00 20.08 ? 55  LEU B N   1 
ATOM   3373 C CA  . LEU B 1 53  ? -13.172 -17.956 21.985 1.00 20.60 ? 55  LEU B CA  1 
ATOM   3374 C C   . LEU B 1 53  ? -14.165 -18.411 23.098 1.00 21.22 ? 55  LEU B C   1 
ATOM   3375 O O   . LEU B 1 53  ? -14.067 -19.537 23.601 1.00 21.01 ? 55  LEU B O   1 
ATOM   3376 C CB  . LEU B 1 53  ? -11.910 -17.278 22.561 1.00 18.80 ? 55  LEU B CB  1 
ATOM   3377 C CG  . LEU B 1 53  ? -10.753 -17.156 21.572 1.00 19.22 ? 55  LEU B CG  1 
ATOM   3378 C CD1 . LEU B 1 53  ? -9.639  -16.418 22.276 1.00 13.57 ? 55  LEU B CD1 1 
ATOM   3379 C CD2 . LEU B 1 53  ? -10.280 -18.582 21.123 1.00 20.37 ? 55  LEU B CD2 1 
ATOM   3380 N N   . ARG B 1 54  ? -15.155 -17.567 23.400 1.00 21.58 ? 56  ARG B N   1 
ATOM   3381 C CA  . ARG B 1 54  ? -16.255 -17.944 24.322 1.00 22.25 ? 56  ARG B CA  1 
ATOM   3382 C C   . ARG B 1 54  ? -17.063 -19.098 23.752 1.00 22.87 ? 56  ARG B C   1 
ATOM   3383 O O   . ARG B 1 54  ? -17.347 -20.013 24.499 1.00 22.66 ? 56  ARG B O   1 
ATOM   3384 C CB  . ARG B 1 54  ? -17.197 -16.782 24.630 1.00 22.74 ? 56  ARG B CB  1 
ATOM   3385 C CG  . ARG B 1 54  ? -16.538 -15.705 25.497 1.00 23.89 ? 56  ARG B CG  1 
ATOM   3386 C CD  . ARG B 1 54  ? -17.345 -14.397 25.542 1.00 25.61 ? 56  ARG B CD  1 
ATOM   3387 N NE  . ARG B 1 54  ? -16.533 -13.351 26.152 1.00 28.32 ? 56  ARG B NE  1 
ATOM   3388 C CZ  . ARG B 1 54  ? -16.267 -12.156 25.618 1.00 31.06 ? 56  ARG B CZ  1 
ATOM   3389 N NH1 . ARG B 1 54  ? -16.730 -11.799 24.410 1.00 29.62 ? 56  ARG B NH1 1 
ATOM   3390 N NH2 . ARG B 1 54  ? -15.513 -11.306 26.302 1.00 28.06 ? 56  ARG B NH2 1 
ATOM   3391 N N   . GLU B 1 55  ? -17.412 -19.088 22.445 1.00 22.08 ? 57  GLU B N   1 
ATOM   3392 C CA  . GLU B 1 55  ? -18.128 -20.246 21.883 1.00 23.17 ? 57  GLU B CA  1 
ATOM   3393 C C   . GLU B 1 55  ? -17.219 -21.463 21.836 1.00 21.39 ? 57  GLU B C   1 
ATOM   3394 O O   . GLU B 1 55  ? -17.652 -22.616 22.035 1.00 21.09 ? 57  GLU B O   1 
ATOM   3395 C CB  . GLU B 1 55  ? -18.556 -20.023 20.443 1.00 22.77 ? 57  GLU B CB  1 
ATOM   3396 C CG  . GLU B 1 55  ? -19.289 -18.865 20.228 1.00 26.57 ? 57  GLU B CG  1 
ATOM   3397 C CD  . GLU B 1 55  ? -20.063 -18.977 18.946 1.00 34.42 ? 57  GLU B CD  1 
ATOM   3398 O OE1 . GLU B 1 55  ? -20.352 -17.907 18.406 1.00 35.91 ? 57  GLU B OE1 1 
ATOM   3399 O OE2 . GLU B 1 55  ? -20.394 -20.113 18.483 1.00 35.27 ? 57  GLU B OE2 1 
ATOM   3400 N N   . LEU B 1 56  ? -15.966 -21.212 21.506 1.00 20.38 ? 58  LEU B N   1 
ATOM   3401 C CA  . LEU B 1 56  ? -15.000 -22.302 21.321 1.00 18.58 ? 58  LEU B CA  1 
ATOM   3402 C C   . LEU B 1 56  ? -14.841 -23.061 22.649 1.00 17.92 ? 58  LEU B C   1 
ATOM   3403 O O   . LEU B 1 56  ? -14.888 -24.314 22.667 1.00 19.13 ? 58  LEU B O   1 
ATOM   3404 C CB  . LEU B 1 56  ? -13.666 -21.745 20.834 1.00 18.41 ? 58  LEU B CB  1 
ATOM   3405 C CG  . LEU B 1 56  ? -12.533 -22.790 20.793 1.00 20.21 ? 58  LEU B CG  1 
ATOM   3406 C CD1 . LEU B 1 56  ? -12.824 -23.867 19.828 1.00 21.74 ? 58  LEU B CD1 1 
ATOM   3407 C CD2 . LEU B 1 56  ? -11.166 -22.159 20.424 1.00 22.70 ? 58  LEU B CD2 1 
ATOM   3408 N N   . PHE B 1 57  ? -14.688 -22.334 23.753 1.00 18.65 ? 59  PHE B N   1 
ATOM   3409 C CA  . PHE B 1 57  ? -14.526 -22.940 25.090 1.00 19.06 ? 59  PHE B CA  1 
ATOM   3410 C C   . PHE B 1 57  ? -15.866 -23.325 25.724 1.00 19.96 ? 59  PHE B C   1 
ATOM   3411 O O   . PHE B 1 57  ? -15.894 -23.822 26.858 1.00 19.14 ? 59  PHE B O   1 
ATOM   3412 C CB  . PHE B 1 57  ? -13.779 -22.033 26.048 1.00 20.15 ? 59  PHE B CB  1 
ATOM   3413 C CG  . PHE B 1 57  ? -12.249 -21.982 25.837 1.00 22.91 ? 59  PHE B CG  1 
ATOM   3414 C CD1 . PHE B 1 57  ? -11.431 -23.062 26.189 1.00 20.63 ? 59  PHE B CD1 1 
ATOM   3415 C CD2 . PHE B 1 57  ? -11.649 -20.835 25.362 1.00 23.72 ? 59  PHE B CD2 1 
ATOM   3416 C CE1 . PHE B 1 57  ? -10.017 -22.992 26.037 1.00 25.76 ? 59  PHE B CE1 1 
ATOM   3417 C CE2 . PHE B 1 57  ? -10.253 -20.745 25.229 1.00 21.99 ? 59  PHE B CE2 1 
ATOM   3418 C CZ  . PHE B 1 57  ? -9.446  -21.832 25.557 1.00 23.15 ? 59  PHE B CZ  1 
ATOM   3419 N N   . GLN B 1 58  ? -16.970 -23.055 25.023 1.00 20.16 ? 60  GLN B N   1 
ATOM   3420 C CA  . GLN B 1 58  ? -18.329 -23.306 25.559 1.00 21.42 ? 60  GLN B CA  1 
ATOM   3421 C C   . GLN B 1 58  ? -18.521 -22.669 26.918 1.00 22.67 ? 60  GLN B C   1 
ATOM   3422 O O   . GLN B 1 58  ? -18.869 -23.332 27.979 1.00 21.94 ? 60  GLN B O   1 
ATOM   3423 C CB  . GLN B 1 58  ? -18.663 -24.780 25.542 1.00 21.12 ? 60  GLN B CB  1 
ATOM   3424 C CG  . GLN B 1 58  ? -18.710 -25.342 24.088 1.00 21.90 ? 60  GLN B CG  1 
ATOM   3425 C CD  . GLN B 1 58  ? -19.125 -26.799 24.020 1.00 22.27 ? 60  GLN B CD  1 
ATOM   3426 O OE1 . GLN B 1 58  ? -20.247 -27.163 24.379 1.00 26.91 ? 60  GLN B OE1 1 
ATOM   3427 N NE2 . GLN B 1 58  ? -18.261 -27.620 23.468 1.00 22.39 ? 60  GLN B NE2 1 
ATOM   3428 N N   . THR B 1 59  ? -18.323 -21.343 26.898 1.00 22.76 ? 61  THR B N   1 
ATOM   3429 C CA  . THR B 1 59  ? -18.392 -20.583 28.129 1.00 23.38 ? 61  THR B CA  1 
ATOM   3430 C C   . THR B 1 59  ? -19.039 -19.229 27.928 1.00 25.68 ? 61  THR B C   1 
ATOM   3431 O O   . THR B 1 59  ? -19.049 -18.682 26.798 1.00 25.88 ? 61  THR B O   1 
ATOM   3432 C CB  . THR B 1 59  ? -17.001 -20.372 28.757 1.00 23.64 ? 61  THR B CB  1 
ATOM   3433 O OG1 . THR B 1 59  ? -17.141 -19.697 30.015 1.00 19.90 ? 61  THR B OG1 1 
ATOM   3434 C CG2 . THR B 1 59  ? -16.107 -19.536 27.827 1.00 22.54 ? 61  THR B CG2 1 
ATOM   3435 N N   . LYS B 1 60  ? -19.566 -18.694 29.038 1.00 25.80 ? 62  LYS B N   1 
ATOM   3436 C CA  . LYS B 1 60  ? -20.018 -17.308 29.107 1.00 27.07 ? 62  LYS B CA  1 
ATOM   3437 C C   . LYS B 1 60  ? -18.942 -16.361 29.692 1.00 25.99 ? 62  LYS B C   1 
ATOM   3438 O O   . LYS B 1 60  ? -19.193 -15.165 29.827 1.00 24.83 ? 62  LYS B O   1 
ATOM   3439 C CB  . LYS B 1 60  ? -21.307 -17.205 29.994 1.00 28.37 ? 62  LYS B CB  1 
ATOM   3440 C CG  . LYS B 1 60  ? -22.528 -18.074 29.548 1.00 30.67 ? 62  LYS B CG  1 
ATOM   3441 C CD  . LYS B 1 60  ? -22.902 -17.823 28.090 1.00 35.69 ? 62  LYS B CD  1 
ATOM   3442 C CE  . LYS B 1 60  ? -23.500 -19.111 27.455 1.00 37.64 ? 62  LYS B CE  1 
ATOM   3443 N NZ  . LYS B 1 60  ? -23.589 -19.081 25.960 1.00 38.89 ? 62  LYS B NZ  1 
ATOM   3444 N N   . ASN B 1 61  ? -17.799 -16.890 30.132 1.00 25.94 ? 63  ASN B N   1 
ATOM   3445 C CA  . ASN B 1 61  ? -16.754 -16.033 30.768 1.00 26.92 ? 63  ASN B CA  1 
ATOM   3446 C C   . ASN B 1 61  ? -16.538 -14.719 30.010 1.00 28.45 ? 63  ASN B C   1 
ATOM   3447 O O   . ASN B 1 61  ? -16.381 -14.720 28.757 1.00 28.17 ? 63  ASN B O   1 
ATOM   3448 C CB  . ASN B 1 61  ? -15.386 -16.741 30.810 1.00 26.02 ? 63  ASN B CB  1 
ATOM   3449 C CG  . ASN B 1 61  ? -15.347 -17.860 31.802 1.00 24.73 ? 63  ASN B CG  1 
ATOM   3450 O OD1 . ASN B 1 61  ? -16.215 -17.955 32.661 1.00 21.71 ? 63  ASN B OD1 1 
ATOM   3451 N ND2 . ASN B 1 61  ? -14.361 -18.728 31.680 1.00 21.73 ? 63  ASN B ND2 1 
ATOM   3452 N N   . ARG B 1 62  ? -16.494 -13.629 30.752 1.00 29.58 ? 64  ARG B N   1 
ATOM   3453 C CA  . ARG B 1 62  ? -16.034 -12.356 30.211 1.00 32.46 ? 64  ARG B CA  1 
ATOM   3454 C C   . ARG B 1 62  ? -14.608 -12.441 29.715 1.00 33.01 ? 64  ARG B C   1 
ATOM   3455 O O   . ARG B 1 62  ? -14.253 -11.745 28.758 1.00 34.56 ? 64  ARG B O   1 
ATOM   3456 C CB  . ARG B 1 62  ? -16.204 -11.192 31.240 1.00 33.37 ? 64  ARG B CB  1 
ATOM   3457 C CG  . ARG B 1 62  ? -15.826 -9.761  30.695 1.00 38.77 ? 64  ARG B CG  1 
ATOM   3458 C CD  . ARG B 1 62  ? -15.577 -8.662  31.800 1.00 44.80 ? 64  ARG B CD  1 
ATOM   3459 N NE  . ARG B 1 62  ? -14.698 -7.581  31.303 1.00 50.87 ? 64  ARG B NE  1 
ATOM   3460 C CZ  . ARG B 1 62  ? -14.440 -6.427  31.941 1.00 51.40 ? 64  ARG B CZ  1 
ATOM   3461 N NH1 . ARG B 1 62  ? -14.995 -6.158  33.114 1.00 49.79 ? 64  ARG B NH1 1 
ATOM   3462 N NH2 . ARG B 1 62  ? -13.636 -5.520  31.383 1.00 51.74 ? 64  ARG B NH2 1 
ATOM   3463 N N   . TRP B 1 63  ? -13.798 -13.329 30.295 1.00 31.76 ? 65  TRP B N   1 
ATOM   3464 C CA  . TRP B 1 63  ? -12.378 -13.368 29.977 1.00 31.50 ? 65  TRP B CA  1 
ATOM   3465 C C   . TRP B 1 63  ? -12.050 -14.580 29.080 1.00 31.11 ? 65  TRP B C   1 
ATOM   3466 O O   . TRP B 1 63  ? -12.015 -15.705 29.560 1.00 32.18 ? 65  TRP B O   1 
ATOM   3467 C CB  . TRP B 1 63  ? -11.516 -13.293 31.272 1.00 31.70 ? 65  TRP B CB  1 
ATOM   3468 C CG  . TRP B 1 63  ? -11.841 -12.033 32.141 1.00 33.05 ? 65  TRP B CG  1 
ATOM   3469 C CD1 . TRP B 1 63  ? -11.263 -10.784 32.022 1.00 33.93 ? 65  TRP B CD1 1 
ATOM   3470 C CD2 . TRP B 1 63  ? -12.847 -11.906 33.195 1.00 36.73 ? 65  TRP B CD2 1 
ATOM   3471 N NE1 . TRP B 1 63  ? -11.820 -9.910  32.934 1.00 33.57 ? 65  TRP B NE1 1 
ATOM   3472 C CE2 . TRP B 1 63  ? -12.794 -10.561 33.663 1.00 37.31 ? 65  TRP B CE2 1 
ATOM   3473 C CE3 . TRP B 1 63  ? -13.810 -12.797 33.770 1.00 41.26 ? 65  TRP B CE3 1 
ATOM   3474 C CZ2 . TRP B 1 63  ? -13.660 -10.070 34.706 1.00 40.29 ? 65  TRP B CZ2 1 
ATOM   3475 C CZ3 . TRP B 1 63  ? -14.676 -12.317 34.830 1.00 39.28 ? 65  TRP B CZ3 1 
ATOM   3476 C CH2 . TRP B 1 63  ? -14.591 -10.951 35.263 1.00 42.74 ? 65  TRP B CH2 1 
ATOM   3477 N N   . ALA B 1 64  ? -11.886 -14.322 27.766 1.00 29.14 ? 66  ALA B N   1 
ATOM   3478 C CA  . ALA B 1 64  ? -11.498 -15.294 26.796 1.00 26.95 ? 66  ALA B CA  1 
ATOM   3479 C C   . ALA B 1 64  ? -10.585 -14.562 25.815 1.00 27.49 ? 66  ALA B C   1 
ATOM   3480 O O   . ALA B 1 64  ? -11.020 -13.708 25.072 1.00 26.45 ? 66  ALA B O   1 
ATOM   3481 C CB  . ALA B 1 64  ? -12.734 -15.914 26.116 1.00 25.56 ? 66  ALA B CB  1 
ATOM   3482 N N   . TYR B 1 65  ? -9.295  -14.883 25.836 1.00 27.78 ? 67  TYR B N   1 
ATOM   3483 C CA  . TYR B 1 65  ? -8.332  -14.115 25.020 1.00 28.24 ? 67  TYR B CA  1 
ATOM   3484 C C   . TYR B 1 65  ? -7.012  -14.810 24.851 1.00 28.82 ? 67  TYR B C   1 
ATOM   3485 O O   . TYR B 1 65  ? -6.677  -15.707 25.654 1.00 28.40 ? 67  TYR B O   1 
ATOM   3486 C CB  . TYR B 1 65  ? -8.116  -12.669 25.581 1.00 28.41 ? 67  TYR B CB  1 
ATOM   3487 C CG  . TYR B 1 65  ? -7.570  -12.572 27.004 1.00 29.47 ? 67  TYR B CG  1 
ATOM   3488 C CD1 . TYR B 1 65  ? -8.429  -12.360 28.088 1.00 32.09 ? 67  TYR B CD1 1 
ATOM   3489 C CD2 . TYR B 1 65  ? -6.193  -12.639 27.252 1.00 33.57 ? 67  TYR B CD2 1 
ATOM   3490 C CE1 . TYR B 1 65  ? -7.940  -12.261 29.400 1.00 32.71 ? 67  TYR B CE1 1 
ATOM   3491 C CE2 . TYR B 1 65  ? -5.677  -12.552 28.542 1.00 30.19 ? 67  TYR B CE2 1 
ATOM   3492 C CZ  . TYR B 1 65  ? -6.550  -12.348 29.608 1.00 34.24 ? 67  TYR B CZ  1 
ATOM   3493 O OH  . TYR B 1 65  ? -6.020  -12.238 30.884 1.00 33.09 ? 67  TYR B OH  1 
ATOM   3494 N N   . PRO B 1 66  ? -6.248  -14.414 23.798 1.00 28.13 ? 68  PRO B N   1 
ATOM   3495 C CA  . PRO B 1 66  ? -5.003  -15.128 23.555 1.00 29.26 ? 68  PRO B CA  1 
ATOM   3496 C C   . PRO B 1 66  ? -3.817  -14.536 24.314 1.00 30.36 ? 68  PRO B C   1 
ATOM   3497 O O   . PRO B 1 66  ? -3.743  -13.329 24.522 1.00 30.08 ? 68  PRO B O   1 
ATOM   3498 C CB  . PRO B 1 66  ? -4.746  -14.944 22.029 1.00 27.49 ? 68  PRO B CB  1 
ATOM   3499 C CG  . PRO B 1 66  ? -5.620  -13.719 21.625 1.00 27.14 ? 68  PRO B CG  1 
ATOM   3500 C CD  . PRO B 1 66  ? -6.777  -13.705 22.614 1.00 28.79 ? 68  PRO B CD  1 
ATOM   3501 N N   . ILE B 1 67  ? -2.868  -15.384 24.685 1.00 32.55 ? 69  ILE B N   1 
ATOM   3502 C CA  . ILE B 1 67  ? -1.602  -14.821 25.100 1.00 34.50 ? 69  ILE B CA  1 
ATOM   3503 C C   . ILE B 1 67  ? -0.426  -15.193 24.146 1.00 34.03 ? 69  ILE B C   1 
ATOM   3504 O O   . ILE B 1 67  ? -0.402  -16.267 23.482 1.00 33.88 ? 69  ILE B O   1 
ATOM   3505 C CB  . ILE B 1 67  ? -1.296  -14.969 26.650 1.00 36.23 ? 69  ILE B CB  1 
ATOM   3506 C CG1 . ILE B 1 67  ? -0.602  -16.297 26.940 1.00 38.97 ? 69  ILE B CG1 1 
ATOM   3507 C CG2 . ILE B 1 67  ? -2.491  -14.677 27.576 1.00 33.75 ? 69  ILE B CG2 1 
ATOM   3508 C CD1 . ILE B 1 67  ? 0.945   -16.105 26.943 1.00 34.76 ? 69  ILE B CD1 1 
ATOM   3509 N N   . ASP B 1 68  ? 0.557   -14.296 24.076 1.00 33.61 ? 70  ASP B N   1 
ATOM   3510 C CA  . ASP B 1 68  ? 1.534   -14.407 23.013 1.00 32.37 ? 70  ASP B CA  1 
ATOM   3511 C C   . ASP B 1 68  ? 2.702   -15.293 23.463 1.00 32.55 ? 70  ASP B C   1 
ATOM   3512 O O   . ASP B 1 68  ? 3.785   -14.822 23.844 1.00 35.39 ? 70  ASP B O   1 
ATOM   3513 C CB  . ASP B 1 68  ? 1.955   -12.999 22.535 1.00 32.33 ? 70  ASP B CB  1 
ATOM   3514 C CG  . ASP B 1 68  ? 0.810   -12.233 21.850 1.00 33.68 ? 70  ASP B CG  1 
ATOM   3515 O OD1 . ASP B 1 68  ? 1.010   -11.066 21.448 1.00 27.83 ? 70  ASP B OD1 1 
ATOM   3516 O OD2 . ASP B 1 68  ? -0.299  -12.819 21.700 1.00 35.01 ? 70  ASP B OD2 1 
ATOM   3517 N N   . GLY B 1 69  ? 2.512   -16.583 23.474 1.00 31.93 ? 71  GLY B N   1 
ATOM   3518 C CA  . GLY B 1 69  ? 3.668   -17.475 23.604 1.00 30.18 ? 71  GLY B CA  1 
ATOM   3519 C C   . GLY B 1 69  ? 3.108   -18.764 23.148 1.00 28.86 ? 71  GLY B C   1 
ATOM   3520 O O   . GLY B 1 69  ? 1.959   -18.796 22.719 1.00 28.32 ? 71  GLY B O   1 
ATOM   3521 N N   . THR B 1 70  ? 3.858   -19.841 23.313 1.00 29.87 ? 72  THR B N   1 
ATOM   3522 C CA  . THR B 1 70  ? 3.306   -21.163 23.047 1.00 30.21 ? 72  THR B CA  1 
ATOM   3523 C C   . THR B 1 70  ? 2.264   -21.504 24.132 1.00 29.28 ? 72  THR B C   1 
ATOM   3524 O O   . THR B 1 70  ? 2.015   -20.716 25.075 1.00 30.10 ? 72  THR B O   1 
ATOM   3525 C CB  . THR B 1 70  ? 4.425   -22.259 22.779 1.00 31.36 ? 72  THR B CB  1 
ATOM   3526 O OG1 . THR B 1 70  ? 5.035   -22.688 23.992 1.00 32.59 ? 72  THR B OG1 1 
ATOM   3527 C CG2 . THR B 1 70  ? 5.564   -21.668 21.890 1.00 32.12 ? 72  THR B CG2 1 
ATOM   3528 N N   . SER B 1 71  ? 1.581   -22.606 23.903 1.00 27.65 ? 73  SER B N   1 
ATOM   3529 C CA  . SER B 1 71  ? 0.681   -23.226 24.826 1.00 27.42 ? 73  SER B CA  1 
ATOM   3530 C C   . SER B 1 71  ? 1.196   -23.126 26.265 1.00 27.40 ? 73  SER B C   1 
ATOM   3531 O O   . SER B 1 71  ? 0.439   -22.669 27.121 1.00 25.98 ? 73  SER B O   1 
ATOM   3532 C CB  . SER B 1 71  ? 0.574   -24.674 24.420 1.00 27.48 ? 73  SER B CB  1 
ATOM   3533 O OG  . SER B 1 71  ? 0.302   -24.758 23.022 1.00 29.24 ? 73  SER B OG  1 
ATOM   3534 N N   . ARG B 1 72  ? 2.460   -23.524 26.514 1.00 26.48 ? 74  ARG B N   1 
ATOM   3535 C CA  . ARG B 1 72  ? 3.063   -23.566 27.875 1.00 27.17 ? 74  ARG B CA  1 
ATOM   3536 C C   . ARG B 1 72  ? 3.139   -22.185 28.536 1.00 25.85 ? 74  ARG B C   1 
ATOM   3537 O O   . ARG B 1 72  ? 3.092   -22.114 29.762 1.00 24.87 ? 74  ARG B O   1 
ATOM   3538 C CB  . ARG B 1 72  ? 4.544   -23.969 27.810 1.00 29.02 ? 74  ARG B CB  1 
ATOM   3539 C CG  . ARG B 1 72  ? 4.739   -25.413 27.659 1.00 32.80 ? 74  ARG B CG  1 
ATOM   3540 C CD  . ARG B 1 72  ? 6.157   -25.650 27.281 1.00 35.23 ? 74  ARG B CD  1 
ATOM   3541 N NE  . ARG B 1 72  ? 6.048   -26.592 26.188 1.00 38.14 ? 74  ARG B NE  1 
ATOM   3542 C CZ  . ARG B 1 72  ? 6.382   -27.883 26.232 1.00 38.79 ? 74  ARG B CZ  1 
ATOM   3543 N NH1 . ARG B 1 72  ? 6.874   -28.424 27.336 1.00 35.05 ? 74  ARG B NH1 1 
ATOM   3544 N NH2 . ARG B 1 72  ? 6.214   -28.626 25.139 1.00 41.18 ? 74  ARG B NH2 1 
ATOM   3545 N N   . ALA B 1 73  ? 3.372   -21.133 27.730 1.00 25.01 ? 75  ALA B N   1 
ATOM   3546 C CA  . ALA B 1 73  ? 3.430   -19.756 28.257 1.00 25.02 ? 75  ALA B CA  1 
ATOM   3547 C C   . ALA B 1 73  ? 2.058   -19.361 28.772 1.00 27.25 ? 75  ALA B C   1 
ATOM   3548 O O   . ALA B 1 73  ? 1.961   -18.624 29.764 1.00 28.63 ? 75  ALA B O   1 
ATOM   3549 C CB  . ALA B 1 73  ? 3.923   -18.768 27.195 1.00 24.73 ? 75  ALA B CB  1 
ATOM   3550 N N   . GLY B 1 74  ? 1.005   -19.861 28.100 1.00 25.95 ? 76  GLY B N   1 
ATOM   3551 C CA  . GLY B 1 74  ? -0.357  -19.631 28.484 1.00 26.87 ? 76  GLY B CA  1 
ATOM   3552 C C   . GLY B 1 74  ? -0.653  -20.295 29.825 1.00 26.75 ? 76  GLY B C   1 
ATOM   3553 O O   . GLY B 1 74  ? -1.193  -19.668 30.704 1.00 25.19 ? 76  GLY B O   1 
ATOM   3554 N N   . ILE B 1 75  ? -0.288  -21.571 29.957 1.00 27.05 ? 77  ILE B N   1 
ATOM   3555 C CA  . ILE B 1 75  ? -0.415  -22.326 31.181 1.00 27.04 ? 77  ILE B CA  1 
ATOM   3556 C C   . ILE B 1 75  ? 0.356   -21.638 32.329 1.00 27.72 ? 77  ILE B C   1 
ATOM   3557 O O   . ILE B 1 75  ? -0.197  -21.466 33.436 1.00 27.00 ? 77  ILE B O   1 
ATOM   3558 C CB  . ILE B 1 75  ? 0.100   -23.742 30.977 1.00 27.72 ? 77  ILE B CB  1 
ATOM   3559 C CG1 . ILE B 1 75  ? -0.638  -24.457 29.826 1.00 29.10 ? 77  ILE B CG1 1 
ATOM   3560 C CG2 . ILE B 1 75  ? 0.092   -24.462 32.274 1.00 26.46 ? 77  ILE B CG2 1 
ATOM   3561 C CD1 . ILE B 1 75  ? -0.208  -25.987 29.612 1.00 27.43 ? 77  ILE B CD1 1 
ATOM   3562 N N   . GLU B 1 76  ? 1.587   -21.186 32.030 1.00 26.90 ? 78  GLU B N   1 
ATOM   3563 C CA  . GLU B 1 76  ? 2.421   -20.515 32.986 1.00 26.79 ? 78  GLU B CA  1 
ATOM   3564 C C   . GLU B 1 76  ? 1.798   -19.192 33.434 1.00 27.48 ? 78  GLU B C   1 
ATOM   3565 O O   . GLU B 1 76  ? 1.780   -18.901 34.629 1.00 26.99 ? 78  GLU B O   1 
ATOM   3566 C CB  . GLU B 1 76  ? 3.841   -20.304 32.463 1.00 26.35 ? 78  GLU B CB  1 
ATOM   3567 C CG  . GLU B 1 76  ? 4.745   -19.609 33.540 1.00 26.74 ? 78  GLU B CG  1 
ATOM   3568 C CD  . GLU B 1 76  ? 6.204   -19.889 33.376 1.00 29.17 ? 78  GLU B CD  1 
ATOM   3569 O OE1 . GLU B 1 76  ? 6.991   -19.169 34.018 1.00 35.88 ? 78  GLU B OE1 1 
ATOM   3570 O OE2 . GLU B 1 76  ? 6.581   -20.811 32.613 1.00 30.37 ? 78  GLU B OE2 1 
ATOM   3571 N N   . ALA B 1 77  ? 1.336   -18.394 32.466 1.00 27.91 ? 79  ALA B N   1 
ATOM   3572 C CA  . ALA B 1 77  ? 0.653   -17.150 32.716 1.00 28.10 ? 79  ALA B CA  1 
ATOM   3573 C C   . ALA B 1 77  ? -0.549  -17.312 33.686 1.00 28.32 ? 79  ALA B C   1 
ATOM   3574 O O   . ALA B 1 77  ? -0.671  -16.533 34.635 1.00 27.84 ? 79  ALA B O   1 
ATOM   3575 C CB  . ALA B 1 77  ? 0.201   -16.540 31.422 1.00 28.52 ? 79  ALA B CB  1 
ATOM   3576 N N   . VAL B 1 78  ? -1.409  -18.315 33.479 1.00 28.02 ? 80  VAL B N   1 
ATOM   3577 C CA  . VAL B 1 78  ? -2.524  -18.545 34.424 1.00 27.94 ? 80  VAL B CA  1 
ATOM   3578 C C   . VAL B 1 78  ? -1.988  -18.952 35.794 1.00 28.57 ? 80  VAL B C   1 
ATOM   3579 O O   . VAL B 1 78  ? -2.303  -18.343 36.800 1.00 28.83 ? 80  VAL B O   1 
ATOM   3580 C CB  . VAL B 1 78  ? -3.527  -19.604 33.875 1.00 27.70 ? 80  VAL B CB  1 
ATOM   3581 C CG1 . VAL B 1 78  ? -4.633  -19.984 34.907 1.00 27.84 ? 80  VAL B CG1 1 
ATOM   3582 C CG2 . VAL B 1 78  ? -4.174  -19.098 32.589 1.00 27.37 ? 80  VAL B CG2 1 
ATOM   3583 N N   . LEU B 1 79  ? -1.163  -19.988 35.843 1.00 29.61 ? 81  LEU B N   1 
ATOM   3584 C CA  . LEU B 1 79  ? -0.716  -20.494 37.124 1.00 28.97 ? 81  LEU B CA  1 
ATOM   3585 C C   . LEU B 1 79  ? 0.042   -19.417 37.904 1.00 29.99 ? 81  LEU B C   1 
ATOM   3586 O O   . LEU B 1 79  ? -0.128  -19.289 39.117 1.00 30.97 ? 81  LEU B O   1 
ATOM   3587 C CB  . LEU B 1 79  ? 0.143   -21.727 36.943 1.00 27.93 ? 81  LEU B CB  1 
ATOM   3588 C CG  . LEU B 1 79  ? -0.595  -22.963 36.488 1.00 28.21 ? 81  LEU B CG  1 
ATOM   3589 C CD1 . LEU B 1 79  ? 0.374   -24.003 36.042 1.00 28.20 ? 81  LEU B CD1 1 
ATOM   3590 C CD2 . LEU B 1 79  ? -1.448  -23.506 37.668 1.00 27.07 ? 81  LEU B CD2 1 
ATOM   3591 N N   . ALA B 1 80  ? 0.874   -18.649 37.211 1.00 30.68 ? 82  ALA B N   1 
ATOM   3592 C CA  . ALA B 1 80  ? 1.652   -17.564 37.827 1.00 30.80 ? 82  ALA B CA  1 
ATOM   3593 C C   . ALA B 1 80  ? 0.773   -16.506 38.442 1.00 31.00 ? 82  ALA B C   1 
ATOM   3594 O O   . ALA B 1 80  ? 1.130   -15.898 39.449 1.00 31.63 ? 82  ALA B O   1 
ATOM   3595 C CB  . ALA B 1 80  ? 2.624   -16.901 36.788 1.00 30.73 ? 82  ALA B CB  1 
ATOM   3596 N N   . SER B 1 81  ? -0.367  -16.273 37.829 1.00 30.36 ? 83  SER B N   1 
ATOM   3597 C CA  . SER B 1 81  ? -1.240  -15.199 38.250 1.00 30.99 ? 83  SER B CA  1 
ATOM   3598 C C   . SER B 1 81  ? -2.113  -15.622 39.444 1.00 30.76 ? 83  SER B C   1 
ATOM   3599 O O   . SER B 1 81  ? -2.542  -14.759 40.213 1.00 31.00 ? 83  SER B O   1 
ATOM   3600 C CB  . SER B 1 81  ? -2.109  -14.720 37.063 1.00 31.64 ? 83  SER B CB  1 
ATOM   3601 O OG  . SER B 1 81  ? -3.200  -15.660 36.912 1.00 34.63 ? 83  SER B OG  1 
ATOM   3602 N N   . VAL B 1 82  ? -2.327  -16.932 39.634 1.00 29.53 ? 84  VAL B N   1 
ATOM   3603 C CA  . VAL B 1 82  ? -3.079  -17.444 40.816 1.00 29.74 ? 84  VAL B CA  1 
ATOM   3604 C C   . VAL B 1 82  ? -2.253  -18.153 41.926 1.00 29.80 ? 84  VAL B C   1 
ATOM   3605 O O   . VAL B 1 82  ? -2.755  -18.413 43.019 1.00 30.56 ? 84  VAL B O   1 
ATOM   3606 C CB  . VAL B 1 82  ? -4.313  -18.332 40.390 1.00 29.51 ? 84  VAL B CB  1 
ATOM   3607 C CG1 . VAL B 1 82  ? -5.251  -17.541 39.494 1.00 28.90 ? 84  VAL B CG1 1 
ATOM   3608 C CG2 . VAL B 1 82  ? -3.886  -19.579 39.679 1.00 27.63 ? 84  VAL B CG2 1 
ATOM   3609 N N   . ILE B 1 83  ? -0.986  -18.462 41.667 1.00 29.75 ? 85  ILE B N   1 
ATOM   3610 C CA  . ILE B 1 83  ? -0.130  -18.990 42.730 1.00 29.44 ? 85  ILE B CA  1 
ATOM   3611 C C   . ILE B 1 83  ? 0.724   -17.971 43.490 1.00 30.48 ? 85  ILE B C   1 
ATOM   3612 O O   . ILE B 1 83  ? 1.437   -17.106 42.906 1.00 31.11 ? 85  ILE B O   1 
ATOM   3613 C CB  . ILE B 1 83  ? 0.775   -20.170 42.251 1.00 29.53 ? 85  ILE B CB  1 
ATOM   3614 C CG1 . ILE B 1 83  ? -0.078  -21.371 41.797 1.00 28.65 ? 85  ILE B CG1 1 
ATOM   3615 C CG2 . ILE B 1 83  ? 1.755   -20.559 43.376 1.00 26.36 ? 85  ILE B CG2 1 
ATOM   3616 C CD1 . ILE B 1 83  ? 0.711   -22.408 40.969 1.00 29.13 ? 85  ILE B CD1 1 
ATOM   3617 N N   . GLU B 1 84  ? 0.658   -18.074 44.803 1.00 30.66 ? 86  GLU B N   1 
ATOM   3618 C CA  . GLU B 1 84  ? 1.559   -17.322 45.702 1.00 31.47 ? 86  GLU B CA  1 
ATOM   3619 C C   . GLU B 1 84  ? 2.418   -18.295 46.482 1.00 30.49 ? 86  GLU B C   1 
ATOM   3620 O O   . GLU B 1 84  ? 2.001   -19.419 46.706 1.00 29.73 ? 86  GLU B O   1 
ATOM   3621 C CB  . GLU B 1 84  ? 0.752   -16.472 46.664 1.00 31.37 ? 86  GLU B CB  1 
ATOM   3622 C CG  . GLU B 1 84  ? 0.078   -15.337 45.944 1.00 36.29 ? 86  GLU B CG  1 
ATOM   3623 C CD  . GLU B 1 84  ? -0.501  -14.339 46.910 1.00 41.77 ? 86  GLU B CD  1 
ATOM   3624 O OE1 . GLU B 1 84  ? -0.003  -13.182 46.912 1.00 43.88 ? 86  GLU B OE1 1 
ATOM   3625 O OE2 . GLU B 1 84  ? -1.429  -14.729 47.669 1.00 40.56 ? 86  GLU B OE2 1 
ATOM   3626 N N   . PRO B 1 85  ? 3.613   -17.869 46.903 1.00 30.93 ? 87  PRO B N   1 
ATOM   3627 C CA  . PRO B 1 85  ? 4.410   -18.815 47.672 1.00 31.53 ? 87  PRO B CA  1 
ATOM   3628 C C   . PRO B 1 85  ? 3.555   -19.524 48.717 1.00 31.36 ? 87  PRO B C   1 
ATOM   3629 O O   . PRO B 1 85  ? 2.735   -18.889 49.377 1.00 31.54 ? 87  PRO B O   1 
ATOM   3630 C CB  . PRO B 1 85  ? 5.514   -17.911 48.302 1.00 32.14 ? 87  PRO B CB  1 
ATOM   3631 C CG  . PRO B 1 85  ? 5.708   -16.830 47.223 1.00 31.43 ? 87  PRO B CG  1 
ATOM   3632 C CD  . PRO B 1 85  ? 4.268   -16.547 46.806 1.00 30.90 ? 87  PRO B CD  1 
ATOM   3633 N N   . GLU B 1 86  ? 3.698   -20.846 48.790 1.00 31.82 ? 88  GLU B N   1 
ATOM   3634 C CA  . GLU B 1 86  ? 3.061   -21.720 49.800 1.00 33.24 ? 88  GLU B CA  1 
ATOM   3635 C C   . GLU B 1 86  ? 1.565   -22.084 49.614 1.00 32.45 ? 88  GLU B C   1 
ATOM   3636 O O   . GLU B 1 86  ? 1.035   -22.869 50.390 1.00 31.18 ? 88  GLU B O   1 
ATOM   3637 C CB  . GLU B 1 86  ? 3.384   -21.284 51.269 1.00 34.23 ? 88  GLU B CB  1 
ATOM   3638 C CG  . GLU B 1 86  ? 4.882   -21.369 51.623 1.00 38.49 ? 88  GLU B CG  1 
ATOM   3639 C CD  . GLU B 1 86  ? 5.129   -21.865 53.031 1.00 45.66 ? 88  GLU B CD  1 
ATOM   3640 O OE1 . GLU B 1 86  ? 4.427   -22.811 53.488 1.00 48.17 ? 88  GLU B OE1 1 
ATOM   3641 O OE2 . GLU B 1 86  ? 6.039   -21.308 53.693 1.00 47.95 ? 88  GLU B OE2 1 
ATOM   3642 N N   . ASP B 1 87  ? 0.897   -21.554 48.585 1.00 31.92 ? 89  ASP B N   1 
ATOM   3643 C CA  . ASP B 1 87  ? -0.468  -22.064 48.278 1.00 30.99 ? 89  ASP B CA  1 
ATOM   3644 C C   . ASP B 1 87  ? -0.381  -23.550 47.979 1.00 30.00 ? 89  ASP B C   1 
ATOM   3645 O O   . ASP B 1 87  ? 0.551   -23.982 47.277 1.00 30.67 ? 89  ASP B O   1 
ATOM   3646 C CB  . ASP B 1 87  ? -1.075  -21.386 47.034 1.00 31.34 ? 89  ASP B CB  1 
ATOM   3647 C CG  . ASP B 1 87  ? -1.408  -19.921 47.261 1.00 32.89 ? 89  ASP B CG  1 
ATOM   3648 O OD1 . ASP B 1 87  ? -1.461  -19.478 48.433 1.00 31.93 ? 89  ASP B OD1 1 
ATOM   3649 O OD2 . ASP B 1 87  ? -1.608  -19.202 46.264 1.00 30.35 ? 89  ASP B OD2 1 
ATOM   3650 N N   . ASP B 1 88  ? -1.365  -24.315 48.445 1.00 27.87 ? 90  ASP B N   1 
ATOM   3651 C CA  . ASP B 1 88  ? -1.485  -25.725 48.091 1.00 27.47 ? 90  ASP B CA  1 
ATOM   3652 C C   . ASP B 1 88  ? -2.029  -25.905 46.682 1.00 26.52 ? 90  ASP B C   1 
ATOM   3653 O O   . ASP B 1 88  ? -3.099  -25.360 46.360 1.00 26.11 ? 90  ASP B O   1 
ATOM   3654 C CB  . ASP B 1 88  ? -2.416  -26.456 49.088 1.00 27.35 ? 90  ASP B CB  1 
ATOM   3655 C CG  . ASP B 1 88  ? -1.799  -26.574 50.485 1.00 29.80 ? 90  ASP B CG  1 
ATOM   3656 O OD1 . ASP B 1 88  ? -0.573  -26.717 50.576 1.00 32.69 ? 90  ASP B OD1 1 
ATOM   3657 O OD2 . ASP B 1 88  ? -2.543  -26.547 51.487 1.00 31.13 ? 90  ASP B OD2 1 
ATOM   3658 N N   . VAL B 1 89  ? -1.316  -26.677 45.854 1.00 26.13 ? 91  VAL B N   1 
ATOM   3659 C CA  . VAL B 1 89  ? -1.775  -26.956 44.474 1.00 25.86 ? 91  VAL B CA  1 
ATOM   3660 C C   . VAL B 1 89  ? -1.825  -28.494 44.295 1.00 25.93 ? 91  VAL B C   1 
ATOM   3661 O O   . VAL B 1 89  ? -0.789  -29.199 44.432 1.00 25.57 ? 91  VAL B O   1 
ATOM   3662 C CB  . VAL B 1 89  ? -0.836  -26.241 43.422 1.00 27.23 ? 91  VAL B CB  1 
ATOM   3663 C CG1 . VAL B 1 89  ? -1.272  -26.492 41.947 1.00 25.52 ? 91  VAL B CG1 1 
ATOM   3664 C CG2 . VAL B 1 89  ? -0.739  -24.723 43.703 1.00 25.23 ? 91  VAL B CG2 1 
ATOM   3665 N N   . LEU B 1 90  ? -3.016  -29.032 44.044 1.00 24.60 ? 92  LEU B N   1 
ATOM   3666 C CA  . LEU B 1 90  ? -3.124  -30.478 43.885 1.00 23.61 ? 92  LEU B CA  1 
ATOM   3667 C C   . LEU B 1 90  ? -2.985  -30.720 42.400 1.00 23.26 ? 92  LEU B C   1 
ATOM   3668 O O   . LEU B 1 90  ? -3.712  -30.095 41.605 1.00 22.75 ? 92  LEU B O   1 
ATOM   3669 C CB  . LEU B 1 90  ? -4.479  -31.014 44.392 1.00 22.94 ? 92  LEU B CB  1 
ATOM   3670 C CG  . LEU B 1 90  ? -4.787  -32.509 44.178 1.00 23.19 ? 92  LEU B CG  1 
ATOM   3671 C CD1 . LEU B 1 90  ? -3.786  -33.326 44.933 1.00 22.03 ? 92  LEU B CD1 1 
ATOM   3672 C CD2 . LEU B 1 90  ? -6.180  -32.809 44.744 1.00 25.21 ? 92  LEU B CD2 1 
ATOM   3673 N N   . ILE B 1 91  ? -2.087  -31.620 42.019 1.00 22.56 ? 93  ILE B N   1 
ATOM   3674 C CA  . ILE B 1 91  ? -1.897  -31.971 40.595 1.00 23.88 ? 93  ILE B CA  1 
ATOM   3675 C C   . ILE B 1 91  ? -1.914  -33.494 40.318 1.00 25.01 ? 93  ILE B C   1 
ATOM   3676 O O   . ILE B 1 91  ? -0.937  -34.209 40.612 1.00 24.92 ? 93  ILE B O   1 
ATOM   3677 C CB  . ILE B 1 91  ? -0.586  -31.377 40.076 1.00 24.62 ? 93  ILE B CB  1 
ATOM   3678 C CG1 . ILE B 1 91  ? -0.516  -29.894 40.517 1.00 27.11 ? 93  ILE B CG1 1 
ATOM   3679 C CG2 . ILE B 1 91  ? -0.456  -31.628 38.562 1.00 25.34 ? 93  ILE B CG2 1 
ATOM   3680 C CD1 . ILE B 1 91  ? 0.599   -29.076 39.896 1.00 31.86 ? 93  ILE B CD1 1 
ATOM   3681 N N   . PRO B 1 92  ? -2.998  -34.003 39.696 1.00 25.63 ? 94  PRO B N   1 
ATOM   3682 C CA  . PRO B 1 92  ? -3.054  -35.410 39.349 1.00 25.99 ? 94  PRO B CA  1 
ATOM   3683 C C   . PRO B 1 92  ? -2.326  -35.733 38.046 1.00 26.62 ? 94  PRO B C   1 
ATOM   3684 O O   . PRO B 1 92  ? -2.757  -35.301 36.989 1.00 28.47 ? 94  PRO B O   1 
ATOM   3685 C CB  . PRO B 1 92  ? -4.565  -35.658 39.153 1.00 26.49 ? 94  PRO B CB  1 
ATOM   3686 C CG  . PRO B 1 92  ? -5.243  -34.466 39.730 1.00 26.85 ? 94  PRO B CG  1 
ATOM   3687 C CD  . PRO B 1 92  ? -4.284  -33.342 39.465 1.00 26.00 ? 94  PRO B CD  1 
ATOM   3688 N N   . ILE B 1 93  ? -1.318  -36.587 38.082 1.00 26.14 ? 95  ILE B N   1 
ATOM   3689 C CA  . ILE B 1 93  ? -0.490  -36.777 36.933 1.00 25.26 ? 95  ILE B CA  1 
ATOM   3690 C C   . ILE B 1 93  ? -0.619  -38.161 36.356 1.00 26.31 ? 95  ILE B C   1 
ATOM   3691 O O   . ILE B 1 93  ? -0.428  -39.168 37.078 1.00 26.22 ? 95  ILE B O   1 
ATOM   3692 C CB  . ILE B 1 93  ? 0.982   -36.546 37.322 1.00 26.19 ? 95  ILE B CB  1 
ATOM   3693 C CG1 . ILE B 1 93  ? 1.141   -35.120 37.877 1.00 24.52 ? 95  ILE B CG1 1 
ATOM   3694 C CG2 . ILE B 1 93  ? 1.854   -36.778 36.084 1.00 21.44 ? 95  ILE B CG2 1 
ATOM   3695 C CD1 . ILE B 1 93  ? 2.444   -34.900 38.537 1.00 26.22 ? 95  ILE B CD1 1 
ATOM   3696 N N   . TYR B 1 94  ? -0.960  -38.237 35.076 1.00 25.28 ? 96  TYR B N   1 
ATOM   3697 C CA  . TYR B 1 94  ? -1.049  -39.548 34.408 1.00 26.44 ? 96  TYR B CA  1 
ATOM   3698 C C   . TYR B 1 94  ? -0.299  -39.505 33.068 1.00 26.96 ? 96  TYR B C   1 
ATOM   3699 O O   . TYR B 1 94  ? -0.512  -40.355 32.194 1.00 26.24 ? 96  TYR B O   1 
ATOM   3700 C CB  . TYR B 1 94  ? -2.526  -39.921 34.142 1.00 27.13 ? 96  TYR B CB  1 
ATOM   3701 C CG  . TYR B 1 94  ? -3.326  -38.878 33.338 1.00 27.82 ? 96  TYR B CG  1 
ATOM   3702 C CD1 . TYR B 1 94  ? -3.775  -37.686 33.927 1.00 27.09 ? 96  TYR B CD1 1 
ATOM   3703 C CD2 . TYR B 1 94  ? -3.665  -39.124 32.000 1.00 28.10 ? 96  TYR B CD2 1 
ATOM   3704 C CE1 . TYR B 1 94  ? -4.497  -36.731 33.160 1.00 25.51 ? 96  TYR B CE1 1 
ATOM   3705 C CE2 . TYR B 1 94  ? -4.394  -38.194 31.235 1.00 28.84 ? 96  TYR B CE2 1 
ATOM   3706 C CZ  . TYR B 1 94  ? -4.794  -37.017 31.824 1.00 27.80 ? 96  TYR B CZ  1 
ATOM   3707 O OH  . TYR B 1 94  ? -5.492  -36.164 31.035 1.00 25.80 ? 96  TYR B OH  1 
ATOM   3708 N N   . GLY B 1 95  ? 0.530   -38.479 32.895 1.00 26.06 ? 97  GLY B N   1 
ATOM   3709 C CA  . GLY B 1 95  ? 1.362   -38.386 31.724 1.00 27.22 ? 97  GLY B CA  1 
ATOM   3710 C C   . GLY B 1 95  ? 2.373   -37.259 31.817 1.00 27.41 ? 97  GLY B C   1 
ATOM   3711 O O   . GLY B 1 95  ? 2.494   -36.598 32.840 1.00 27.44 ? 97  GLY B O   1 
ATOM   3712 N N   . ARG B 1 96  ? 3.109   -37.049 30.731 1.00 27.30 ? 98  ARG B N   1 
ATOM   3713 C CA  . ARG B 1 96  ? 4.216   -36.123 30.746 1.00 27.08 ? 98  ARG B CA  1 
ATOM   3714 C C   . ARG B 1 96  ? 3.814   -34.683 31.067 1.00 26.58 ? 98  ARG B C   1 
ATOM   3715 O O   . ARG B 1 96  ? 4.575   -33.956 31.701 1.00 26.03 ? 98  ARG B O   1 
ATOM   3716 C CB  . ARG B 1 96  ? 4.973   -36.201 29.409 1.00 27.94 ? 98  ARG B CB  1 
ATOM   3717 C CG  . ARG B 1 96  ? 6.110   -35.191 29.263 1.00 30.06 ? 98  ARG B CG  1 
ATOM   3718 C CD  . ARG B 1 96  ? 5.502   -33.944 28.666 1.00 37.30 ? 98  ARG B CD  1 
ATOM   3719 N NE  . ARG B 1 96  ? 6.470   -32.945 28.196 1.00 42.80 ? 98  ARG B NE  1 
ATOM   3720 C CZ  . ARG B 1 96  ? 7.126   -32.118 28.999 1.00 43.76 ? 98  ARG B CZ  1 
ATOM   3721 N NH1 . ARG B 1 96  ? 6.944   -32.182 30.319 1.00 44.88 ? 98  ARG B NH1 1 
ATOM   3722 N NH2 . ARG B 1 96  ? 7.978   -31.243 28.485 1.00 43.57 ? 98  ARG B NH2 1 
ATOM   3723 N N   . PHE B 1 97  ? 2.635   -34.270 30.617 1.00 26.34 ? 99  PHE B N   1 
ATOM   3724 C CA  . PHE B 1 97  ? 2.210   -32.889 30.758 1.00 27.11 ? 99  PHE B CA  1 
ATOM   3725 C C   . PHE B 1 97  ? 1.741   -32.482 32.168 1.00 26.57 ? 99  PHE B C   1 
ATOM   3726 O O   . PHE B 1 97  ? 1.763   -31.288 32.536 1.00 26.07 ? 99  PHE B O   1 
ATOM   3727 C CB  . PHE B 1 97  ? 1.259   -32.516 29.592 1.00 29.14 ? 99  PHE B CB  1 
ATOM   3728 C CG  . PHE B 1 97  ? 2.004   -32.417 28.276 1.00 33.58 ? 99  PHE B CG  1 
ATOM   3729 C CD1 . PHE B 1 97  ? 2.766   -31.281 27.989 1.00 36.05 ? 99  PHE B CD1 1 
ATOM   3730 C CD2 . PHE B 1 97  ? 2.075   -33.525 27.395 1.00 36.77 ? 99  PHE B CD2 1 
ATOM   3731 C CE1 . PHE B 1 97  ? 3.564   -31.201 26.803 1.00 33.43 ? 99  PHE B CE1 1 
ATOM   3732 C CE2 . PHE B 1 97  ? 2.875   -33.459 26.225 1.00 39.26 ? 99  PHE B CE2 1 
ATOM   3733 C CZ  . PHE B 1 97  ? 3.608   -32.266 25.936 1.00 36.67 ? 99  PHE B CZ  1 
ATOM   3734 N N   . GLY B 1 98  ? 1.412   -33.479 32.975 1.00 26.27 ? 100 GLY B N   1 
ATOM   3735 C CA  . GLY B 1 98  ? 1.184   -33.272 34.404 1.00 26.63 ? 100 GLY B CA  1 
ATOM   3736 C C   . GLY B 1 98  ? 2.453   -32.810 35.117 1.00 26.44 ? 100 GLY B C   1 
ATOM   3737 O O   . GLY B 1 98  ? 2.383   -31.992 36.025 1.00 24.75 ? 100 GLY B O   1 
ATOM   3738 N N   . TYR B 1 99  ? 3.622   -33.280 34.670 1.00 26.80 ? 101 TYR B N   1 
ATOM   3739 C CA  . TYR B 1 99  ? 4.865   -32.853 35.314 1.00 27.75 ? 101 TYR B CA  1 
ATOM   3740 C C   . TYR B 1 99  ? 5.254   -31.409 34.934 1.00 27.11 ? 101 TYR B C   1 
ATOM   3741 O O   . TYR B 1 99  ? 5.897   -30.701 35.702 1.00 28.18 ? 101 TYR B O   1 
ATOM   3742 C CB  . TYR B 1 99  ? 6.006   -33.820 34.982 1.00 29.26 ? 101 TYR B CB  1 
ATOM   3743 C CG  . TYR B 1 99  ? 5.765   -35.163 35.593 1.00 33.09 ? 101 TYR B CG  1 
ATOM   3744 C CD1 . TYR B 1 99  ? 5.683   -35.308 36.981 1.00 34.85 ? 101 TYR B CD1 1 
ATOM   3745 C CD2 . TYR B 1 99  ? 5.590   -36.302 34.793 1.00 38.11 ? 101 TYR B CD2 1 
ATOM   3746 C CE1 . TYR B 1 99  ? 5.407   -36.571 37.574 1.00 40.03 ? 101 TYR B CE1 1 
ATOM   3747 C CE2 . TYR B 1 99  ? 5.333   -37.559 35.376 1.00 41.22 ? 101 TYR B CE2 1 
ATOM   3748 C CZ  . TYR B 1 99  ? 5.230   -37.690 36.766 1.00 40.53 ? 101 TYR B CZ  1 
ATOM   3749 O OH  . TYR B 1 99  ? 4.962   -38.934 37.356 1.00 44.11 ? 101 TYR B OH  1 
ATOM   3750 N N   . LEU B 1 100 ? 4.921   -30.993 33.724 1.00 25.86 ? 102 LEU B N   1 
ATOM   3751 C CA  . LEU B 1 100 ? 5.088   -29.606 33.357 1.00 25.81 ? 102 LEU B CA  1 
ATOM   3752 C C   . LEU B 1 100 ? 4.282   -28.718 34.335 1.00 25.03 ? 102 LEU B C   1 
ATOM   3753 O O   . LEU B 1 100 ? 4.754   -27.687 34.805 1.00 24.60 ? 102 LEU B O   1 
ATOM   3754 C CB  . LEU B 1 100 ? 4.617   -29.441 31.877 1.00 27.16 ? 102 LEU B CB  1 
ATOM   3755 C CG  . LEU B 1 100 ? 4.419   -28.060 31.274 1.00 27.59 ? 102 LEU B CG  1 
ATOM   3756 C CD1 . LEU B 1 100 ? 5.772   -27.340 31.221 1.00 26.02 ? 102 LEU B CD1 1 
ATOM   3757 C CD2 . LEU B 1 100 ? 3.656   -28.142 29.880 1.00 28.99 ? 102 LEU B CD2 1 
ATOM   3758 N N   . LEU B 1 101 ? 3.066   -29.131 34.675 1.00 25.01 ? 103 LEU B N   1 
ATOM   3759 C CA  . LEU B 1 101 ? 2.244   -28.336 35.613 1.00 25.88 ? 103 LEU B CA  1 
ATOM   3760 C C   . LEU B 1 101 ? 2.884   -28.250 36.984 1.00 25.99 ? 103 LEU B C   1 
ATOM   3761 O O   . LEU B 1 101 ? 2.848   -27.197 37.670 1.00 25.95 ? 103 LEU B O   1 
ATOM   3762 C CB  . LEU B 1 101 ? 0.833   -28.921 35.766 1.00 26.15 ? 103 LEU B CB  1 
ATOM   3763 C CG  . LEU B 1 101 ? -0.096  -28.919 34.561 1.00 25.60 ? 103 LEU B CG  1 
ATOM   3764 C CD1 . LEU B 1 101 ? -1.444  -29.563 35.058 1.00 22.04 ? 103 LEU B CD1 1 
ATOM   3765 C CD2 . LEU B 1 101 ? -0.314  -27.512 34.123 1.00 23.05 ? 103 LEU B CD2 1 
ATOM   3766 N N   . THR B 1 102 ? 3.509   -29.344 37.389 1.00 27.37 ? 104 THR B N   1 
ATOM   3767 C CA  . THR B 1 102 ? 4.165   -29.340 38.687 1.00 29.10 ? 104 THR B CA  1 
ATOM   3768 C C   . THR B 1 102 ? 5.426   -28.468 38.613 1.00 28.73 ? 104 THR B C   1 
ATOM   3769 O O   . THR B 1 102 ? 5.617   -27.625 39.460 1.00 28.50 ? 104 THR B O   1 
ATOM   3770 C CB  . THR B 1 102 ? 4.457   -30.757 39.244 1.00 30.40 ? 104 THR B CB  1 
ATOM   3771 O OG1 . THR B 1 102 ? 5.525   -31.362 38.489 1.00 36.54 ? 104 THR B OG1 1 
ATOM   3772 C CG2 . THR B 1 102 ? 3.251   -31.618 39.183 1.00 27.30 ? 104 THR B CG2 1 
ATOM   3773 N N   . GLU B 1 103 ? 6.248   -28.633 37.579 1.00 29.08 ? 105 GLU B N   1 
ATOM   3774 C CA  . GLU B 1 103 ? 7.437   -27.767 37.412 1.00 29.51 ? 105 GLU B CA  1 
ATOM   3775 C C   . GLU B 1 103 ? 7.017   -26.316 37.547 1.00 29.48 ? 105 GLU B C   1 
ATOM   3776 O O   . GLU B 1 103 ? 7.606   -25.596 38.320 1.00 30.35 ? 105 GLU B O   1 
ATOM   3777 C CB  . GLU B 1 103 ? 8.140   -28.000 36.066 1.00 29.90 ? 105 GLU B CB  1 
ATOM   3778 C CG  . GLU B 1 103 ? 9.547   -27.367 35.922 1.00 31.69 ? 105 GLU B CG  1 
ATOM   3779 C CD  . GLU B 1 103 ? 10.644  -28.171 36.660 1.00 38.69 ? 105 GLU B CD  1 
ATOM   3780 O OE1 . GLU B 1 103 ? 10.479  -29.411 36.813 1.00 39.88 ? 105 GLU B OE1 1 
ATOM   3781 O OE2 . GLU B 1 103 ? 11.685  -27.579 37.101 1.00 36.80 ? 105 GLU B OE2 1 
ATOM   3782 N N   . ILE B 1 104 ? 5.980   -25.891 36.823 1.00 30.03 ? 106 ILE B N   1 
ATOM   3783 C CA  . ILE B 1 104 ? 5.532   -24.486 36.871 1.00 29.66 ? 106 ILE B CA  1 
ATOM   3784 C C   . ILE B 1 104 ? 5.067   -24.075 38.262 1.00 29.80 ? 106 ILE B C   1 
ATOM   3785 O O   . ILE B 1 104 ? 5.440   -23.011 38.761 1.00 30.41 ? 106 ILE B O   1 
ATOM   3786 C CB  . ILE B 1 104 ? 4.397   -24.175 35.820 1.00 28.75 ? 106 ILE B CB  1 
ATOM   3787 C CG1 . ILE B 1 104 ? 4.945   -24.364 34.413 1.00 26.38 ? 106 ILE B CG1 1 
ATOM   3788 C CG2 . ILE B 1 104 ? 3.941   -22.712 35.989 1.00 29.32 ? 106 ILE B CG2 1 
ATOM   3789 C CD1 . ILE B 1 104 ? 3.885   -24.524 33.335 1.00 27.82 ? 106 ILE B CD1 1 
ATOM   3790 N N   . ALA B 1 105 ? 4.244   -24.913 38.888 1.00 29.86 ? 107 ALA B N   1 
ATOM   3791 C CA  . ALA B 1 105 ? 3.706   -24.615 40.187 1.00 29.35 ? 107 ALA B CA  1 
ATOM   3792 C C   . ALA B 1 105 ? 4.818   -24.464 41.188 1.00 29.45 ? 107 ALA B C   1 
ATOM   3793 O O   . ALA B 1 105 ? 4.828   -23.527 41.960 1.00 29.75 ? 107 ALA B O   1 
ATOM   3794 C CB  . ALA B 1 105 ? 2.749   -25.730 40.643 1.00 30.09 ? 107 ALA B CB  1 
ATOM   3795 N N   . GLU B 1 106 ? 5.747   -25.409 41.201 1.00 30.21 ? 108 GLU B N   1 
ATOM   3796 C CA  . GLU B 1 106 ? 6.823   -25.399 42.183 1.00 30.01 ? 108 GLU B CA  1 
ATOM   3797 C C   . GLU B 1 106 ? 7.690   -24.156 41.960 1.00 29.07 ? 108 GLU B C   1 
ATOM   3798 O O   . GLU B 1 106 ? 8.080   -23.489 42.913 1.00 26.46 ? 108 GLU B O   1 
ATOM   3799 C CB  . GLU B 1 106 ? 7.703   -26.633 42.046 1.00 31.14 ? 108 GLU B CB  1 
ATOM   3800 C CG  . GLU B 1 106 ? 7.151   -27.925 42.700 1.00 36.44 ? 108 GLU B CG  1 
ATOM   3801 C CD  . GLU B 1 106 ? 7.909   -29.182 42.216 1.00 41.25 ? 108 GLU B CD  1 
ATOM   3802 O OE1 . GLU B 1 106 ? 7.530   -30.313 42.592 1.00 41.93 ? 108 GLU B OE1 1 
ATOM   3803 O OE2 . GLU B 1 106 ? 8.881   -29.036 41.446 1.00 43.30 ? 108 GLU B OE2 1 
ATOM   3804 N N   . ARG B 1 107 ? 7.958   -23.842 40.692 1.00 28.10 ? 109 ARG B N   1 
ATOM   3805 C CA  . ARG B 1 107 ? 8.731   -22.634 40.368 1.00 29.28 ? 109 ARG B CA  1 
ATOM   3806 C C   . ARG B 1 107 ? 8.096   -21.359 40.918 1.00 28.01 ? 109 ARG B C   1 
ATOM   3807 O O   . ARG B 1 107 ? 8.785   -20.433 41.278 1.00 27.57 ? 109 ARG B O   1 
ATOM   3808 C CB  . ARG B 1 107 ? 9.009   -22.511 38.869 1.00 29.41 ? 109 ARG B CB  1 
ATOM   3809 C CG  . ARG B 1 107 ? 10.294  -23.245 38.504 1.00 34.29 ? 109 ARG B CG  1 
ATOM   3810 C CD  . ARG B 1 107 ? 10.696  -23.149 37.021 1.00 36.71 ? 109 ARG B CD  1 
ATOM   3811 N NE  . ARG B 1 107 ? 11.397  -24.384 36.649 1.00 38.87 ? 109 ARG B NE  1 
ATOM   3812 C CZ  . ARG B 1 107 ? 12.419  -24.467 35.795 1.00 41.35 ? 109 ARG B CZ  1 
ATOM   3813 N NH1 . ARG B 1 107 ? 12.927  -23.387 35.204 1.00 39.56 ? 109 ARG B NH1 1 
ATOM   3814 N NH2 . ARG B 1 107 ? 12.947  -25.655 35.535 1.00 42.34 ? 109 ARG B NH2 1 
ATOM   3815 N N   . TYR B 1 108 ? 6.777   -21.324 41.015 1.00 27.90 ? 110 TYR B N   1 
ATOM   3816 C CA  . TYR B 1 108 ? 6.138   -20.121 41.557 1.00 26.71 ? 110 TYR B CA  1 
ATOM   3817 C C   . TYR B 1 108 ? 5.940   -20.210 43.079 1.00 25.91 ? 110 TYR B C   1 
ATOM   3818 O O   . TYR B 1 108 ? 5.273   -19.400 43.687 1.00 24.84 ? 110 TYR B O   1 
ATOM   3819 C CB  . TYR B 1 108 ? 4.905   -19.753 40.734 1.00 26.86 ? 110 TYR B CB  1 
ATOM   3820 C CG  . TYR B 1 108 ? 5.286   -19.084 39.418 1.00 27.30 ? 110 TYR B CG  1 
ATOM   3821 C CD1 . TYR B 1 108 ? 5.576   -17.730 39.384 1.00 26.85 ? 110 TYR B CD1 1 
ATOM   3822 C CD2 . TYR B 1 108 ? 5.411   -19.816 38.226 1.00 29.35 ? 110 TYR B CD2 1 
ATOM   3823 C CE1 . TYR B 1 108 ? 5.987   -17.067 38.182 1.00 27.85 ? 110 TYR B CE1 1 
ATOM   3824 C CE2 . TYR B 1 108 ? 5.790   -19.174 36.997 1.00 27.92 ? 110 TYR B CE2 1 
ATOM   3825 C CZ  . TYR B 1 108 ? 6.079   -17.782 36.998 1.00 27.67 ? 110 TYR B CZ  1 
ATOM   3826 O OH  . TYR B 1 108 ? 6.443   -17.098 35.834 1.00 25.19 ? 110 TYR B OH  1 
ATOM   3827 N N   . GLY B 1 109 ? 6.616   -21.182 43.689 1.00 26.42 ? 111 GLY B N   1 
ATOM   3828 C CA  . GLY B 1 109 ? 6.628   -21.352 45.151 1.00 27.84 ? 111 GLY B CA  1 
ATOM   3829 C C   . GLY B 1 109 ? 5.437   -22.046 45.796 1.00 28.68 ? 111 GLY B C   1 
ATOM   3830 O O   . GLY B 1 109 ? 5.224   -21.913 46.997 1.00 28.93 ? 111 GLY B O   1 
ATOM   3831 N N   . ALA B 1 110 ? 4.648   -22.778 45.011 1.00 28.73 ? 112 ALA B N   1 
ATOM   3832 C CA  . ALA B 1 110 ? 3.515   -23.552 45.566 1.00 29.43 ? 112 ALA B CA  1 
ATOM   3833 C C   . ALA B 1 110 ? 3.973   -24.795 46.356 1.00 30.63 ? 112 ALA B C   1 
ATOM   3834 O O   . ALA B 1 110 ? 5.010   -25.410 46.036 1.00 30.02 ? 112 ALA B O   1 
ATOM   3835 C CB  . ALA B 1 110 ? 2.560   -23.975 44.437 1.00 27.45 ? 112 ALA B CB  1 
ATOM   3836 N N   . ASN B 1 111 ? 3.204   -25.154 47.388 1.00 31.48 ? 113 ASN B N   1 
ATOM   3837 C CA  . ASN B 1 111 ? 3.296   -26.487 47.955 1.00 33.35 ? 113 ASN B CA  1 
ATOM   3838 C C   . ASN B 1 111 ? 2.466   -27.406 47.062 1.00 33.32 ? 113 ASN B C   1 
ATOM   3839 O O   . ASN B 1 111 ? 1.259   -27.235 46.967 1.00 32.97 ? 113 ASN B O   1 
ATOM   3840 C CB  . ASN B 1 111 ? 2.800   -26.538 49.409 1.00 34.33 ? 113 ASN B CB  1 
ATOM   3841 C CG  . ASN B 1 111 ? 3.183   -27.852 50.095 1.00 40.92 ? 113 ASN B CG  1 
ATOM   3842 O OD1 . ASN B 1 111 ? 2.730   -28.177 51.226 1.00 45.03 ? 113 ASN B OD1 1 
ATOM   3843 N ND2 . ASN B 1 111 ? 4.039   -28.634 49.406 1.00 44.79 ? 113 ASN B ND2 1 
ATOM   3844 N N   . VAL B 1 112 ? 3.141   -28.345 46.384 1.00 33.59 ? 114 VAL B N   1 
ATOM   3845 C CA  . VAL B 1 112 ? 2.559   -29.189 45.341 1.00 32.49 ? 114 VAL B CA  1 
ATOM   3846 C C   . VAL B 1 112 ? 2.194   -30.573 45.878 1.00 32.92 ? 114 VAL B C   1 
ATOM   3847 O O   . VAL B 1 112 ? 3.060   -31.293 46.401 1.00 33.08 ? 114 VAL B O   1 
ATOM   3848 C CB  . VAL B 1 112 ? 3.544   -29.305 44.143 1.00 32.73 ? 114 VAL B CB  1 
ATOM   3849 C CG1 . VAL B 1 112 ? 3.046   -30.305 43.109 1.00 33.25 ? 114 VAL B CG1 1 
ATOM   3850 C CG2 . VAL B 1 112 ? 3.726   -27.954 43.487 1.00 30.67 ? 114 VAL B CG2 1 
ATOM   3851 N N   . HIS B 1 113 ? 0.911   -30.931 45.775 1.00 31.66 ? 115 HIS B N   1 
ATOM   3852 C CA  . HIS B 1 113 ? 0.441   -32.240 46.198 1.00 31.27 ? 115 HIS B CA  1 
ATOM   3853 C C   . HIS B 1 113 ? 0.201   -33.034 44.939 1.00 30.50 ? 115 HIS B C   1 
ATOM   3854 O O   . HIS B 1 113 ? -0.612  -32.658 44.142 1.00 30.21 ? 115 HIS B O   1 
ATOM   3855 C CB  . HIS B 1 113 ? -0.819  -32.130 47.088 1.00 30.84 ? 115 HIS B CB  1 
ATOM   3856 C CG  . HIS B 1 113 ? -0.628  -31.248 48.293 1.00 33.78 ? 115 HIS B CG  1 
ATOM   3857 N ND1 . HIS B 1 113 ? -0.586  -29.862 48.215 1.00 35.72 ? 115 HIS B ND1 1 
ATOM   3858 C CD2 . HIS B 1 113 ? -0.393  -31.553 49.591 1.00 35.33 ? 115 HIS B CD2 1 
ATOM   3859 C CE1 . HIS B 1 113 ? -0.374  -29.361 49.420 1.00 34.42 ? 115 HIS B CE1 1 
ATOM   3860 N NE2 . HIS B 1 113 ? -0.250  -30.363 50.271 1.00 34.95 ? 115 HIS B NE2 1 
ATOM   3861 N N   . MET B 1 114 ? 0.969   -34.084 44.697 1.00 30.84 ? 116 MET B N   1 
ATOM   3862 C CA  . MET B 1 114 ? 0.711   -34.840 43.474 1.00 31.46 ? 116 MET B CA  1 
ATOM   3863 C C   . MET B 1 114 ? 0.148   -36.210 43.698 1.00 30.36 ? 116 MET B C   1 
ATOM   3864 O O   . MET B 1 114 ? 0.303   -36.780 44.758 1.00 29.79 ? 116 MET B O   1 
ATOM   3865 C CB  . MET B 1 114 ? 1.895   -34.890 42.515 1.00 32.25 ? 116 MET B CB  1 
ATOM   3866 C CG  . MET B 1 114 ? 3.195   -35.214 43.098 1.00 37.13 ? 116 MET B CG  1 
ATOM   3867 S SD  . MET B 1 114 ? 4.435   -34.719 41.888 1.00 47.13 ? 116 MET B SD  1 
ATOM   3868 C CE  . MET B 1 114 ? 5.915   -34.849 42.894 1.00 46.19 ? 116 MET B CE  1 
ATOM   3869 N N   . LEU B 1 115 ? -0.552  -36.700 42.680 1.00 29.49 ? 117 LEU B N   1 
ATOM   3870 C CA  . LEU B 1 115 ? -1.068  -38.042 42.654 1.00 29.29 ? 117 LEU B CA  1 
ATOM   3871 C C   . LEU B 1 115 ? -0.539  -38.547 41.336 1.00 30.24 ? 117 LEU B C   1 
ATOM   3872 O O   . LEU B 1 115 ? -0.371  -37.750 40.421 1.00 28.64 ? 117 LEU B O   1 
ATOM   3873 C CB  . LEU B 1 115 ? -2.599  -38.044 42.632 1.00 28.18 ? 117 LEU B CB  1 
ATOM   3874 C CG  . LEU B 1 115 ? -3.448  -37.511 43.771 1.00 28.52 ? 117 LEU B CG  1 
ATOM   3875 C CD1 . LEU B 1 115 ? -4.886  -37.428 43.338 1.00 30.37 ? 117 LEU B CD1 1 
ATOM   3876 C CD2 . LEU B 1 115 ? -3.329  -38.485 44.986 1.00 31.39 ? 117 LEU B CD2 1 
ATOM   3877 N N   . GLU B 1 116 ? -0.267  -39.848 41.232 1.00 31.16 ? 118 GLU B N   1 
ATOM   3878 C CA  . GLU B 1 116 ? 0.238   -40.409 39.974 1.00 32.96 ? 118 GLU B CA  1 
ATOM   3879 C C   . GLU B 1 116 ? -0.431  -41.717 39.662 1.00 33.20 ? 118 GLU B C   1 
ATOM   3880 O O   . GLU B 1 116 ? -0.751  -42.488 40.578 1.00 33.98 ? 118 GLU B O   1 
ATOM   3881 C CB  . GLU B 1 116 ? 1.759   -40.595 40.016 1.00 32.87 ? 118 GLU B CB  1 
ATOM   3882 C CG  . GLU B 1 116 ? 2.548   -39.265 40.123 1.00 35.03 ? 118 GLU B CG  1 
ATOM   3883 C CD  . GLU B 1 116 ? 3.976   -39.478 40.659 1.00 40.17 ? 118 GLU B CD  1 
ATOM   3884 O OE1 . GLU B 1 116 ? 4.166   -40.343 41.588 1.00 42.58 ? 118 GLU B OE1 1 
ATOM   3885 O OE2 . GLU B 1 116 ? 4.899   -38.802 40.153 1.00 36.71 ? 118 GLU B OE2 1 
ATOM   3886 N N   . CYS B 1 117 ? -0.713  -41.948 38.383 1.00 33.56 ? 119 CYS B N   1 
ATOM   3887 C CA  . CYS B 1 117 ? -1.104  -43.294 37.944 1.00 32.79 ? 119 CYS B CA  1 
ATOM   3888 C C   . CYS B 1 117 ? -0.282  -43.801 36.764 1.00 32.19 ? 119 CYS B C   1 
ATOM   3889 O O   . CYS B 1 117 ? 0.530   -43.057 36.148 1.00 31.64 ? 119 CYS B O   1 
ATOM   3890 C CB  . CYS B 1 117 ? -2.615  -43.438 37.701 1.00 33.15 ? 119 CYS B CB  1 
ATOM   3891 S SG  . CYS B 1 117 ? -3.273  -42.350 36.401 1.00 30.49 ? 119 CYS B SG  1 
ATOM   3892 N N   . GLU B 1 118 ? -0.519  -45.066 36.458 1.00 31.04 ? 120 GLU B N   1 
ATOM   3893 C CA  . GLU B 1 118 ? 0.165   -45.765 35.394 1.00 31.83 ? 120 GLU B CA  1 
ATOM   3894 C C   . GLU B 1 118 ? -0.095  -45.074 34.048 1.00 31.51 ? 120 GLU B C   1 
ATOM   3895 O O   . GLU B 1 118 ? -1.262  -44.830 33.653 1.00 30.35 ? 120 GLU B O   1 
ATOM   3896 C CB  . GLU B 1 118 ? -0.221  -47.279 35.403 1.00 32.81 ? 120 GLU B CB  1 
ATOM   3897 C CG  . GLU B 1 118 ? -0.275  -47.937 34.008 1.00 37.62 ? 120 GLU B CG  1 
ATOM   3898 C CD  . GLU B 1 118 ? 0.320   -49.332 33.957 1.00 42.84 ? 120 GLU B CD  1 
ATOM   3899 O OE1 . GLU B 1 118 ? 0.193   -50.079 34.945 1.00 45.02 ? 120 GLU B OE1 1 
ATOM   3900 O OE2 . GLU B 1 118 ? 0.907   -49.682 32.903 1.00 45.21 ? 120 GLU B OE2 1 
ATOM   3901 N N   . TRP B 1 119 ? 1.005   -44.719 33.372 1.00 31.39 ? 121 TRP B N   1 
ATOM   3902 C CA  . TRP B 1 119 ? 0.913   -44.137 32.051 1.00 31.47 ? 121 TRP B CA  1 
ATOM   3903 C C   . TRP B 1 119 ? 0.104   -45.082 31.158 1.00 30.81 ? 121 TRP B C   1 
ATOM   3904 O O   . TRP B 1 119 ? 0.242   -46.289 31.217 1.00 30.74 ? 121 TRP B O   1 
ATOM   3905 C CB  . TRP B 1 119 ? 2.311   -43.827 31.516 1.00 31.89 ? 121 TRP B CB  1 
ATOM   3906 C CG  . TRP B 1 119 ? 2.895   -42.596 32.146 1.00 32.89 ? 121 TRP B CG  1 
ATOM   3907 C CD1 . TRP B 1 119 ? 2.632   -42.122 33.398 1.00 31.73 ? 121 TRP B CD1 1 
ATOM   3908 C CD2 . TRP B 1 119 ? 3.830   -41.668 31.556 1.00 32.89 ? 121 TRP B CD2 1 
ATOM   3909 N NE1 . TRP B 1 119 ? 3.323   -40.956 33.614 1.00 33.84 ? 121 TRP B NE1 1 
ATOM   3910 C CE2 . TRP B 1 119 ? 4.088   -40.671 32.516 1.00 31.75 ? 121 TRP B CE2 1 
ATOM   3911 C CE3 . TRP B 1 119 ? 4.462   -41.584 30.316 1.00 31.88 ? 121 TRP B CE3 1 
ATOM   3912 C CZ2 . TRP B 1 119 ? 4.949   -39.603 32.276 1.00 33.30 ? 121 TRP B CZ2 1 
ATOM   3913 C CZ3 . TRP B 1 119 ? 5.307   -40.507 30.075 1.00 33.45 ? 121 TRP B CZ3 1 
ATOM   3914 C CH2 . TRP B 1 119 ? 5.548   -39.542 31.050 1.00 32.91 ? 121 TRP B CH2 1 
ATOM   3915 N N   . GLY B 1 120 ? -0.820  -44.547 30.394 1.00 31.07 ? 122 GLY B N   1 
ATOM   3916 C CA  . GLY B 1 120 ? -1.760  -45.462 29.719 1.00 29.77 ? 122 GLY B CA  1 
ATOM   3917 C C   . GLY B 1 120 ? -3.138  -45.538 30.329 1.00 29.28 ? 122 GLY B C   1 
ATOM   3918 O O   . GLY B 1 120 ? -4.077  -45.962 29.660 1.00 28.78 ? 122 GLY B O   1 
ATOM   3919 N N   . THR B 1 121 ? -3.286  -45.128 31.588 1.00 29.18 ? 123 THR B N   1 
ATOM   3920 C CA  . THR B 1 121 ? -4.619  -45.188 32.237 1.00 28.04 ? 123 THR B CA  1 
ATOM   3921 C C   . THR B 1 121 ? -4.924  -43.798 32.774 1.00 27.25 ? 123 THR B C   1 
ATOM   3922 O O   . THR B 1 121 ? -4.093  -42.872 32.628 1.00 24.38 ? 123 THR B O   1 
ATOM   3923 C CB  . THR B 1 121 ? -4.632  -46.148 33.477 1.00 29.21 ? 123 THR B CB  1 
ATOM   3924 O OG1 . THR B 1 121 ? -3.745  -45.608 34.486 1.00 30.72 ? 123 THR B OG1 1 
ATOM   3925 C CG2 . THR B 1 121 ? -4.180  -47.544 33.089 1.00 29.33 ? 123 THR B CG2 1 
ATOM   3926 N N   . VAL B 1 122 ? -6.101  -43.676 33.409 1.00 26.90 ? 124 VAL B N   1 
ATOM   3927 C CA  . VAL B 1 122 ? -6.578  -42.417 34.020 1.00 26.76 ? 124 VAL B CA  1 
ATOM   3928 C C   . VAL B 1 122 ? -7.010  -42.708 35.466 1.00 27.71 ? 124 VAL B C   1 
ATOM   3929 O O   . VAL B 1 122 ? -7.140  -43.879 35.865 1.00 26.14 ? 124 VAL B O   1 
ATOM   3930 C CB  . VAL B 1 122 ? -7.703  -41.705 33.171 1.00 27.08 ? 124 VAL B CB  1 
ATOM   3931 C CG1 . VAL B 1 122 ? -7.145  -41.188 31.766 1.00 25.68 ? 124 VAL B CG1 1 
ATOM   3932 C CG2 . VAL B 1 122 ? -8.994  -42.607 32.939 1.00 27.31 ? 124 VAL B CG2 1 
ATOM   3933 N N   . PHE B 1 123 ? -7.201  -41.670 36.270 1.00 26.85 ? 125 PHE B N   1 
ATOM   3934 C CA  . PHE B 1 123 ? -7.710  -41.908 37.594 1.00 27.01 ? 125 PHE B CA  1 
ATOM   3935 C C   . PHE B 1 123 ? -9.187  -42.200 37.584 1.00 27.24 ? 125 PHE B C   1 
ATOM   3936 O O   . PHE B 1 123 ? -9.891  -41.767 36.683 1.00 27.85 ? 125 PHE B O   1 
ATOM   3937 C CB  . PHE B 1 123 ? -7.460  -40.665 38.416 1.00 27.34 ? 125 PHE B CB  1 
ATOM   3938 C CG  . PHE B 1 123 ? -5.987  -40.341 38.627 1.00 28.35 ? 125 PHE B CG  1 
ATOM   3939 C CD1 . PHE B 1 123 ? -5.329  -40.788 39.782 1.00 27.76 ? 125 PHE B CD1 1 
ATOM   3940 C CD2 . PHE B 1 123 ? -5.277  -39.546 37.708 1.00 27.88 ? 125 PHE B CD2 1 
ATOM   3941 C CE1 . PHE B 1 123 ? -4.004  -40.455 40.032 1.00 27.22 ? 125 PHE B CE1 1 
ATOM   3942 C CE2 . PHE B 1 123 ? -3.950  -39.209 37.928 1.00 28.10 ? 125 PHE B CE2 1 
ATOM   3943 C CZ  . PHE B 1 123 ? -3.296  -39.666 39.105 1.00 26.35 ? 125 PHE B CZ  1 
ATOM   3944 N N   . ASP B 1 124 ? -9.676  -42.953 38.571 1.00 26.00 ? 126 ASP B N   1 
ATOM   3945 C CA  . ASP B 1 124 ? -11.034 -42.780 39.039 1.00 25.97 ? 126 ASP B CA  1 
ATOM   3946 C C   . ASP B 1 124 ? -11.206 -41.340 39.597 1.00 25.60 ? 126 ASP B C   1 
ATOM   3947 O O   . ASP B 1 124 ? -10.494 -40.965 40.517 1.00 25.71 ? 126 ASP B O   1 
ATOM   3948 C CB  . ASP B 1 124 ? -11.296 -43.851 40.126 1.00 26.14 ? 126 ASP B CB  1 
ATOM   3949 C CG  . ASP B 1 124 ? -12.724 -43.925 40.559 1.00 26.24 ? 126 ASP B CG  1 
ATOM   3950 O OD1 . ASP B 1 124 ? -13.488 -42.926 40.479 1.00 25.08 ? 126 ASP B OD1 1 
ATOM   3951 O OD2 . ASP B 1 124 ? -13.087 -45.019 41.045 1.00 29.77 ? 126 ASP B OD2 1 
ATOM   3952 N N   . PRO B 1 125 ? -12.110 -40.498 39.024 1.00 25.98 ? 127 PRO B N   1 
ATOM   3953 C CA  . PRO B 1 125 ? -12.224 -39.144 39.584 1.00 25.37 ? 127 PRO B CA  1 
ATOM   3954 C C   . PRO B 1 125 ? -12.384 -39.159 41.105 1.00 26.49 ? 127 PRO B C   1 
ATOM   3955 O O   . PRO B 1 125 ? -11.928 -38.250 41.766 1.00 26.81 ? 127 PRO B O   1 
ATOM   3956 C CB  . PRO B 1 125 ? -13.523 -38.611 38.952 1.00 25.59 ? 127 PRO B CB  1 
ATOM   3957 C CG  . PRO B 1 125 ? -13.579 -39.322 37.591 1.00 24.61 ? 127 PRO B CG  1 
ATOM   3958 C CD  . PRO B 1 125 ? -13.005 -40.692 37.844 1.00 25.21 ? 127 PRO B CD  1 
ATOM   3959 N N   . GLU B 1 126 ? -13.033 -40.194 41.639 1.00 26.81 ? 128 GLU B N   1 
ATOM   3960 C CA  . GLU B 1 126 ? -13.227 -40.339 43.084 1.00 27.44 ? 128 GLU B CA  1 
ATOM   3961 C C   . GLU B 1 126 ? -11.945 -40.302 43.939 1.00 26.33 ? 128 GLU B C   1 
ATOM   3962 O O   . GLU B 1 126 ? -11.941 -39.778 45.053 1.00 26.79 ? 128 GLU B O   1 
ATOM   3963 C CB  . GLU B 1 126 ? -14.021 -41.608 43.347 1.00 27.72 ? 128 GLU B CB  1 
ATOM   3964 C CG  . GLU B 1 126 ? -14.591 -41.783 44.727 1.00 32.75 ? 128 GLU B CG  1 
ATOM   3965 C CD  . GLU B 1 126 ? -15.322 -40.564 45.309 1.00 37.57 ? 128 GLU B CD  1 
ATOM   3966 O OE1 . GLU B 1 126 ? -16.002 -39.732 44.580 1.00 30.75 ? 128 GLU B OE1 1 
ATOM   3967 O OE2 . GLU B 1 126 ? -15.158 -40.474 46.558 1.00 37.77 ? 128 GLU B OE2 1 
ATOM   3968 N N   . ASP B 1 127 ? -10.871 -40.877 43.442 1.00 24.95 ? 129 ASP B N   1 
ATOM   3969 C CA  . ASP B 1 127 ? -9.607  -40.782 44.129 1.00 25.58 ? 129 ASP B CA  1 
ATOM   3970 C C   . ASP B 1 127 ? -9.074  -39.331 44.142 1.00 25.93 ? 129 ASP B C   1 
ATOM   3971 O O   . ASP B 1 127 ? -8.513  -38.884 45.164 1.00 26.08 ? 129 ASP B O   1 
ATOM   3972 C CB  . ASP B 1 127 ? -8.619  -41.810 43.573 1.00 25.43 ? 129 ASP B CB  1 
ATOM   3973 C CG  . ASP B 1 127 ? -9.159  -43.265 43.739 1.00 28.84 ? 129 ASP B CG  1 
ATOM   3974 O OD1 . ASP B 1 127 ? -9.960  -43.504 44.687 1.00 27.75 ? 129 ASP B OD1 1 
ATOM   3975 O OD2 . ASP B 1 127 ? -8.843  -44.152 42.903 1.00 32.25 ? 129 ASP B OD2 1 
ATOM   3976 N N   . ILE B 1 128 ? -9.341  -38.566 43.080 1.00 25.06 ? 130 ILE B N   1 
ATOM   3977 C CA  . ILE B 1 128 ? -8.927  -37.151 43.049 1.00 23.45 ? 130 ILE B CA  1 
ATOM   3978 C C   . ILE B 1 128 ? -9.785  -36.295 43.990 1.00 24.58 ? 130 ILE B C   1 
ATOM   3979 O O   . ILE B 1 128 ? -9.265  -35.478 44.748 1.00 23.60 ? 130 ILE B O   1 
ATOM   3980 C CB  . ILE B 1 128 ? -8.922  -36.581 41.603 1.00 23.88 ? 130 ILE B CB  1 
ATOM   3981 C CG1 . ILE B 1 128 ? -7.807  -37.271 40.818 1.00 22.11 ? 130 ILE B CG1 1 
ATOM   3982 C CG2 . ILE B 1 128 ? -8.729  -35.019 41.638 1.00 19.27 ? 130 ILE B CG2 1 
ATOM   3983 C CD1 . ILE B 1 128 ? -7.927  -37.277 39.328 1.00 20.75 ? 130 ILE B CD1 1 
ATOM   3984 N N   . ILE B 1 129 ? -11.100 -36.505 43.948 1.00 24.09 ? 131 ILE B N   1 
ATOM   3985 C CA  . ILE B 1 129 ? -12.051 -35.795 44.822 1.00 24.58 ? 131 ILE B CA  1 
ATOM   3986 C C   . ILE B 1 129 ? -11.731 -36.030 46.316 1.00 25.29 ? 131 ILE B C   1 
ATOM   3987 O O   . ILE B 1 129 ? -11.765 -35.094 47.111 1.00 24.13 ? 131 ILE B O   1 
ATOM   3988 C CB  . ILE B 1 129 ? -13.491 -36.192 44.463 1.00 24.88 ? 131 ILE B CB  1 
ATOM   3989 C CG1 . ILE B 1 129 ? -13.772 -35.778 43.005 1.00 23.82 ? 131 ILE B CG1 1 
ATOM   3990 C CG2 . ILE B 1 129 ? -14.549 -35.642 45.482 1.00 25.07 ? 131 ILE B CG2 1 
ATOM   3991 C CD1 . ILE B 1 129 ? -15.087 -36.402 42.490 1.00 28.86 ? 131 ILE B CD1 1 
ATOM   3992 N N   . ARG B 1 130 ? -11.402 -37.268 46.685 1.00 25.77 ? 132 ARG B N   1 
ATOM   3993 C CA  . ARG B 1 130 ? -11.095 -37.570 48.063 1.00 27.28 ? 132 ARG B CA  1 
ATOM   3994 C C   . ARG B 1 130 ? -9.844  -36.790 48.504 1.00 26.91 ? 132 ARG B C   1 
ATOM   3995 O O   . ARG B 1 130 ? -9.747  -36.322 49.660 1.00 25.97 ? 132 ARG B O   1 
ATOM   3996 C CB  . ARG B 1 130 ? -10.893 -39.071 48.224 1.00 28.38 ? 132 ARG B CB  1 
ATOM   3997 C CG  . ARG B 1 130 ? -10.568 -39.475 49.609 1.00 33.12 ? 132 ARG B CG  1 
ATOM   3998 C CD  . ARG B 1 130 ? -9.904  -40.816 49.612 1.00 38.10 ? 132 ARG B CD  1 
ATOM   3999 N NE  . ARG B 1 130 ? -10.841 -41.838 49.182 1.00 42.92 ? 132 ARG B NE  1 
ATOM   4000 C CZ  . ARG B 1 130 ? -10.620 -42.711 48.206 1.00 43.81 ? 132 ARG B CZ  1 
ATOM   4001 N NH1 . ARG B 1 130 ? -9.447  -42.720 47.551 1.00 42.07 ? 132 ARG B NH1 1 
ATOM   4002 N NH2 . ARG B 1 130 ? -11.573 -43.602 47.922 1.00 44.40 ? 132 ARG B NH2 1 
ATOM   4003 N N   . GLU B 1 131 ? -8.888  -36.668 47.589 1.00 25.81 ? 133 GLU B N   1 
ATOM   4004 C CA  . GLU B 1 131 ? -7.668  -35.945 47.879 1.00 26.81 ? 133 GLU B CA  1 
ATOM   4005 C C   . GLU B 1 131 ? -7.955  -34.443 47.974 1.00 26.00 ? 133 GLU B C   1 
ATOM   4006 O O   . GLU B 1 131 ? -7.363  -33.774 48.827 1.00 27.89 ? 133 GLU B O   1 
ATOM   4007 C CB  . GLU B 1 131 ? -6.574  -36.305 46.866 1.00 26.23 ? 133 GLU B CB  1 
ATOM   4008 C CG  . GLU B 1 131 ? -5.170  -35.920 47.269 1.00 31.24 ? 133 GLU B CG  1 
ATOM   4009 C CD  . GLU B 1 131 ? -4.558  -36.847 48.389 1.00 32.98 ? 133 GLU B CD  1 
ATOM   4010 O OE1 . GLU B 1 131 ? -5.248  -37.693 48.947 1.00 33.89 ? 133 GLU B OE1 1 
ATOM   4011 O OE2 . GLU B 1 131 ? -3.367  -36.732 48.661 1.00 36.55 ? 133 GLU B OE2 1 
ATOM   4012 N N   . ILE B 1 132 ? -8.874  -33.925 47.152 1.00 25.60 ? 134 ILE B N   1 
ATOM   4013 C CA  . ILE B 1 132 ? -9.337  -32.518 47.190 1.00 25.20 ? 134 ILE B CA  1 
ATOM   4014 C C   . ILE B 1 132 ? -9.923  -32.198 48.578 1.00 27.53 ? 134 ILE B C   1 
ATOM   4015 O O   . ILE B 1 132 ? -9.565  -31.206 49.222 1.00 27.77 ? 134 ILE B O   1 
ATOM   4016 C CB  . ILE B 1 132 ? -10.391 -32.199 46.098 1.00 24.94 ? 134 ILE B CB  1 
ATOM   4017 C CG1 . ILE B 1 132 ? -9.756  -32.321 44.695 1.00 25.77 ? 134 ILE B CG1 1 
ATOM   4018 C CG2 . ILE B 1 132 ? -11.036 -30.779 46.360 1.00 22.80 ? 134 ILE B CG2 1 
ATOM   4019 C CD1 . ILE B 1 132 ? -10.697 -32.146 43.469 1.00 25.56 ? 134 ILE B CD1 1 
ATOM   4020 N N   . LYS B 1 133 ? -10.764 -33.101 49.048 1.00 27.41 ? 135 LYS B N   1 
ATOM   4021 C CA  . LYS B 1 133 ? -11.455 -32.969 50.305 1.00 29.03 ? 135 LYS B CA  1 
ATOM   4022 C C   . LYS B 1 133 ? -10.438 -32.921 51.469 1.00 28.68 ? 135 LYS B C   1 
ATOM   4023 O O   . LYS B 1 133 ? -10.555 -32.079 52.385 1.00 28.33 ? 135 LYS B O   1 
ATOM   4024 C CB  . LYS B 1 133 ? -12.450 -34.145 50.411 1.00 28.19 ? 135 LYS B CB  1 
ATOM   4025 C CG  . LYS B 1 133 ? -13.277 -34.205 51.693 1.00 33.62 ? 135 LYS B CG  1 
ATOM   4026 C CD  . LYS B 1 133 ? -13.543 -35.678 52.208 1.00 36.84 ? 135 LYS B CD  1 
ATOM   4027 C CE  . LYS B 1 133 ? -12.276 -36.290 52.972 1.00 38.44 ? 135 LYS B CE  1 
ATOM   4028 N NZ  . LYS B 1 133 ? -11.192 -36.810 52.005 1.00 28.33 ? 135 LYS B NZ  1 
ATOM   4029 N N   . LYS B 1 134 ? -9.461  -33.829 51.391 1.00 28.31 ? 136 LYS B N   1 
ATOM   4030 C CA  . LYS B 1 134 ? -8.422  -34.018 52.380 1.00 29.53 ? 136 LYS B CA  1 
ATOM   4031 C C   . LYS B 1 134 ? -7.461  -32.803 52.421 1.00 29.76 ? 136 LYS B C   1 
ATOM   4032 O O   . LYS B 1 134 ? -7.328  -32.172 53.457 1.00 29.50 ? 136 LYS B O   1 
ATOM   4033 C CB  . LYS B 1 134 ? -7.679  -35.335 52.091 1.00 29.20 ? 136 LYS B CB  1 
ATOM   4034 C CG  . LYS B 1 134 ? -6.300  -35.531 52.772 1.00 32.88 ? 136 LYS B CG  1 
ATOM   4035 C CD  . LYS B 1 134 ? -5.635  -36.841 52.265 1.00 37.07 ? 136 LYS B CD  1 
ATOM   4036 C CE  . LYS B 1 134 ? -4.179  -36.957 52.666 1.00 42.25 ? 136 LYS B CE  1 
ATOM   4037 N NZ  . LYS B 1 134 ? -3.315  -37.325 51.490 1.00 44.21 ? 136 LYS B NZ  1 
ATOM   4038 N N   . VAL B 1 135 ? -6.806  -32.470 51.313 1.00 29.38 ? 137 VAL B N   1 
ATOM   4039 C CA  . VAL B 1 135 ? -5.862  -31.344 51.347 1.00 30.75 ? 137 VAL B CA  1 
ATOM   4040 C C   . VAL B 1 135 ? -6.496  -29.926 51.252 1.00 31.06 ? 137 VAL B C   1 
ATOM   4041 O O   . VAL B 1 135 ? -5.912  -28.973 51.719 1.00 31.92 ? 137 VAL B O   1 
ATOM   4042 C CB  . VAL B 1 135 ? -4.557  -31.533 50.437 1.00 30.89 ? 137 VAL B CB  1 
ATOM   4043 C CG1 . VAL B 1 135 ? -4.563  -32.795 49.629 1.00 31.79 ? 137 VAL B CG1 1 
ATOM   4044 C CG2 . VAL B 1 135 ? -4.263  -30.304 49.576 1.00 29.84 ? 137 VAL B CG2 1 
ATOM   4045 N N   . LYS B 1 136 ? -7.701  -29.785 50.702 1.00 30.42 ? 138 LYS B N   1 
ATOM   4046 C CA  . LYS B 1 136 ? -8.296  -28.464 50.560 1.00 29.36 ? 138 LYS B CA  1 
ATOM   4047 C C   . LYS B 1 136 ? -7.324  -27.496 49.884 1.00 29.49 ? 138 LYS B C   1 
ATOM   4048 O O   . LYS B 1 136 ? -6.969  -26.425 50.440 1.00 29.02 ? 138 LYS B O   1 
ATOM   4049 C CB  . LYS B 1 136 ? -8.803  -27.945 51.908 1.00 30.64 ? 138 LYS B CB  1 
ATOM   4050 C CG  . LYS B 1 136 ? -10.142 -28.626 52.266 1.00 32.19 ? 138 LYS B CG  1 
ATOM   4051 C CD  . LYS B 1 136 ? -10.573 -28.386 53.682 1.00 37.22 ? 138 LYS B CD  1 
ATOM   4052 C CE  . LYS B 1 136 ? -11.575 -29.491 54.122 1.00 37.85 ? 138 LYS B CE  1 
ATOM   4053 N NZ  . LYS B 1 136 ? -10.865 -30.457 55.051 1.00 39.05 ? 138 LYS B NZ  1 
ATOM   4054 N N   . PRO B 1 137 ? -6.884  -27.873 48.663 1.00 28.32 ? 139 PRO B N   1 
ATOM   4055 C CA  . PRO B 1 137 ? -5.993  -27.044 47.870 1.00 27.53 ? 139 PRO B CA  1 
ATOM   4056 C C   . PRO B 1 137 ? -6.666  -25.758 47.396 1.00 26.87 ? 139 PRO B C   1 
ATOM   4057 O O   . PRO B 1 137 ? -7.890  -25.704 47.215 1.00 27.10 ? 139 PRO B O   1 
ATOM   4058 C CB  . PRO B 1 137 ? -5.684  -27.935 46.684 1.00 26.48 ? 139 PRO B CB  1 
ATOM   4059 C CG  . PRO B 1 137 ? -6.991  -28.663 46.481 1.00 28.72 ? 139 PRO B CG  1 
ATOM   4060 C CD  . PRO B 1 137 ? -7.324  -29.058 47.901 1.00 27.57 ? 139 PRO B CD  1 
ATOM   4061 N N   . LYS B 1 138 ? -5.865  -24.727 47.195 1.00 27.45 ? 140 LYS B N   1 
ATOM   4062 C CA  . LYS B 1 138 ? -6.354  -23.492 46.577 1.00 26.84 ? 140 LYS B CA  1 
ATOM   4063 C C   . LYS B 1 138 ? -6.666  -23.762 45.108 1.00 26.66 ? 140 LYS B C   1 
ATOM   4064 O O   . LYS B 1 138 ? -7.591  -23.145 44.517 1.00 26.71 ? 140 LYS B O   1 
ATOM   4065 C CB  . LYS B 1 138 ? -5.295  -22.391 46.701 1.00 26.88 ? 140 LYS B CB  1 
ATOM   4066 C CG  . LYS B 1 138 ? -5.663  -21.088 45.942 1.00 28.84 ? 140 LYS B CG  1 
ATOM   4067 C CD  . LYS B 1 138 ? -4.703  -19.934 46.207 1.00 27.37 ? 140 LYS B CD  1 
ATOM   4068 C CE  . LYS B 1 138 ? -5.137  -18.662 45.474 1.00 26.91 ? 140 LYS B CE  1 
ATOM   4069 N NZ  . LYS B 1 138 ? -4.048  -17.614 45.527 1.00 29.25 ? 140 LYS B NZ  1 
ATOM   4070 N N   . ILE B 1 139 ? -5.900  -24.685 44.514 1.00 26.61 ? 141 ILE B N   1 
ATOM   4071 C CA  . ILE B 1 139 ? -5.881  -24.910 43.060 1.00 25.70 ? 141 ILE B CA  1 
ATOM   4072 C C   . ILE B 1 139 ? -5.714  -26.411 42.809 1.00 26.64 ? 141 ILE B C   1 
ATOM   4073 O O   . ILE B 1 139 ? -4.987  -27.123 43.558 1.00 26.15 ? 141 ILE B O   1 
ATOM   4074 C CB  . ILE B 1 139 ? -4.716  -24.158 42.367 1.00 27.36 ? 141 ILE B CB  1 
ATOM   4075 C CG1 . ILE B 1 139 ? -4.921  -22.643 42.461 1.00 27.48 ? 141 ILE B CG1 1 
ATOM   4076 C CG2 . ILE B 1 139 ? -4.529  -24.563 40.863 1.00 23.57 ? 141 ILE B CG2 1 
ATOM   4077 C CD1 . ILE B 1 139 ? -3.646  -21.958 42.683 1.00 25.61 ? 141 ILE B CD1 1 
ATOM   4078 N N   . VAL B 1 140 ? -6.453  -26.881 41.808 1.00 24.99 ? 142 VAL B N   1 
ATOM   4079 C CA  . VAL B 1 140 ? -6.318  -28.197 41.284 1.00 25.37 ? 142 VAL B CA  1 
ATOM   4080 C C   . VAL B 1 140 ? -5.979  -27.957 39.817 1.00 25.97 ? 142 VAL B C   1 
ATOM   4081 O O   . VAL B 1 140 ? -6.758  -27.325 39.066 1.00 25.68 ? 142 VAL B O   1 
ATOM   4082 C CB  . VAL B 1 140 ? -7.670  -29.039 41.422 1.00 26.33 ? 142 VAL B CB  1 
ATOM   4083 C CG1 . VAL B 1 140 ? -7.582  -30.343 40.642 1.00 25.69 ? 142 VAL B CG1 1 
ATOM   4084 C CG2 . VAL B 1 140 ? -7.984  -29.363 42.914 1.00 21.82 ? 142 VAL B CG2 1 
ATOM   4085 N N   . ALA B 1 141 ? -4.801  -28.426 39.412 1.00 25.35 ? 143 ALA B N   1 
ATOM   4086 C CA  . ALA B 1 141 ? -4.362  -28.229 38.062 1.00 24.94 ? 143 ALA B CA  1 
ATOM   4087 C C   . ALA B 1 141 ? -4.236  -29.557 37.389 1.00 25.06 ? 143 ALA B C   1 
ATOM   4088 O O   . ALA B 1 141 ? -3.604  -30.480 37.959 1.00 24.99 ? 143 ALA B O   1 
ATOM   4089 C CB  . ALA B 1 141 ? -2.993  -27.464 38.012 1.00 24.68 ? 143 ALA B CB  1 
ATOM   4090 N N   . MET B 1 142 ? -4.778  -29.652 36.168 1.00 23.84 ? 144 MET B N   1 
ATOM   4091 C CA  . MET B 1 142 ? -4.825  -30.913 35.497 1.00 25.35 ? 144 MET B CA  1 
ATOM   4092 C C   . MET B 1 142 ? -4.857  -30.802 33.970 1.00 25.79 ? 144 MET B C   1 
ATOM   4093 O O   . MET B 1 142 ? -5.416  -29.833 33.414 1.00 25.04 ? 144 MET B O   1 
ATOM   4094 C CB  . MET B 1 142 ? -6.103  -31.582 36.007 1.00 26.88 ? 144 MET B CB  1 
ATOM   4095 C CG  . MET B 1 142 ? -6.395  -32.939 35.472 1.00 28.92 ? 144 MET B CG  1 
ATOM   4096 S SD  . MET B 1 142 ? -7.610  -33.660 36.582 1.00 33.49 ? 144 MET B SD  1 
ATOM   4097 C CE  . MET B 1 142 ? -7.435  -35.317 35.928 1.00 25.85 ? 144 MET B CE  1 
ATOM   4098 N N   . VAL B 1 143 ? -4.232  -31.794 33.308 1.00 25.93 ? 145 VAL B N   1 
ATOM   4099 C CA  . VAL B 1 143 ? -4.269  -31.950 31.875 1.00 24.06 ? 145 VAL B CA  1 
ATOM   4100 C C   . VAL B 1 143 ? -5.593  -32.655 31.510 1.00 25.94 ? 145 VAL B C   1 
ATOM   4101 O O   . VAL B 1 143 ? -5.944  -33.747 32.026 1.00 25.62 ? 145 VAL B O   1 
ATOM   4102 C CB  . VAL B 1 143 ? -3.047  -32.750 31.344 1.00 24.84 ? 145 VAL B CB  1 
ATOM   4103 C CG1 . VAL B 1 143 ? -3.023  -32.775 29.813 1.00 24.82 ? 145 VAL B CG1 1 
ATOM   4104 C CG2 . VAL B 1 143 ? -1.658  -32.186 31.896 1.00 22.19 ? 145 VAL B CG2 1 
ATOM   4105 N N   . HIS B 1 144 ? -6.350  -32.023 30.633 1.00 25.92 ? 146 HIS B N   1 
ATOM   4106 C CA  . HIS B 1 144 ? -7.504  -32.677 30.026 1.00 24.70 ? 146 HIS B CA  1 
ATOM   4107 C C   . HIS B 1 144 ? -7.146  -33.913 29.164 1.00 25.91 ? 146 HIS B C   1 
ATOM   4108 O O   . HIS B 1 144 ? -7.719  -35.015 29.378 1.00 26.15 ? 146 HIS B O   1 
ATOM   4109 C CB  . HIS B 1 144 ? -8.267  -31.689 29.194 1.00 22.92 ? 146 HIS B CB  1 
ATOM   4110 C CG  . HIS B 1 144 ? -9.555  -32.226 28.658 1.00 25.53 ? 146 HIS B CG  1 
ATOM   4111 N ND1 . HIS B 1 144 ? -10.156 -31.700 27.541 1.00 17.57 ? 146 HIS B ND1 1 
ATOM   4112 C CD2 . HIS B 1 144 ? -10.361 -33.230 29.091 1.00 19.48 ? 146 HIS B CD2 1 
ATOM   4113 C CE1 . HIS B 1 144 ? -11.281 -32.351 27.306 1.00 21.31 ? 146 HIS B CE1 1 
ATOM   4114 N NE2 . HIS B 1 144 ? -11.459 -33.237 28.267 1.00 16.69 ? 146 HIS B NE2 1 
ATOM   4115 N N   . GLY B 1 145 ? -6.258  -33.721 28.194 1.00 24.63 ? 147 GLY B N   1 
ATOM   4116 C CA  . GLY B 1 145 ? -5.826  -34.803 27.314 1.00 25.48 ? 147 GLY B CA  1 
ATOM   4117 C C   . GLY B 1 145 ? -4.309  -34.838 27.167 1.00 26.80 ? 147 GLY B C   1 
ATOM   4118 O O   . GLY B 1 145 ? -3.707  -33.896 26.676 1.00 26.25 ? 147 GLY B O   1 
ATOM   4119 N N   . GLU B 1 146 ? -3.695  -35.942 27.586 1.00 26.68 ? 148 GLU B N   1 
ATOM   4120 C CA  . GLU B 1 146 ? -2.245  -36.110 27.575 1.00 26.54 ? 148 GLU B CA  1 
ATOM   4121 C C   . GLU B 1 146 ? -1.859  -36.789 26.302 1.00 26.92 ? 148 GLU B C   1 
ATOM   4122 O O   . GLU B 1 146 ? -2.143  -38.011 26.122 1.00 27.32 ? 148 GLU B O   1 
ATOM   4123 C CB  . GLU B 1 146 ? -1.810  -37.091 28.695 1.00 27.11 ? 148 GLU B CB  1 
ATOM   4124 C CG  . GLU B 1 146 ? -1.581  -36.486 30.041 1.00 28.33 ? 148 GLU B CG  1 
ATOM   4125 C CD  . GLU B 1 146 ? -0.263  -35.733 30.154 1.00 28.84 ? 148 GLU B CD  1 
ATOM   4126 O OE1 . GLU B 1 146 ? 0.558   -35.795 29.216 1.00 30.76 ? 148 GLU B OE1 1 
ATOM   4127 O OE2 . GLU B 1 146 ? -0.033  -35.114 31.204 1.00 28.74 ? 148 GLU B OE2 1 
ATOM   4128 N N   . THR B 1 147 ? -1.191  -36.060 25.427 1.00 26.85 ? 149 THR B N   1 
ATOM   4129 C CA  . THR B 1 147 ? -0.765  -36.634 24.184 1.00 28.74 ? 149 THR B CA  1 
ATOM   4130 C C   . THR B 1 147 ? 0.337   -37.637 24.438 1.00 27.35 ? 149 THR B C   1 
ATOM   4131 O O   . THR B 1 147 ? 0.525   -38.504 23.633 1.00 27.06 ? 149 THR B O   1 
ATOM   4132 C CB  . THR B 1 147 ? -0.294  -35.583 23.114 1.00 29.31 ? 149 THR B CB  1 
ATOM   4133 O OG1 . THR B 1 147 ? 0.624   -34.643 23.691 1.00 32.76 ? 149 THR B OG1 1 
ATOM   4134 C CG2 . THR B 1 147 ? -1.459  -34.843 22.575 1.00 34.69 ? 149 THR B CG2 1 
ATOM   4135 N N   . SER B 1 148 ? 1.095   -37.499 25.533 1.00 28.33 ? 150 SER B N   1 
ATOM   4136 C CA  . SER B 1 148 ? 2.217   -38.436 25.808 1.00 27.26 ? 150 SER B CA  1 
ATOM   4137 C C   . SER B 1 148 ? 1.761   -39.888 25.973 1.00 26.94 ? 150 SER B C   1 
ATOM   4138 O O   . SER B 1 148 ? 2.448   -40.801 25.538 1.00 27.42 ? 150 SER B O   1 
ATOM   4139 C CB  . SER B 1 148 ? 3.026   -38.031 27.040 1.00 27.38 ? 150 SER B CB  1 
ATOM   4140 O OG  . SER B 1 148 ? 2.205   -38.068 28.186 1.00 27.20 ? 150 SER B OG  1 
ATOM   4141 N N   . THR B 1 149 ? 0.633   -40.097 26.630 1.00 26.89 ? 151 THR B N   1 
ATOM   4142 C CA  . THR B 1 149 ? 0.091   -41.458 26.831 1.00 27.50 ? 151 THR B CA  1 
ATOM   4143 C C   . THR B 1 149 ? -1.127  -41.745 25.955 1.00 27.31 ? 151 THR B C   1 
ATOM   4144 O O   . THR B 1 149 ? -1.711  -42.799 26.026 1.00 27.22 ? 151 THR B O   1 
ATOM   4145 C CB  . THR B 1 149 ? -0.323  -41.636 28.258 1.00 26.69 ? 151 THR B CB  1 
ATOM   4146 O OG1 . THR B 1 149 ? -1.445  -40.794 28.519 1.00 29.04 ? 151 THR B OG1 1 
ATOM   4147 C CG2 . THR B 1 149 ? 0.831   -41.231 29.204 1.00 28.45 ? 151 THR B CG2 1 
ATOM   4148 N N   . GLY B 1 150 ? -1.528  -40.793 25.131 1.00 27.54 ? 152 GLY B N   1 
ATOM   4149 C CA  . GLY B 1 150 ? -2.820  -40.918 24.448 1.00 26.67 ? 152 GLY B CA  1 
ATOM   4150 C C   . GLY B 1 150 ? -4.126  -41.062 25.228 1.00 26.88 ? 152 GLY B C   1 
ATOM   4151 O O   . GLY B 1 150 ? -5.087  -41.583 24.656 1.00 24.95 ? 152 GLY B O   1 
ATOM   4152 N N   . ARG B 1 151 ? -4.200  -40.617 26.496 1.00 26.01 ? 153 ARG B N   1 
ATOM   4153 C CA  . ARG B 1 151 ? -5.492  -40.652 27.253 1.00 26.36 ? 153 ARG B CA  1 
ATOM   4154 C C   . ARG B 1 151 ? -6.086  -39.324 27.517 1.00 25.85 ? 153 ARG B C   1 
ATOM   4155 O O   . ARG B 1 151 ? -5.358  -38.346 27.700 1.00 25.08 ? 153 ARG B O   1 
ATOM   4156 C CB  . ARG B 1 151 ? -5.360  -41.316 28.632 1.00 26.04 ? 153 ARG B CB  1 
ATOM   4157 C CG  . ARG B 1 151 ? -4.334  -42.376 28.572 1.00 29.88 ? 153 ARG B CG  1 
ATOM   4158 C CD  . ARG B 1 151 ? -4.690  -43.745 28.238 1.00 29.58 ? 153 ARG B CD  1 
ATOM   4159 N NE  . ARG B 1 151 ? -5.297  -44.288 27.024 1.00 34.90 ? 153 ARG B NE  1 
ATOM   4160 C CZ  . ARG B 1 151 ? -4.801  -44.731 25.850 1.00 32.43 ? 153 ARG B CZ  1 
ATOM   4161 N NH1 . ARG B 1 151 ? -3.598  -44.487 25.359 1.00 30.87 ? 153 ARG B NH1 1 
ATOM   4162 N NH2 . ARG B 1 151 ? -5.658  -45.398 25.065 1.00 28.19 ? 153 ARG B NH2 1 
ATOM   4163 N N   . ILE B 1 152 ? -7.414  -39.339 27.571 1.00 25.10 ? 154 ILE B N   1 
ATOM   4164 C CA  . ILE B 1 152 ? -8.240  -38.174 27.812 1.00 25.57 ? 154 ILE B CA  1 
ATOM   4165 C C   . ILE B 1 152 ? -8.903  -38.363 29.180 1.00 26.38 ? 154 ILE B C   1 
ATOM   4166 O O   . ILE B 1 152 ? -9.382  -39.470 29.521 1.00 26.31 ? 154 ILE B O   1 
ATOM   4167 C CB  . ILE B 1 152 ? -9.288  -37.893 26.628 1.00 24.94 ? 154 ILE B CB  1 
ATOM   4168 C CG1 . ILE B 1 152 ? -9.958  -36.535 26.858 1.00 24.44 ? 154 ILE B CG1 1 
ATOM   4169 C CG2 . ILE B 1 152 ? -10.332 -39.068 26.422 1.00 22.10 ? 154 ILE B CG2 1 
ATOM   4170 C CD1 . ILE B 1 152 ? -10.655 -35.972 25.602 1.00 23.08 ? 154 ILE B CD1 1 
ATOM   4171 N N   . HIS B 1 153 ? -8.865  -37.343 30.036 1.00 25.12 ? 155 HIS B N   1 
ATOM   4172 C CA  . HIS B 1 153 ? -9.440  -37.596 31.413 1.00 25.02 ? 155 HIS B CA  1 
ATOM   4173 C C   . HIS B 1 153 ? -10.862 -37.023 31.601 1.00 23.13 ? 155 HIS B C   1 
ATOM   4174 O O   . HIS B 1 153 ? -11.068 -35.891 31.261 1.00 22.56 ? 155 HIS B O   1 
ATOM   4175 C CB  . HIS B 1 153 ? -8.521  -37.000 32.465 1.00 24.72 ? 155 HIS B CB  1 
ATOM   4176 C CG  . HIS B 1 153 ? -8.637  -37.644 33.800 1.00 27.61 ? 155 HIS B CG  1 
ATOM   4177 N ND1 . HIS B 1 153 ? -7.607  -38.368 34.361 1.00 31.92 ? 155 HIS B ND1 1 
ATOM   4178 C CD2 . HIS B 1 153 ? -9.655  -37.683 34.683 1.00 22.19 ? 155 HIS B CD2 1 
ATOM   4179 C CE1 . HIS B 1 153 ? -7.997  -38.842 35.528 1.00 28.58 ? 155 HIS B CE1 1 
ATOM   4180 N NE2 . HIS B 1 153 ? -9.229  -38.433 35.750 1.00 29.51 ? 155 HIS B NE2 1 
ATOM   4181 N N   . PRO B 1 154 ? -11.845 -37.812 32.123 1.00 23.18 ? 156 PRO B N   1 
ATOM   4182 C CA  . PRO B 1 154 ? -13.153 -37.204 32.534 1.00 23.86 ? 156 PRO B CA  1 
ATOM   4183 C C   . PRO B 1 154 ? -12.962 -36.072 33.569 1.00 24.13 ? 156 PRO B C   1 
ATOM   4184 O O   . PRO B 1 154 ? -12.276 -36.274 34.581 1.00 21.97 ? 156 PRO B O   1 
ATOM   4185 C CB  . PRO B 1 154 ? -13.951 -38.396 33.168 1.00 24.12 ? 156 PRO B CB  1 
ATOM   4186 C CG  . PRO B 1 154 ? -13.076 -39.637 32.970 1.00 25.02 ? 156 PRO B CG  1 
ATOM   4187 C CD  . PRO B 1 154 ? -11.739 -39.253 32.455 1.00 21.82 ? 156 PRO B CD  1 
ATOM   4188 N N   . LEU B 1 155 ? -13.609 -34.917 33.361 1.00 24.86 ? 157 LEU B N   1 
ATOM   4189 C CA  . LEU B 1 155 ? -13.350 -33.758 34.260 1.00 25.11 ? 157 LEU B CA  1 
ATOM   4190 C C   . LEU B 1 155 ? -14.544 -33.175 35.041 1.00 25.36 ? 157 LEU B C   1 
ATOM   4191 O O   . LEU B 1 155 ? -14.343 -32.340 35.933 1.00 26.16 ? 157 LEU B O   1 
ATOM   4192 C CB  . LEU B 1 155 ? -12.724 -32.593 33.478 1.00 25.24 ? 157 LEU B CB  1 
ATOM   4193 C CG  . LEU B 1 155 ? -11.611 -32.920 32.500 1.00 27.43 ? 157 LEU B CG  1 
ATOM   4194 C CD1 . LEU B 1 155 ? -11.341 -31.649 31.700 1.00 29.05 ? 157 LEU B CD1 1 
ATOM   4195 C CD2 . LEU B 1 155 ? -10.347 -33.368 33.271 1.00 29.99 ? 157 LEU B CD2 1 
ATOM   4196 N N   . LYS B 1 156 ? -15.756 -33.571 34.677 1.00 23.54 ? 158 LYS B N   1 
ATOM   4197 C CA  . LYS B 1 156 ? -16.956 -33.011 35.220 1.00 24.21 ? 158 LYS B CA  1 
ATOM   4198 C C   . LYS B 1 156 ? -17.039 -33.201 36.747 1.00 23.69 ? 158 LYS B C   1 
ATOM   4199 O O   . LYS B 1 156 ? -17.221 -32.231 37.451 1.00 22.78 ? 158 LYS B O   1 
ATOM   4200 C CB  . LYS B 1 156 ? -18.200 -33.642 34.558 1.00 22.59 ? 158 LYS B CB  1 
ATOM   4201 C CG  . LYS B 1 156 ? -19.527 -33.056 35.052 1.00 25.50 ? 158 LYS B CG  1 
ATOM   4202 C CD  . LYS B 1 156 ? -20.681 -33.555 34.185 1.00 29.39 ? 158 LYS B CD  1 
ATOM   4203 C CE  . LYS B 1 156 ? -21.888 -32.650 34.213 1.00 31.05 ? 158 LYS B CE  1 
ATOM   4204 N NZ  . LYS B 1 156 ? -22.721 -32.836 35.367 1.00 32.39 ? 158 LYS B NZ  1 
ATOM   4205 N N   . ALA B 1 157 ? -16.969 -34.429 37.250 1.00 25.06 ? 159 ALA B N   1 
ATOM   4206 C CA  . ALA B 1 157 ? -17.035 -34.662 38.727 1.00 25.88 ? 159 ALA B CA  1 
ATOM   4207 C C   . ALA B 1 157 ? -15.934 -33.879 39.497 1.00 25.96 ? 159 ALA B C   1 
ATOM   4208 O O   . ALA B 1 157 ? -16.181 -33.211 40.510 1.00 26.31 ? 159 ALA B O   1 
ATOM   4209 C CB  . ALA B 1 157 ? -17.008 -36.163 39.051 1.00 26.51 ? 159 ALA B CB  1 
ATOM   4210 N N   . ILE B 1 158 ? -14.726 -33.941 38.980 1.00 25.70 ? 160 ILE B N   1 
ATOM   4211 C CA  . ILE B 1 158 ? -13.599 -33.226 39.543 1.00 25.83 ? 160 ILE B CA  1 
ATOM   4212 C C   . ILE B 1 158 ? -13.860 -31.724 39.603 1.00 25.67 ? 160 ILE B C   1 
ATOM   4213 O O   . ILE B 1 158 ? -13.593 -31.109 40.623 1.00 25.80 ? 160 ILE B O   1 
ATOM   4214 C CB  . ILE B 1 158 ? -12.309 -33.474 38.758 1.00 25.84 ? 160 ILE B CB  1 
ATOM   4215 C CG1 . ILE B 1 158 ? -11.884 -34.955 38.841 1.00 24.76 ? 160 ILE B CG1 1 
ATOM   4216 C CG2 . ILE B 1 158 ? -11.174 -32.565 39.324 1.00 25.52 ? 160 ILE B CG2 1 
ATOM   4217 C CD1 . ILE B 1 158 ? -10.798 -35.380 37.803 1.00 21.98 ? 160 ILE B CD1 1 
ATOM   4218 N N   . GLY B 1 159 ? -14.412 -31.153 38.535 1.00 25.68 ? 161 GLY B N   1 
ATOM   4219 C CA  . GLY B 1 159 ? -14.796 -29.729 38.528 1.00 25.81 ? 161 GLY B CA  1 
ATOM   4220 C C   . GLY B 1 159 ? -15.844 -29.367 39.562 1.00 26.22 ? 161 GLY B C   1 
ATOM   4221 O O   . GLY B 1 159 ? -15.702 -28.356 40.283 1.00 27.00 ? 161 GLY B O   1 
ATOM   4222 N N   . GLU B 1 160 ? -16.891 -30.181 39.638 1.00 23.86 ? 162 GLU B N   1 
ATOM   4223 C CA  . GLU B 1 160 ? -17.948 -29.980 40.602 1.00 24.86 ? 162 GLU B CA  1 
ATOM   4224 C C   . GLU B 1 160 ? -17.402 -30.128 42.019 1.00 24.49 ? 162 GLU B C   1 
ATOM   4225 O O   . GLU B 1 160 ? -17.861 -29.442 42.957 1.00 23.98 ? 162 GLU B O   1 
ATOM   4226 C CB  . GLU B 1 160 ? -19.082 -31.011 40.406 1.00 24.84 ? 162 GLU B CB  1 
ATOM   4227 C CG  . GLU B 1 160 ? -19.883 -30.790 39.099 1.00 25.60 ? 162 GLU B CG  1 
ATOM   4228 C CD  . GLU B 1 160 ? -20.813 -31.956 38.746 1.00 30.56 ? 162 GLU B CD  1 
ATOM   4229 O OE1 . GLU B 1 160 ? -20.769 -33.034 39.411 1.00 32.02 ? 162 GLU B OE1 1 
ATOM   4230 O OE2 . GLU B 1 160 ? -21.623 -31.768 37.822 1.00 32.88 ? 162 GLU B OE2 1 
ATOM   4231 N N   . ALA B 1 161 ? -16.452 -31.039 42.201 1.00 23.38 ? 163 ALA B N   1 
ATOM   4232 C CA  . ALA B 1 161 ? -15.873 -31.134 43.537 1.00 23.81 ? 163 ALA B CA  1 
ATOM   4233 C C   . ALA B 1 161 ? -14.986 -29.906 43.906 1.00 24.17 ? 163 ALA B C   1 
ATOM   4234 O O   . ALA B 1 161 ? -15.014 -29.456 45.066 1.00 24.17 ? 163 ALA B O   1 
ATOM   4235 C CB  . ALA B 1 161 ? -15.160 -32.448 43.718 1.00 23.23 ? 163 ALA B CB  1 
ATOM   4236 N N   . CYS B 1 162 ? -14.230 -29.344 42.939 1.00 24.36 ? 164 CYS B N   1 
ATOM   4237 C CA  . CYS B 1 162 ? -13.419 -28.122 43.199 1.00 25.86 ? 164 CYS B CA  1 
ATOM   4238 C C   . CYS B 1 162 ? -14.323 -26.968 43.606 1.00 26.84 ? 164 CYS B C   1 
ATOM   4239 O O   . CYS B 1 162 ? -13.988 -26.205 44.523 1.00 28.32 ? 164 CYS B O   1 
ATOM   4240 C CB  . CYS B 1 162 ? -12.542 -27.683 41.980 1.00 23.78 ? 164 CYS B CB  1 
ATOM   4241 S SG  . CYS B 1 162 ? -11.338 -28.938 41.437 1.00 25.95 ? 164 CYS B SG  1 
ATOM   4242 N N   . ARG B 1 163 ? -15.454 -26.836 42.912 1.00 27.16 ? 165 ARG B N   1 
ATOM   4243 C CA  . ARG B 1 163 ? -16.379 -25.750 43.144 1.00 27.78 ? 165 ARG B CA  1 
ATOM   4244 C C   . ARG B 1 163 ? -17.011 -25.912 44.539 1.00 28.62 ? 165 ARG B C   1 
ATOM   4245 O O   . ARG B 1 163 ? -17.139 -24.914 45.270 1.00 28.10 ? 165 ARG B O   1 
ATOM   4246 C CB  . ARG B 1 163 ? -17.454 -25.742 42.058 1.00 27.75 ? 165 ARG B CB  1 
ATOM   4247 C CG  . ARG B 1 163 ? -18.431 -24.544 42.049 1.00 28.37 ? 165 ARG B CG  1 
ATOM   4248 C CD  . ARG B 1 163 ? -17.767 -23.210 41.654 1.00 28.59 ? 165 ARG B CD  1 
ATOM   4249 N NE  . ARG B 1 163 ? -17.097 -23.309 40.356 1.00 31.24 ? 165 ARG B NE  1 
ATOM   4250 C CZ  . ARG B 1 163 ? -17.553 -22.788 39.211 1.00 32.78 ? 165 ARG B CZ  1 
ATOM   4251 N NH1 . ARG B 1 163 ? -18.700 -22.122 39.199 1.00 31.59 ? 165 ARG B NH1 1 
ATOM   4252 N NH2 . ARG B 1 163 ? -16.839 -22.921 38.073 1.00 28.74 ? 165 ARG B NH2 1 
ATOM   4253 N N   . THR B 1 164 ? -17.379 -27.144 44.926 1.00 29.03 ? 166 THR B N   1 
ATOM   4254 C CA  . THR B 1 164 ? -17.958 -27.325 46.299 1.00 29.59 ? 166 THR B CA  1 
ATOM   4255 C C   . THR B 1 164 ? -16.936 -27.035 47.399 1.00 29.72 ? 166 THR B C   1 
ATOM   4256 O O   . THR B 1 164 ? -17.273 -26.434 48.402 1.00 28.97 ? 166 THR B O   1 
ATOM   4257 C CB  . THR B 1 164 ? -18.852 -28.615 46.584 1.00 29.86 ? 166 THR B CB  1 
ATOM   4258 O OG1 . THR B 1 164 ? -18.480 -29.297 47.814 1.00 32.61 ? 166 THR B OG1 1 
ATOM   4259 C CG2 . THR B 1 164 ? -19.060 -29.558 45.436 1.00 29.03 ? 166 THR B CG2 1 
ATOM   4260 N N   . GLU B 1 165 ? -15.673 -27.365 47.130 1.00 30.35 ? 167 GLU B N   1 
ATOM   4261 C CA  . GLU B 1 165 ? -14.597 -27.248 48.100 1.00 30.40 ? 167 GLU B CA  1 
ATOM   4262 C C   . GLU B 1 165 ? -13.888 -25.883 48.018 1.00 30.23 ? 167 GLU B C   1 
ATOM   4263 O O   . GLU B 1 165 ? -12.900 -25.615 48.708 1.00 29.47 ? 167 GLU B O   1 
ATOM   4264 C CB  . GLU B 1 165 ? -13.600 -28.388 47.865 1.00 29.72 ? 167 GLU B CB  1 
ATOM   4265 C CG  . GLU B 1 165 ? -12.947 -28.871 49.117 1.00 32.87 ? 167 GLU B CG  1 
ATOM   4266 C CD  . GLU B 1 165 ? -13.930 -29.584 50.034 1.00 34.03 ? 167 GLU B CD  1 
ATOM   4267 O OE1 . GLU B 1 165 ? -13.666 -29.632 51.239 1.00 35.19 ? 167 GLU B OE1 1 
ATOM   4268 O OE2 . GLU B 1 165 ? -14.946 -30.114 49.535 1.00 34.88 ? 167 GLU B OE2 1 
ATOM   4269 N N   . ASP B 1 166 ? -14.407 -25.035 47.141 1.00 30.85 ? 168 ASP B N   1 
ATOM   4270 C CA  . ASP B 1 166 ? -13.856 -23.706 46.879 1.00 30.63 ? 168 ASP B CA  1 
ATOM   4271 C C   . ASP B 1 166 ? -12.383 -23.714 46.358 1.00 30.16 ? 168 ASP B C   1 
ATOM   4272 O O   . ASP B 1 166 ? -11.578 -22.794 46.635 1.00 29.82 ? 168 ASP B O   1 
ATOM   4273 C CB  . ASP B 1 166 ? -14.122 -22.738 48.077 1.00 31.47 ? 168 ASP B CB  1 
ATOM   4274 C CG  . ASP B 1 166 ? -13.979 -21.260 47.663 1.00 34.68 ? 168 ASP B CG  1 
ATOM   4275 O OD1 . ASP B 1 166 ? -14.134 -20.942 46.453 1.00 33.82 ? 168 ASP B OD1 1 
ATOM   4276 O OD2 . ASP B 1 166 ? -13.675 -20.417 48.534 1.00 37.98 ? 168 ASP B OD2 1 
ATOM   4277 N N   . ALA B 1 167 ? -12.052 -24.759 45.589 1.00 28.60 ? 169 ALA B N   1 
ATOM   4278 C CA  . ALA B 1 167 ? -10.818 -24.801 44.789 1.00 28.55 ? 169 ALA B CA  1 
ATOM   4279 C C   . ALA B 1 167 ? -11.011 -24.174 43.390 1.00 28.19 ? 169 ALA B C   1 
ATOM   4280 O O   . ALA B 1 167 ? -12.118 -24.251 42.861 1.00 28.28 ? 169 ALA B O   1 
ATOM   4281 C CB  . ALA B 1 167 ? -10.358 -26.266 44.655 1.00 26.80 ? 169 ALA B CB  1 
ATOM   4282 N N   . LEU B 1 168 ? -9.955  -23.562 42.806 1.00 28.05 ? 170 LEU B N   1 
ATOM   4283 C CA  . LEU B 1 168 ? -9.921  -23.167 41.373 1.00 27.01 ? 170 LEU B CA  1 
ATOM   4284 C C   . LEU B 1 168 ? -9.407  -24.335 40.521 1.00 26.59 ? 170 LEU B C   1 
ATOM   4285 O O   . LEU B 1 168 ? -8.315  -24.841 40.742 1.00 26.85 ? 170 LEU B O   1 
ATOM   4286 C CB  . LEU B 1 168 ? -9.015  -21.938 41.119 1.00 26.76 ? 170 LEU B CB  1 
ATOM   4287 C CG  . LEU B 1 168 ? -9.302  -20.675 41.935 1.00 26.31 ? 170 LEU B CG  1 
ATOM   4288 C CD1 . LEU B 1 168 ? -8.323  -19.562 41.576 1.00 29.40 ? 170 LEU B CD1 1 
ATOM   4289 C CD2 . LEU B 1 168 ? -10.679 -20.220 41.669 1.00 25.71 ? 170 LEU B CD2 1 
ATOM   4290 N N   . PHE B 1 169 ? -10.223 -24.777 39.589 1.00 26.02 ? 171 PHE B N   1 
ATOM   4291 C CA  . PHE B 1 169 ? -9.884  -25.905 38.786 1.00 27.21 ? 171 PHE B CA  1 
ATOM   4292 C C   . PHE B 1 169 ? -9.341  -25.351 37.501 1.00 27.97 ? 171 PHE B C   1 
ATOM   4293 O O   . PHE B 1 169 ? -10.094 -24.785 36.677 1.00 28.67 ? 171 PHE B O   1 
ATOM   4294 C CB  . PHE B 1 169 ? -11.140 -26.698 38.504 1.00 26.26 ? 171 PHE B CB  1 
ATOM   4295 C CG  . PHE B 1 169 ? -10.915 -27.967 37.742 1.00 26.12 ? 171 PHE B CG  1 
ATOM   4296 C CD1 . PHE B 1 169 ? -9.705  -28.650 37.811 1.00 25.67 ? 171 PHE B CD1 1 
ATOM   4297 C CD2 . PHE B 1 169 ? -11.978 -28.541 37.022 1.00 25.95 ? 171 PHE B CD2 1 
ATOM   4298 C CE1 . PHE B 1 169 ? -9.535  -29.869 37.149 1.00 25.74 ? 171 PHE B CE1 1 
ATOM   4299 C CE2 . PHE B 1 169 ? -11.834 -29.755 36.372 1.00 25.14 ? 171 PHE B CE2 1 
ATOM   4300 C CZ  . PHE B 1 169 ? -10.588 -30.414 36.402 1.00 23.39 ? 171 PHE B CZ  1 
ATOM   4301 N N   . ILE B 1 170 ? -8.036  -25.533 37.320 1.00 28.61 ? 172 ILE B N   1 
ATOM   4302 C CA  . ILE B 1 170 ? -7.353  -24.983 36.175 1.00 27.56 ? 172 ILE B CA  1 
ATOM   4303 C C   . ILE B 1 170 ? -6.982  -26.091 35.188 1.00 28.36 ? 172 ILE B C   1 
ATOM   4304 O O   . ILE B 1 170 ? -6.324  -27.052 35.597 1.00 29.56 ? 172 ILE B O   1 
ATOM   4305 C CB  . ILE B 1 170 ? -6.172  -24.143 36.661 1.00 28.33 ? 172 ILE B CB  1 
ATOM   4306 C CG1 . ILE B 1 170 ? -6.765  -22.961 37.459 1.00 27.11 ? 172 ILE B CG1 1 
ATOM   4307 C CG2 . ILE B 1 170 ? -5.296  -23.657 35.464 1.00 26.45 ? 172 ILE B CG2 1 
ATOM   4308 C CD1 . ILE B 1 170 ? -5.821  -22.135 38.067 1.00 26.57 ? 172 ILE B CD1 1 
ATOM   4309 N N   . VAL B 1 171 ? -7.412  -25.977 33.902 1.00 27.02 ? 173 VAL B N   1 
ATOM   4310 C CA  . VAL B 1 171 ? -7.232  -27.085 32.940 1.00 26.29 ? 173 VAL B CA  1 
ATOM   4311 C C   . VAL B 1 171 ? -6.381  -26.765 31.699 1.00 26.63 ? 173 VAL B C   1 
ATOM   4312 O O   . VAL B 1 171 ? -6.520  -25.737 31.074 1.00 27.15 ? 173 VAL B O   1 
ATOM   4313 C CB  . VAL B 1 171 ? -8.609  -27.762 32.529 1.00 26.04 ? 173 VAL B CB  1 
ATOM   4314 C CG1 . VAL B 1 171 ? -8.400  -28.809 31.472 1.00 22.94 ? 173 VAL B CG1 1 
ATOM   4315 C CG2 . VAL B 1 171 ? -9.281  -28.418 33.764 1.00 24.70 ? 173 VAL B CG2 1 
ATOM   4316 N N   . ASP B 1 172 ? -5.467  -27.671 31.371 1.00 27.16 ? 174 ASP B N   1 
ATOM   4317 C CA  . ASP B 1 172 ? -4.699  -27.627 30.144 1.00 26.88 ? 174 ASP B CA  1 
ATOM   4318 C C   . ASP B 1 172 ? -5.513  -28.447 29.132 1.00 26.82 ? 174 ASP B C   1 
ATOM   4319 O O   . ASP B 1 172 ? -5.515  -29.684 29.180 1.00 27.91 ? 174 ASP B O   1 
ATOM   4320 C CB  . ASP B 1 172 ? -3.333  -28.308 30.453 1.00 26.68 ? 174 ASP B CB  1 
ATOM   4321 C CG  . ASP B 1 172 ? -2.524  -28.736 29.191 1.00 26.35 ? 174 ASP B CG  1 
ATOM   4322 O OD1 . ASP B 1 172 ? -3.021  -28.875 28.045 1.00 25.33 ? 174 ASP B OD1 1 
ATOM   4323 O OD2 . ASP B 1 172 ? -1.348  -29.057 29.395 1.00 25.98 ? 174 ASP B OD2 1 
ATOM   4324 N N   . ALA B 1 173 ? -6.235  -27.738 28.281 1.00 26.70 ? 175 ALA B N   1 
ATOM   4325 C CA  . ALA B 1 173 ? -6.978  -28.290 27.165 1.00 25.14 ? 175 ALA B CA  1 
ATOM   4326 C C   . ALA B 1 173 ? -6.194  -28.015 25.849 1.00 25.17 ? 175 ALA B C   1 
ATOM   4327 O O   . ALA B 1 173 ? -6.773  -27.821 24.796 1.00 24.42 ? 175 ALA B O   1 
ATOM   4328 C CB  . ALA B 1 173 ? -8.373  -27.654 27.109 1.00 24.14 ? 175 ALA B CB  1 
ATOM   4329 N N   . VAL B 1 174 ? -4.881  -27.987 25.910 1.00 25.09 ? 176 VAL B N   1 
ATOM   4330 C CA  . VAL B 1 174 ? -4.079  -27.685 24.734 1.00 24.93 ? 176 VAL B CA  1 
ATOM   4331 C C   . VAL B 1 174 ? -4.319  -28.660 23.587 1.00 24.95 ? 176 VAL B C   1 
ATOM   4332 O O   . VAL B 1 174 ? -4.422  -28.267 22.403 1.00 26.41 ? 176 VAL B O   1 
ATOM   4333 C CB  . VAL B 1 174 ? -2.576  -27.509 25.068 1.00 24.57 ? 176 VAL B CB  1 
ATOM   4334 C CG1 . VAL B 1 174 ? -1.732  -27.574 23.764 1.00 22.58 ? 176 VAL B CG1 1 
ATOM   4335 C CG2 . VAL B 1 174 ? -2.354  -26.207 25.795 1.00 24.80 ? 176 VAL B CG2 1 
ATOM   4336 N N   . ALA B 1 175 ? -4.433  -29.929 23.910 1.00 24.90 ? 177 ALA B N   1 
ATOM   4337 C CA  . ALA B 1 175 ? -4.453  -30.920 22.878 1.00 25.07 ? 177 ALA B CA  1 
ATOM   4338 C C   . ALA B 1 175 ? -5.871  -31.329 22.498 1.00 25.85 ? 177 ALA B C   1 
ATOM   4339 O O   . ALA B 1 175 ? -6.053  -32.089 21.533 1.00 26.37 ? 177 ALA B O   1 
ATOM   4340 C CB  . ALA B 1 175 ? -3.586  -32.124 23.288 1.00 26.07 ? 177 ALA B CB  1 
ATOM   4341 N N   . THR B 1 176 ? -6.865  -30.833 23.241 1.00 24.43 ? 178 THR B N   1 
ATOM   4342 C CA  . THR B 1 176 ? -8.264  -31.239 23.051 1.00 25.57 ? 178 THR B CA  1 
ATOM   4343 C C   . THR B 1 176 ? -9.097  -30.133 22.461 1.00 24.40 ? 178 THR B C   1 
ATOM   4344 O O   . THR B 1 176 ? -10.010 -30.463 21.715 1.00 26.34 ? 178 THR B O   1 
ATOM   4345 C CB  . THR B 1 176 ? -8.967  -31.748 24.370 1.00 25.42 ? 178 THR B CB  1 
ATOM   4346 O OG1 . THR B 1 176 ? -8.808  -30.762 25.372 1.00 23.88 ? 178 THR B OG1 1 
ATOM   4347 C CG2 . THR B 1 176 ? -8.250  -32.959 24.877 1.00 27.14 ? 178 THR B CG2 1 
ATOM   4348 N N   . ILE B 1 177 ? -8.771  -28.840 22.727 1.00 22.37 ? 179 ILE B N   1 
ATOM   4349 C CA  . ILE B 1 177 ? -9.640  -27.770 22.303 1.00 21.12 ? 179 ILE B CA  1 
ATOM   4350 C C   . ILE B 1 177 ? -9.816  -27.849 20.771 1.00 21.54 ? 179 ILE B C   1 
ATOM   4351 O O   . ILE B 1 177 ? -8.806  -27.898 20.042 1.00 23.85 ? 179 ILE B O   1 
ATOM   4352 C CB  . ILE B 1 177 ? -9.136  -26.339 22.814 1.00 22.48 ? 179 ILE B CB  1 
ATOM   4353 C CG1 . ILE B 1 177 ? -10.230 -25.265 22.630 1.00 19.95 ? 179 ILE B CG1 1 
ATOM   4354 C CG2 . ILE B 1 177 ? -7.744  -25.930 22.237 1.00 15.84 ? 179 ILE B CG2 1 
ATOM   4355 C CD1 . ILE B 1 177 ? -11.444 -25.632 23.590 1.00 16.26 ? 179 ILE B CD1 1 
ATOM   4356 N N   . GLY B 1 178 ? -11.047 -27.788 20.260 1.00 22.06 ? 180 GLY B N   1 
ATOM   4357 C CA  . GLY B 1 178 ? -11.285 -27.763 18.767 1.00 20.87 ? 180 GLY B CA  1 
ATOM   4358 C C   . GLY B 1 178 ? -11.339 -29.193 18.179 1.00 22.61 ? 180 GLY B C   1 
ATOM   4359 O O   . GLY B 1 178 ? -11.652 -29.382 17.001 1.00 23.56 ? 180 GLY B O   1 
ATOM   4360 N N   . GLY B 1 179 ? -11.027 -30.200 18.980 1.00 22.74 ? 181 GLY B N   1 
ATOM   4361 C CA  . GLY B 1 179 ? -10.998 -31.608 18.513 1.00 22.45 ? 181 GLY B CA  1 
ATOM   4362 C C   . GLY B 1 179 ? -11.868 -32.520 19.344 1.00 22.99 ? 181 GLY B C   1 
ATOM   4363 O O   . GLY B 1 179 ? -12.446 -33.447 18.815 1.00 22.33 ? 181 GLY B O   1 
ATOM   4364 N N   . CYS B 1 180 ? -11.939 -32.262 20.649 1.00 23.51 ? 182 CYS B N   1 
ATOM   4365 C CA  . CYS B 1 180 ? -12.702 -33.108 21.604 1.00 26.32 ? 182 CYS B CA  1 
ATOM   4366 C C   . CYS B 1 180 ? -13.546 -32.111 22.373 1.00 25.75 ? 182 CYS B C   1 
ATOM   4367 O O   . CYS B 1 180 ? -13.106 -30.970 22.563 1.00 26.77 ? 182 CYS B O   1 
ATOM   4368 C CB  . CYS B 1 180 ? -11.796 -33.837 22.643 1.00 24.27 ? 182 CYS B CB  1 
ATOM   4369 S SG  . CYS B 1 180 ? -10.504 -34.795 21.937 1.00 35.29 ? 182 CYS B SG  1 
ATOM   4370 N N   . GLU B 1 181 ? -14.723 -32.543 22.826 1.00 25.20 ? 183 GLU B N   1 
ATOM   4371 C CA  . GLU B 1 181 ? -15.574 -31.715 23.687 1.00 25.36 ? 183 GLU B CA  1 
ATOM   4372 C C   . GLU B 1 181 ? -14.735 -31.134 24.820 1.00 24.29 ? 183 GLU B C   1 
ATOM   4373 O O   . GLU B 1 181 ? -13.993 -31.844 25.496 1.00 22.97 ? 183 GLU B O   1 
ATOM   4374 C CB  . GLU B 1 181 ? -16.689 -32.579 24.341 1.00 25.36 ? 183 GLU B CB  1 
ATOM   4375 C CG  . GLU B 1 181 ? -17.926 -32.837 23.467 1.00 31.68 ? 183 GLU B CG  1 
ATOM   4376 C CD  . GLU B 1 181 ? -18.845 -31.591 23.286 1.00 38.48 ? 183 GLU B CD  1 
ATOM   4377 O OE1 . GLU B 1 181 ? -18.485 -30.491 23.777 1.00 39.70 ? 183 GLU B OE1 1 
ATOM   4378 O OE2 . GLU B 1 181 ? -19.908 -31.718 22.621 1.00 40.44 ? 183 GLU B OE2 1 
ATOM   4379 N N   . VAL B 1 182 ? -14.849 -29.838 25.002 1.00 24.82 ? 184 VAL B N   1 
ATOM   4380 C CA  . VAL B 1 182 ? -14.325 -29.164 26.165 1.00 24.92 ? 184 VAL B CA  1 
ATOM   4381 C C   . VAL B 1 182 ? -15.441 -28.201 26.575 1.00 26.19 ? 184 VAL B C   1 
ATOM   4382 O O   . VAL B 1 182 ? -15.794 -27.290 25.792 1.00 26.03 ? 184 VAL B O   1 
ATOM   4383 C CB  . VAL B 1 182 ? -13.062 -28.303 25.828 1.00 24.61 ? 184 VAL B CB  1 
ATOM   4384 C CG1 . VAL B 1 182 ? -12.703 -27.470 27.062 1.00 21.93 ? 184 VAL B CG1 1 
ATOM   4385 C CG2 . VAL B 1 182 ? -11.888 -29.194 25.310 1.00 22.94 ? 184 VAL B CG2 1 
ATOM   4386 N N   . LYS B 1 183 ? -16.025 -28.410 27.748 1.00 26.09 ? 185 LYS B N   1 
ATOM   4387 C CA  . LYS B 1 183 ? -17.153 -27.561 28.208 1.00 26.29 ? 185 LYS B CA  1 
ATOM   4388 C C   . LYS B 1 183 ? -16.811 -26.878 29.490 1.00 26.04 ? 185 LYS B C   1 
ATOM   4389 O O   . LYS B 1 183 ? -17.101 -27.399 30.550 1.00 25.47 ? 185 LYS B O   1 
ATOM   4390 C CB  . LYS B 1 183 ? -18.416 -28.401 28.446 1.00 26.42 ? 185 LYS B CB  1 
ATOM   4391 C CG  . LYS B 1 183 ? -18.748 -29.418 27.357 1.00 29.24 ? 185 LYS B CG  1 
ATOM   4392 C CD  . LYS B 1 183 ? -19.957 -30.306 27.800 1.00 31.21 ? 185 LYS B CD  1 
ATOM   4393 C CE  . LYS B 1 183 ? -20.554 -31.025 26.610 1.00 34.72 ? 185 LYS B CE  1 
ATOM   4394 N NZ  . LYS B 1 183 ? -21.858 -31.765 27.055 1.00 40.60 ? 185 LYS B NZ  1 
ATOM   4395 N N   . VAL B 1 184 ? -16.215 -25.698 29.390 1.00 27.60 ? 186 VAL B N   1 
ATOM   4396 C CA  . VAL B 1 184 ? -15.738 -24.929 30.553 1.00 27.74 ? 186 VAL B CA  1 
ATOM   4397 C C   . VAL B 1 184 ? -16.841 -24.732 31.606 1.00 28.64 ? 186 VAL B C   1 
ATOM   4398 O O   . VAL B 1 184 ? -16.628 -25.045 32.794 1.00 28.90 ? 186 VAL B O   1 
ATOM   4399 C CB  . VAL B 1 184 ? -15.057 -23.610 30.043 1.00 29.00 ? 186 VAL B CB  1 
ATOM   4400 C CG1 . VAL B 1 184 ? -14.725 -22.690 31.131 1.00 27.72 ? 186 VAL B CG1 1 
ATOM   4401 C CG2 . VAL B 1 184 ? -13.748 -23.975 29.275 1.00 27.18 ? 186 VAL B CG2 1 
ATOM   4402 N N   . ASP B 1 185 ? -18.022 -24.244 31.212 1.00 28.73 ? 187 ASP B N   1 
ATOM   4403 C CA  . ASP B 1 185 ? -19.082 -23.943 32.197 1.00 28.57 ? 187 ASP B CA  1 
ATOM   4404 C C   . ASP B 1 185 ? -19.729 -25.247 32.712 1.00 29.58 ? 187 ASP B C   1 
ATOM   4405 O O   . ASP B 1 185 ? -19.921 -25.428 33.916 1.00 29.92 ? 187 ASP B O   1 
ATOM   4406 C CB  . ASP B 1 185 ? -20.177 -22.997 31.630 1.00 27.98 ? 187 ASP B CB  1 
ATOM   4407 C CG  . ASP B 1 185 ? -19.656 -21.599 31.307 1.00 27.50 ? 187 ASP B CG  1 
ATOM   4408 O OD1 . ASP B 1 185 ? -18.457 -21.322 31.520 1.00 25.66 ? 187 ASP B OD1 1 
ATOM   4409 O OD2 . ASP B 1 185 ? -20.449 -20.765 30.825 1.00 28.06 ? 187 ASP B OD2 1 
ATOM   4410 N N   . GLU B 1 186 ? -20.074 -26.145 31.797 1.00 30.35 ? 188 GLU B N   1 
ATOM   4411 C CA  . GLU B 1 186 ? -20.666 -27.428 32.208 1.00 31.31 ? 188 GLU B CA  1 
ATOM   4412 C C   . GLU B 1 186 ? -19.785 -28.257 33.144 1.00 29.80 ? 188 GLU B C   1 
ATOM   4413 O O   . GLU B 1 186 ? -20.296 -28.880 34.047 1.00 29.10 ? 188 GLU B O   1 
ATOM   4414 C CB  . GLU B 1 186 ? -21.169 -28.271 31.021 1.00 31.43 ? 188 GLU B CB  1 
ATOM   4415 C CG  . GLU B 1 186 ? -22.549 -27.843 30.514 1.00 36.95 ? 188 GLU B CG  1 
ATOM   4416 C CD  . GLU B 1 186 ? -23.156 -28.798 29.490 1.00 41.19 ? 188 GLU B CD  1 
ATOM   4417 O OE1 . GLU B 1 186 ? -23.354 -28.398 28.326 1.00 40.81 ? 188 GLU B OE1 1 
ATOM   4418 O OE2 . GLU B 1 186 ? -23.468 -29.951 29.862 1.00 45.68 ? 188 GLU B OE2 1 
ATOM   4419 N N   . TRP B 1 187 ? -18.467 -28.243 32.961 1.00 28.58 ? 189 TRP B N   1 
ATOM   4420 C CA  . TRP B 1 187 ? -17.616 -29.080 33.816 1.00 27.25 ? 189 TRP B CA  1 
ATOM   4421 C C   . TRP B 1 187 ? -17.017 -28.304 34.963 1.00 27.52 ? 189 TRP B C   1 
ATOM   4422 O O   . TRP B 1 187 ? -16.067 -28.790 35.614 1.00 28.46 ? 189 TRP B O   1 
ATOM   4423 C CB  . TRP B 1 187 ? -16.510 -29.737 32.991 1.00 26.28 ? 189 TRP B CB  1 
ATOM   4424 C CG  . TRP B 1 187 ? -17.042 -30.607 31.925 1.00 25.53 ? 189 TRP B CG  1 
ATOM   4425 C CD1 . TRP B 1 187 ? -18.300 -31.114 31.838 1.00 26.83 ? 189 TRP B CD1 1 
ATOM   4426 C CD2 . TRP B 1 187 ? -16.338 -31.080 30.768 1.00 29.83 ? 189 TRP B CD2 1 
ATOM   4427 N NE1 . TRP B 1 187 ? -18.427 -31.896 30.719 1.00 28.01 ? 189 TRP B NE1 1 
ATOM   4428 C CE2 . TRP B 1 187 ? -17.242 -31.890 30.034 1.00 25.72 ? 189 TRP B CE2 1 
ATOM   4429 C CE3 . TRP B 1 187 ? -15.024 -30.887 30.270 1.00 28.87 ? 189 TRP B CE3 1 
ATOM   4430 C CZ2 . TRP B 1 187 ? -16.876 -32.546 28.843 1.00 28.88 ? 189 TRP B CZ2 1 
ATOM   4431 C CZ3 . TRP B 1 187 ? -14.675 -31.515 29.068 1.00 29.18 ? 189 TRP B CZ3 1 
ATOM   4432 C CH2 . TRP B 1 187 ? -15.591 -32.334 28.377 1.00 28.18 ? 189 TRP B CH2 1 
ATOM   4433 N N   . LYS B 1 188 ? -17.534 -27.084 35.166 1.00 26.78 ? 190 LYS B N   1 
ATOM   4434 C CA  . LYS B 1 188 ? -17.121 -26.182 36.228 1.00 26.82 ? 190 LYS B CA  1 
ATOM   4435 C C   . LYS B 1 188 ? -15.594 -26.012 36.307 1.00 27.78 ? 190 LYS B C   1 
ATOM   4436 O O   . LYS B 1 188 ? -14.941 -25.989 37.419 1.00 27.02 ? 190 LYS B O   1 
ATOM   4437 C CB  . LYS B 1 188 ? -17.736 -26.632 37.566 1.00 26.62 ? 190 LYS B CB  1 
ATOM   4438 C CG  . LYS B 1 188 ? -19.284 -26.638 37.571 1.00 27.48 ? 190 LYS B CG  1 
ATOM   4439 C CD  . LYS B 1 188 ? -19.836 -26.777 38.997 1.00 34.33 ? 190 LYS B CD  1 
ATOM   4440 C CE  . LYS B 1 188 ? -21.258 -27.345 39.016 1.00 38.65 ? 190 LYS B CE  1 
ATOM   4441 N NZ  . LYS B 1 188 ? -22.194 -26.284 38.522 1.00 40.64 ? 190 LYS B NZ  1 
ATOM   4442 N N   . ILE B 1 189 ? -15.024 -25.874 35.119 1.00 27.43 ? 191 ILE B N   1 
ATOM   4443 C CA  . ILE B 1 189 ? -13.617 -25.498 34.956 1.00 26.77 ? 191 ILE B CA  1 
ATOM   4444 C C   . ILE B 1 189 ? -13.497 -24.013 35.219 1.00 26.64 ? 191 ILE B C   1 
ATOM   4445 O O   . ILE B 1 189 ? -14.236 -23.228 34.651 1.00 26.68 ? 191 ILE B O   1 
ATOM   4446 C CB  . ILE B 1 189 ? -13.104 -25.832 33.509 1.00 27.16 ? 191 ILE B CB  1 
ATOM   4447 C CG1 . ILE B 1 189 ? -13.082 -27.341 33.281 1.00 28.50 ? 191 ILE B CG1 1 
ATOM   4448 C CG2 . ILE B 1 189 ? -11.674 -25.213 33.262 1.00 24.92 ? 191 ILE B CG2 1 
ATOM   4449 C CD1 . ILE B 1 189 ? -12.718 -27.726 31.793 1.00 25.54 ? 191 ILE B CD1 1 
ATOM   4450 N N   . ASP B 1 190 ? -12.554 -23.605 36.061 1.00 26.56 ? 192 ASP B N   1 
ATOM   4451 C CA  . ASP B 1 190 ? -12.400 -22.191 36.386 1.00 25.53 ? 192 ASP B CA  1 
ATOM   4452 C C   . ASP B 1 190 ? -11.460 -21.387 35.448 1.00 25.14 ? 192 ASP B C   1 
ATOM   4453 O O   . ASP B 1 190 ? -11.616 -20.191 35.282 1.00 24.48 ? 192 ASP B O   1 
ATOM   4454 C CB  . ASP B 1 190 ? -11.938 -22.086 37.839 1.00 26.07 ? 192 ASP B CB  1 
ATOM   4455 C CG  . ASP B 1 190 ? -13.015 -22.570 38.832 1.00 26.79 ? 192 ASP B CG  1 
ATOM   4456 O OD1 . ASP B 1 190 ? -14.013 -21.833 39.045 1.00 26.55 ? 192 ASP B OD1 1 
ATOM   4457 O OD2 . ASP B 1 190 ? -12.852 -23.684 39.379 1.00 25.86 ? 192 ASP B OD2 1 
ATOM   4458 N N   . ALA B 1 191 ? -10.463 -22.040 34.885 1.00 26.17 ? 193 ALA B N   1 
ATOM   4459 C CA  . ALA B 1 191 ? -9.633  -21.452 33.830 1.00 26.36 ? 193 ALA B CA  1 
ATOM   4460 C C   . ALA B 1 191 ? -9.209  -22.579 32.925 1.00 27.14 ? 193 ALA B C   1 
ATOM   4461 O O   . ALA B 1 191 ? -8.861  -23.681 33.409 1.00 27.28 ? 193 ALA B O   1 
ATOM   4462 C CB  . ALA B 1 191 ? -8.417  -20.826 34.407 1.00 27.01 ? 193 ALA B CB  1 
ATOM   4463 N N   . ALA B 1 192 ? -9.218  -22.324 31.616 1.00 26.82 ? 194 ALA B N   1 
ATOM   4464 C CA  . ALA B 1 192 ? -8.767  -23.363 30.690 1.00 26.64 ? 194 ALA B CA  1 
ATOM   4465 C C   . ALA B 1 192 ? -7.757  -22.707 29.750 1.00 25.22 ? 194 ALA B C   1 
ATOM   4466 O O   . ALA B 1 192 ? -7.888  -21.540 29.475 1.00 23.74 ? 194 ALA B O   1 
ATOM   4467 C CB  . ALA B 1 192 ? -9.918  -23.951 29.905 1.00 24.61 ? 194 ALA B CB  1 
ATOM   4468 N N   . ILE B 1 193 ? -6.764  -23.461 29.278 1.00 25.20 ? 195 ILE B N   1 
ATOM   4469 C CA  . ILE B 1 193 ? -5.749  -22.875 28.386 1.00 25.68 ? 195 ILE B CA  1 
ATOM   4470 C C   . ILE B 1 193 ? -5.760  -23.804 27.209 1.00 26.31 ? 195 ILE B C   1 
ATOM   4471 O O   . ILE B 1 193 ? -5.752  -25.067 27.352 1.00 26.94 ? 195 ILE B O   1 
ATOM   4472 C CB  . ILE B 1 193 ? -4.344  -22.857 29.034 1.00 26.84 ? 195 ILE B CB  1 
ATOM   4473 C CG1 . ILE B 1 193 ? -4.301  -21.984 30.296 1.00 27.17 ? 195 ILE B CG1 1 
ATOM   4474 C CG2 . ILE B 1 193 ? -3.157  -22.637 28.012 1.00 22.54 ? 195 ILE B CG2 1 
ATOM   4475 C CD1 . ILE B 1 193 ? -4.392  -22.866 31.602 1.00 24.82 ? 195 ILE B CD1 1 
ATOM   4476 N N   . GLY B 1 194 ? -5.812  -23.201 26.036 1.00 26.68 ? 196 GLY B N   1 
ATOM   4477 C CA  . GLY B 1 194 ? -5.681  -23.988 24.821 1.00 26.09 ? 196 GLY B CA  1 
ATOM   4478 C C   . GLY B 1 194 ? -4.367  -23.699 24.156 1.00 25.53 ? 196 GLY B C   1 
ATOM   4479 O O   . GLY B 1 194 ? -3.501  -22.961 24.699 1.00 24.50 ? 196 GLY B O   1 
ATOM   4480 N N   . GLY B 1 195 ? -4.204  -24.296 22.973 1.00 25.33 ? 197 GLY B N   1 
ATOM   4481 C CA  . GLY B 1 195 ? -3.072  -23.955 22.094 1.00 24.26 ? 197 GLY B CA  1 
ATOM   4482 C C   . GLY B 1 195 ? -3.595  -23.891 20.686 1.00 23.98 ? 197 GLY B C   1 
ATOM   4483 O O   . GLY B 1 195 ? -4.754  -24.241 20.459 1.00 25.52 ? 197 GLY B O   1 
ATOM   4484 N N   . THR B 1 196 ? -2.757  -23.481 19.731 1.00 24.35 ? 198 THR B N   1 
ATOM   4485 C CA  . THR B 1 196 ? -3.214  -23.166 18.396 1.00 23.32 ? 198 THR B CA  1 
ATOM   4486 C C   . THR B 1 196 ? -2.855  -24.260 17.435 1.00 23.50 ? 198 THR B C   1 
ATOM   4487 O O   . THR B 1 196 ? -3.621  -24.524 16.521 1.00 22.68 ? 198 THR B O   1 
ATOM   4488 C CB  . THR B 1 196 ? -2.604  -21.789 17.882 1.00 25.17 ? 198 THR B CB  1 
ATOM   4489 O OG1 . THR B 1 196 ? -1.212  -21.745 18.191 1.00 23.99 ? 198 THR B OG1 1 
ATOM   4490 C CG2 . THR B 1 196 ? -3.291  -20.606 18.567 1.00 25.40 ? 198 THR B CG2 1 
ATOM   4491 N N   . GLN B 1 197 ? -1.716  -24.939 17.637 1.00 22.40 ? 199 GLN B N   1 
ATOM   4492 C CA  . GLN B 1 197 ? -1.149  -25.784 16.568 1.00 23.35 ? 199 GLN B CA  1 
ATOM   4493 C C   . GLN B 1 197 ? -1.580  -27.234 16.587 1.00 23.30 ? 199 GLN B C   1 
ATOM   4494 O O   . GLN B 1 197 ? -1.001  -28.053 15.872 1.00 22.76 ? 199 GLN B O   1 
ATOM   4495 C CB  . GLN B 1 197 ? 0.391   -25.702 16.549 1.00 23.32 ? 199 GLN B CB  1 
ATOM   4496 C CG  . GLN B 1 197 ? 1.074   -26.591 17.755 1.00 27.27 ? 199 GLN B CG  1 
ATOM   4497 C CD  . GLN B 1 197 ? 1.131   -25.926 19.158 1.00 31.32 ? 199 GLN B CD  1 
ATOM   4498 O OE1 . GLN B 1 197 ? 0.576   -24.834 19.370 1.00 26.09 ? 199 GLN B OE1 1 
ATOM   4499 N NE2 . GLN B 1 197 ? 1.856   -26.596 20.126 1.00 30.21 ? 199 GLN B NE2 1 
ATOM   4500 N N   . LYS B 1 198 ? -2.532  -27.568 17.455 1.00 23.80 ? 200 LYS B N   1 
ATOM   4501 C CA  . LYS B 1 198 ? -3.083  -28.938 17.496 1.00 23.34 ? 200 LYS B CA  1 
ATOM   4502 C C   . LYS B 1 198 ? -4.427  -28.928 16.783 1.00 24.26 ? 200 LYS B C   1 
ATOM   4503 O O   . LYS B 1 198 ? -4.454  -28.662 15.591 1.00 23.25 ? 200 LYS B O   1 
ATOM   4504 C CB  . LYS B 1 198 ? -3.140  -29.502 18.941 1.00 22.45 ? 200 LYS B CB  1 
ATOM   4505 C CG  . LYS B 1 198 ? -1.609  -29.826 19.409 1.00 24.93 ? 200 LYS B CG  1 
ATOM   4506 C CD  . LYS B 1 198 ? -1.274  -30.131 20.926 1.00 28.13 ? 200 LYS B CD  1 
ATOM   4507 C CE  . LYS B 1 198 ? 0.224   -29.855 21.205 1.00 30.06 ? 200 LYS B CE  1 
ATOM   4508 N NZ  . LYS B 1 198 ? 0.938   -30.492 22.400 1.00 44.22 ? 200 LYS B NZ  1 
ATOM   4509 N N   . CYS B 1 199 ? -5.539  -29.167 17.495 1.00 22.88 ? 201 CYS B N   1 
ATOM   4510 C CA  . CYS B 1 199 ? -6.783  -29.330 16.800 1.00 24.45 ? 201 CYS B CA  1 
ATOM   4511 C C   . CYS B 1 199 ? -7.334  -28.102 16.142 1.00 24.47 ? 201 CYS B C   1 
ATOM   4512 O O   . CYS B 1 199 ? -8.208  -28.244 15.283 1.00 26.37 ? 201 CYS B O   1 
ATOM   4513 C CB  . CYS B 1 199 ? -7.857  -29.946 17.723 1.00 24.85 ? 201 CYS B CB  1 
ATOM   4514 S SG  . CYS B 1 199 ? -7.371  -31.608 18.270 1.00 24.79 ? 201 CYS B SG  1 
ATOM   4515 N N   . LEU B 1 200 ? -6.855  -26.913 16.526 1.00 24.03 ? 202 LEU B N   1 
ATOM   4516 C CA  . LEU B 1 200 ? -7.255  -25.654 15.858 1.00 24.52 ? 202 LEU B CA  1 
ATOM   4517 C C   . LEU B 1 200 ? -6.512  -25.407 14.560 1.00 23.53 ? 202 LEU B C   1 
ATOM   4518 O O   . LEU B 1 200 ? -6.942  -24.583 13.713 1.00 22.12 ? 202 LEU B O   1 
ATOM   4519 C CB  . LEU B 1 200 ? -7.082  -24.416 16.771 1.00 24.03 ? 202 LEU B CB  1 
ATOM   4520 C CG  . LEU B 1 200 ? -7.846  -24.543 18.093 1.00 24.38 ? 202 LEU B CG  1 
ATOM   4521 C CD1 . LEU B 1 200 ? -7.528  -23.358 18.892 1.00 22.78 ? 202 LEU B CD1 1 
ATOM   4522 C CD2 . LEU B 1 200 ? -9.333  -24.579 17.808 1.00 24.02 ? 202 LEU B CD2 1 
ATOM   4523 N N   . SER B 1 201 ? -5.434  -26.146 14.361 1.00 22.60 ? 203 SER B N   1 
ATOM   4524 C CA  . SER B 1 201 ? -4.670  -25.964 13.149 1.00 24.10 ? 203 SER B CA  1 
ATOM   4525 C C   . SER B 1 201 ? -4.298  -24.527 12.839 1.00 22.76 ? 203 SER B C   1 
ATOM   4526 O O   . SER B 1 201 ? -4.420  -24.031 11.702 1.00 23.73 ? 203 SER B O   1 
ATOM   4527 C CB  . SER B 1 201 ? -5.408  -26.600 11.968 1.00 24.59 ? 203 SER B CB  1 
ATOM   4528 O OG  . SER B 1 201 ? -4.992  -27.933 11.937 1.00 26.50 ? 203 SER B OG  1 
ATOM   4529 N N   . VAL B 1 202 ? -3.829  -23.833 13.851 1.00 24.20 ? 204 VAL B N   1 
ATOM   4530 C CA  . VAL B 1 202 ? -3.294  -22.490 13.648 1.00 23.91 ? 204 VAL B CA  1 
ATOM   4531 C C   . VAL B 1 202 ? -1.800  -22.530 13.996 1.00 25.71 ? 204 VAL B C   1 
ATOM   4532 O O   . VAL B 1 202 ? -1.438  -23.212 14.952 1.00 28.36 ? 204 VAL B O   1 
ATOM   4533 C CB  . VAL B 1 202 ? -4.035  -21.522 14.580 1.00 23.43 ? 204 VAL B CB  1 
ATOM   4534 C CG1 . VAL B 1 202 ? -3.295  -20.097 14.674 1.00 20.71 ? 204 VAL B CG1 1 
ATOM   4535 C CG2 . VAL B 1 202 ? -5.500  -21.400 14.132 1.00 24.77 ? 204 VAL B CG2 1 
ATOM   4536 N N   . PRO B 1 203 ? -0.929  -21.784 13.283 1.00 26.03 ? 205 PRO B N   1 
ATOM   4537 C CA  . PRO B 1 203 ? 0.520   -21.913 13.568 1.00 27.51 ? 205 PRO B CA  1 
ATOM   4538 C C   . PRO B 1 203 ? 0.878   -21.835 15.024 1.00 28.71 ? 205 PRO B C   1 
ATOM   4539 O O   . PRO B 1 203 ? 0.289   -21.014 15.758 1.00 28.36 ? 205 PRO B O   1 
ATOM   4540 C CB  . PRO B 1 203 ? 1.125   -20.691 12.867 1.00 26.69 ? 205 PRO B CB  1 
ATOM   4541 C CG  . PRO B 1 203 ? 0.277   -20.580 11.705 1.00 27.24 ? 205 PRO B CG  1 
ATOM   4542 C CD  . PRO B 1 203 ? -1.153  -20.775 12.244 1.00 23.93 ? 205 PRO B CD  1 
ATOM   4543 N N   . SER B 1 204 ? 1.847   -22.675 15.433 1.00 31.36 ? 206 SER B N   1 
ATOM   4544 C CA  . SER B 1 204 ? 2.222   -22.708 16.848 1.00 34.43 ? 206 SER B CA  1 
ATOM   4545 C C   . SER B 1 204 ? 2.608   -21.297 17.283 1.00 34.09 ? 206 SER B C   1 
ATOM   4546 O O   . SER B 1 204 ? 3.072   -20.505 16.441 1.00 35.05 ? 206 SER B O   1 
ATOM   4547 C CB  . SER B 1 204 ? 3.390   -23.672 17.123 1.00 35.30 ? 206 SER B CB  1 
ATOM   4548 O OG  . SER B 1 204 ? 3.705   -23.648 18.534 1.00 37.03 ? 206 SER B OG  1 
ATOM   4549 N N   . GLY B 1 205 ? 2.439   -21.014 18.569 1.00 33.51 ? 207 GLY B N   1 
ATOM   4550 C CA  . GLY B 1 205 ? 2.934   -19.778 19.147 1.00 34.24 ? 207 GLY B CA  1 
ATOM   4551 C C   . GLY B 1 205 ? 1.881   -18.800 19.639 1.00 35.32 ? 207 GLY B C   1 
ATOM   4552 O O   . GLY B 1 205 ? 2.135   -17.600 19.752 1.00 34.26 ? 207 GLY B O   1 
ATOM   4553 N N   . MET B 1 206 ? 0.704   -19.323 20.024 1.00 36.51 ? 208 MET B N   1 
ATOM   4554 C CA  . MET B 1 206 ? -0.206  -18.494 20.771 1.00 36.90 ? 208 MET B CA  1 
ATOM   4555 C C   . MET B 1 206 ? -0.989  -19.473 21.568 1.00 37.46 ? 208 MET B C   1 
ATOM   4556 O O   . MET B 1 206 ? -1.005  -20.677 21.219 1.00 37.76 ? 208 MET B O   1 
ATOM   4557 C CB  . MET B 1 206 ? -1.098  -17.603 19.878 1.00 38.96 ? 208 MET B CB  1 
ATOM   4558 C CG  . MET B 1 206 ? -0.793  -16.043 19.845 1.00 35.04 ? 208 MET B CG  1 
ATOM   4559 S SD  . MET B 1 206 ? -2.245  -15.407 18.950 1.00 44.92 ? 208 MET B SD  1 
ATOM   4560 C CE  . MET B 1 206 ? -2.102  -13.631 18.968 1.00 30.61 ? 208 MET B CE  1 
ATOM   4561 N N   . ALA B 1 207 ? -1.580  -18.954 22.662 1.00 35.92 ? 209 ALA B N   1 
ATOM   4562 C CA  . ALA B 1 207 ? -2.178  -19.751 23.673 1.00 34.83 ? 209 ALA B CA  1 
ATOM   4563 C C   . ALA B 1 207 ? -3.491  -19.048 24.082 1.00 34.24 ? 209 ALA B C   1 
ATOM   4564 O O   . ALA B 1 207 ? -3.456  -18.110 24.876 1.00 36.07 ? 209 ALA B O   1 
ATOM   4565 C CB  . ALA B 1 207 ? -1.209  -19.922 24.857 1.00 33.92 ? 209 ALA B CB  1 
ATOM   4566 N N   . PRO B 1 208 ? -4.653  -19.469 23.500 1.00 32.05 ? 210 PRO B N   1 
ATOM   4567 C CA  . PRO B 1 208 ? -5.940  -18.910 23.963 1.00 30.51 ? 210 PRO B CA  1 
ATOM   4568 C C   . PRO B 1 208 ? -6.345  -19.382 25.363 1.00 27.83 ? 210 PRO B C   1 
ATOM   4569 O O   . PRO B 1 208 ? -6.322  -20.603 25.672 1.00 28.12 ? 210 PRO B O   1 
ATOM   4570 C CB  . PRO B 1 208 ? -6.967  -19.427 22.937 1.00 29.76 ? 210 PRO B CB  1 
ATOM   4571 C CG  . PRO B 1 208 ? -6.292  -20.549 22.248 1.00 32.84 ? 210 PRO B CG  1 
ATOM   4572 C CD  . PRO B 1 208 ? -4.808  -20.230 22.258 1.00 31.97 ? 210 PRO B CD  1 
ATOM   4573 N N   . ILE B 1 209 ? -6.793  -18.449 26.165 1.00 26.37 ? 211 ILE B N   1 
ATOM   4574 C CA  . ILE B 1 209 ? -7.192  -18.789 27.533 1.00 27.94 ? 211 ILE B CA  1 
ATOM   4575 C C   . ILE B 1 209 ? -8.555  -18.265 27.894 1.00 27.50 ? 211 ILE B C   1 
ATOM   4576 O O   . ILE B 1 209 ? -9.035  -17.296 27.289 1.00 28.22 ? 211 ILE B O   1 
ATOM   4577 C CB  . ILE B 1 209 ? -6.201  -18.261 28.602 1.00 26.78 ? 211 ILE B CB  1 
ATOM   4578 C CG1 . ILE B 1 209 ? -6.324  -16.740 28.750 1.00 29.33 ? 211 ILE B CG1 1 
ATOM   4579 C CG2 . ILE B 1 209 ? -4.764  -18.739 28.345 1.00 26.85 ? 211 ILE B CG2 1 
ATOM   4580 C CD1 . ILE B 1 209 ? -5.340  -16.168 29.819 1.00 27.05 ? 211 ILE B CD1 1 
ATOM   4581 N N   . THR B 1 210 ? -9.157  -18.877 28.907 1.00 27.15 ? 212 THR B N   1 
ATOM   4582 C CA  . THR B 1 210 ? -10.403 -18.358 29.415 1.00 27.66 ? 212 THR B CA  1 
ATOM   4583 C C   . THR B 1 210 ? -10.495 -18.618 30.910 1.00 27.70 ? 212 THR B C   1 
ATOM   4584 O O   . THR B 1 210 ? -10.007 -19.632 31.401 1.00 28.78 ? 212 THR B O   1 
ATOM   4585 C CB  . THR B 1 210 ? -11.634 -18.931 28.643 1.00 27.48 ? 212 THR B CB  1 
ATOM   4586 O OG1 . THR B 1 210 ? -12.802 -18.284 29.115 1.00 25.24 ? 212 THR B OG1 1 
ATOM   4587 C CG2 . THR B 1 210 ? -11.813 -20.445 28.891 1.00 25.53 ? 212 THR B CG2 1 
ATOM   4588 N N   . TYR B 1 211 ? -11.131 -17.722 31.638 1.00 28.40 ? 213 TYR B N   1 
ATOM   4589 C CA  . TYR B 1 211 ? -11.322 -17.962 33.067 1.00 28.43 ? 213 TYR B CA  1 
ATOM   4590 C C   . TYR B 1 211 ? -12.476 -17.138 33.526 1.00 29.22 ? 213 TYR B C   1 
ATOM   4591 O O   . TYR B 1 211 ? -12.805 -16.144 32.870 1.00 29.17 ? 213 TYR B O   1 
ATOM   4592 C CB  . TYR B 1 211 ? -10.064 -17.621 33.889 1.00 27.38 ? 213 TYR B CB  1 
ATOM   4593 C CG  . TYR B 1 211 ? -9.526  -16.220 33.665 1.00 28.41 ? 213 TYR B CG  1 
ATOM   4594 C CD1 . TYR B 1 211 ? -10.058 -15.108 34.350 1.00 27.70 ? 213 TYR B CD1 1 
ATOM   4595 C CD2 . TYR B 1 211 ? -8.472  -16.000 32.762 1.00 26.60 ? 213 TYR B CD2 1 
ATOM   4596 C CE1 . TYR B 1 211 ? -9.542  -13.821 34.133 1.00 26.15 ? 213 TYR B CE1 1 
ATOM   4597 C CE2 . TYR B 1 211 ? -7.947  -14.712 32.552 1.00 26.77 ? 213 TYR B CE2 1 
ATOM   4598 C CZ  . TYR B 1 211 ? -8.504  -13.644 33.217 1.00 28.00 ? 213 TYR B CZ  1 
ATOM   4599 O OH  . TYR B 1 211 ? -7.995  -12.401 32.985 1.00 29.88 ? 213 TYR B OH  1 
ATOM   4600 N N   . ASN B 1 212 ? -13.066 -17.555 34.662 1.00 29.78 ? 214 ASN B N   1 
ATOM   4601 C CA  . ASN B 1 212 ? -14.289 -16.982 35.202 1.00 31.13 ? 214 ASN B CA  1 
ATOM   4602 C C   . ASN B 1 212 ? -14.019 -15.915 36.269 1.00 31.80 ? 214 ASN B C   1 
ATOM   4603 O O   . ASN B 1 212 ? -12.862 -15.639 36.557 1.00 32.49 ? 214 ASN B O   1 
ATOM   4604 C CB  . ASN B 1 212 ? -15.198 -18.106 35.795 1.00 30.78 ? 214 ASN B CB  1 
ATOM   4605 C CG  . ASN B 1 212 ? -14.560 -18.833 36.985 1.00 31.87 ? 214 ASN B CG  1 
ATOM   4606 O OD1 . ASN B 1 212 ? -13.570 -18.365 37.587 1.00 29.83 ? 214 ASN B OD1 1 
ATOM   4607 N ND2 . ASN B 1 212 ? -15.134 -19.998 37.337 1.00 32.21 ? 214 ASN B ND2 1 
ATOM   4608 N N   . GLU B 1 213 ? -15.079 -15.339 36.858 1.00 32.50 ? 215 GLU B N   1 
ATOM   4609 C CA  . GLU B 1 213 ? -14.952 -14.340 37.954 1.00 33.33 ? 215 GLU B CA  1 
ATOM   4610 C C   . GLU B 1 213 ? -14.186 -14.864 39.173 1.00 31.96 ? 215 GLU B C   1 
ATOM   4611 O O   . GLU B 1 213 ? -13.437 -14.115 39.821 1.00 29.85 ? 215 GLU B O   1 
ATOM   4612 C CB  . GLU B 1 213 ? -16.320 -13.817 38.442 1.00 34.17 ? 215 GLU B CB  1 
ATOM   4613 C CG  . GLU B 1 213 ? -16.612 -12.372 38.018 1.00 39.89 ? 215 GLU B CG  1 
ATOM   4614 C CD  . GLU B 1 213 ? -17.103 -11.430 39.147 1.00 46.14 ? 215 GLU B CD  1 
ATOM   4615 O OE1 . GLU B 1 213 ? -16.553 -10.285 39.190 1.00 48.61 ? 215 GLU B OE1 1 
ATOM   4616 O OE2 . GLU B 1 213 ? -18.011 -11.795 39.961 1.00 46.03 ? 215 GLU B OE2 1 
ATOM   4617 N N   . ARG B 1 214 ? -14.355 -16.145 39.486 1.00 30.66 ? 216 ARG B N   1 
ATOM   4618 C CA  . ARG B 1 214 ? -13.587 -16.683 40.617 1.00 30.97 ? 216 ARG B CA  1 
ATOM   4619 C C   . ARG B 1 214 ? -12.078 -16.565 40.375 1.00 30.07 ? 216 ARG B C   1 
ATOM   4620 O O   . ARG B 1 214 ? -11.338 -16.115 41.272 1.00 29.44 ? 216 ARG B O   1 
ATOM   4621 C CB  . ARG B 1 214 ? -13.979 -18.090 40.974 1.00 29.92 ? 216 ARG B CB  1 
ATOM   4622 C CG  . ARG B 1 214 ? -15.289 -18.135 41.720 1.00 33.49 ? 216 ARG B CG  1 
ATOM   4623 C CD  . ARG B 1 214 ? -15.265 -19.291 42.740 1.00 36.29 ? 216 ARG B CD  1 
ATOM   4624 N NE  . ARG B 1 214 ? -14.924 -20.513 42.058 1.00 32.94 ? 216 ARG B NE  1 
ATOM   4625 C CZ  . ARG B 1 214 ? -14.223 -21.522 42.567 1.00 31.98 ? 216 ARG B CZ  1 
ATOM   4626 N NH1 . ARG B 1 214 ? -13.802 -21.522 43.815 1.00 28.10 ? 216 ARG B NH1 1 
ATOM   4627 N NH2 . ARG B 1 214 ? -13.983 -22.576 41.794 1.00 31.13 ? 216 ARG B NH2 1 
ATOM   4628 N N   . VAL B 1 215 ? -11.625 -16.939 39.170 1.00 28.78 ? 217 VAL B N   1 
ATOM   4629 C CA  . VAL B 1 215 ? -10.227 -16.736 38.852 1.00 26.78 ? 217 VAL B CA  1 
ATOM   4630 C C   . VAL B 1 215 ? -9.875  -15.216 38.810 1.00 27.34 ? 217 VAL B C   1 
ATOM   4631 O O   . VAL B 1 215 ? -8.846  -14.804 39.376 1.00 25.44 ? 217 VAL B O   1 
ATOM   4632 C CB  . VAL B 1 215 ? -9.761  -17.453 37.551 1.00 27.19 ? 217 VAL B CB  1 
ATOM   4633 C CG1 . VAL B 1 215 ? -8.408  -16.930 37.168 1.00 24.32 ? 217 VAL B CG1 1 
ATOM   4634 C CG2 . VAL B 1 215 ? -9.615  -18.960 37.771 1.00 25.44 ? 217 VAL B CG2 1 
ATOM   4635 N N   . ALA B 1 216 ? -10.731 -14.401 38.184 1.00 26.66 ? 218 ALA B N   1 
ATOM   4636 C CA  . ALA B 1 216 ? -10.421 -12.956 38.032 1.00 28.30 ? 218 ALA B CA  1 
ATOM   4637 C C   . ALA B 1 216 ? -10.304 -12.255 39.344 1.00 28.34 ? 218 ALA B C   1 
ATOM   4638 O O   . ALA B 1 216 ? -9.527  -11.291 39.498 1.00 28.81 ? 218 ALA B O   1 
ATOM   4639 C CB  . ALA B 1 216 ? -11.430 -12.203 37.121 1.00 27.29 ? 218 ALA B CB  1 
ATOM   4640 N N   . ASP B 1 217 ? -11.101 -12.711 40.293 1.00 29.62 ? 219 ASP B N   1 
ATOM   4641 C CA  . ASP B 1 217 ? -11.112 -12.095 41.615 1.00 29.84 ? 219 ASP B CA  1 
ATOM   4642 C C   . ASP B 1 217 ? -9.757  -12.241 42.291 1.00 29.63 ? 219 ASP B C   1 
ATOM   4643 O O   . ASP B 1 217 ? -9.245  -11.290 42.878 1.00 30.67 ? 219 ASP B O   1 
ATOM   4644 C CB  . ASP B 1 217 ? -12.211 -12.722 42.472 1.00 30.43 ? 219 ASP B CB  1 
ATOM   4645 C CG  . ASP B 1 217 ? -13.567 -12.073 42.250 1.00 30.76 ? 219 ASP B CG  1 
ATOM   4646 O OD1 . ASP B 1 217 ? -14.583 -12.630 42.742 1.00 35.33 ? 219 ASP B OD1 1 
ATOM   4647 O OD2 . ASP B 1 217 ? -13.615 -11.004 41.609 1.00 33.24 ? 219 ASP B OD2 1 
ATOM   4648 N N   . VAL B 1 218 ? -9.195  -13.446 42.192 1.00 28.94 ? 220 VAL B N   1 
ATOM   4649 C CA  . VAL B 1 218 ? -7.888  -13.778 42.760 1.00 28.61 ? 220 VAL B CA  1 
ATOM   4650 C C   . VAL B 1 218 ? -6.767  -13.023 42.065 1.00 29.04 ? 220 VAL B C   1 
ATOM   4651 O O   . VAL B 1 218 ? -5.847  -12.540 42.701 1.00 29.10 ? 220 VAL B O   1 
ATOM   4652 C CB  . VAL B 1 218 ? -7.643  -15.298 42.682 1.00 28.13 ? 220 VAL B CB  1 
ATOM   4653 C CG1 . VAL B 1 218 ? -6.139  -15.621 42.861 1.00 27.29 ? 220 VAL B CG1 1 
ATOM   4654 C CG2 . VAL B 1 218 ? -8.527  -15.989 43.713 1.00 27.13 ? 220 VAL B CG2 1 
ATOM   4655 N N   . ILE B 1 219 ? -6.867  -12.902 40.739 1.00 29.97 ? 221 ILE B N   1 
ATOM   4656 C CA  . ILE B 1 219 ? -5.939  -12.100 39.973 1.00 29.16 ? 221 ILE B CA  1 
ATOM   4657 C C   . ILE B 1 219 ? -5.965  -10.610 40.403 1.00 30.38 ? 221 ILE B C   1 
ATOM   4658 O O   . ILE B 1 219 ? -4.890  -9.974  40.547 1.00 31.08 ? 221 ILE B O   1 
ATOM   4659 C CB  . ILE B 1 219 ? -6.257  -12.207 38.462 1.00 29.08 ? 221 ILE B CB  1 
ATOM   4660 C CG1 . ILE B 1 219 ? -5.793  -13.564 37.911 1.00 27.10 ? 221 ILE B CG1 1 
ATOM   4661 C CG2 . ILE B 1 219 ? -5.694  -10.968 37.722 1.00 25.90 ? 221 ILE B CG2 1 
ATOM   4662 C CD1 . ILE B 1 219 ? -6.327  -13.923 36.536 1.00 28.05 ? 221 ILE B CD1 1 
ATOM   4663 N N   . ALA B 1 220 ? -7.166  -10.044 40.551 1.00 30.93 ? 222 ALA B N   1 
ATOM   4664 C CA  . ALA B 1 220 ? -7.315  -8.615  40.965 1.00 31.97 ? 222 ALA B CA  1 
ATOM   4665 C C   . ALA B 1 220 ? -6.693  -8.318  42.306 1.00 31.58 ? 222 ALA B C   1 
ATOM   4666 O O   . ALA B 1 220 ? -6.269  -7.181  42.528 1.00 31.41 ? 222 ALA B O   1 
ATOM   4667 C CB  . ALA B 1 220 ? -8.783  -8.126  40.960 1.00 31.97 ? 222 ALA B CB  1 
ATOM   4668 N N   . ALA B 1 221 ? -6.617  -9.318  43.182 1.00 32.61 ? 223 ALA B N   1 
ATOM   4669 C CA  . ALA B 1 221 ? -6.008  -9.111  44.499 1.00 34.07 ? 223 ALA B CA  1 
ATOM   4670 C C   . ALA B 1 221 ? -4.490  -8.849  44.403 1.00 35.72 ? 223 ALA B C   1 
ATOM   4671 O O   . ALA B 1 221 ? -3.863  -8.467  45.412 1.00 34.97 ? 223 ALA B O   1 
ATOM   4672 C CB  . ALA B 1 221 ? -6.312  -10.246 45.435 1.00 33.88 ? 223 ALA B CB  1 
ATOM   4673 N N   . ARG B 1 222 ? -3.927  -8.954  43.180 1.00 36.80 ? 224 ARG B N   1 
ATOM   4674 C CA  . ARG B 1 222 ? -2.465  -8.922  42.966 1.00 37.52 ? 224 ARG B CA  1 
ATOM   4675 C C   . ARG B 1 222 ? -1.917  -7.904  41.948 1.00 37.88 ? 224 ARG B C   1 
ATOM   4676 O O   . ARG B 1 222 ? -2.609  -7.461  41.028 1.00 39.19 ? 224 ARG B O   1 
ATOM   4677 C CB  . ARG B 1 222 ? -1.955  -10.325 42.599 1.00 37.15 ? 224 ARG B CB  1 
ATOM   4678 C CG  . ARG B 1 222 ? -2.263  -11.451 43.596 1.00 39.12 ? 224 ARG B CG  1 
ATOM   4679 C CD  . ARG B 1 222 ? -1.674  -12.829 43.102 1.00 39.17 ? 224 ARG B CD  1 
ATOM   4680 N NE  . ARG B 1 222 ? -0.199  -12.826 43.146 1.00 38.22 ? 224 ARG B NE  1 
ATOM   4681 C CZ  . ARG B 1 222 ? 0.598   -13.792 42.679 1.00 37.51 ? 224 ARG B CZ  1 
ATOM   4682 N NH1 . ARG B 1 222 ? 0.099   -14.867 42.081 1.00 35.17 ? 224 ARG B NH1 1 
ATOM   4683 N NH2 . ARG B 1 222 ? 1.912   -13.654 42.786 1.00 37.89 ? 224 ARG B NH2 1 
ATOM   4684 N N   . ASN B 1 241 ? -1.185  -5.407  46.627 1.00 53.23 ? 243 ASN B N   1 
ATOM   4685 C CA  . ASN B 1 241 ? -0.705  -6.731  47.028 1.00 53.02 ? 243 ASN B CA  1 
ATOM   4686 C C   . ASN B 1 241 ? 0.305   -7.362  46.047 1.00 52.61 ? 243 ASN B C   1 
ATOM   4687 O O   . ASN B 1 241 ? 0.347   -6.982  44.873 1.00 52.47 ? 243 ASN B O   1 
ATOM   4688 C CB  . ASN B 1 241 ? -1.887  -7.677  47.282 1.00 53.20 ? 243 ASN B CB  1 
ATOM   4689 C CG  . ASN B 1 241 ? -1.455  -9.019  47.841 1.00 52.87 ? 243 ASN B CG  1 
ATOM   4690 O OD1 . ASN B 1 241 ? -0.584  -9.083  48.705 1.00 52.79 ? 243 ASN B OD1 1 
ATOM   4691 N ND2 . ASN B 1 241 ? -2.056  -10.097 47.343 1.00 52.12 ? 243 ASN B ND2 1 
ATOM   4692 N N   . ARG B 1 242 ? 1.084   -8.328  46.560 1.00 52.16 ? 244 ARG B N   1 
ATOM   4693 C CA  . ARG B 1 242 ? 2.253   -8.955  45.890 1.00 51.53 ? 244 ARG B CA  1 
ATOM   4694 C C   . ARG B 1 242 ? 2.120   -9.180  44.394 1.00 50.60 ? 244 ARG B C   1 
ATOM   4695 O O   . ARG B 1 242 ? 1.175   -9.835  43.958 1.00 50.82 ? 244 ARG B O   1 
ATOM   4696 C CB  . ARG B 1 242 ? 2.635   -10.297 46.553 1.00 51.99 ? 244 ARG B CB  1 
ATOM   4697 C CG  . ARG B 1 242 ? 3.890   -10.979 45.957 1.00 51.99 ? 244 ARG B CG  1 
ATOM   4698 C CD  . ARG B 1 242 ? 4.202   -12.340 46.592 1.00 53.83 ? 244 ARG B CD  1 
ATOM   4699 N NE  . ARG B 1 242 ? 3.786   -12.430 47.998 1.00 54.68 ? 244 ARG B NE  1 
ATOM   4700 C CZ  . ARG B 1 242 ? 4.395   -13.152 48.944 1.00 55.43 ? 244 ARG B CZ  1 
ATOM   4701 N NH1 . ARG B 1 242 ? 5.491   -13.856 48.676 1.00 55.15 ? 244 ARG B NH1 1 
ATOM   4702 N NH2 . ARG B 1 242 ? 3.907   -13.162 50.179 1.00 54.37 ? 244 ARG B NH2 1 
ATOM   4703 N N   . PRO B 1 243 ? 3.089   -8.655  43.617 1.00 49.50 ? 245 PRO B N   1 
ATOM   4704 C CA  . PRO B 1 243 ? 3.268   -8.867  42.171 1.00 48.74 ? 245 PRO B CA  1 
ATOM   4705 C C   . PRO B 1 243 ? 3.153   -10.330 41.693 1.00 47.53 ? 245 PRO B C   1 
ATOM   4706 O O   . PRO B 1 243 ? 3.644   -11.257 42.368 1.00 46.94 ? 245 PRO B O   1 
ATOM   4707 C CB  . PRO B 1 243 ? 4.709   -8.382  41.934 1.00 48.87 ? 245 PRO B CB  1 
ATOM   4708 C CG  . PRO B 1 243 ? 4.928   -7.339  42.980 1.00 49.15 ? 245 PRO B CG  1 
ATOM   4709 C CD  . PRO B 1 243 ? 4.078   -7.699  44.162 1.00 49.49 ? 245 PRO B CD  1 
ATOM   4710 N N   . ILE B 1 244 ? 2.502   -10.523 40.541 1.00 46.44 ? 246 ILE B N   1 
ATOM   4711 C CA  . ILE B 1 244 ? 2.689   -11.740 39.728 1.00 45.27 ? 246 ILE B CA  1 
ATOM   4712 C C   . ILE B 1 244 ? 4.174   -11.679 39.305 1.00 44.74 ? 246 ILE B C   1 
ATOM   4713 O O   . ILE B 1 244 ? 4.607   -10.636 38.766 1.00 44.52 ? 246 ILE B O   1 
ATOM   4714 C CB  . ILE B 1 244 ? 1.811   -11.716 38.411 1.00 45.47 ? 246 ILE B CB  1 
ATOM   4715 C CG1 . ILE B 1 244 ? 0.312   -11.393 38.652 1.00 45.99 ? 246 ILE B CG1 1 
ATOM   4716 C CG2 . ILE B 1 244 ? 2.077   -12.927 37.524 1.00 43.97 ? 246 ILE B CG2 1 
ATOM   4717 C CD1 . ILE B 1 244 ? -0.446  -12.318 39.541 1.00 46.19 ? 246 ILE B CD1 1 
ATOM   4718 N N   . THR B 1 245 ? 4.943   -12.757 39.531 1.00 43.61 ? 247 THR B N   1 
ATOM   4719 C CA  . THR B 1 245 ? 6.413   -12.757 39.260 1.00 43.11 ? 247 THR B CA  1 
ATOM   4720 C C   . THR B 1 245 ? 6.814   -12.458 37.771 1.00 42.60 ? 247 THR B C   1 
ATOM   4721 O O   . THR B 1 245 ? 7.790   -11.713 37.498 1.00 42.45 ? 247 THR B O   1 
ATOM   4722 C CB  . THR B 1 245 ? 7.152   -14.017 39.884 1.00 43.18 ? 247 THR B CB  1 
ATOM   4723 O OG1 . THR B 1 245 ? 6.819   -14.131 41.274 1.00 42.16 ? 247 THR B OG1 1 
ATOM   4724 C CG2 . THR B 1 245 ? 8.700   -13.938 39.743 1.00 42.29 ? 247 THR B CG2 1 
ATOM   4725 N N   . SER B 1 246 ? 6.036   -12.974 36.822 1.00 41.76 ? 248 SER B N   1 
ATOM   4726 C CA  . SER B 1 246 ? 6.273   -12.615 35.423 1.00 40.94 ? 248 SER B CA  1 
ATOM   4727 C C   . SER B 1 246 ? 5.432   -11.407 34.927 1.00 41.46 ? 248 SER B C   1 
ATOM   4728 O O   . SER B 1 246 ? 4.204   -11.518 34.787 1.00 41.66 ? 248 SER B O   1 
ATOM   4729 C CB  . SER B 1 246 ? 6.081   -13.834 34.514 1.00 40.78 ? 248 SER B CB  1 
ATOM   4730 O OG  . SER B 1 246 ? 6.170   -13.454 33.155 1.00 35.40 ? 248 SER B OG  1 
ATOM   4731 N N   . ASN B 1 247 ? 6.096   -10.281 34.641 1.00 41.02 ? 249 ASN B N   1 
ATOM   4732 C CA  . ASN B 1 247 ? 5.444   -9.102  34.020 1.00 40.33 ? 249 ASN B CA  1 
ATOM   4733 C C   . ASN B 1 247 ? 4.718   -9.459  32.699 1.00 39.69 ? 249 ASN B C   1 
ATOM   4734 O O   . ASN B 1 247 ? 3.569   -9.046  32.456 1.00 38.26 ? 249 ASN B O   1 
ATOM   4735 C CB  . ASN B 1 247 ? 6.470   -7.952  33.801 1.00 40.22 ? 249 ASN B CB  1 
ATOM   4736 C CG  . ASN B 1 247 ? 5.915   -6.810  32.926 1.00 41.19 ? 249 ASN B CG  1 
ATOM   4737 O OD1 . ASN B 1 247 ? 5.200   -5.926  33.416 1.00 39.23 ? 249 ASN B OD1 1 
ATOM   4738 N ND2 . ASN B 1 247 ? 6.250   -6.833  31.622 1.00 41.13 ? 249 ASN B ND2 1 
ATOM   4739 N N   . TYR B 1 248 ? 5.388   -10.250 31.865 1.00 39.17 ? 250 TYR B N   1 
ATOM   4740 C CA  . TYR B 1 248 ? 4.857   -10.591 30.530 1.00 39.88 ? 250 TYR B CA  1 
ATOM   4741 C C   . TYR B 1 248 ? 3.668   -11.546 30.647 1.00 39.28 ? 250 TYR B C   1 
ATOM   4742 O O   . TYR B 1 248 ? 2.766   -11.505 29.811 1.00 39.16 ? 250 TYR B O   1 
ATOM   4743 C CB  . TYR B 1 248 ? 5.971   -11.151 29.635 1.00 39.77 ? 250 TYR B CB  1 
ATOM   4744 C CG  . TYR B 1 248 ? 5.566   -11.538 28.246 1.00 40.42 ? 250 TYR B CG  1 
ATOM   4745 C CD1 . TYR B 1 248 ? 5.710   -10.628 27.181 1.00 42.23 ? 250 TYR B CD1 1 
ATOM   4746 C CD2 . TYR B 1 248 ? 5.082   -12.821 27.971 1.00 39.29 ? 250 TYR B CD2 1 
ATOM   4747 C CE1 . TYR B 1 248 ? 5.364   -10.982 25.891 1.00 41.36 ? 250 TYR B CE1 1 
ATOM   4748 C CE2 . TYR B 1 248 ? 4.702   -13.192 26.680 1.00 39.15 ? 250 TYR B CE2 1 
ATOM   4749 C CZ  . TYR B 1 248 ? 4.858   -12.276 25.644 1.00 41.25 ? 250 TYR B CZ  1 
ATOM   4750 O OH  . TYR B 1 248 ? 4.519   -12.631 24.363 1.00 38.40 ? 250 TYR B OH  1 
ATOM   4751 N N   . PHE B 1 249 ? 3.644   -12.325 31.742 1.00 39.43 ? 251 PHE B N   1 
ATOM   4752 C CA  . PHE B 1 249 ? 2.578   -13.305 32.056 1.00 38.68 ? 251 PHE B CA  1 
ATOM   4753 C C   . PHE B 1 249 ? 1.605   -12.797 33.147 1.00 39.20 ? 251 PHE B C   1 
ATOM   4754 O O   . PHE B 1 249 ? 0.912   -13.583 33.812 1.00 38.97 ? 251 PHE B O   1 
ATOM   4755 C CB  . PHE B 1 249 ? 3.198   -14.630 32.525 1.00 38.44 ? 251 PHE B CB  1 
ATOM   4756 C CG  . PHE B 1 249 ? 3.897   -15.399 31.455 1.00 37.64 ? 251 PHE B CG  1 
ATOM   4757 C CD1 . PHE B 1 249 ? 3.459   -15.341 30.136 1.00 38.57 ? 251 PHE B CD1 1 
ATOM   4758 C CD2 . PHE B 1 249 ? 4.995   -16.192 31.773 1.00 37.99 ? 251 PHE B CD2 1 
ATOM   4759 C CE1 . PHE B 1 249 ? 4.093   -16.045 29.151 1.00 38.99 ? 251 PHE B CE1 1 
ATOM   4760 C CE2 . PHE B 1 249 ? 5.666   -16.905 30.797 1.00 40.28 ? 251 PHE B CE2 1 
ATOM   4761 C CZ  . PHE B 1 249 ? 5.217   -16.823 29.475 1.00 42.19 ? 251 PHE B CZ  1 
ATOM   4762 N N   . ASP B 1 250 ? 1.579   -11.482 33.348 1.00 39.05 ? 252 ASP B N   1 
ATOM   4763 C CA  . ASP B 1 250 ? 0.691   -10.845 34.332 1.00 38.79 ? 252 ASP B CA  1 
ATOM   4764 C C   . ASP B 1 250 ? -0.723  -10.639 33.701 1.00 39.38 ? 252 ASP B C   1 
ATOM   4765 O O   . ASP B 1 250 ? -0.915  -9.753  32.807 1.00 38.93 ? 252 ASP B O   1 
ATOM   4766 C CB  . ASP B 1 250 ? 1.317   -9.513  34.820 1.00 38.21 ? 252 ASP B CB  1 
ATOM   4767 C CG  . ASP B 1 250 ? 0.572   -8.895  36.015 1.00 39.88 ? 252 ASP B CG  1 
ATOM   4768 O OD1 . ASP B 1 250 ? 1.156   -7.988  36.669 1.00 36.35 ? 252 ASP B OD1 1 
ATOM   4769 O OD2 . ASP B 1 250 ? -0.586  -9.314  36.308 1.00 40.17 ? 252 ASP B OD2 1 
ATOM   4770 N N   . LEU B 1 251 ? -1.695  -11.455 34.145 1.00 38.46 ? 253 LEU B N   1 
ATOM   4771 C CA  . LEU B 1 251 ? -3.079  -11.394 33.604 1.00 38.84 ? 253 LEU B CA  1 
ATOM   4772 C C   . LEU B 1 251 ? -3.879  -10.116 34.041 1.00 38.87 ? 253 LEU B C   1 
ATOM   4773 O O   . LEU B 1 251 ? -4.803  -9.699  33.344 1.00 38.77 ? 253 LEU B O   1 
ATOM   4774 C CB  . LEU B 1 251 ? -3.862  -12.709 33.898 1.00 37.41 ? 253 LEU B CB  1 
ATOM   4775 C CG  . LEU B 1 251 ? -3.251  -13.989 33.308 1.00 37.94 ? 253 LEU B CG  1 
ATOM   4776 C CD1 . LEU B 1 251 ? -4.073  -15.239 33.638 1.00 35.74 ? 253 LEU B CD1 1 
ATOM   4777 C CD2 . LEU B 1 251 ? -3.031  -13.841 31.791 1.00 36.47 ? 253 LEU B CD2 1 
ATOM   4778 N N   . SER B 1 252 ? -3.493  -9.503  35.171 1.00 39.53 ? 254 SER B N   1 
ATOM   4779 C CA  . SER B 1 252 ? -4.098  -8.232  35.668 1.00 40.06 ? 254 SER B CA  1 
ATOM   4780 C C   . SER B 1 252 ? -3.780  -7.017  34.781 1.00 41.52 ? 254 SER B C   1 
ATOM   4781 O O   . SER B 1 252 ? -4.444  -5.966  34.903 1.00 42.70 ? 254 SER B O   1 
ATOM   4782 C CB  . SER B 1 252 ? -3.629  -7.912  37.085 1.00 39.79 ? 254 SER B CB  1 
ATOM   4783 O OG  . SER B 1 252 ? -2.286  -7.449  37.094 1.00 37.61 ? 254 SER B OG  1 
ATOM   4784 N N   . GLN B 1 253 ? -2.711  -7.153  33.984 1.00 41.70 ? 255 GLN B N   1 
ATOM   4785 C CA  . GLN B 1 253 ? -2.259  -6.179  32.991 1.00 42.39 ? 255 GLN B CA  1 
ATOM   4786 C C   . GLN B 1 253 ? -2.655  -6.683  31.603 1.00 42.63 ? 255 GLN B C   1 
ATOM   4787 O O   . GLN B 1 253 ? -2.883  -5.871  30.697 1.00 43.53 ? 255 GLN B O   1 
ATOM   4788 C CB  . GLN B 1 253 ? -0.730  -6.046  33.019 1.00 41.89 ? 255 GLN B CB  1 
ATOM   4789 C CG  . GLN B 1 253 ? -0.096  -5.307  34.255 1.00 42.62 ? 255 GLN B CG  1 
ATOM   4790 C CD  . GLN B 1 253 ? 1.408   -5.057  34.019 1.00 42.07 ? 255 GLN B CD  1 
ATOM   4791 O OE1 . GLN B 1 253 ? 2.269   -5.877  34.385 1.00 41.25 ? 255 GLN B OE1 1 
ATOM   4792 N NE2 . GLN B 1 253 ? 1.717   -3.945  33.363 1.00 40.87 ? 255 GLN B NE2 1 
ATOM   4793 N N   . LEU B 1 254 ? -2.684  -8.017  31.427 1.00 42.61 ? 256 LEU B N   1 
ATOM   4794 C CA  . LEU B 1 254 ? -3.240  -8.633  30.206 1.00 42.06 ? 256 LEU B CA  1 
ATOM   4795 C C   . LEU B 1 254 ? -4.772  -8.431  30.054 1.00 42.33 ? 256 LEU B C   1 
ATOM   4796 O O   . LEU B 1 254 ? -5.293  -8.321  28.920 1.00 43.05 ? 256 LEU B O   1 
ATOM   4797 C CB  . LEU B 1 254 ? -2.818  -10.096 30.079 1.00 41.80 ? 256 LEU B CB  1 
ATOM   4798 C CG  . LEU B 1 254 ? -1.377  -10.231 29.588 1.00 41.63 ? 256 LEU B CG  1 
ATOM   4799 C CD1 . LEU B 1 254 ? -0.872  -11.647 29.684 1.00 42.40 ? 256 LEU B CD1 1 
ATOM   4800 C CD2 . LEU B 1 254 ? -1.321  -9.733  28.157 1.00 40.64 ? 256 LEU B CD2 1 
ATOM   4801 N N   . GLU B 1 255 ? -5.497  -8.378  31.175 1.00 41.73 ? 257 GLU B N   1 
ATOM   4802 C CA  . GLU B 1 255 ? -6.933  -8.091  31.093 1.00 41.88 ? 257 GLU B CA  1 
ATOM   4803 C C   . GLU B 1 255 ? -7.194  -6.620  30.714 1.00 42.53 ? 257 GLU B C   1 
ATOM   4804 O O   . GLU B 1 255 ? -8.127  -6.346  29.953 1.00 42.20 ? 257 GLU B O   1 
ATOM   4805 C CB  . GLU B 1 255 ? -7.745  -8.608  32.294 1.00 40.39 ? 257 GLU B CB  1 
ATOM   4806 C CG  . GLU B 1 255 ? -7.322  -8.165  33.658 1.00 40.24 ? 257 GLU B CG  1 
ATOM   4807 C CD  . GLU B 1 255 ? -8.099  -8.885  34.788 1.00 37.31 ? 257 GLU B CD  1 
ATOM   4808 O OE1 . GLU B 1 255 ? -8.524  -8.198  35.771 1.00 40.97 ? 257 GLU B OE1 1 
ATOM   4809 O OE2 . GLU B 1 255 ? -8.293  -10.134 34.661 1.00 30.96 ? 257 GLU B OE2 1 
ATOM   4810 N N   . ASP B 1 256 ? -6.343  -5.701  31.196 1.00 43.09 ? 258 ASP B N   1 
ATOM   4811 C CA  . ASP B 1 256 ? -6.369  -4.279  30.777 1.00 44.00 ? 258 ASP B CA  1 
ATOM   4812 C C   . ASP B 1 256 ? -6.050  -4.121  29.255 1.00 44.78 ? 258 ASP B C   1 
ATOM   4813 O O   . ASP B 1 256 ? -6.710  -3.311  28.556 1.00 44.68 ? 258 ASP B O   1 
ATOM   4814 C CB  . ASP B 1 256 ? -5.452  -3.399  31.665 1.00 43.74 ? 258 ASP B CB  1 
ATOM   4815 C CG  . ASP B 1 256 ? -6.021  -3.165  33.098 1.00 45.11 ? 258 ASP B CG  1 
ATOM   4816 O OD1 . ASP B 1 256 ? -7.233  -3.383  33.354 1.00 46.04 ? 258 ASP B OD1 1 
ATOM   4817 O OD2 . ASP B 1 256 ? -5.245  -2.731  33.983 1.00 44.81 ? 258 ASP B OD2 1 
ATOM   4818 N N   . TYR B 1 257 ? -5.076  -4.904  28.747 1.00 44.86 ? 259 TYR B N   1 
ATOM   4819 C CA  . TYR B 1 257 ? -4.869  -5.070  27.281 1.00 45.08 ? 259 TYR B CA  1 
ATOM   4820 C C   . TYR B 1 257 ? -6.156  -5.445  26.487 1.00 45.07 ? 259 TYR B C   1 
ATOM   4821 O O   . TYR B 1 257 ? -6.517  -4.778  25.491 1.00 44.49 ? 259 TYR B O   1 
ATOM   4822 C CB  . TYR B 1 257 ? -3.758  -6.101  26.970 1.00 45.34 ? 259 TYR B CB  1 
ATOM   4823 C CG  . TYR B 1 257 ? -3.115  -5.831  25.619 1.00 46.83 ? 259 TYR B CG  1 
ATOM   4824 C CD1 . TYR B 1 257 ? -2.221  -4.769  25.467 1.00 46.21 ? 259 TYR B CD1 1 
ATOM   4825 C CD2 . TYR B 1 257 ? -3.437  -6.611  24.485 1.00 46.51 ? 259 TYR B CD2 1 
ATOM   4826 C CE1 . TYR B 1 257 ? -1.659  -4.478  24.246 1.00 47.06 ? 259 TYR B CE1 1 
ATOM   4827 C CE2 . TYR B 1 257 ? -2.871  -6.347  23.267 1.00 46.73 ? 259 TYR B CE2 1 
ATOM   4828 C CZ  . TYR B 1 257 ? -1.973  -5.274  23.153 1.00 46.83 ? 259 TYR B CZ  1 
ATOM   4829 O OH  . TYR B 1 257 ? -1.419  -4.987  21.957 1.00 43.71 ? 259 TYR B OH  1 
ATOM   4830 N N   . TRP B 1 258 ? -6.833  -6.495  26.970 1.00 44.82 ? 260 TRP B N   1 
ATOM   4831 C CA  . TRP B 1 258 ? -7.970  -7.147  26.305 1.00 44.94 ? 260 TRP B CA  1 
ATOM   4832 C C   . TRP B 1 258 ? -9.317  -6.683  26.893 1.00 45.34 ? 260 TRP B C   1 
ATOM   4833 O O   . TRP B 1 258 ? -10.127 -7.505  27.408 1.00 46.47 ? 260 TRP B O   1 
ATOM   4834 C CB  . TRP B 1 258 ? -7.804  -8.673  26.388 1.00 43.78 ? 260 TRP B CB  1 
ATOM   4835 C CG  . TRP B 1 258 ? -6.709  -9.177  25.456 1.00 41.71 ? 260 TRP B CG  1 
ATOM   4836 C CD1 . TRP B 1 258 ? -5.358  -9.363  25.760 1.00 38.23 ? 260 TRP B CD1 1 
ATOM   4837 C CD2 . TRP B 1 258 ? -6.868  -9.554  24.067 1.00 36.59 ? 260 TRP B CD2 1 
ATOM   4838 N NE1 . TRP B 1 258 ? -4.696  -9.836  24.650 1.00 37.85 ? 260 TRP B NE1 1 
ATOM   4839 C CE2 . TRP B 1 258 ? -5.583  -9.959  23.598 1.00 35.90 ? 260 TRP B CE2 1 
ATOM   4840 C CE3 . TRP B 1 258 ? -7.976  -9.601  23.175 1.00 33.96 ? 260 TRP B CE3 1 
ATOM   4841 C CZ2 . TRP B 1 258 ? -5.366  -10.383 22.268 1.00 34.66 ? 260 TRP B CZ2 1 
ATOM   4842 C CZ3 . TRP B 1 258 ? -7.754  -10.014 21.808 1.00 27.60 ? 260 TRP B CZ3 1 
ATOM   4843 C CH2 . TRP B 1 258 ? -6.467  -10.403 21.392 1.00 33.39 ? 260 TRP B CH2 1 
ATOM   4844 N N   . SER B 1 259 ? -9.499  -5.357  26.844 1.00 45.53 ? 261 SER B N   1 
ATOM   4845 C CA  . SER B 1 259 ? -10.672 -4.587  27.337 1.00 45.74 ? 261 SER B CA  1 
ATOM   4846 C C   . SER B 1 259 ? -10.467 -3.095  26.957 1.00 46.00 ? 261 SER B C   1 
ATOM   4847 O O   . SER B 1 259 ? -9.427  -2.748  26.373 1.00 46.36 ? 261 SER B O   1 
ATOM   4848 C CB  . SER B 1 259 ? -10.911 -4.785  28.853 1.00 45.46 ? 261 SER B CB  1 
ATOM   4849 O OG  . SER B 1 259 ? -9.809  -4.352  29.646 1.00 44.62 ? 261 SER B OG  1 
ATOM   4850 N N   . GLU B 1 260 ? -11.424 -2.226  27.290 1.00 46.46 ? 262 GLU B N   1 
ATOM   4851 C CA  . GLU B 1 260 ? -11.476 -0.835  26.748 1.00 47.31 ? 262 GLU B CA  1 
ATOM   4852 C C   . GLU B 1 260 ? -10.308 0.079   27.072 1.00 46.99 ? 262 GLU B C   1 
ATOM   4853 O O   . GLU B 1 260 ? -9.969  0.934   26.249 1.00 47.23 ? 262 GLU B O   1 
ATOM   4854 C CB  . GLU B 1 260 ? -12.773 -0.116  27.122 1.00 47.56 ? 262 GLU B CB  1 
ATOM   4855 C CG  . GLU B 1 260 ? -13.952 -0.499  26.241 1.00 50.95 ? 262 GLU B CG  1 
ATOM   4856 C CD  . GLU B 1 260 ? -15.107 -1.100  27.052 1.00 54.12 ? 262 GLU B CD  1 
ATOM   4857 O OE1 . GLU B 1 260 ? -15.456 -2.278  26.804 1.00 55.51 ? 262 GLU B OE1 1 
ATOM   4858 O OE2 . GLU B 1 260 ? -15.645 -0.411  27.951 1.00 54.57 ? 262 GLU B OE2 1 
ATOM   4859 N N   . ARG B 1 261 ? -9.708  -0.081  28.251 1.00 46.52 ? 263 ARG B N   1 
ATOM   4860 C CA  . ARG B 1 261 ? -8.469  0.651   28.604 1.00 46.97 ? 263 ARG B CA  1 
ATOM   4861 C C   . ARG B 1 261 ? -7.354  0.600   27.523 1.00 46.16 ? 263 ARG B C   1 
ATOM   4862 O O   . ARG B 1 261 ? -6.617  1.572   27.359 1.00 45.92 ? 263 ARG B O   1 
ATOM   4863 C CB  . ARG B 1 261 ? -7.939  0.177   29.975 1.00 47.60 ? 263 ARG B CB  1 
ATOM   4864 C CG  . ARG B 1 261 ? -6.685  0.911   30.516 1.00 49.07 ? 263 ARG B CG  1 
ATOM   4865 C CD  . ARG B 1 261 ? -6.477  0.681   32.025 1.00 50.81 ? 263 ARG B CD  1 
ATOM   4866 N NE  . ARG B 1 261 ? -5.215  1.261   32.512 1.00 52.88 ? 263 ARG B NE  1 
ATOM   4867 C CZ  . ARG B 1 261 ? -4.987  1.670   33.764 1.00 54.37 ? 263 ARG B CZ  1 
ATOM   4868 N NH1 . ARG B 1 261 ? -5.940  1.597   34.695 1.00 55.14 ? 263 ARG B NH1 1 
ATOM   4869 N NH2 . ARG B 1 261 ? -3.802  2.179   34.085 1.00 54.27 ? 263 ARG B NH2 1 
ATOM   4870 N N   . ARG B 1 262 ? -7.264  -0.516  26.784 1.00 46.08 ? 264 ARG B N   1 
ATOM   4871 C CA  . ARG B 1 262 ? -6.137  -0.813  25.858 1.00 46.22 ? 264 ARG B CA  1 
ATOM   4872 C C   . ARG B 1 262 ? -4.757  -0.462  26.487 1.00 46.32 ? 264 ARG B C   1 
ATOM   4873 O O   . ARG B 1 262 ? -3.942  0.306   25.907 1.00 44.94 ? 264 ARG B O   1 
ATOM   4874 C CB  . ARG B 1 262 ? -6.326  -0.155  24.465 1.00 46.22 ? 264 ARG B CB  1 
ATOM   4875 C CG  . ARG B 1 262 ? -7.631  -0.562  23.720 1.00 46.08 ? 264 ARG B CG  1 
ATOM   4876 C CD  . ARG B 1 262 ? -7.798  -2.092  23.635 1.00 44.50 ? 264 ARG B CD  1 
ATOM   4877 N NE  . ARG B 1 262 ? -9.053  -2.549  22.995 1.00 42.72 ? 264 ARG B NE  1 
ATOM   4878 C CZ  . ARG B 1 262 ? -9.504  -3.812  23.036 1.00 41.31 ? 264 ARG B CZ  1 
ATOM   4879 N NH1 . ARG B 1 262 ? -8.834  -4.749  23.705 1.00 40.45 ? 264 ARG B NH1 1 
ATOM   4880 N NH2 . ARG B 1 262 ? -10.636 -4.154  22.431 1.00 39.37 ? 264 ARG B NH2 1 
ATOM   4881 N N   . LEU B 1 263 ? -4.522  -1.028  27.686 1.00 46.23 ? 265 LEU B N   1 
ATOM   4882 C CA  . LEU B 1 263 ? -3.293  -0.748  28.442 1.00 46.29 ? 265 LEU B CA  1 
ATOM   4883 C C   . LEU B 1 263 ? -2.091  -1.312  27.673 1.00 46.04 ? 265 LEU B C   1 
ATOM   4884 O O   . LEU B 1 263 ? -2.055  -2.526  27.383 1.00 45.35 ? 265 LEU B O   1 
ATOM   4885 C CB  . LEU B 1 263 ? -3.340  -1.276  29.899 1.00 46.27 ? 265 LEU B CB  1 
ATOM   4886 C CG  . LEU B 1 263 ? -2.069  -1.025  30.743 1.00 46.09 ? 265 LEU B CG  1 
ATOM   4887 C CD1 . LEU B 1 263 ? -1.929  0.454   31.165 1.00 45.65 ? 265 LEU B CD1 1 
ATOM   4888 C CD2 . LEU B 1 263 ? -1.976  -1.971  31.961 1.00 46.82 ? 265 LEU B CD2 1 
ATOM   4889 N N   . ASN B 1 264 ? -1.140  -0.421  27.335 1.00 45.52 ? 266 ASN B N   1 
ATOM   4890 C CA  . ASN B 1 264 ? 0.024   -0.794  26.519 1.00 45.18 ? 266 ASN B CA  1 
ATOM   4891 C C   . ASN B 1 264 ? 0.993   -1.772  27.227 1.00 44.66 ? 266 ASN B C   1 
ATOM   4892 O O   . ASN B 1 264 ? 2.111   -1.383  27.632 1.00 44.48 ? 266 ASN B O   1 
ATOM   4893 C CB  . ASN B 1 264 ? 0.787   0.437   25.977 1.00 45.14 ? 266 ASN B CB  1 
ATOM   4894 C CG  . ASN B 1 264 ? 1.660   0.086   24.765 1.00 46.62 ? 266 ASN B CG  1 
ATOM   4895 O OD1 . ASN B 1 264 ? 2.203   0.970   24.104 1.00 47.29 ? 266 ASN B OD1 1 
ATOM   4896 N ND2 . ASN B 1 264 ? 1.775   -1.219  24.458 1.00 46.32 ? 266 ASN B ND2 1 
ATOM   4897 N N   . HIS B 1 265 ? 0.566   -3.039  27.329 1.00 43.14 ? 267 HIS B N   1 
ATOM   4898 C CA  . HIS B 1 265 ? 1.338   -4.082  28.027 1.00 42.06 ? 267 HIS B CA  1 
ATOM   4899 C C   . HIS B 1 265 ? 2.449   -4.778  27.160 1.00 40.39 ? 267 HIS B C   1 
ATOM   4900 O O   . HIS B 1 265 ? 3.514   -5.149  27.688 1.00 39.48 ? 267 HIS B O   1 
ATOM   4901 C CB  . HIS B 1 265 ? 0.381   -5.117  28.660 1.00 41.89 ? 267 HIS B CB  1 
ATOM   4902 C CG  . HIS B 1 265 ? 1.089   -6.282  29.269 1.00 43.67 ? 267 HIS B CG  1 
ATOM   4903 N ND1 . HIS B 1 265 ? 1.107   -7.534  28.679 1.00 45.24 ? 267 HIS B ND1 1 
ATOM   4904 C CD2 . HIS B 1 265 ? 1.865   -6.372  30.381 1.00 43.15 ? 267 HIS B CD2 1 
ATOM   4905 C CE1 . HIS B 1 265 ? 1.842   -8.350  29.421 1.00 46.97 ? 267 HIS B CE1 1 
ATOM   4906 N NE2 . HIS B 1 265 ? 2.313   -7.668  30.457 1.00 44.66 ? 267 HIS B NE2 1 
ATOM   4907 N N   . HIS B 1 266 ? 2.197   -4.913  25.848 1.00 38.31 ? 268 HIS B N   1 
ATOM   4908 C CA  . HIS B 1 266 ? 3.084   -5.596  24.897 1.00 36.68 ? 268 HIS B CA  1 
ATOM   4909 C C   . HIS B 1 266 ? 2.513   -5.359  23.469 1.00 35.40 ? 268 HIS B C   1 
ATOM   4910 O O   . HIS B 1 266 ? 1.326   -5.026  23.306 1.00 36.20 ? 268 HIS B O   1 
ATOM   4911 C CB  . HIS B 1 266 ? 3.123   -7.117  25.198 1.00 37.65 ? 268 HIS B CB  1 
ATOM   4912 C CG  . HIS B 1 266 ? 1.773   -7.781  25.103 1.00 40.28 ? 268 HIS B CG  1 
ATOM   4913 N ND1 . HIS B 1 266 ? 1.395   -8.565  24.033 1.00 43.72 ? 268 HIS B ND1 1 
ATOM   4914 C CD2 . HIS B 1 266 ? 0.684   -7.690  25.904 1.00 40.59 ? 268 HIS B CD2 1 
ATOM   4915 C CE1 . HIS B 1 266 ? 0.140   -8.950  24.195 1.00 46.44 ? 268 HIS B CE1 1 
ATOM   4916 N NE2 . HIS B 1 266 ? -0.312  -8.438  25.330 1.00 45.45 ? 268 HIS B NE2 1 
ATOM   4917 N N   . THR B 1 267 ? 3.329   -5.520  22.432 1.00 32.83 ? 269 THR B N   1 
ATOM   4918 C CA  . THR B 1 267 ? 2.817   -5.361  21.058 1.00 29.46 ? 269 THR B CA  1 
ATOM   4919 C C   . THR B 1 267 ? 2.231   -6.725  20.684 1.00 28.01 ? 269 THR B C   1 
ATOM   4920 O O   . THR B 1 267 ? 2.988   -7.638  20.357 1.00 24.85 ? 269 THR B O   1 
ATOM   4921 C CB  . THR B 1 267 ? 3.914   -4.880  20.032 1.00 29.07 ? 269 THR B CB  1 
ATOM   4922 O OG1 . THR B 1 267 ? 4.384   -3.581  20.398 1.00 26.61 ? 269 THR B OG1 1 
ATOM   4923 C CG2 . THR B 1 267 ? 3.372   -4.842  18.580 1.00 25.44 ? 269 THR B CG2 1 
ATOM   4924 N N   . GLU B 1 268 ? 0.899   -6.860  20.827 1.00 27.74 ? 270 GLU B N   1 
ATOM   4925 C CA  . GLU B 1 268 ? 0.219   -8.103  20.419 1.00 27.92 ? 270 GLU B CA  1 
ATOM   4926 C C   . GLU B 1 268 ? 0.772   -8.575  19.038 1.00 27.20 ? 270 GLU B C   1 
ATOM   4927 O O   . GLU B 1 268 ? 1.284   -7.752  18.253 1.00 28.37 ? 270 GLU B O   1 
ATOM   4928 C CB  . GLU B 1 268 ? -1.319  -7.936  20.408 1.00 28.53 ? 270 GLU B CB  1 
ATOM   4929 C CG  . GLU B 1 268 ? -2.087  -9.218  19.926 1.00 27.47 ? 270 GLU B CG  1 
ATOM   4930 C CD  . GLU B 1 268 ? -2.030  -10.338 20.959 1.00 30.13 ? 270 GLU B CD  1 
ATOM   4931 O OE1 . GLU B 1 268 ? -2.346  -11.564 20.647 1.00 29.04 ? 270 GLU B OE1 1 
ATOM   4932 O OE2 . GLU B 1 268 ? -1.654  -9.971  22.103 1.00 29.57 ? 270 GLU B OE2 1 
ATOM   4933 N N   . ALA B 1 269 ? 0.716   -9.869  18.777 1.00 25.07 ? 271 ALA B N   1 
ATOM   4934 C CA  . ALA B 1 269 ? 1.304   -10.421 17.596 1.00 23.77 ? 271 ALA B CA  1 
ATOM   4935 C C   . ALA B 1 269 ? 0.267   -10.348 16.450 1.00 23.39 ? 271 ALA B C   1 
ATOM   4936 O O   . ALA B 1 269 ? -0.669  -11.183 16.381 1.00 22.44 ? 271 ALA B O   1 
ATOM   4937 C CB  . ALA B 1 269 ? 1.778   -11.900 17.840 1.00 24.07 ? 271 ALA B CB  1 
ATOM   4938 N N   . THR B 1 270 ? 0.429   -9.334  15.608 1.00 20.81 ? 272 THR B N   1 
ATOM   4939 C CA  . THR B 1 270 ? -0.445  -8.961  14.483 1.00 18.99 ? 272 THR B CA  1 
ATOM   4940 C C   . THR B 1 270 ? -0.855  -10.126 13.591 1.00 18.50 ? 272 THR B C   1 
ATOM   4941 O O   . THR B 1 270 ? -2.009  -10.551 13.593 1.00 18.75 ? 272 THR B O   1 
ATOM   4942 C CB  . THR B 1 270 ? 0.283   -7.920  13.621 1.00 19.56 ? 272 THR B CB  1 
ATOM   4943 O OG1 . THR B 1 270 ? 1.522   -8.507  13.112 1.00 26.82 ? 272 THR B OG1 1 
ATOM   4944 C CG2 . THR B 1 270 ? 0.658   -6.764  14.443 1.00 16.22 ? 272 THR B CG2 1 
ATOM   4945 N N   . THR B 1 271 ? 0.100   -10.705 12.860 1.00 18.77 ? 273 THR B N   1 
ATOM   4946 C CA  . THR B 1 271 ? -0.191  -11.848 11.972 1.00 17.09 ? 273 THR B CA  1 
ATOM   4947 C C   . THR B 1 271 ? -0.769  -13.026 12.697 1.00 17.76 ? 273 THR B C   1 
ATOM   4948 O O   . THR B 1 271 ? -1.740  -13.684 12.174 1.00 17.56 ? 273 THR B O   1 
ATOM   4949 C CB  . THR B 1 271 ? 1.066   -12.253 11.235 1.00 16.05 ? 273 THR B CB  1 
ATOM   4950 O OG1 . THR B 1 271 ? 1.494   -11.124 10.522 1.00 18.36 ? 273 THR B OG1 1 
ATOM   4951 C CG2 . THR B 1 271 ? 0.818   -13.375 10.281 1.00 16.14 ? 273 THR B CG2 1 
ATOM   4952 N N   . MET B 1 272 ? -0.234  -13.318 13.896 1.00 16.42 ? 274 MET B N   1 
ATOM   4953 C CA  . MET B 1 272 ? -0.722  -14.494 14.647 1.00 17.63 ? 274 MET B CA  1 
ATOM   4954 C C   . MET B 1 272 ? -2.176  -14.288 15.096 1.00 16.75 ? 274 MET B C   1 
ATOM   4955 O O   . MET B 1 272 ? -2.934  -15.229 15.229 1.00 15.51 ? 274 MET B O   1 
ATOM   4956 C CB  . MET B 1 272 ? 0.219   -14.802 15.862 1.00 18.72 ? 274 MET B CB  1 
ATOM   4957 C CG  . MET B 1 272 ? 1.598   -15.448 15.452 1.00 21.31 ? 274 MET B CG  1 
ATOM   4958 S SD  . MET B 1 272 ? 1.398   -17.055 14.575 1.00 31.02 ? 274 MET B SD  1 
ATOM   4959 C CE  . MET B 1 272 ? 0.507   -18.078 15.785 1.00 28.55 ? 274 MET B CE  1 
ATOM   4960 N N   . LEU B 1 273 ? -2.546  -13.059 15.411 1.00 17.06 ? 275 LEU B N   1 
ATOM   4961 C CA  . LEU B 1 273 ? -3.956  -12.766 15.745 1.00 17.16 ? 275 LEU B CA  1 
ATOM   4962 C C   . LEU B 1 273 ? -4.825  -12.949 14.486 1.00 16.33 ? 275 LEU B C   1 
ATOM   4963 O O   . LEU B 1 273 ? -5.859  -13.626 14.544 1.00 17.77 ? 275 LEU B O   1 
ATOM   4964 C CB  . LEU B 1 273 ? -4.105  -11.370 16.346 1.00 15.98 ? 275 LEU B CB  1 
ATOM   4965 C CG  . LEU B 1 273 ? -5.564  -11.183 16.778 1.00 21.00 ? 275 LEU B CG  1 
ATOM   4966 C CD1 . LEU B 1 273 ? -5.976  -12.277 17.785 1.00 20.24 ? 275 LEU B CD1 1 
ATOM   4967 C CD2 . LEU B 1 273 ? -5.853  -9.859  17.286 1.00 17.50 ? 275 LEU B CD2 1 
ATOM   4968 N N   . TYR B 1 274 ? -4.340  -12.488 13.318 1.00 15.38 ? 276 TYR B N   1 
ATOM   4969 C CA  . TYR B 1 274 ? -5.097  -12.703 12.072 1.00 15.36 ? 276 TYR B CA  1 
ATOM   4970 C C   . TYR B 1 274 ? -5.352  -14.223 11.887 1.00 16.09 ? 276 TYR B C   1 
ATOM   4971 O O   . TYR B 1 274 ? -6.478  -14.635 11.526 1.00 14.33 ? 276 TYR B O   1 
ATOM   4972 C CB  . TYR B 1 274 ? -4.271  -12.290 10.840 1.00 17.05 ? 276 TYR B CB  1 
ATOM   4973 C CG  . TYR B 1 274 ? -4.147  -10.826 10.542 1.00 16.30 ? 276 TYR B CG  1 
ATOM   4974 C CD1 . TYR B 1 274 ? -4.930  -9.847  11.218 1.00 14.64 ? 276 TYR B CD1 1 
ATOM   4975 C CD2 . TYR B 1 274 ? -3.247  -10.430 9.557  1.00 19.63 ? 276 TYR B CD2 1 
ATOM   4976 C CE1 . TYR B 1 274 ? -4.816  -8.475  10.857 1.00 14.42 ? 276 TYR B CE1 1 
ATOM   4977 C CE2 . TYR B 1 274 ? -3.078  -9.115  9.219  1.00 13.41 ? 276 TYR B CE2 1 
ATOM   4978 C CZ  . TYR B 1 274 ? -3.841  -8.147  9.845  1.00 16.43 ? 276 TYR B CZ  1 
ATOM   4979 O OH  . TYR B 1 274 ? -3.652  -6.869  9.386  1.00 18.35 ? 276 TYR B OH  1 
ATOM   4980 N N   . ALA B 1 275 ? -4.295  -15.036 12.093 1.00 13.89 ? 277 ALA B N   1 
ATOM   4981 C CA  . ALA B 1 275 ? -4.380  -16.483 11.871 1.00 15.32 ? 277 ALA B CA  1 
ATOM   4982 C C   . ALA B 1 275 ? -5.335  -17.179 12.887 1.00 15.59 ? 277 ALA B C   1 
ATOM   4983 O O   . ALA B 1 275 ? -6.094  -18.086 12.508 1.00 17.14 ? 277 ALA B O   1 
ATOM   4984 C CB  . ALA B 1 275 ? -2.945  -17.187 11.945 1.00 13.19 ? 277 ALA B CB  1 
ATOM   4985 N N   . LEU B 1 276 ? -5.265  -16.776 14.149 1.00 14.57 ? 278 LEU B N   1 
ATOM   4986 C CA  . LEU B 1 276 ? -6.161  -17.337 15.185 1.00 15.97 ? 278 LEU B CA  1 
ATOM   4987 C C   . LEU B 1 276 ? -7.641  -17.029 14.898 1.00 14.97 ? 278 LEU B C   1 
ATOM   4988 O O   . LEU B 1 276 ? -8.545  -17.883 15.012 1.00 15.78 ? 278 LEU B O   1 
ATOM   4989 C CB  . LEU B 1 276 ? -5.761  -16.832 16.615 1.00 13.54 ? 278 LEU B CB  1 
ATOM   4990 C CG  . LEU B 1 276 ? -6.688  -17.314 17.743 1.00 13.73 ? 278 LEU B CG  1 
ATOM   4991 C CD1 . LEU B 1 276 ? -6.552  -18.909 18.025 1.00 14.28 ? 278 LEU B CD1 1 
ATOM   4992 C CD2 . LEU B 1 276 ? -6.328  -16.621 19.001 1.00 14.26 ? 278 LEU B CD2 1 
ATOM   4993 N N   . ARG B 1 277 ? -7.881  -15.778 14.615 1.00 15.20 ? 279 ARG B N   1 
ATOM   4994 C CA  . ARG B 1 277 ? -9.187  -15.283 14.202 1.00 17.41 ? 279 ARG B CA  1 
ATOM   4995 C C   . ARG B 1 277 ? -9.773  -16.153 13.088 1.00 17.14 ? 279 ARG B C   1 
ATOM   4996 O O   . ARG B 1 277 ? -10.937 -16.653 13.231 1.00 17.24 ? 279 ARG B O   1 
ATOM   4997 C CB  . ARG B 1 277 ? -9.058  -13.789 13.773 1.00 17.09 ? 279 ARG B CB  1 
ATOM   4998 C CG  . ARG B 1 277 ? -10.386 -12.948 13.725 1.00 21.67 ? 279 ARG B CG  1 
ATOM   4999 C CD  . ARG B 1 277 ? -11.084 -13.184 12.396 1.00 24.55 ? 279 ARG B CD  1 
ATOM   5000 N NE  . ARG B 1 277 ? -12.202 -12.286 12.184 1.00 21.70 ? 279 ARG B NE  1 
ATOM   5001 C CZ  . ARG B 1 277 ? -12.961 -12.293 11.087 1.00 22.71 ? 279 ARG B CZ  1 
ATOM   5002 N NH1 . ARG B 1 277 ? -12.674 -13.129 10.090 1.00 26.24 ? 279 ARG B NH1 1 
ATOM   5003 N NH2 . ARG B 1 277 ? -13.982 -11.448 10.973 1.00 22.59 ? 279 ARG B NH2 1 
ATOM   5004 N N   . GLU B 1 278 ? -8.955  -16.421 12.051 1.00 16.34 ? 280 GLU B N   1 
ATOM   5005 C CA  . GLU B 1 278 ? -9.437  -17.173 10.926 1.00 17.83 ? 280 GLU B CA  1 
ATOM   5006 C C   . GLU B 1 278 ? -9.610  -18.586 11.348 1.00 17.18 ? 280 GLU B C   1 
ATOM   5007 O O   . GLU B 1 278 ? -10.585 -19.189 10.934 1.00 15.82 ? 280 GLU B O   1 
ATOM   5008 C CB  . GLU B 1 278 ? -8.508  -17.145 9.677  1.00 17.48 ? 280 GLU B CB  1 
ATOM   5009 C CG  . GLU B 1 278 ? -8.510  -15.793 8.982  1.00 24.92 ? 280 GLU B CG  1 
ATOM   5010 C CD  . GLU B 1 278 ? -9.912  -15.296 8.444  1.00 25.14 ? 280 GLU B CD  1 
ATOM   5011 O OE1 . GLU B 1 278 ? -10.087 -15.046 7.243  1.00 23.48 ? 280 GLU B OE1 1 
ATOM   5012 O OE2 . GLU B 1 278 ? -10.795 -15.027 9.237  1.00 24.14 ? 280 GLU B OE2 1 
ATOM   5013 N N   . GLY B 1 279 ? -8.627  -19.114 12.110 1.00 16.65 ? 281 GLY B N   1 
ATOM   5014 C CA  . GLY B 1 279 ? -8.622  -20.541 12.474 1.00 17.38 ? 281 GLY B CA  1 
ATOM   5015 C C   . GLY B 1 279 ? -9.795  -20.887 13.378 1.00 17.71 ? 281 GLY B C   1 
ATOM   5016 O O   . GLY B 1 279 ? -10.487 -21.921 13.202 1.00 17.50 ? 281 GLY B O   1 
ATOM   5017 N N   . VAL B 1 280 ? -10.079 -19.996 14.325 1.00 17.09 ? 282 VAL B N   1 
ATOM   5018 C CA  . VAL B 1 280 ? -11.353 -20.165 15.005 1.00 18.56 ? 282 VAL B CA  1 
ATOM   5019 C C   . VAL B 1 280 ? -12.656 -19.916 14.226 1.00 19.46 ? 282 VAL B C   1 
ATOM   5020 O O   . VAL B 1 280 ? -13.607 -20.690 14.391 1.00 19.83 ? 282 VAL B O   1 
ATOM   5021 C CB  . VAL B 1 280 ? -11.354 -19.890 16.552 1.00 19.42 ? 282 VAL B CB  1 
ATOM   5022 C CG1 . VAL B 1 280 ? -10.052 -19.467 17.172 1.00 18.10 ? 282 VAL B CG1 1 
ATOM   5023 C CG2 . VAL B 1 280 ? -12.705 -19.559 17.209 1.00 19.84 ? 282 VAL B CG2 1 
ATOM   5024 N N   . ARG B 1 281 ? -12.707 -18.913 13.357 1.00 18.30 ? 283 ARG B N   1 
ATOM   5025 C CA  . ARG B 1 281 ? -13.865 -18.795 12.487 1.00 19.34 ? 283 ARG B CA  1 
ATOM   5026 C C   . ARG B 1 281 ? -14.125 -20.189 11.813 1.00 20.02 ? 283 ARG B C   1 
ATOM   5027 O O   . ARG B 1 281 ? -15.276 -20.616 11.753 1.00 20.06 ? 283 ARG B O   1 
ATOM   5028 C CB  . ARG B 1 281 ? -13.661 -17.630 11.457 1.00 19.55 ? 283 ARG B CB  1 
ATOM   5029 C CG  . ARG B 1 281 ? -14.776 -17.486 10.398 1.00 19.29 ? 283 ARG B CG  1 
ATOM   5030 C CD  . ARG B 1 281 ? -14.571 -16.353 9.420  1.00 25.02 ? 283 ARG B CD  1 
ATOM   5031 N NE  . ARG B 1 281 ? -13.362 -16.466 8.571  1.00 24.32 ? 283 ARG B NE  1 
ATOM   5032 C CZ  . ARG B 1 281 ? -13.246 -17.236 7.483  1.00 24.66 ? 283 ARG B CZ  1 
ATOM   5033 N NH1 . ARG B 1 281 ? -14.258 -18.015 7.024  1.00 15.91 ? 283 ARG B NH1 1 
ATOM   5034 N NH2 . ARG B 1 281 ? -12.087 -17.200 6.829  1.00 23.75 ? 283 ARG B NH2 1 
ATOM   5035 N N   . LEU B 1 282 ? -13.070 -20.883 11.328 1.00 17.63 ? 284 LEU B N   1 
ATOM   5036 C CA  . LEU B 1 282 ? -13.277 -22.102 10.566 1.00 18.66 ? 284 LEU B CA  1 
ATOM   5037 C C   . LEU B 1 282 ? -13.833 -23.229 11.436 1.00 18.52 ? 284 LEU B C   1 
ATOM   5038 O O   . LEU B 1 282 ? -14.648 -24.070 10.969 1.00 18.01 ? 284 LEU B O   1 
ATOM   5039 C CB  . LEU B 1 282 ? -11.983 -22.601 9.851  1.00 17.90 ? 284 LEU B CB  1 
ATOM   5040 C CG  . LEU B 1 282 ? -11.386 -21.639 8.811  1.00 20.82 ? 284 LEU B CG  1 
ATOM   5041 C CD1 . LEU B 1 282 ? -10.205 -22.311 8.033  1.00 23.47 ? 284 LEU B CD1 1 
ATOM   5042 C CD2 . LEU B 1 282 ? -12.466 -21.183 7.822  1.00 18.50 ? 284 LEU B CD2 1 
ATOM   5043 N N   . VAL B 1 283 ? -13.343 -23.299 12.674 1.00 17.19 ? 285 VAL B N   1 
ATOM   5044 C CA  . VAL B 1 283 ? -13.949 -24.227 13.567 1.00 19.41 ? 285 VAL B CA  1 
ATOM   5045 C C   . VAL B 1 283 ? -15.474 -24.071 13.790 1.00 18.82 ? 285 VAL B C   1 
ATOM   5046 O O   . VAL B 1 283 ? -16.209 -25.058 13.761 1.00 19.91 ? 285 VAL B O   1 
ATOM   5047 C CB  . VAL B 1 283 ? -13.131 -24.639 14.848 1.00 20.18 ? 285 VAL B CB  1 
ATOM   5048 C CG1 . VAL B 1 283 ? -11.636 -24.486 14.823 1.00 15.76 ? 285 VAL B CG1 1 
ATOM   5049 C CG2 . VAL B 1 283 ? -13.912 -24.678 16.144 1.00 20.06 ? 285 VAL B CG2 1 
ATOM   5050 N N   . LEU B 1 284 ? -15.911 -22.838 13.953 1.00 18.45 ? 286 LEU B N   1 
ATOM   5051 C CA  . LEU B 1 284 ? -17.270 -22.519 14.248 1.00 19.13 ? 286 LEU B CA  1 
ATOM   5052 C C   . LEU B 1 284 ? -18.131 -22.654 13.025 1.00 19.76 ? 286 LEU B C   1 
ATOM   5053 O O   . LEU B 1 284 ? -19.320 -23.013 13.125 1.00 21.12 ? 286 LEU B O   1 
ATOM   5054 C CB  . LEU B 1 284 ? -17.379 -21.135 14.927 1.00 18.20 ? 286 LEU B CB  1 
ATOM   5055 C CG  . LEU B 1 284 ? -16.653 -21.102 16.305 1.00 18.19 ? 286 LEU B CG  1 
ATOM   5056 C CD1 . LEU B 1 284 ? -16.689 -19.680 16.820 1.00 13.35 ? 286 LEU B CD1 1 
ATOM   5057 C CD2 . LEU B 1 284 ? -17.301 -22.047 17.389 1.00 14.98 ? 286 LEU B CD2 1 
ATOM   5058 N N   . GLU B 1 285 ? -17.549 -22.416 11.857 1.00 20.71 ? 287 GLU B N   1 
ATOM   5059 C CA  . GLU B 1 285 ? -18.255 -22.694 10.618 1.00 21.35 ? 287 GLU B CA  1 
ATOM   5060 C C   . GLU B 1 285 ? -18.545 -24.182 10.492 1.00 21.60 ? 287 GLU B C   1 
ATOM   5061 O O   . GLU B 1 285 ? -19.649 -24.602 10.082 1.00 20.00 ? 287 GLU B O   1 
ATOM   5062 C CB  . GLU B 1 285 ? -17.425 -22.184 9.420  1.00 22.73 ? 287 GLU B CB  1 
ATOM   5063 C CG  . GLU B 1 285 ? -17.735 -20.741 9.086  1.00 25.84 ? 287 GLU B CG  1 
ATOM   5064 C CD  . GLU B 1 285 ? -16.959 -20.157 7.873  1.00 31.96 ? 287 GLU B CD  1 
ATOM   5065 O OE1 . GLU B 1 285 ? -16.583 -20.907 6.932  1.00 32.57 ? 287 GLU B OE1 1 
ATOM   5066 O OE2 . GLU B 1 285 ? -16.769 -18.912 7.882  1.00 27.52 ? 287 GLU B OE2 1 
ATOM   5067 N N   . GLU B 1 286 ? -17.562 -24.998 10.876 1.00 21.30 ? 288 GLU B N   1 
ATOM   5068 C CA  . GLU B 1 286 ? -17.756 -26.429 10.792 1.00 20.38 ? 288 GLU B CA  1 
ATOM   5069 C C   . GLU B 1 286 ? -18.849 -26.811 11.783 1.00 20.53 ? 288 GLU B C   1 
ATOM   5070 O O   . GLU B 1 286 ? -19.685 -27.666 11.510 1.00 19.26 ? 288 GLU B O   1 
ATOM   5071 C CB  . GLU B 1 286 ? -16.460 -27.225 11.061 1.00 19.93 ? 288 GLU B CB  1 
ATOM   5072 C CG  . GLU B 1 286 ? -16.666 -28.748 10.830 1.00 17.28 ? 288 GLU B CG  1 
ATOM   5073 C CD  . GLU B 1 286 ? -15.343 -29.562 10.957 1.00 17.00 ? 288 GLU B CD  1 
ATOM   5074 O OE1 . GLU B 1 286 ? -14.318 -28.959 11.311 1.00 16.22 ? 288 GLU B OE1 1 
ATOM   5075 O OE2 . GLU B 1 286 ? -15.331 -30.794 10.697 1.00 20.21 ? 288 GLU B OE2 1 
ATOM   5076 N N   . GLY B 1 287 ? -18.841 -26.159 12.940 1.00 20.05 ? 289 GLY B N   1 
ATOM   5077 C CA  . GLY B 1 287 ? -19.769 -26.507 13.994 1.00 19.33 ? 289 GLY B CA  1 
ATOM   5078 C C   . GLY B 1 287 ? -19.008 -27.422 14.938 1.00 19.64 ? 289 GLY B C   1 
ATOM   5079 O O   . GLY B 1 287 ? -18.439 -28.429 14.517 1.00 19.91 ? 289 GLY B O   1 
ATOM   5080 N N   . LEU B 1 288 ? -19.034 -27.112 16.231 1.00 18.44 ? 290 LEU B N   1 
ATOM   5081 C CA  . LEU B 1 288 ? -18.385 -27.961 17.263 1.00 18.94 ? 290 LEU B CA  1 
ATOM   5082 C C   . LEU B 1 288 ? -18.679 -29.489 17.292 1.00 19.63 ? 290 LEU B C   1 
ATOM   5083 O O   . LEU B 1 288 ? -17.753 -30.325 17.137 1.00 20.14 ? 290 LEU B O   1 
ATOM   5084 C CB  . LEU B 1 288 ? -18.628 -27.330 18.625 1.00 19.12 ? 290 LEU B CB  1 
ATOM   5085 C CG  . LEU B 1 288 ? -17.936 -25.959 18.848 1.00 20.45 ? 290 LEU B CG  1 
ATOM   5086 C CD1 . LEU B 1 288 ? -18.193 -25.572 20.312 1.00 22.84 ? 290 LEU B CD1 1 
ATOM   5087 C CD2 . LEU B 1 288 ? -16.475 -26.097 18.602 1.00 21.77 ? 290 LEU B CD2 1 
ATOM   5088 N N   . GLU B 1 289 ? -19.944 -29.860 17.517 1.00 20.11 ? 291 GLU B N   1 
ATOM   5089 C CA  . GLU B 1 289 ? -20.377 -31.267 17.469 1.00 21.08 ? 291 GLU B CA  1 
ATOM   5090 C C   . GLU B 1 289 ? -20.029 -31.969 16.156 1.00 21.21 ? 291 GLU B C   1 
ATOM   5091 O O   . GLU B 1 289 ? -19.537 -33.121 16.180 1.00 21.24 ? 291 GLU B O   1 
ATOM   5092 C CB  . GLU B 1 289 ? -21.876 -31.383 17.819 1.00 22.53 ? 291 GLU B CB  1 
ATOM   5093 C CG  . GLU B 1 289 ? -22.121 -31.073 19.330 1.00 28.14 ? 291 GLU B CG  1 
ATOM   5094 C CD  . GLU B 1 289 ? -23.608 -31.194 19.787 1.00 38.88 ? 291 GLU B CD  1 
ATOM   5095 O OE1 . GLU B 1 289 ? -24.545 -30.936 18.948 1.00 40.43 ? 291 GLU B OE1 1 
ATOM   5096 O OE2 . GLU B 1 289 ? -23.822 -31.556 20.992 1.00 37.66 ? 291 GLU B OE2 1 
ATOM   5097 N N   . THR B 1 290 ? -20.206 -31.271 15.019 1.00 21.22 ? 292 THR B N   1 
ATOM   5098 C CA  . THR B 1 290 ? -19.870 -31.833 13.708 1.00 20.45 ? 292 THR B CA  1 
ATOM   5099 C C   . THR B 1 290 ? -18.381 -32.044 13.712 1.00 19.96 ? 292 THR B C   1 
ATOM   5100 O O   . THR B 1 290 ? -17.898 -33.090 13.309 1.00 21.00 ? 292 THR B O   1 
ATOM   5101 C CB  . THR B 1 290 ? -20.236 -30.864 12.538 1.00 21.71 ? 292 THR B CB  1 
ATOM   5102 O OG1 . THR B 1 290 ? -21.632 -30.550 12.568 1.00 21.68 ? 292 THR B OG1 1 
ATOM   5103 C CG2 . THR B 1 290 ? -19.834 -31.415 11.132 1.00 21.47 ? 292 THR B CG2 1 
ATOM   5104 N N   . ARG B 1 291 ? -17.621 -31.058 14.149 1.00 18.40 ? 293 ARG B N   1 
ATOM   5105 C CA  . ARG B 1 291 ? -16.177 -31.253 14.143 1.00 18.87 ? 293 ARG B CA  1 
ATOM   5106 C C   . ARG B 1 291 ? -15.691 -32.378 15.049 1.00 17.19 ? 293 ARG B C   1 
ATOM   5107 O O   . ARG B 1 291 ? -14.726 -33.114 14.675 1.00 17.90 ? 293 ARG B O   1 
ATOM   5108 C CB  . ARG B 1 291 ? -15.439 -29.938 14.475 1.00 15.85 ? 293 ARG B CB  1 
ATOM   5109 C CG  . ARG B 1 291 ? -14.008 -30.006 14.365 1.00 16.54 ? 293 ARG B CG  1 
ATOM   5110 C CD  . ARG B 1 291 ? -13.466 -28.534 14.529 1.00 12.89 ? 293 ARG B CD  1 
ATOM   5111 N NE  . ARG B 1 291 ? -12.040 -28.366 14.414 1.00 17.75 ? 293 ARG B NE  1 
ATOM   5112 C CZ  . ARG B 1 291 ? -11.454 -27.764 13.360 1.00 17.68 ? 293 ARG B CZ  1 
ATOM   5113 N NH1 . ARG B 1 291 ? -12.182 -27.346 12.292 1.00 14.99 ? 293 ARG B NH1 1 
ATOM   5114 N NH2 . ARG B 1 291 ? -10.156 -27.633 13.337 1.00 13.54 ? 293 ARG B NH2 1 
ATOM   5115 N N   . PHE B 1 292 ? -16.301 -32.503 16.227 1.00 18.50 ? 294 PHE B N   1 
ATOM   5116 C CA  . PHE B 1 292 ? -15.950 -33.627 17.141 1.00 19.23 ? 294 PHE B CA  1 
ATOM   5117 C C   . PHE B 1 292 ? -16.219 -34.953 16.507 1.00 20.10 ? 294 PHE B C   1 
ATOM   5118 O O   . PHE B 1 292 ? -15.373 -35.876 16.558 1.00 20.36 ? 294 PHE B O   1 
ATOM   5119 C CB  . PHE B 1 292 ? -16.558 -33.552 18.538 1.00 18.01 ? 294 PHE B CB  1 
ATOM   5120 C CG  . PHE B 1 292 ? -16.347 -32.202 19.228 1.00 18.87 ? 294 PHE B CG  1 
ATOM   5121 C CD1 . PHE B 1 292 ? -15.187 -31.457 19.015 1.00 16.69 ? 294 PHE B CD1 1 
ATOM   5122 C CD2 . PHE B 1 292 ? -17.339 -31.686 20.058 1.00 19.25 ? 294 PHE B CD2 1 
ATOM   5123 C CE1 . PHE B 1 292 ? -15.005 -30.172 19.612 1.00 16.71 ? 294 PHE B CE1 1 
ATOM   5124 C CE2 . PHE B 1 292 ? -17.202 -30.406 20.657 1.00 18.91 ? 294 PHE B CE2 1 
ATOM   5125 C CZ  . PHE B 1 292 ? -16.043 -29.641 20.437 1.00 17.18 ? 294 PHE B CZ  1 
ATOM   5126 N N   . GLU B 1 293 ? -17.396 -35.059 15.899 1.00 20.93 ? 295 GLU B N   1 
ATOM   5127 C CA  . GLU B 1 293 ? -17.815 -36.292 15.285 1.00 21.18 ? 295 GLU B CA  1 
ATOM   5128 C C   . GLU B 1 293 ? -16.933 -36.584 14.076 1.00 20.17 ? 295 GLU B C   1 
ATOM   5129 O O   . GLU B 1 293 ? -16.513 -37.706 13.858 1.00 19.86 ? 295 GLU B O   1 
ATOM   5130 C CB  . GLU B 1 293 ? -19.263 -36.100 14.870 1.00 23.80 ? 295 GLU B CB  1 
ATOM   5131 C CG  . GLU B 1 293 ? -19.692 -36.869 13.623 1.00 31.19 ? 295 GLU B CG  1 
ATOM   5132 C CD  . GLU B 1 293 ? -20.050 -38.272 13.928 1.00 40.62 ? 295 GLU B CD  1 
ATOM   5133 O OE1 . GLU B 1 293 ? -19.229 -38.956 14.571 1.00 44.35 ? 295 GLU B OE1 1 
ATOM   5134 O OE2 . GLU B 1 293 ? -21.168 -38.693 13.526 1.00 46.42 ? 295 GLU B OE2 1 
ATOM   5135 N N   . ARG B 1 294 ? -16.567 -35.539 13.334 1.00 19.61 ? 296 ARG B N   1 
ATOM   5136 C CA  . ARG B 1 294 ? -15.599 -35.710 12.249 1.00 20.11 ? 296 ARG B CA  1 
ATOM   5137 C C   . ARG B 1 294 ? -14.219 -36.232 12.714 1.00 19.39 ? 296 ARG B C   1 
ATOM   5138 O O   . ARG B 1 294 ? -13.599 -37.049 12.023 1.00 20.16 ? 296 ARG B O   1 
ATOM   5139 C CB  . ARG B 1 294 ? -15.441 -34.397 11.505 1.00 19.89 ? 296 ARG B CB  1 
ATOM   5140 C CG  . ARG B 1 294 ? -14.547 -34.473 10.303 1.00 24.02 ? 296 ARG B CG  1 
ATOM   5141 C CD  . ARG B 1 294 ? -13.122 -33.960 10.564 1.00 24.19 ? 296 ARG B CD  1 
ATOM   5142 N NE  . ARG B 1 294 ? -13.056 -32.521 10.803 1.00 23.31 ? 296 ARG B NE  1 
ATOM   5143 C CZ  . ARG B 1 294 ? -11.928 -31.817 10.788 1.00 23.11 ? 296 ARG B CZ  1 
ATOM   5144 N NH1 . ARG B 1 294 ? -10.768 -32.423 10.521 1.00 18.11 ? 296 ARG B NH1 1 
ATOM   5145 N NH2 . ARG B 1 294 ? -11.966 -30.496 11.045 1.00 14.02 ? 296 ARG B NH2 1 
ATOM   5146 N N   . HIS B 1 295 ? -13.704 -35.743 13.842 1.00 19.38 ? 297 HIS B N   1 
ATOM   5147 C CA  . HIS B 1 295 ? -12.446 -36.312 14.424 1.00 17.50 ? 297 HIS B CA  1 
ATOM   5148 C C   . HIS B 1 295 ? -12.639 -37.833 14.769 1.00 18.01 ? 297 HIS B C   1 
ATOM   5149 O O   . HIS B 1 295 ? -11.789 -38.695 14.474 1.00 17.95 ? 297 HIS B O   1 
ATOM   5150 C CB  . HIS B 1 295 ? -11.973 -35.473 15.612 1.00 16.64 ? 297 HIS B CB  1 
ATOM   5151 C CG  . HIS B 1 295 ? -11.218 -34.216 15.207 1.00 18.27 ? 297 HIS B CG  1 
ATOM   5152 N ND1 . HIS B 1 295 ? -11.832 -33.116 14.624 1.00 18.52 ? 297 HIS B ND1 1 
ATOM   5153 C CD2 . HIS B 1 295 ? -9.902  -33.903 15.296 1.00 16.13 ? 297 HIS B CD2 1 
ATOM   5154 C CE1 . HIS B 1 295 ? -10.922 -32.194 14.358 1.00 16.78 ? 297 HIS B CE1 1 
ATOM   5155 N NE2 . HIS B 1 295 ? -9.737  -32.651 14.742 1.00 18.00 ? 297 HIS B NE2 1 
ATOM   5156 N N   . ARG B 1 296 ? -13.763 -38.167 15.343 1.00 17.40 ? 298 ARG B N   1 
ATOM   5157 C CA  . ARG B 1 296 ? -13.970 -39.569 15.697 1.00 17.87 ? 298 ARG B CA  1 
ATOM   5158 C C   . ARG B 1 296 ? -14.036 -40.443 14.432 1.00 18.61 ? 298 ARG B C   1 
ATOM   5159 O O   . ARG B 1 296 ? -13.594 -41.603 14.455 1.00 20.21 ? 298 ARG B O   1 
ATOM   5160 C CB  . ARG B 1 296 ? -15.268 -39.730 16.494 1.00 17.35 ? 298 ARG B CB  1 
ATOM   5161 C CG  . ARG B 1 296 ? -15.207 -39.180 17.915 1.00 17.43 ? 298 ARG B CG  1 
ATOM   5162 C CD  . ARG B 1 296 ? -16.389 -39.718 18.794 1.00 22.37 ? 298 ARG B CD  1 
ATOM   5163 N NE  . ARG B 1 296 ? -17.677 -39.225 18.292 1.00 27.59 ? 298 ARG B NE  1 
ATOM   5164 C CZ  . ARG B 1 296 ? -18.224 -38.045 18.603 1.00 26.01 ? 298 ARG B CZ  1 
ATOM   5165 N NH1 . ARG B 1 296 ? -17.595 -37.209 19.418 1.00 20.77 ? 298 ARG B NH1 1 
ATOM   5166 N NH2 . ARG B 1 296 ? -19.414 -37.709 18.080 1.00 23.33 ? 298 ARG B NH2 1 
ATOM   5167 N N   . HIS B 1 297 ? -14.612 -39.908 13.350 1.00 18.01 ? 299 HIS B N   1 
ATOM   5168 C CA  . HIS B 1 297 ? -14.779 -40.680 12.108 1.00 19.25 ? 299 HIS B CA  1 
ATOM   5169 C C   . HIS B 1 297 ? -13.403 -41.137 11.516 1.00 19.43 ? 299 HIS B C   1 
ATOM   5170 O O   . HIS B 1 297 ? -13.196 -42.321 11.208 1.00 17.49 ? 299 HIS B O   1 
ATOM   5171 C CB  . HIS B 1 297 ? -15.596 -39.858 11.098 1.00 19.78 ? 299 HIS B CB  1 
ATOM   5172 C CG  . HIS B 1 297 ? -15.749 -40.519 9.758  1.00 22.60 ? 299 HIS B CG  1 
ATOM   5173 N ND1 . HIS B 1 297 ? -15.484 -39.857 8.580  1.00 24.23 ? 299 HIS B ND1 1 
ATOM   5174 C CD2 . HIS B 1 297 ? -16.145 -41.773 9.408  1.00 23.17 ? 299 HIS B CD2 1 
ATOM   5175 C CE1 . HIS B 1 297 ? -15.709 -40.660 7.562  1.00 22.59 ? 299 HIS B CE1 1 
ATOM   5176 N NE2 . HIS B 1 297 ? -16.117 -41.829 8.037  1.00 25.89 ? 299 HIS B NE2 1 
ATOM   5177 N N   . HIS B 1 298 ? -12.465 -40.185 11.403 1.00 18.71 ? 300 HIS B N   1 
ATOM   5178 C CA  . HIS B 1 298 ? -11.116 -40.438 10.953 1.00 19.20 ? 300 HIS B CA  1 
ATOM   5179 C C   . HIS B 1 298 ? -10.310 -41.273 11.965 1.00 18.97 ? 300 HIS B C   1 
ATOM   5180 O O   . HIS B 1 298 ? -9.528  -42.156 11.549 1.00 21.18 ? 300 HIS B O   1 
ATOM   5181 C CB  . HIS B 1 298 ? -10.437 -39.087 10.568 1.00 17.07 ? 300 HIS B CB  1 
ATOM   5182 C CG  . HIS B 1 298 ? -11.169 -38.377 9.484  1.00 20.64 ? 300 HIS B CG  1 
ATOM   5183 N ND1 . HIS B 1 298 ? -11.276 -38.900 8.210  1.00 21.61 ? 300 HIS B ND1 1 
ATOM   5184 C CD2 . HIS B 1 298 ? -11.824 -37.189 9.460  1.00 20.49 ? 300 HIS B CD2 1 
ATOM   5185 C CE1 . HIS B 1 298 ? -11.999 -38.080 7.466  1.00 20.57 ? 300 HIS B CE1 1 
ATOM   5186 N NE2 . HIS B 1 298 ? -12.330 -37.032 8.191  1.00 17.49 ? 300 HIS B NE2 1 
ATOM   5187 N N   . GLU B 1 299 ? -10.518 -41.062 13.267 1.00 18.41 ? 301 GLU B N   1 
ATOM   5188 C CA  . GLU B 1 299 ? -9.936  -41.947 14.254 1.00 17.89 ? 301 GLU B CA  1 
ATOM   5189 C C   . GLU B 1 299 ? -10.394 -43.417 14.005 1.00 18.06 ? 301 GLU B C   1 
ATOM   5190 O O   . GLU B 1 299 ? -9.590  -44.364 14.069 1.00 17.81 ? 301 GLU B O   1 
ATOM   5191 C CB  . GLU B 1 299 ? -10.341 -41.524 15.667 1.00 19.55 ? 301 GLU B CB  1 
ATOM   5192 C CG  . GLU B 1 299 ? -10.036 -42.630 16.742 1.00 17.54 ? 301 GLU B CG  1 
ATOM   5193 C CD  . GLU B 1 299 ? -10.669 -42.314 18.069 1.00 20.95 ? 301 GLU B CD  1 
ATOM   5194 O OE1 . GLU B 1 299 ? -11.786 -41.737 18.051 1.00 16.12 ? 301 GLU B OE1 1 
ATOM   5195 O OE2 . GLU B 1 299 ? -10.071 -42.662 19.129 1.00 19.03 ? 301 GLU B OE2 1 
ATOM   5196 N N   . ALA B 1 300 ? -11.670 -43.596 13.701 1.00 18.33 ? 302 ALA B N   1 
ATOM   5197 C CA  . ALA B 1 300 ? -12.204 -44.933 13.383 1.00 18.64 ? 302 ALA B CA  1 
ATOM   5198 C C   . ALA B 1 300 ? -11.589 -45.510 12.106 1.00 18.37 ? 302 ALA B C   1 
ATOM   5199 O O   . ALA B 1 300 ? -11.228 -46.705 12.076 1.00 17.60 ? 302 ALA B O   1 
ATOM   5200 C CB  . ALA B 1 300 ? -13.757 -44.915 13.280 1.00 19.75 ? 302 ALA B CB  1 
ATOM   5201 N N   . ALA B 1 301 ? -11.427 -44.693 11.058 1.00 18.59 ? 303 ALA B N   1 
ATOM   5202 C CA  . ALA B 1 301 ? -10.827 -45.237 9.847  1.00 18.62 ? 303 ALA B CA  1 
ATOM   5203 C C   . ALA B 1 301 ? -9.356  -45.620 10.087 1.00 19.95 ? 303 ALA B C   1 
ATOM   5204 O O   . ALA B 1 301 ? -8.915  -46.654 9.607  1.00 20.51 ? 303 ALA B O   1 
ATOM   5205 C CB  . ALA B 1 301 ? -10.970 -44.289 8.656  1.00 18.58 ? 303 ALA B CB  1 
ATOM   5206 N N   . LEU B 1 302 ? -8.612  -44.786 10.825 1.00 21.27 ? 304 LEU B N   1 
ATOM   5207 C CA  . LEU B 1 302 ? -7.216  -45.081 11.175 1.00 21.25 ? 304 LEU B CA  1 
ATOM   5208 C C   . LEU B 1 302 ? -7.106  -46.355 11.958 1.00 21.77 ? 304 LEU B C   1 
ATOM   5209 O O   . LEU B 1 302 ? -6.294  -47.210 11.584 1.00 22.75 ? 304 LEU B O   1 
ATOM   5210 C CB  . LEU B 1 302 ? -6.525  -43.920 11.944 1.00 20.65 ? 304 LEU B CB  1 
ATOM   5211 C CG  . LEU B 1 302 ? -5.048  -44.135 12.320 1.00 19.65 ? 304 LEU B CG  1 
ATOM   5212 C CD1 . LEU B 1 302 ? -4.104  -44.001 11.116 1.00 19.61 ? 304 LEU B CD1 1 
ATOM   5213 C CD2 . LEU B 1 302 ? -4.592  -43.111 13.338 1.00 16.78 ? 304 LEU B CD2 1 
ATOM   5214 N N   . ALA B 1 303 ? -7.919  -46.485 13.028 1.00 22.36 ? 305 ALA B N   1 
ATOM   5215 C CA  . ALA B 1 303 ? -7.949  -47.693 13.884 1.00 22.05 ? 305 ALA B CA  1 
ATOM   5216 C C   . ALA B 1 303 ? -8.149  -48.978 13.118 1.00 21.18 ? 305 ALA B C   1 
ATOM   5217 O O   . ALA B 1 303 ? -7.452  -49.996 13.379 1.00 20.90 ? 305 ALA B O   1 
ATOM   5218 C CB  . ALA B 1 303 ? -9.037  -47.598 15.029 1.00 21.57 ? 305 ALA B CB  1 
ATOM   5219 N N   . ALA B 1 304 ? -9.092  -48.951 12.170 1.00 21.28 ? 306 ALA B N   1 
ATOM   5220 C CA  . ALA B 1 304 ? -9.424  -50.165 11.391 1.00 19.83 ? 306 ALA B CA  1 
ATOM   5221 C C   . ALA B 1 304 ? -8.218  -50.535 10.456 1.00 20.19 ? 306 ALA B C   1 
ATOM   5222 O O   . ALA B 1 304 ? -7.887  -51.740 10.271 1.00 18.25 ? 306 ALA B O   1 
ATOM   5223 C CB  . ALA B 1 304 ? -10.773 -49.952 10.576 1.00 19.48 ? 306 ALA B CB  1 
ATOM   5224 N N   . GLY B 1 305 ? -7.555  -49.501 9.882  1.00 19.14 ? 307 GLY B N   1 
ATOM   5225 C CA  . GLY B 1 305 ? -6.374  -49.747 9.073  1.00 19.09 ? 307 GLY B CA  1 
ATOM   5226 C C   . GLY B 1 305 ? -5.223  -50.354 9.903  1.00 19.96 ? 307 GLY B C   1 
ATOM   5227 O O   . GLY B 1 305 ? -4.692  -51.470 9.587  1.00 21.97 ? 307 GLY B O   1 
ATOM   5228 N N   . ILE B 1 306 ? -4.863  -49.674 10.995 1.00 19.60 ? 308 ILE B N   1 
ATOM   5229 C CA  . ILE B 1 306 ? -3.848  -50.190 11.956 1.00 19.42 ? 308 ILE B CA  1 
ATOM   5230 C C   . ILE B 1 306 ? -4.209  -51.608 12.389 1.00 20.75 ? 308 ILE B C   1 
ATOM   5231 O O   . ILE B 1 306 ? -3.350  -52.529 12.402 1.00 22.22 ? 308 ILE B O   1 
ATOM   5232 C CB  . ILE B 1 306 ? -3.773  -49.268 13.211 1.00 20.01 ? 308 ILE B CB  1 
ATOM   5233 C CG1 . ILE B 1 306 ? -3.364  -47.835 12.796 1.00 16.48 ? 308 ILE B CG1 1 
ATOM   5234 C CG2 . ILE B 1 306 ? -2.869  -49.866 14.344 1.00 18.59 ? 308 ILE B CG2 1 
ATOM   5235 C CD1 . ILE B 1 306 ? -2.020  -47.748 12.033 1.00 20.58 ? 308 ILE B CD1 1 
ATOM   5236 N N   . LYS B 1 307 ? -5.467  -51.814 12.767 1.00 21.11 ? 309 LYS B N   1 
ATOM   5237 C CA  . LYS B 1 307 ? -5.876  -53.189 13.152 1.00 21.20 ? 309 LYS B CA  1 
ATOM   5238 C C   . LYS B 1 307 ? -5.669  -54.186 12.022 1.00 21.58 ? 309 LYS B C   1 
ATOM   5239 O O   . LYS B 1 307 ? -5.101  -55.242 12.259 1.00 21.83 ? 309 LYS B O   1 
ATOM   5240 C CB  . LYS B 1 307 ? -7.309  -53.266 13.607 1.00 21.35 ? 309 LYS B CB  1 
ATOM   5241 C CG  . LYS B 1 307 ? -7.580  -54.498 14.376 1.00 22.99 ? 309 LYS B CG  1 
ATOM   5242 C CD  . LYS B 1 307 ? -9.078  -54.731 14.565 1.00 28.00 ? 309 LYS B CD  1 
ATOM   5243 C CE  . LYS B 1 307 ? -9.245  -56.124 15.141 1.00 30.06 ? 309 LYS B CE  1 
ATOM   5244 N NZ  . LYS B 1 307 ? -10.577 -56.375 15.759 1.00 31.22 ? 309 LYS B NZ  1 
ATOM   5245 N N   . ALA B 1 308 ? -6.108  -53.858 10.795 1.00 21.24 ? 310 ALA B N   1 
ATOM   5246 C CA  . ALA B 1 308 ? -6.026  -54.839 9.708  1.00 21.73 ? 310 ALA B CA  1 
ATOM   5247 C C   . ALA B 1 308 ? -4.575  -55.097 9.340  1.00 21.66 ? 310 ALA B C   1 
ATOM   5248 O O   . ALA B 1 308 ? -4.210  -56.158 8.845  1.00 21.99 ? 310 ALA B O   1 
ATOM   5249 C CB  . ALA B 1 308 ? -6.863  -54.447 8.500  1.00 20.47 ? 310 ALA B CB  1 
ATOM   5250 N N   . MET B 1 309 ? -3.737  -54.132 9.639  1.00 22.56 ? 311 MET B N   1 
ATOM   5251 C CA  . MET B 1 309 ? -2.316  -54.247 9.394  1.00 23.15 ? 311 MET B CA  1 
ATOM   5252 C C   . MET B 1 309 ? -1.654  -55.209 10.399 1.00 23.95 ? 311 MET B C   1 
ATOM   5253 O O   . MET B 1 309 ? -0.466  -55.514 10.276 1.00 24.71 ? 311 MET B O   1 
ATOM   5254 C CB  . MET B 1 309 ? -1.658  -52.835 9.452  1.00 22.95 ? 311 MET B CB  1 
ATOM   5255 C CG  . MET B 1 309 ? -0.308  -52.727 8.723  1.00 21.77 ? 311 MET B CG  1 
ATOM   5256 S SD  . MET B 1 309 ? 0.504   -51.126 8.990  1.00 25.97 ? 311 MET B SD  1 
ATOM   5257 C CE  . MET B 1 309 ? -0.681  -49.989 8.251  1.00 18.73 ? 311 MET B CE  1 
ATOM   5258 N N   . GLY B 1 310 ? -2.398  -55.668 11.400 1.00 24.88 ? 312 GLY B N   1 
ATOM   5259 C CA  . GLY B 1 310 ? -1.825  -56.603 12.406 1.00 25.82 ? 312 GLY B CA  1 
ATOM   5260 C C   . GLY B 1 310 ? -1.111  -55.954 13.589 1.00 26.25 ? 312 GLY B C   1 
ATOM   5261 O O   . GLY B 1 310 ? -0.466  -56.660 14.372 1.00 27.05 ? 312 GLY B O   1 
ATOM   5262 N N   . LEU B 1 311 ? -1.237  -54.623 13.720 1.00 24.93 ? 313 LEU B N   1 
ATOM   5263 C CA  . LEU B 1 311 ? -0.681  -53.848 14.830 1.00 24.98 ? 313 LEU B CA  1 
ATOM   5264 C C   . LEU B 1 311 ? -1.665  -53.737 15.986 1.00 24.83 ? 313 LEU B C   1 
ATOM   5265 O O   . LEU B 1 311 ? -2.838  -53.921 15.817 1.00 24.82 ? 313 LEU B O   1 
ATOM   5266 C CB  . LEU B 1 311 ? -0.196  -52.445 14.360 1.00 24.25 ? 313 LEU B CB  1 
ATOM   5267 C CG  . LEU B 1 311 ? 0.861   -52.644 13.272 1.00 26.00 ? 313 LEU B CG  1 
ATOM   5268 C CD1 . LEU B 1 311 ? 1.198   -51.427 12.485 1.00 24.69 ? 313 LEU B CD1 1 
ATOM   5269 C CD2 . LEU B 1 311 ? 2.128   -53.355 13.845 1.00 27.45 ? 313 LEU B CD2 1 
ATOM   5270 N N   . ARG B 1 312 ? -1.130  -53.486 17.172 1.00 26.39 ? 314 ARG B N   1 
ATOM   5271 C CA  . ARG B 1 312 ? -1.857  -53.412 18.449 1.00 27.78 ? 314 ARG B CA  1 
ATOM   5272 C C   . ARG B 1 312 ? -1.822  -51.947 18.963 1.00 27.12 ? 314 ARG B C   1 
ATOM   5273 O O   . ARG B 1 312 ? -0.862  -51.232 18.735 1.00 27.14 ? 314 ARG B O   1 
ATOM   5274 C CB  . ARG B 1 312 ? -1.140  -54.267 19.500 1.00 27.13 ? 314 ARG B CB  1 
ATOM   5275 C CG  . ARG B 1 312 ? -1.084  -55.812 19.269 1.00 34.45 ? 314 ARG B CG  1 
ATOM   5276 C CD  . ARG B 1 312 ? -1.878  -56.529 20.362 1.00 39.93 ? 314 ARG B CD  1 
ATOM   5277 N NE  . ARG B 1 312 ? -1.643  -57.974 20.409 1.00 45.18 ? 314 ARG B NE  1 
ATOM   5278 C CZ  . ARG B 1 312 ? -2.523  -58.904 20.026 1.00 47.80 ? 314 ARG B CZ  1 
ATOM   5279 N NH1 . ARG B 1 312 ? -3.711  -58.557 19.539 1.00 48.33 ? 314 ARG B NH1 1 
ATOM   5280 N NH2 . ARG B 1 312 ? -2.213  -60.195 20.117 1.00 47.68 ? 314 ARG B NH2 1 
ATOM   5281 N N   . LEU B 1 313 ? -2.820  -51.509 19.699 1.00 27.40 ? 315 LEU B N   1 
ATOM   5282 C CA  . LEU B 1 313 ? -2.771  -50.130 20.175 1.00 28.33 ? 315 LEU B CA  1 
ATOM   5283 C C   . LEU B 1 313 ? -2.328  -50.167 21.640 1.00 28.72 ? 315 LEU B C   1 
ATOM   5284 O O   . LEU B 1 313 ? -2.718  -51.040 22.358 1.00 26.82 ? 315 LEU B O   1 
ATOM   5285 C CB  . LEU B 1 313 ? -4.154  -49.499 20.114 1.00 27.80 ? 315 LEU B CB  1 
ATOM   5286 C CG  . LEU B 1 313 ? -4.759  -49.164 18.768 1.00 30.06 ? 315 LEU B CG  1 
ATOM   5287 C CD1 . LEU B 1 313 ? -5.955  -48.197 19.028 1.00 29.39 ? 315 LEU B CD1 1 
ATOM   5288 C CD2 . LEU B 1 313 ? -3.653  -48.484 17.891 1.00 28.17 ? 315 LEU B CD2 1 
ATOM   5289 N N   . PHE B 1 314 ? -1.566  -49.166 22.078 1.00 28.48 ? 316 PHE B N   1 
ATOM   5290 C CA  . PHE B 1 314 ? -1.155  -49.127 23.462 1.00 28.02 ? 316 PHE B CA  1 
ATOM   5291 C C   . PHE B 1 314 ? -2.262  -48.485 24.293 1.00 28.42 ? 316 PHE B C   1 
ATOM   5292 O O   . PHE B 1 314 ? -3.017  -47.646 23.792 1.00 26.60 ? 316 PHE B O   1 
ATOM   5293 C CB  . PHE B 1 314 ? 0.118   -48.303 23.581 1.00 26.72 ? 316 PHE B CB  1 
ATOM   5294 C CG  . PHE B 1 314 ? 0.452   -47.914 24.975 1.00 27.30 ? 316 PHE B CG  1 
ATOM   5295 C CD1 . PHE B 1 314 ? 1.224   -48.749 25.775 1.00 28.47 ? 316 PHE B CD1 1 
ATOM   5296 C CD2 . PHE B 1 314 ? 0.003   -46.695 25.492 1.00 28.49 ? 316 PHE B CD2 1 
ATOM   5297 C CE1 . PHE B 1 314 ? 1.534   -48.382 27.114 1.00 31.98 ? 316 PHE B CE1 1 
ATOM   5298 C CE2 . PHE B 1 314 ? 0.293   -46.318 26.804 1.00 30.49 ? 316 PHE B CE2 1 
ATOM   5299 C CZ  . PHE B 1 314 ? 1.058   -47.145 27.615 1.00 30.80 ? 316 PHE B CZ  1 
ATOM   5300 N N   . GLY B 1 315 ? -2.373  -48.924 25.544 1.00 28.59 ? 317 GLY B N   1 
ATOM   5301 C CA  . GLY B 1 315 ? -3.137  -48.227 26.556 1.00 29.76 ? 317 GLY B CA  1 
ATOM   5302 C C   . GLY B 1 315 ? -4.559  -48.719 26.708 1.00 31.31 ? 317 GLY B C   1 
ATOM   5303 O O   . GLY B 1 315 ? -5.011  -49.567 25.942 1.00 31.72 ? 317 GLY B O   1 
ATOM   5304 N N   . ASP B 1 316 ? -5.238  -48.141 27.708 1.00 31.88 ? 318 ASP B N   1 
ATOM   5305 C CA  . ASP B 1 316 ? -6.602  -48.417 28.145 1.00 32.96 ? 318 ASP B CA  1 
ATOM   5306 C C   . ASP B 1 316 ? -7.496  -47.887 27.045 1.00 32.97 ? 318 ASP B C   1 
ATOM   5307 O O   . ASP B 1 316 ? -7.524  -46.665 26.784 1.00 33.14 ? 318 ASP B O   1 
ATOM   5308 C CB  . ASP B 1 316 ? -6.833  -47.617 29.453 1.00 33.19 ? 318 ASP B CB  1 
ATOM   5309 C CG  . ASP B 1 316 ? -8.104  -47.990 30.204 1.00 36.36 ? 318 ASP B CG  1 
ATOM   5310 O OD1 . ASP B 1 316 ? -9.140  -48.387 29.592 1.00 34.87 ? 318 ASP B OD1 1 
ATOM   5311 O OD2 . ASP B 1 316 ? -8.064  -47.806 31.462 1.00 42.06 ? 318 ASP B OD2 1 
ATOM   5312 N N   . ASP B 1 317 ? -8.215  -48.782 26.378 1.00 33.07 ? 319 ASP B N   1 
ATOM   5313 C CA  . ASP B 1 317 ? -9.048  -48.295 25.304 1.00 33.62 ? 319 ASP B CA  1 
ATOM   5314 C C   . ASP B 1 317 ? -10.284 -47.436 25.717 1.00 32.08 ? 319 ASP B C   1 
ATOM   5315 O O   . ASP B 1 317 ? -10.790 -46.651 24.900 1.00 32.04 ? 319 ASP B O   1 
ATOM   5316 C CB  . ASP B 1 317 ? -9.355  -49.362 24.225 1.00 34.17 ? 319 ASP B CB  1 
ATOM   5317 C CG  . ASP B 1 317 ? -9.277  -48.738 22.798 1.00 40.21 ? 319 ASP B CG  1 
ATOM   5318 O OD1 . ASP B 1 317 ? -10.380 -48.541 22.204 1.00 46.13 ? 319 ASP B OD1 1 
ATOM   5319 O OD2 . ASP B 1 317 ? -8.139  -48.368 22.310 1.00 38.70 ? 319 ASP B OD2 1 
ATOM   5320 N N   . SER B 1 318 ? -10.711 -47.544 26.978 1.00 30.36 ? 320 SER B N   1 
ATOM   5321 C CA  . SER B 1 318 ? -11.865 -46.760 27.473 1.00 29.65 ? 320 SER B CA  1 
ATOM   5322 C C   . SER B 1 318 ? -11.602 -45.264 27.752 1.00 28.93 ? 320 SER B C   1 
ATOM   5323 O O   . SER B 1 318 ? -12.562 -44.484 27.894 1.00 28.54 ? 320 SER B O   1 
ATOM   5324 C CB  . SER B 1 318 ? -12.586 -47.445 28.659 1.00 30.08 ? 320 SER B CB  1 
ATOM   5325 O OG  . SER B 1 318 ? -11.811 -47.481 29.851 1.00 29.66 ? 320 SER B OG  1 
ATOM   5326 N N   . CYS B 1 319 ? -10.338 -44.846 27.804 1.00 27.20 ? 321 CYS B N   1 
ATOM   5327 C CA  . CYS B 1 319 ? -10.055 -43.407 27.943 1.00 26.55 ? 321 CYS B CA  1 
ATOM   5328 C C   . CYS B 1 319 ? -9.114  -42.928 26.834 1.00 26.80 ? 321 CYS B C   1 
ATOM   5329 O O   . CYS B 1 319 ? -8.310  -42.022 27.036 1.00 27.85 ? 321 CYS B O   1 
ATOM   5330 C CB  . CYS B 1 319 ? -9.453  -43.121 29.319 1.00 26.14 ? 321 CYS B CB  1 
ATOM   5331 S SG  . CYS B 1 319 ? -7.928  -44.140 29.694 1.00 24.89 ? 321 CYS B SG  1 
ATOM   5332 N N   . LYS B 1 320 ? -9.199  -43.560 25.670 1.00 26.72 ? 322 LYS B N   1 
ATOM   5333 C CA  . LYS B 1 320 ? -8.389  -43.205 24.536 1.00 25.54 ? 322 LYS B CA  1 
ATOM   5334 C C   . LYS B 1 320 ? -8.739  -41.821 24.065 1.00 24.50 ? 322 LYS B C   1 
ATOM   5335 O O   . LYS B 1 320 ? -9.862  -41.573 23.704 1.00 24.45 ? 322 LYS B O   1 
ATOM   5336 C CB  . LYS B 1 320 ? -8.636  -44.196 23.396 1.00 25.91 ? 322 LYS B CB  1 
ATOM   5337 C CG  . LYS B 1 320 ? -7.673  -43.935 22.180 1.00 25.44 ? 322 LYS B CG  1 
ATOM   5338 C CD  . LYS B 1 320 ? -8.143  -44.709 20.933 1.00 25.24 ? 322 LYS B CD  1 
ATOM   5339 C CE  . LYS B 1 320 ? -7.239  -44.423 19.764 1.00 25.34 ? 322 LYS B CE  1 
ATOM   5340 N NZ  . LYS B 1 320 ? -7.425  -43.012 19.264 1.00 27.34 ? 322 LYS B NZ  1 
ATOM   5341 N N   . MET B 1 321 ? -7.756  -40.922 24.028 1.00 24.66 ? 323 MET B N   1 
ATOM   5342 C CA  . MET B 1 321 ? -7.932  -39.620 23.437 1.00 24.10 ? 323 MET B CA  1 
ATOM   5343 C C   . MET B 1 321 ? -8.354  -39.801 21.950 1.00 23.44 ? 323 MET B C   1 
ATOM   5344 O O   . MET B 1 321 ? -7.676  -40.497 21.192 1.00 24.57 ? 323 MET B O   1 
ATOM   5345 C CB  . MET B 1 321 ? -6.613  -38.832 23.559 1.00 24.57 ? 323 MET B CB  1 
ATOM   5346 C CG  . MET B 1 321 ? -6.767  -37.335 23.232 1.00 28.95 ? 323 MET B CG  1 
ATOM   5347 S SD  . MET B 1 321 ? -5.371  -36.237 23.647 1.00 36.49 ? 323 MET B SD  1 
ATOM   5348 C CE  . MET B 1 321 ? -4.264  -37.495 24.097 1.00 27.74 ? 323 MET B CE  1 
ATOM   5349 N N   . PRO B 1 322 ? -9.460  -39.198 21.521 1.00 22.94 ? 324 PRO B N   1 
ATOM   5350 C CA  . PRO B 1 322 ? -9.920  -39.471 20.140 1.00 24.88 ? 324 PRO B CA  1 
ATOM   5351 C C   . PRO B 1 322 ? -8.904  -39.064 19.058 1.00 25.68 ? 324 PRO B C   1 
ATOM   5352 O O   . PRO B 1 322 ? -8.902  -39.668 17.986 1.00 26.09 ? 324 PRO B O   1 
ATOM   5353 C CB  . PRO B 1 322 ? -11.171 -38.532 19.990 1.00 26.36 ? 324 PRO B CB  1 
ATOM   5354 C CG  . PRO B 1 322 ? -11.688 -38.396 21.458 1.00 25.67 ? 324 PRO B CG  1 
ATOM   5355 C CD  . PRO B 1 322 ? -10.374 -38.269 22.234 1.00 23.73 ? 324 PRO B CD  1 
ATOM   5356 N N   . VAL B 1 323 ? -8.062  -38.085 19.387 1.00 23.80 ? 325 VAL B N   1 
ATOM   5357 C CA  . VAL B 1 323 ? -7.241  -37.320 18.418 1.00 26.72 ? 325 VAL B CA  1 
ATOM   5358 C C   . VAL B 1 323 ? -5.776  -37.760 18.344 1.00 26.42 ? 325 VAL B C   1 
ATOM   5359 O O   . VAL B 1 323 ? -4.983  -37.242 17.545 1.00 26.48 ? 325 VAL B O   1 
ATOM   5360 C CB  . VAL B 1 323 ? -7.345  -35.816 18.696 1.00 24.71 ? 325 VAL B CB  1 
ATOM   5361 C CG1 . VAL B 1 323 ? -6.571  -35.199 17.742 1.00 32.98 ? 325 VAL B CG1 1 
ATOM   5362 C CG2 . VAL B 1 323 ? -8.760  -35.326 18.351 1.00 23.69 ? 325 VAL B CG2 1 
ATOM   5363 N N   . VAL B 1 324 ? -5.429  -38.744 19.158 1.00 26.92 ? 326 VAL B N   1 
ATOM   5364 C CA  . VAL B 1 324 ? -4.093  -39.335 19.147 1.00 27.67 ? 326 VAL B CA  1 
ATOM   5365 C C   . VAL B 1 324 ? -4.263  -40.874 19.153 1.00 26.66 ? 326 VAL B C   1 
ATOM   5366 O O   . VAL B 1 324 ? -5.056  -41.406 19.931 1.00 27.18 ? 326 VAL B O   1 
ATOM   5367 C CB  . VAL B 1 324 ? -3.282  -38.861 20.418 1.00 26.64 ? 326 VAL B CB  1 
ATOM   5368 C CG1 . VAL B 1 324 ? -1.994  -39.682 20.586 1.00 30.03 ? 326 VAL B CG1 1 
ATOM   5369 C CG2 . VAL B 1 324 ? -2.895  -37.412 20.288 1.00 28.90 ? 326 VAL B CG2 1 
ATOM   5370 N N   . THR B 1 325 ? -3.510  -41.587 18.315 1.00 25.88 ? 327 THR B N   1 
ATOM   5371 C CA  . THR B 1 325 ? -3.539  -43.043 18.327 1.00 23.98 ? 327 THR B CA  1 
ATOM   5372 C C   . THR B 1 325 ? -2.145  -43.606 18.614 1.00 25.51 ? 327 THR B C   1 
ATOM   5373 O O   . THR B 1 325 ? -1.176  -43.196 17.988 1.00 25.42 ? 327 THR B O   1 
ATOM   5374 C CB  . THR B 1 325 ? -4.156  -43.540 17.016 1.00 25.02 ? 327 THR B CB  1 
ATOM   5375 O OG1 . THR B 1 325 ? -5.516  -43.045 16.943 1.00 20.55 ? 327 THR B OG1 1 
ATOM   5376 C CG2 . THR B 1 325 ? -4.145  -45.093 16.932 1.00 21.96 ? 327 THR B CG2 1 
ATOM   5377 N N   . CYS B 1 326 ? -2.034  -44.483 19.614 1.00 24.62 ? 328 CYS B N   1 
ATOM   5378 C CA  . CYS B 1 326 ? -0.757  -44.988 20.078 1.00 25.03 ? 328 CYS B CA  1 
ATOM   5379 C C   . CYS B 1 326 ? -0.545  -46.381 19.566 1.00 24.62 ? 328 CYS B C   1 
ATOM   5380 O O   . CYS B 1 326 ? -1.140  -47.316 20.082 1.00 24.01 ? 328 CYS B O   1 
ATOM   5381 C CB  . CYS B 1 326 ? -0.737  -45.045 21.621 1.00 26.15 ? 328 CYS B CB  1 
ATOM   5382 S SG  . CYS B 1 326 ? -0.858  -43.424 22.287 1.00 24.32 ? 328 CYS B SG  1 
ATOM   5383 N N   . VAL B 1 327 ? 0.306   -46.505 18.559 1.00 23.93 ? 329 VAL B N   1 
ATOM   5384 C CA  . VAL B 1 327 ? 0.541   -47.765 17.942 1.00 23.90 ? 329 VAL B CA  1 
ATOM   5385 C C   . VAL B 1 327 ? 1.796   -48.433 18.561 1.00 24.54 ? 329 VAL B C   1 
ATOM   5386 O O   . VAL B 1 327 ? 2.882   -47.858 18.597 1.00 22.80 ? 329 VAL B O   1 
ATOM   5387 C CB  . VAL B 1 327 ? 0.684   -47.597 16.436 1.00 24.50 ? 329 VAL B CB  1 
ATOM   5388 C CG1 . VAL B 1 327 ? 0.777   -48.993 15.749 1.00 22.73 ? 329 VAL B CG1 1 
ATOM   5389 C CG2 . VAL B 1 327 ? -0.493  -46.865 15.895 1.00 24.44 ? 329 VAL B CG2 1 
ATOM   5390 N N   . GLU B 1 328 ? 1.638   -49.671 19.019 1.00 24.36 ? 330 GLU B N   1 
ATOM   5391 C CA  . GLU B 1 328 ? 2.754   -50.448 19.573 1.00 25.26 ? 330 GLU B CA  1 
ATOM   5392 C C   . GLU B 1 328 ? 3.779   -50.800 18.516 1.00 25.01 ? 330 GLU B C   1 
ATOM   5393 O O   . GLU B 1 328 ? 3.431   -51.304 17.476 1.00 26.70 ? 330 GLU B O   1 
ATOM   5394 C CB  . GLU B 1 328 ? 2.224   -51.729 20.209 1.00 25.03 ? 330 GLU B CB  1 
ATOM   5395 C CG  . GLU B 1 328 ? 1.716   -51.497 21.597 1.00 28.65 ? 330 GLU B CG  1 
ATOM   5396 C CD  . GLU B 1 328 ? 1.287   -52.760 22.306 1.00 32.83 ? 330 GLU B CD  1 
ATOM   5397 O OE1 . GLU B 1 328 ? 0.685   -52.598 23.392 1.00 35.84 ? 330 GLU B OE1 1 
ATOM   5398 O OE2 . GLU B 1 328 ? 1.537   -53.890 21.800 1.00 33.39 ? 330 GLU B OE2 1 
ATOM   5399 N N   . ILE B 1 329 ? 5.039   -50.493 18.781 1.00 24.94 ? 331 ILE B N   1 
ATOM   5400 C CA  . ILE B 1 329 ? 6.173   -50.958 17.964 1.00 24.54 ? 331 ILE B CA  1 
ATOM   5401 C C   . ILE B 1 329 ? 6.381   -52.452 18.239 1.00 24.28 ? 331 ILE B C   1 
ATOM   5402 O O   . ILE B 1 329 ? 6.539   -52.837 19.378 1.00 24.35 ? 331 ILE B O   1 
ATOM   5403 C CB  . ILE B 1 329 ? 7.432   -50.173 18.331 1.00 23.74 ? 331 ILE B CB  1 
ATOM   5404 C CG1 . ILE B 1 329 ? 7.214   -48.673 18.038 1.00 22.40 ? 331 ILE B CG1 1 
ATOM   5405 C CG2 . ILE B 1 329 ? 8.588   -50.646 17.562 1.00 24.81 ? 331 ILE B CG2 1 
ATOM   5406 C CD1 . ILE B 1 329 ? 8.176   -47.721 18.804 1.00 17.07 ? 331 ILE B CD1 1 
ATOM   5407 N N   . PRO B 1 330 ? 6.343   -53.295 17.189 1.00 24.85 ? 332 PRO B N   1 
ATOM   5408 C CA  . PRO B 1 330 ? 6.478   -54.780 17.318 1.00 25.05 ? 332 PRO B CA  1 
ATOM   5409 C C   . PRO B 1 330 ? 7.877   -55.232 17.720 1.00 26.43 ? 332 PRO B C   1 
ATOM   5410 O O   . PRO B 1 330 ? 8.846   -54.563 17.372 1.00 26.77 ? 332 PRO B O   1 
ATOM   5411 C CB  . PRO B 1 330 ? 6.189   -55.296 15.907 1.00 24.00 ? 332 PRO B CB  1 
ATOM   5412 C CG  . PRO B 1 330 ? 5.414   -54.126 15.192 1.00 24.40 ? 332 PRO B CG  1 
ATOM   5413 C CD  . PRO B 1 330 ? 5.984   -52.873 15.820 1.00 24.24 ? 332 PRO B CD  1 
ATOM   5414 N N   . GLY B 1 331 ? 7.988   -56.372 18.416 1.00 26.86 ? 333 GLY B N   1 
ATOM   5415 C CA  . GLY B 1 331 ? 9.299   -56.994 18.662 1.00 28.04 ? 333 GLY B CA  1 
ATOM   5416 C C   . GLY B 1 331 ? 10.291  -56.898 17.498 1.00 29.09 ? 333 GLY B C   1 
ATOM   5417 O O   . GLY B 1 331 ? 9.924   -57.128 16.325 1.00 29.41 ? 333 GLY B O   1 
ATOM   5418 N N   . GLY B 1 332 ? 11.528  -56.494 17.802 1.00 29.34 ? 334 GLY B N   1 
ATOM   5419 C CA  . GLY B 1 332 ? 12.610  -56.467 16.810 1.00 31.39 ? 334 GLY B CA  1 
ATOM   5420 C C   . GLY B 1 332 ? 12.600  -55.454 15.644 1.00 32.68 ? 334 GLY B C   1 
ATOM   5421 O O   . GLY B 1 332 ? 13.448  -55.552 14.768 1.00 33.34 ? 334 GLY B O   1 
ATOM   5422 N N   . ILE B 1 333 ? 11.657  -54.503 15.606 1.00 32.61 ? 335 ILE B N   1 
ATOM   5423 C CA  . ILE B 1 333 ? 11.707  -53.412 14.621 1.00 32.59 ? 335 ILE B CA  1 
ATOM   5424 C C   . ILE B 1 333 ? 12.209  -52.129 15.305 1.00 31.78 ? 335 ILE B C   1 
ATOM   5425 O O   . ILE B 1 333 ? 11.795  -51.827 16.423 1.00 31.97 ? 335 ILE B O   1 
ATOM   5426 C CB  . ILE B 1 333 ? 10.320  -53.148 13.880 1.00 33.78 ? 335 ILE B CB  1 
ATOM   5427 C CG1 . ILE B 1 333 ? 9.385   -52.349 14.760 1.00 35.45 ? 335 ILE B CG1 1 
ATOM   5428 C CG2 . ILE B 1 333 ? 9.622   -54.440 13.376 1.00 30.85 ? 335 ILE B CG2 1 
ATOM   5429 C CD1 . ILE B 1 333 ? 9.618   -50.846 14.594 1.00 40.30 ? 335 ILE B CD1 1 
ATOM   5430 N N   . ASP B 1 334 ? 13.140  -51.406 14.675 1.00 31.02 ? 336 ASP B N   1 
ATOM   5431 C CA  . ASP B 1 334 ? 13.557  -50.090 15.207 1.00 30.66 ? 336 ASP B CA  1 
ATOM   5432 C C   . ASP B 1 334 ? 12.560  -48.981 14.822 1.00 29.45 ? 336 ASP B C   1 
ATOM   5433 O O   . ASP B 1 334 ? 12.345  -48.710 13.637 1.00 28.70 ? 336 ASP B O   1 
ATOM   5434 C CB  . ASP B 1 334 ? 14.991  -49.684 14.798 1.00 30.48 ? 336 ASP B CB  1 
ATOM   5435 C CG  . ASP B 1 334 ? 15.467  -48.394 15.516 1.00 33.88 ? 336 ASP B CG  1 
ATOM   5436 O OD1 . ASP B 1 334 ? 14.632  -47.610 16.021 1.00 36.12 ? 336 ASP B OD1 1 
ATOM   5437 O OD2 . ASP B 1 334 ? 16.686  -48.149 15.575 1.00 39.08 ? 336 ASP B OD2 1 
ATOM   5438 N N   . GLY B 1 335 ? 11.961  -48.365 15.834 1.00 28.25 ? 337 GLY B N   1 
ATOM   5439 C CA  . GLY B 1 335 ? 10.840  -47.456 15.622 1.00 28.02 ? 337 GLY B CA  1 
ATOM   5440 C C   . GLY B 1 335 ? 11.276  -46.102 15.112 1.00 28.53 ? 337 GLY B C   1 
ATOM   5441 O O   . GLY B 1 335 ? 10.522  -45.416 14.415 1.00 27.06 ? 337 GLY B O   1 
ATOM   5442 N N   . GLU B 1 336 ? 12.499  -45.722 15.491 1.00 28.71 ? 338 GLU B N   1 
ATOM   5443 C CA  . GLU B 1 336 ? 13.139  -44.508 15.034 1.00 29.43 ? 338 GLU B CA  1 
ATOM   5444 C C   . GLU B 1 336 ? 13.507  -44.634 13.566 1.00 29.03 ? 338 GLU B C   1 
ATOM   5445 O O   . GLU B 1 336 ? 13.444  -43.648 12.810 1.00 28.85 ? 338 GLU B O   1 
ATOM   5446 C CB  . GLU B 1 336 ? 14.404  -44.220 15.865 1.00 30.75 ? 338 GLU B CB  1 
ATOM   5447 C CG  . GLU B 1 336 ? 14.118  -43.837 17.302 1.00 34.75 ? 338 GLU B CG  1 
ATOM   5448 C CD  . GLU B 1 336 ? 12.881  -42.954 17.373 1.00 42.09 ? 338 GLU B CD  1 
ATOM   5449 O OE1 . GLU B 1 336 ? 11.876  -43.413 17.973 1.00 45.58 ? 338 GLU B OE1 1 
ATOM   5450 O OE2 . GLU B 1 336 ? 12.888  -41.844 16.783 1.00 43.62 ? 338 GLU B OE2 1 
ATOM   5451 N N   . SER B 1 337 ? 13.902  -45.846 13.168 1.00 26.91 ? 339 SER B N   1 
ATOM   5452 C CA  . SER B 1 337 ? 14.312  -46.065 11.815 1.00 26.86 ? 339 SER B CA  1 
ATOM   5453 C C   . SER B 1 337 ? 13.046  -46.014 10.904 1.00 25.53 ? 339 SER B C   1 
ATOM   5454 O O   . SER B 1 337 ? 13.079  -45.506 9.752  1.00 26.53 ? 339 SER B O   1 
ATOM   5455 C CB  . SER B 1 337 ? 15.007  -47.424 11.742 1.00 26.53 ? 339 SER B CB  1 
ATOM   5456 O OG  . SER B 1 337 ? 15.171  -47.880 10.412 1.00 27.74 ? 339 SER B OG  1 
ATOM   5457 N N   . VAL B 1 338 ? 11.951  -46.538 11.426 1.00 24.07 ? 340 VAL B N   1 
ATOM   5458 C CA  . VAL B 1 338 ? 10.657  -46.475 10.753 1.00 24.36 ? 340 VAL B CA  1 
ATOM   5459 C C   . VAL B 1 338 ? 10.180  -45.060 10.632 1.00 24.66 ? 340 VAL B C   1 
ATOM   5460 O O   . VAL B 1 338 ? 9.765   -44.657 9.560  1.00 24.77 ? 340 VAL B O   1 
ATOM   5461 C CB  . VAL B 1 338 ? 9.559   -47.303 11.483 1.00 23.92 ? 340 VAL B CB  1 
ATOM   5462 C CG1 . VAL B 1 338 ? 8.202   -46.910 10.946 1.00 20.61 ? 340 VAL B CG1 1 
ATOM   5463 C CG2 . VAL B 1 338 ? 9.848   -48.842 11.233 1.00 22.34 ? 340 VAL B CG2 1 
ATOM   5464 N N   . ARG B 1 339 ? 10.262  -44.308 11.715 1.00 25.07 ? 341 ARG B N   1 
ATOM   5465 C CA  . ARG B 1 339 ? 9.830   -42.914 11.653 1.00 27.28 ? 341 ARG B CA  1 
ATOM   5466 C C   . ARG B 1 339 ? 10.688  -42.076 10.668 1.00 27.37 ? 341 ARG B C   1 
ATOM   5467 O O   . ARG B 1 339 ? 10.180  -41.159 10.000 1.00 28.51 ? 341 ARG B O   1 
ATOM   5468 C CB  . ARG B 1 339 ? 9.828   -42.315 13.029 1.00 27.11 ? 341 ARG B CB  1 
ATOM   5469 C CG  . ARG B 1 339 ? 9.738   -40.792 13.044 1.00 32.43 ? 341 ARG B CG  1 
ATOM   5470 C CD  . ARG B 1 339 ? 9.092   -40.348 14.345 1.00 42.53 ? 341 ARG B CD  1 
ATOM   5471 N NE  . ARG B 1 339 ? 10.076  -40.092 15.377 1.00 45.71 ? 341 ARG B NE  1 
ATOM   5472 C CZ  . ARG B 1 339 ? 10.828  -39.001 15.410 1.00 51.14 ? 341 ARG B CZ  1 
ATOM   5473 N NH1 . ARG B 1 339 ? 10.701  -38.080 14.443 1.00 53.02 ? 341 ARG B NH1 1 
ATOM   5474 N NH2 . ARG B 1 339 ? 11.720  -38.842 16.391 1.00 52.62 ? 341 ARG B NH2 1 
ATOM   5475 N N   . ASP B 1 340 ? 11.974  -42.386 10.586 1.00 26.88 ? 342 ASP B N   1 
ATOM   5476 C CA  . ASP B 1 340 ? 12.896  -41.580 9.787  1.00 26.56 ? 342 ASP B CA  1 
ATOM   5477 C C   . ASP B 1 340 ? 12.734  -41.873 8.320  1.00 26.60 ? 342 ASP B C   1 
ATOM   5478 O O   . ASP B 1 340 ? 12.770  -40.961 7.546  1.00 25.41 ? 342 ASP B O   1 
ATOM   5479 C CB  . ASP B 1 340 ? 14.384  -41.759 10.221 1.00 27.14 ? 342 ASP B CB  1 
ATOM   5480 C CG  . ASP B 1 340 ? 14.635  -41.240 11.627 1.00 30.24 ? 342 ASP B CG  1 
ATOM   5481 O OD1 . ASP B 1 340 ? 15.678  -41.609 12.197 1.00 33.65 ? 342 ASP B OD1 1 
ATOM   5482 O OD2 . ASP B 1 340 ? 13.762  -40.473 12.166 1.00 35.13 ? 342 ASP B OD2 1 
ATOM   5483 N N   . MET B 1 341 ? 12.555  -43.149 7.955  1.00 25.73 ? 343 MET B N   1 
ATOM   5484 C CA  . MET B 1 341 ? 12.242  -43.549 6.587  1.00 26.08 ? 343 MET B CA  1 
ATOM   5485 C C   . MET B 1 341 ? 10.872  -42.982 6.117  1.00 25.75 ? 343 MET B C   1 
ATOM   5486 O O   . MET B 1 341 ? 10.699  -42.596 4.966  1.00 24.75 ? 343 MET B O   1 
ATOM   5487 C CB  . MET B 1 341 ? 12.275  -45.105 6.462  1.00 25.34 ? 343 MET B CB  1 
ATOM   5488 C CG  . MET B 1 341 ? 12.195  -45.606 5.053  1.00 27.87 ? 343 MET B CG  1 
ATOM   5489 S SD  . MET B 1 341 ? 12.175  -47.400 4.823  1.00 33.48 ? 343 MET B SD  1 
ATOM   5490 C CE  . MET B 1 341 ? 13.883  -47.842 5.148  1.00 33.20 ? 343 MET B CE  1 
ATOM   5491 N N   . LEU B 1 342 ? 9.889   -42.968 7.004  1.00 26.16 ? 344 LEU B N   1 
ATOM   5492 C CA  . LEU B 1 342 ? 8.593   -42.472 6.657  1.00 26.63 ? 344 LEU B CA  1 
ATOM   5493 C C   . LEU B 1 342 ? 8.756   -40.993 6.272  1.00 26.55 ? 344 LEU B C   1 
ATOM   5494 O O   . LEU B 1 342 ? 8.251   -40.552 5.237  1.00 26.89 ? 344 LEU B O   1 
ATOM   5495 C CB  . LEU B 1 342 ? 7.700   -42.624 7.882  1.00 26.87 ? 344 LEU B CB  1 
ATOM   5496 C CG  . LEU B 1 342 ? 6.236   -43.030 7.831  1.00 31.68 ? 344 LEU B CG  1 
ATOM   5497 C CD1 . LEU B 1 342 ? 5.802   -43.765 6.557  1.00 29.03 ? 344 LEU B CD1 1 
ATOM   5498 C CD2 . LEU B 1 342 ? 6.056   -43.911 9.028  1.00 33.15 ? 344 LEU B CD2 1 
ATOM   5499 N N   . LEU B 1 343 ? 9.490   -40.238 7.082  1.00 25.68 ? 345 LEU B N   1 
ATOM   5500 C CA  . LEU B 1 343 ? 9.694   -38.830 6.783  1.00 26.98 ? 345 LEU B CA  1 
ATOM   5501 C C   . LEU B 1 343 ? 10.580  -38.651 5.547  1.00 27.65 ? 345 LEU B C   1 
ATOM   5502 O O   . LEU B 1 343 ? 10.223  -37.892 4.665  1.00 27.30 ? 345 LEU B O   1 
ATOM   5503 C CB  . LEU B 1 343 ? 10.257  -38.071 7.989  1.00 26.96 ? 345 LEU B CB  1 
ATOM   5504 C CG  . LEU B 1 343 ? 10.321  -36.538 7.861  1.00 25.55 ? 345 LEU B CG  1 
ATOM   5505 C CD1 . LEU B 1 343 ? 8.882   -35.950 7.588  1.00 24.07 ? 345 LEU B CD1 1 
ATOM   5506 C CD2 . LEU B 1 343 ? 10.951  -35.888 9.094  1.00 24.57 ? 345 LEU B CD2 1 
ATOM   5507 N N   . ALA B 1 344 ? 11.659  -39.417 5.437  1.00 26.63 ? 346 ALA B N   1 
ATOM   5508 C CA  . ALA B 1 344 ? 12.660  -39.159 4.394  1.00 27.63 ? 346 ALA B CA  1 
ATOM   5509 C C   . ALA B 1 344 ? 12.142  -39.605 3.008  1.00 27.96 ? 346 ALA B C   1 
ATOM   5510 O O   . ALA B 1 344 ? 12.358  -38.914 2.025  1.00 26.46 ? 346 ALA B O   1 
ATOM   5511 C CB  . ALA B 1 344 ? 14.004  -39.849 4.731  1.00 27.64 ? 346 ALA B CB  1 
ATOM   5512 N N   . GLN B 1 345 ? 11.445  -40.737 2.959  1.00 27.51 ? 347 GLN B N   1 
ATOM   5513 C CA  . GLN B 1 345 ? 10.877  -41.245 1.702  1.00 27.97 ? 347 GLN B CA  1 
ATOM   5514 C C   . GLN B 1 345 ? 9.492   -40.673 1.356  1.00 28.26 ? 347 GLN B C   1 
ATOM   5515 O O   . GLN B 1 345 ? 9.252   -40.252 0.200  1.00 28.01 ? 347 GLN B O   1 
ATOM   5516 C CB  . GLN B 1 345 ? 10.842  -42.789 1.717  1.00 28.82 ? 347 GLN B CB  1 
ATOM   5517 C CG  . GLN B 1 345 ? 12.192  -43.460 2.053  1.00 27.87 ? 347 GLN B CG  1 
ATOM   5518 C CD  . GLN B 1 345 ? 13.309  -42.961 1.179  1.00 28.84 ? 347 GLN B CD  1 
ATOM   5519 O OE1 . GLN B 1 345 ? 13.108  -42.698 -0.009 1.00 35.85 ? 347 GLN B OE1 1 
ATOM   5520 N NE2 . GLN B 1 345 ? 14.471  -42.803 1.733  1.00 25.71 ? 347 GLN B NE2 1 
ATOM   5521 N N   . PHE B 1 346 ? 8.571   -40.670 2.330  1.00 27.46 ? 348 PHE B N   1 
ATOM   5522 C CA  . PHE B 1 346 ? 7.153   -40.241 2.063  1.00 26.58 ? 348 PHE B CA  1 
ATOM   5523 C C   . PHE B 1 346 ? 6.799   -38.820 2.484  1.00 25.74 ? 348 PHE B C   1 
ATOM   5524 O O   . PHE B 1 346 ? 5.768   -38.270 2.056  1.00 26.16 ? 348 PHE B O   1 
ATOM   5525 C CB  . PHE B 1 346 ? 6.141   -41.226 2.699  1.00 25.42 ? 348 PHE B CB  1 
ATOM   5526 C CG  . PHE B 1 346 ? 6.244   -42.672 2.191  1.00 26.26 ? 348 PHE B CG  1 
ATOM   5527 C CD1 . PHE B 1 346 ? 5.299   -43.156 1.272  1.00 24.39 ? 348 PHE B CD1 1 
ATOM   5528 C CD2 . PHE B 1 346 ? 7.204   -43.563 2.685  1.00 22.48 ? 348 PHE B CD2 1 
ATOM   5529 C CE1 . PHE B 1 346 ? 5.339   -44.409 0.819  1.00 23.59 ? 348 PHE B CE1 1 
ATOM   5530 C CE2 . PHE B 1 346 ? 7.277   -44.903 2.203  1.00 23.47 ? 348 PHE B CE2 1 
ATOM   5531 C CZ  . PHE B 1 346 ? 6.323   -45.330 1.282  1.00 26.15 ? 348 PHE B CZ  1 
ATOM   5532 N N   . GLY B 1 347 ? 7.646   -38.162 3.283  1.00 26.18 ? 349 GLY B N   1 
ATOM   5533 C CA  . GLY B 1 347 ? 7.346   -36.795 3.702  1.00 22.79 ? 349 GLY B CA  1 
ATOM   5534 C C   . GLY B 1 347 ? 6.290   -36.911 4.784  1.00 23.61 ? 349 GLY B C   1 
ATOM   5535 O O   . GLY B 1 347 ? 5.612   -35.905 5.107  1.00 22.80 ? 349 GLY B O   1 
ATOM   5536 N N   . ILE B 1 348 ? 6.057   -38.152 5.243  1.00 22.30 ? 350 ILE B N   1 
ATOM   5537 C CA  . ILE B 1 348 ? 5.035   -38.434 6.276  1.00 23.40 ? 350 ILE B CA  1 
ATOM   5538 C C   . ILE B 1 348 ? 5.664   -38.276 7.674  1.00 23.04 ? 350 ILE B C   1 
ATOM   5539 O O   . ILE B 1 348 ? 6.676   -38.902 7.964  1.00 23.84 ? 350 ILE B O   1 
ATOM   5540 C CB  . ILE B 1 348 ? 4.399   -39.877 6.155  1.00 22.89 ? 350 ILE B CB  1 
ATOM   5541 C CG1 . ILE B 1 348 ? 3.664   -39.997 4.820  1.00 23.48 ? 350 ILE B CG1 1 
ATOM   5542 C CG2 . ILE B 1 348 ? 3.483   -40.183 7.410  1.00 23.67 ? 350 ILE B CG2 1 
ATOM   5543 C CD1 . ILE B 1 348 ? 3.116   -41.301 4.482  1.00 22.51 ? 350 ILE B CD1 1 
ATOM   5544 N N   . GLU B 1 349 ? 5.104   -37.407 8.498  1.00 23.21 ? 351 GLU B N   1 
ATOM   5545 C CA  . GLU B 1 349 ? 5.604   -37.236 9.874  1.00 23.76 ? 351 GLU B CA  1 
ATOM   5546 C C   . GLU B 1 349 ? 4.704   -37.907 10.925 1.00 23.00 ? 351 GLU B C   1 
ATOM   5547 O O   . GLU B 1 349 ? 3.560   -37.578 10.989 1.00 22.04 ? 351 GLU B O   1 
ATOM   5548 C CB  . GLU B 1 349 ? 5.786   -35.755 10.222 1.00 21.95 ? 351 GLU B CB  1 
ATOM   5549 C CG  . GLU B 1 349 ? 6.897   -35.619 11.296 1.00 24.08 ? 351 GLU B CG  1 
ATOM   5550 C CD  . GLU B 1 349 ? 6.849   -34.329 12.058 1.00 30.48 ? 351 GLU B CD  1 
ATOM   5551 O OE1 . GLU B 1 349 ? 6.051   -33.408 11.696 1.00 29.22 ? 351 GLU B OE1 1 
ATOM   5552 O OE2 . GLU B 1 349 ? 7.621   -34.244 13.032 1.00 31.10 ? 351 GLU B OE2 1 
ATOM   5553 N N   . ILE B 1 350 ? 5.212   -38.867 11.699 1.00 23.32 ? 352 ILE B N   1 
ATOM   5554 C CA  . ILE B 1 350 ? 4.505   -39.287 12.942 1.00 23.74 ? 352 ILE B CA  1 
ATOM   5555 C C   . ILE B 1 350 ? 5.482   -39.089 14.092 1.00 23.92 ? 352 ILE B C   1 
ATOM   5556 O O   . ILE B 1 350 ? 6.667   -38.879 13.838 1.00 20.77 ? 352 ILE B O   1 
ATOM   5557 C CB  . ILE B 1 350 ? 4.092   -40.770 12.958 1.00 21.95 ? 352 ILE B CB  1 
ATOM   5558 C CG1 . ILE B 1 350 ? 5.310   -41.683 12.794 1.00 22.33 ? 352 ILE B CG1 1 
ATOM   5559 C CG2 . ILE B 1 350 ? 3.067   -41.044 11.867 1.00 23.09 ? 352 ILE B CG2 1 
ATOM   5560 C CD1 . ILE B 1 350 ? 4.928   -43.186 12.506 1.00 23.11 ? 352 ILE B CD1 1 
ATOM   5561 N N   . ALA B 1 351 ? 4.987   -39.332 15.308 1.00 25.10 ? 353 ALA B N   1 
ATOM   5562 C CA  . ALA B 1 351 ? 5.750   -39.121 16.540 1.00 27.52 ? 353 ALA B CA  1 
ATOM   5563 C C   . ALA B 1 351 ? 6.281   -40.376 17.226 1.00 28.98 ? 353 ALA B C   1 
ATOM   5564 O O   . ALA B 1 351 ? 5.620   -41.417 17.261 1.00 30.42 ? 353 ALA B O   1 
ATOM   5565 C CB  . ALA B 1 351 ? 4.933   -38.294 17.497 1.00 24.94 ? 353 ALA B CB  1 
ATOM   5566 N N   . SER B 1 352 ? 7.478   -40.268 17.773 1.00 32.32 ? 354 SER B N   1 
ATOM   5567 C CA  . SER B 1 352 ? 7.998   -41.301 18.636 1.00 36.46 ? 354 SER B CA  1 
ATOM   5568 C C   . SER B 1 352 ? 7.543   -40.927 20.036 1.00 39.22 ? 354 SER B C   1 
ATOM   5569 O O   . SER B 1 352 ? 6.618   -40.109 20.220 1.00 40.93 ? 354 SER B O   1 
ATOM   5570 C CB  . SER B 1 352 ? 9.536   -41.291 18.635 1.00 37.04 ? 354 SER B CB  1 
ATOM   5571 O OG  . SER B 1 352 ? 10.093  -41.678 17.392 1.00 39.98 ? 354 SER B OG  1 
ATOM   5572 N N   . SER B 1 353 ? 8.217   -41.505 21.025 1.00 40.61 ? 355 SER B N   1 
ATOM   5573 C CA  . SER B 1 353 ? 8.048   -41.109 22.406 1.00 42.50 ? 355 SER B CA  1 
ATOM   5574 C C   . SER B 1 353 ? 9.442   -41.004 22.976 1.00 44.13 ? 355 SER B C   1 
ATOM   5575 O O   . SER B 1 353 ? 10.340  -41.796 22.634 1.00 43.75 ? 355 SER B O   1 
ATOM   5576 C CB  . SER B 1 353 ? 7.258   -42.155 23.194 1.00 42.31 ? 355 SER B CB  1 
ATOM   5577 O OG  . SER B 1 353 ? 5.888   -42.019 22.926 1.00 41.36 ? 355 SER B OG  1 
ATOM   5578 N N   . PHE B 1 354 ? 9.626   -40.006 23.829 1.00 46.43 ? 356 PHE B N   1 
ATOM   5579 C CA  . PHE B 1 354 ? 10.883  -39.865 24.575 1.00 48.28 ? 356 PHE B CA  1 
ATOM   5580 C C   . PHE B 1 354 ? 10.553  -39.735 26.073 1.00 47.69 ? 356 PHE B C   1 
ATOM   5581 O O   . PHE B 1 354 ? 9.610   -39.027 26.445 1.00 48.99 ? 356 PHE B O   1 
ATOM   5582 C CB  . PHE B 1 354 ? 11.762  -38.752 23.952 1.00 49.33 ? 356 PHE B CB  1 
ATOM   5583 C CG  . PHE B 1 354 ? 12.078  -38.999 22.477 1.00 52.58 ? 356 PHE B CG  1 
ATOM   5584 C CD1 . PHE B 1 354 ? 12.955  -40.041 22.093 1.00 55.75 ? 356 PHE B CD1 1 
ATOM   5585 C CD2 . PHE B 1 354 ? 11.467  -38.234 21.469 1.00 56.08 ? 356 PHE B CD2 1 
ATOM   5586 C CE1 . PHE B 1 354 ? 13.248  -40.305 20.713 1.00 57.44 ? 356 PHE B CE1 1 
ATOM   5587 C CE2 . PHE B 1 354 ? 11.756  -38.482 20.074 1.00 56.84 ? 356 PHE B CE2 1 
ATOM   5588 C CZ  . PHE B 1 354 ? 12.652  -39.520 19.708 1.00 55.82 ? 356 PHE B CZ  1 
ATOM   5589 N N   . GLY B 1 355 ? 11.261  -40.484 26.922 1.00 46.43 ? 357 GLY B N   1 
ATOM   5590 C CA  . GLY B 1 355 ? 10.778  -40.719 28.305 1.00 43.19 ? 357 GLY B CA  1 
ATOM   5591 C C   . GLY B 1 355 ? 10.265  -42.148 28.501 1.00 41.39 ? 357 GLY B C   1 
ATOM   5592 O O   . GLY B 1 355 ? 10.615  -43.054 27.746 1.00 40.41 ? 357 GLY B O   1 
ATOM   5593 N N   . PRO B 1 356 ? 9.404   -42.367 29.504 1.00 40.02 ? 358 PRO B N   1 
ATOM   5594 C CA  . PRO B 1 356 ? 8.975   -43.736 29.859 1.00 39.31 ? 358 PRO B CA  1 
ATOM   5595 C C   . PRO B 1 356 ? 8.488   -44.664 28.709 1.00 39.00 ? 358 PRO B C   1 
ATOM   5596 O O   . PRO B 1 356 ? 8.701   -45.880 28.793 1.00 39.27 ? 358 PRO B O   1 
ATOM   5597 C CB  . PRO B 1 356 ? 7.848   -43.505 30.869 1.00 39.30 ? 358 PRO B CB  1 
ATOM   5598 C CG  . PRO B 1 356 ? 8.115   -42.152 31.447 1.00 39.22 ? 358 PRO B CG  1 
ATOM   5599 C CD  . PRO B 1 356 ? 8.844   -41.346 30.404 1.00 39.97 ? 358 PRO B CD  1 
ATOM   5600 N N   . LEU B 1 357 ? 7.820   -44.117 27.684 1.00 37.19 ? 359 LEU B N   1 
ATOM   5601 C CA  . LEU B 1 357 ? 7.297   -44.935 26.581 1.00 36.07 ? 359 LEU B CA  1 
ATOM   5602 C C   . LEU B 1 357 ? 8.177   -44.959 25.321 1.00 35.64 ? 359 LEU B C   1 
ATOM   5603 O O   . LEU B 1 357 ? 7.755   -45.491 24.282 1.00 35.89 ? 359 LEU B O   1 
ATOM   5604 C CB  . LEU B 1 357 ? 5.869   -44.493 26.218 1.00 35.99 ? 359 LEU B CB  1 
ATOM   5605 C CG  . LEU B 1 357 ? 4.867   -44.476 27.376 1.00 34.88 ? 359 LEU B CG  1 
ATOM   5606 C CD1 . LEU B 1 357 ? 3.588   -43.741 27.006 1.00 32.18 ? 359 LEU B CD1 1 
ATOM   5607 C CD2 . LEU B 1 357 ? 4.559   -45.871 27.870 1.00 31.13 ? 359 LEU B CD2 1 
ATOM   5608 N N   . ALA B 1 358 ? 9.371   -44.352 25.415 1.00 34.59 ? 360 ALA B N   1 
ATOM   5609 C CA  . ALA B 1 358 ? 10.412  -44.351 24.383 1.00 32.78 ? 360 ALA B CA  1 
ATOM   5610 C C   . ALA B 1 358 ? 10.610  -45.726 23.808 1.00 31.07 ? 360 ALA B C   1 
ATOM   5611 O O   . ALA B 1 358 ? 10.767  -46.669 24.543 1.00 31.52 ? 360 ALA B O   1 
ATOM   5612 C CB  . ALA B 1 358 ? 11.747  -43.853 24.978 1.00 32.59 ? 360 ALA B CB  1 
ATOM   5613 N N   . GLY B 1 359 ? 10.596  -45.850 22.494 1.00 29.54 ? 361 GLY B N   1 
ATOM   5614 C CA  . GLY B 1 359 ? 10.721  -47.154 21.879 1.00 28.55 ? 361 GLY B CA  1 
ATOM   5615 C C   . GLY B 1 359 ? 9.593   -48.155 22.119 1.00 28.28 ? 361 GLY B C   1 
ATOM   5616 O O   . GLY B 1 359 ? 9.744   -49.332 21.772 1.00 30.46 ? 361 GLY B O   1 
ATOM   5617 N N   . LYS B 1 360 ? 8.491   -47.761 22.744 1.00 26.39 ? 362 LYS B N   1 
ATOM   5618 C CA  . LYS B 1 360 ? 7.347   -48.703 22.906 1.00 26.46 ? 362 LYS B CA  1 
ATOM   5619 C C   . LYS B 1 360 ? 6.216   -48.412 21.867 1.00 25.62 ? 362 LYS B C   1 
ATOM   5620 O O   . LYS B 1 360 ? 5.528   -49.288 21.423 1.00 24.59 ? 362 LYS B O   1 
ATOM   5621 C CB  . LYS B 1 360 ? 6.760   -48.590 24.301 1.00 25.58 ? 362 LYS B CB  1 
ATOM   5622 C CG  . LYS B 1 360 ? 7.601   -49.201 25.405 1.00 31.26 ? 362 LYS B CG  1 
ATOM   5623 C CD  . LYS B 1 360 ? 6.804   -49.100 26.705 1.00 37.02 ? 362 LYS B CD  1 
ATOM   5624 C CE  . LYS B 1 360 ? 7.005   -50.316 27.591 1.00 40.31 ? 362 LYS B CE  1 
ATOM   5625 N NZ  . LYS B 1 360 ? 5.609   -50.689 27.983 1.00 43.65 ? 362 LYS B NZ  1 
ATOM   5626 N N   . ILE B 1 361 ? 6.044   -47.140 21.509 1.00 26.00 ? 363 ILE B N   1 
ATOM   5627 C CA  . ILE B 1 361 ? 4.910   -46.730 20.670 1.00 25.14 ? 363 ILE B CA  1 
ATOM   5628 C C   . ILE B 1 361 ? 5.294   -45.682 19.677 1.00 24.99 ? 363 ILE B C   1 
ATOM   5629 O O   . ILE B 1 361 ? 6.206   -44.910 19.912 1.00 25.59 ? 363 ILE B O   1 
ATOM   5630 C CB  . ILE B 1 361 ? 3.738   -46.198 21.553 1.00 25.09 ? 363 ILE B CB  1 
ATOM   5631 C CG1 . ILE B 1 361 ? 4.156   -44.953 22.370 1.00 23.52 ? 363 ILE B CG1 1 
ATOM   5632 C CG2 . ILE B 1 361 ? 3.213   -47.340 22.469 1.00 24.41 ? 363 ILE B CG2 1 
ATOM   5633 C CD1 . ILE B 1 361 ? 2.962   -44.221 23.088 1.00 23.63 ? 363 ILE B CD1 1 
ATOM   5634 N N   . TRP B 1 362 ? 4.567   -45.616 18.567 1.00 25.65 ? 364 TRP B N   1 
ATOM   5635 C CA  . TRP B 1 362 ? 4.537   -44.407 17.789 1.00 25.16 ? 364 TRP B CA  1 
ATOM   5636 C C   . TRP B 1 362 ? 3.231   -43.713 18.140 1.00 25.56 ? 364 TRP B C   1 
ATOM   5637 O O   . TRP B 1 362 ? 2.290   -44.361 18.493 1.00 25.56 ? 364 TRP B O   1 
ATOM   5638 C CB  . TRP B 1 362 ? 4.497   -44.706 16.296 1.00 24.76 ? 364 TRP B CB  1 
ATOM   5639 C CG  . TRP B 1 362 ? 5.668   -45.419 15.742 1.00 22.92 ? 364 TRP B CG  1 
ATOM   5640 C CD1 . TRP B 1 362 ? 6.918   -44.910 15.427 1.00 20.56 ? 364 TRP B CD1 1 
ATOM   5641 C CD2 . TRP B 1 362 ? 5.676   -46.803 15.349 1.00 20.39 ? 364 TRP B CD2 1 
ATOM   5642 N NE1 . TRP B 1 362 ? 7.720   -45.943 14.876 1.00 18.77 ? 364 TRP B NE1 1 
ATOM   5643 C CE2 . TRP B 1 362 ? 6.979   -47.096 14.826 1.00 19.10 ? 364 TRP B CE2 1 
ATOM   5644 C CE3 . TRP B 1 362 ? 4.699   -47.817 15.374 1.00 18.75 ? 364 TRP B CE3 1 
ATOM   5645 C CZ2 . TRP B 1 362 ? 7.318   -48.368 14.332 1.00 19.45 ? 364 TRP B CZ2 1 
ATOM   5646 C CZ3 . TRP B 1 362 ? 5.025   -49.073 14.920 1.00 15.28 ? 364 TRP B CZ3 1 
ATOM   5647 C CH2 . TRP B 1 362 ? 6.327   -49.347 14.363 1.00 19.97 ? 364 TRP B CH2 1 
ATOM   5648 N N   . ARG B 1 363 ? 3.159   -42.399 17.970 1.00 26.59 ? 365 ARG B N   1 
ATOM   5649 C CA  . ARG B 1 363 ? 1.886   -41.692 18.196 1.00 25.57 ? 365 ARG B CA  1 
ATOM   5650 C C   . ARG B 1 363 ? 1.449   -41.049 16.918 1.00 24.17 ? 365 ARG B C   1 
ATOM   5651 O O   . ARG B 1 363 ? 2.177   -40.195 16.328 1.00 24.10 ? 365 ARG B O   1 
ATOM   5652 C CB  . ARG B 1 363 ? 2.017   -40.674 19.342 1.00 26.42 ? 365 ARG B CB  1 
ATOM   5653 C CG  . ARG B 1 363 ? 2.202   -41.315 20.684 1.00 26.81 ? 365 ARG B CG  1 
ATOM   5654 C CD  . ARG B 1 363 ? 2.589   -40.317 21.804 1.00 29.63 ? 365 ARG B CD  1 
ATOM   5655 N NE  . ARG B 1 363 ? 3.836   -39.605 21.512 1.00 29.65 ? 365 ARG B NE  1 
ATOM   5656 C CZ  . ARG B 1 363 ? 3.967   -38.292 21.618 1.00 32.03 ? 365 ARG B CZ  1 
ATOM   5657 N NH1 . ARG B 1 363 ? 2.943   -37.592 22.058 1.00 29.18 ? 365 ARG B NH1 1 
ATOM   5658 N NH2 . ARG B 1 363 ? 5.120   -37.680 21.317 1.00 30.65 ? 365 ARG B NH2 1 
ATOM   5659 N N   . ILE B 1 364 ? 0.318   -41.492 16.402 1.00 22.94 ? 366 ILE B N   1 
ATOM   5660 C CA  . ILE B 1 364 ? -0.197  -40.901 15.172 1.00 22.95 ? 366 ILE B CA  1 
ATOM   5661 C C   . ILE B 1 364 ? -1.334  -39.935 15.550 1.00 24.09 ? 366 ILE B C   1 
ATOM   5662 O O   . ILE B 1 364 ? -2.335  -40.360 16.104 1.00 23.68 ? 366 ILE B O   1 
ATOM   5663 C CB  . ILE B 1 364 ? -0.687  -41.975 14.162 1.00 23.65 ? 366 ILE B CB  1 
ATOM   5664 C CG1 . ILE B 1 364 ? 0.455   -42.987 13.923 1.00 22.89 ? 366 ILE B CG1 1 
ATOM   5665 C CG2 . ILE B 1 364 ? -1.218  -41.276 12.780 1.00 19.48 ? 366 ILE B CG2 1 
ATOM   5666 C CD1 . ILE B 1 364 ? 0.144   -44.075 12.909 1.00 18.14 ? 366 ILE B CD1 1 
ATOM   5667 N N   . GLY B 1 365 ? -1.175  -38.640 15.240 1.00 22.91 ? 367 GLY B N   1 
ATOM   5668 C CA  . GLY B 1 365 ? -2.196  -37.644 15.581 1.00 23.33 ? 367 GLY B CA  1 
ATOM   5669 C C   . GLY B 1 365 ? -3.183  -37.568 14.440 1.00 24.94 ? 367 GLY B C   1 
ATOM   5670 O O   . GLY B 1 365 ? -2.800  -37.753 13.278 1.00 25.43 ? 367 GLY B O   1 
ATOM   5671 N N   . THR B 1 366 ? -4.459  -37.329 14.754 1.00 24.86 ? 368 THR B N   1 
ATOM   5672 C CA  . THR B 1 366 ? -5.452  -36.997 13.722 1.00 24.74 ? 368 THR B CA  1 
ATOM   5673 C C   . THR B 1 366 ? -6.120  -35.695 14.199 1.00 24.30 ? 368 THR B C   1 
ATOM   5674 O O   . THR B 1 366 ? -7.196  -35.743 14.745 1.00 24.38 ? 368 THR B O   1 
ATOM   5675 C CB  . THR B 1 366 ? -6.496  -38.126 13.554 1.00 25.57 ? 368 THR B CB  1 
ATOM   5676 O OG1 . THR B 1 366 ? -6.887  -38.646 14.830 1.00 26.61 ? 368 THR B OG1 1 
ATOM   5677 C CG2 . THR B 1 366 ? -5.914  -39.275 12.763 1.00 23.46 ? 368 THR B CG2 1 
ATOM   5678 N N   . MET B 1 367 ? -5.441  -34.539 14.028 1.00 22.71 ? 369 MET B N   1 
ATOM   5679 C CA  . MET B 1 367 ? -5.927  -33.269 14.556 1.00 22.11 ? 369 MET B CA  1 
ATOM   5680 C C   . MET B 1 367 ? -6.210  -32.253 13.487 1.00 22.57 ? 369 MET B C   1 
ATOM   5681 O O   . MET B 1 367 ? -5.382  -32.024 12.640 1.00 22.94 ? 369 MET B O   1 
ATOM   5682 C CB  . MET B 1 367 ? -4.852  -32.639 15.504 1.00 21.84 ? 369 MET B CB  1 
ATOM   5683 C CG  . MET B 1 367 ? -4.479  -33.579 16.742 1.00 22.47 ? 369 MET B CG  1 
ATOM   5684 S SD  . MET B 1 367 ? -3.025  -32.977 17.588 1.00 24.03 ? 369 MET B SD  1 
ATOM   5685 C CE  . MET B 1 367 ? -3.299  -33.735 19.235 1.00 18.42 ? 369 MET B CE  1 
ATOM   5686 N N   . GLY B 1 368 ? -7.316  -31.522 13.612 1.00 21.97 ? 370 GLY B N   1 
ATOM   5687 C CA  . GLY B 1 368 ? -7.486  -30.335 12.838 1.00 20.52 ? 370 GLY B CA  1 
ATOM   5688 C C   . GLY B 1 368 ? -7.478  -30.634 11.350 1.00 20.78 ? 370 GLY B C   1 
ATOM   5689 O O   . GLY B 1 368 ? -8.096  -31.616 10.897 1.00 19.22 ? 370 GLY B O   1 
ATOM   5690 N N   . TYR B 1 369 ? -6.747  -29.811 10.599 1.00 18.86 ? 371 TYR B N   1 
ATOM   5691 C CA  . TYR B 1 369 ? -6.699  -29.978 9.121  1.00 20.89 ? 371 TYR B CA  1 
ATOM   5692 C C   . TYR B 1 369 ? -6.006  -31.305 8.700  1.00 21.59 ? 371 TYR B C   1 
ATOM   5693 O O   . TYR B 1 369 ? -6.275  -31.857 7.620  1.00 21.18 ? 371 TYR B O   1 
ATOM   5694 C CB  . TYR B 1 369 ? -5.969  -28.767 8.474  1.00 21.09 ? 371 TYR B CB  1 
ATOM   5695 C CG  . TYR B 1 369 ? -6.098  -28.781 6.948  1.00 23.54 ? 371 TYR B CG  1 
ATOM   5696 C CD1 . TYR B 1 369 ? -7.327  -28.490 6.326  1.00 25.16 ? 371 TYR B CD1 1 
ATOM   5697 C CD2 . TYR B 1 369 ? -5.028  -29.108 6.144  1.00 21.03 ? 371 TYR B CD2 1 
ATOM   5698 C CE1 . TYR B 1 369 ? -7.457  -28.507 4.912  1.00 23.94 ? 371 TYR B CE1 1 
ATOM   5699 C CE2 . TYR B 1 369 ? -5.150  -29.075 4.777  1.00 26.04 ? 371 TYR B CE2 1 
ATOM   5700 C CZ  . TYR B 1 369 ? -6.363  -28.802 4.166  1.00 23.18 ? 371 TYR B CZ  1 
ATOM   5701 O OH  . TYR B 1 369 ? -6.475  -28.800 2.775  1.00 24.75 ? 371 TYR B OH  1 
ATOM   5702 N N   . SER B 1 370 ? -5.137  -31.833 9.567  1.00 20.36 ? 372 SER B N   1 
ATOM   5703 C CA  . SER B 1 370 ? -4.427  -33.067 9.280  1.00 20.38 ? 372 SER B CA  1 
ATOM   5704 C C   . SER B 1 370 ? -5.390  -34.235 9.436  1.00 21.50 ? 372 SER B C   1 
ATOM   5705 O O   . SER B 1 370 ? -5.101  -35.335 9.041  1.00 23.04 ? 372 SER B O   1 
ATOM   5706 C CB  . SER B 1 370 ? -3.304  -33.242 10.281 1.00 20.08 ? 372 SER B CB  1 
ATOM   5707 O OG  . SER B 1 370 ? -2.047  -32.665 9.837  1.00 20.97 ? 372 SER B OG  1 
ATOM   5708 N N   . CYS B 1 371 ? -6.516  -34.004 10.083 1.00 21.60 ? 373 CYS B N   1 
ATOM   5709 C CA  . CYS B 1 371 ? -7.477  -35.110 10.350 1.00 22.98 ? 373 CYS B CA  1 
ATOM   5710 C C   . CYS B 1 371 ? -8.443  -35.191 9.152  1.00 22.96 ? 373 CYS B C   1 
ATOM   5711 O O   . CYS B 1 371 ? -9.526  -34.653 9.196  1.00 22.23 ? 373 CYS B O   1 
ATOM   5712 C CB  . CYS B 1 371 ? -8.236  -34.767 11.624 1.00 22.65 ? 373 CYS B CB  1 
ATOM   5713 S SG  . CYS B 1 371 ? -9.454  -36.006 12.113 1.00 25.19 ? 373 CYS B SG  1 
ATOM   5714 N N   . ARG B 1 372 ? -8.020  -35.834 8.069  1.00 23.22 ? 374 ARG B N   1 
ATOM   5715 C CA  . ARG B 1 372 ? -8.841  -35.910 6.889  1.00 23.57 ? 374 ARG B CA  1 
ATOM   5716 C C   . ARG B 1 372 ? -8.520  -37.192 6.255  1.00 23.93 ? 374 ARG B C   1 
ATOM   5717 O O   . ARG B 1 372 ? -7.484  -37.759 6.512  1.00 25.34 ? 374 ARG B O   1 
ATOM   5718 C CB  . ARG B 1 372 ? -8.627  -34.716 5.904  1.00 23.12 ? 374 ARG B CB  1 
ATOM   5719 C CG  . ARG B 1 372 ? -7.261  -34.499 5.370  1.00 23.22 ? 374 ARG B CG  1 
ATOM   5720 C CD  . ARG B 1 372 ? -7.230  -33.138 4.547  1.00 21.20 ? 374 ARG B CD  1 
ATOM   5721 N NE  . ARG B 1 372 ? -6.037  -33.068 3.679  1.00 25.37 ? 374 ARG B NE  1 
ATOM   5722 C CZ  . ARG B 1 372 ? -4.817  -32.738 4.117  1.00 28.79 ? 374 ARG B CZ  1 
ATOM   5723 N NH1 . ARG B 1 372 ? -4.661  -32.500 5.414  1.00 27.95 ? 374 ARG B NH1 1 
ATOM   5724 N NH2 . ARG B 1 372 ? -3.753  -32.624 3.276  1.00 27.18 ? 374 ARG B NH2 1 
ATOM   5725 N N   . LYS B 1 373 ? -9.419  -37.611 5.370  1.00 25.22 ? 375 LYS B N   1 
ATOM   5726 C CA  . LYS B 1 373 ? -9.390  -38.898 4.724  1.00 25.31 ? 375 LYS B CA  1 
ATOM   5727 C C   . LYS B 1 373 ? -8.086  -39.100 3.926  1.00 24.54 ? 375 LYS B C   1 
ATOM   5728 O O   . LYS B 1 373 ? -7.483  -40.174 4.022  1.00 23.80 ? 375 LYS B O   1 
ATOM   5729 C CB  . LYS B 1 373 ? -10.582 -38.932 3.760  1.00 26.11 ? 375 LYS B CB  1 
ATOM   5730 C CG  . LYS B 1 373 ? -10.661 -40.070 2.828  1.00 31.41 ? 375 LYS B CG  1 
ATOM   5731 C CD  . LYS B 1 373 ? -11.732 -39.778 1.728  1.00 36.25 ? 375 LYS B CD  1 
ATOM   5732 C CE  . LYS B 1 373 ? -13.141 -39.985 2.219  1.00 40.03 ? 375 LYS B CE  1 
ATOM   5733 N NZ  . LYS B 1 373 ? -14.213 -39.928 1.096  1.00 37.79 ? 375 LYS B NZ  1 
ATOM   5734 N N   . GLU B 1 374 ? -7.633  -38.083 3.167  1.00 22.84 ? 376 GLU B N   1 
ATOM   5735 C CA  . GLU B 1 374 ? -6.431  -38.273 2.354  1.00 23.13 ? 376 GLU B CA  1 
ATOM   5736 C C   . GLU B 1 374 ? -5.201  -38.538 3.242  1.00 23.26 ? 376 GLU B C   1 
ATOM   5737 O O   . GLU B 1 374 ? -4.297  -39.330 2.846  1.00 23.35 ? 376 GLU B O   1 
ATOM   5738 C CB  . GLU B 1 374 ? -6.179  -37.080 1.386  1.00 23.95 ? 376 GLU B CB  1 
ATOM   5739 C CG  . GLU B 1 374 ? -7.361  -36.850 0.382  1.00 21.93 ? 376 GLU B CG  1 
ATOM   5740 C CD  . GLU B 1 374 ? -8.373  -35.835 0.923  1.00 24.71 ? 376 GLU B CD  1 
ATOM   5741 O OE1 . GLU B 1 374 ? -8.558  -35.739 2.151  1.00 23.25 ? 376 GLU B OE1 1 
ATOM   5742 O OE2 . GLU B 1 374 ? -8.969  -35.092 0.115  1.00 28.81 ? 376 GLU B OE2 1 
ATOM   5743 N N   . ASN B 1 375 ? -5.162  -37.913 4.427  1.00 23.24 ? 377 ASN B N   1 
ATOM   5744 C CA  . ASN B 1 375 ? -3.972  -38.037 5.334  1.00 24.89 ? 377 ASN B CA  1 
ATOM   5745 C C   . ASN B 1 375 ? -3.960  -39.419 6.023  1.00 24.79 ? 377 ASN B C   1 
ATOM   5746 O O   . ASN B 1 375 ? -2.888  -40.050 6.158  1.00 27.46 ? 377 ASN B O   1 
ATOM   5747 C CB  . ASN B 1 375 ? -3.858  -36.942 6.425  1.00 23.73 ? 377 ASN B CB  1 
ATOM   5748 C CG  . ASN B 1 375 ? -3.101  -35.730 5.993  1.00 27.10 ? 377 ASN B CG  1 
ATOM   5749 O OD1 . ASN B 1 375 ? -2.574  -34.989 6.834  1.00 30.22 ? 377 ASN B OD1 1 
ATOM   5750 N ND2 . ASN B 1 375 ? -2.969  -35.534 4.698  1.00 20.05 ? 377 ASN B ND2 1 
ATOM   5751 N N   . VAL B 1 376 ? -5.132  -39.879 6.425  1.00 26.15 ? 378 VAL B N   1 
ATOM   5752 C CA  . VAL B 1 376 ? -5.291  -41.165 7.121  1.00 25.20 ? 378 VAL B CA  1 
ATOM   5753 C C   . VAL B 1 376 ? -4.904  -42.299 6.166  1.00 26.46 ? 378 VAL B C   1 
ATOM   5754 O O   . VAL B 1 376 ? -4.153  -43.204 6.513  1.00 27.38 ? 378 VAL B O   1 
ATOM   5755 C CB  . VAL B 1 376 ? -6.727  -41.346 7.579  1.00 25.93 ? 378 VAL B CB  1 
ATOM   5756 C CG1 . VAL B 1 376 ? -7.033  -42.908 7.902  1.00 21.09 ? 378 VAL B CG1 1 
ATOM   5757 C CG2 . VAL B 1 376 ? -7.057  -40.460 8.727  1.00 25.73 ? 378 VAL B CG2 1 
ATOM   5758 N N   . LEU B 1 377 ? -5.366  -42.194 4.940  1.00 25.79 ? 379 LEU B N   1 
ATOM   5759 C CA  . LEU B 1 377 ? -5.008  -43.148 3.923  1.00 26.03 ? 379 LEU B CA  1 
ATOM   5760 C C   . LEU B 1 377 ? -3.506  -43.122 3.619  1.00 25.79 ? 379 LEU B C   1 
ATOM   5761 O O   . LEU B 1 377 ? -2.915  -44.200 3.564  1.00 23.54 ? 379 LEU B O   1 
ATOM   5762 C CB  . LEU B 1 377 ? -5.818  -42.910 2.654  1.00 24.48 ? 379 LEU B CB  1 
ATOM   5763 C CG  . LEU B 1 377 ? -7.077  -43.669 2.189  1.00 30.23 ? 379 LEU B CG  1 
ATOM   5764 C CD1 . LEU B 1 377 ? -7.733  -44.704 3.121  1.00 26.56 ? 379 LEU B CD1 1 
ATOM   5765 C CD2 . LEU B 1 377 ? -8.118  -42.755 1.536  1.00 22.71 ? 379 LEU B CD2 1 
ATOM   5766 N N   . PHE B 1 378 ? -2.923  -41.922 3.399  1.00 24.97 ? 380 PHE B N   1 
ATOM   5767 C CA  . PHE B 1 378 ? -1.474  -41.788 3.109  1.00 26.57 ? 380 PHE B CA  1 
ATOM   5768 C C   . PHE B 1 378 ? -0.623  -42.297 4.294  1.00 25.73 ? 380 PHE B C   1 
ATOM   5769 O O   . PHE B 1 378 ? 0.362   -43.079 4.093  1.00 26.25 ? 380 PHE B O   1 
ATOM   5770 C CB  . PHE B 1 378 ? -1.114  -40.337 2.712  1.00 26.19 ? 380 PHE B CB  1 
ATOM   5771 C CG  . PHE B 1 378 ? 0.274   -40.175 2.038  1.00 31.18 ? 380 PHE B CG  1 
ATOM   5772 C CD1 . PHE B 1 378 ? 0.941   -41.236 1.423  1.00 33.87 ? 380 PHE B CD1 1 
ATOM   5773 C CD2 . PHE B 1 378 ? 0.884   -38.914 1.987  1.00 33.85 ? 380 PHE B CD2 1 
ATOM   5774 C CE1 . PHE B 1 378 ? 2.215   -41.019 0.793  1.00 35.10 ? 380 PHE B CE1 1 
ATOM   5775 C CE2 . PHE B 1 378 ? 2.137   -38.697 1.342  1.00 34.76 ? 380 PHE B CE2 1 
ATOM   5776 C CZ  . PHE B 1 378 ? 2.789   -39.761 0.748  1.00 32.75 ? 380 PHE B CZ  1 
ATOM   5777 N N   . VAL B 1 379 ? -1.065  -42.010 5.529  1.00 25.11 ? 381 VAL B N   1 
ATOM   5778 C CA  . VAL B 1 379 ? -0.258  -42.495 6.669  1.00 25.68 ? 381 VAL B CA  1 
ATOM   5779 C C   . VAL B 1 379 ? -0.270  -44.015 6.819  1.00 25.13 ? 381 VAL B C   1 
ATOM   5780 O O   . VAL B 1 379 ? 0.732   -44.601 7.197  1.00 23.18 ? 381 VAL B O   1 
ATOM   5781 C CB  . VAL B 1 379 ? -0.502  -41.775 8.006  1.00 26.76 ? 381 VAL B CB  1 
ATOM   5782 C CG1 . VAL B 1 379 ? -1.780  -42.233 8.674  1.00 25.33 ? 381 VAL B CG1 1 
ATOM   5783 C CG2 . VAL B 1 379 ? 0.680   -42.004 8.966  1.00 27.95 ? 381 VAL B CG2 1 
ATOM   5784 N N   . LEU B 1 380 ? -1.383  -44.660 6.480  1.00 25.03 ? 382 LEU B N   1 
ATOM   5785 C CA  . LEU B 1 380 ? -1.432  -46.142 6.541  1.00 25.56 ? 382 LEU B CA  1 
ATOM   5786 C C   . LEU B 1 380 ? -0.628  -46.768 5.404  1.00 25.28 ? 382 LEU B C   1 
ATOM   5787 O O   . LEU B 1 380 ? 0.006   -47.817 5.581  1.00 26.49 ? 382 LEU B O   1 
ATOM   5788 C CB  . LEU B 1 380 ? -2.864  -46.605 6.433  1.00 23.70 ? 382 LEU B CB  1 
ATOM   5789 C CG  . LEU B 1 380 ? -3.720  -46.253 7.639  1.00 24.87 ? 382 LEU B CG  1 
ATOM   5790 C CD1 . LEU B 1 380 ? -5.180  -46.318 7.172  1.00 24.29 ? 382 LEU B CD1 1 
ATOM   5791 C CD2 . LEU B 1 380 ? -3.444  -47.271 8.779  1.00 20.19 ? 382 LEU B CD2 1 
ATOM   5792 N N   . ALA B 1 381 ? -0.717  -46.179 4.218  1.00 23.84 ? 383 ALA B N   1 
ATOM   5793 C CA  . ALA B 1 381 ? 0.012   -46.746 3.098  1.00 25.90 ? 383 ALA B CA  1 
ATOM   5794 C C   . ALA B 1 381 ? 1.494   -46.610 3.384  1.00 25.42 ? 383 ALA B C   1 
ATOM   5795 O O   . ALA B 1 381 ? 2.239   -47.558 3.249  1.00 26.00 ? 383 ALA B O   1 
ATOM   5796 C CB  . ALA B 1 381 ? -0.358  -46.046 1.774  1.00 26.53 ? 383 ALA B CB  1 
ATOM   5797 N N   . GLY B 1 382 ? 1.894   -45.421 3.820  1.00 26.00 ? 384 GLY B N   1 
ATOM   5798 C CA  . GLY B 1 382 ? 3.245   -45.135 4.203  1.00 27.16 ? 384 GLY B CA  1 
ATOM   5799 C C   . GLY B 1 382 ? 3.826   -46.062 5.241  1.00 28.27 ? 384 GLY B C   1 
ATOM   5800 O O   . GLY B 1 382 ? 4.871   -46.711 5.008  1.00 30.11 ? 384 GLY B O   1 
ATOM   5801 N N   . LEU B 1 383 ? 3.177   -46.111 6.397  1.00 28.43 ? 385 LEU B N   1 
ATOM   5802 C CA  . LEU B 1 383 ? 3.521   -47.026 7.469  1.00 27.30 ? 385 LEU B CA  1 
ATOM   5803 C C   . LEU B 1 383 ? 3.537   -48.486 7.003  1.00 28.31 ? 385 LEU B C   1 
ATOM   5804 O O   . LEU B 1 383 ? 4.483   -49.241 7.315  1.00 28.03 ? 385 LEU B O   1 
ATOM   5805 C CB  . LEU B 1 383 ? 2.567   -46.858 8.671  1.00 27.74 ? 385 LEU B CB  1 
ATOM   5806 C CG  . LEU B 1 383 ? 2.922   -47.636 9.973  1.00 29.52 ? 385 LEU B CG  1 
ATOM   5807 C CD1 . LEU B 1 383 ? 4.205   -47.205 10.607 1.00 23.94 ? 385 LEU B CD1 1 
ATOM   5808 C CD2 . LEU B 1 383 ? 1.806   -47.487 11.007 1.00 32.85 ? 385 LEU B CD2 1 
ATOM   5809 N N   . GLU B 1 384 ? 2.542   -48.920 6.236  1.00 27.97 ? 386 GLU B N   1 
ATOM   5810 C CA  . GLU B 1 384 ? 2.622   -50.312 5.762  1.00 26.97 ? 386 GLU B CA  1 
ATOM   5811 C C   . GLU B 1 384 ? 3.931   -50.579 4.961  1.00 26.75 ? 386 GLU B C   1 
ATOM   5812 O O   . GLU B 1 384 ? 4.679   -51.542 5.232  1.00 24.66 ? 386 GLU B O   1 
ATOM   5813 C CB  . GLU B 1 384 ? 1.417   -50.664 4.898  1.00 27.10 ? 386 GLU B CB  1 
ATOM   5814 C CG  . GLU B 1 384 ? 1.416   -52.158 4.415  1.00 28.14 ? 386 GLU B CG  1 
ATOM   5815 C CD  . GLU B 1 384 ? 0.245   -52.488 3.487  1.00 30.79 ? 386 GLU B CD  1 
ATOM   5816 O OE1 . GLU B 1 384 ? -0.655  -53.209 3.926  1.00 33.93 ? 386 GLU B OE1 1 
ATOM   5817 O OE2 . GLU B 1 384 ? 0.221   -52.046 2.338  1.00 33.87 ? 386 GLU B OE2 1 
ATOM   5818 N N   . ALA B 1 385 ? 4.189   -49.717 3.971  1.00 25.57 ? 387 ALA B N   1 
ATOM   5819 C CA  . ALA B 1 385 ? 5.343   -49.880 3.085  1.00 25.14 ? 387 ALA B CA  1 
ATOM   5820 C C   . ALA B 1 385 ? 6.674   -49.887 3.887  1.00 24.95 ? 387 ALA B C   1 
ATOM   5821 O O   . ALA B 1 385 ? 7.588   -50.678 3.597  1.00 23.98 ? 387 ALA B O   1 
ATOM   5822 C CB  . ALA B 1 385 ? 5.355   -48.749 2.042  1.00 24.20 ? 387 ALA B CB  1 
ATOM   5823 N N   . VAL B 1 386 ? 6.779   -49.002 4.883  1.00 23.78 ? 388 VAL B N   1 
ATOM   5824 C CA  . VAL B 1 386 ? 8.002   -48.865 5.694  1.00 23.95 ? 388 VAL B CA  1 
ATOM   5825 C C   . VAL B 1 386 ? 8.210   -50.055 6.636  1.00 25.41 ? 388 VAL B C   1 
ATOM   5826 O O   . VAL B 1 386 ? 9.346   -50.560 6.803  1.00 26.74 ? 388 VAL B O   1 
ATOM   5827 C CB  . VAL B 1 386 ? 8.089   -47.472 6.376  1.00 24.81 ? 388 VAL B CB  1 
ATOM   5828 C CG1 . VAL B 1 386 ? 9.166   -47.421 7.472  1.00 21.48 ? 388 VAL B CG1 1 
ATOM   5829 C CG2 . VAL B 1 386 ? 8.376   -46.408 5.298  1.00 21.29 ? 388 VAL B CG2 1 
ATOM   5830 N N   . LEU B 1 387 ? 7.113   -50.568 7.171  1.00 25.84 ? 389 LEU B N   1 
ATOM   5831 C CA  . LEU B 1 387 ? 7.161   -51.743 7.995  1.00 26.43 ? 389 LEU B CA  1 
ATOM   5832 C C   . LEU B 1 387 ? 7.484   -53.025 7.229  1.00 26.75 ? 389 LEU B C   1 
ATOM   5833 O O   . LEU B 1 387 ? 8.169   -53.852 7.758  1.00 26.46 ? 389 LEU B O   1 
ATOM   5834 C CB  . LEU B 1 387 ? 5.901   -51.881 8.811  1.00 26.84 ? 389 LEU B CB  1 
ATOM   5835 C CG  . LEU B 1 387 ? 5.793   -50.883 9.959  1.00 28.19 ? 389 LEU B CG  1 
ATOM   5836 C CD1 . LEU B 1 387 ? 4.471   -51.161 10.676 1.00 29.32 ? 389 LEU B CD1 1 
ATOM   5837 C CD2 . LEU B 1 387 ? 6.950   -51.131 10.905 1.00 27.93 ? 389 LEU B CD2 1 
ATOM   5838 N N   . LEU B 1 388 ? 7.003   -53.170 6.000  1.00 27.27 ? 390 LEU B N   1 
ATOM   5839 C CA  . LEU B 1 388 ? 7.319   -54.322 5.135  1.00 28.35 ? 390 LEU B CA  1 
ATOM   5840 C C   . LEU B 1 388 ? 8.814   -54.298 4.726  1.00 28.29 ? 390 LEU B C   1 
ATOM   5841 O O   . LEU B 1 388 ? 9.488   -55.342 4.664  1.00 27.58 ? 390 LEU B O   1 
ATOM   5842 C CB  . LEU B 1 388 ? 6.427   -54.276 3.883  1.00 28.07 ? 390 LEU B CB  1 
ATOM   5843 C CG  . LEU B 1 388 ? 5.011   -54.846 3.986  1.00 28.64 ? 390 LEU B CG  1 
ATOM   5844 C CD1 . LEU B 1 388 ? 4.037   -54.295 2.888  1.00 25.02 ? 390 LEU B CD1 1 
ATOM   5845 C CD2 . LEU B 1 388 ? 5.062   -56.418 3.986  1.00 25.43 ? 390 LEU B CD2 1 
ATOM   5846 N N   . ARG B 1 389 ? 9.317   -53.079 4.516  1.00 27.80 ? 391 ARG B N   1 
ATOM   5847 C CA  . ARG B 1 389 ? 10.739  -52.826 4.308  1.00 27.57 ? 391 ARG B CA  1 
ATOM   5848 C C   . ARG B 1 389 ? 11.606  -53.196 5.558  1.00 27.94 ? 391 ARG B C   1 
ATOM   5849 O O   . ARG B 1 389 ? 12.787  -53.491 5.416  1.00 29.15 ? 391 ARG B O   1 
ATOM   5850 C CB  . ARG B 1 389 ? 10.951  -51.369 3.854  1.00 26.98 ? 391 ARG B CB  1 
ATOM   5851 C CG  . ARG B 1 389 ? 12.246  -51.150 3.067  1.00 27.23 ? 391 ARG B CG  1 
ATOM   5852 C CD  . ARG B 1 389 ? 12.144  -50.034 2.041  1.00 25.78 ? 391 ARG B CD  1 
ATOM   5853 N NE  . ARG B 1 389 ? 13.351  -49.949 1.194  1.00 23.99 ? 391 ARG B NE  1 
ATOM   5854 C CZ  . ARG B 1 389 ? 13.507  -50.590 0.032  1.00 26.26 ? 391 ARG B CZ  1 
ATOM   5855 N NH1 . ARG B 1 389 ? 12.554  -51.409 -0.449 1.00 22.96 ? 391 ARG B NH1 1 
ATOM   5856 N NH2 . ARG B 1 389 ? 14.647  -50.457 -0.632 1.00 24.58 ? 391 ARG B NH2 1 
ATOM   5857 N N   . HIS B 1 390 ? 11.037  -53.144 6.758  1.00 28.19 ? 392 HIS B N   1 
ATOM   5858 C CA  . HIS B 1 390 ? 11.753  -53.523 7.993  1.00 29.82 ? 392 HIS B CA  1 
ATOM   5859 C C   . HIS B 1 390 ? 11.387  -54.956 8.413  1.00 30.50 ? 392 HIS B C   1 
ATOM   5860 O O   . HIS B 1 390 ? 11.627  -55.348 9.540  1.00 30.82 ? 392 HIS B O   1 
ATOM   5861 C CB  . HIS B 1 390 ? 11.409  -52.584 9.156  1.00 29.28 ? 392 HIS B CB  1 
ATOM   5862 C CG  . HIS B 1 390 ? 11.924  -51.190 8.986  1.00 30.78 ? 392 HIS B CG  1 
ATOM   5863 N ND1 . HIS B 1 390 ? 12.956  -50.674 9.751  1.00 31.98 ? 392 HIS B ND1 1 
ATOM   5864 C CD2 . HIS B 1 390 ? 11.561  -50.210 8.132  1.00 28.85 ? 392 HIS B CD2 1 
ATOM   5865 C CE1 . HIS B 1 390 ? 13.189  -49.426 9.384  1.00 33.04 ? 392 HIS B CE1 1 
ATOM   5866 N NE2 . HIS B 1 390 ? 12.360  -49.121 8.400  1.00 32.92 ? 392 HIS B NE2 1 
ATOM   5867 N N   . ASN B 1 391 ? 10.782  -55.700 7.489  1.00 32.31 ? 393 ASN B N   1 
ATOM   5868 C CA  . ASN B 1 391 ? 10.334  -57.078 7.681  1.00 34.46 ? 393 ASN B CA  1 
ATOM   5869 C C   . ASN B 1 391 ? 9.374   -57.281 8.816  1.00 34.97 ? 393 ASN B C   1 
ATOM   5870 O O   . ASN B 1 391 ? 9.413   -58.349 9.448  1.00 34.56 ? 393 ASN B O   1 
ATOM   5871 C CB  . ASN B 1 391 ? 11.518  -58.035 7.851  1.00 35.20 ? 393 ASN B CB  1 
ATOM   5872 C CG  . ASN B 1 391 ? 12.119  -58.417 6.529  1.00 38.27 ? 393 ASN B CG  1 
ATOM   5873 O OD1 . ASN B 1 391 ? 13.024  -57.729 6.002  1.00 39.20 ? 393 ASN B OD1 1 
ATOM   5874 N ND2 . ASN B 1 391 ? 11.586  -59.499 5.945  1.00 41.26 ? 393 ASN B ND2 1 
ATOM   5875 N N   . ALA B 1 392 ? 8.519   -56.286 9.079  1.00 34.47 ? 394 ALA B N   1 
ATOM   5876 C CA  . ALA B 1 392 ? 7.404   -56.530 9.988  1.00 35.32 ? 394 ALA B CA  1 
ATOM   5877 C C   . ALA B 1 392 ? 6.501   -57.616 9.386  1.00 36.34 ? 394 ALA B C   1 
ATOM   5878 O O   . ALA B 1 392 ? 6.364   -57.742 8.145  1.00 36.21 ? 394 ALA B O   1 
ATOM   5879 C CB  . ALA B 1 392 ? 6.627   -55.270 10.270 1.00 35.28 ? 394 ALA B CB  1 
ATOM   5880 N N   . GLY B 1 393 ? 5.917   -58.422 10.270 1.00 37.93 ? 395 GLY B N   1 
ATOM   5881 C CA  . GLY B 1 393 ? 5.008   -59.491 9.862  1.00 39.17 ? 395 GLY B CA  1 
ATOM   5882 C C   . GLY B 1 393 ? 3.676   -58.801 9.658  1.00 40.20 ? 395 GLY B C   1 
ATOM   5883 O O   . GLY B 1 393 ? 2.884   -58.696 10.602 1.00 41.02 ? 395 GLY B O   1 
ATOM   5884 N N   . ILE B 1 394 ? 3.478   -58.256 8.448  1.00 39.56 ? 396 ILE B N   1 
ATOM   5885 C CA  . ILE B 1 394 ? 2.166   -57.792 8.007  1.00 38.64 ? 396 ILE B CA  1 
ATOM   5886 C C   . ILE B 1 394 ? 1.640   -58.498 6.730  1.00 37.81 ? 396 ILE B C   1 
ATOM   5887 O O   . ILE B 1 394 ? 2.396   -58.973 5.876  1.00 37.05 ? 396 ILE B O   1 
ATOM   5888 C CB  . ILE B 1 394 ? 2.057   -56.213 7.947  1.00 39.35 ? 396 ILE B CB  1 
ATOM   5889 C CG1 . ILE B 1 394 ? 3.223   -55.553 7.245  1.00 38.60 ? 396 ILE B CG1 1 
ATOM   5890 C CG2 . ILE B 1 394 ? 2.075   -55.614 9.353  1.00 40.36 ? 396 ILE B CG2 1 
ATOM   5891 C CD1 . ILE B 1 394 ? 3.336   -54.088 7.667  1.00 39.23 ? 396 ILE B CD1 1 
ATOM   5892 N N   . GLU B 1 395 ? 0.321   -58.577 6.603  1.00 37.38 ? 397 GLU B N   1 
ATOM   5893 C CA  . GLU B 1 395 ? -0.248  -58.953 5.315  1.00 36.44 ? 397 GLU B CA  1 
ATOM   5894 C C   . GLU B 1 395 ? -0.509  -57.669 4.517  1.00 35.15 ? 397 GLU B C   1 
ATOM   5895 O O   . GLU B 1 395 ? -1.332  -56.844 4.899  1.00 34.95 ? 397 GLU B O   1 
ATOM   5896 C CB  . GLU B 1 395 ? -1.528  -59.778 5.475  1.00 36.78 ? 397 GLU B CB  1 
ATOM   5897 C CG  . GLU B 1 395 ? -2.355  -59.869 4.196  1.00 38.02 ? 397 GLU B CG  1 
ATOM   5898 C CD  . GLU B 1 395 ? -3.091  -61.190 4.065  1.00 41.09 ? 397 GLU B CD  1 
ATOM   5899 O OE1 . GLU B 1 395 ? -4.119  -61.388 4.758  1.00 39.57 ? 397 GLU B OE1 1 
ATOM   5900 O OE2 . GLU B 1 395 ? -2.628  -62.028 3.256  1.00 41.72 ? 397 GLU B OE2 1 
ATOM   5901 N N   . ALA B 1 396 ? 0.184   -57.541 3.397  1.00 33.37 ? 398 ALA B N   1 
ATOM   5902 C CA  . ALA B 1 396 ? 0.070   -56.365 2.548  1.00 32.00 ? 398 ALA B CA  1 
ATOM   5903 C C   . ALA B 1 396 ? -1.325  -56.192 1.945  1.00 30.82 ? 398 ALA B C   1 
ATOM   5904 O O   . ALA B 1 396 ? -1.913  -57.151 1.446  1.00 29.96 ? 398 ALA B O   1 
ATOM   5905 C CB  . ALA B 1 396 ? 1.121   -56.452 1.448  1.00 31.48 ? 398 ALA B CB  1 
ATOM   5906 N N   . GLY B 1 397 ? -1.851  -54.964 1.985  1.00 29.80 ? 399 GLY B N   1 
ATOM   5907 C CA  . GLY B 1 397 ? -3.072  -54.618 1.255  1.00 28.59 ? 399 GLY B CA  1 
ATOM   5908 C C   . GLY B 1 397 ? -4.306  -54.619 2.137  1.00 29.54 ? 399 GLY B C   1 
ATOM   5909 O O   . GLY B 1 397 ? -5.322  -53.979 1.791  1.00 28.26 ? 399 GLY B O   1 
ATOM   5910 N N   . LYS B 1 398 ? -4.218  -55.281 3.304  1.00 29.38 ? 400 LYS B N   1 
ATOM   5911 C CA  . LYS B 1 398 ? -5.374  -55.340 4.222  1.00 30.26 ? 400 LYS B CA  1 
ATOM   5912 C C   . LYS B 1 398 ? -5.717  -53.965 4.845  1.00 30.26 ? 400 LYS B C   1 
ATOM   5913 O O   . LYS B 1 398 ? -6.891  -53.564 4.875  1.00 31.22 ? 400 LYS B O   1 
ATOM   5914 C CB  . LYS B 1 398 ? -5.165  -56.443 5.308  1.00 30.88 ? 400 LYS B CB  1 
ATOM   5915 C CG  . LYS B 1 398 ? -5.753  -57.867 5.018  1.00 32.55 ? 400 LYS B CG  1 
ATOM   5916 C CD  . LYS B 1 398 ? -5.884  -58.204 3.527  1.00 36.64 ? 400 LYS B CD  1 
ATOM   5917 C CE  . LYS B 1 398 ? -6.523  -59.581 3.269  1.00 41.75 ? 400 LYS B CE  1 
ATOM   5918 N NZ  . LYS B 1 398 ? -7.989  -59.648 3.605  1.00 44.50 ? 400 LYS B NZ  1 
ATOM   5919 N N   . ALA B 1 399 ? -4.711  -53.276 5.381  1.00 29.27 ? 401 ALA B N   1 
ATOM   5920 C CA  . ALA B 1 399 ? -4.864  -51.949 6.039  1.00 28.17 ? 401 ALA B CA  1 
ATOM   5921 C C   . ALA B 1 399 ? -5.723  -50.912 5.282  1.00 28.62 ? 401 ALA B C   1 
ATOM   5922 O O   . ALA B 1 399 ? -6.669  -50.316 5.855  1.00 27.28 ? 401 ALA B O   1 
ATOM   5923 C CB  . ALA B 1 399 ? -3.482  -51.343 6.321  1.00 26.89 ? 401 ALA B CB  1 
ATOM   5924 N N   . LEU B 1 400 ? -5.380  -50.676 4.016  1.00 27.87 ? 402 LEU B N   1 
ATOM   5925 C CA  . LEU B 1 400 ? -6.108  -49.673 3.228  1.00 28.82 ? 402 LEU B CA  1 
ATOM   5926 C C   . LEU B 1 400 ? -7.562  -50.090 2.930  1.00 28.33 ? 402 LEU B C   1 
ATOM   5927 O O   . LEU B 1 400 ? -8.479  -49.250 2.928  1.00 27.75 ? 402 LEU B O   1 
ATOM   5928 C CB  . LEU B 1 400 ? -5.317  -49.314 1.970  1.00 28.06 ? 402 LEU B CB  1 
ATOM   5929 C CG  . LEU B 1 400 ? -4.188  -48.327 2.361  1.00 30.12 ? 402 LEU B CG  1 
ATOM   5930 C CD1 . LEU B 1 400 ? -3.380  -47.952 1.159  1.00 31.61 ? 402 LEU B CD1 1 
ATOM   5931 C CD2 . LEU B 1 400 ? -4.840  -47.078 2.884  1.00 32.90 ? 402 LEU B CD2 1 
ATOM   5932 N N   . GLN B 1 401 ? -7.772  -51.395 2.712  1.00 27.46 ? 403 GLN B N   1 
ATOM   5933 C CA  . GLN B 1 401 ? -9.118  -51.886 2.452  1.00 27.01 ? 403 GLN B CA  1 
ATOM   5934 C C   . GLN B 1 401 ? -10.010 -51.658 3.649  1.00 25.98 ? 403 GLN B C   1 
ATOM   5935 O O   . GLN B 1 401 ? -11.183 -51.299 3.468  1.00 26.15 ? 403 GLN B O   1 
ATOM   5936 C CB  . GLN B 1 401 ? -9.157  -53.368 1.999  1.00 28.11 ? 403 GLN B CB  1 
ATOM   5937 C CG  . GLN B 1 401 ? -8.427  -53.622 0.631  1.00 29.04 ? 403 GLN B CG  1 
ATOM   5938 C CD  . GLN B 1 401 ? -8.905  -52.686 -0.494 1.00 31.28 ? 403 GLN B CD  1 
ATOM   5939 O OE1 . GLN B 1 401 ? -10.115 -52.528 -0.721 1.00 31.18 ? 403 GLN B OE1 1 
ATOM   5940 N NE2 . GLN B 1 401 ? -7.958  -52.054 -1.182 1.00 28.51 ? 403 GLN B NE2 1 
ATOM   5941 N N   . ALA B 1 402 ? -9.450  -51.818 4.849  1.00 24.84 ? 404 ALA B N   1 
ATOM   5942 C CA  . ALA B 1 402 ? -10.230 -51.719 6.063  1.00 25.01 ? 404 ALA B CA  1 
ATOM   5943 C C   . ALA B 1 402 ? -10.570 -50.235 6.320  1.00 25.45 ? 404 ALA B C   1 
ATOM   5944 O O   . ALA B 1 402 ? -11.714 -49.929 6.699  1.00 26.02 ? 404 ALA B O   1 
ATOM   5945 C CB  . ALA B 1 402 ? -9.496  -52.368 7.257  1.00 24.84 ? 404 ALA B CB  1 
ATOM   5946 N N   . ALA B 1 403 ? -9.618  -49.319 6.034  1.00 24.03 ? 405 ALA B N   1 
ATOM   5947 C CA  . ALA B 1 403 ? -9.904  -47.852 6.125  1.00 23.92 ? 405 ALA B CA  1 
ATOM   5948 C C   . ALA B 1 403 ? -10.878 -47.393 5.048  1.00 22.94 ? 405 ALA B C   1 
ATOM   5949 O O   . ALA B 1 403 ? -11.789 -46.597 5.312  1.00 22.30 ? 405 ALA B O   1 
ATOM   5950 C CB  . ALA B 1 403 ? -8.596  -47.009 6.099  1.00 22.90 ? 405 ALA B CB  1 
ATOM   5951 N N   . LEU B 1 404 ? -10.710 -47.882 3.827  1.00 22.48 ? 406 LEU B N   1 
ATOM   5952 C CA  . LEU B 1 404 ? -11.694 -47.557 2.794  1.00 22.66 ? 406 LEU B CA  1 
ATOM   5953 C C   . LEU B 1 404 ? -13.099 -48.093 3.073  1.00 23.48 ? 406 LEU B C   1 
ATOM   5954 O O   . LEU B 1 404 ? -14.097 -47.422 2.739  1.00 23.01 ? 406 LEU B O   1 
ATOM   5955 C CB  . LEU B 1 404 ? -11.247 -47.991 1.399  1.00 22.93 ? 406 LEU B CB  1 
ATOM   5956 C CG  . LEU B 1 404 ? -10.007 -47.272 0.808  1.00 23.13 ? 406 LEU B CG  1 
ATOM   5957 C CD1 . LEU B 1 404 ? -9.409  -48.089 -0.376 1.00 20.59 ? 406 LEU B CD1 1 
ATOM   5958 C CD2 . LEU B 1 404 ? -10.442 -45.891 0.337  1.00 17.38 ? 406 LEU B CD2 1 
ATOM   5959 N N   . ASP B 1 405 ? -13.185 -49.292 3.662  1.00 23.52 ? 407 ASP B N   1 
ATOM   5960 C CA  . ASP B 1 405 ? -14.486 -49.780 4.183  1.00 23.93 ? 407 ASP B CA  1 
ATOM   5961 C C   . ASP B 1 405 ? -15.133 -48.803 5.138  1.00 23.30 ? 407 ASP B C   1 
ATOM   5962 O O   . ASP B 1 405 ? -16.324 -48.556 4.995  1.00 22.74 ? 407 ASP B O   1 
ATOM   5963 C CB  . ASP B 1 405 ? -14.382 -51.152 4.862  1.00 23.47 ? 407 ASP B CB  1 
ATOM   5964 C CG  . ASP B 1 405 ? -14.006 -52.255 3.873  1.00 26.27 ? 407 ASP B CG  1 
ATOM   5965 O OD1 . ASP B 1 405 ? -14.055 -52.015 2.637  1.00 26.66 ? 407 ASP B OD1 1 
ATOM   5966 O OD2 . ASP B 1 405 ? -13.658 -53.369 4.315  1.00 29.62 ? 407 ASP B OD2 1 
ATOM   5967 N N   . VAL B 1 406 ? -14.403 -48.265 6.119  1.00 23.68 ? 408 VAL B N   1 
ATOM   5968 C CA  . VAL B 1 406 ? -15.057 -47.251 6.929  1.00 24.53 ? 408 VAL B CA  1 
ATOM   5969 C C   . VAL B 1 406 ? -15.381 -45.952 6.178  1.00 25.43 ? 408 VAL B C   1 
ATOM   5970 O O   . VAL B 1 406 ? -16.388 -45.307 6.496  1.00 23.44 ? 408 VAL B O   1 
ATOM   5971 C CB  . VAL B 1 406 ? -14.543 -47.020 8.431  1.00 26.64 ? 408 VAL B CB  1 
ATOM   5972 C CG1 . VAL B 1 406 ? -13.375 -47.887 8.837  1.00 25.98 ? 408 VAL B CG1 1 
ATOM   5973 C CG2 . VAL B 1 406 ? -14.361 -45.539 8.741  1.00 23.91 ? 408 VAL B CG2 1 
ATOM   5974 N N   . TYR B 1 407 ? -14.584 -45.578 5.166  1.00 26.72 ? 409 TYR B N   1 
ATOM   5975 C CA  . TYR B 1 407 ? -14.877 -44.336 4.397  1.00 28.38 ? 409 TYR B CA  1 
ATOM   5976 C C   . TYR B 1 407 ? -16.105 -44.438 3.461  1.00 30.61 ? 409 TYR B C   1 
ATOM   5977 O O   . TYR B 1 407 ? -16.792 -43.439 3.187  1.00 30.25 ? 409 TYR B O   1 
ATOM   5978 C CB  . TYR B 1 407 ? -13.630 -43.792 3.646  1.00 27.61 ? 409 TYR B CB  1 
ATOM   5979 C CG  . TYR B 1 407 ? -12.634 -43.133 4.607  1.00 26.22 ? 409 TYR B CG  1 
ATOM   5980 C CD1 . TYR B 1 407 ? -13.088 -42.162 5.518  1.00 20.93 ? 409 TYR B CD1 1 
ATOM   5981 C CD2 . TYR B 1 407 ? -11.263 -43.470 4.605  1.00 22.28 ? 409 TYR B CD2 1 
ATOM   5982 C CE1 . TYR B 1 407 ? -12.232 -41.551 6.427  1.00 23.15 ? 409 TYR B CE1 1 
ATOM   5983 C CE2 . TYR B 1 407 ? -10.348 -42.821 5.536  1.00 24.16 ? 409 TYR B CE2 1 
ATOM   5984 C CZ  . TYR B 1 407 ? -10.863 -41.871 6.435  1.00 22.42 ? 409 TYR B CZ  1 
ATOM   5985 O OH  . TYR B 1 407 ? -10.106 -41.199 7.370  1.00 23.63 ? 409 TYR B OH  1 
ATOM   5986 N N   . GLU B 1 408 ? -16.371 -45.645 2.990  1.00 32.81 ? 410 GLU B N   1 
ATOM   5987 C CA  . GLU B 1 408 ? -17.550 -45.902 2.182  1.00 36.70 ? 410 GLU B CA  1 
ATOM   5988 C C   . GLU B 1 408 ? -18.808 -46.066 3.034  1.00 37.91 ? 410 GLU B C   1 
ATOM   5989 O O   . GLU B 1 408 ? -19.696 -45.222 2.964  1.00 38.50 ? 410 GLU B O   1 
ATOM   5990 C CB  . GLU B 1 408 ? -17.295 -47.077 1.228  1.00 37.33 ? 410 GLU B CB  1 
ATOM   5991 C CG  . GLU B 1 408 ? -16.190 -46.664 0.242  1.00 40.87 ? 410 GLU B CG  1 
ATOM   5992 C CD  . GLU B 1 408 ? -15.878 -47.694 -0.850 1.00 45.96 ? 410 GLU B CD  1 
ATOM   5993 O OE1 . GLU B 1 408 ? -16.772 -48.496 -1.253 1.00 47.08 ? 410 GLU B OE1 1 
ATOM   5994 O OE2 . GLU B 1 408 ? -14.715 -47.666 -1.314 1.00 46.72 ? 410 GLU B OE2 1 
ATOM   5995 N N   . ASN B 1 409 ? -18.836 -47.106 3.875  1.00 39.98 ? 411 ASN B N   1 
ATOM   5996 C CA  . ASN B 1 409 ? -20.009 -47.511 4.708  1.00 41.24 ? 411 ASN B CA  1 
ATOM   5997 C C   . ASN B 1 409 ? -21.018 -46.424 5.092  1.00 41.39 ? 411 ASN B C   1 
ATOM   5998 O O   . ASN B 1 409 ? -20.707 -45.559 5.920  1.00 42.33 ? 411 ASN B O   1 
ATOM   5999 C CB  . ASN B 1 409 ? -19.523 -48.239 5.977  1.00 41.37 ? 411 ASN B CB  1 
ATOM   6000 C CG  . ASN B 1 409 ? -19.324 -49.741 5.746  1.00 43.48 ? 411 ASN B CG  1 
ATOM   6001 O OD1 . ASN B 1 409 ? -20.038 -50.350 4.946  1.00 43.50 ? 411 ASN B OD1 1 
ATOM   6002 N ND2 . ASN B 1 409 ? -18.341 -50.337 6.434  1.00 44.64 ? 411 ASN B ND2 1 
HETATM 6003 N N1  . PLP C 2 .   ? 11.700  -2.229  24.377 1.00 48.01 ? 419 PLP A N1  1 
HETATM 6004 C C2  . PLP C 2 .   ? 11.793  -1.031  23.526 1.00 54.08 ? 419 PLP A C2  1 
HETATM 6005 C C2A . PLP C 2 .   ? 12.881  -0.136  23.506 1.00 53.92 ? 419 PLP A C2A 1 
HETATM 6006 C C3  . PLP C 2 .   ? 10.764  -0.669  22.647 1.00 55.09 ? 419 PLP A C3  1 
HETATM 6007 O O3  . PLP C 2 .   ? 10.854  0.442   21.848 1.00 59.85 ? 419 PLP A O3  1 
HETATM 6008 C C4  . PLP C 2 .   ? 9.619   -1.421  22.507 1.00 54.47 ? 419 PLP A C4  1 
HETATM 6009 C C4A . PLP C 2 .   ? 8.509   -0.968  21.481 1.00 50.93 ? 419 PLP A C4A 1 
HETATM 6010 C C5  . PLP C 2 .   ? 9.493   -2.568  23.281 1.00 55.92 ? 419 PLP A C5  1 
HETATM 6011 C C6  . PLP C 2 .   ? 10.489  -2.986  24.220 1.00 57.10 ? 419 PLP A C6  1 
HETATM 6012 C C5A . PLP C 2 .   ? 8.211   -3.319  23.137 1.00 55.45 ? 419 PLP A C5A 1 
HETATM 6013 O O4P . PLP C 2 .   ? 8.452   -4.614  22.842 1.00 57.94 ? 419 PLP A O4P 1 
HETATM 6014 P P   . PLP C 2 .   ? 7.113   -5.419  22.602 1.00 55.59 ? 419 PLP A P   1 
HETATM 6015 O O1P . PLP C 2 .   ? 5.893   -4.508  22.531 1.00 48.93 ? 419 PLP A O1P 1 
HETATM 6016 O O2P . PLP C 2 .   ? 7.190   -6.496  23.866 1.00 47.17 ? 419 PLP A O2P 1 
HETATM 6017 O O3P . PLP C 2 .   ? 7.285   -6.341  21.208 1.00 53.58 ? 419 PLP A O3P 1 
HETATM 6018 N N1  . PLP D 2 .   ? -0.226  -29.816 27.222 1.00 56.14 ? 419 PLP B N1  1 
HETATM 6019 C C2  . PLP D 2 .   ? -0.468  -30.865 26.293 1.00 53.78 ? 419 PLP B C2  1 
HETATM 6020 C C2A . PLP D 2 .   ? -1.348  -31.925 26.579 1.00 52.66 ? 419 PLP B C2A 1 
HETATM 6021 C C3  . PLP D 2 .   ? 0.230   -30.860 25.089 1.00 56.48 ? 419 PLP B C3  1 
HETATM 6022 O O3  . PLP D 2 .   ? 0.060   -31.860 24.152 1.00 55.74 ? 419 PLP B O3  1 
HETATM 6023 C C4  . PLP D 2 .   ? 1.120   -29.832 24.765 1.00 54.56 ? 419 PLP B C4  1 
HETATM 6024 C C4A . PLP D 2 .   ? 1.749   -30.047 23.334 1.00 54.35 ? 419 PLP B C4A 1 
HETATM 6025 C C5  . PLP D 2 .   ? 1.336   -28.771 25.700 1.00 55.93 ? 419 PLP B C5  1 
HETATM 6026 C C6  . PLP D 2 .   ? 0.660   -28.768 26.934 1.00 52.54 ? 419 PLP B C6  1 
HETATM 6027 C C5A . PLP D 2 .   ? 2.262   -27.546 25.542 1.00 52.68 ? 419 PLP B C5A 1 
HETATM 6028 O O4P . PLP D 2 .   ? 2.558   -27.339 24.192 1.00 51.97 ? 419 PLP B O4P 1 
HETATM 6029 P P   . PLP D 2 .   ? 3.568   -26.100 23.592 1.00 56.76 ? 419 PLP B P   1 
HETATM 6030 O O1P . PLP D 2 .   ? 4.076   -25.153 24.672 1.00 45.10 ? 419 PLP B O1P 1 
HETATM 6031 O O2P . PLP D 2 .   ? 2.726   -25.274 22.475 1.00 55.67 ? 419 PLP B O2P 1 
HETATM 6032 O O3P . PLP D 2 .   ? 4.718   -26.891 22.749 1.00 52.39 ? 419 PLP B O3P 1 
HETATM 6033 O O   . HOH E 3 .   ? 5.384   -5.413  12.363 1.00 25.63 ? 420 HOH A O   1 
HETATM 6034 O O   . HOH E 3 .   ? 2.018   -28.631 6.713  1.00 20.46 ? 421 HOH A O   1 
HETATM 6035 O O   . HOH E 3 .   ? -2.219  -2.535  6.442  1.00 19.41 ? 422 HOH A O   1 
HETATM 6036 O O   . HOH E 3 .   ? 2.497   -12.082 14.772 1.00 25.60 ? 423 HOH A O   1 
HETATM 6037 O O   . HOH E 3 .   ? 30.658  -5.820  17.248 1.00 16.82 ? 424 HOH A O   1 
HETATM 6038 O O   . HOH E 3 .   ? 12.880  -20.378 21.139 1.00 34.66 ? 425 HOH A O   1 
HETATM 6039 O O   . HOH E 3 .   ? 3.476   -20.565 7.424  1.00 22.42 ? 426 HOH A O   1 
HETATM 6040 O O   . HOH E 3 .   ? 22.859  -21.719 22.308 1.00 38.67 ? 427 HOH A O   1 
HETATM 6041 O O   . HOH E 3 .   ? 27.472  -10.920 24.010 1.00 16.19 ? 428 HOH A O   1 
HETATM 6042 O O   . HOH E 3 .   ? 2.131   0.882   14.488 1.00 16.64 ? 429 HOH A O   1 
HETATM 6043 O O   . HOH E 3 .   ? 24.108  -22.263 13.251 1.00 24.89 ? 430 HOH A O   1 
HETATM 6044 O O   . HOH E 3 .   ? -2.853  4.864   3.817  1.00 22.38 ? 431 HOH A O   1 
HETATM 6045 O O   . HOH E 3 .   ? -2.589  8.398   12.874 1.00 18.84 ? 432 HOH A O   1 
HETATM 6046 O O   . HOH E 3 .   ? 25.163  -8.600  42.937 1.00 31.80 ? 433 HOH A O   1 
HETATM 6047 O O   . HOH E 3 .   ? 15.395  10.524  27.025 1.00 20.09 ? 434 HOH A O   1 
HETATM 6048 O O   . HOH E 3 .   ? 24.750  3.945   19.971 1.00 24.13 ? 435 HOH A O   1 
HETATM 6049 O O   . HOH E 3 .   ? 28.833  -21.987 35.190 1.00 27.26 ? 436 HOH A O   1 
HETATM 6050 O O   . HOH E 3 .   ? 8.055   -8.784  30.284 1.00 31.34 ? 437 HOH A O   1 
HETATM 6051 O O   . HOH E 3 .   ? 3.352   -4.767  3.488  1.00 17.41 ? 438 HOH A O   1 
HETATM 6052 O O   . HOH E 3 .   ? 26.858  3.068   21.283 1.00 24.76 ? 439 HOH A O   1 
HETATM 6053 O O   . HOH E 3 .   ? 19.041  0.208   0.492  1.00 18.92 ? 440 HOH A O   1 
HETATM 6054 O O   . HOH E 3 .   ? 8.057   3.393   10.733 1.00 20.21 ? 441 HOH A O   1 
HETATM 6055 O O   . HOH E 3 .   ? 18.588  -30.296 8.237  1.00 37.90 ? 442 HOH A O   1 
HETATM 6056 O O   . HOH E 3 .   ? 13.796  11.142  18.064 1.00 23.51 ? 443 HOH A O   1 
HETATM 6057 O O   . HOH E 3 .   ? 24.708  12.275  33.259 1.00 30.86 ? 444 HOH A O   1 
HETATM 6058 O O   . HOH E 3 .   ? -0.495  0.676   16.797 1.00 28.33 ? 445 HOH A O   1 
HETATM 6059 O O   . HOH E 3 .   ? 17.194  24.118  7.018  1.00 35.92 ? 446 HOH A O   1 
HETATM 6060 O O   . HOH E 3 .   ? 19.057  -0.136  46.360 1.00 47.64 ? 447 HOH A O   1 
HETATM 6061 O O   . HOH E 3 .   ? 12.764  18.614  11.447 1.00 21.31 ? 448 HOH A O   1 
HETATM 6062 O O   . HOH E 3 .   ? 13.847  13.313  11.072 1.00 24.53 ? 449 HOH A O   1 
HETATM 6063 O O   . HOH E 3 .   ? 30.936  -6.423  29.535 1.00 21.16 ? 450 HOH A O   1 
HETATM 6064 O O   . HOH E 3 .   ? 2.635   2.020   2.826  1.00 21.31 ? 451 HOH A O   1 
HETATM 6065 O O   . HOH E 3 .   ? 3.209   5.228   1.046  1.00 28.98 ? 452 HOH A O   1 
HETATM 6066 O O   . HOH E 3 .   ? 16.961  -8.152  -1.082 1.00 25.47 ? 453 HOH A O   1 
HETATM 6067 O O   . HOH E 3 .   ? 15.071  6.470   9.740  1.00 21.64 ? 454 HOH A O   1 
HETATM 6068 O O   . HOH E 3 .   ? -2.299  19.749  1.475  1.00 31.92 ? 455 HOH A O   1 
HETATM 6069 O O   . HOH E 3 .   ? 13.242  -7.592  6.912  1.00 22.74 ? 456 HOH A O   1 
HETATM 6070 O O   . HOH E 3 .   ? 23.483  8.943   20.995 1.00 31.08 ? 457 HOH A O   1 
HETATM 6071 O O   . HOH E 3 .   ? 7.711   -26.333 16.137 1.00 25.31 ? 458 HOH A O   1 
HETATM 6072 O O   . HOH E 3 .   ? 29.121  4.230   21.962 1.00 33.30 ? 459 HOH A O   1 
HETATM 6073 O O   . HOH E 3 .   ? -7.032  21.054  17.372 1.00 21.74 ? 460 HOH A O   1 
HETATM 6074 O O   . HOH E 3 .   ? 30.652  -11.285 22.592 1.00 18.76 ? 461 HOH A O   1 
HETATM 6075 O O   . HOH E 3 .   ? 23.370  -16.415 39.069 1.00 36.28 ? 462 HOH A O   1 
HETATM 6076 O O   . HOH E 3 .   ? 7.780   -8.036  -3.982 1.00 33.76 ? 463 HOH A O   1 
HETATM 6077 O O   . HOH E 3 .   ? 19.661  11.121  14.416 1.00 22.76 ? 464 HOH A O   1 
HETATM 6078 O O   . HOH E 3 .   ? -6.111  2.820   5.243  1.00 19.22 ? 465 HOH A O   1 
HETATM 6079 O O   . HOH E 3 .   ? 15.022  -16.566 38.240 1.00 30.42 ? 466 HOH A O   1 
HETATM 6080 O O   . HOH E 3 .   ? 33.067  5.546   41.497 1.00 33.59 ? 467 HOH A O   1 
HETATM 6081 O O   . HOH E 3 .   ? 32.640  0.523   45.416 1.00 21.88 ? 468 HOH A O   1 
HETATM 6082 O O   . HOH E 3 .   ? -0.557  -22.524 1.278  1.00 27.52 ? 469 HOH A O   1 
HETATM 6083 O O   . HOH E 3 .   ? 22.025  -2.915  -0.848 1.00 21.97 ? 470 HOH A O   1 
HETATM 6084 O O   . HOH E 3 .   ? 20.435  4.473   10.978 1.00 24.41 ? 471 HOH A O   1 
HETATM 6085 O O   . HOH E 3 .   ? 13.511  -5.384  5.459  1.00 22.24 ? 472 HOH A O   1 
HETATM 6086 O O   . HOH E 3 .   ? 15.128  15.538  18.196 1.00 25.20 ? 473 HOH A O   1 
HETATM 6087 O O   . HOH E 3 .   ? 24.799  -22.672 16.158 1.00 28.37 ? 474 HOH A O   1 
HETATM 6088 O O   . HOH E 3 .   ? 23.781  -25.774 26.614 1.00 25.48 ? 475 HOH A O   1 
HETATM 6089 O O   . HOH E 3 .   ? 13.095  25.096  19.240 1.00 42.67 ? 476 HOH A O   1 
HETATM 6090 O O   . HOH E 3 .   ? 18.681  14.870  33.921 1.00 30.39 ? 477 HOH A O   1 
HETATM 6091 O O   . HOH E 3 .   ? 21.249  -12.725 3.177  1.00 23.11 ? 478 HOH A O   1 
HETATM 6092 O O   . HOH E 3 .   ? 13.061  13.881  17.315 1.00 22.26 ? 479 HOH A O   1 
HETATM 6093 O O   . HOH E 3 .   ? 3.017   -2.145  3.224  1.00 29.52 ? 480 HOH A O   1 
HETATM 6094 O O   . HOH E 3 .   ? 34.785  2.811   29.833 1.00 26.72 ? 481 HOH A O   1 
HETATM 6095 O O   . HOH E 3 .   ? 31.717  1.695   17.773 1.00 39.22 ? 482 HOH A O   1 
HETATM 6096 O O   . HOH E 3 .   ? -3.318  4.432   16.086 1.00 29.76 ? 483 HOH A O   1 
HETATM 6097 O O   . HOH E 3 .   ? 31.012  -5.859  13.025 1.00 31.24 ? 484 HOH A O   1 
HETATM 6098 O O   . HOH E 3 .   ? 23.990  3.646   12.846 1.00 35.63 ? 485 HOH A O   1 
HETATM 6099 O O   . HOH E 3 .   ? 31.808  5.363   21.293 1.00 42.10 ? 486 HOH A O   1 
HETATM 6100 O O   . HOH E 3 .   ? 10.342  -20.154 25.204 1.00 46.82 ? 487 HOH A O   1 
HETATM 6101 O O   . HOH E 3 .   ? 27.904  -8.470  10.714 1.00 21.84 ? 488 HOH A O   1 
HETATM 6102 O O   . HOH E 3 .   ? 26.139  -6.684  6.270  1.00 27.95 ? 489 HOH A O   1 
HETATM 6103 O O   . HOH E 3 .   ? 8.856   -3.679  -2.111 1.00 25.58 ? 490 HOH A O   1 
HETATM 6104 O O   . HOH E 3 .   ? 14.958  18.502  19.137 1.00 35.92 ? 491 HOH A O   1 
HETATM 6105 O O   . HOH E 3 .   ? 4.413   2.906   18.413 1.00 25.41 ? 492 HOH A O   1 
HETATM 6106 O O   . HOH E 3 .   ? 15.678  -4.727  2.490  1.00 34.18 ? 493 HOH A O   1 
HETATM 6107 O O   . HOH E 3 .   ? 11.809  14.255  32.481 1.00 31.65 ? 494 HOH A O   1 
HETATM 6108 O O   . HOH E 3 .   ? -9.259  4.555   7.323  1.00 40.47 ? 495 HOH A O   1 
HETATM 6109 O O   . HOH E 3 .   ? 28.515  10.590  25.424 1.00 25.49 ? 496 HOH A O   1 
HETATM 6110 O O   . HOH E 3 .   ? 20.839  -28.326 30.779 1.00 24.60 ? 497 HOH A O   1 
HETATM 6111 O O   . HOH E 3 .   ? 18.606  14.028  10.063 1.00 28.35 ? 498 HOH A O   1 
HETATM 6112 O O   . HOH E 3 .   ? 27.330  -3.626  5.947  1.00 34.69 ? 499 HOH A O   1 
HETATM 6113 O O   . HOH E 3 .   ? 18.805  16.251  8.814  1.00 23.67 ? 500 HOH A O   1 
HETATM 6114 O O   . HOH E 3 .   ? 17.142  17.163  6.788  1.00 20.40 ? 501 HOH A O   1 
HETATM 6115 O O   . HOH E 3 .   ? 1.507   0.735   18.283 1.00 37.80 ? 502 HOH A O   1 
HETATM 6116 O O   . HOH E 3 .   ? -9.613  14.351  20.634 1.00 25.64 ? 503 HOH A O   1 
HETATM 6117 O O   . HOH E 3 .   ? 6.404   -26.284 3.428  1.00 19.31 ? 504 HOH A O   1 
HETATM 6118 O O   . HOH E 3 .   ? 15.833  4.247   29.360 1.00 28.46 ? 505 HOH A O   1 
HETATM 6119 O O   . HOH E 3 .   ? 20.333  12.102  -3.817 1.00 35.82 ? 506 HOH A O   1 
HETATM 6120 O O   . HOH E 3 .   ? 6.758   23.649  19.251 1.00 29.55 ? 507 HOH A O   1 
HETATM 6121 O O   . HOH E 3 .   ? 8.748   -26.934 29.216 1.00 30.85 ? 508 HOH A O   1 
HETATM 6122 O O   . HOH E 3 .   ? 10.201  23.899  0.619  1.00 32.01 ? 509 HOH A O   1 
HETATM 6123 O O   . HOH E 3 .   ? 26.531  -2.842  3.810  1.00 18.55 ? 510 HOH A O   1 
HETATM 6124 O O   . HOH E 3 .   ? 16.326  -0.034  22.032 1.00 23.84 ? 511 HOH A O   1 
HETATM 6125 O O   . HOH E 3 .   ? -10.848 -4.311  9.415  1.00 30.25 ? 512 HOH A O   1 
HETATM 6126 O O   . HOH E 3 .   ? 6.107   22.186  16.210 1.00 21.99 ? 513 HOH A O   1 
HETATM 6127 O O   . HOH E 3 .   ? 12.749  4.618   -0.678 1.00 19.61 ? 514 HOH A O   1 
HETATM 6128 O O   . HOH E 3 .   ? 16.982  7.902   40.908 1.00 29.62 ? 515 HOH A O   1 
HETATM 6129 O O   . HOH E 3 .   ? 5.286   9.795   27.670 1.00 23.12 ? 516 HOH A O   1 
HETATM 6130 O O   . HOH E 3 .   ? 17.223  -32.703 12.882 1.00 44.59 ? 517 HOH A O   1 
HETATM 6131 O O   . HOH E 3 .   ? -0.742  18.002  1.529  1.00 41.29 ? 518 HOH A O   1 
HETATM 6132 O O   . HOH E 3 .   ? 26.203  -23.031 28.868 1.00 34.91 ? 519 HOH A O   1 
HETATM 6133 O O   . HOH E 3 .   ? 23.017  -24.269 30.783 1.00 31.88 ? 520 HOH A O   1 
HETATM 6134 O O   . HOH E 3 .   ? 4.083   22.643  4.031  1.00 36.51 ? 521 HOH A O   1 
HETATM 6135 O O   . HOH E 3 .   ? 10.245  -7.463  5.953  1.00 36.91 ? 522 HOH A O   1 
HETATM 6136 O O   . HOH E 3 .   ? 30.095  5.380   24.770 1.00 22.60 ? 523 HOH A O   1 
HETATM 6137 O O   . HOH E 3 .   ? 13.129  -2.060  3.971  1.00 30.72 ? 524 HOH A O   1 
HETATM 6138 O O   . HOH E 3 .   ? 27.292  8.677   39.230 1.00 30.83 ? 525 HOH A O   1 
HETATM 6139 O O   . HOH E 3 .   ? 11.905  20.855  12.697 1.00 28.48 ? 526 HOH A O   1 
HETATM 6140 O O   . HOH E 3 .   ? 26.151  10.942  26.319 1.00 36.88 ? 527 HOH A O   1 
HETATM 6141 O O   . HOH E 3 .   ? 15.641  19.954  1.553  1.00 30.30 ? 528 HOH A O   1 
HETATM 6142 O O   . HOH E 3 .   ? 0.065   -1.606  4.586  1.00 18.92 ? 529 HOH A O   1 
HETATM 6143 O O   . HOH E 3 .   ? 28.215  -1.320  11.814 1.00 34.53 ? 530 HOH A O   1 
HETATM 6144 O O   . HOH E 3 .   ? 13.329  21.712  15.600 1.00 31.63 ? 531 HOH A O   1 
HETATM 6145 O O   . HOH E 3 .   ? 33.634  8.041   35.499 1.00 31.59 ? 532 HOH A O   1 
HETATM 6146 O O   . HOH E 3 .   ? 32.422  -12.976 34.188 1.00 36.01 ? 533 HOH A O   1 
HETATM 6147 O O   . HOH E 3 .   ? 6.013   8.664   24.684 1.00 30.22 ? 534 HOH A O   1 
HETATM 6148 O O   . HOH E 3 .   ? 27.124  -15.791 11.248 1.00 31.62 ? 535 HOH A O   1 
HETATM 6149 O O   . HOH E 3 .   ? 4.670   -0.810  26.041 1.00 38.42 ? 536 HOH A O   1 
HETATM 6150 O O   . HOH E 3 .   ? 15.776  18.047  25.447 1.00 32.12 ? 537 HOH A O   1 
HETATM 6151 O O   . HOH E 3 .   ? 32.151  11.688  29.019 1.00 45.87 ? 538 HOH A O   1 
HETATM 6152 O O   . HOH E 3 .   ? -7.479  0.169   2.506  1.00 31.09 ? 539 HOH A O   1 
HETATM 6153 O O   . HOH E 3 .   ? 5.299   2.253   -1.708 1.00 33.80 ? 540 HOH A O   1 
HETATM 6154 O O   . HOH E 3 .   ? 10.989  3.137   -2.176 1.00 29.76 ? 541 HOH A O   1 
HETATM 6155 O O   . HOH E 3 .   ? 24.349  13.372  17.062 1.00 39.57 ? 542 HOH A O   1 
HETATM 6156 O O   . HOH E 3 .   ? 34.818  -10.642 39.910 1.00 38.00 ? 543 HOH A O   1 
HETATM 6157 O O   . HOH E 3 .   ? 0.325   -2.306  2.063  1.00 28.79 ? 544 HOH A O   1 
HETATM 6158 O O   . HOH E 3 .   ? 15.066  -2.953  44.534 1.00 35.46 ? 545 HOH A O   1 
HETATM 6159 O O   . HOH E 3 .   ? 25.406  -8.540  4.509  1.00 22.49 ? 546 HOH A O   1 
HETATM 6160 O O   . HOH E 3 .   ? 30.556  -9.107  23.908 1.00 38.36 ? 547 HOH A O   1 
HETATM 6161 O O   . HOH E 3 .   ? 15.040  5.827   -2.147 1.00 32.13 ? 548 HOH A O   1 
HETATM 6162 O O   . HOH E 3 .   ? 0.127   26.106  14.086 1.00 37.71 ? 549 HOH A O   1 
HETATM 6163 O O   . HOH E 3 .   ? 7.021   -33.956 25.182 1.00 29.19 ? 550 HOH A O   1 
HETATM 6164 O O   . HOH E 3 .   ? 0.076   -4.311  0.060  0.50 24.80 ? 551 HOH A O   1 
HETATM 6165 O O   . HOH E 3 .   ? 21.080  -24.873 7.751  1.00 34.34 ? 552 HOH A O   1 
HETATM 6166 O O   . HOH E 3 .   ? 11.540  27.395  -0.692 1.00 29.48 ? 553 HOH A O   1 
HETATM 6167 O O   . HOH E 3 .   ? 28.592  -23.381 29.968 1.00 52.88 ? 554 HOH A O   1 
HETATM 6168 O O   . HOH E 3 .   ? 16.871  -6.546  1.005  1.00 19.97 ? 555 HOH A O   1 
HETATM 6169 O O   . HOH E 3 .   ? 21.832  -27.172 9.054  1.00 31.21 ? 556 HOH A O   1 
HETATM 6170 O O   . HOH E 3 .   ? 30.902  -17.939 16.209 1.00 36.14 ? 557 HOH A O   1 
HETATM 6171 O O   . HOH E 3 .   ? 29.553  -4.085  4.549  1.00 41.35 ? 558 HOH A O   1 
HETATM 6172 O O   . HOH E 3 .   ? 15.059  -4.713  -1.354 1.00 35.68 ? 559 HOH A O   1 
HETATM 6173 O O   . HOH E 3 .   ? 10.596  -14.706 0.604  1.00 38.28 ? 560 HOH A O   1 
HETATM 6174 O O   . HOH E 3 .   ? 15.460  -34.722 18.293 1.00 42.71 ? 561 HOH A O   1 
HETATM 6175 O O   . HOH E 3 .   ? 2.253   -5.598  1.092  1.00 33.74 ? 562 HOH A O   1 
HETATM 6176 O O   . HOH E 3 .   ? 24.228  -26.519 31.291 1.00 47.44 ? 563 HOH A O   1 
HETATM 6177 O O   . HOH E 3 .   ? 6.418   3.027   21.102 1.00 38.96 ? 564 HOH A O   1 
HETATM 6178 O O   . HOH E 3 .   ? 5.202   -35.634 24.685 1.00 49.77 ? 565 HOH A O   1 
HETATM 6179 O O   . HOH E 3 .   ? -0.070  6.365   19.709 1.00 36.39 ? 566 HOH A O   1 
HETATM 6180 O O   . HOH E 3 .   ? 11.708  -0.103  -0.378 1.00 34.89 ? 567 HOH A O   1 
HETATM 6181 O O   . HOH E 3 .   ? 34.256  7.462   29.193 1.00 31.86 ? 568 HOH A O   1 
HETATM 6182 O O   . HOH E 3 .   ? 36.934  -9.216  38.582 1.00 53.90 ? 569 HOH A O   1 
HETATM 6183 O O   . HOH E 3 .   ? 36.347  13.661  30.950 1.00 18.22 ? 570 HOH A O   1 
HETATM 6184 O O   . HOH E 3 .   ? 28.645  4.323   26.803 1.00 22.38 ? 571 HOH A O   1 
HETATM 6185 O O   . HOH E 3 .   ? -1.489  -25.328 1.552  1.00 35.57 ? 572 HOH A O   1 
HETATM 6186 O O   . HOH F 3 .   ? -11.536 -42.839 21.511 1.00 26.37 ? 420 HOH B O   1 
HETATM 6187 O O   . HOH F 3 .   ? -6.142  -28.724 20.326 1.00 20.10 ? 421 HOH B O   1 
HETATM 6188 O O   . HOH F 3 .   ? 7.559   -41.430 27.126 1.00 23.43 ? 422 HOH B O   1 
HETATM 6189 O O   . HOH F 3 .   ? -14.760 -25.360 40.062 1.00 21.31 ? 423 HOH B O   1 
HETATM 6190 O O   . HOH F 3 .   ? -2.146  -41.862 30.992 1.00 25.20 ? 424 HOH B O   1 
HETATM 6191 O O   . HOH F 3 .   ? -2.496  -34.848 13.180 1.00 16.41 ? 425 HOH B O   1 
HETATM 6192 O O   . HOH F 3 .   ? 0.124   -10.990 8.202  1.00 19.55 ? 426 HOH B O   1 
HETATM 6193 O O   . HOH F 3 .   ? -19.149 -34.655 11.304 1.00 23.61 ? 427 HOH B O   1 
HETATM 6194 O O   . HOH F 3 .   ? -11.976 -35.938 4.846  1.00 27.96 ? 428 HOH B O   1 
HETATM 6195 O O   . HOH F 3 .   ? -12.848 -9.365  13.118 1.00 23.37 ? 429 HOH B O   1 
HETATM 6196 O O   . HOH F 3 .   ? -16.932 -31.536 8.739  1.00 23.04 ? 430 HOH B O   1 
HETATM 6197 O O   . HOH F 3 .   ? -11.611 -5.137  12.150 1.00 26.31 ? 431 HOH B O   1 
HETATM 6198 O O   . HOH F 3 .   ? -13.494 -43.073 16.748 1.00 20.65 ? 432 HOH B O   1 
HETATM 6199 O O   . HOH F 3 .   ? -4.331  -5.158  5.737  1.00 25.29 ? 433 HOH B O   1 
HETATM 6200 O O   . HOH F 3 .   ? -20.186 -22.910 21.774 1.00 27.19 ? 434 HOH B O   1 
HETATM 6201 O O   . HOH F 3 .   ? -5.295  -40.675 16.222 1.00 21.60 ? 435 HOH B O   1 
HETATM 6202 O O   . HOH F 3 .   ? 0.191   -4.977  17.867 1.00 27.13 ? 436 HOH B O   1 
HETATM 6203 O O   . HOH F 3 .   ? 7.844   -39.811 10.215 1.00 22.84 ? 437 HOH B O   1 
HETATM 6204 O O   . HOH F 3 .   ? 7.640   -34.166 1.879  1.00 17.25 ? 438 HOH B O   1 
HETATM 6205 O O   . HOH F 3 .   ? -13.966 -36.110 36.560 1.00 21.28 ? 439 HOH B O   1 
HETATM 6206 O O   . HOH F 3 .   ? 13.818  -38.338 8.325  1.00 30.18 ? 440 HOH B O   1 
HETATM 6207 O O   . HOH F 3 .   ? -9.966  -6.181  34.542 1.00 25.14 ? 441 HOH B O   1 
HETATM 6208 O O   . HOH F 3 .   ? -13.083 -42.755 30.480 1.00 19.47 ? 442 HOH B O   1 
HETATM 6209 O O   . HOH F 3 .   ? -15.059 -31.031 47.235 1.00 33.15 ? 443 HOH B O   1 
HETATM 6210 O O   . HOH F 3 .   ? -19.942 -25.472 29.012 1.00 16.13 ? 444 HOH B O   1 
HETATM 6211 O O   . HOH F 3 .   ? 4.320   -19.396 14.318 1.00 16.66 ? 445 HOH B O   1 
HETATM 6212 O O   . HOH F 3 .   ? -6.422  -50.081 15.766 1.00 15.30 ? 446 HOH B O   1 
HETATM 6213 O O   . HOH F 3 .   ? -15.768 -35.367 22.085 1.00 28.46 ? 447 HOH B O   1 
HETATM 6214 O O   . HOH F 3 .   ? -2.741  1.902   36.638 1.00 14.65 ? 448 HOH B O   1 
HETATM 6215 O O   . HOH F 3 .   ? -1.277  -26.568 4.661  1.00 17.72 ? 449 HOH B O   1 
HETATM 6216 O O   . HOH F 3 .   ? -15.895 -7.800  38.434 1.00 47.34 ? 450 HOH B O   1 
HETATM 6217 O O   . HOH F 3 .   ? 0.226   -26.352 6.668  1.00 16.20 ? 451 HOH B O   1 
HETATM 6218 O O   . HOH F 3 .   ? -4.263  -45.298 21.490 1.00 20.69 ? 452 HOH B O   1 
HETATM 6219 O O   . HOH F 3 .   ? -13.978 -34.553 25.911 1.00 28.06 ? 453 HOH B O   1 
HETATM 6220 O O   . HOH F 3 .   ? 8.528   -37.648 17.789 1.00 36.75 ? 454 HOH B O   1 
HETATM 6221 O O   . HOH F 3 .   ? -5.105  -53.480 19.923 1.00 24.06 ? 455 HOH B O   1 
HETATM 6222 O O   . HOH F 3 .   ? 8.667   -27.833 -1.819 1.00 21.75 ? 456 HOH B O   1 
HETATM 6223 O O   . HOH F 3 .   ? -15.621 -23.336 6.586  1.00 29.90 ? 457 HOH B O   1 
HETATM 6224 O O   . HOH F 3 .   ? -14.545 -20.738 4.984  1.00 32.57 ? 458 HOH B O   1 
HETATM 6225 O O   . HOH F 3 .   ? -9.880  -29.263 9.536  1.00 33.28 ? 459 HOH B O   1 
HETATM 6226 O O   . HOH F 3 .   ? -10.838 -34.616 2.983  1.00 26.85 ? 460 HOH B O   1 
HETATM 6227 O O   . HOH F 3 .   ? -2.237  -36.942 2.273  1.00 33.79 ? 461 HOH B O   1 
HETATM 6228 O O   . HOH F 3 .   ? -1.502  -35.679 33.377 1.00 28.87 ? 462 HOH B O   1 
HETATM 6229 O O   . HOH F 3 .   ? -3.793  -15.058 45.223 1.00 25.92 ? 463 HOH B O   1 
HETATM 6230 O O   . HOH F 3 .   ? -13.550 -3.203  12.966 1.00 36.27 ? 464 HOH B O   1 
HETATM 6231 O O   . HOH F 3 .   ? 3.048   -34.606 46.425 1.00 39.25 ? 465 HOH B O   1 
HETATM 6232 O O   . HOH F 3 .   ? 1.115   -8.986  0.744  1.00 31.74 ? 466 HOH B O   1 
HETATM 6233 O O   . HOH F 3 .   ? -9.126  -31.397 7.009  1.00 24.41 ? 467 HOH B O   1 
HETATM 6234 O O   . HOH F 3 .   ? -16.324 -36.911 35.703 1.00 27.88 ? 468 HOH B O   1 
HETATM 6235 O O   . HOH F 3 .   ? -12.561 -48.469 14.019 1.00 17.43 ? 469 HOH B O   1 
HETATM 6236 O O   . HOH F 3 .   ? -14.395 -20.699 33.737 1.00 24.66 ? 470 HOH B O   1 
HETATM 6237 O O   . HOH F 3 .   ? -17.413 -13.514 33.429 1.00 22.26 ? 471 HOH B O   1 
HETATM 6238 O O   . HOH F 3 .   ? 2.537   -39.658 43.910 1.00 43.23 ? 472 HOH B O   1 
HETATM 6239 O O   . HOH F 3 .   ? -11.933 -34.125 6.922  1.00 40.10 ? 473 HOH B O   1 
HETATM 6240 O O   . HOH F 3 .   ? -13.496 -35.847 18.814 1.00 24.01 ? 474 HOH B O   1 
HETATM 6241 O O   . HOH F 3 .   ? 5.063   -40.380 24.829 1.00 27.09 ? 475 HOH B O   1 
HETATM 6242 O O   . HOH F 3 .   ? -9.268  -37.777 15.369 1.00 20.85 ? 476 HOH B O   1 
HETATM 6243 O O   . HOH F 3 .   ? -2.502  -33.704 34.740 1.00 27.80 ? 477 HOH B O   1 
HETATM 6244 O O   . HOH F 3 .   ? -17.665 -15.970 33.970 1.00 35.92 ? 478 HOH B O   1 
HETATM 6245 O O   . HOH F 3 .   ? -20.531 -34.450 18.672 1.00 28.48 ? 479 HOH B O   1 
HETATM 6246 O O   . HOH F 3 .   ? -3.160  -17.410 48.345 1.00 28.59 ? 480 HOH B O   1 
HETATM 6247 O O   . HOH F 3 .   ? -19.608 -14.959 22.094 1.00 34.52 ? 481 HOH B O   1 
HETATM 6248 O O   . HOH F 3 .   ? -10.489 -9.345  44.154 1.00 20.95 ? 482 HOH B O   1 
HETATM 6249 O O   . HOH F 3 .   ? -20.267 -28.570 9.081  1.00 18.35 ? 483 HOH B O   1 
HETATM 6250 O O   . HOH F 3 .   ? -20.680 -24.864 17.045 1.00 20.72 ? 484 HOH B O   1 
HETATM 6251 O O   . HOH F 3 .   ? -19.007 -41.013 16.664 1.00 29.76 ? 485 HOH B O   1 
HETATM 6252 O O   . HOH F 3 .   ? 9.012   -44.250 20.539 1.00 36.36 ? 486 HOH B O   1 
HETATM 6253 O O   . HOH F 3 .   ? 15.415  -45.356 8.422  1.00 26.12 ? 487 HOH B O   1 
HETATM 6254 O O   . HOH F 3 .   ? -19.983 -33.854 20.988 1.00 37.18 ? 488 HOH B O   1 
HETATM 6255 O O   . HOH F 3 .   ? -9.617  -26.021 10.751 1.00 25.72 ? 489 HOH B O   1 
HETATM 6256 O O   . HOH F 3 .   ? -7.665  -23.565 50.332 1.00 39.74 ? 490 HOH B O   1 
HETATM 6257 O O   . HOH F 3 .   ? -9.225  -21.347 45.740 1.00 33.19 ? 491 HOH B O   1 
HETATM 6258 O O   . HOH F 3 .   ? -14.656 -24.814 8.540  1.00 28.76 ? 492 HOH B O   1 
HETATM 6259 O O   . HOH F 3 .   ? 7.472   -35.945 15.809 1.00 29.76 ? 493 HOH B O   1 
HETATM 6260 O O   . HOH F 3 .   ? -4.926  -31.539 26.975 1.00 30.39 ? 494 HOH B O   1 
HETATM 6261 O O   . HOH F 3 .   ? -8.930  -23.830 12.065 1.00 21.82 ? 495 HOH B O   1 
HETATM 6262 O O   . HOH F 3 .   ? -8.839  -56.601 10.883 1.00 22.61 ? 496 HOH B O   1 
HETATM 6263 O O   . HOH F 3 .   ? -16.741 -26.769 7.194  1.00 43.67 ? 497 HOH B O   1 
HETATM 6264 O O   . HOH F 3 .   ? 12.539  -48.612 18.637 1.00 28.86 ? 498 HOH B O   1 
HETATM 6265 O O   . HOH F 3 .   ? 4.821   -28.872 4.700  1.00 19.56 ? 499 HOH B O   1 
HETATM 6266 O O   . HOH F 3 .   ? 4.683   -32.298 13.792 1.00 20.60 ? 500 HOH B O   1 
HETATM 6267 O O   . HOH F 3 .   ? -3.265  -23.366 49.599 1.00 28.31 ? 501 HOH B O   1 
HETATM 6268 O O   . HOH F 3 .   ? 4.543   -17.186 43.039 1.00 32.29 ? 502 HOH B O   1 
HETATM 6269 O O   . HOH F 3 .   ? -13.126 -28.403 21.999 1.00 21.46 ? 503 HOH B O   1 
HETATM 6270 O O   . HOH F 3 .   ? -2.304  -11.306 24.524 1.00 35.93 ? 504 HOH B O   1 
HETATM 6271 O O   . HOH F 3 .   ? -22.057 -27.783 17.673 1.00 30.45 ? 505 HOH B O   1 
HETATM 6272 O O   . HOH F 3 .   ? -22.140 -28.719 15.070 1.00 16.84 ? 506 HOH B O   1 
HETATM 6273 O O   . HOH F 3 .   ? -1.460  -29.156 4.303  1.00 19.59 ? 507 HOH B O   1 
HETATM 6274 O O   . HOH F 3 .   ? 5.971   -2.395  18.799 1.00 29.53 ? 508 HOH B O   1 
HETATM 6275 O O   . HOH F 3 .   ? -15.961 -41.906 39.884 1.00 19.64 ? 509 HOH B O   1 
HETATM 6276 O O   . HOH F 3 .   ? 0.293   -11.873 25.665 1.00 39.96 ? 510 HOH B O   1 
HETATM 6277 O O   . HOH F 3 .   ? -9.903  -26.662 48.341 1.00 31.25 ? 511 HOH B O   1 
HETATM 6278 O O   . HOH F 3 .   ? 1.592   -53.503 17.139 1.00 23.91 ? 512 HOH B O   1 
HETATM 6279 O O   . HOH F 3 .   ? -6.536  -24.053 9.851  1.00 31.57 ? 513 HOH B O   1 
HETATM 6280 O O   . HOH F 3 .   ? -2.087  0.665   11.571 1.00 29.59 ? 514 HOH B O   1 
HETATM 6281 O O   . HOH F 3 .   ? -7.304  -43.732 40.520 1.00 32.75 ? 515 HOH B O   1 
HETATM 6282 O O   . HOH F 3 .   ? -7.911  -51.289 26.709 1.00 44.75 ? 516 HOH B O   1 
HETATM 6283 O O   . HOH F 3 .   ? -4.328  -42.646 22.052 1.00 20.55 ? 517 HOH B O   1 
HETATM 6284 O O   . HOH F 3 .   ? -15.401 -26.879 23.114 1.00 17.55 ? 518 HOH B O   1 
HETATM 6285 O O   . HOH F 3 .   ? 2.074   -29.637 4.130  1.00 19.87 ? 519 HOH B O   1 
HETATM 6286 O O   . HOH F 3 .   ? 7.562   -31.467 -1.099 1.00 30.64 ? 520 HOH B O   1 
HETATM 6287 O O   . HOH F 3 .   ? 9.761   -35.887 13.267 1.00 30.06 ? 521 HOH B O   1 
HETATM 6288 O O   . HOH F 3 .   ? -20.928 -18.174 24.519 1.00 46.38 ? 522 HOH B O   1 
HETATM 6289 O O   . HOH F 3 .   ? 4.297   -36.029 2.242  1.00 22.35 ? 523 HOH B O   1 
HETATM 6290 O O   . HOH F 3 .   ? -0.990  -33.528 3.721  1.00 30.74 ? 524 HOH B O   1 
HETATM 6291 O O   . HOH F 3 .   ? 10.246  -45.127 18.040 1.00 49.11 ? 525 HOH B O   1 
HETATM 6292 O O   . HOH F 3 .   ? 15.253  -22.898 2.473  1.00 22.81 ? 526 HOH B O   1 
HETATM 6293 O O   . HOH F 3 .   ? -13.669 -48.443 31.358 1.00 23.53 ? 527 HOH B O   1 
HETATM 6294 O O   . HOH F 3 .   ? -22.086 -41.422 13.669 1.00 44.83 ? 528 HOH B O   1 
HETATM 6295 O O   . HOH F 3 .   ? -13.633 -3.568  28.301 1.00 36.17 ? 529 HOH B O   1 
HETATM 6296 O O   . HOH F 3 .   ? 7.748   -32.043 14.627 1.00 31.97 ? 530 HOH B O   1 
HETATM 6297 O O   . HOH F 3 .   ? -10.351 -26.619 8.288  1.00 32.23 ? 531 HOH B O   1 
HETATM 6298 O O   . HOH F 3 .   ? -8.990  -55.337 5.055  1.00 27.66 ? 532 HOH B O   1 
HETATM 6299 O O   . HOH F 3 .   ? -3.294  -62.312 22.449 1.00 42.34 ? 533 HOH B O   1 
HETATM 6300 O O   . HOH F 3 .   ? -5.410  -46.975 22.854 1.00 20.50 ? 534 HOH B O   1 
HETATM 6301 O O   . HOH F 3 .   ? 13.653  -37.747 10.848 1.00 52.26 ? 535 HOH B O   1 
HETATM 6302 O O   . HOH F 3 .   ? 13.833  -27.131 3.722  1.00 22.82 ? 536 HOH B O   1 
HETATM 6303 O O   . HOH F 3 .   ? 3.927   -34.190 18.490 1.00 21.18 ? 537 HOH B O   1 
HETATM 6304 O O   . HOH F 3 .   ? -7.030  -40.300 46.920 1.00 39.95 ? 538 HOH B O   1 
HETATM 6305 O O   . HOH F 3 .   ? -13.115 -51.489 8.100  1.00 25.72 ? 539 HOH B O   1 
HETATM 6306 O O   . HOH F 3 .   ? 0.725   -29.171 1.942  1.00 28.68 ? 540 HOH B O   1 
HETATM 6307 O O   . HOH F 3 .   ? 14.105  -37.824 0.266  1.00 43.29 ? 541 HOH B O   1 
HETATM 6308 O O   . HOH F 3 .   ? 17.663  -45.554 14.490 1.00 31.35 ? 542 HOH B O   1 
HETATM 6309 O O   . HOH F 3 .   ? 11.203  -52.879 19.056 1.00 23.35 ? 543 HOH B O   1 
HETATM 6310 O O   . HOH F 3 .   ? 7.313   -15.958 43.787 1.00 25.40 ? 544 HOH B O   1 
HETATM 6311 O O   . HOH F 3 .   ? 2.296   -54.726 24.768 1.00 38.34 ? 545 HOH B O   1 
HETATM 6312 O O   . HOH F 3 .   ? -20.976 -23.044 15.317 1.00 28.76 ? 546 HOH B O   1 
HETATM 6313 O O   . HOH F 3 .   ? -11.835 -43.210 35.081 1.00 27.42 ? 547 HOH B O   1 
HETATM 6314 O O   . HOH F 3 .   ? -0.064  -27.026 -0.058 0.50 17.97 ? 548 HOH B O   1 
HETATM 6315 O O   . HOH F 3 .   ? -17.233 -20.206 33.707 1.00 22.92 ? 549 HOH B O   1 
HETATM 6316 O O   . HOH F 3 .   ? -8.791  -46.510 43.102 1.00 47.90 ? 550 HOH B O   1 
HETATM 6317 O O   . HOH F 3 .   ? -9.372  -56.659 2.761  1.00 37.05 ? 551 HOH B O   1 
HETATM 6318 O O   . HOH F 3 .   ? 16.762  -21.602 0.685  1.00 28.53 ? 552 HOH B O   1 
HETATM 6319 O O   . HOH F 3 .   ? -15.948 -9.278  22.539 1.00 32.72 ? 553 HOH B O   1 
HETATM 6320 O O   . HOH F 3 .   ? -4.437  -61.065 7.101  1.00 26.06 ? 554 HOH B O   1 
HETATM 6321 O O   . HOH F 3 .   ? -22.522 -25.570 25.053 1.00 40.17 ? 555 HOH B O   1 
HETATM 6322 O O   . HOH F 3 .   ? -15.077 -8.649  25.223 1.00 34.41 ? 556 HOH B O   1 
HETATM 6323 O O   . HOH F 3 .   ? -20.194 -13.380 28.239 1.00 26.92 ? 557 HOH B O   1 
HETATM 6324 O O   . HOH F 3 .   ? -22.461 -35.597 16.555 1.00 53.44 ? 558 HOH B O   1 
HETATM 6325 O O   . HOH F 3 .   ? -16.359 -25.184 50.663 1.00 30.28 ? 559 HOH B O   1 
HETATM 6326 O O   . HOH F 3 .   ? -13.090 -1.220  15.929 1.00 31.54 ? 560 HOH B O   1 
HETATM 6327 O O   . HOH F 3 .   ? 16.429  -23.715 4.943  1.00 26.13 ? 561 HOH B O   1 
HETATM 6328 O O   . HOH F 3 .   ? -14.131 -37.172 4.613  1.00 33.79 ? 562 HOH B O   1 
HETATM 6329 O O   . HOH F 3 .   ? 6.127   -22.695 30.727 1.00 29.26 ? 563 HOH B O   1 
HETATM 6330 O O   . HOH F 3 .   ? -14.571 -42.735 35.412 1.00 28.27 ? 564 HOH B O   1 
HETATM 6331 O O   . HOH F 3 .   ? 9.074   -19.089 45.211 1.00 41.93 ? 565 HOH B O   1 
HETATM 6332 O O   . HOH F 3 .   ? -11.528 -34.432 -0.715 1.00 33.51 ? 566 HOH B O   1 
HETATM 6333 O O   . HOH F 3 .   ? 15.503  -37.785 17.514 1.00 38.78 ? 567 HOH B O   1 
HETATM 6334 O O   . HOH F 3 .   ? 19.554  -21.039 0.407  1.00 37.26 ? 568 HOH B O   1 
HETATM 6335 O O   . HOH F 3 .   ? -17.524 -7.901  26.485 1.00 34.12 ? 569 HOH B O   1 
HETATM 6336 O O   . HOH F 3 .   ? 16.837  -51.489 11.133 1.00 54.20 ? 570 HOH B O   1 
HETATM 6337 O O   . HOH F 3 .   ? 18.506  -53.764 10.447 1.00 61.34 ? 571 HOH B O   1 
HETATM 6338 O O   . HOH F 3 .   ? -4.948  -26.589 18.693 1.00 22.49 ? 572 HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   3   ?   ?   ?   A . n 
A 1 2   SER 2   4   ?   ?   ?   A . n 
A 1 3   GLY 3   5   ?   ?   ?   A . n 
A 1 4   ARG 4   6   ?   ?   ?   A . n 
A 1 5   ARG 5   7   7   ARG ARG A . n 
A 1 6   GLU 6   8   8   GLU GLU A . n 
A 1 7   LEU 7   9   9   LEU LEU A . n 
A 1 8   CYS 8   10  10  CYS CYS A . n 
A 1 9   THR 9   11  11  THR THR A . n 
A 1 10  PRO 10  12  12  PRO PRO A . n 
A 1 11  LEU 11  13  13  LEU LEU A . n 
A 1 12  ARG 12  14  14  ARG ARG A . n 
A 1 13  THR 13  15  15  THR THR A . n 
A 1 14  ILE 14  16  16  ILE ILE A . n 
A 1 15  MET 15  17  17  MET MET A . n 
A 1 16  THR 16  18  18  THR THR A . n 
A 1 17  PRO 17  19  19  PRO PRO A . n 
A 1 18  GLY 18  20  20  GLY GLY A . n 
A 1 19  PRO 19  21  21  PRO PRO A . n 
A 1 20  VAL 20  22  22  VAL VAL A . n 
A 1 21  GLU 21  23  23  GLU GLU A . n 
A 1 22  VAL 22  24  24  VAL VAL A . n 
A 1 23  ASP 23  25  25  ASP ASP A . n 
A 1 24  PRO 24  26  26  PRO PRO A . n 
A 1 25  ARG 25  27  27  ARG ARG A . n 
A 1 26  VAL 26  28  28  VAL VAL A . n 
A 1 27  LEU 27  29  29  LEU LEU A . n 
A 1 28  ARG 28  30  30  ARG ARG A . n 
A 1 29  VAL 29  31  31  VAL VAL A . n 
A 1 30  MET 30  32  32  MET MET A . n 
A 1 31  SER 31  33  33  SER SER A . n 
A 1 32  THR 32  34  34  THR THR A . n 
A 1 33  PRO 33  35  35  PRO PRO A . n 
A 1 34  VAL 34  36  36  VAL VAL A . n 
A 1 35  VAL 35  37  37  VAL VAL A . n 
A 1 36  GLY 36  38  38  GLY GLY A . n 
A 1 37  GLN 37  39  39  GLN GLN A . n 
A 1 38  PHE 38  40  40  PHE PHE A . n 
A 1 39  ASP 39  41  41  ASP ASP A . n 
A 1 40  PRO 40  42  42  PRO PRO A . n 
A 1 41  ALA 41  43  43  ALA ALA A . n 
A 1 42  PHE 42  44  44  PHE PHE A . n 
A 1 43  THR 43  45  45  THR THR A . n 
A 1 44  GLY 44  46  46  GLY GLY A . n 
A 1 45  ILE 45  47  47  ILE ILE A . n 
A 1 46  MET 46  48  48  MET MET A . n 
A 1 47  ASN 47  49  49  ASN ASN A . n 
A 1 48  GLU 48  50  50  GLU GLU A . n 
A 1 49  THR 49  51  51  THR THR A . n 
A 1 50  MET 50  52  52  MET MET A . n 
A 1 51  GLU 51  53  53  GLU GLU A . n 
A 1 52  MET 52  54  54  MET MET A . n 
A 1 53  LEU 53  55  55  LEU LEU A . n 
A 1 54  ARG 54  56  56  ARG ARG A . n 
A 1 55  GLU 55  57  57  GLU GLU A . n 
A 1 56  LEU 56  58  58  LEU LEU A . n 
A 1 57  PHE 57  59  59  PHE PHE A . n 
A 1 58  GLN 58  60  60  GLN GLN A . n 
A 1 59  THR 59  61  61  THR THR A . n 
A 1 60  LYS 60  62  62  LYS LYS A . n 
A 1 61  ASN 61  63  63  ASN ASN A . n 
A 1 62  ARG 62  64  64  ARG ARG A . n 
A 1 63  TRP 63  65  65  TRP TRP A . n 
A 1 64  ALA 64  66  66  ALA ALA A . n 
A 1 65  TYR 65  67  67  TYR TYR A . n 
A 1 66  PRO 66  68  68  PRO PRO A . n 
A 1 67  ILE 67  69  69  ILE ILE A . n 
A 1 68  ASP 68  70  70  ASP ASP A . n 
A 1 69  GLY 69  71  71  GLY GLY A . n 
A 1 70  THR 70  72  72  THR THR A . n 
A 1 71  SER 71  73  73  SER SER A . n 
A 1 72  ARG 72  74  74  ARG ARG A . n 
A 1 73  ALA 73  75  75  ALA ALA A . n 
A 1 74  GLY 74  76  76  GLY GLY A . n 
A 1 75  ILE 75  77  77  ILE ILE A . n 
A 1 76  GLU 76  78  78  GLU GLU A . n 
A 1 77  ALA 77  79  79  ALA ALA A . n 
A 1 78  VAL 78  80  80  VAL VAL A . n 
A 1 79  LEU 79  81  81  LEU LEU A . n 
A 1 80  ALA 80  82  82  ALA ALA A . n 
A 1 81  SER 81  83  83  SER SER A . n 
A 1 82  VAL 82  84  84  VAL VAL A . n 
A 1 83  ILE 83  85  85  ILE ILE A . n 
A 1 84  GLU 84  86  86  GLU GLU A . n 
A 1 85  PRO 85  87  87  PRO PRO A . n 
A 1 86  GLU 86  88  88  GLU GLU A . n 
A 1 87  ASP 87  89  89  ASP ASP A . n 
A 1 88  ASP 88  90  90  ASP ASP A . n 
A 1 89  VAL 89  91  91  VAL VAL A . n 
A 1 90  LEU 90  92  92  LEU LEU A . n 
A 1 91  ILE 91  93  93  ILE ILE A . n 
A 1 92  PRO 92  94  94  PRO PRO A . n 
A 1 93  ILE 93  95  95  ILE ILE A . n 
A 1 94  TYR 94  96  96  TYR TYR A . n 
A 1 95  GLY 95  97  97  GLY GLY A . n 
A 1 96  ARG 96  98  98  ARG ARG A . n 
A 1 97  PHE 97  99  99  PHE PHE A . n 
A 1 98  GLY 98  100 100 GLY GLY A . n 
A 1 99  TYR 99  101 101 TYR TYR A . n 
A 1 100 LEU 100 102 102 LEU LEU A . n 
A 1 101 LEU 101 103 103 LEU LEU A . n 
A 1 102 THR 102 104 104 THR THR A . n 
A 1 103 GLU 103 105 105 GLU GLU A . n 
A 1 104 ILE 104 106 106 ILE ILE A . n 
A 1 105 ALA 105 107 107 ALA ALA A . n 
A 1 106 GLU 106 108 108 GLU GLU A . n 
A 1 107 ARG 107 109 109 ARG ARG A . n 
A 1 108 TYR 108 110 110 TYR TYR A . n 
A 1 109 GLY 109 111 111 GLY GLY A . n 
A 1 110 ALA 110 112 112 ALA ALA A . n 
A 1 111 ASN 111 113 113 ASN ASN A . n 
A 1 112 VAL 112 114 114 VAL VAL A . n 
A 1 113 HIS 113 115 115 HIS HIS A . n 
A 1 114 MET 114 116 116 MET MET A . n 
A 1 115 LEU 115 117 117 LEU LEU A . n 
A 1 116 GLU 116 118 118 GLU GLU A . n 
A 1 117 CYS 117 119 119 CYS CYS A . n 
A 1 118 GLU 118 120 120 GLU GLU A . n 
A 1 119 TRP 119 121 121 TRP TRP A . n 
A 1 120 GLY 120 122 122 GLY GLY A . n 
A 1 121 THR 121 123 123 THR THR A . n 
A 1 122 VAL 122 124 124 VAL VAL A . n 
A 1 123 PHE 123 125 125 PHE PHE A . n 
A 1 124 ASP 124 126 126 ASP ASP A . n 
A 1 125 PRO 125 127 127 PRO PRO A . n 
A 1 126 GLU 126 128 128 GLU GLU A . n 
A 1 127 ASP 127 129 129 ASP ASP A . n 
A 1 128 ILE 128 130 130 ILE ILE A . n 
A 1 129 ILE 129 131 131 ILE ILE A . n 
A 1 130 ARG 130 132 132 ARG ARG A . n 
A 1 131 GLU 131 133 133 GLU GLU A . n 
A 1 132 ILE 132 134 134 ILE ILE A . n 
A 1 133 LYS 133 135 135 LYS LYS A . n 
A 1 134 LYS 134 136 136 LYS LYS A . n 
A 1 135 VAL 135 137 137 VAL VAL A . n 
A 1 136 LYS 136 138 138 LYS LYS A . n 
A 1 137 PRO 137 139 139 PRO PRO A . n 
A 1 138 LYS 138 140 140 LYS LYS A . n 
A 1 139 ILE 139 141 141 ILE ILE A . n 
A 1 140 VAL 140 142 142 VAL VAL A . n 
A 1 141 ALA 141 143 143 ALA ALA A . n 
A 1 142 MET 142 144 144 MET MET A . n 
A 1 143 VAL 143 145 145 VAL VAL A . n 
A 1 144 HIS 144 146 146 HIS HIS A . n 
A 1 145 GLY 145 147 147 GLY GLY A . n 
A 1 146 GLU 146 148 148 GLU GLU A . n 
A 1 147 THR 147 149 149 THR THR A . n 
A 1 148 SER 148 150 150 SER SER A . n 
A 1 149 THR 149 151 151 THR THR A . n 
A 1 150 GLY 150 152 152 GLY GLY A . n 
A 1 151 ARG 151 153 153 ARG ARG A . n 
A 1 152 ILE 152 154 154 ILE ILE A . n 
A 1 153 HIS 153 155 155 HIS HIS A . n 
A 1 154 PRO 154 156 156 PRO PRO A . n 
A 1 155 LEU 155 157 157 LEU LEU A . n 
A 1 156 LYS 156 158 158 LYS LYS A . n 
A 1 157 ALA 157 159 159 ALA ALA A . n 
A 1 158 ILE 158 160 160 ILE ILE A . n 
A 1 159 GLY 159 161 161 GLY GLY A . n 
A 1 160 GLU 160 162 162 GLU GLU A . n 
A 1 161 ALA 161 163 163 ALA ALA A . n 
A 1 162 CYS 162 164 164 CYS CYS A . n 
A 1 163 ARG 163 165 165 ARG ARG A . n 
A 1 164 THR 164 166 166 THR THR A . n 
A 1 165 GLU 165 167 167 GLU GLU A . n 
A 1 166 ASP 166 168 168 ASP ASP A . n 
A 1 167 ALA 167 169 169 ALA ALA A . n 
A 1 168 LEU 168 170 170 LEU LEU A . n 
A 1 169 PHE 169 171 171 PHE PHE A . n 
A 1 170 ILE 170 172 172 ILE ILE A . n 
A 1 171 VAL 171 173 173 VAL VAL A . n 
A 1 172 ASP 172 174 174 ASP ASP A . n 
A 1 173 ALA 173 175 175 ALA ALA A . n 
A 1 174 VAL 174 176 176 VAL VAL A . n 
A 1 175 ALA 175 177 177 ALA ALA A . n 
A 1 176 THR 176 178 178 THR THR A . n 
A 1 177 ILE 177 179 179 ILE ILE A . n 
A 1 178 GLY 178 180 180 GLY GLY A . n 
A 1 179 GLY 179 181 181 GLY GLY A . n 
A 1 180 CYS 180 182 182 CYS CYS A . n 
A 1 181 GLU 181 183 183 GLU GLU A . n 
A 1 182 VAL 182 184 184 VAL VAL A . n 
A 1 183 LYS 183 185 185 LYS LYS A . n 
A 1 184 VAL 184 186 186 VAL VAL A . n 
A 1 185 ASP 185 187 187 ASP ASP A . n 
A 1 186 GLU 186 188 188 GLU GLU A . n 
A 1 187 TRP 187 189 189 TRP TRP A . n 
A 1 188 LYS 188 190 190 LYS LYS A . n 
A 1 189 ILE 189 191 191 ILE ILE A . n 
A 1 190 ASP 190 192 192 ASP ASP A . n 
A 1 191 ALA 191 193 193 ALA ALA A . n 
A 1 192 ALA 192 194 194 ALA ALA A . n 
A 1 193 ILE 193 195 195 ILE ILE A . n 
A 1 194 GLY 194 196 196 GLY GLY A . n 
A 1 195 GLY 195 197 197 GLY GLY A . n 
A 1 196 THR 196 198 198 THR THR A . n 
A 1 197 GLN 197 199 199 GLN GLN A . n 
A 1 198 LYS 198 200 200 LYS LYS A . n 
A 1 199 CYS 199 201 201 CYS CYS A . n 
A 1 200 LEU 200 202 202 LEU LEU A . n 
A 1 201 SER 201 203 203 SER SER A . n 
A 1 202 VAL 202 204 204 VAL VAL A . n 
A 1 203 PRO 203 205 205 PRO PRO A . n 
A 1 204 SER 204 206 206 SER SER A . n 
A 1 205 GLY 205 207 207 GLY GLY A . n 
A 1 206 MET 206 208 208 MET MET A . n 
A 1 207 ALA 207 209 209 ALA ALA A . n 
A 1 208 PRO 208 210 210 PRO PRO A . n 
A 1 209 ILE 209 211 211 ILE ILE A . n 
A 1 210 THR 210 212 212 THR THR A . n 
A 1 211 TYR 211 213 213 TYR TYR A . n 
A 1 212 ASN 212 214 214 ASN ASN A . n 
A 1 213 GLU 213 215 215 GLU GLU A . n 
A 1 214 ARG 214 216 216 ARG ARG A . n 
A 1 215 VAL 215 217 217 VAL VAL A . n 
A 1 216 ALA 216 218 218 ALA ALA A . n 
A 1 217 ASP 217 219 219 ASP ASP A . n 
A 1 218 VAL 218 220 220 VAL VAL A . n 
A 1 219 ILE 219 221 221 ILE ILE A . n 
A 1 220 ALA 220 222 222 ALA ALA A . n 
A 1 221 ALA 221 223 223 ALA ALA A . n 
A 1 222 ARG 222 224 224 ARG ARG A . n 
A 1 223 LYS 223 225 ?   ?   ?   A . n 
A 1 224 LYS 224 226 ?   ?   ?   A . n 
A 1 225 VAL 225 227 ?   ?   ?   A . n 
A 1 226 GLU 226 228 ?   ?   ?   A . n 
A 1 227 ARG 227 229 ?   ?   ?   A . n 
A 1 228 GLY 228 230 ?   ?   ?   A . n 
A 1 229 ILE 229 231 ?   ?   ?   A . n 
A 1 230 ALA 230 232 ?   ?   ?   A . n 
A 1 231 THR 231 233 ?   ?   ?   A . n 
A 1 232 GLN 232 234 ?   ?   ?   A . n 
A 1 233 ALA 233 235 ?   ?   ?   A . n 
A 1 234 ASP 234 236 ?   ?   ?   A . n 
A 1 235 ARG 235 237 ?   ?   ?   A . n 
A 1 236 ALA 236 238 ?   ?   ?   A . n 
A 1 237 ALA 237 239 ?   ?   ?   A . n 
A 1 238 LEU 238 240 ?   ?   ?   A . n 
A 1 239 SER 239 241 ?   ?   ?   A . n 
A 1 240 GLY 240 242 ?   ?   ?   A . n 
A 1 241 ASN 241 243 243 ASN ASN A . n 
A 1 242 ARG 242 244 244 ARG ARG A . n 
A 1 243 PRO 243 245 245 PRO PRO A . n 
A 1 244 ILE 244 246 246 ILE ILE A . n 
A 1 245 THR 245 247 247 THR THR A . n 
A 1 246 SER 246 248 248 SER SER A . n 
A 1 247 ASN 247 249 249 ASN ASN A . n 
A 1 248 TYR 248 250 250 TYR TYR A . n 
A 1 249 PHE 249 251 251 PHE PHE A . n 
A 1 250 ASP 250 252 252 ASP ASP A . n 
A 1 251 LEU 251 253 253 LEU LEU A . n 
A 1 252 SER 252 254 254 SER SER A . n 
A 1 253 GLN 253 255 255 GLN GLN A . n 
A 1 254 LEU 254 256 256 LEU LEU A . n 
A 1 255 GLU 255 257 257 GLU GLU A . n 
A 1 256 ASP 256 258 258 ASP ASP A . n 
A 1 257 TYR 257 259 259 TYR TYR A . n 
A 1 258 TRP 258 260 260 TRP TRP A . n 
A 1 259 SER 259 261 261 SER SER A . n 
A 1 260 GLU 260 262 262 GLU GLU A . n 
A 1 261 ARG 261 263 263 ARG ARG A . n 
A 1 262 ARG 262 264 264 ARG ARG A . n 
A 1 263 LEU 263 265 265 LEU LEU A . n 
A 1 264 ASN 264 266 266 ASN ASN A . n 
A 1 265 HIS 265 267 267 HIS HIS A . n 
A 1 266 HIS 266 268 268 HIS HIS A . n 
A 1 267 THR 267 269 269 THR THR A . n 
A 1 268 GLU 268 270 270 GLU GLU A . n 
A 1 269 ALA 269 271 271 ALA ALA A . n 
A 1 270 THR 270 272 272 THR THR A . n 
A 1 271 THR 271 273 273 THR THR A . n 
A 1 272 MET 272 274 274 MET MET A . n 
A 1 273 LEU 273 275 275 LEU LEU A . n 
A 1 274 TYR 274 276 276 TYR TYR A . n 
A 1 275 ALA 275 277 277 ALA ALA A . n 
A 1 276 LEU 276 278 278 LEU LEU A . n 
A 1 277 ARG 277 279 279 ARG ARG A . n 
A 1 278 GLU 278 280 280 GLU GLU A . n 
A 1 279 GLY 279 281 281 GLY GLY A . n 
A 1 280 VAL 280 282 282 VAL VAL A . n 
A 1 281 ARG 281 283 283 ARG ARG A . n 
A 1 282 LEU 282 284 284 LEU LEU A . n 
A 1 283 VAL 283 285 285 VAL VAL A . n 
A 1 284 LEU 284 286 286 LEU LEU A . n 
A 1 285 GLU 285 287 287 GLU GLU A . n 
A 1 286 GLU 286 288 288 GLU GLU A . n 
A 1 287 GLY 287 289 289 GLY GLY A . n 
A 1 288 LEU 288 290 290 LEU LEU A . n 
A 1 289 GLU 289 291 291 GLU GLU A . n 
A 1 290 THR 290 292 292 THR THR A . n 
A 1 291 ARG 291 293 293 ARG ARG A . n 
A 1 292 PHE 292 294 294 PHE PHE A . n 
A 1 293 GLU 293 295 295 GLU GLU A . n 
A 1 294 ARG 294 296 296 ARG ARG A . n 
A 1 295 HIS 295 297 297 HIS HIS A . n 
A 1 296 ARG 296 298 298 ARG ARG A . n 
A 1 297 HIS 297 299 299 HIS HIS A . n 
A 1 298 HIS 298 300 300 HIS HIS A . n 
A 1 299 GLU 299 301 301 GLU GLU A . n 
A 1 300 ALA 300 302 302 ALA ALA A . n 
A 1 301 ALA 301 303 303 ALA ALA A . n 
A 1 302 LEU 302 304 304 LEU LEU A . n 
A 1 303 ALA 303 305 305 ALA ALA A . n 
A 1 304 ALA 304 306 306 ALA ALA A . n 
A 1 305 GLY 305 307 307 GLY GLY A . n 
A 1 306 ILE 306 308 308 ILE ILE A . n 
A 1 307 LYS 307 309 309 LYS LYS A . n 
A 1 308 ALA 308 310 310 ALA ALA A . n 
A 1 309 MET 309 311 311 MET MET A . n 
A 1 310 GLY 310 312 312 GLY GLY A . n 
A 1 311 LEU 311 313 313 LEU LEU A . n 
A 1 312 ARG 312 314 314 ARG ARG A . n 
A 1 313 LEU 313 315 315 LEU LEU A . n 
A 1 314 PHE 314 316 316 PHE PHE A . n 
A 1 315 GLY 315 317 317 GLY GLY A . n 
A 1 316 ASP 316 318 318 ASP ASP A . n 
A 1 317 ASP 317 319 319 ASP ASP A . n 
A 1 318 SER 318 320 320 SER SER A . n 
A 1 319 CYS 319 321 321 CYS CYS A . n 
A 1 320 LYS 320 322 322 LYS LYS A . n 
A 1 321 MET 321 323 323 MET MET A . n 
A 1 322 PRO 322 324 324 PRO PRO A . n 
A 1 323 VAL 323 325 325 VAL VAL A . n 
A 1 324 VAL 324 326 326 VAL VAL A . n 
A 1 325 THR 325 327 327 THR THR A . n 
A 1 326 CYS 326 328 328 CYS CYS A . n 
A 1 327 VAL 327 329 329 VAL VAL A . n 
A 1 328 GLU 328 330 330 GLU GLU A . n 
A 1 329 ILE 329 331 331 ILE ILE A . n 
A 1 330 PRO 330 332 332 PRO PRO A . n 
A 1 331 GLY 331 333 333 GLY GLY A . n 
A 1 332 GLY 332 334 334 GLY GLY A . n 
A 1 333 ILE 333 335 335 ILE ILE A . n 
A 1 334 ASP 334 336 336 ASP ASP A . n 
A 1 335 GLY 335 337 337 GLY GLY A . n 
A 1 336 GLU 336 338 338 GLU GLU A . n 
A 1 337 SER 337 339 339 SER SER A . n 
A 1 338 VAL 338 340 340 VAL VAL A . n 
A 1 339 ARG 339 341 341 ARG ARG A . n 
A 1 340 ASP 340 342 342 ASP ASP A . n 
A 1 341 MET 341 343 343 MET MET A . n 
A 1 342 LEU 342 344 344 LEU LEU A . n 
A 1 343 LEU 343 345 345 LEU LEU A . n 
A 1 344 ALA 344 346 346 ALA ALA A . n 
A 1 345 GLN 345 347 347 GLN GLN A . n 
A 1 346 PHE 346 348 348 PHE PHE A . n 
A 1 347 GLY 347 349 349 GLY GLY A . n 
A 1 348 ILE 348 350 350 ILE ILE A . n 
A 1 349 GLU 349 351 351 GLU GLU A . n 
A 1 350 ILE 350 352 352 ILE ILE A . n 
A 1 351 ALA 351 353 353 ALA ALA A . n 
A 1 352 SER 352 354 354 SER SER A . n 
A 1 353 SER 353 355 355 SER SER A . n 
A 1 354 PHE 354 356 356 PHE PHE A . n 
A 1 355 GLY 355 357 357 GLY GLY A . n 
A 1 356 PRO 356 358 358 PRO PRO A . n 
A 1 357 LEU 357 359 359 LEU LEU A . n 
A 1 358 ALA 358 360 360 ALA ALA A . n 
A 1 359 GLY 359 361 361 GLY GLY A . n 
A 1 360 LYS 360 362 362 LYS LYS A . n 
A 1 361 ILE 361 363 363 ILE ILE A . n 
A 1 362 TRP 362 364 364 TRP TRP A . n 
A 1 363 ARG 363 365 365 ARG ARG A . n 
A 1 364 ILE 364 366 366 ILE ILE A . n 
A 1 365 GLY 365 367 367 GLY GLY A . n 
A 1 366 THR 366 368 368 THR THR A . n 
A 1 367 MET 367 369 369 MET MET A . n 
A 1 368 GLY 368 370 370 GLY GLY A . n 
A 1 369 TYR 369 371 371 TYR TYR A . n 
A 1 370 SER 370 372 372 SER SER A . n 
A 1 371 CYS 371 373 373 CYS CYS A . n 
A 1 372 ARG 372 374 374 ARG ARG A . n 
A 1 373 LYS 373 375 375 LYS LYS A . n 
A 1 374 GLU 374 376 376 GLU GLU A . n 
A 1 375 ASN 375 377 377 ASN ASN A . n 
A 1 376 VAL 376 378 378 VAL VAL A . n 
A 1 377 LEU 377 379 379 LEU LEU A . n 
A 1 378 PHE 378 380 380 PHE PHE A . n 
A 1 379 VAL 379 381 381 VAL VAL A . n 
A 1 380 LEU 380 382 382 LEU LEU A . n 
A 1 381 ALA 381 383 383 ALA ALA A . n 
A 1 382 GLY 382 384 384 GLY GLY A . n 
A 1 383 LEU 383 385 385 LEU LEU A . n 
A 1 384 GLU 384 386 386 GLU GLU A . n 
A 1 385 ALA 385 387 387 ALA ALA A . n 
A 1 386 VAL 386 388 388 VAL VAL A . n 
A 1 387 LEU 387 389 389 LEU LEU A . n 
A 1 388 LEU 388 390 390 LEU LEU A . n 
A 1 389 ARG 389 391 391 ARG ARG A . n 
A 1 390 HIS 390 392 392 HIS HIS A . n 
A 1 391 ASN 391 393 393 ASN ASN A . n 
A 1 392 ALA 392 394 394 ALA ALA A . n 
A 1 393 GLY 393 395 395 GLY GLY A . n 
A 1 394 ILE 394 396 396 ILE ILE A . n 
A 1 395 GLU 395 397 397 GLU GLU A . n 
A 1 396 ALA 396 398 398 ALA ALA A . n 
A 1 397 GLY 397 399 399 GLY GLY A . n 
A 1 398 LYS 398 400 400 LYS LYS A . n 
A 1 399 ALA 399 401 401 ALA ALA A . n 
A 1 400 LEU 400 402 402 LEU LEU A . n 
A 1 401 GLN 401 403 403 GLN GLN A . n 
A 1 402 ALA 402 404 404 ALA ALA A . n 
A 1 403 ALA 403 405 405 ALA ALA A . n 
A 1 404 LEU 404 406 406 LEU LEU A . n 
A 1 405 ASP 405 407 407 ASP ASP A . n 
A 1 406 VAL 406 408 408 VAL VAL A . n 
A 1 407 TYR 407 409 409 TYR TYR A . n 
A 1 408 GLU 408 410 410 GLU GLU A . n 
A 1 409 ASN 409 411 411 ASN ASN A . n 
A 1 410 ALA 410 412 ?   ?   ?   A . n 
A 1 411 GLY 411 413 ?   ?   ?   A . n 
A 1 412 ARG 412 414 ?   ?   ?   A . n 
A 1 413 GLN 413 415 ?   ?   ?   A . n 
A 1 414 ALA 414 416 ?   ?   ?   A . n 
A 1 415 ALA 415 417 ?   ?   ?   A . n 
A 1 416 VAL 416 418 ?   ?   ?   A . n 
B 1 1   MET 1   3   ?   ?   ?   B . n 
B 1 2   SER 2   4   ?   ?   ?   B . n 
B 1 3   GLY 3   5   ?   ?   ?   B . n 
B 1 4   ARG 4   6   ?   ?   ?   B . n 
B 1 5   ARG 5   7   7   ARG ARG B . n 
B 1 6   GLU 6   8   8   GLU GLU B . n 
B 1 7   LEU 7   9   9   LEU LEU B . n 
B 1 8   CYS 8   10  10  CYS CYS B . n 
B 1 9   THR 9   11  11  THR THR B . n 
B 1 10  PRO 10  12  12  PRO PRO B . n 
B 1 11  LEU 11  13  13  LEU LEU B . n 
B 1 12  ARG 12  14  14  ARG ARG B . n 
B 1 13  THR 13  15  15  THR THR B . n 
B 1 14  ILE 14  16  16  ILE ILE B . n 
B 1 15  MET 15  17  17  MET MET B . n 
B 1 16  THR 16  18  18  THR THR B . n 
B 1 17  PRO 17  19  19  PRO PRO B . n 
B 1 18  GLY 18  20  20  GLY GLY B . n 
B 1 19  PRO 19  21  21  PRO PRO B . n 
B 1 20  VAL 20  22  22  VAL VAL B . n 
B 1 21  GLU 21  23  23  GLU GLU B . n 
B 1 22  VAL 22  24  24  VAL VAL B . n 
B 1 23  ASP 23  25  25  ASP ASP B . n 
B 1 24  PRO 24  26  26  PRO PRO B . n 
B 1 25  ARG 25  27  27  ARG ARG B . n 
B 1 26  VAL 26  28  28  VAL VAL B . n 
B 1 27  LEU 27  29  29  LEU LEU B . n 
B 1 28  ARG 28  30  30  ARG ARG B . n 
B 1 29  VAL 29  31  31  VAL VAL B . n 
B 1 30  MET 30  32  32  MET MET B . n 
B 1 31  SER 31  33  33  SER SER B . n 
B 1 32  THR 32  34  34  THR THR B . n 
B 1 33  PRO 33  35  35  PRO PRO B . n 
B 1 34  VAL 34  36  36  VAL VAL B . n 
B 1 35  VAL 35  37  37  VAL VAL B . n 
B 1 36  GLY 36  38  38  GLY GLY B . n 
B 1 37  GLN 37  39  39  GLN GLN B . n 
B 1 38  PHE 38  40  40  PHE PHE B . n 
B 1 39  ASP 39  41  41  ASP ASP B . n 
B 1 40  PRO 40  42  42  PRO PRO B . n 
B 1 41  ALA 41  43  43  ALA ALA B . n 
B 1 42  PHE 42  44  44  PHE PHE B . n 
B 1 43  THR 43  45  45  THR THR B . n 
B 1 44  GLY 44  46  46  GLY GLY B . n 
B 1 45  ILE 45  47  47  ILE ILE B . n 
B 1 46  MET 46  48  48  MET MET B . n 
B 1 47  ASN 47  49  49  ASN ASN B . n 
B 1 48  GLU 48  50  50  GLU GLU B . n 
B 1 49  THR 49  51  51  THR THR B . n 
B 1 50  MET 50  52  52  MET MET B . n 
B 1 51  GLU 51  53  53  GLU GLU B . n 
B 1 52  MET 52  54  54  MET MET B . n 
B 1 53  LEU 53  55  55  LEU LEU B . n 
B 1 54  ARG 54  56  56  ARG ARG B . n 
B 1 55  GLU 55  57  57  GLU GLU B . n 
B 1 56  LEU 56  58  58  LEU LEU B . n 
B 1 57  PHE 57  59  59  PHE PHE B . n 
B 1 58  GLN 58  60  60  GLN GLN B . n 
B 1 59  THR 59  61  61  THR THR B . n 
B 1 60  LYS 60  62  62  LYS LYS B . n 
B 1 61  ASN 61  63  63  ASN ASN B . n 
B 1 62  ARG 62  64  64  ARG ARG B . n 
B 1 63  TRP 63  65  65  TRP TRP B . n 
B 1 64  ALA 64  66  66  ALA ALA B . n 
B 1 65  TYR 65  67  67  TYR TYR B . n 
B 1 66  PRO 66  68  68  PRO PRO B . n 
B 1 67  ILE 67  69  69  ILE ILE B . n 
B 1 68  ASP 68  70  70  ASP ASP B . n 
B 1 69  GLY 69  71  71  GLY GLY B . n 
B 1 70  THR 70  72  72  THR THR B . n 
B 1 71  SER 71  73  73  SER SER B . n 
B 1 72  ARG 72  74  74  ARG ARG B . n 
B 1 73  ALA 73  75  75  ALA ALA B . n 
B 1 74  GLY 74  76  76  GLY GLY B . n 
B 1 75  ILE 75  77  77  ILE ILE B . n 
B 1 76  GLU 76  78  78  GLU GLU B . n 
B 1 77  ALA 77  79  79  ALA ALA B . n 
B 1 78  VAL 78  80  80  VAL VAL B . n 
B 1 79  LEU 79  81  81  LEU LEU B . n 
B 1 80  ALA 80  82  82  ALA ALA B . n 
B 1 81  SER 81  83  83  SER SER B . n 
B 1 82  VAL 82  84  84  VAL VAL B . n 
B 1 83  ILE 83  85  85  ILE ILE B . n 
B 1 84  GLU 84  86  86  GLU GLU B . n 
B 1 85  PRO 85  87  87  PRO PRO B . n 
B 1 86  GLU 86  88  88  GLU GLU B . n 
B 1 87  ASP 87  89  89  ASP ASP B . n 
B 1 88  ASP 88  90  90  ASP ASP B . n 
B 1 89  VAL 89  91  91  VAL VAL B . n 
B 1 90  LEU 90  92  92  LEU LEU B . n 
B 1 91  ILE 91  93  93  ILE ILE B . n 
B 1 92  PRO 92  94  94  PRO PRO B . n 
B 1 93  ILE 93  95  95  ILE ILE B . n 
B 1 94  TYR 94  96  96  TYR TYR B . n 
B 1 95  GLY 95  97  97  GLY GLY B . n 
B 1 96  ARG 96  98  98  ARG ARG B . n 
B 1 97  PHE 97  99  99  PHE PHE B . n 
B 1 98  GLY 98  100 100 GLY GLY B . n 
B 1 99  TYR 99  101 101 TYR TYR B . n 
B 1 100 LEU 100 102 102 LEU LEU B . n 
B 1 101 LEU 101 103 103 LEU LEU B . n 
B 1 102 THR 102 104 104 THR THR B . n 
B 1 103 GLU 103 105 105 GLU GLU B . n 
B 1 104 ILE 104 106 106 ILE ILE B . n 
B 1 105 ALA 105 107 107 ALA ALA B . n 
B 1 106 GLU 106 108 108 GLU GLU B . n 
B 1 107 ARG 107 109 109 ARG ARG B . n 
B 1 108 TYR 108 110 110 TYR TYR B . n 
B 1 109 GLY 109 111 111 GLY GLY B . n 
B 1 110 ALA 110 112 112 ALA ALA B . n 
B 1 111 ASN 111 113 113 ASN ASN B . n 
B 1 112 VAL 112 114 114 VAL VAL B . n 
B 1 113 HIS 113 115 115 HIS HIS B . n 
B 1 114 MET 114 116 116 MET MET B . n 
B 1 115 LEU 115 117 117 LEU LEU B . n 
B 1 116 GLU 116 118 118 GLU GLU B . n 
B 1 117 CYS 117 119 119 CYS CYS B . n 
B 1 118 GLU 118 120 120 GLU GLU B . n 
B 1 119 TRP 119 121 121 TRP TRP B . n 
B 1 120 GLY 120 122 122 GLY GLY B . n 
B 1 121 THR 121 123 123 THR THR B . n 
B 1 122 VAL 122 124 124 VAL VAL B . n 
B 1 123 PHE 123 125 125 PHE PHE B . n 
B 1 124 ASP 124 126 126 ASP ASP B . n 
B 1 125 PRO 125 127 127 PRO PRO B . n 
B 1 126 GLU 126 128 128 GLU GLU B . n 
B 1 127 ASP 127 129 129 ASP ASP B . n 
B 1 128 ILE 128 130 130 ILE ILE B . n 
B 1 129 ILE 129 131 131 ILE ILE B . n 
B 1 130 ARG 130 132 132 ARG ARG B . n 
B 1 131 GLU 131 133 133 GLU GLU B . n 
B 1 132 ILE 132 134 134 ILE ILE B . n 
B 1 133 LYS 133 135 135 LYS LYS B . n 
B 1 134 LYS 134 136 136 LYS LYS B . n 
B 1 135 VAL 135 137 137 VAL VAL B . n 
B 1 136 LYS 136 138 138 LYS LYS B . n 
B 1 137 PRO 137 139 139 PRO PRO B . n 
B 1 138 LYS 138 140 140 LYS LYS B . n 
B 1 139 ILE 139 141 141 ILE ILE B . n 
B 1 140 VAL 140 142 142 VAL VAL B . n 
B 1 141 ALA 141 143 143 ALA ALA B . n 
B 1 142 MET 142 144 144 MET MET B . n 
B 1 143 VAL 143 145 145 VAL VAL B . n 
B 1 144 HIS 144 146 146 HIS HIS B . n 
B 1 145 GLY 145 147 147 GLY GLY B . n 
B 1 146 GLU 146 148 148 GLU GLU B . n 
B 1 147 THR 147 149 149 THR THR B . n 
B 1 148 SER 148 150 150 SER SER B . n 
B 1 149 THR 149 151 151 THR THR B . n 
B 1 150 GLY 150 152 152 GLY GLY B . n 
B 1 151 ARG 151 153 153 ARG ARG B . n 
B 1 152 ILE 152 154 154 ILE ILE B . n 
B 1 153 HIS 153 155 155 HIS HIS B . n 
B 1 154 PRO 154 156 156 PRO PRO B . n 
B 1 155 LEU 155 157 157 LEU LEU B . n 
B 1 156 LYS 156 158 158 LYS LYS B . n 
B 1 157 ALA 157 159 159 ALA ALA B . n 
B 1 158 ILE 158 160 160 ILE ILE B . n 
B 1 159 GLY 159 161 161 GLY GLY B . n 
B 1 160 GLU 160 162 162 GLU GLU B . n 
B 1 161 ALA 161 163 163 ALA ALA B . n 
B 1 162 CYS 162 164 164 CYS CYS B . n 
B 1 163 ARG 163 165 165 ARG ARG B . n 
B 1 164 THR 164 166 166 THR THR B . n 
B 1 165 GLU 165 167 167 GLU GLU B . n 
B 1 166 ASP 166 168 168 ASP ASP B . n 
B 1 167 ALA 167 169 169 ALA ALA B . n 
B 1 168 LEU 168 170 170 LEU LEU B . n 
B 1 169 PHE 169 171 171 PHE PHE B . n 
B 1 170 ILE 170 172 172 ILE ILE B . n 
B 1 171 VAL 171 173 173 VAL VAL B . n 
B 1 172 ASP 172 174 174 ASP ASP B . n 
B 1 173 ALA 173 175 175 ALA ALA B . n 
B 1 174 VAL 174 176 176 VAL VAL B . n 
B 1 175 ALA 175 177 177 ALA ALA B . n 
B 1 176 THR 176 178 178 THR THR B . n 
B 1 177 ILE 177 179 179 ILE ILE B . n 
B 1 178 GLY 178 180 180 GLY GLY B . n 
B 1 179 GLY 179 181 181 GLY GLY B . n 
B 1 180 CYS 180 182 182 CYS CYS B . n 
B 1 181 GLU 181 183 183 GLU GLU B . n 
B 1 182 VAL 182 184 184 VAL VAL B . n 
B 1 183 LYS 183 185 185 LYS LYS B . n 
B 1 184 VAL 184 186 186 VAL VAL B . n 
B 1 185 ASP 185 187 187 ASP ASP B . n 
B 1 186 GLU 186 188 188 GLU GLU B . n 
B 1 187 TRP 187 189 189 TRP TRP B . n 
B 1 188 LYS 188 190 190 LYS LYS B . n 
B 1 189 ILE 189 191 191 ILE ILE B . n 
B 1 190 ASP 190 192 192 ASP ASP B . n 
B 1 191 ALA 191 193 193 ALA ALA B . n 
B 1 192 ALA 192 194 194 ALA ALA B . n 
B 1 193 ILE 193 195 195 ILE ILE B . n 
B 1 194 GLY 194 196 196 GLY GLY B . n 
B 1 195 GLY 195 197 197 GLY GLY B . n 
B 1 196 THR 196 198 198 THR THR B . n 
B 1 197 GLN 197 199 199 GLN GLN B . n 
B 1 198 LYS 198 200 200 LYS LYS B . n 
B 1 199 CYS 199 201 201 CYS CYS B . n 
B 1 200 LEU 200 202 202 LEU LEU B . n 
B 1 201 SER 201 203 203 SER SER B . n 
B 1 202 VAL 202 204 204 VAL VAL B . n 
B 1 203 PRO 203 205 205 PRO PRO B . n 
B 1 204 SER 204 206 206 SER SER B . n 
B 1 205 GLY 205 207 207 GLY GLY B . n 
B 1 206 MET 206 208 208 MET MET B . n 
B 1 207 ALA 207 209 209 ALA ALA B . n 
B 1 208 PRO 208 210 210 PRO PRO B . n 
B 1 209 ILE 209 211 211 ILE ILE B . n 
B 1 210 THR 210 212 212 THR THR B . n 
B 1 211 TYR 211 213 213 TYR TYR B . n 
B 1 212 ASN 212 214 214 ASN ASN B . n 
B 1 213 GLU 213 215 215 GLU GLU B . n 
B 1 214 ARG 214 216 216 ARG ARG B . n 
B 1 215 VAL 215 217 217 VAL VAL B . n 
B 1 216 ALA 216 218 218 ALA ALA B . n 
B 1 217 ASP 217 219 219 ASP ASP B . n 
B 1 218 VAL 218 220 220 VAL VAL B . n 
B 1 219 ILE 219 221 221 ILE ILE B . n 
B 1 220 ALA 220 222 222 ALA ALA B . n 
B 1 221 ALA 221 223 223 ALA ALA B . n 
B 1 222 ARG 222 224 224 ARG ARG B . n 
B 1 223 LYS 223 225 ?   ?   ?   B . n 
B 1 224 LYS 224 226 ?   ?   ?   B . n 
B 1 225 VAL 225 227 ?   ?   ?   B . n 
B 1 226 GLU 226 228 ?   ?   ?   B . n 
B 1 227 ARG 227 229 ?   ?   ?   B . n 
B 1 228 GLY 228 230 ?   ?   ?   B . n 
B 1 229 ILE 229 231 ?   ?   ?   B . n 
B 1 230 ALA 230 232 ?   ?   ?   B . n 
B 1 231 THR 231 233 ?   ?   ?   B . n 
B 1 232 GLN 232 234 ?   ?   ?   B . n 
B 1 233 ALA 233 235 ?   ?   ?   B . n 
B 1 234 ASP 234 236 ?   ?   ?   B . n 
B 1 235 ARG 235 237 ?   ?   ?   B . n 
B 1 236 ALA 236 238 ?   ?   ?   B . n 
B 1 237 ALA 237 239 ?   ?   ?   B . n 
B 1 238 LEU 238 240 ?   ?   ?   B . n 
B 1 239 SER 239 241 ?   ?   ?   B . n 
B 1 240 GLY 240 242 ?   ?   ?   B . n 
B 1 241 ASN 241 243 243 ASN ASN B . n 
B 1 242 ARG 242 244 244 ARG ARG B . n 
B 1 243 PRO 243 245 245 PRO PRO B . n 
B 1 244 ILE 244 246 246 ILE ILE B . n 
B 1 245 THR 245 247 247 THR THR B . n 
B 1 246 SER 246 248 248 SER SER B . n 
B 1 247 ASN 247 249 249 ASN ASN B . n 
B 1 248 TYR 248 250 250 TYR TYR B . n 
B 1 249 PHE 249 251 251 PHE PHE B . n 
B 1 250 ASP 250 252 252 ASP ASP B . n 
B 1 251 LEU 251 253 253 LEU LEU B . n 
B 1 252 SER 252 254 254 SER SER B . n 
B 1 253 GLN 253 255 255 GLN GLN B . n 
B 1 254 LEU 254 256 256 LEU LEU B . n 
B 1 255 GLU 255 257 257 GLU GLU B . n 
B 1 256 ASP 256 258 258 ASP ASP B . n 
B 1 257 TYR 257 259 259 TYR TYR B . n 
B 1 258 TRP 258 260 260 TRP TRP B . n 
B 1 259 SER 259 261 261 SER SER B . n 
B 1 260 GLU 260 262 262 GLU GLU B . n 
B 1 261 ARG 261 263 263 ARG ARG B . n 
B 1 262 ARG 262 264 264 ARG ARG B . n 
B 1 263 LEU 263 265 265 LEU LEU B . n 
B 1 264 ASN 264 266 266 ASN ASN B . n 
B 1 265 HIS 265 267 267 HIS HIS B . n 
B 1 266 HIS 266 268 268 HIS HIS B . n 
B 1 267 THR 267 269 269 THR THR B . n 
B 1 268 GLU 268 270 270 GLU GLU B . n 
B 1 269 ALA 269 271 271 ALA ALA B . n 
B 1 270 THR 270 272 272 THR THR B . n 
B 1 271 THR 271 273 273 THR THR B . n 
B 1 272 MET 272 274 274 MET MET B . n 
B 1 273 LEU 273 275 275 LEU LEU B . n 
B 1 274 TYR 274 276 276 TYR TYR B . n 
B 1 275 ALA 275 277 277 ALA ALA B . n 
B 1 276 LEU 276 278 278 LEU LEU B . n 
B 1 277 ARG 277 279 279 ARG ARG B . n 
B 1 278 GLU 278 280 280 GLU GLU B . n 
B 1 279 GLY 279 281 281 GLY GLY B . n 
B 1 280 VAL 280 282 282 VAL VAL B . n 
B 1 281 ARG 281 283 283 ARG ARG B . n 
B 1 282 LEU 282 284 284 LEU LEU B . n 
B 1 283 VAL 283 285 285 VAL VAL B . n 
B 1 284 LEU 284 286 286 LEU LEU B . n 
B 1 285 GLU 285 287 287 GLU GLU B . n 
B 1 286 GLU 286 288 288 GLU GLU B . n 
B 1 287 GLY 287 289 289 GLY GLY B . n 
B 1 288 LEU 288 290 290 LEU LEU B . n 
B 1 289 GLU 289 291 291 GLU GLU B . n 
B 1 290 THR 290 292 292 THR THR B . n 
B 1 291 ARG 291 293 293 ARG ARG B . n 
B 1 292 PHE 292 294 294 PHE PHE B . n 
B 1 293 GLU 293 295 295 GLU GLU B . n 
B 1 294 ARG 294 296 296 ARG ARG B . n 
B 1 295 HIS 295 297 297 HIS HIS B . n 
B 1 296 ARG 296 298 298 ARG ARG B . n 
B 1 297 HIS 297 299 299 HIS HIS B . n 
B 1 298 HIS 298 300 300 HIS HIS B . n 
B 1 299 GLU 299 301 301 GLU GLU B . n 
B 1 300 ALA 300 302 302 ALA ALA B . n 
B 1 301 ALA 301 303 303 ALA ALA B . n 
B 1 302 LEU 302 304 304 LEU LEU B . n 
B 1 303 ALA 303 305 305 ALA ALA B . n 
B 1 304 ALA 304 306 306 ALA ALA B . n 
B 1 305 GLY 305 307 307 GLY GLY B . n 
B 1 306 ILE 306 308 308 ILE ILE B . n 
B 1 307 LYS 307 309 309 LYS LYS B . n 
B 1 308 ALA 308 310 310 ALA ALA B . n 
B 1 309 MET 309 311 311 MET MET B . n 
B 1 310 GLY 310 312 312 GLY GLY B . n 
B 1 311 LEU 311 313 313 LEU LEU B . n 
B 1 312 ARG 312 314 314 ARG ARG B . n 
B 1 313 LEU 313 315 315 LEU LEU B . n 
B 1 314 PHE 314 316 316 PHE PHE B . n 
B 1 315 GLY 315 317 317 GLY GLY B . n 
B 1 316 ASP 316 318 318 ASP ASP B . n 
B 1 317 ASP 317 319 319 ASP ASP B . n 
B 1 318 SER 318 320 320 SER SER B . n 
B 1 319 CYS 319 321 321 CYS CYS B . n 
B 1 320 LYS 320 322 322 LYS LYS B . n 
B 1 321 MET 321 323 323 MET MET B . n 
B 1 322 PRO 322 324 324 PRO PRO B . n 
B 1 323 VAL 323 325 325 VAL VAL B . n 
B 1 324 VAL 324 326 326 VAL VAL B . n 
B 1 325 THR 325 327 327 THR THR B . n 
B 1 326 CYS 326 328 328 CYS CYS B . n 
B 1 327 VAL 327 329 329 VAL VAL B . n 
B 1 328 GLU 328 330 330 GLU GLU B . n 
B 1 329 ILE 329 331 331 ILE ILE B . n 
B 1 330 PRO 330 332 332 PRO PRO B . n 
B 1 331 GLY 331 333 333 GLY GLY B . n 
B 1 332 GLY 332 334 334 GLY GLY B . n 
B 1 333 ILE 333 335 335 ILE ILE B . n 
B 1 334 ASP 334 336 336 ASP ASP B . n 
B 1 335 GLY 335 337 337 GLY GLY B . n 
B 1 336 GLU 336 338 338 GLU GLU B . n 
B 1 337 SER 337 339 339 SER SER B . n 
B 1 338 VAL 338 340 340 VAL VAL B . n 
B 1 339 ARG 339 341 341 ARG ARG B . n 
B 1 340 ASP 340 342 342 ASP ASP B . n 
B 1 341 MET 341 343 343 MET MET B . n 
B 1 342 LEU 342 344 344 LEU LEU B . n 
B 1 343 LEU 343 345 345 LEU LEU B . n 
B 1 344 ALA 344 346 346 ALA ALA B . n 
B 1 345 GLN 345 347 347 GLN GLN B . n 
B 1 346 PHE 346 348 348 PHE PHE B . n 
B 1 347 GLY 347 349 349 GLY GLY B . n 
B 1 348 ILE 348 350 350 ILE ILE B . n 
B 1 349 GLU 349 351 351 GLU GLU B . n 
B 1 350 ILE 350 352 352 ILE ILE B . n 
B 1 351 ALA 351 353 353 ALA ALA B . n 
B 1 352 SER 352 354 354 SER SER B . n 
B 1 353 SER 353 355 355 SER SER B . n 
B 1 354 PHE 354 356 356 PHE PHE B . n 
B 1 355 GLY 355 357 357 GLY GLY B . n 
B 1 356 PRO 356 358 358 PRO PRO B . n 
B 1 357 LEU 357 359 359 LEU LEU B . n 
B 1 358 ALA 358 360 360 ALA ALA B . n 
B 1 359 GLY 359 361 361 GLY GLY B . n 
B 1 360 LYS 360 362 362 LYS LYS B . n 
B 1 361 ILE 361 363 363 ILE ILE B . n 
B 1 362 TRP 362 364 364 TRP TRP B . n 
B 1 363 ARG 363 365 365 ARG ARG B . n 
B 1 364 ILE 364 366 366 ILE ILE B . n 
B 1 365 GLY 365 367 367 GLY GLY B . n 
B 1 366 THR 366 368 368 THR THR B . n 
B 1 367 MET 367 369 369 MET MET B . n 
B 1 368 GLY 368 370 370 GLY GLY B . n 
B 1 369 TYR 369 371 371 TYR TYR B . n 
B 1 370 SER 370 372 372 SER SER B . n 
B 1 371 CYS 371 373 373 CYS CYS B . n 
B 1 372 ARG 372 374 374 ARG ARG B . n 
B 1 373 LYS 373 375 375 LYS LYS B . n 
B 1 374 GLU 374 376 376 GLU GLU B . n 
B 1 375 ASN 375 377 377 ASN ASN B . n 
B 1 376 VAL 376 378 378 VAL VAL B . n 
B 1 377 LEU 377 379 379 LEU LEU B . n 
B 1 378 PHE 378 380 380 PHE PHE B . n 
B 1 379 VAL 379 381 381 VAL VAL B . n 
B 1 380 LEU 380 382 382 LEU LEU B . n 
B 1 381 ALA 381 383 383 ALA ALA B . n 
B 1 382 GLY 382 384 384 GLY GLY B . n 
B 1 383 LEU 383 385 385 LEU LEU B . n 
B 1 384 GLU 384 386 386 GLU GLU B . n 
B 1 385 ALA 385 387 387 ALA ALA B . n 
B 1 386 VAL 386 388 388 VAL VAL B . n 
B 1 387 LEU 387 389 389 LEU LEU B . n 
B 1 388 LEU 388 390 390 LEU LEU B . n 
B 1 389 ARG 389 391 391 ARG ARG B . n 
B 1 390 HIS 390 392 392 HIS HIS B . n 
B 1 391 ASN 391 393 393 ASN ASN B . n 
B 1 392 ALA 392 394 394 ALA ALA B . n 
B 1 393 GLY 393 395 395 GLY GLY B . n 
B 1 394 ILE 394 396 396 ILE ILE B . n 
B 1 395 GLU 395 397 397 GLU GLU B . n 
B 1 396 ALA 396 398 398 ALA ALA B . n 
B 1 397 GLY 397 399 399 GLY GLY B . n 
B 1 398 LYS 398 400 400 LYS LYS B . n 
B 1 399 ALA 399 401 401 ALA ALA B . n 
B 1 400 LEU 400 402 402 LEU LEU B . n 
B 1 401 GLN 401 403 403 GLN GLN B . n 
B 1 402 ALA 402 404 404 ALA ALA B . n 
B 1 403 ALA 403 405 405 ALA ALA B . n 
B 1 404 LEU 404 406 406 LEU LEU B . n 
B 1 405 ASP 405 407 407 ASP ASP B . n 
B 1 406 VAL 406 408 408 VAL VAL B . n 
B 1 407 TYR 407 409 409 TYR TYR B . n 
B 1 408 GLU 408 410 410 GLU GLU B . n 
B 1 409 ASN 409 411 411 ASN ASN B . n 
B 1 410 ALA 410 412 ?   ?   ?   B . n 
B 1 411 GLY 411 413 ?   ?   ?   B . n 
B 1 412 ARG 412 414 ?   ?   ?   B . n 
B 1 413 GLN 413 415 ?   ?   ?   B . n 
B 1 414 ALA 414 416 ?   ?   ?   B . n 
B 1 415 ALA 415 417 ?   ?   ?   B . n 
B 1 416 VAL 416 418 ?   ?   ?   B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   dimeric 
_pdbx_struct_assembly.oligomeric_count     2 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 6590  ? 
1 MORE         -33   ? 
1 'SSA (A^2)'  26740 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A HOH 551 ? E HOH . 
2 1 B HOH 548 ? F HOH . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-09-15 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
_pdbx_refine_tls.S[3][3] 
'X-RAY DIFFRACTION' 1  ? refined 11.1964  -14.3201 11.0999 .1606 .1169 .1455 -.0261 .0106  .0145  .6042  .5325  .7826  .2775   
.2271   .2190   .0004  -.0012 -.0679 .0624  .0059  -.0597 .0178  .0422  -.0063 
'X-RAY DIFFRACTION' 2  ? refined 20.4435  -3.3732  29.5020 .1147 .1657 .1135 -.0711 -.0072 .0116  .7441  1.0520 1.4407 .1556   
.5588   .4734   .0501  -.2266 -.0241 .1202  -.0605 -.0621 -.0345 -.1414 .0105  
'X-RAY DIFFRACTION' 3  ? refined 15.5822  -24.3445 27.8344 .1315 .0921 .3224 -.0325 -.0491 .1295  4.8998 3.3873 4.6286 .8176   
-2.3201 1.8224  .0742  -.0906 -.0861 .3658  -.0924 -.5575 .3963  .0670  .0182  
'X-RAY DIFFRACTION' 4  ? refined 14.9442  -1.6527  7.7843  .1947 .1537 .1767 -.0517 .0040  .0014  .8466  1.1352 .8177  -.1119  
.4343   -.0984  -.0718 .0014  .0572  -.0033 .0092  -.0487 -.1096 .1269  .0626  
'X-RAY DIFFRACTION' 5  ? refined 3.4883   12.9533  13.3042 .2394 .0683 .1799 .0041  -.0496 -.0295 2.4269 .6792  1.7363 -.1378  
.5508   .0083   -.2059 -.2653 .3241  .0987  .0209  .0716  -.3531 -.1632 .1851  
'X-RAY DIFFRACTION' 6  ? refined 10.9250  19.0635  -.8731  .2818 .1194 .2512 -.1115 -.0895 .0596  6.3576 9.6407 7.3968 -4.3547 
.6542   .3007   .1448  .0551  .3838  -.7071 -.4164 -.2245 -.5133 .2612  .2717  
'X-RAY DIFFRACTION' 7  ? refined -4.7393  -17.6841 13.0253 .1656 .1484 .1511 -.0282 .0182  .0093  .6890  .5187  .4683  .0029   
.2734   -.3075  .0066  -.0597 -.0001 .0710  -.0103 -.0442 -.0584 -.1102 .0037  
'X-RAY DIFFRACTION' 8  ? refined -5.5007  -27.3444 35.0746 .1330 .2515 .1157 -.1133 .0302  .0711  .4195  1.2780 1.8395 -.0481  
.3270   -.2558  .0951  -.1972 -.0479 .2120  -.0656 -.0430 -.1344 .0473  -.0295 
'X-RAY DIFFRACTION' 9  ? refined -1.5175  -7.2717  31.8786 .2944 .3416 .1353 -.0622 .0743  -.1061 5.7150 7.2789 .5648  -1.2555 
.1604   -2.0129 -.3000 -.2204 .2824  .8912  .2515  -.1277 -.2443 -.0772 .0485  
'X-RAY DIFFRACTION' 10 ? refined -10.0349 -29.8047 13.5416 .1704 .1861 .1825 -.0551 .0040  .0465  1.0279 .7489  .8626  -.0885  
-.1409  .1878   .0671  -.1260 -.0927 .1106  -.0459 .1029  .0303  -.1546 -.0212 
'X-RAY DIFFRACTION' 11 ? refined 2.7026   -44.3796 13.4416 .1701 .0852 .2298 -.0341 -.0095 .0530  1.5963 .7237  2.2738 -.1613  
-.6242  .2785   .0387  -.2382 -.3033 .0655  .0127  -.0132 .3540  .2275  -.0514 
'X-RAY DIFFRACTION' 12 ? refined -10.0713 -50.4291 3.9175  .2193 .1529 .2050 -.0727 -.0038 .0193  8.2896 9.8448 6.3961 -3.4048 
-1.7551 2.0052  .1160  .2396  -.4886 -.1551 -.0610 .2927  .1826  -.2212 -.0550 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
_pdbx_refine_tls_group.selection_details 
'X-RAY DIFFRACTION' 1  1  A 7   ? ? A 70  ? ? ? ? 
'X-RAY DIFFRACTION' 2  2  A 71  ? ? A 224 ? ? ? ? 
'X-RAY DIFFRACTION' 3  3  A 243 ? ? A 268 ? ? ? ? 
'X-RAY DIFFRACTION' 4  4  A 269 ? ? A 313 ? ? ? ? 
'X-RAY DIFFRACTION' 5  5  A 314 ? ? A 396 ? ? ? ? 
'X-RAY DIFFRACTION' 6  6  A 397 ? ? A 411 ? ? ? ? 
'X-RAY DIFFRACTION' 7  7  B 7   ? ? B 63  ? ? ? ? 
'X-RAY DIFFRACTION' 8  8  B 64  ? ? B 224 ? ? ? ? 
'X-RAY DIFFRACTION' 9  9  B 243 ? ? B 268 ? ? ? ? 
'X-RAY DIFFRACTION' 10 10 B 269 ? ? B 313 ? ? ? ? 
'X-RAY DIFFRACTION' 11 11 B 314 ? ? B 396 ? ? ? ? 
'X-RAY DIFFRACTION' 12 12 B 397 ? ? B 411 ? ? ? ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
MAR345dtb 'data collection' .        ? 1 
PHASER    phasing           .        ? 2 
REFMAC    refinement        5.5.0072 ? 3 
MOSFLM    'data reduction'  .        ? 4 
SCALA     'data scaling'    .        ? 5 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   OE1 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   GLU 
_pdbx_validate_close_contact.auth_seq_id_1    386 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   ALA 
_pdbx_validate_close_contact.auth_seq_id_2    398 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             1.99 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CB B GLU 57  ? ? CG  B GLU 57  ? ? 1.387 1.517 -0.130 0.019 N 
2 1 CB B VAL 325 ? ? CG1 B VAL 325 ? ? 1.375 1.524 -0.149 0.021 N 
# 
loop_
_pdbx_validate_rmsd_angle.id 
_pdbx_validate_rmsd_angle.PDB_model_num 
_pdbx_validate_rmsd_angle.auth_atom_id_1 
_pdbx_validate_rmsd_angle.auth_asym_id_1 
_pdbx_validate_rmsd_angle.auth_comp_id_1 
_pdbx_validate_rmsd_angle.auth_seq_id_1 
_pdbx_validate_rmsd_angle.PDB_ins_code_1 
_pdbx_validate_rmsd_angle.label_alt_id_1 
_pdbx_validate_rmsd_angle.auth_atom_id_2 
_pdbx_validate_rmsd_angle.auth_asym_id_2 
_pdbx_validate_rmsd_angle.auth_comp_id_2 
_pdbx_validate_rmsd_angle.auth_seq_id_2 
_pdbx_validate_rmsd_angle.PDB_ins_code_2 
_pdbx_validate_rmsd_angle.label_alt_id_2 
_pdbx_validate_rmsd_angle.auth_atom_id_3 
_pdbx_validate_rmsd_angle.auth_asym_id_3 
_pdbx_validate_rmsd_angle.auth_comp_id_3 
_pdbx_validate_rmsd_angle.auth_seq_id_3 
_pdbx_validate_rmsd_angle.PDB_ins_code_3 
_pdbx_validate_rmsd_angle.label_alt_id_3 
_pdbx_validate_rmsd_angle.angle_value 
_pdbx_validate_rmsd_angle.angle_target_value 
_pdbx_validate_rmsd_angle.angle_deviation 
_pdbx_validate_rmsd_angle.angle_standard_deviation 
_pdbx_validate_rmsd_angle.linker_flag 
1  1 NE  A ARG 27  ? ? CZ A ARG 27  ? ? NH1 A ARG 27  ? ? 123.90 120.30 3.60  0.50 N 
2  1 NE  A ARG 27  ? ? CZ A ARG 27  ? ? NH2 A ARG 27  ? ? 115.18 120.30 -5.12 0.50 N 
3  1 NE  A ARG 30  ? ? CZ A ARG 30  ? ? NH1 A ARG 30  ? ? 124.83 120.30 4.53  0.50 N 
4  1 NE  A ARG 30  ? ? CZ A ARG 30  ? ? NH2 A ARG 30  ? ? 115.15 120.30 -5.15 0.50 N 
5  1 NE  A ARG 153 ? ? CZ A ARG 153 ? ? NH1 A ARG 153 ? ? 116.72 120.30 -3.58 0.50 N 
6  1 NE  A ARG 153 ? ? CZ A ARG 153 ? ? NH2 A ARG 153 ? ? 123.33 120.30 3.03  0.50 N 
7  1 CG1 A VAL 285 ? ? CB A VAL 285 ? ? CG2 A VAL 285 ? ? 121.16 110.90 10.26 1.60 N 
8  1 CB  A LEU 286 ? ? CG A LEU 286 ? ? CD1 A LEU 286 ? ? 122.13 111.00 11.13 1.70 N 
9  1 NE  A ARG 374 ? ? CZ A ARG 374 ? ? NH1 A ARG 374 ? ? 117.27 120.30 -3.03 0.50 N 
10 1 CG1 B VAL 22  ? ? CB B VAL 22  ? ? CG2 B VAL 22  ? ? 120.92 110.90 10.02 1.60 N 
11 1 NE  B ARG 27  ? ? CZ B ARG 27  ? ? NH1 B ARG 27  ? ? 126.16 120.30 5.86  0.50 N 
12 1 NE  B ARG 27  ? ? CZ B ARG 27  ? ? NH2 B ARG 27  ? ? 113.24 120.30 -7.06 0.50 N 
13 1 NE  B ARG 30  ? ? CZ B ARG 30  ? ? NH1 B ARG 30  ? ? 125.37 120.30 5.07  0.50 N 
14 1 NE  B ARG 30  ? ? CZ B ARG 30  ? ? NH2 B ARG 30  ? ? 115.13 120.30 -5.17 0.50 N 
15 1 CG  B ARG 153 ? ? CD B ARG 153 ? ? NE  B ARG 153 ? ? 129.97 111.80 18.17 2.10 N 
16 1 CD  B ARG 153 ? ? NE B ARG 153 ? ? CZ  B ARG 153 ? ? 133.78 123.60 10.18 1.40 N 
17 1 NE  B ARG 153 ? ? CZ B ARG 153 ? ? NH1 B ARG 153 ? ? 126.66 120.30 6.36  0.50 N 
18 1 NE  B ARG 153 ? ? CZ B ARG 153 ? ? NH2 B ARG 153 ? ? 115.98 120.30 -4.32 0.50 N 
19 1 CB  B ASP 174 ? ? CG B ASP 174 ? ? OD1 B ASP 174 ? ? 124.28 118.30 5.98  0.90 N 
20 1 CG1 B VAL 282 ? ? CB B VAL 282 ? ? CG2 B VAL 282 ? ? 121.61 110.90 10.71 1.60 N 
21 1 CG1 B VAL 285 ? ? CB B VAL 285 ? ? CG2 B VAL 285 ? ? 122.01 110.90 11.11 1.60 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 GLU A 88  ? ? 72.91   -7.59   
2  1 LYS A 200 ? ? -104.07 -124.65 
3  1 ALA A 223 ? ? -62.82  2.10    
4  1 TRP A 260 ? ? -102.51 42.84   
5  1 ASN A 266 ? ? -69.44  75.89   
6  1 ALA A 394 ? ? 84.65   55.09   
7  1 ALA A 398 ? ? 59.30   -157.84 
8  1 GLU B 88  ? ? 77.99   -2.68   
9  1 LYS B 200 ? ? -101.63 -114.05 
10 1 ARG B 244 ? ? -37.42  125.33  
11 1 TRP B 260 ? ? -99.88  56.72   
12 1 ASN B 266 ? ? -66.91  73.93   
13 1 GLU B 270 ? ? -43.58  152.96  
# 
loop_
_pdbx_validate_peptide_omega.id 
_pdbx_validate_peptide_omega.PDB_model_num 
_pdbx_validate_peptide_omega.auth_comp_id_1 
_pdbx_validate_peptide_omega.auth_asym_id_1 
_pdbx_validate_peptide_omega.auth_seq_id_1 
_pdbx_validate_peptide_omega.PDB_ins_code_1 
_pdbx_validate_peptide_omega.label_alt_id_1 
_pdbx_validate_peptide_omega.auth_comp_id_2 
_pdbx_validate_peptide_omega.auth_asym_id_2 
_pdbx_validate_peptide_omega.auth_seq_id_2 
_pdbx_validate_peptide_omega.PDB_ins_code_2 
_pdbx_validate_peptide_omega.label_alt_id_2 
_pdbx_validate_peptide_omega.omega 
1 1 ASN A 393 ? ? ALA A 394 ? ? 39.73  
2 1 PHE B 125 ? ? ASP B 126 ? ? 149.83 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 3   ? A MET 1   
2  1 Y 1 A SER 4   ? A SER 2   
3  1 Y 1 A GLY 5   ? A GLY 3   
4  1 Y 1 A ARG 6   ? A ARG 4   
5  1 Y 1 A LYS 225 ? A LYS 223 
6  1 Y 1 A LYS 226 ? A LYS 224 
7  1 Y 1 A VAL 227 ? A VAL 225 
8  1 Y 1 A GLU 228 ? A GLU 226 
9  1 Y 1 A ARG 229 ? A ARG 227 
10 1 Y 1 A GLY 230 ? A GLY 228 
11 1 Y 1 A ILE 231 ? A ILE 229 
12 1 Y 1 A ALA 232 ? A ALA 230 
13 1 Y 1 A THR 233 ? A THR 231 
14 1 Y 1 A GLN 234 ? A GLN 232 
15 1 Y 1 A ALA 235 ? A ALA 233 
16 1 Y 1 A ASP 236 ? A ASP 234 
17 1 Y 1 A ARG 237 ? A ARG 235 
18 1 Y 1 A ALA 238 ? A ALA 236 
19 1 Y 1 A ALA 239 ? A ALA 237 
20 1 Y 1 A LEU 240 ? A LEU 238 
21 1 Y 1 A SER 241 ? A SER 239 
22 1 Y 1 A GLY 242 ? A GLY 240 
23 1 Y 1 A ALA 412 ? A ALA 410 
24 1 Y 1 A GLY 413 ? A GLY 411 
25 1 Y 1 A ARG 414 ? A ARG 412 
26 1 Y 1 A GLN 415 ? A GLN 413 
27 1 Y 1 A ALA 416 ? A ALA 414 
28 1 Y 1 A ALA 417 ? A ALA 415 
29 1 Y 1 A VAL 418 ? A VAL 416 
30 1 Y 1 B MET 3   ? B MET 1   
31 1 Y 1 B SER 4   ? B SER 2   
32 1 Y 1 B GLY 5   ? B GLY 3   
33 1 Y 1 B ARG 6   ? B ARG 4   
34 1 Y 1 B LYS 225 ? B LYS 223 
35 1 Y 1 B LYS 226 ? B LYS 224 
36 1 Y 1 B VAL 227 ? B VAL 225 
37 1 Y 1 B GLU 228 ? B GLU 226 
38 1 Y 1 B ARG 229 ? B ARG 227 
39 1 Y 1 B GLY 230 ? B GLY 228 
40 1 Y 1 B ILE 231 ? B ILE 229 
41 1 Y 1 B ALA 232 ? B ALA 230 
42 1 Y 1 B THR 233 ? B THR 231 
43 1 Y 1 B GLN 234 ? B GLN 232 
44 1 Y 1 B ALA 235 ? B ALA 233 
45 1 Y 1 B ASP 236 ? B ASP 234 
46 1 Y 1 B ARG 237 ? B ARG 235 
47 1 Y 1 B ALA 238 ? B ALA 236 
48 1 Y 1 B ALA 239 ? B ALA 237 
49 1 Y 1 B LEU 240 ? B LEU 238 
50 1 Y 1 B SER 241 ? B SER 239 
51 1 Y 1 B GLY 242 ? B GLY 240 
52 1 Y 1 B ALA 412 ? B ALA 410 
53 1 Y 1 B GLY 413 ? B GLY 411 
54 1 Y 1 B ARG 414 ? B ARG 412 
55 1 Y 1 B GLN 415 ? B GLN 413 
56 1 Y 1 B ALA 416 ? B ALA 414 
57 1 Y 1 B ALA 417 ? B ALA 415 
58 1 Y 1 B VAL 418 ? B VAL 416 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 "PYRIDOXAL-5'-PHOSPHATE" PLP 
3 water                    HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 PLP 1   419 417 PLP PLP A . 
D 2 PLP 1   419 417 PLP PLP B . 
E 3 HOH 1   420 420 HOH HOH A . 
E 3 HOH 2   421 421 HOH HOH A . 
E 3 HOH 3   422 422 HOH HOH A . 
E 3 HOH 4   423 423 HOH HOH A . 
E 3 HOH 5   424 424 HOH HOH A . 
E 3 HOH 6   425 425 HOH HOH A . 
E 3 HOH 7   426 426 HOH HOH A . 
E 3 HOH 8   427 427 HOH HOH A . 
E 3 HOH 9   428 428 HOH HOH A . 
E 3 HOH 10  429 429 HOH HOH A . 
E 3 HOH 11  430 430 HOH HOH A . 
E 3 HOH 12  431 431 HOH HOH A . 
E 3 HOH 13  432 432 HOH HOH A . 
E 3 HOH 14  433 433 HOH HOH A . 
E 3 HOH 15  434 434 HOH HOH A . 
E 3 HOH 16  435 435 HOH HOH A . 
E 3 HOH 17  436 436 HOH HOH A . 
E 3 HOH 18  437 437 HOH HOH A . 
E 3 HOH 19  438 438 HOH HOH A . 
E 3 HOH 20  439 439 HOH HOH A . 
E 3 HOH 21  440 440 HOH HOH A . 
E 3 HOH 22  441 441 HOH HOH A . 
E 3 HOH 23  442 442 HOH HOH A . 
E 3 HOH 24  443 443 HOH HOH A . 
E 3 HOH 25  444 444 HOH HOH A . 
E 3 HOH 26  445 445 HOH HOH A . 
E 3 HOH 27  446 446 HOH HOH A . 
E 3 HOH 28  447 447 HOH HOH A . 
E 3 HOH 29  448 448 HOH HOH A . 
E 3 HOH 30  449 449 HOH HOH A . 
E 3 HOH 31  450 450 HOH HOH A . 
E 3 HOH 32  451 451 HOH HOH A . 
E 3 HOH 33  452 452 HOH HOH A . 
E 3 HOH 34  453 453 HOH HOH A . 
E 3 HOH 35  454 454 HOH HOH A . 
E 3 HOH 36  455 455 HOH HOH A . 
E 3 HOH 37  456 456 HOH HOH A . 
E 3 HOH 38  457 457 HOH HOH A . 
E 3 HOH 39  458 458 HOH HOH A . 
E 3 HOH 40  459 459 HOH HOH A . 
E 3 HOH 41  460 460 HOH HOH A . 
E 3 HOH 42  461 461 HOH HOH A . 
E 3 HOH 43  462 462 HOH HOH A . 
E 3 HOH 44  463 463 HOH HOH A . 
E 3 HOH 45  464 464 HOH HOH A . 
E 3 HOH 46  465 465 HOH HOH A . 
E 3 HOH 47  466 466 HOH HOH A . 
E 3 HOH 48  467 467 HOH HOH A . 
E 3 HOH 49  468 468 HOH HOH A . 
E 3 HOH 50  469 469 HOH HOH A . 
E 3 HOH 51  470 470 HOH HOH A . 
E 3 HOH 52  471 471 HOH HOH A . 
E 3 HOH 53  472 472 HOH HOH A . 
E 3 HOH 54  473 473 HOH HOH A . 
E 3 HOH 55  474 474 HOH HOH A . 
E 3 HOH 56  475 475 HOH HOH A . 
E 3 HOH 57  476 476 HOH HOH A . 
E 3 HOH 58  477 477 HOH HOH A . 
E 3 HOH 59  478 478 HOH HOH A . 
E 3 HOH 60  479 479 HOH HOH A . 
E 3 HOH 61  480 480 HOH HOH A . 
E 3 HOH 62  481 481 HOH HOH A . 
E 3 HOH 63  482 482 HOH HOH A . 
E 3 HOH 64  483 483 HOH HOH A . 
E 3 HOH 65  484 484 HOH HOH A . 
E 3 HOH 66  485 485 HOH HOH A . 
E 3 HOH 67  486 486 HOH HOH A . 
E 3 HOH 68  487 487 HOH HOH A . 
E 3 HOH 69  488 488 HOH HOH A . 
E 3 HOH 70  489 489 HOH HOH A . 
E 3 HOH 71  490 490 HOH HOH A . 
E 3 HOH 72  491 491 HOH HOH A . 
E 3 HOH 73  492 492 HOH HOH A . 
E 3 HOH 74  493 493 HOH HOH A . 
E 3 HOH 75  494 494 HOH HOH A . 
E 3 HOH 76  495 495 HOH HOH A . 
E 3 HOH 77  496 496 HOH HOH A . 
E 3 HOH 78  497 497 HOH HOH A . 
E 3 HOH 79  498 498 HOH HOH A . 
E 3 HOH 80  499 499 HOH HOH A . 
E 3 HOH 81  500 500 HOH HOH A . 
E 3 HOH 82  501 501 HOH HOH A . 
E 3 HOH 83  502 502 HOH HOH A . 
E 3 HOH 84  503 503 HOH HOH A . 
E 3 HOH 85  504 504 HOH HOH A . 
E 3 HOH 86  505 505 HOH HOH A . 
E 3 HOH 87  506 506 HOH HOH A . 
E 3 HOH 88  507 507 HOH HOH A . 
E 3 HOH 89  508 508 HOH HOH A . 
E 3 HOH 90  509 509 HOH HOH A . 
E 3 HOH 91  510 510 HOH HOH A . 
E 3 HOH 92  511 511 HOH HOH A . 
E 3 HOH 93  512 512 HOH HOH A . 
E 3 HOH 94  513 513 HOH HOH A . 
E 3 HOH 95  514 514 HOH HOH A . 
E 3 HOH 96  515 515 HOH HOH A . 
E 3 HOH 97  516 516 HOH HOH A . 
E 3 HOH 98  517 517 HOH HOH A . 
E 3 HOH 99  518 518 HOH HOH A . 
E 3 HOH 100 519 519 HOH HOH A . 
E 3 HOH 101 520 520 HOH HOH A . 
E 3 HOH 102 521 521 HOH HOH A . 
E 3 HOH 103 522 522 HOH HOH A . 
E 3 HOH 104 523 523 HOH HOH A . 
E 3 HOH 105 524 524 HOH HOH A . 
E 3 HOH 106 525 525 HOH HOH A . 
E 3 HOH 107 526 526 HOH HOH A . 
E 3 HOH 108 527 527 HOH HOH A . 
E 3 HOH 109 528 528 HOH HOH A . 
E 3 HOH 110 529 529 HOH HOH A . 
E 3 HOH 111 530 530 HOH HOH A . 
E 3 HOH 112 531 531 HOH HOH A . 
E 3 HOH 113 532 532 HOH HOH A . 
E 3 HOH 114 533 533 HOH HOH A . 
E 3 HOH 115 534 534 HOH HOH A . 
E 3 HOH 116 535 535 HOH HOH A . 
E 3 HOH 117 536 536 HOH HOH A . 
E 3 HOH 118 537 537 HOH HOH A . 
E 3 HOH 119 538 538 HOH HOH A . 
E 3 HOH 120 539 539 HOH HOH A . 
E 3 HOH 121 540 540 HOH HOH A . 
E 3 HOH 122 541 541 HOH HOH A . 
E 3 HOH 123 542 542 HOH HOH A . 
E 3 HOH 124 543 543 HOH HOH A . 
E 3 HOH 125 544 544 HOH HOH A . 
E 3 HOH 126 545 545 HOH HOH A . 
E 3 HOH 127 546 546 HOH HOH A . 
E 3 HOH 128 547 547 HOH HOH A . 
E 3 HOH 129 548 548 HOH HOH A . 
E 3 HOH 130 549 549 HOH HOH A . 
E 3 HOH 131 550 550 HOH HOH A . 
E 3 HOH 132 551 551 HOH HOH A . 
E 3 HOH 133 552 552 HOH HOH A . 
E 3 HOH 134 553 553 HOH HOH A . 
E 3 HOH 135 554 554 HOH HOH A . 
E 3 HOH 136 555 555 HOH HOH A . 
E 3 HOH 137 556 556 HOH HOH A . 
E 3 HOH 138 557 557 HOH HOH A . 
E 3 HOH 139 558 558 HOH HOH A . 
E 3 HOH 140 559 559 HOH HOH A . 
E 3 HOH 141 560 560 HOH HOH A . 
E 3 HOH 142 561 561 HOH HOH A . 
E 3 HOH 143 562 562 HOH HOH A . 
E 3 HOH 144 563 563 HOH HOH A . 
E 3 HOH 145 564 564 HOH HOH A . 
E 3 HOH 146 565 565 HOH HOH A . 
E 3 HOH 147 566 566 HOH HOH A . 
E 3 HOH 148 567 567 HOH HOH A . 
E 3 HOH 149 568 568 HOH HOH A . 
E 3 HOH 150 569 569 HOH HOH A . 
E 3 HOH 151 570 418 HOH HOH A . 
E 3 HOH 152 571 419 HOH HOH A . 
E 3 HOH 153 572 563 HOH HOH A . 
F 3 HOH 1   420 420 HOH HOH B . 
F 3 HOH 2   421 421 HOH HOH B . 
F 3 HOH 3   422 422 HOH HOH B . 
F 3 HOH 4   423 423 HOH HOH B . 
F 3 HOH 5   424 424 HOH HOH B . 
F 3 HOH 6   425 425 HOH HOH B . 
F 3 HOH 7   426 426 HOH HOH B . 
F 3 HOH 8   427 427 HOH HOH B . 
F 3 HOH 9   428 428 HOH HOH B . 
F 3 HOH 10  429 429 HOH HOH B . 
F 3 HOH 11  430 430 HOH HOH B . 
F 3 HOH 12  431 431 HOH HOH B . 
F 3 HOH 13  432 432 HOH HOH B . 
F 3 HOH 14  433 433 HOH HOH B . 
F 3 HOH 15  434 434 HOH HOH B . 
F 3 HOH 16  435 435 HOH HOH B . 
F 3 HOH 17  436 436 HOH HOH B . 
F 3 HOH 18  437 437 HOH HOH B . 
F 3 HOH 19  438 438 HOH HOH B . 
F 3 HOH 20  439 439 HOH HOH B . 
F 3 HOH 21  440 440 HOH HOH B . 
F 3 HOH 22  441 441 HOH HOH B . 
F 3 HOH 23  442 442 HOH HOH B . 
F 3 HOH 24  443 443 HOH HOH B . 
F 3 HOH 25  444 444 HOH HOH B . 
F 3 HOH 26  445 445 HOH HOH B . 
F 3 HOH 27  446 446 HOH HOH B . 
F 3 HOH 28  447 447 HOH HOH B . 
F 3 HOH 29  448 448 HOH HOH B . 
F 3 HOH 30  449 449 HOH HOH B . 
F 3 HOH 31  450 450 HOH HOH B . 
F 3 HOH 32  451 451 HOH HOH B . 
F 3 HOH 33  452 452 HOH HOH B . 
F 3 HOH 34  453 453 HOH HOH B . 
F 3 HOH 35  454 454 HOH HOH B . 
F 3 HOH 36  455 455 HOH HOH B . 
F 3 HOH 37  456 456 HOH HOH B . 
F 3 HOH 38  457 457 HOH HOH B . 
F 3 HOH 39  458 458 HOH HOH B . 
F 3 HOH 40  459 459 HOH HOH B . 
F 3 HOH 41  460 460 HOH HOH B . 
F 3 HOH 42  461 461 HOH HOH B . 
F 3 HOH 43  462 462 HOH HOH B . 
F 3 HOH 44  463 463 HOH HOH B . 
F 3 HOH 45  464 464 HOH HOH B . 
F 3 HOH 46  465 465 HOH HOH B . 
F 3 HOH 47  466 466 HOH HOH B . 
F 3 HOH 48  467 467 HOH HOH B . 
F 3 HOH 49  468 468 HOH HOH B . 
F 3 HOH 50  469 469 HOH HOH B . 
F 3 HOH 51  470 470 HOH HOH B . 
F 3 HOH 52  471 471 HOH HOH B . 
F 3 HOH 53  472 472 HOH HOH B . 
F 3 HOH 54  473 473 HOH HOH B . 
F 3 HOH 55  474 474 HOH HOH B . 
F 3 HOH 56  475 475 HOH HOH B . 
F 3 HOH 57  476 476 HOH HOH B . 
F 3 HOH 58  477 477 HOH HOH B . 
F 3 HOH 59  478 478 HOH HOH B . 
F 3 HOH 60  479 479 HOH HOH B . 
F 3 HOH 61  480 480 HOH HOH B . 
F 3 HOH 62  481 481 HOH HOH B . 
F 3 HOH 63  482 482 HOH HOH B . 
F 3 HOH 64  483 483 HOH HOH B . 
F 3 HOH 65  484 484 HOH HOH B . 
F 3 HOH 66  485 485 HOH HOH B . 
F 3 HOH 67  486 486 HOH HOH B . 
F 3 HOH 68  487 487 HOH HOH B . 
F 3 HOH 69  488 488 HOH HOH B . 
F 3 HOH 70  489 489 HOH HOH B . 
F 3 HOH 71  490 490 HOH HOH B . 
F 3 HOH 72  491 491 HOH HOH B . 
F 3 HOH 73  492 492 HOH HOH B . 
F 3 HOH 74  493 493 HOH HOH B . 
F 3 HOH 75  494 494 HOH HOH B . 
F 3 HOH 76  495 495 HOH HOH B . 
F 3 HOH 77  496 496 HOH HOH B . 
F 3 HOH 78  497 497 HOH HOH B . 
F 3 HOH 79  498 498 HOH HOH B . 
F 3 HOH 80  499 499 HOH HOH B . 
F 3 HOH 81  500 500 HOH HOH B . 
F 3 HOH 82  501 501 HOH HOH B . 
F 3 HOH 83  502 502 HOH HOH B . 
F 3 HOH 84  503 503 HOH HOH B . 
F 3 HOH 85  504 504 HOH HOH B . 
F 3 HOH 86  505 505 HOH HOH B . 
F 3 HOH 87  506 506 HOH HOH B . 
F 3 HOH 88  507 507 HOH HOH B . 
F 3 HOH 89  508 508 HOH HOH B . 
F 3 HOH 90  509 509 HOH HOH B . 
F 3 HOH 91  510 510 HOH HOH B . 
F 3 HOH 92  511 511 HOH HOH B . 
F 3 HOH 93  512 512 HOH HOH B . 
F 3 HOH 94  513 513 HOH HOH B . 
F 3 HOH 95  514 514 HOH HOH B . 
F 3 HOH 96  515 515 HOH HOH B . 
F 3 HOH 97  516 516 HOH HOH B . 
F 3 HOH 98  517 517 HOH HOH B . 
F 3 HOH 99  518 518 HOH HOH B . 
F 3 HOH 100 519 519 HOH HOH B . 
F 3 HOH 101 520 520 HOH HOH B . 
F 3 HOH 102 521 521 HOH HOH B . 
F 3 HOH 103 522 522 HOH HOH B . 
F 3 HOH 104 523 523 HOH HOH B . 
F 3 HOH 105 524 524 HOH HOH B . 
F 3 HOH 106 525 525 HOH HOH B . 
F 3 HOH 107 526 526 HOH HOH B . 
F 3 HOH 108 527 527 HOH HOH B . 
F 3 HOH 109 528 528 HOH HOH B . 
F 3 HOH 110 529 529 HOH HOH B . 
F 3 HOH 111 530 530 HOH HOH B . 
F 3 HOH 112 531 531 HOH HOH B . 
F 3 HOH 113 532 532 HOH HOH B . 
F 3 HOH 114 533 533 HOH HOH B . 
F 3 HOH 115 534 534 HOH HOH B . 
F 3 HOH 116 535 535 HOH HOH B . 
F 3 HOH 117 536 536 HOH HOH B . 
F 3 HOH 118 537 537 HOH HOH B . 
F 3 HOH 119 538 538 HOH HOH B . 
F 3 HOH 120 539 539 HOH HOH B . 
F 3 HOH 121 540 540 HOH HOH B . 
F 3 HOH 122 541 541 HOH HOH B . 
F 3 HOH 123 542 542 HOH HOH B . 
F 3 HOH 124 543 543 HOH HOH B . 
F 3 HOH 125 544 544 HOH HOH B . 
F 3 HOH 126 545 545 HOH HOH B . 
F 3 HOH 127 546 546 HOH HOH B . 
F 3 HOH 128 547 547 HOH HOH B . 
F 3 HOH 129 548 548 HOH HOH B . 
F 3 HOH 130 549 549 HOH HOH B . 
F 3 HOH 131 550 550 HOH HOH B . 
F 3 HOH 132 551 551 HOH HOH B . 
F 3 HOH 133 552 552 HOH HOH B . 
F 3 HOH 134 553 553 HOH HOH B . 
F 3 HOH 135 554 554 HOH HOH B . 
F 3 HOH 136 555 555 HOH HOH B . 
F 3 HOH 137 556 556 HOH HOH B . 
F 3 HOH 138 557 557 HOH HOH B . 
F 3 HOH 139 558 558 HOH HOH B . 
F 3 HOH 140 559 559 HOH HOH B . 
F 3 HOH 141 560 560 HOH HOH B . 
F 3 HOH 142 561 561 HOH HOH B . 
F 3 HOH 143 562 562 HOH HOH B . 
F 3 HOH 144 563 418 HOH HOH B . 
F 3 HOH 145 564 564 HOH HOH B . 
F 3 HOH 146 565 565 HOH HOH B . 
F 3 HOH 147 566 566 HOH HOH B . 
F 3 HOH 148 567 567 HOH HOH B . 
F 3 HOH 149 568 568 HOH HOH B . 
F 3 HOH 150 569 569 HOH HOH B . 
F 3 HOH 151 570 570 HOH HOH B . 
F 3 HOH 152 571 571 HOH HOH B . 
F 3 HOH 153 572 419 HOH HOH B . 
#