data_3IW4
# 
_entry.id   3IW4 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.287 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3IW4         
RCSB  RCSB054938   
WWPDB D_1000054938 
# 
_pdbx_database_status.entry_id                        3IW4 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.recvd_initial_deposition_date   2009-09-02 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Stark, W.'         1 
'Rummel, G.'        2 
'Strauss, A.'       3 
'Cowan-Jacob, S.W.' 4 
# 
_citation.id                        primary 
_citation.title                     
;Discovery of 3-(1H-indol-3-yl)-4-[2-(4-methylpiperazin-1-yl)quinazolin-4-yl]pyrrole-2,5-dione (AEB071), a potent and selective inhibitor of protein kinase C isotypes
;
_citation.journal_abbrev            J.Med.Chem. 
_citation.journal_volume            52 
_citation.page_first                6193 
_citation.page_last                 6196 
_citation.year                      2009 
_citation.journal_id_ASTM           JMCMAR 
_citation.country                   US 
_citation.journal_id_ISSN           0022-2623 
_citation.journal_id_CSD            0151 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19827831 
_citation.pdbx_database_id_DOI      10.1021/jm901108b 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Wagner, J.'        1  
primary 'von Matt, P.'      2  
primary 'Sedrani, R.'       3  
primary 'Albert, R.'        4  
primary 'Cooke, N.'         5  
primary 'Ehrhardt, C.'      6  
primary 'Geiser, M.'        7  
primary 'Rummel, G.'        8  
primary 'Stark, W.'         9  
primary 'Strauss, A.'       10 
primary 'Cowan-Jacob, S.W.' 11 
primary 'Beerli, C.'        12 
primary 'Weckbecker, G.'    13 
primary 'Evenou, J.P.'      14 
primary 'Zenke, G.'         15 
primary 'Cottens, S.'       16 
# 
_cell.length_a           43.868 
_cell.length_b           100.669 
_cell.length_c           251.335 
_cell.angle_alpha        90.000 
_cell.angle_beta         90.000 
_cell.angle_gamma        90.000 
_cell.entry_id           3IW4 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              12 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.entry_id                         3IW4 
_symmetry.Int_Tables_number                19 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Protein kinase C alpha type'                                                          41571.387 3  2.7.11.13 ? 
'kinase domain, UNP residues 320-672' ? 
2 non-polymer syn '3-(1H-indol-3-yl)-4-[2-(4-methylpiperazin-1-yl)quinazolin-4-yl]-1H-pyrrole-2,5-dione' 438.481   3  ?         ? 
?                                     ? 
3 water       nat water                                                                                  18.015    46 ?         ? 
?                                     ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'PKC-alpha, PKC-A' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   yes 
_entity_poly.pdbx_seq_one_letter_code       
;MPSEDRKQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKGTEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPP
FLTQLHSCFQTVDRLYFVMEYVNGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIK
IADFGMCKEHMMDGVTTREFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDGEDEDELFQSIMEHNVSYP
KSLSKEAVSICKGLMTKHPAKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVL
(TPO)PPDQLVIANIDQSDFEGF(SEP)YVNPQFVHPILQSAVHHHHHH
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MPSEDRKQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKGTEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPP
FLTQLHSCFQTVDRLYFVMEYVNGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIK
IADFGMCKEHMMDGVTTREFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDGEDEDELFQSIMEHNVSYP
KSLSKEAVSICKGLMTKHPAKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLT
PPDQLVIANIDQSDFEGFSYVNPQFVHPILQSAVHHHHHH
;
_entity_poly.pdbx_strand_id                 A,B,C 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   PRO n 
1 3   SER n 
1 4   GLU n 
1 5   ASP n 
1 6   ARG n 
1 7   LYS n 
1 8   GLN n 
1 9   PRO n 
1 10  SER n 
1 11  ASN n 
1 12  ASN n 
1 13  LEU n 
1 14  ASP n 
1 15  ARG n 
1 16  VAL n 
1 17  LYS n 
1 18  LEU n 
1 19  THR n 
1 20  ASP n 
1 21  PHE n 
1 22  ASN n 
1 23  PHE n 
1 24  LEU n 
1 25  MET n 
1 26  VAL n 
1 27  LEU n 
1 28  GLY n 
1 29  LYS n 
1 30  GLY n 
1 31  SER n 
1 32  PHE n 
1 33  GLY n 
1 34  LYS n 
1 35  VAL n 
1 36  MET n 
1 37  LEU n 
1 38  ALA n 
1 39  ASP n 
1 40  ARG n 
1 41  LYS n 
1 42  GLY n 
1 43  THR n 
1 44  GLU n 
1 45  GLU n 
1 46  LEU n 
1 47  TYR n 
1 48  ALA n 
1 49  ILE n 
1 50  LYS n 
1 51  ILE n 
1 52  LEU n 
1 53  LYS n 
1 54  LYS n 
1 55  ASP n 
1 56  VAL n 
1 57  VAL n 
1 58  ILE n 
1 59  GLN n 
1 60  ASP n 
1 61  ASP n 
1 62  ASP n 
1 63  VAL n 
1 64  GLU n 
1 65  CYS n 
1 66  THR n 
1 67  MET n 
1 68  VAL n 
1 69  GLU n 
1 70  LYS n 
1 71  ARG n 
1 72  VAL n 
1 73  LEU n 
1 74  ALA n 
1 75  LEU n 
1 76  LEU n 
1 77  ASP n 
1 78  LYS n 
1 79  PRO n 
1 80  PRO n 
1 81  PHE n 
1 82  LEU n 
1 83  THR n 
1 84  GLN n 
1 85  LEU n 
1 86  HIS n 
1 87  SER n 
1 88  CYS n 
1 89  PHE n 
1 90  GLN n 
1 91  THR n 
1 92  VAL n 
1 93  ASP n 
1 94  ARG n 
1 95  LEU n 
1 96  TYR n 
1 97  PHE n 
1 98  VAL n 
1 99  MET n 
1 100 GLU n 
1 101 TYR n 
1 102 VAL n 
1 103 ASN n 
1 104 GLY n 
1 105 GLY n 
1 106 ASP n 
1 107 LEU n 
1 108 MET n 
1 109 TYR n 
1 110 HIS n 
1 111 ILE n 
1 112 GLN n 
1 113 GLN n 
1 114 VAL n 
1 115 GLY n 
1 116 LYS n 
1 117 PHE n 
1 118 LYS n 
1 119 GLU n 
1 120 PRO n 
1 121 GLN n 
1 122 ALA n 
1 123 VAL n 
1 124 PHE n 
1 125 TYR n 
1 126 ALA n 
1 127 ALA n 
1 128 GLU n 
1 129 ILE n 
1 130 SER n 
1 131 ILE n 
1 132 GLY n 
1 133 LEU n 
1 134 PHE n 
1 135 PHE n 
1 136 LEU n 
1 137 HIS n 
1 138 LYS n 
1 139 ARG n 
1 140 GLY n 
1 141 ILE n 
1 142 ILE n 
1 143 TYR n 
1 144 ARG n 
1 145 ASP n 
1 146 LEU n 
1 147 LYS n 
1 148 LEU n 
1 149 ASP n 
1 150 ASN n 
1 151 VAL n 
1 152 MET n 
1 153 LEU n 
1 154 ASP n 
1 155 SER n 
1 156 GLU n 
1 157 GLY n 
1 158 HIS n 
1 159 ILE n 
1 160 LYS n 
1 161 ILE n 
1 162 ALA n 
1 163 ASP n 
1 164 PHE n 
1 165 GLY n 
1 166 MET n 
1 167 CYS n 
1 168 LYS n 
1 169 GLU n 
1 170 HIS n 
1 171 MET n 
1 172 MET n 
1 173 ASP n 
1 174 GLY n 
1 175 VAL n 
1 176 THR n 
1 177 THR n 
1 178 ARG n 
1 179 GLU n 
1 180 PHE n 
1 181 CYS n 
1 182 GLY n 
1 183 THR n 
1 184 PRO n 
1 185 ASP n 
1 186 TYR n 
1 187 ILE n 
1 188 ALA n 
1 189 PRO n 
1 190 GLU n 
1 191 ILE n 
1 192 ILE n 
1 193 ALA n 
1 194 TYR n 
1 195 GLN n 
1 196 PRO n 
1 197 TYR n 
1 198 GLY n 
1 199 LYS n 
1 200 SER n 
1 201 VAL n 
1 202 ASP n 
1 203 TRP n 
1 204 TRP n 
1 205 ALA n 
1 206 TYR n 
1 207 GLY n 
1 208 VAL n 
1 209 LEU n 
1 210 LEU n 
1 211 TYR n 
1 212 GLU n 
1 213 MET n 
1 214 LEU n 
1 215 ALA n 
1 216 GLY n 
1 217 GLN n 
1 218 PRO n 
1 219 PRO n 
1 220 PHE n 
1 221 ASP n 
1 222 GLY n 
1 223 GLU n 
1 224 ASP n 
1 225 GLU n 
1 226 ASP n 
1 227 GLU n 
1 228 LEU n 
1 229 PHE n 
1 230 GLN n 
1 231 SER n 
1 232 ILE n 
1 233 MET n 
1 234 GLU n 
1 235 HIS n 
1 236 ASN n 
1 237 VAL n 
1 238 SER n 
1 239 TYR n 
1 240 PRO n 
1 241 LYS n 
1 242 SER n 
1 243 LEU n 
1 244 SER n 
1 245 LYS n 
1 246 GLU n 
1 247 ALA n 
1 248 VAL n 
1 249 SER n 
1 250 ILE n 
1 251 CYS n 
1 252 LYS n 
1 253 GLY n 
1 254 LEU n 
1 255 MET n 
1 256 THR n 
1 257 LYS n 
1 258 HIS n 
1 259 PRO n 
1 260 ALA n 
1 261 LYS n 
1 262 ARG n 
1 263 LEU n 
1 264 GLY n 
1 265 CYS n 
1 266 GLY n 
1 267 PRO n 
1 268 GLU n 
1 269 GLY n 
1 270 GLU n 
1 271 ARG n 
1 272 ASP n 
1 273 VAL n 
1 274 ARG n 
1 275 GLU n 
1 276 HIS n 
1 277 ALA n 
1 278 PHE n 
1 279 PHE n 
1 280 ARG n 
1 281 ARG n 
1 282 ILE n 
1 283 ASP n 
1 284 TRP n 
1 285 GLU n 
1 286 LYS n 
1 287 LEU n 
1 288 GLU n 
1 289 ASN n 
1 290 ARG n 
1 291 GLU n 
1 292 ILE n 
1 293 GLN n 
1 294 PRO n 
1 295 PRO n 
1 296 PHE n 
1 297 LYS n 
1 298 PRO n 
1 299 LYS n 
1 300 VAL n 
1 301 CYS n 
1 302 GLY n 
1 303 LYS n 
1 304 GLY n 
1 305 ALA n 
1 306 GLU n 
1 307 ASN n 
1 308 PHE n 
1 309 ASP n 
1 310 LYS n 
1 311 PHE n 
1 312 PHE n 
1 313 THR n 
1 314 ARG n 
1 315 GLY n 
1 316 GLN n 
1 317 PRO n 
1 318 VAL n 
1 319 LEU n 
1 320 TPO n 
1 321 PRO n 
1 322 PRO n 
1 323 ASP n 
1 324 GLN n 
1 325 LEU n 
1 326 VAL n 
1 327 ILE n 
1 328 ALA n 
1 329 ASN n 
1 330 ILE n 
1 331 ASP n 
1 332 GLN n 
1 333 SER n 
1 334 ASP n 
1 335 PHE n 
1 336 GLU n 
1 337 GLY n 
1 338 PHE n 
1 339 SEP n 
1 340 TYR n 
1 341 VAL n 
1 342 ASN n 
1 343 PRO n 
1 344 GLN n 
1 345 PHE n 
1 346 VAL n 
1 347 HIS n 
1 348 PRO n 
1 349 ILE n 
1 350 LEU n 
1 351 GLN n 
1 352 SER n 
1 353 ALA n 
1 354 VAL n 
1 355 HIS n 
1 356 HIS n 
1 357 HIS n 
1 358 HIS n 
1 359 HIS n 
1 360 HIS n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'PRKCA, PKCA, PRKACA' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Spodoptera frugiperda' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     7108 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pXI525e 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    KPCA_HUMAN 
_struct_ref.pdbx_db_accession          P17252 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;PSEDRKQPSNNLDRVKLTDFNFLMVLGKGSFGKVMLADRKGTEELYAIKILKKDVVIQDDDVECTMVEKRVLALLDKPPF
LTQLHSCFQTVDRLYFVMEYVNGGDLMYHIQQVGKFKEPQAVFYAAEISIGLFFLHKRGIIYRDLKLDNVMLDSEGHIKI
ADFGMCKEHMMDGVTTRTFCGTPDYIAPEIIAYQPYGKSVDWWAYGVLLYEMLAGQPPFDGEDEDELFQSIMEHNVSYPK
SLSKEAVSICKGLMTKHPAKRLGCGPEGERDVREHAFFRRIDWEKLENREIQPPFKPKVCGKGAENFDKFFTRGQPVLTP
PDQLVIANIDQSDFEGFSYVNPQFVHPILQSAV
;
_struct_ref.pdbx_align_begin           320 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3IW4 A 2 ? 354 ? P17252 320 ? 672 ? 320 672 
2 1 3IW4 B 2 ? 354 ? P17252 320 ? 672 ? 320 672 
3 1 3IW4 C 2 ? 354 ? P17252 320 ? 672 ? 320 672 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3IW4 MET A 1   ? UNP P17252 ?   ?   'CLONING ARTIFACT' 319 1  
1 3IW4 GLU A 179 ? UNP P17252 THR 497 ENGINEERED         497 2  
1 3IW4 HIS A 355 ? UNP P17252 ?   ?   'EXPRESSION TAG'   673 3  
1 3IW4 HIS A 356 ? UNP P17252 ?   ?   'EXPRESSION TAG'   674 4  
1 3IW4 HIS A 357 ? UNP P17252 ?   ?   'EXPRESSION TAG'   675 5  
1 3IW4 HIS A 358 ? UNP P17252 ?   ?   'EXPRESSION TAG'   676 6  
1 3IW4 HIS A 359 ? UNP P17252 ?   ?   'EXPRESSION TAG'   677 7  
1 3IW4 HIS A 360 ? UNP P17252 ?   ?   'EXPRESSION TAG'   678 8  
2 3IW4 MET B 1   ? UNP P17252 ?   ?   'CLONING ARTIFACT' 319 9  
2 3IW4 GLU B 179 ? UNP P17252 THR 497 ENGINEERED         497 10 
2 3IW4 HIS B 355 ? UNP P17252 ?   ?   'EXPRESSION TAG'   673 11 
2 3IW4 HIS B 356 ? UNP P17252 ?   ?   'EXPRESSION TAG'   674 12 
2 3IW4 HIS B 357 ? UNP P17252 ?   ?   'EXPRESSION TAG'   675 13 
2 3IW4 HIS B 358 ? UNP P17252 ?   ?   'EXPRESSION TAG'   676 14 
2 3IW4 HIS B 359 ? UNP P17252 ?   ?   'EXPRESSION TAG'   677 15 
2 3IW4 HIS B 360 ? UNP P17252 ?   ?   'EXPRESSION TAG'   678 16 
3 3IW4 MET C 1   ? UNP P17252 ?   ?   'CLONING ARTIFACT' 319 17 
3 3IW4 GLU C 179 ? UNP P17252 THR 497 ENGINEERED         497 18 
3 3IW4 HIS C 355 ? UNP P17252 ?   ?   'EXPRESSION TAG'   673 19 
3 3IW4 HIS C 356 ? UNP P17252 ?   ?   'EXPRESSION TAG'   674 20 
3 3IW4 HIS C 357 ? UNP P17252 ?   ?   'EXPRESSION TAG'   675 21 
3 3IW4 HIS C 358 ? UNP P17252 ?   ?   'EXPRESSION TAG'   676 22 
3 3IW4 HIS C 359 ? UNP P17252 ?   ?   'EXPRESSION TAG'   677 23 
3 3IW4 HIS C 360 ? UNP P17252 ?   ?   'EXPRESSION TAG'   678 24 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                                                                                ? 'C3 H7 N O2' 
89.093  
ARG 'L-peptide linking' y ARGININE                                                                               ? 
'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                             ? 'C4 H8 N2 O3' 
132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                        ? 'C4 H7 N O4' 
133.103 
CYS 'L-peptide linking' y CYSTEINE                                                                               ? 'C3 H7 N O2 S' 
121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                                              ? 'C5 H10 N2 O3' 
146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                        ? 'C5 H9 N O4' 
147.129 
GLY 'peptide linking'   y GLYCINE                                                                                ? 'C2 H5 N O2' 
75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                              ? 
'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                                                                  ? 'H2 O' 18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                             ? 'C6 H13 N O2' 
131.173 
LEU 'L-peptide linking' y LEUCINE                                                                                ? 'C6 H13 N O2' 
131.173 
LW4 non-polymer         . '3-(1H-indol-3-yl)-4-[2-(4-methylpiperazin-1-yl)quinazolin-4-yl]-1H-pyrrole-2,5-dione' ? 'C25 H22 N6 O2' 
438.481 
LYS 'L-peptide linking' y LYSINE                                                                                 ? 
'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                                                             ? 'C5 H11 N O2 S' 
149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                                          ? 'C9 H11 N O2' 
165.189 
PRO 'L-peptide linking' y PROLINE                                                                                ? 'C5 H9 N O2' 
115.130 
SEP 'L-peptide linking' n PHOSPHOSERINE                                                                          PHOSPHONOSERINE 
'C3 H8 N O6 P'   185.072 
SER 'L-peptide linking' y SERINE                                                                                 ? 'C3 H7 N O3' 
105.093 
THR 'L-peptide linking' y THREONINE                                                                              ? 'C4 H9 N O3' 
119.119 
TPO 'L-peptide linking' n PHOSPHOTHREONINE                                                                       
PHOSPHONOTHREONINE 'C4 H10 N O6 P'  199.099 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                             ? 'C11 H12 N2 O2' 
204.225 
TYR 'L-peptide linking' y TYROSINE                                                                               ? 'C9 H11 N O3' 
181.189 
VAL 'L-peptide linking' y VALINE                                                                                 ? 'C5 H11 N O2' 
117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3IW4 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.pdbx_mosaicity        ? 
_exptl_crystal.pdbx_mosaicity_esd    ? 
_exptl_crystal.density_Matthews      2.22 
_exptl_crystal.density_diffrn        ? 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_meas_temp     ? 
_exptl_crystal.density_percent_sol   44.72 
_exptl_crystal.size_max              ? 
_exptl_crystal.size_mid              ? 
_exptl_crystal.size_min              ? 
_exptl_crystal.size_rad              ? 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.pH              5.1 
_exptl_crystal_grow.temp            278 
_exptl_crystal_grow.pdbx_details    
;protein solution: 12mg/mL in 0.2M NaCl, 0.05M imidazole, pH8.0, 2mM TCEP, 1mM NAF, 2% glycerol, reservoir solution: 1mL 22% polyethyleneglycol 3350, 0.2M di-ammonium-hydrogen citrate, pH5.1, VAPOR DIFFUSION, HANGING DROP, temperature 278K
;
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2006-06-01 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97880 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'SLS BEAMLINE X10SA' 
_diffrn_source.pdbx_wavelength_list        0.97880 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_site       SLS 
_diffrn_source.pdbx_synchrotron_beamline   X10SA 
# 
_reflns.entry_id                     3IW4 
_reflns.d_resolution_high            2.800 
_reflns.number_obs                   28331 
_reflns.pdbx_Rmerge_I_obs            0.138 
_reflns.pdbx_netI_over_sigmaI        9.210 
_reflns.percent_possible_obs         99.500 
_reflns.B_iso_Wilson_estimate        45.933 
_reflns.observed_criterion_sigma_I   -3.00 
_reflns.observed_criterion_sigma_F   0.0 
_reflns.d_resolution_low             100.0 
_reflns.number_all                   28331 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_redundancy              4.5 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.80 
_reflns_shell.d_res_low              2.92 
_reflns_shell.number_measured_obs    13561 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_unique_obs      3185 
_reflns_shell.Rmerge_I_obs           0.664 
_reflns_shell.meanI_over_sigI_obs    2.3 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_redundancy        ? 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.percent_possible_all   98.50 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3IW4 
_refine.ls_d_res_high                            2.80 
_refine.ls_d_res_low                             64.42 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    99.48 
_refine.ls_number_reflns_obs                     26913 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'U VALUES: RESIDUAL ONLY' 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.19625 
_refine.ls_R_factor_R_work                       0.19209 
_refine.ls_wR_factor_R_work                      0.171 
_refine.ls_R_factor_R_free                       0.27703 
_refine.ls_wR_factor_R_free                      0.247 
_refine.ls_percent_reflns_R_free                 5.000 
_refine.ls_number_reflns_R_free                  1417 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               39.781 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            -1.33 
_refine.aniso_B[2][2]                            1.46 
_refine.aniso_B[3][3]                            -0.13 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.correlation_coeff_Fo_to_Fc               0.940 
_refine.correlation_coeff_Fo_to_Fc_free          0.876 
_refine.overall_SU_R_Cruickshank_DPI             0.320 
_refine.overall_SU_R_free                        0.439 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  0.436 
_refine.overall_SU_ML                            0.335 
_refine.overall_SU_B                             37.860 
_refine.solvent_model_details                    MASK 
_refine.pdbx_solvent_vdw_probe_radii             1.40 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'FOURIER SYNTHESIS' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   0.808 
_refine.B_iso_max                                94.52 
_refine.B_iso_min                                8.48 
_refine.occupancy_max                            1.00 
_refine.occupancy_min                            1.00 
_refine.pdbx_ls_sigma_I                          0.0 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_TLS_residual_ADP_flag               'LIKELY RESIDUAL' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        8051 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         99 
_refine_hist.number_atoms_solvent             46 
_refine_hist.number_atoms_total               8196 
_refine_hist.d_res_high                       2.80 
_refine_hist.d_res_low                        64.42 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d             0.011  0.022  ? 8366  'X-RAY DIFFRACTION' ? 
r_bond_other_d               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_angle_refined_deg          1.424  1.988  ? 11315 'X-RAY DIFFRACTION' ? 
r_angle_other_deg            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg       6.517  5.000  ? 986   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg       37.039 24.364 ? 401   'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg       19.114 15.031 ? 1460  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg       21.062 15.000 ? 42    'X-RAY DIFFRACTION' ? 
r_chiral_restr               0.088  0.200  ? 1178  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined         0.006  0.021  ? 6361  'X-RAY DIFFRACTION' ? 
r_gen_planes_other           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_refined                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbd_other                  ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_refined              ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_nbtor_other                ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined        ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_other          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_refined          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_metal_ion_other            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_other         ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined     ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_other       ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_refined ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_symmetry_metal_ion_other   ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcbond_it                  1.136  2.000  ? 4946  'X-RAY DIFFRACTION' ? 
r_mcbond_other               ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_mcangle_it                 2.233  3.000  ? 8005  'X-RAY DIFFRACTION' ? 
r_scbond_it                  3.531  4.500  ? 3420  'X-RAY DIFFRACTION' ? 
r_scangle_it                 5.383  6.000  ? 3310  'X-RAY DIFFRACTION' ? 
r_rigid_bond_restr           ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_free            ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
r_sphericity_bonded          ?      ?      ? ?     'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       2.800 
_refine_ls_shell.d_res_low                        2.873 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               98.59 
_refine_ls_shell.number_reflns_R_work             1927 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.251 
_refine_ls_shell.R_factor_R_free                  0.332 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             101 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                2028 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3IW4 
_struct.title                     'Crystal structure of PKC alpha in complex with NVP-AEB071' 
_struct.pdbx_descriptor           'Protein kinase C alpha type' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3IW4 
_struct_keywords.text            
;kinase, ATP-binding, Cell membrane, Membrane, Metal-binding, Nucleotide-binding, Phorbol-ester binding, Phosphoprotein, Serine/threonine-protein kinase, Transferase, Zinc-finger
;
_struct_keywords.pdbx_keywords   TRANSFERASE 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 2 ? 
E N N 2 ? 
F N N 2 ? 
G N N 3 ? 
H N N 3 ? 
I N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LYS A 17  ? THR A 19  ? LYS A 335 THR A 337 5 ? 3  
HELX_P HELX_P2  2  LYS A 54  ? ASP A 60  ? LYS A 372 ASP A 378 1 ? 7  
HELX_P HELX_P3  3  ASP A 62  ? LEU A 75  ? ASP A 380 LEU A 393 1 ? 14 
HELX_P HELX_P4  4  LEU A 107 ? GLY A 115 ? LEU A 425 GLY A 433 1 ? 9  
HELX_P HELX_P5  5  LYS A 118 ? ARG A 139 ? LYS A 436 ARG A 457 1 ? 22 
HELX_P HELX_P6  6  LYS A 147 ? ASP A 149 ? LYS A 465 ASP A 467 5 ? 3  
HELX_P HELX_P7  7  THR A 183 ? ILE A 187 ? THR A 501 ILE A 505 5 ? 5  
HELX_P HELX_P8  8  ALA A 188 ? ALA A 193 ? ALA A 506 ALA A 511 1 ? 6  
HELX_P HELX_P9  9  LYS A 199 ? GLY A 216 ? LYS A 517 GLY A 534 1 ? 18 
HELX_P HELX_P10 10 ASP A 224 ? HIS A 235 ? ASP A 542 HIS A 553 1 ? 12 
HELX_P HELX_P11 11 SER A 244 ? MET A 255 ? SER A 562 MET A 573 1 ? 12 
HELX_P HELX_P12 12 GLU A 268 ? GLU A 275 ? GLU A 586 GLU A 593 1 ? 8  
HELX_P HELX_P13 13 HIS A 276 ? ARG A 280 ? HIS A 594 ARG A 598 5 ? 5  
HELX_P HELX_P14 14 ASP A 283 ? GLU A 288 ? ASP A 601 GLU A 606 1 ? 6  
HELX_P HELX_P15 15 ASP A 323 ? ASN A 329 ? ASP A 641 ASN A 647 1 ? 7  
HELX_P HELX_P16 16 ILE A 330 ? GLU A 336 ? ILE A 648 GLU A 654 5 ? 7  
HELX_P HELX_P17 17 LYS B 17  ? THR B 19  ? LYS B 335 THR B 337 5 ? 3  
HELX_P HELX_P18 18 LYS B 54  ? ASP B 60  ? LYS B 372 ASP B 378 1 ? 7  
HELX_P HELX_P19 19 ASP B 62  ? LEU B 75  ? ASP B 380 LEU B 393 1 ? 14 
HELX_P HELX_P20 20 ASP B 106 ? GLY B 115 ? ASP B 424 GLY B 433 1 ? 10 
HELX_P HELX_P21 21 LYS B 118 ? ARG B 139 ? LYS B 436 ARG B 457 1 ? 22 
HELX_P HELX_P22 22 LYS B 147 ? ASP B 149 ? LYS B 465 ASP B 467 5 ? 3  
HELX_P HELX_P23 23 THR B 183 ? ILE B 187 ? THR B 501 ILE B 505 5 ? 5  
HELX_P HELX_P24 24 ALA B 188 ? TYR B 194 ? ALA B 506 TYR B 512 1 ? 7  
HELX_P HELX_P25 25 LYS B 199 ? GLY B 216 ? LYS B 517 GLY B 534 1 ? 18 
HELX_P HELX_P26 26 ASP B 224 ? HIS B 235 ? ASP B 542 HIS B 553 1 ? 12 
HELX_P HELX_P27 27 SER B 244 ? MET B 255 ? SER B 562 MET B 573 1 ? 12 
HELX_P HELX_P28 28 HIS B 258 ? ARG B 262 ? HIS B 576 ARG B 580 5 ? 5  
HELX_P HELX_P29 29 GLU B 268 ? HIS B 276 ? GLU B 586 HIS B 594 1 ? 9  
HELX_P HELX_P30 30 ALA B 277 ? ARG B 280 ? ALA B 595 ARG B 598 5 ? 4  
HELX_P HELX_P31 31 ASP B 283 ? GLU B 288 ? ASP B 601 GLU B 606 1 ? 6  
HELX_P HELX_P32 32 ASP B 323 ? ALA B 328 ? ASP B 641 ALA B 646 1 ? 6  
HELX_P HELX_P33 33 ASN B 329 ? ILE B 330 ? ASN B 647 ILE B 648 5 ? 2  
HELX_P HELX_P34 34 ASP B 331 ? GLU B 336 ? ASP B 649 GLU B 654 5 ? 6  
HELX_P HELX_P35 35 LYS C 17  ? THR C 19  ? LYS C 335 THR C 337 5 ? 3  
HELX_P HELX_P36 36 LYS C 54  ? ASP C 60  ? LYS C 372 ASP C 378 1 ? 7  
HELX_P HELX_P37 37 ASP C 62  ? LEU C 75  ? ASP C 380 LEU C 393 1 ? 14 
HELX_P HELX_P38 38 ASP C 106 ? GLY C 115 ? ASP C 424 GLY C 433 1 ? 10 
HELX_P HELX_P39 39 LYS C 118 ? ARG C 139 ? LYS C 436 ARG C 457 1 ? 22 
HELX_P HELX_P40 40 LYS C 147 ? ASP C 149 ? LYS C 465 ASP C 467 5 ? 3  
HELX_P HELX_P41 41 THR C 183 ? ILE C 187 ? THR C 501 ILE C 505 5 ? 5  
HELX_P HELX_P42 42 ALA C 188 ? ALA C 193 ? ALA C 506 ALA C 511 1 ? 6  
HELX_P HELX_P43 43 LYS C 199 ? GLY C 216 ? LYS C 517 GLY C 534 1 ? 18 
HELX_P HELX_P44 44 ASP C 224 ? HIS C 235 ? ASP C 542 HIS C 553 1 ? 12 
HELX_P HELX_P45 45 SER C 244 ? MET C 255 ? SER C 562 MET C 573 1 ? 12 
HELX_P HELX_P46 46 HIS C 258 ? ARG C 262 ? HIS C 576 ARG C 580 5 ? 5  
HELX_P HELX_P47 47 GLU C 268 ? GLU C 275 ? GLU C 586 GLU C 593 1 ? 8  
HELX_P HELX_P48 48 HIS C 276 ? ARG C 280 ? HIS C 594 ARG C 598 5 ? 5  
HELX_P HELX_P49 49 ASP C 283 ? ASN C 289 ? ASP C 601 ASN C 607 1 ? 7  
HELX_P HELX_P50 50 ASP C 323 ? ASN C 329 ? ASP C 641 ASN C 647 1 ? 7  
HELX_P HELX_P51 51 ILE C 330 ? GLU C 336 ? ILE C 648 GLU C 654 5 ? 7  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
covale1  covale ? ? A LEU 319 C ? ? ? 1_555 A TPO 320 N ? ? A LEU 637 A TPO 638 1_555 ? ? ? ? ? ? ? 1.322 ? 
covale2  covale ? ? A TPO 320 C ? ? ? 1_555 A PRO 321 N ? ? A TPO 638 A PRO 639 1_555 ? ? ? ? ? ? ? 1.337 ? 
covale3  covale ? ? A PHE 338 C ? ? ? 1_555 A SEP 339 N ? ? A PHE 656 A SEP 657 1_555 ? ? ? ? ? ? ? 1.326 ? 
covale4  covale ? ? A SEP 339 C ? ? ? 1_555 A TYR 340 N ? ? A SEP 657 A TYR 658 1_555 ? ? ? ? ? ? ? 1.324 ? 
covale5  covale ? ? B LEU 319 C ? ? ? 1_555 B TPO 320 N ? ? B LEU 637 B TPO 638 1_555 ? ? ? ? ? ? ? 1.339 ? 
covale6  covale ? ? B TPO 320 C ? ? ? 1_555 B PRO 321 N ? ? B TPO 638 B PRO 639 1_555 ? ? ? ? ? ? ? 1.343 ? 
covale7  covale ? ? B PHE 338 C ? ? ? 1_555 B SEP 339 N ? ? B PHE 656 B SEP 657 1_555 ? ? ? ? ? ? ? 1.315 ? 
covale8  covale ? ? B SEP 339 C ? ? ? 1_555 B TYR 340 N ? ? B SEP 657 B TYR 658 1_555 ? ? ? ? ? ? ? 1.324 ? 
covale9  covale ? ? C LEU 319 C ? ? ? 1_555 C TPO 320 N ? ? C LEU 637 C TPO 638 1_555 ? ? ? ? ? ? ? 1.330 ? 
covale10 covale ? ? C TPO 320 C ? ? ? 1_555 C PRO 321 N ? ? C TPO 638 C PRO 639 1_555 ? ? ? ? ? ? ? 1.347 ? 
covale11 covale ? ? C PHE 338 C ? ? ? 1_555 C SEP 339 N ? ? C PHE 656 C SEP 657 1_555 ? ? ? ? ? ? ? 1.321 ? 
covale12 covale ? ? C SEP 339 C ? ? ? 1_555 C TYR 340 N ? ? C SEP 657 C TYR 658 1_555 ? ? ? ? ? ? ? 1.326 ? 
# 
_struct_conn_type.id          covale 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 3 ? 
C ? 6 ? 
D ? 2 ? 
E ? 6 ? 
F ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
C 4 5 ? anti-parallel 
C 5 6 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
E 4 5 ? anti-parallel 
E 5 6 ? anti-parallel 
F 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 21  ? GLY A 30  ? PHE A 339 GLY A 348 
A 2 GLY A 33  ? ARG A 40  ? GLY A 351 ARG A 358 
A 3 LEU A 46  ? LYS A 53  ? LEU A 364 LYS A 371 
A 4 ARG A 94  ? GLU A 100 ? ARG A 412 GLU A 418 
A 5 LEU A 85  ? GLN A 90  ? LEU A 403 GLN A 408 
A 6 TYR A 340 ? VAL A 341 ? TYR A 658 VAL A 659 
B 1 GLY A 105 ? ASP A 106 ? GLY A 423 ASP A 424 
B 2 VAL A 151 ? LEU A 153 ? VAL A 469 LEU A 471 
B 3 ILE A 159 ? ILE A 161 ? ILE A 477 ILE A 479 
C 1 PHE B 21  ? GLY B 30  ? PHE B 339 GLY B 348 
C 2 GLY B 33  ? ARG B 40  ? GLY B 351 ARG B 358 
C 3 LEU B 46  ? LYS B 53  ? LEU B 364 LYS B 371 
C 4 ARG B 94  ? GLU B 100 ? ARG B 412 GLU B 418 
C 5 LEU B 85  ? GLN B 90  ? LEU B 403 GLN B 408 
C 6 TYR B 340 ? VAL B 341 ? TYR B 658 VAL B 659 
D 1 VAL B 151 ? LEU B 153 ? VAL B 469 LEU B 471 
D 2 ILE B 159 ? ILE B 161 ? ILE B 477 ILE B 479 
E 1 PHE C 21  ? GLY C 30  ? PHE C 339 GLY C 348 
E 2 GLY C 33  ? ARG C 40  ? GLY C 351 ARG C 358 
E 3 LEU C 46  ? LYS C 53  ? LEU C 364 LYS C 371 
E 4 ARG C 94  ? MET C 99  ? ARG C 412 MET C 417 
E 5 LEU C 85  ? GLN C 90  ? LEU C 403 GLN C 408 
E 6 TYR C 340 ? VAL C 341 ? TYR C 658 VAL C 659 
F 1 VAL C 151 ? LEU C 153 ? VAL C 469 LEU C 471 
F 2 ILE C 159 ? ILE C 161 ? ILE C 477 ILE C 479 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 27  ? N LEU A 345 O VAL A 35  ? O VAL A 353 
A 2 3 N ALA A 38  ? N ALA A 356 O TYR A 47  ? O TYR A 365 
A 3 4 N ALA A 48  ? N ALA A 366 O MET A 99  ? O MET A 417 
A 4 5 O VAL A 98  ? O VAL A 416 N HIS A 86  ? N HIS A 404 
A 5 6 N CYS A 88  ? N CYS A 406 O TYR A 340 ? O TYR A 658 
B 1 2 N GLY A 105 ? N GLY A 423 O LEU A 153 ? O LEU A 471 
B 2 3 N MET A 152 ? N MET A 470 O LYS A 160 ? O LYS A 478 
C 1 2 N MET B 25  ? N MET B 343 O LEU B 37  ? O LEU B 355 
C 2 3 N ALA B 38  ? N ALA B 356 O TYR B 47  ? O TYR B 365 
C 3 4 N ALA B 48  ? N ALA B 366 O MET B 99  ? O MET B 417 
C 4 5 O VAL B 98  ? O VAL B 416 N HIS B 86  ? N HIS B 404 
C 5 6 N CYS B 88  ? N CYS B 406 O TYR B 340 ? O TYR B 658 
D 1 2 N MET B 152 ? N MET B 470 O LYS B 160 ? O LYS B 478 
E 1 2 N MET C 25  ? N MET C 343 O LEU C 37  ? O LEU C 355 
E 2 3 N ALA C 38  ? N ALA C 356 O TYR C 47  ? O TYR C 365 
E 3 4 N ALA C 48  ? N ALA C 366 O MET C 99  ? O MET C 417 
E 4 5 O VAL C 98  ? O VAL C 416 N SER C 87  ? N SER C 405 
E 5 6 N CYS C 88  ? N CYS C 406 O TYR C 340 ? O TYR C 658 
F 1 2 N MET C 152 ? N MET C 470 O LYS C 160 ? O LYS C 478 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE LW4 A 901' 
AC2 Software ? ? ? ? 14 'BINDING SITE FOR RESIDUE LW4 B 901' 
AC3 Software ? ? ? ? 15 'BINDING SITE FOR RESIDUE LW4 C 901' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 14 LEU A 27  ? LEU A 345 . ? 1_555 ? 
2  AC1 14 PHE A 32  ? PHE A 350 . ? 1_555 ? 
3  AC1 14 VAL A 35  ? VAL A 353 . ? 1_555 ? 
4  AC1 14 ALA A 48  ? ALA A 366 . ? 1_555 ? 
5  AC1 14 GLU A 69  ? GLU A 387 . ? 1_555 ? 
6  AC1 14 THR A 83  ? THR A 401 . ? 1_555 ? 
7  AC1 14 MET A 99  ? MET A 417 . ? 1_555 ? 
8  AC1 14 GLU A 100 ? GLU A 418 . ? 1_555 ? 
9  AC1 14 TYR A 101 ? TYR A 419 . ? 1_555 ? 
10 AC1 14 VAL A 102 ? VAL A 420 . ? 1_555 ? 
11 AC1 14 ASP A 149 ? ASP A 467 . ? 1_555 ? 
12 AC1 14 MET A 152 ? MET A 470 . ? 1_555 ? 
13 AC1 14 ALA A 162 ? ALA A 480 . ? 1_555 ? 
14 AC1 14 ASP A 163 ? ASP A 481 . ? 1_555 ? 
15 AC2 14 LEU B 27  ? LEU B 345 . ? 1_555 ? 
16 AC2 14 PHE B 32  ? PHE B 350 . ? 1_555 ? 
17 AC2 14 ALA B 48  ? ALA B 366 . ? 1_555 ? 
18 AC2 14 GLU B 69  ? GLU B 387 . ? 1_555 ? 
19 AC2 14 THR B 83  ? THR B 401 . ? 1_555 ? 
20 AC2 14 MET B 99  ? MET B 417 . ? 1_555 ? 
21 AC2 14 GLU B 100 ? GLU B 418 . ? 1_555 ? 
22 AC2 14 TYR B 101 ? TYR B 419 . ? 1_555 ? 
23 AC2 14 VAL B 102 ? VAL B 420 . ? 1_555 ? 
24 AC2 14 ASP B 106 ? ASP B 424 . ? 1_555 ? 
25 AC2 14 ASP B 149 ? ASP B 467 . ? 1_555 ? 
26 AC2 14 MET B 152 ? MET B 470 . ? 1_555 ? 
27 AC2 14 ALA B 162 ? ALA B 480 . ? 1_555 ? 
28 AC2 14 ASP B 163 ? ASP B 481 . ? 1_555 ? 
29 AC3 15 LEU C 27  ? LEU C 345 . ? 1_555 ? 
30 AC3 15 PHE C 32  ? PHE C 350 . ? 1_555 ? 
31 AC3 15 VAL C 35  ? VAL C 353 . ? 1_555 ? 
32 AC3 15 ALA C 48  ? ALA C 366 . ? 1_555 ? 
33 AC3 15 LYS C 50  ? LYS C 368 . ? 1_555 ? 
34 AC3 15 GLU C 69  ? GLU C 387 . ? 1_555 ? 
35 AC3 15 THR C 83  ? THR C 401 . ? 1_555 ? 
36 AC3 15 GLU C 100 ? GLU C 418 . ? 1_555 ? 
37 AC3 15 TYR C 101 ? TYR C 419 . ? 1_555 ? 
38 AC3 15 VAL C 102 ? VAL C 420 . ? 1_555 ? 
39 AC3 15 ASP C 149 ? ASP C 467 . ? 1_555 ? 
40 AC3 15 ASN C 150 ? ASN C 468 . ? 1_555 ? 
41 AC3 15 MET C 152 ? MET C 470 . ? 1_555 ? 
42 AC3 15 ALA C 162 ? ALA C 480 . ? 1_555 ? 
43 AC3 15 ASP C 163 ? ASP C 481 . ? 1_555 ? 
# 
_atom_sites.entry_id                    3IW4 
_atom_sites.fract_transf_matrix[1][1]   0.022796 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.009934 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.003979 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . LEU A 1 13  ? -11.824 50.235 52.489  1.00 68.16 ? 331 LEU A N   1 
ATOM   2    C CA  . LEU A 1 13  ? -11.116 49.142 51.766  1.00 67.41 ? 331 LEU A CA  1 
ATOM   3    C C   . LEU A 1 13  ? -9.686  49.575 51.443  1.00 67.16 ? 331 LEU A C   1 
ATOM   4    O O   . LEU A 1 13  ? -9.465  50.653 50.896  1.00 67.61 ? 331 LEU A O   1 
ATOM   5    C CB  . LEU A 1 13  ? -11.877 48.761 50.488  1.00 67.01 ? 331 LEU A CB  1 
ATOM   6    N N   . ASP A 1 14  ? -8.719  48.732 51.797  1.00 66.97 ? 332 ASP A N   1 
ATOM   7    C CA  . ASP A 1 14  ? -7.303  49.000 51.546  1.00 66.31 ? 332 ASP A CA  1 
ATOM   8    C C   . ASP A 1 14  ? -6.886  48.412 50.199  1.00 65.29 ? 332 ASP A C   1 
ATOM   9    O O   . ASP A 1 14  ? -5.782  47.890 50.054  1.00 65.02 ? 332 ASP A O   1 
ATOM   10   C CB  . ASP A 1 14  ? -6.448  48.400 52.674  1.00 66.76 ? 332 ASP A CB  1 
ATOM   11   C CG  . ASP A 1 14  ? -5.061  49.024 52.758  1.00 67.20 ? 332 ASP A CG  1 
ATOM   12   O OD1 . ASP A 1 14  ? -4.904  50.161 52.267  1.00 66.87 ? 332 ASP A OD1 1 
ATOM   13   O OD2 . ASP A 1 14  ? -4.134  48.387 53.312  1.00 63.87 ? 332 ASP A OD2 1 
ATOM   14   N N   . ARG A 1 15  ? -7.772  48.523 49.212  1.00 64.61 ? 333 ARG A N   1 
ATOM   15   C CA  . ARG A 1 15  ? -7.640  47.799 47.944  1.00 63.98 ? 333 ARG A CA  1 
ATOM   16   C C   . ARG A 1 15  ? -6.307  48.025 47.221  1.00 63.19 ? 333 ARG A C   1 
ATOM   17   O O   . ARG A 1 15  ? -5.781  49.139 47.196  1.00 62.97 ? 333 ARG A O   1 
ATOM   18   C CB  . ARG A 1 15  ? -8.810  48.135 47.001  1.00 64.29 ? 333 ARG A CB  1 
ATOM   19   C CG  . ARG A 1 15  ? -9.391  46.927 46.258  1.00 64.52 ? 333 ARG A CG  1 
ATOM   20   C CD  . ARG A 1 15  ? -9.930  47.302 44.884  1.00 67.69 ? 333 ARG A CD  1 
ATOM   21   N NE  . ARG A 1 15  ? -8.834  47.595 43.963  1.00 71.96 ? 333 ARG A NE  1 
ATOM   22   C CZ  . ARG A 1 15  ? -8.573  48.795 43.448  1.00 73.30 ? 333 ARG A CZ  1 
ATOM   23   N NH1 . ARG A 1 15  ? -9.350  49.833 43.741  1.00 72.47 ? 333 ARG A NH1 1 
ATOM   24   N NH2 . ARG A 1 15  ? -7.534  48.954 42.632  1.00 71.95 ? 333 ARG A NH2 1 
ATOM   25   N N   . VAL A 1 16  ? -5.777  46.945 46.643  1.00 62.09 ? 334 VAL A N   1 
ATOM   26   C CA  . VAL A 1 16  ? -4.619  46.989 45.744  1.00 59.88 ? 334 VAL A CA  1 
ATOM   27   C C   . VAL A 1 16  ? -4.910  46.204 44.459  1.00 58.66 ? 334 VAL A C   1 
ATOM   28   O O   . VAL A 1 16  ? -5.734  45.288 44.464  1.00 58.85 ? 334 VAL A O   1 
ATOM   29   C CB  . VAL A 1 16  ? -3.360  46.392 46.405  1.00 59.36 ? 334 VAL A CB  1 
ATOM   30   C CG1 . VAL A 1 16  ? -2.548  47.474 47.079  1.00 59.46 ? 334 VAL A CG1 1 
ATOM   31   C CG2 . VAL A 1 16  ? -3.739  45.310 47.396  1.00 58.39 ? 334 VAL A CG2 1 
ATOM   32   N N   . LYS A 1 17  ? -4.254  46.579 43.363  1.00 56.64 ? 335 LYS A N   1 
ATOM   33   C CA  . LYS A 1 17  ? -4.258  45.766 42.150  1.00 55.07 ? 335 LYS A CA  1 
ATOM   34   C C   . LYS A 1 17  ? -2.836  45.330 41.862  1.00 55.72 ? 335 LYS A C   1 
ATOM   35   O O   . LYS A 1 17  ? -1.956  45.448 42.722  1.00 56.03 ? 335 LYS A O   1 
ATOM   36   C CB  . LYS A 1 17  ? -4.818  46.528 40.960  1.00 54.55 ? 335 LYS A CB  1 
ATOM   37   C CG  . LYS A 1 17  ? -4.043  47.771 40.605  1.00 52.66 ? 335 LYS A CG  1 
ATOM   38   C CD  . LYS A 1 17  ? -4.980  48.823 40.083  1.00 52.05 ? 335 LYS A CD  1 
ATOM   39   C CE  . LYS A 1 17  ? -4.722  50.151 40.773  1.00 54.52 ? 335 LYS A CE  1 
ATOM   40   N NZ  . LYS A 1 17  ? -5.963  50.974 40.850  1.00 52.85 ? 335 LYS A NZ  1 
ATOM   41   N N   . LEU A 1 18  ? -2.598  44.827 40.655  1.00 55.66 ? 336 LEU A N   1 
ATOM   42   C CA  . LEU A 1 18  ? -1.275  44.291 40.320  1.00 55.18 ? 336 LEU A CA  1 
ATOM   43   C C   . LEU A 1 18  ? -0.181  45.362 40.272  1.00 55.07 ? 336 LEU A C   1 
ATOM   44   O O   . LEU A 1 18  ? 0.791   45.269 41.010  1.00 54.57 ? 336 LEU A O   1 
ATOM   45   C CB  . LEU A 1 18  ? -1.338  43.477 39.022  1.00 54.95 ? 336 LEU A CB  1 
ATOM   46   C CG  . LEU A 1 18  ? -0.089  42.790 38.452  1.00 52.29 ? 336 LEU A CG  1 
ATOM   47   C CD1 . LEU A 1 18  ? 0.786   42.163 39.526  1.00 47.42 ? 336 LEU A CD1 1 
ATOM   48   C CD2 . LEU A 1 18  ? -0.516  41.747 37.415  1.00 47.09 ? 336 LEU A CD2 1 
ATOM   49   N N   . THR A 1 19  ? -0.367  46.391 39.443  1.00 56.17 ? 337 THR A N   1 
ATOM   50   C CA  . THR A 1 19  ? 0.654   47.432 39.216  1.00 57.12 ? 337 THR A CA  1 
ATOM   51   C C   . THR A 1 19  ? 1.208   48.070 40.481  1.00 57.80 ? 337 THR A C   1 
ATOM   52   O O   . THR A 1 19  ? 2.255   48.724 40.424  1.00 59.09 ? 337 THR A O   1 
ATOM   53   C CB  . THR A 1 19  ? 0.154   48.622 38.341  1.00 57.25 ? 337 THR A CB  1 
ATOM   54   O OG1 . THR A 1 19  ? -1.154  48.363 37.817  1.00 56.80 ? 337 THR A OG1 1 
ATOM   55   C CG2 . THR A 1 19  ? 1.147   48.925 37.213  1.00 57.02 ? 337 THR A CG2 1 
ATOM   56   N N   . ASP A 1 20  ? 0.505   47.916 41.605  1.00 57.67 ? 338 ASP A N   1 
ATOM   57   C CA  . ASP A 1 20  ? 0.951   48.512 42.874  1.00 57.88 ? 338 ASP A CA  1 
ATOM   58   C C   . ASP A 1 20  ? 2.185   47.794 43.434  1.00 56.94 ? 338 ASP A C   1 
ATOM   59   O O   . ASP A 1 20  ? 2.615   48.067 44.563  1.00 57.07 ? 338 ASP A O   1 
ATOM   60   C CB  . ASP A 1 20  ? -0.173  48.508 43.919  1.00 58.40 ? 338 ASP A CB  1 
ATOM   61   C CG  . ASP A 1 20  ? -1.514  48.958 43.349  1.00 61.94 ? 338 ASP A CG  1 
ATOM   62   O OD1 . ASP A 1 20  ? -1.569  49.302 42.147  1.00 65.24 ? 338 ASP A OD1 1 
ATOM   63   O OD2 . ASP A 1 20  ? -2.519  48.961 44.099  1.00 63.47 ? 338 ASP A OD2 1 
ATOM   64   N N   . PHE A 1 21  ? 2.759   46.891 42.636  1.00 55.28 ? 339 PHE A N   1 
ATOM   65   C CA  . PHE A 1 21  ? 3.816   46.008 43.125  1.00 54.03 ? 339 PHE A CA  1 
ATOM   66   C C   . PHE A 1 21  ? 5.082   45.912 42.272  1.00 53.49 ? 339 PHE A C   1 
ATOM   67   O O   . PHE A 1 21  ? 5.035   45.926 41.042  1.00 53.13 ? 339 PHE A O   1 
ATOM   68   C CB  . PHE A 1 21  ? 3.249   44.603 43.376  1.00 53.68 ? 339 PHE A CB  1 
ATOM   69   C CG  . PHE A 1 21  ? 2.242   44.553 44.482  1.00 48.51 ? 339 PHE A CG  1 
ATOM   70   C CD1 . PHE A 1 21  ? 2.651   44.606 45.805  1.00 43.73 ? 339 PHE A CD1 1 
ATOM   71   C CD2 . PHE A 1 21  ? 0.892   44.475 44.203  1.00 44.76 ? 339 PHE A CD2 1 
ATOM   72   C CE1 . PHE A 1 21  ? 1.732   44.568 46.824  1.00 41.62 ? 339 PHE A CE1 1 
ATOM   73   C CE2 . PHE A 1 21  ? -0.031  44.442 45.222  1.00 42.18 ? 339 PHE A CE2 1 
ATOM   74   C CZ  . PHE A 1 21  ? 0.389   44.485 46.533  1.00 39.89 ? 339 PHE A CZ  1 
ATOM   75   N N   . ASN A 1 22  ? 6.210   45.805 42.960  1.00 53.71 ? 340 ASN A N   1 
ATOM   76   C CA  . ASN A 1 22  ? 7.490   45.522 42.327  1.00 54.81 ? 340 ASN A CA  1 
ATOM   77   C C   . ASN A 1 22  ? 7.996   44.138 42.672  1.00 54.28 ? 340 ASN A C   1 
ATOM   78   O O   . ASN A 1 22  ? 8.461   43.897 43.786  1.00 54.22 ? 340 ASN A O   1 
ATOM   79   C CB  . ASN A 1 22  ? 8.542   46.557 42.721  1.00 55.09 ? 340 ASN A CB  1 
ATOM   80   C CG  . ASN A 1 22  ? 8.775   47.571 41.639  1.00 56.96 ? 340 ASN A CG  1 
ATOM   81   O OD1 . ASN A 1 22  ? 8.568   48.771 41.832  1.00 59.96 ? 340 ASN A OD1 1 
ATOM   82   N ND2 . ASN A 1 22  ? 9.187   47.093 40.472  1.00 56.74 ? 340 ASN A ND2 1 
ATOM   83   N N   . PHE A 1 23  ? 7.906   43.237 41.703  1.00 53.69 ? 341 PHE A N   1 
ATOM   84   C CA  . PHE A 1 23  ? 8.391   41.873 41.866  1.00 52.93 ? 341 PHE A CA  1 
ATOM   85   C C   . PHE A 1 23  ? 9.912   41.751 42.075  1.00 51.73 ? 341 PHE A C   1 
ATOM   86   O O   . PHE A 1 23  ? 10.694  41.827 41.130  1.00 51.59 ? 341 PHE A O   1 
ATOM   87   C CB  . PHE A 1 23  ? 7.983   41.035 40.660  1.00 53.71 ? 341 PHE A CB  1 
ATOM   88   C CG  . PHE A 1 23  ? 6.554   40.603 40.680  1.00 55.95 ? 341 PHE A CG  1 
ATOM   89   C CD1 . PHE A 1 23  ? 5.827   40.628 41.859  1.00 58.01 ? 341 PHE A CD1 1 
ATOM   90   C CD2 . PHE A 1 23  ? 5.950   40.134 39.526  1.00 57.12 ? 341 PHE A CD2 1 
ATOM   91   C CE1 . PHE A 1 23  ? 4.515   40.218 41.888  1.00 58.57 ? 341 PHE A CE1 1 
ATOM   92   C CE2 . PHE A 1 23  ? 4.644   39.719 39.544  1.00 60.21 ? 341 PHE A CE2 1 
ATOM   93   C CZ  . PHE A 1 23  ? 3.920   39.762 40.732  1.00 61.57 ? 341 PHE A CZ  1 
ATOM   94   N N   . LEU A 1 24  ? 10.321  41.532 43.318  1.00 50.26 ? 342 LEU A N   1 
ATOM   95   C CA  . LEU A 1 24  ? 11.727  41.304 43.640  1.00 47.75 ? 342 LEU A CA  1 
ATOM   96   C C   . LEU A 1 24  ? 12.194  39.916 43.196  1.00 47.15 ? 342 LEU A C   1 
ATOM   97   O O   . LEU A 1 24  ? 12.734  39.771 42.097  1.00 47.27 ? 342 LEU A O   1 
ATOM   98   C CB  . LEU A 1 24  ? 11.945  41.507 45.134  1.00 46.69 ? 342 LEU A CB  1 
ATOM   99   C CG  . LEU A 1 24  ? 11.284  42.825 45.513  1.00 40.88 ? 342 LEU A CG  1 
ATOM   100  C CD1 . LEU A 1 24  ? 11.558  43.168 46.956  1.00 40.82 ? 342 LEU A CD1 1 
ATOM   101  C CD2 . LEU A 1 24  ? 11.809  43.888 44.592  1.00 36.81 ? 342 LEU A CD2 1 
ATOM   102  N N   . MET A 1 25  ? 11.967  38.905 44.038  1.00 45.43 ? 343 MET A N   1 
ATOM   103  C CA  . MET A 1 25  ? 12.334  37.519 43.718  1.00 43.97 ? 343 MET A CA  1 
ATOM   104  C C   . MET A 1 25  ? 11.249  36.503 44.057  1.00 42.08 ? 343 MET A C   1 
ATOM   105  O O   . MET A 1 25  ? 10.173  36.841 44.534  1.00 45.11 ? 343 MET A O   1 
ATOM   106  C CB  . MET A 1 25  ? 13.596  37.144 44.460  1.00 44.23 ? 343 MET A CB  1 
ATOM   107  C CG  . MET A 1 25  ? 13.705  37.879 45.758  1.00 49.15 ? 343 MET A CG  1 
ATOM   108  S SD  . MET A 1 25  ? 14.444  36.878 47.044  1.00 64.19 ? 343 MET A SD  1 
ATOM   109  C CE  . MET A 1 25  ? 16.113  36.618 46.404  1.00 60.22 ? 343 MET A CE  1 
ATOM   110  N N   . VAL A 1 26  ? 11.539  35.239 43.817  1.00 38.68 ? 344 VAL A N   1 
ATOM   111  C CA  . VAL A 1 26  ? 10.575  34.183 44.044  1.00 34.96 ? 344 VAL A CA  1 
ATOM   112  C C   . VAL A 1 26  ? 10.819  33.647 45.433  1.00 35.19 ? 344 VAL A C   1 
ATOM   113  O O   . VAL A 1 26  ? 11.927  33.252 45.751  1.00 35.17 ? 344 VAL A O   1 
ATOM   114  C CB  . VAL A 1 26  ? 10.804  33.043 43.034  1.00 33.81 ? 344 VAL A CB  1 
ATOM   115  C CG1 . VAL A 1 26  ? 10.140  31.762 43.485  1.00 32.29 ? 344 VAL A CG1 1 
ATOM   116  C CG2 . VAL A 1 26  ? 10.340  33.446 41.657  1.00 31.10 ? 344 VAL A CG2 1 
ATOM   117  N N   . LEU A 1 27  ? 9.809   33.628 46.287  1.00 35.95 ? 345 LEU A N   1 
ATOM   118  C CA  . LEU A 1 27  ? 9.997   32.966 47.580  1.00 35.13 ? 345 LEU A CA  1 
ATOM   119  C C   . LEU A 1 27  ? 10.040  31.440 47.401  1.00 35.06 ? 345 LEU A C   1 
ATOM   120  O O   . LEU A 1 27  ? 10.862  30.774 48.028  1.00 36.63 ? 345 LEU A O   1 
ATOM   121  C CB  . LEU A 1 27  ? 8.972   33.436 48.624  1.00 34.71 ? 345 LEU A CB  1 
ATOM   122  C CG  . LEU A 1 27  ? 9.133   34.928 48.921  1.00 33.78 ? 345 LEU A CG  1 
ATOM   123  C CD1 . LEU A 1 27  ? 7.993   35.513 49.727  1.00 38.68 ? 345 LEU A CD1 1 
ATOM   124  C CD2 . LEU A 1 27  ? 10.412  35.132 49.653  1.00 29.82 ? 345 LEU A CD2 1 
ATOM   125  N N   . GLY A 1 28  ? 9.192   30.892 46.531  1.00 34.21 ? 346 GLY A N   1 
ATOM   126  C CA  . GLY A 1 28  ? 9.273   29.470 46.163  1.00 33.49 ? 346 GLY A CA  1 
ATOM   127  C C   . GLY A 1 28  ? 8.193   28.964 45.205  1.00 33.73 ? 346 GLY A C   1 
ATOM   128  O O   . GLY A 1 28  ? 7.162   29.592 45.012  1.00 33.51 ? 346 GLY A O   1 
ATOM   129  N N   . LYS A 1 29  ? 8.434   27.828 44.575  1.00 33.88 ? 347 LYS A N   1 
ATOM   130  C CA  . LYS A 1 29  ? 7.397   27.205 43.773  1.00 34.65 ? 347 LYS A CA  1 
ATOM   131  C C   . LYS A 1 29  ? 7.084   25.872 44.428  1.00 35.10 ? 347 LYS A C   1 
ATOM   132  O O   . LYS A 1 29  ? 7.960   25.259 45.028  1.00 34.59 ? 347 LYS A O   1 
ATOM   133  C CB  . LYS A 1 29  ? 7.868   26.984 42.336  1.00 35.44 ? 347 LYS A CB  1 
ATOM   134  C CG  . LYS A 1 29  ? 8.141   28.249 41.520  1.00 34.72 ? 347 LYS A CG  1 
ATOM   135  C CD  . LYS A 1 29  ? 8.384   27.889 40.059  1.00 38.64 ? 347 LYS A CD  1 
ATOM   136  C CE  . LYS A 1 29  ? 8.763   29.101 39.196  1.00 44.05 ? 347 LYS A CE  1 
ATOM   137  N NZ  . LYS A 1 29  ? 8.211   28.986 37.795  1.00 44.23 ? 347 LYS A NZ  1 
ATOM   138  N N   . GLY A 1 30  ? 5.835   25.430 44.349  1.00 35.14 ? 348 GLY A N   1 
ATOM   139  C CA  . GLY A 1 30  ? 5.480   24.142 44.931  1.00 35.25 ? 348 GLY A CA  1 
ATOM   140  C C   . GLY A 1 30  ? 4.029   23.858 44.672  1.00 35.46 ? 348 GLY A C   1 
ATOM   141  O O   . GLY A 1 30  ? 3.389   24.557 43.885  1.00 34.65 ? 348 GLY A O   1 
ATOM   142  N N   . SER A 1 31  ? 3.495   22.841 45.341  1.00 36.29 ? 349 SER A N   1 
ATOM   143  C CA  . SER A 1 31  ? 2.064   22.534 45.213  1.00 35.51 ? 349 SER A CA  1 
ATOM   144  C C   . SER A 1 31  ? 1.230   23.758 45.594  1.00 33.12 ? 349 SER A C   1 
ATOM   145  O O   . SER A 1 31  ? 0.174   23.988 45.037  1.00 33.63 ? 349 SER A O   1 
ATOM   146  C CB  . SER A 1 31  ? 1.674   21.362 46.102  1.00 34.59 ? 349 SER A CB  1 
ATOM   147  O OG  . SER A 1 31  ? 1.514   21.835 47.433  1.00 40.72 ? 349 SER A OG  1 
ATOM   148  N N   . PHE A 1 32  ? 1.718   24.539 46.547  1.00 30.96 ? 350 PHE A N   1 
ATOM   149  C CA  . PHE A 1 32  ? 1.048   25.750 46.954  1.00 29.01 ? 350 PHE A CA  1 
ATOM   150  C C   . PHE A 1 32  ? 1.113   26.808 45.878  1.00 28.97 ? 350 PHE A C   1 
ATOM   151  O O   . PHE A 1 32  ? 0.699   27.936 46.116  1.00 28.79 ? 350 PHE A O   1 
ATOM   152  C CB  . PHE A 1 32  ? 1.696   26.305 48.212  1.00 28.44 ? 350 PHE A CB  1 
ATOM   153  C CG  . PHE A 1 32  ? 3.174   26.443 48.100  1.00 29.07 ? 350 PHE A CG  1 
ATOM   154  C CD1 . PHE A 1 32  ? 4.013   25.628 48.828  1.00 29.78 ? 350 PHE A CD1 1 
ATOM   155  C CD2 . PHE A 1 32  ? 3.729   27.367 47.238  1.00 35.12 ? 350 PHE A CD2 1 
ATOM   156  C CE1 . PHE A 1 32  ? 5.363   25.732 48.716  1.00 29.18 ? 350 PHE A CE1 1 
ATOM   157  C CE2 . PHE A 1 32  ? 5.088   27.481 47.118  1.00 36.61 ? 350 PHE A CE2 1 
ATOM   158  C CZ  . PHE A 1 32  ? 5.910   26.659 47.857  1.00 37.26 ? 350 PHE A CZ  1 
ATOM   159  N N   . GLY A 1 33  ? 1.640   26.456 44.704  1.00 30.65 ? 351 GLY A N   1 
ATOM   160  C CA  . GLY A 1 33  ? 1.811   27.413 43.589  1.00 30.50 ? 351 GLY A CA  1 
ATOM   161  C C   . GLY A 1 33  ? 3.151   28.151 43.627  1.00 32.12 ? 351 GLY A C   1 
ATOM   162  O O   . GLY A 1 33  ? 4.208   27.547 43.911  1.00 32.09 ? 351 GLY A O   1 
ATOM   163  N N   . LYS A 1 34  ? 3.112   29.454 43.328  1.00 32.05 ? 352 LYS A N   1 
ATOM   164  C CA  . LYS A 1 34  ? 4.290   30.323 43.384  1.00 31.90 ? 352 LYS A CA  1 
ATOM   165  C C   . LYS A 1 34  ? 4.110   31.506 44.317  1.00 32.41 ? 352 LYS A C   1 
ATOM   166  O O   . LYS A 1 34  ? 3.186   32.293 44.158  1.00 33.65 ? 352 LYS A O   1 
ATOM   167  C CB  . LYS A 1 34  ? 4.632   30.864 42.003  1.00 32.40 ? 352 LYS A CB  1 
ATOM   168  C CG  . LYS A 1 34  ? 5.786   31.863 42.024  1.00 35.43 ? 352 LYS A CG  1 
ATOM   169  C CD  . LYS A 1 34  ? 5.851   32.677 40.761  1.00 37.95 ? 352 LYS A CD  1 
ATOM   170  C CE  . LYS A 1 34  ? 6.091   31.814 39.527  1.00 40.67 ? 352 LYS A CE  1 
ATOM   171  N NZ  . LYS A 1 34  ? 6.292   32.682 38.309  1.00 42.70 ? 352 LYS A NZ  1 
ATOM   172  N N   . VAL A 1 35  ? 4.999   31.649 45.287  1.00 34.02 ? 353 VAL A N   1 
ATOM   173  C CA  . VAL A 1 35  ? 4.982   32.833 46.133  1.00 35.88 ? 353 VAL A CA  1 
ATOM   174  C C   . VAL A 1 35  ? 6.141   33.761 45.797  1.00 36.84 ? 353 VAL A C   1 
ATOM   175  O O   . VAL A 1 35  ? 7.277   33.321 45.677  1.00 37.09 ? 353 VAL A O   1 
ATOM   176  C CB  . VAL A 1 35  ? 5.077   32.455 47.600  1.00 35.42 ? 353 VAL A CB  1 
ATOM   177  C CG1 . VAL A 1 35  ? 5.026   33.705 48.464  1.00 37.81 ? 353 VAL A CG1 1 
ATOM   178  C CG2 . VAL A 1 35  ? 3.956   31.543 47.939  1.00 35.46 ? 353 VAL A CG2 1 
ATOM   179  N N   . MET A 1 36  ? 5.855   35.046 45.663  1.00 38.03 ? 354 MET A N   1 
ATOM   180  C CA  . MET A 1 36  ? 6.875   35.998 45.260  1.00 40.24 ? 354 MET A CA  1 
ATOM   181  C C   . MET A 1 36  ? 7.092   37.022 46.360  1.00 40.31 ? 354 MET A C   1 
ATOM   182  O O   . MET A 1 36  ? 6.126   37.474 46.978  1.00 40.54 ? 354 MET A O   1 
ATOM   183  C CB  . MET A 1 36  ? 6.409   36.712 43.994  1.00 40.65 ? 354 MET A CB  1 
ATOM   184  C CG  . MET A 1 36  ? 7.517   37.271 43.114  1.00 45.03 ? 354 MET A CG  1 
ATOM   185  S SD  . MET A 1 36  ? 7.992   36.208 41.723  1.00 55.42 ? 354 MET A SD  1 
ATOM   186  C CE  . MET A 1 36  ? 6.392   35.827 41.032  1.00 54.53 ? 354 MET A CE  1 
ATOM   187  N N   . LEU A 1 37  ? 8.339   37.391 46.623  1.00 39.86 ? 355 LEU A N   1 
ATOM   188  C CA  . LEU A 1 37  ? 8.547   38.575 47.442  1.00 42.15 ? 355 LEU A CA  1 
ATOM   189  C C   . LEU A 1 37  ? 8.368   39.843 46.603  1.00 44.86 ? 355 LEU A C   1 
ATOM   190  O O   . LEU A 1 37  ? 8.862   39.921 45.472  1.00 45.44 ? 355 LEU A O   1 
ATOM   191  C CB  . LEU A 1 37  ? 9.922   38.608 48.108  1.00 41.61 ? 355 LEU A CB  1 
ATOM   192  C CG  . LEU A 1 37  ? 9.865   39.700 49.189  1.00 37.83 ? 355 LEU A CG  1 
ATOM   193  C CD1 . LEU A 1 37  ? 8.776   39.346 50.180  1.00 36.40 ? 355 LEU A CD1 1 
ATOM   194  C CD2 . LEU A 1 37  ? 11.158  39.900 49.912  1.00 33.47 ? 355 LEU A CD2 1 
ATOM   195  N N   . ALA A 1 38  ? 7.676   40.837 47.160  1.00 46.84 ? 356 ALA A N   1 
ATOM   196  C CA  . ALA A 1 38  ? 7.435   42.099 46.458  1.00 48.90 ? 356 ALA A CA  1 
ATOM   197  C C   . ALA A 1 38  ? 7.176   43.263 47.422  1.00 50.85 ? 356 ALA A C   1 
ATOM   198  O O   . ALA A 1 38  ? 6.827   43.046 48.594  1.00 51.28 ? 356 ALA A O   1 
ATOM   199  C CB  . ALA A 1 38  ? 6.270   41.943 45.492  1.00 48.66 ? 356 ALA A CB  1 
ATOM   200  N N   . ASP A 1 39  ? 7.350   44.494 46.932  1.00 52.45 ? 357 ASP A N   1 
ATOM   201  C CA  . ASP A 1 39  ? 6.946   45.680 47.696  1.00 54.28 ? 357 ASP A CA  1 
ATOM   202  C C   . ASP A 1 39  ? 5.779   46.429 47.058  1.00 53.79 ? 357 ASP A C   1 
ATOM   203  O O   . ASP A 1 39  ? 5.607   46.421 45.839  1.00 53.07 ? 357 ASP A O   1 
ATOM   204  C CB  . ASP A 1 39  ? 8.128   46.639 47.926  1.00 56.36 ? 357 ASP A CB  1 
ATOM   205  C CG  . ASP A 1 39  ? 8.785   47.101 46.628  1.00 60.66 ? 357 ASP A CG  1 
ATOM   206  O OD1 . ASP A 1 39  ? 8.075   47.247 45.604  1.00 62.00 ? 357 ASP A OD1 1 
ATOM   207  O OD2 . ASP A 1 39  ? 10.021  47.324 46.642  1.00 64.01 ? 357 ASP A OD2 1 
ATOM   208  N N   . ARG A 1 40  ? 4.966   47.060 47.895  1.00 54.15 ? 358 ARG A N   1 
ATOM   209  C CA  . ARG A 1 40  ? 4.012   48.040 47.413  1.00 55.04 ? 358 ARG A CA  1 
ATOM   210  C C   . ARG A 1 40  ? 4.864   49.191 46.878  1.00 56.35 ? 358 ARG A C   1 
ATOM   211  O O   . ARG A 1 40  ? 5.698   49.748 47.608  1.00 56.05 ? 358 ARG A O   1 
ATOM   212  C CB  . ARG A 1 40  ? 3.120   48.518 48.563  1.00 54.52 ? 358 ARG A CB  1 
ATOM   213  C CG  . ARG A 1 40  ? 1.706   48.945 48.175  1.00 53.84 ? 358 ARG A CG  1 
ATOM   214  C CD  . ARG A 1 40  ? 0.832   49.016 49.428  1.00 57.10 ? 358 ARG A CD  1 
ATOM   215  N NE  . ARG A 1 40  ? -0.548  49.430 49.175  1.00 59.27 ? 358 ARG A NE  1 
ATOM   216  C CZ  . ARG A 1 40  ? -1.567  49.213 50.013  1.00 62.62 ? 358 ARG A CZ  1 
ATOM   217  N NH1 . ARG A 1 40  ? -1.376  48.569 51.162  1.00 59.96 ? 358 ARG A NH1 1 
ATOM   218  N NH2 . ARG A 1 40  ? -2.790  49.635 49.700  1.00 63.41 ? 358 ARG A NH2 1 
ATOM   219  N N   . LYS A 1 41  ? 4.691   49.519 45.599  1.00 57.59 ? 359 LYS A N   1 
ATOM   220  C CA  . LYS A 1 41  ? 5.464   50.598 44.976  1.00 58.52 ? 359 LYS A CA  1 
ATOM   221  C C   . LYS A 1 41  ? 5.355   51.902 45.773  1.00 59.65 ? 359 LYS A C   1 
ATOM   222  O O   . LYS A 1 41  ? 4.254   52.346 46.098  1.00 59.72 ? 359 LYS A O   1 
ATOM   223  C CB  . LYS A 1 41  ? 4.998   50.837 43.537  1.00 58.28 ? 359 LYS A CB  1 
ATOM   224  C CG  . LYS A 1 41  ? 5.758   50.070 42.476  1.00 55.88 ? 359 LYS A CG  1 
ATOM   225  C CD  . LYS A 1 41  ? 5.171   50.375 41.115  1.00 54.13 ? 359 LYS A CD  1 
ATOM   226  C CE  . LYS A 1 41  ? 5.357   49.211 40.172  1.00 52.35 ? 359 LYS A CE  1 
ATOM   227  N NZ  . LYS A 1 41  ? 4.308   49.217 39.124  1.00 49.84 ? 359 LYS A NZ  1 
ATOM   228  N N   . GLY A 1 42  ? 6.495   52.509 46.094  1.00 60.37 ? 360 GLY A N   1 
ATOM   229  C CA  . GLY A 1 42  ? 6.495   53.820 46.735  1.00 60.66 ? 360 GLY A CA  1 
ATOM   230  C C   . GLY A 1 42  ? 6.458   53.795 48.250  1.00 61.03 ? 360 GLY A C   1 
ATOM   231  O O   . GLY A 1 42  ? 6.574   54.836 48.893  1.00 61.48 ? 360 GLY A O   1 
ATOM   232  N N   . THR A 1 43  ? 6.279   52.614 48.830  1.00 61.37 ? 361 THR A N   1 
ATOM   233  C CA  . THR A 1 43  ? 6.401   52.466 50.274  1.00 61.92 ? 361 THR A CA  1 
ATOM   234  C C   . THR A 1 43  ? 7.394   51.374 50.618  1.00 62.28 ? 361 THR A C   1 
ATOM   235  O O   . THR A 1 43  ? 7.925   50.696 49.730  1.00 61.86 ? 361 THR A O   1 
ATOM   236  C CB  . THR A 1 43  ? 5.051   52.176 50.991  1.00 62.28 ? 361 THR A CB  1 
ATOM   237  O OG1 . THR A 1 43  ? 4.186   51.409 50.140  1.00 63.04 ? 361 THR A OG1 1 
ATOM   238  C CG2 . THR A 1 43  ? 4.362   53.472 51.395  1.00 62.98 ? 361 THR A CG2 1 
ATOM   239  N N   . GLU A 1 44  ? 7.633   51.217 51.918  1.00 63.06 ? 362 GLU A N   1 
ATOM   240  C CA  . GLU A 1 44  ? 8.557   50.214 52.439  1.00 64.22 ? 362 GLU A CA  1 
ATOM   241  C C   . GLU A 1 44  ? 7.893   48.838 52.551  1.00 63.68 ? 362 GLU A C   1 
ATOM   242  O O   . GLU A 1 44  ? 8.586   47.824 52.659  1.00 64.60 ? 362 GLU A O   1 
ATOM   243  C CB  . GLU A 1 44  ? 9.125   50.636 53.813  1.00 64.89 ? 362 GLU A CB  1 
ATOM   244  C CG  . GLU A 1 44  ? 10.507  51.339 53.787  1.00 66.59 ? 362 GLU A CG  1 
ATOM   245  C CD  . GLU A 1 44  ? 11.037  51.680 55.189  1.00 67.12 ? 362 GLU A CD  1 
ATOM   246  O OE1 . GLU A 1 44  ? 11.091  50.767 56.048  1.00 64.99 ? 362 GLU A OE1 1 
ATOM   247  O OE2 . GLU A 1 44  ? 11.404  52.860 55.425  1.00 64.84 ? 362 GLU A OE2 1 
ATOM   248  N N   . GLU A 1 45  ? 6.561   48.803 52.515  1.00 62.05 ? 363 GLU A N   1 
ATOM   249  C CA  . GLU A 1 45  ? 5.817   47.571 52.807  1.00 60.53 ? 363 GLU A CA  1 
ATOM   250  C C   . GLU A 1 45  ? 6.135   46.403 51.869  1.00 58.48 ? 363 GLU A C   1 
ATOM   251  O O   . GLU A 1 45  ? 6.015   46.511 50.643  1.00 58.81 ? 363 GLU A O   1 
ATOM   252  C CB  . GLU A 1 45  ? 4.311   47.843 52.894  1.00 60.50 ? 363 GLU A CB  1 
ATOM   253  C CG  . GLU A 1 45  ? 3.933   48.663 54.126  1.00 64.57 ? 363 GLU A CG  1 
ATOM   254  C CD  . GLU A 1 45  ? 2.976   49.816 53.821  1.00 68.52 ? 363 GLU A CD  1 
ATOM   255  O OE1 . GLU A 1 45  ? 2.092   49.633 52.951  1.00 66.31 ? 363 GLU A OE1 1 
ATOM   256  O OE2 . GLU A 1 45  ? 3.113   50.899 54.456  1.00 68.60 ? 363 GLU A OE2 1 
ATOM   257  N N   . LEU A 1 46  ? 6.575   45.299 52.474  1.00 55.62 ? 364 LEU A N   1 
ATOM   258  C CA  . LEU A 1 46  ? 6.802   44.030 51.777  1.00 52.00 ? 364 LEU A CA  1 
ATOM   259  C C   . LEU A 1 46  ? 5.623   43.066 51.965  1.00 49.97 ? 364 LEU A C   1 
ATOM   260  O O   . LEU A 1 46  ? 5.002   43.000 53.040  1.00 48.26 ? 364 LEU A O   1 
ATOM   261  C CB  . LEU A 1 46  ? 8.078   43.371 52.286  1.00 51.22 ? 364 LEU A CB  1 
ATOM   262  C CG  . LEU A 1 46  ? 9.344   43.574 51.466  1.00 49.27 ? 364 LEU A CG  1 
ATOM   263  C CD1 . LEU A 1 46  ? 9.302   44.897 50.756  1.00 48.81 ? 364 LEU A CD1 1 
ATOM   264  C CD2 . LEU A 1 46  ? 10.560  43.460 52.366  1.00 45.73 ? 364 LEU A CD2 1 
ATOM   265  N N   . TYR A 1 47  ? 5.307   42.328 50.909  1.00 47.25 ? 365 TYR A N   1 
ATOM   266  C CA  . TYR A 1 47  ? 4.269   41.318 50.991  1.00 45.20 ? 365 TYR A CA  1 
ATOM   267  C C   . TYR A 1 47  ? 4.765   40.082 50.255  1.00 43.30 ? 365 TYR A C   1 
ATOM   268  O O   . TYR A 1 47  ? 5.625   40.193 49.384  1.00 43.66 ? 365 TYR A O   1 
ATOM   269  C CB  . TYR A 1 47  ? 2.946   41.816 50.376  1.00 45.34 ? 365 TYR A CB  1 
ATOM   270  C CG  . TYR A 1 47  ? 2.343   43.056 51.017  1.00 45.69 ? 365 TYR A CG  1 
ATOM   271  C CD1 . TYR A 1 47  ? 2.523   44.320 50.443  1.00 49.01 ? 365 TYR A CD1 1 
ATOM   272  C CD2 . TYR A 1 47  ? 1.590   42.970 52.183  1.00 45.47 ? 365 TYR A CD2 1 
ATOM   273  C CE1 . TYR A 1 47  ? 1.980   45.468 51.019  1.00 48.71 ? 365 TYR A CE1 1 
ATOM   274  C CE2 . TYR A 1 47  ? 1.038   44.110 52.770  1.00 48.93 ? 365 TYR A CE2 1 
ATOM   275  C CZ  . TYR A 1 47  ? 1.236   45.359 52.183  1.00 51.21 ? 365 TYR A CZ  1 
ATOM   276  O OH  . TYR A 1 47  ? 0.697   46.500 52.758  1.00 52.41 ? 365 TYR A OH  1 
ATOM   277  N N   . ALA A 1 48  ? 4.247   38.912 50.628  1.00 40.20 ? 366 ALA A N   1 
ATOM   278  C CA  . ALA A 1 48  ? 4.404   37.716 49.820  1.00 36.88 ? 366 ALA A CA  1 
ATOM   279  C C   . ALA A 1 48  ? 3.121   37.546 49.032  1.00 36.20 ? 366 ALA A C   1 
ATOM   280  O O   . ALA A 1 48  ? 2.011   37.660 49.583  1.00 35.38 ? 366 ALA A O   1 
ATOM   281  C CB  . ALA A 1 48  ? 4.651   36.519 50.684  1.00 37.55 ? 366 ALA A CB  1 
ATOM   282  N N   . ILE A 1 49  ? 3.273   37.306 47.731  1.00 34.58 ? 367 ILE A N   1 
ATOM   283  C CA  . ILE A 1 49  ? 2.126   37.252 46.831  1.00 32.24 ? 367 ILE A CA  1 
ATOM   284  C C   . ILE A 1 49  ? 2.085   35.909 46.158  1.00 31.53 ? 367 ILE A C   1 
ATOM   285  O O   . ILE A 1 49  ? 3.002   35.560 45.431  1.00 32.31 ? 367 ILE A O   1 
ATOM   286  C CB  . ILE A 1 49  ? 2.188   38.328 45.726  1.00 31.74 ? 367 ILE A CB  1 
ATOM   287  C CG1 . ILE A 1 49  ? 2.271   39.729 46.323  1.00 30.84 ? 367 ILE A CG1 1 
ATOM   288  C CG2 . ILE A 1 49  ? 0.969   38.262 44.837  1.00 28.57 ? 367 ILE A CG2 1 
ATOM   289  C CD1 . ILE A 1 49  ? 2.496   40.791 45.264  1.00 30.46 ? 367 ILE A CD1 1 
ATOM   290  N N   . LYS A 1 50  ? 1.022   35.153 46.395  1.00 29.90 ? 368 LYS A N   1 
ATOM   291  C CA  . LYS A 1 50  ? 0.911   33.871 45.759  1.00 29.28 ? 368 LYS A CA  1 
ATOM   292  C C   . LYS A 1 50  ? 0.210   34.087 44.439  1.00 28.53 ? 368 LYS A C   1 
ATOM   293  O O   . LYS A 1 50  ? -0.801  34.775 44.379  1.00 27.83 ? 368 LYS A O   1 
ATOM   294  C CB  . LYS A 1 50  ? 0.140   32.902 46.650  1.00 29.50 ? 368 LYS A CB  1 
ATOM   295  C CG  . LYS A 1 50  ? -0.067  31.519 46.047  1.00 28.14 ? 368 LYS A CG  1 
ATOM   296  C CD  . LYS A 1 50  ? -1.236  30.839 46.752  1.00 30.53 ? 368 LYS A CD  1 
ATOM   297  C CE  . LYS A 1 50  ? -1.505  29.442 46.211  1.00 34.04 ? 368 LYS A CE  1 
ATOM   298  N NZ  . LYS A 1 50  ? -2.344  28.670 47.188  1.00 38.00 ? 368 LYS A NZ  1 
ATOM   299  N N   . ILE A 1 51  ? 0.748   33.506 43.377  1.00 28.46 ? 369 ILE A N   1 
ATOM   300  C CA  . ILE A 1 51  ? 0.179   33.711 42.046  1.00 29.40 ? 369 ILE A CA  1 
ATOM   301  C C   . ILE A 1 51  ? -0.313  32.405 41.415  1.00 29.53 ? 369 ILE A C   1 
ATOM   302  O O   . ILE A 1 51  ? 0.463   31.466 41.272  1.00 29.78 ? 369 ILE A O   1 
ATOM   303  C CB  . ILE A 1 51  ? 1.220   34.361 41.107  1.00 28.89 ? 369 ILE A CB  1 
ATOM   304  C CG1 . ILE A 1 51  ? 1.681   35.698 41.688  1.00 30.60 ? 369 ILE A CG1 1 
ATOM   305  C CG2 . ILE A 1 51  ? 0.674   34.519 39.695  1.00 23.52 ? 369 ILE A CG2 1 
ATOM   306  C CD1 . ILE A 1 51  ? 2.928   36.280 41.010  1.00 33.50 ? 369 ILE A CD1 1 
ATOM   307  N N   . LEU A 1 52  ? -1.588  32.336 41.035  1.00 28.52 ? 370 LEU A N   1 
ATOM   308  C CA  . LEU A 1 52  ? -2.047  31.170 40.284  1.00 29.12 ? 370 LEU A CA  1 
ATOM   309  C C   . LEU A 1 52  ? -2.454  31.504 38.867  1.00 29.44 ? 370 LEU A C   1 
ATOM   310  O O   . LEU A 1 52  ? -3.139  32.498 38.628  1.00 30.56 ? 370 LEU A O   1 
ATOM   311  C CB  . LEU A 1 52  ? -3.183  30.470 40.999  1.00 27.91 ? 370 LEU A CB  1 
ATOM   312  C CG  . LEU A 1 52  ? -2.617  29.769 42.224  1.00 29.86 ? 370 LEU A CG  1 
ATOM   313  C CD1 . LEU A 1 52  ? -3.731  29.533 43.216  1.00 30.32 ? 370 LEU A CD1 1 
ATOM   314  C CD2 . LEU A 1 52  ? -1.894  28.463 41.844  1.00 30.52 ? 370 LEU A CD2 1 
ATOM   315  N N   . LYS A 1 53  ? -2.003  30.682 37.930  1.00 28.29 ? 371 LYS A N   1 
ATOM   316  C CA  . LYS A 1 53  ? -2.486  30.757 36.579  1.00 28.75 ? 371 LYS A CA  1 
ATOM   317  C C   . LYS A 1 53  ? -3.823  30.040 36.563  1.00 28.91 ? 371 LYS A C   1 
ATOM   318  O O   . LYS A 1 53  ? -3.865  28.816 36.699  1.00 29.26 ? 371 LYS A O   1 
ATOM   319  C CB  . LYS A 1 53  ? -1.498  30.076 35.636  1.00 29.21 ? 371 LYS A CB  1 
ATOM   320  C CG  . LYS A 1 53  ? -0.380  30.994 35.116  1.00 33.25 ? 371 LYS A CG  1 
ATOM   321  C CD  . LYS A 1 53  ? 0.853   30.217 34.574  1.00 37.24 ? 371 LYS A CD  1 
ATOM   322  C CE  . LYS A 1 53  ? 0.591   29.528 33.231  1.00 39.64 ? 371 LYS A CE  1 
ATOM   323  N NZ  . LYS A 1 53  ? 0.582   30.466 32.071  1.00 40.14 ? 371 LYS A NZ  1 
ATOM   324  N N   . LYS A 1 54  ? -4.903  30.810 36.417  1.00 29.65 ? 372 LYS A N   1 
ATOM   325  C CA  . LYS A 1 54  ? -6.282  30.296 36.393  1.00 30.85 ? 372 LYS A CA  1 
ATOM   326  C C   . LYS A 1 54  ? -6.456  28.962 35.684  1.00 32.99 ? 372 LYS A C   1 
ATOM   327  O O   . LYS A 1 54  ? -7.066  28.042 36.237  1.00 34.44 ? 372 LYS A O   1 
ATOM   328  C CB  . LYS A 1 54  ? -7.230  31.304 35.740  1.00 30.28 ? 372 LYS A CB  1 
ATOM   329  C CG  . LYS A 1 54  ? -8.011  32.187 36.723  1.00 32.79 ? 372 LYS A CG  1 
ATOM   330  C CD  . LYS A 1 54  ? -8.578  33.425 36.040  1.00 29.42 ? 372 LYS A CD  1 
ATOM   331  C CE  . LYS A 1 54  ? -9.062  34.478 37.014  1.00 30.90 ? 372 LYS A CE  1 
ATOM   332  N NZ  . LYS A 1 54  ? -10.098 35.350 36.346  1.00 31.40 ? 372 LYS A NZ  1 
ATOM   333  N N   . ASP A 1 55  ? -5.939  28.843 34.459  1.00 34.04 ? 373 ASP A N   1 
ATOM   334  C CA  . ASP A 1 55  ? -6.179  27.625 33.689  1.00 36.02 ? 373 ASP A CA  1 
ATOM   335  C C   . ASP A 1 55  ? -5.540  26.396 34.327  1.00 36.95 ? 373 ASP A C   1 
ATOM   336  O O   . ASP A 1 55  ? -6.076  25.303 34.227  1.00 38.77 ? 373 ASP A O   1 
ATOM   337  C CB  . ASP A 1 55  ? -5.753  27.768 32.229  1.00 36.72 ? 373 ASP A CB  1 
ATOM   338  C CG  . ASP A 1 55  ? -4.245  27.782 32.046  1.00 43.48 ? 373 ASP A CG  1 
ATOM   339  O OD1 . ASP A 1 55  ? -3.546  28.482 32.815  1.00 46.06 ? 373 ASP A OD1 1 
ATOM   340  O OD2 . ASP A 1 55  ? -3.758  27.099 31.109  1.00 49.53 ? 373 ASP A OD2 1 
ATOM   341  N N   . VAL A 1 56  ? -4.404  26.575 34.990  1.00 36.25 ? 374 VAL A N   1 
ATOM   342  C CA  . VAL A 1 56  ? -3.764  25.462 35.657  1.00 35.32 ? 374 VAL A CA  1 
ATOM   343  C C   . VAL A 1 56  ? -4.653  25.010 36.806  1.00 35.58 ? 374 VAL A C   1 
ATOM   344  O O   . VAL A 1 56  ? -5.014  23.836 36.913  1.00 35.43 ? 374 VAL A O   1 
ATOM   345  C CB  . VAL A 1 56  ? -2.353  25.826 36.168  1.00 34.84 ? 374 VAL A CB  1 
ATOM   346  C CG1 . VAL A 1 56  ? -1.690  24.608 36.755  1.00 26.62 ? 374 VAL A CG1 1 
ATOM   347  C CG2 . VAL A 1 56  ? -1.515  26.380 35.028  1.00 33.73 ? 374 VAL A CG2 1 
ATOM   348  N N   . VAL A 1 57  ? -5.025  25.949 37.656  1.00 34.74 ? 375 VAL A N   1 
ATOM   349  C CA  . VAL A 1 57  ? -5.929  25.616 38.722  1.00 35.50 ? 375 VAL A CA  1 
ATOM   350  C C   . VAL A 1 57  ? -7.049  24.744 38.150  1.00 37.21 ? 375 VAL A C   1 
ATOM   351  O O   . VAL A 1 57  ? -7.382  23.682 38.710  1.00 38.31 ? 375 VAL A O   1 
ATOM   352  C CB  . VAL A 1 57  ? -6.458  26.878 39.392  1.00 34.82 ? 375 VAL A CB  1 
ATOM   353  C CG1 . VAL A 1 57  ? -7.834  26.656 39.949  1.00 35.61 ? 375 VAL A CG1 1 
ATOM   354  C CG2 . VAL A 1 57  ? -5.492  27.313 40.482  1.00 35.46 ? 375 VAL A CG2 1 
ATOM   355  N N   . ILE A 1 58  ? -7.600  25.146 37.007  1.00 36.91 ? 376 ILE A N   1 
ATOM   356  C CA  . ILE A 1 58  ? -8.609  24.301 36.364  1.00 36.19 ? 376 ILE A CA  1 
ATOM   357  C C   . ILE A 1 58  ? -8.064  22.945 35.849  1.00 37.94 ? 376 ILE A C   1 
ATOM   358  O O   . ILE A 1 58  ? -8.468  21.910 36.340  1.00 38.88 ? 376 ILE A O   1 
ATOM   359  C CB  . ILE A 1 58  ? -9.398  25.053 35.302  1.00 34.52 ? 376 ILE A CB  1 
ATOM   360  C CG1 . ILE A 1 58  ? -9.987  26.313 35.909  1.00 30.66 ? 376 ILE A CG1 1 
ATOM   361  C CG2 . ILE A 1 58  ? -10.513 24.194 34.753  1.00 30.74 ? 376 ILE A CG2 1 
ATOM   362  C CD1 . ILE A 1 58  ? -10.449 27.286 34.883  1.00 27.33 ? 376 ILE A CD1 1 
ATOM   363  N N   . GLN A 1 59  ? -7.149  22.927 34.891  1.00 40.78 ? 377 GLN A N   1 
ATOM   364  C CA  . GLN A 1 59  ? -6.624  21.636 34.430  1.00 44.83 ? 377 GLN A CA  1 
ATOM   365  C C   . GLN A 1 59  ? -6.337  20.754 35.625  1.00 45.48 ? 377 GLN A C   1 
ATOM   366  O O   . GLN A 1 59  ? -6.492  19.546 35.542  1.00 45.96 ? 377 GLN A O   1 
ATOM   367  C CB  . GLN A 1 59  ? -5.291  21.761 33.693  1.00 46.21 ? 377 GLN A CB  1 
ATOM   368  C CG  . GLN A 1 59  ? -5.270  22.521 32.392  1.00 54.00 ? 377 GLN A CG  1 
ATOM   369  C CD  . GLN A 1 59  ? -3.864  23.066 32.124  1.00 63.12 ? 377 GLN A CD  1 
ATOM   370  O OE1 . GLN A 1 59  ? -3.653  23.927 31.253  1.00 66.23 ? 377 GLN A OE1 1 
ATOM   371  N NE2 . GLN A 1 59  ? -2.892  22.570 32.897  1.00 64.33 ? 377 GLN A NE2 1 
ATOM   372  N N   . ASP A 1 60  ? -5.878  21.361 36.721  1.00 45.77 ? 378 ASP A N   1 
ATOM   373  C CA  . ASP A 1 60  ? -5.391  20.605 37.870  1.00 45.13 ? 378 ASP A CA  1 
ATOM   374  C C   . ASP A 1 60  ? -6.533  20.251 38.779  1.00 46.17 ? 378 ASP A C   1 
ATOM   375  O O   . ASP A 1 60  ? -6.347  19.565 39.776  1.00 46.87 ? 378 ASP A O   1 
ATOM   376  C CB  . ASP A 1 60  ? -4.350  21.401 38.668  1.00 44.72 ? 378 ASP A CB  1 
ATOM   377  C CG  . ASP A 1 60  ? -2.950  21.341 38.050  1.00 44.34 ? 378 ASP A CG  1 
ATOM   378  O OD1 . ASP A 1 60  ? -2.789  20.811 36.927  1.00 37.66 ? 378 ASP A OD1 1 
ATOM   379  O OD2 . ASP A 1 60  ? -2.007  21.834 38.697  1.00 38.18 ? 378 ASP A OD2 1 
ATOM   380  N N   . ASP A 1 61  ? -7.719  20.737 38.455  1.00 46.67 ? 379 ASP A N   1 
ATOM   381  C CA  . ASP A 1 61  ? -8.871  20.440 39.285  1.00 47.73 ? 379 ASP A CA  1 
ATOM   382  C C   . ASP A 1 61  ? -8.712  21.045 40.660  1.00 47.23 ? 379 ASP A C   1 
ATOM   383  O O   . ASP A 1 61  ? -9.035  20.407 41.653  1.00 48.14 ? 379 ASP A O   1 
ATOM   384  C CB  . ASP A 1 61  ? -9.031  18.931 39.448  1.00 48.00 ? 379 ASP A CB  1 
ATOM   385  C CG  . ASP A 1 61  ? -9.996  18.339 38.456  1.00 50.89 ? 379 ASP A CG  1 
ATOM   386  O OD1 . ASP A 1 61  ? -11.104 18.896 38.302  1.00 52.17 ? 379 ASP A OD1 1 
ATOM   387  O OD2 . ASP A 1 61  ? -9.651  17.307 37.840  1.00 53.98 ? 379 ASP A OD2 1 
ATOM   388  N N   . ASP A 1 62  ? -8.223  22.269 40.731  1.00 45.88 ? 380 ASP A N   1 
ATOM   389  C CA  . ASP A 1 62  ? -7.972  22.851 42.028  1.00 45.28 ? 380 ASP A CA  1 
ATOM   390  C C   . ASP A 1 62  ? -8.905  23.971 42.378  1.00 43.90 ? 380 ASP A C   1 
ATOM   391  O O   . ASP A 1 62  ? -8.730  24.617 43.400  1.00 43.84 ? 380 ASP A O   1 
ATOM   392  C CB  . ASP A 1 62  ? -6.544  23.353 42.102  1.00 46.89 ? 380 ASP A CB  1 
ATOM   393  C CG  . ASP A 1 62  ? -5.607  22.290 42.540  1.00 50.35 ? 380 ASP A CG  1 
ATOM   394  O OD1 . ASP A 1 62  ? -5.976  21.584 43.508  1.00 48.70 ? 380 ASP A OD1 1 
ATOM   395  O OD2 . ASP A 1 62  ? -4.525  22.155 41.916  1.00 57.30 ? 380 ASP A OD2 1 
ATOM   396  N N   . VAL A 1 63  ? -9.893  24.213 41.533  1.00 42.78 ? 381 VAL A N   1 
ATOM   397  C CA  . VAL A 1 63  ? -10.810 25.314 41.769  1.00 41.94 ? 381 VAL A CA  1 
ATOM   398  C C   . VAL A 1 63  ? -11.382 25.305 43.195  1.00 41.49 ? 381 VAL A C   1 
ATOM   399  O O   . VAL A 1 63  ? -11.330 26.309 43.901  1.00 41.38 ? 381 VAL A O   1 
ATOM   400  C CB  . VAL A 1 63  ? -11.914 25.334 40.706  1.00 41.49 ? 381 VAL A CB  1 
ATOM   401  C CG1 . VAL A 1 63  ? -12.964 26.349 41.036  1.00 40.80 ? 381 VAL A CG1 1 
ATOM   402  C CG2 . VAL A 1 63  ? -11.305 25.685 39.376  1.00 43.78 ? 381 VAL A CG2 1 
ATOM   403  N N   . GLU A 1 64  ? -11.882 24.159 43.637  1.00 42.03 ? 382 GLU A N   1 
ATOM   404  C CA  . GLU A 1 64  ? -12.525 24.064 44.952  1.00 41.92 ? 382 GLU A CA  1 
ATOM   405  C C   . GLU A 1 64  ? -11.674 24.558 46.118  1.00 39.61 ? 382 GLU A C   1 
ATOM   406  O O   . GLU A 1 64  ? -12.084 25.421 46.885  1.00 37.84 ? 382 GLU A O   1 
ATOM   407  C CB  . GLU A 1 64  ? -13.007 22.630 45.199  1.00 42.31 ? 382 GLU A CB  1 
ATOM   408  C CG  . GLU A 1 64  ? -13.622 22.369 46.592  1.00 52.28 ? 382 GLU A CG  1 
ATOM   409  C CD  . GLU A 1 64  ? -14.490 23.519 47.135  1.00 61.92 ? 382 GLU A CD  1 
ATOM   410  O OE1 . GLU A 1 64  ? -14.710 24.515 46.400  1.00 64.61 ? 382 GLU A OE1 1 
ATOM   411  O OE2 . GLU A 1 64  ? -14.941 23.427 48.313  1.00 65.14 ? 382 GLU A OE2 1 
ATOM   412  N N   . CYS A 1 65  ? -10.484 24.003 46.242  1.00 39.82 ? 383 CYS A N   1 
ATOM   413  C CA  . CYS A 1 65  ? -9.633  24.277 47.388  1.00 40.72 ? 383 CYS A CA  1 
ATOM   414  C C   . CYS A 1 65  ? -8.915  25.617 47.228  1.00 38.48 ? 383 CYS A C   1 
ATOM   415  O O   . CYS A 1 65  ? -8.348  26.160 48.188  1.00 38.78 ? 383 CYS A O   1 
ATOM   416  C CB  . CYS A 1 65  ? -8.631  23.148 47.528  1.00 40.08 ? 383 CYS A CB  1 
ATOM   417  S SG  . CYS A 1 65  ? -8.043  22.752 45.892  1.00 55.43 ? 383 CYS A SG  1 
ATOM   418  N N   . THR A 1 66  ? -8.935  26.149 46.014  1.00 35.63 ? 384 THR A N   1 
ATOM   419  C CA  . THR A 1 66  ? -8.437  27.481 45.806  1.00 33.88 ? 384 THR A CA  1 
ATOM   420  C C   . THR A 1 66  ? -9.433  28.409 46.443  1.00 33.39 ? 384 THR A C   1 
ATOM   421  O O   . THR A 1 66  ? -9.075  29.273 47.227  1.00 33.47 ? 384 THR A O   1 
ATOM   422  C CB  . THR A 1 66  ? -8.342  27.814 44.342  1.00 33.76 ? 384 THR A CB  1 
ATOM   423  O OG1 . THR A 1 66  ? -7.254  27.086 43.765  1.00 34.83 ? 384 THR A OG1 1 
ATOM   424  C CG2 . THR A 1 66  ? -8.073  29.282 44.179  1.00 34.64 ? 384 THR A CG2 1 
ATOM   425  N N   . MET A 1 67  ? -10.698 28.207 46.117  1.00 33.64 ? 385 MET A N   1 
ATOM   426  C CA  . MET A 1 67  ? -11.764 28.984 46.708  1.00 35.35 ? 385 MET A CA  1 
ATOM   427  C C   . MET A 1 67  ? -11.832 28.793 48.230  1.00 35.62 ? 385 MET A C   1 
ATOM   428  O O   . MET A 1 67  ? -12.148 29.739 48.986  1.00 36.77 ? 385 MET A O   1 
ATOM   429  C CB  . MET A 1 67  ? -13.090 28.613 46.056  1.00 36.81 ? 385 MET A CB  1 
ATOM   430  C CG  . MET A 1 67  ? -13.147 28.978 44.586  1.00 40.68 ? 385 MET A CG  1 
ATOM   431  S SD  . MET A 1 67  ? -12.581 30.671 44.343  1.00 51.89 ? 385 MET A SD  1 
ATOM   432  C CE  . MET A 1 67  ? -13.954 31.595 45.047  1.00 41.71 ? 385 MET A CE  1 
ATOM   433  N N   . VAL A 1 68  ? -11.521 27.583 48.687  1.00 33.34 ? 386 VAL A N   1 
ATOM   434  C CA  . VAL A 1 68  ? -11.540 27.312 50.119  1.00 31.19 ? 386 VAL A CA  1 
ATOM   435  C C   . VAL A 1 68  ? -10.380 27.995 50.861  1.00 31.15 ? 386 VAL A C   1 
ATOM   436  O O   . VAL A 1 68  ? -10.576 28.528 51.955  1.00 29.20 ? 386 VAL A O   1 
ATOM   437  C CB  . VAL A 1 68  ? -11.544 25.817 50.395  1.00 30.22 ? 386 VAL A CB  1 
ATOM   438  C CG1 . VAL A 1 68  ? -11.284 25.556 51.873  1.00 28.63 ? 386 VAL A CG1 1 
ATOM   439  C CG2 . VAL A 1 68  ? -12.867 25.219 49.958  1.00 29.28 ? 386 VAL A CG2 1 
ATOM   440  N N   . GLU A 1 69  ? -9.188  27.983 50.254  1.00 30.48 ? 387 GLU A N   1 
ATOM   441  C CA  . GLU A 1 69  ? -8.029  28.662 50.819  1.00 30.64 ? 387 GLU A CA  1 
ATOM   442  C C   . GLU A 1 69  ? -8.356  30.129 51.015  1.00 31.21 ? 387 GLU A C   1 
ATOM   443  O O   . GLU A 1 69  ? -8.048  30.731 52.060  1.00 32.32 ? 387 GLU A O   1 
ATOM   444  C CB  . GLU A 1 69  ? -6.788  28.539 49.917  1.00 30.71 ? 387 GLU A CB  1 
ATOM   445  C CG  . GLU A 1 69  ? -5.532  29.178 50.539  1.00 33.48 ? 387 GLU A CG  1 
ATOM   446  C CD  . GLU A 1 69  ? -4.223  28.973 49.758  1.00 37.29 ? 387 GLU A CD  1 
ATOM   447  O OE1 . GLU A 1 69  ? -4.249  28.412 48.642  1.00 34.20 ? 387 GLU A OE1 1 
ATOM   448  O OE2 . GLU A 1 69  ? -3.151  29.394 50.280  1.00 41.59 ? 387 GLU A OE2 1 
ATOM   449  N N   . LYS A 1 70  ? -8.993  30.712 50.010  1.00 29.55 ? 388 LYS A N   1 
ATOM   450  C CA  . LYS A 1 70  ? -9.332  32.111 50.099  1.00 28.06 ? 388 LYS A CA  1 
ATOM   451  C C   . LYS A 1 70  ? -10.279 32.346 51.272  1.00 27.64 ? 388 LYS A C   1 
ATOM   452  O O   . LYS A 1 70  ? -10.100 33.291 52.015  1.00 27.24 ? 388 LYS A O   1 
ATOM   453  C CB  . LYS A 1 70  ? -9.897  32.624 48.773  1.00 27.86 ? 388 LYS A CB  1 
ATOM   454  C CG  . LYS A 1 70  ? -10.482 34.027 48.837  1.00 27.61 ? 388 LYS A CG  1 
ATOM   455  C CD  . LYS A 1 70  ? -11.981 33.988 49.134  1.00 25.34 ? 388 LYS A CD  1 
ATOM   456  C CE  . LYS A 1 70  ? -12.586 35.372 49.116  1.00 25.07 ? 388 LYS A CE  1 
ATOM   457  N NZ  . LYS A 1 70  ? -14.066 35.311 49.034  1.00 28.73 ? 388 LYS A NZ  1 
ATOM   458  N N   . ARG A 1 71  ? -11.276 31.488 51.456  1.00 28.67 ? 389 ARG A N   1 
ATOM   459  C CA  . ARG A 1 71  ? -12.184 31.651 52.602  1.00 29.43 ? 389 ARG A CA  1 
ATOM   460  C C   . ARG A 1 71  ? -11.441 31.384 53.907  1.00 29.25 ? 389 ARG A C   1 
ATOM   461  O O   . ARG A 1 71  ? -11.511 32.149 54.883  1.00 28.56 ? 389 ARG A O   1 
ATOM   462  C CB  . ARG A 1 71  ? -13.376 30.707 52.499  1.00 30.45 ? 389 ARG A CB  1 
ATOM   463  C CG  . ARG A 1 71  ? -14.254 30.919 51.276  1.00 32.78 ? 389 ARG A CG  1 
ATOM   464  C CD  . ARG A 1 71  ? -15.595 30.225 51.457  1.00 32.56 ? 389 ARG A CD  1 
ATOM   465  N NE  . ARG A 1 71  ? -15.543 28.815 51.094  1.00 35.85 ? 389 ARG A NE  1 
ATOM   466  C CZ  . ARG A 1 71  ? -15.479 28.373 49.842  1.00 37.15 ? 389 ARG A CZ  1 
ATOM   467  N NH1 . ARG A 1 71  ? -15.436 29.225 48.823  1.00 32.33 ? 389 ARG A NH1 1 
ATOM   468  N NH2 . ARG A 1 71  ? -15.440 27.069 49.608  1.00 42.19 ? 389 ARG A NH2 1 
ATOM   469  N N   . VAL A 1 72  ? -10.712 30.286 53.932  1.00 28.89 ? 390 VAL A N   1 
ATOM   470  C CA  . VAL A 1 72  ? -9.912  30.031 55.101  1.00 29.12 ? 390 VAL A CA  1 
ATOM   471  C C   . VAL A 1 72  ? -9.043  31.236 55.455  1.00 29.55 ? 390 VAL A C   1 
ATOM   472  O O   . VAL A 1 72  ? -9.029  31.650 56.605  1.00 30.38 ? 390 VAL A O   1 
ATOM   473  C CB  . VAL A 1 72  ? -9.086  28.773 54.967  1.00 27.29 ? 390 VAL A CB  1 
ATOM   474  C CG1 . VAL A 1 72  ? -8.170  28.654 56.127  1.00 26.79 ? 390 VAL A CG1 1 
ATOM   475  C CG2 . VAL A 1 72  ? -10.002 27.599 54.937  1.00 29.57 ? 390 VAL A CG2 1 
ATOM   476  N N   . LEU A 1 73  ? -8.350  31.821 54.482  1.00 29.19 ? 391 LEU A N   1 
ATOM   477  C CA  . LEU A 1 73  ? -7.529  33.005 54.779  1.00 29.64 ? 391 LEU A CA  1 
ATOM   478  C C   . LEU A 1 73  ? -8.378  34.207 55.195  1.00 30.59 ? 391 LEU A C   1 
ATOM   479  O O   . LEU A 1 73  ? -7.941  35.044 55.979  1.00 31.75 ? 391 LEU A O   1 
ATOM   480  C CB  . LEU A 1 73  ? -6.663  33.398 53.585  1.00 28.50 ? 391 LEU A CB  1 
ATOM   481  C CG  . LEU A 1 73  ? -5.514  32.475 53.195  1.00 25.93 ? 391 LEU A CG  1 
ATOM   482  C CD1 . LEU A 1 73  ? -4.829  32.994 51.956  1.00 30.45 ? 391 LEU A CD1 1 
ATOM   483  C CD2 . LEU A 1 73  ? -4.518  32.402 54.309  1.00 23.91 ? 391 LEU A CD2 1 
ATOM   484  N N   . ALA A 1 74  ? -9.603  34.292 54.687  1.00 30.95 ? 392 ALA A N   1 
ATOM   485  C CA  . ALA A 1 74  ? -10.406 35.490 54.903  1.00 30.99 ? 392 ALA A CA  1 
ATOM   486  C C   . ALA A 1 74  ? -11.118 35.523 56.257  1.00 31.84 ? 392 ALA A C   1 
ATOM   487  O O   . ALA A 1 74  ? -11.669 36.558 56.652  1.00 31.85 ? 392 ALA A O   1 
ATOM   488  C CB  . ALA A 1 74  ? -11.384 35.666 53.780  1.00 29.43 ? 392 ALA A CB  1 
ATOM   489  N N   . LEU A 1 75  ? -11.087 34.394 56.965  1.00 33.09 ? 393 LEU A N   1 
ATOM   490  C CA  . LEU A 1 75  ? -11.772 34.257 58.240  1.00 33.24 ? 393 LEU A CA  1 
ATOM   491  C C   . LEU A 1 75  ? -11.441 35.449 59.101  1.00 35.49 ? 393 LEU A C   1 
ATOM   492  O O   . LEU A 1 75  ? -10.297 35.911 59.094  1.00 38.34 ? 393 LEU A O   1 
ATOM   493  C CB  . LEU A 1 75  ? -11.330 32.978 58.937  1.00 31.83 ? 393 LEU A CB  1 
ATOM   494  C CG  . LEU A 1 75  ? -11.728 31.666 58.240  1.00 32.75 ? 393 LEU A CG  1 
ATOM   495  C CD1 . LEU A 1 75  ? -11.130 30.441 58.970  1.00 30.29 ? 393 LEU A CD1 1 
ATOM   496  C CD2 . LEU A 1 75  ? -13.244 31.530 58.085  1.00 20.96 ? 393 LEU A CD2 1 
ATOM   497  N N   . LEU A 1 76  ? -12.421 35.966 59.838  1.00 35.25 ? 394 LEU A N   1 
ATOM   498  C CA  . LEU A 1 76  ? -12.130 37.044 60.778  1.00 35.27 ? 394 LEU A CA  1 
ATOM   499  C C   . LEU A 1 76  ? -11.620 36.481 62.095  1.00 35.82 ? 394 LEU A C   1 
ATOM   500  O O   . LEU A 1 76  ? -11.934 35.346 62.445  1.00 36.68 ? 394 LEU A O   1 
ATOM   501  C CB  . LEU A 1 76  ? -13.370 37.883 61.025  1.00 34.69 ? 394 LEU A CB  1 
ATOM   502  C CG  . LEU A 1 76  ? -14.053 38.314 59.734  1.00 37.02 ? 394 LEU A CG  1 
ATOM   503  C CD1 . LEU A 1 76  ? -15.568 38.172 59.865  1.00 39.92 ? 394 LEU A CD1 1 
ATOM   504  C CD2 . LEU A 1 76  ? -13.656 39.717 59.317  1.00 34.39 ? 394 LEU A CD2 1 
ATOM   505  N N   . ASP A 1 77  ? -10.821 37.272 62.810  1.00 36.41 ? 395 ASP A N   1 
ATOM   506  C CA  . ASP A 1 77  ? -10.367 36.943 64.175  1.00 36.53 ? 395 ASP A CA  1 
ATOM   507  C C   . ASP A 1 77  ? -9.309  35.849 64.253  1.00 36.10 ? 395 ASP A C   1 
ATOM   508  O O   . ASP A 1 77  ? -9.110  35.234 65.303  1.00 36.42 ? 395 ASP A O   1 
ATOM   509  C CB  . ASP A 1 77  ? -11.556 36.612 65.080  1.00 36.64 ? 395 ASP A CB  1 
ATOM   510  C CG  . ASP A 1 77  ? -12.550 37.751 65.158  1.00 39.92 ? 395 ASP A CG  1 
ATOM   511  O OD1 . ASP A 1 77  ? -12.111 38.925 65.216  1.00 39.66 ? 395 ASP A OD1 1 
ATOM   512  O OD2 . ASP A 1 77  ? -13.773 37.479 65.150  1.00 45.22 ? 395 ASP A OD2 1 
ATOM   513  N N   . LYS A 1 78  ? -8.635  35.613 63.133  1.00 35.58 ? 396 LYS A N   1 
ATOM   514  C CA  . LYS A 1 78  ? -7.524  34.689 63.088  1.00 34.04 ? 396 LYS A CA  1 
ATOM   515  C C   . LYS A 1 78  ? -6.508  35.143 64.108  1.00 34.18 ? 396 LYS A C   1 
ATOM   516  O O   . LYS A 1 78  ? -6.099  36.313 64.114  1.00 34.56 ? 396 LYS A O   1 
ATOM   517  C CB  . LYS A 1 78  ? -6.892  34.664 61.682  1.00 34.35 ? 396 LYS A CB  1 
ATOM   518  C CG  . LYS A 1 78  ? -7.911  34.491 60.534  1.00 34.35 ? 396 LYS A CG  1 
ATOM   519  C CD  . LYS A 1 78  ? -7.295  34.151 59.188  1.00 27.74 ? 396 LYS A CD  1 
ATOM   520  C CE  . LYS A 1 78  ? -6.003  34.893 58.973  1.00 38.91 ? 396 LYS A CE  1 
ATOM   521  N NZ  . LYS A 1 78  ? -5.989  35.722 57.721  1.00 42.05 ? 396 LYS A NZ  1 
ATOM   522  N N   . PRO A 1 79  ? -6.110  34.227 64.996  1.00 33.76 ? 397 PRO A N   1 
ATOM   523  C CA  . PRO A 1 79  ? -4.958  34.425 65.851  1.00 33.57 ? 397 PRO A CA  1 
ATOM   524  C C   . PRO A 1 79  ? -3.746  34.899 65.039  1.00 32.48 ? 397 PRO A C   1 
ATOM   525  O O   . PRO A 1 79  ? -3.701  34.691 63.824  1.00 31.47 ? 397 PRO A O   1 
ATOM   526  C CB  . PRO A 1 79  ? -4.692  33.016 66.417  1.00 33.46 ? 397 PRO A CB  1 
ATOM   527  C CG  . PRO A 1 79  ? -5.711  32.116 65.816  1.00 34.37 ? 397 PRO A CG  1 
ATOM   528  C CD  . PRO A 1 79  ? -6.814  32.986 65.322  1.00 34.14 ? 397 PRO A CD  1 
ATOM   529  N N   . PRO A 1 80  ? -2.751  35.504 65.711  1.00 31.84 ? 398 PRO A N   1 
ATOM   530  C CA  . PRO A 1 80  ? -1.538  35.972 65.039  1.00 32.26 ? 398 PRO A CA  1 
ATOM   531  C C   . PRO A 1 80  ? -0.753  34.831 64.355  1.00 33.24 ? 398 PRO A C   1 
ATOM   532  O O   . PRO A 1 80  ? 0.092   35.075 63.484  1.00 33.00 ? 398 PRO A O   1 
ATOM   533  C CB  . PRO A 1 80  ? -0.725  36.542 66.191  1.00 30.88 ? 398 PRO A CB  1 
ATOM   534  C CG  . PRO A 1 80  ? -1.182  35.750 67.367  1.00 29.39 ? 398 PRO A CG  1 
ATOM   535  C CD  . PRO A 1 80  ? -2.633  35.608 67.174  1.00 30.93 ? 398 PRO A CD  1 
ATOM   536  N N   . PHE A 1 81  ? -1.064  33.596 64.737  1.00 33.66 ? 399 PHE A N   1 
ATOM   537  C CA  . PHE A 1 81  ? -0.248  32.443 64.389  1.00 33.54 ? 399 PHE A CA  1 
ATOM   538  C C   . PHE A 1 81  ? -0.539  31.855 63.016  1.00 33.98 ? 399 PHE A C   1 
ATOM   539  O O   . PHE A 1 81  ? 0.091   30.875 62.606  1.00 34.80 ? 399 PHE A O   1 
ATOM   540  C CB  . PHE A 1 81  ? -0.340  31.393 65.499  1.00 33.91 ? 399 PHE A CB  1 
ATOM   541  C CG  . PHE A 1 81  ? -0.065  31.951 66.859  1.00 34.39 ? 399 PHE A CG  1 
ATOM   542  C CD1 . PHE A 1 81  ? 1.116   32.645 67.110  1.00 37.55 ? 399 PHE A CD1 1 
ATOM   543  C CD2 . PHE A 1 81  ? -0.989  31.821 67.876  1.00 38.10 ? 399 PHE A CD2 1 
ATOM   544  C CE1 . PHE A 1 81  ? 1.373   33.201 68.360  1.00 40.07 ? 399 PHE A CE1 1 
ATOM   545  C CE2 . PHE A 1 81  ? -0.739  32.366 69.148  1.00 42.73 ? 399 PHE A CE2 1 
ATOM   546  C CZ  . PHE A 1 81  ? 0.443   33.060 69.388  1.00 41.14 ? 399 PHE A CZ  1 
ATOM   547  N N   . LEU A 1 82  ? -1.482  32.463 62.300  1.00 33.80 ? 400 LEU A N   1 
ATOM   548  C CA  . LEU A 1 82  ? -1.742  32.096 60.915  1.00 31.59 ? 400 LEU A CA  1 
ATOM   549  C C   . LEU A 1 82  ? -1.361  33.262 60.051  1.00 31.84 ? 400 LEU A C   1 
ATOM   550  O O   . LEU A 1 82  ? -1.655  34.404 60.373  1.00 32.89 ? 400 LEU A O   1 
ATOM   551  C CB  . LEU A 1 82  ? -3.206  31.801 60.689  1.00 29.83 ? 400 LEU A CB  1 
ATOM   552  C CG  . LEU A 1 82  ? -3.859  31.053 61.828  1.00 29.60 ? 400 LEU A CG  1 
ATOM   553  C CD1 . LEU A 1 82  ? -5.372  30.942 61.600  1.00 20.13 ? 400 LEU A CD1 1 
ATOM   554  C CD2 . LEU A 1 82  ? -3.174  29.704 61.973  1.00 28.92 ? 400 LEU A CD2 1 
ATOM   555  N N   . THR A 1 83  ? -0.712  32.965 58.940  1.00 32.62 ? 401 THR A N   1 
ATOM   556  C CA  . THR A 1 83  ? -0.316  33.997 57.998  1.00 32.25 ? 401 THR A CA  1 
ATOM   557  C C   . THR A 1 83  ? -1.453  34.948 57.722  1.00 32.30 ? 401 THR A C   1 
ATOM   558  O O   . THR A 1 83  ? -2.527  34.538 57.315  1.00 32.66 ? 401 THR A O   1 
ATOM   559  C CB  . THR A 1 83  ? 0.166   33.392 56.670  1.00 31.54 ? 401 THR A CB  1 
ATOM   560  O OG1 . THR A 1 83  ? -0.740  32.359 56.263  1.00 29.78 ? 401 THR A OG1 1 
ATOM   561  C CG2 . THR A 1 83  ? 1.553   32.825 56.850  1.00 26.13 ? 401 THR A CG2 1 
ATOM   562  N N   . GLN A 1 84  ? -1.205  36.224 57.962  1.00 33.14 ? 402 GLN A N   1 
ATOM   563  C CA  . GLN A 1 84  ? -2.155  37.260 57.616  1.00 33.80 ? 402 GLN A CA  1 
ATOM   564  C C   . GLN A 1 84  ? -2.392  37.348 56.115  1.00 33.71 ? 402 GLN A C   1 
ATOM   565  O O   . GLN A 1 84  ? -1.464  37.262 55.320  1.00 36.31 ? 402 GLN A O   1 
ATOM   566  C CB  . GLN A 1 84  ? -1.631  38.602 58.095  1.00 34.45 ? 402 GLN A CB  1 
ATOM   567  C CG  . GLN A 1 84  ? -1.903  38.893 59.542  1.00 35.33 ? 402 GLN A CG  1 
ATOM   568  C CD  . GLN A 1 84  ? -1.612  40.329 59.859  1.00 33.44 ? 402 GLN A CD  1 
ATOM   569  O OE1 . GLN A 1 84  ? -2.520  41.122 60.105  1.00 34.64 ? 402 GLN A OE1 1 
ATOM   570  N NE2 . GLN A 1 84  ? -0.347  40.684 59.820  1.00 28.82 ? 402 GLN A NE2 1 
ATOM   571  N N   . LEU A 1 85  ? -3.648  37.532 55.735  1.00 33.62 ? 403 LEU A N   1 
ATOM   572  C CA  . LEU A 1 85  ? -4.001  37.893 54.369  1.00 32.26 ? 403 LEU A CA  1 
ATOM   573  C C   . LEU A 1 85  ? -4.145  39.402 54.260  1.00 32.88 ? 403 LEU A C   1 
ATOM   574  O O   . LEU A 1 85  ? -4.845  40.035 55.063  1.00 32.84 ? 403 LEU A O   1 
ATOM   575  C CB  . LEU A 1 85  ? -5.320  37.244 53.983  1.00 30.26 ? 403 LEU A CB  1 
ATOM   576  C CG  . LEU A 1 85  ? -5.903  37.606 52.624  1.00 28.24 ? 403 LEU A CG  1 
ATOM   577  C CD1 . LEU A 1 85  ? -4.957  37.280 51.479  1.00 21.91 ? 403 LEU A CD1 1 
ATOM   578  C CD2 . LEU A 1 85  ? -7.213  36.856 52.470  1.00 29.72 ? 403 LEU A CD2 1 
ATOM   579  N N   . HIS A 1 86  ? -3.482  39.990 53.275  1.00 33.29 ? 404 HIS A N   1 
ATOM   580  C CA  . HIS A 1 86  ? -3.742  41.384 52.985  1.00 33.55 ? 404 HIS A CA  1 
ATOM   581  C C   . HIS A 1 86  ? -5.033  41.486 52.191  1.00 34.50 ? 404 HIS A C   1 
ATOM   582  O O   . HIS A 1 86  ? -5.925  42.243 52.555  1.00 34.78 ? 404 HIS A O   1 
ATOM   583  C CB  . HIS A 1 86  ? -2.610  42.030 52.203  1.00 32.72 ? 404 HIS A CB  1 
ATOM   584  C CG  . HIS A 1 86  ? -2.883  43.459 51.858  1.00 33.78 ? 404 HIS A CG  1 
ATOM   585  N ND1 . HIS A 1 86  ? -2.246  44.512 52.482  1.00 29.28 ? 404 HIS A ND1 1 
ATOM   586  C CD2 . HIS A 1 86  ? -3.757  44.010 50.984  1.00 30.97 ? 404 HIS A CD2 1 
ATOM   587  C CE1 . HIS A 1 86  ? -2.701  45.648 51.988  1.00 32.06 ? 404 HIS A CE1 1 
ATOM   588  N NE2 . HIS A 1 86  ? -3.618  45.371 51.079  1.00 33.68 ? 404 HIS A NE2 1 
ATOM   589  N N   . SER A 1 87  ? -5.130  40.700 51.117  1.00 36.24 ? 405 SER A N   1 
ATOM   590  C CA  . SER A 1 87  ? -6.287  40.735 50.221  1.00 36.50 ? 405 SER A CA  1 
ATOM   591  C C   . SER A 1 87  ? -6.108  39.809 49.014  1.00 37.18 ? 405 SER A C   1 
ATOM   592  O O   . SER A 1 87  ? -4.998  39.326 48.748  1.00 37.75 ? 405 SER A O   1 
ATOM   593  C CB  . SER A 1 87  ? -6.500  42.165 49.737  1.00 36.15 ? 405 SER A CB  1 
ATOM   594  O OG  . SER A 1 87  ? -5.257  42.740 49.364  1.00 38.78 ? 405 SER A OG  1 
ATOM   595  N N   . CYS A 1 88  ? -7.210  39.567 48.295  1.00 37.67 ? 406 CYS A N   1 
ATOM   596  C CA  . CYS A 1 88  ? -7.188  38.889 46.985  1.00 37.40 ? 406 CYS A CA  1 
ATOM   597  C C   . CYS A 1 88  ? -7.757  39.713 45.874  1.00 35.67 ? 406 CYS A C   1 
ATOM   598  O O   . CYS A 1 88  ? -8.627  40.577 46.063  1.00 35.04 ? 406 CYS A O   1 
ATOM   599  C CB  . CYS A 1 88  ? -8.082  37.671 46.970  1.00 37.54 ? 406 CYS A CB  1 
ATOM   600  S SG  . CYS A 1 88  ? -7.764  36.611 48.235  1.00 46.46 ? 406 CYS A SG  1 
ATOM   601  N N   . PHE A 1 89  ? -7.327  39.348 44.685  1.00 33.91 ? 407 PHE A N   1 
ATOM   602  C CA  . PHE A 1 89  ? -7.925  39.861 43.493  1.00 31.74 ? 407 PHE A CA  1 
ATOM   603  C C   . PHE A 1 89  ? -7.456  38.939 42.396  1.00 32.21 ? 407 PHE A C   1 
ATOM   604  O O   . PHE A 1 89  ? -6.417  38.291 42.515  1.00 32.41 ? 407 PHE A O   1 
ATOM   605  C CB  . PHE A 1 89  ? -7.476  41.311 43.255  1.00 30.68 ? 407 PHE A CB  1 
ATOM   606  C CG  . PHE A 1 89  ? -6.000  41.461 42.993  1.00 23.26 ? 407 PHE A CG  1 
ATOM   607  C CD1 . PHE A 1 89  ? -5.512  41.464 41.694  1.00 18.65 ? 407 PHE A CD1 1 
ATOM   608  C CD2 . PHE A 1 89  ? -5.105  41.584 44.041  1.00 22.48 ? 407 PHE A CD2 1 
ATOM   609  C CE1 . PHE A 1 89  ? -4.164  41.592 41.435  1.00 19.10 ? 407 PHE A CE1 1 
ATOM   610  C CE2 . PHE A 1 89  ? -3.731  41.709 43.799  1.00 22.48 ? 407 PHE A CE2 1 
ATOM   611  C CZ  . PHE A 1 89  ? -3.260  41.716 42.494  1.00 21.20 ? 407 PHE A CZ  1 
ATOM   612  N N   . GLN A 1 90  ? -8.228  38.863 41.334  1.00 32.82 ? 408 GLN A N   1 
ATOM   613  C CA  . GLN A 1 90  ? -7.821  38.081 40.198  1.00 34.41 ? 408 GLN A CA  1 
ATOM   614  C C   . GLN A 1 90  ? -7.571  39.035 39.061  1.00 34.89 ? 408 GLN A C   1 
ATOM   615  O O   . GLN A 1 90  ? -8.194  40.071 38.968  1.00 34.75 ? 408 GLN A O   1 
ATOM   616  C CB  . GLN A 1 90  ? -8.943  37.106 39.802  1.00 35.76 ? 408 GLN A CB  1 
ATOM   617  C CG  . GLN A 1 90  ? -10.256 37.801 39.384  1.00 31.01 ? 408 GLN A CG  1 
ATOM   618  C CD  . GLN A 1 90  ? -11.463 36.888 39.473  1.00 29.77 ? 408 GLN A CD  1 
ATOM   619  O OE1 . GLN A 1 90  ? -11.619 35.957 38.681  1.00 25.13 ? 408 GLN A OE1 1 
ATOM   620  N NE2 . GLN A 1 90  ? -12.337 37.161 40.438  1.00 30.33 ? 408 GLN A NE2 1 
ATOM   621  N N   . THR A 1 91  ? -6.655  38.683 38.183  1.00 37.23 ? 409 THR A N   1 
ATOM   622  C CA  . THR A 1 91  ? -6.668  39.281 36.865  1.00 38.04 ? 409 THR A CA  1 
ATOM   623  C C   . THR A 1 91  ? -7.405  38.313 35.925  1.00 36.97 ? 409 THR A C   1 
ATOM   624  O O   . THR A 1 91  ? -7.942  37.305 36.381  1.00 36.62 ? 409 THR A O   1 
ATOM   625  C CB  . THR A 1 91  ? -5.273  39.555 36.370  1.00 37.68 ? 409 THR A CB  1 
ATOM   626  O OG1 . THR A 1 91  ? -5.386  40.184 35.095  1.00 44.47 ? 409 THR A OG1 1 
ATOM   627  C CG2 . THR A 1 91  ? -4.482  38.252 36.216  1.00 38.09 ? 409 THR A CG2 1 
ATOM   628  N N   . VAL A 1 92  ? -7.442  38.598 34.631  1.00 36.31 ? 410 VAL A N   1 
ATOM   629  C CA  . VAL A 1 92  ? -8.227  37.753 33.731  1.00 36.86 ? 410 VAL A CA  1 
ATOM   630  C C   . VAL A 1 92  ? -7.780  36.308 33.741  1.00 37.41 ? 410 VAL A C   1 
ATOM   631  O O   . VAL A 1 92  ? -8.610  35.401 33.569  1.00 38.29 ? 410 VAL A O   1 
ATOM   632  C CB  . VAL A 1 92  ? -8.148  38.193 32.253  1.00 37.50 ? 410 VAL A CB  1 
ATOM   633  C CG1 . VAL A 1 92  ? -8.961  39.439 32.014  1.00 40.32 ? 410 VAL A CG1 1 
ATOM   634  C CG2 . VAL A 1 92  ? -6.697  38.354 31.806  1.00 35.57 ? 410 VAL A CG2 1 
ATOM   635  N N   . ASP A 1 93  ? -6.474  36.094 33.902  1.00 36.16 ? 411 ASP A N   1 
ATOM   636  C CA  . ASP A 1 93  ? -5.908  34.759 33.747  1.00 35.95 ? 411 ASP A CA  1 
ATOM   637  C C   . ASP A 1 93  ? -5.198  34.231 34.999  1.00 35.52 ? 411 ASP A C   1 
ATOM   638  O O   . ASP A 1 93  ? -4.670  33.115 35.005  1.00 35.14 ? 411 ASP A O   1 
ATOM   639  C CB  . ASP A 1 93  ? -4.993  34.688 32.509  1.00 36.34 ? 411 ASP A CB  1 
ATOM   640  C CG  . ASP A 1 93  ? -3.876  35.738 32.520  1.00 39.51 ? 411 ASP A CG  1 
ATOM   641  O OD1 . ASP A 1 93  ? -3.771  36.508 33.504  1.00 45.78 ? 411 ASP A OD1 1 
ATOM   642  O OD2 . ASP A 1 93  ? -3.098  35.793 31.534  1.00 40.79 ? 411 ASP A OD2 1 
ATOM   643  N N   . ARG A 1 94  ? -5.214  35.022 36.065  1.00 35.01 ? 412 ARG A N   1 
ATOM   644  C CA  . ARG A 1 94  ? -4.423  34.701 37.239  1.00 34.13 ? 412 ARG A CA  1 
ATOM   645  C C   . ARG A 1 94  ? -5.087  35.107 38.528  1.00 32.99 ? 412 ARG A C   1 
ATOM   646  O O   . ARG A 1 94  ? -5.910  36.023 38.548  1.00 33.26 ? 412 ARG A O   1 
ATOM   647  C CB  . ARG A 1 94  ? -3.083  35.405 37.149  1.00 34.48 ? 412 ARG A CB  1 
ATOM   648  C CG  . ARG A 1 94  ? -2.180  34.835 36.091  1.00 36.76 ? 412 ARG A CG  1 
ATOM   649  C CD  . ARG A 1 94  ? -1.229  35.897 35.549  1.00 43.90 ? 412 ARG A CD  1 
ATOM   650  N NE  . ARG A 1 94  ? 0.137   35.398 35.558  1.00 45.57 ? 412 ARG A NE  1 
ATOM   651  C CZ  . ARG A 1 94  ? 0.666   34.619 34.620  1.00 48.32 ? 412 ARG A CZ  1 
ATOM   652  N NH1 . ARG A 1 94  ? -0.036  34.249 33.562  1.00 49.12 ? 412 ARG A NH1 1 
ATOM   653  N NH2 . ARG A 1 94  ? 1.915   34.220 34.738  1.00 54.10 ? 412 ARG A NH2 1 
ATOM   654  N N   . LEU A 1 95  ? -4.716  34.422 39.605  1.00 31.44 ? 413 LEU A N   1 
ATOM   655  C CA  . LEU A 1 95  ? -5.175  34.780 40.941  1.00 30.13 ? 413 LEU A CA  1 
ATOM   656  C C   . LEU A 1 95  ? -4.007  35.219 41.782  1.00 29.32 ? 413 LEU A C   1 
ATOM   657  O O   . LEU A 1 95  ? -2.928  34.635 41.696  1.00 29.04 ? 413 LEU A O   1 
ATOM   658  C CB  . LEU A 1 95  ? -5.803  33.578 41.611  1.00 30.25 ? 413 LEU A CB  1 
ATOM   659  C CG  . LEU A 1 95  ? -6.782  32.802 40.749  1.00 30.86 ? 413 LEU A CG  1 
ATOM   660  C CD1 . LEU A 1 95  ? -6.930  31.450 41.348  1.00 33.41 ? 413 LEU A CD1 1 
ATOM   661  C CD2 . LEU A 1 95  ? -8.129  33.505 40.688  1.00 33.37 ? 413 LEU A CD2 1 
ATOM   662  N N   . TYR A 1 96  ? -4.212  36.234 42.611  1.00 29.21 ? 414 TYR A N   1 
ATOM   663  C CA  . TYR A 1 96  ? -3.146  36.692 43.488  1.00 29.74 ? 414 TYR A CA  1 
ATOM   664  C C   . TYR A 1 96  ? -3.621  36.751 44.917  1.00 29.74 ? 414 TYR A C   1 
ATOM   665  O O   . TYR A 1 96  ? -4.642  37.379 45.221  1.00 31.15 ? 414 TYR A O   1 
ATOM   666  C CB  . TYR A 1 96  ? -2.606  38.066 43.060  1.00 29.68 ? 414 TYR A CB  1 
ATOM   667  C CG  . TYR A 1 96  ? -2.255  38.177 41.596  1.00 31.51 ? 414 TYR A CG  1 
ATOM   668  C CD1 . TYR A 1 96  ? -0.968  37.905 41.131  1.00 31.17 ? 414 TYR A CD1 1 
ATOM   669  C CD2 . TYR A 1 96  ? -3.216  38.547 40.669  1.00 36.03 ? 414 TYR A CD2 1 
ATOM   670  C CE1 . TYR A 1 96  ? -0.650  38.005 39.760  1.00 34.30 ? 414 TYR A CE1 1 
ATOM   671  C CE2 . TYR A 1 96  ? -2.911  38.654 39.299  1.00 40.97 ? 414 TYR A CE2 1 
ATOM   672  C CZ  . TYR A 1 96  ? -1.628  38.386 38.846  1.00 38.27 ? 414 TYR A CZ  1 
ATOM   673  O OH  . TYR A 1 96  ? -1.361  38.509 37.483  1.00 39.03 ? 414 TYR A OH  1 
ATOM   674  N N   . PHE A 1 97  ? -2.876  36.096 45.795  1.00 29.98 ? 415 PHE A N   1 
ATOM   675  C CA  . PHE A 1 97  ? -3.107  36.206 47.227  1.00 31.65 ? 415 PHE A CA  1 
ATOM   676  C C   . PHE A 1 97  ? -2.049  37.111 47.774  1.00 33.08 ? 415 PHE A C   1 
ATOM   677  O O   . PHE A 1 97  ? -0.865  36.832 47.596  1.00 35.05 ? 415 PHE A O   1 
ATOM   678  C CB  . PHE A 1 97  ? -2.961  34.853 47.899  1.00 30.20 ? 415 PHE A CB  1 
ATOM   679  C CG  . PHE A 1 97  ? -4.002  33.883 47.494  1.00 32.29 ? 415 PHE A CG  1 
ATOM   680  C CD1 . PHE A 1 97  ? -3.963  33.292 46.231  1.00 33.72 ? 415 PHE A CD1 1 
ATOM   681  C CD2 . PHE A 1 97  ? -5.042  33.569 48.345  1.00 32.58 ? 415 PHE A CD2 1 
ATOM   682  C CE1 . PHE A 1 97  ? -4.937  32.382 45.831  1.00 30.62 ? 415 PHE A CE1 1 
ATOM   683  C CE2 . PHE A 1 97  ? -6.022  32.661 47.945  1.00 33.33 ? 415 PHE A CE2 1 
ATOM   684  C CZ  . PHE A 1 97  ? -5.965  32.066 46.688  1.00 27.76 ? 415 PHE A CZ  1 
ATOM   685  N N   . VAL A 1 98  ? -2.438  38.192 48.435  1.00 33.76 ? 416 VAL A N   1 
ATOM   686  C CA  . VAL A 1 98  ? -1.406  39.086 48.944  1.00 34.05 ? 416 VAL A CA  1 
ATOM   687  C C   . VAL A 1 98  ? -1.189  38.869 50.443  1.00 35.37 ? 416 VAL A C   1 
ATOM   688  O O   . VAL A 1 98  ? -2.089  39.066 51.267  1.00 36.16 ? 416 VAL A O   1 
ATOM   689  C CB  . VAL A 1 98  ? -1.640  40.553 48.557  1.00 32.86 ? 416 VAL A CB  1 
ATOM   690  C CG1 . VAL A 1 98  ? -0.367  41.311 48.749  1.00 32.41 ? 416 VAL A CG1 1 
ATOM   691  C CG2 . VAL A 1 98  ? -2.016  40.645 47.099  1.00 28.00 ? 416 VAL A CG2 1 
ATOM   692  N N   . MET A 1 99  ? 0.011   38.416 50.785  1.00 34.76 ? 417 MET A N   1 
ATOM   693  C CA  . MET A 1 99  ? 0.230   37.908 52.116  1.00 33.80 ? 417 MET A CA  1 
ATOM   694  C C   . MET A 1 99  ? 1.092   38.833 52.910  1.00 34.75 ? 417 MET A C   1 
ATOM   695  O O   . MET A 1 99  ? 1.964   39.514 52.370  1.00 34.44 ? 417 MET A O   1 
ATOM   696  C CB  . MET A 1 99  ? 0.901   36.543 52.045  1.00 32.91 ? 417 MET A CB  1 
ATOM   697  C CG  . MET A 1 99  ? 0.143   35.560 51.196  1.00 30.59 ? 417 MET A CG  1 
ATOM   698  S SD  . MET A 1 99  ? -1.589  35.505 51.688  1.00 36.50 ? 417 MET A SD  1 
ATOM   699  C CE  . MET A 1 99  ? -1.504  34.762 53.316  1.00 34.19 ? 417 MET A CE  1 
ATOM   700  N N   . GLU A 1 100 ? 0.861   38.853 54.211  1.00 35.40 ? 418 GLU A N   1 
ATOM   701  C CA  . GLU A 1 100 ? 1.831   39.456 55.079  1.00 34.98 ? 418 GLU A CA  1 
ATOM   702  C C   . GLU A 1 100 ? 3.112   38.697 54.823  1.00 33.99 ? 418 GLU A C   1 
ATOM   703  O O   . GLU A 1 100 ? 3.101   37.479 54.701  1.00 35.64 ? 418 GLU A O   1 
ATOM   704  C CB  . GLU A 1 100 ? 1.402   39.308 56.527  1.00 36.15 ? 418 GLU A CB  1 
ATOM   705  C CG  . GLU A 1 100 ? 1.495   37.919 57.069  1.00 34.84 ? 418 GLU A CG  1 
ATOM   706  C CD  . GLU A 1 100 ? 1.525   37.919 58.583  1.00 40.65 ? 418 GLU A CD  1 
ATOM   707  O OE1 . GLU A 1 100 ? 1.857   38.971 59.176  1.00 39.82 ? 418 GLU A OE1 1 
ATOM   708  O OE2 . GLU A 1 100 ? 1.217   36.869 59.181  1.00 41.46 ? 418 GLU A OE2 1 
ATOM   709  N N   . TYR A 1 101 ? 4.217   39.401 54.694  1.00 33.33 ? 419 TYR A N   1 
ATOM   710  C CA  . TYR A 1 101 ? 5.477   38.719 54.436  1.00 33.91 ? 419 TYR A CA  1 
ATOM   711  C C   . TYR A 1 101 ? 6.154   38.223 55.735  1.00 33.47 ? 419 TYR A C   1 
ATOM   712  O O   . TYR A 1 101 ? 6.241   38.944 56.718  1.00 32.51 ? 419 TYR A O   1 
ATOM   713  C CB  . TYR A 1 101 ? 6.397   39.596 53.600  1.00 33.54 ? 419 TYR A CB  1 
ATOM   714  C CG  . TYR A 1 101 ? 7.798   39.082 53.529  1.00 35.43 ? 419 TYR A CG  1 
ATOM   715  C CD1 . TYR A 1 101 ? 8.047   37.735 53.304  1.00 36.57 ? 419 TYR A CD1 1 
ATOM   716  C CD2 . TYR A 1 101 ? 8.877   39.937 53.683  1.00 36.11 ? 419 TYR A CD2 1 
ATOM   717  C CE1 . TYR A 1 101 ? 9.318   37.253 53.239  1.00 37.33 ? 419 TYR A CE1 1 
ATOM   718  C CE2 . TYR A 1 101 ? 10.160  39.463 53.610  1.00 37.55 ? 419 TYR A CE2 1 
ATOM   719  C CZ  . TYR A 1 101 ? 10.377  38.116 53.394  1.00 38.92 ? 419 TYR A CZ  1 
ATOM   720  O OH  . TYR A 1 101 ? 11.663  37.628 53.317  1.00 41.43 ? 419 TYR A OH  1 
ATOM   721  N N   . VAL A 1 102 ? 6.601   36.970 55.728  1.00 33.64 ? 420 VAL A N   1 
ATOM   722  C CA  . VAL A 1 102 ? 7.040   36.303 56.943  1.00 33.60 ? 420 VAL A CA  1 
ATOM   723  C C   . VAL A 1 102 ? 8.499   35.946 56.837  1.00 35.60 ? 420 VAL A C   1 
ATOM   724  O O   . VAL A 1 102 ? 8.995   35.685 55.749  1.00 36.98 ? 420 VAL A O   1 
ATOM   725  C CB  . VAL A 1 102 ? 6.262   35.035 57.176  1.00 33.09 ? 420 VAL A CB  1 
ATOM   726  C CG1 . VAL A 1 102 ? 6.717   34.404 58.449  1.00 31.76 ? 420 VAL A CG1 1 
ATOM   727  C CG2 . VAL A 1 102 ? 4.741   35.318 57.190  1.00 30.38 ? 420 VAL A CG2 1 
ATOM   728  N N   . ASN A 1 103 ? 9.174   35.881 57.975  1.00 36.76 ? 421 ASN A N   1 
ATOM   729  C CA  . ASN A 1 103 ? 10.590  36.230 58.001  1.00 37.86 ? 421 ASN A CA  1 
ATOM   730  C C   . ASN A 1 103 ? 11.602  35.311 58.695  1.00 36.61 ? 421 ASN A C   1 
ATOM   731  O O   . ASN A 1 103 ? 12.787  35.383 58.386  1.00 35.47 ? 421 ASN A O   1 
ATOM   732  C CB  . ASN A 1 103 ? 10.712  37.619 58.626  1.00 39.88 ? 421 ASN A CB  1 
ATOM   733  C CG  . ASN A 1 103 ? 11.477  38.564 57.756  1.00 43.34 ? 421 ASN A CG  1 
ATOM   734  O OD1 . ASN A 1 103 ? 12.432  38.174 57.076  1.00 48.29 ? 421 ASN A OD1 1 
ATOM   735  N ND2 . ASN A 1 103 ? 11.054  39.817 57.749  1.00 42.89 ? 421 ASN A ND2 1 
ATOM   736  N N   . GLY A 1 104 ? 11.154  34.485 59.641  1.00 35.62 ? 422 GLY A N   1 
ATOM   737  C CA  . GLY A 1 104 ? 12.066  33.681 60.445  1.00 34.40 ? 422 GLY A CA  1 
ATOM   738  C C   . GLY A 1 104 ? 12.664  32.462 59.761  1.00 35.32 ? 422 GLY A C   1 
ATOM   739  O O   . GLY A 1 104 ? 13.577  31.856 60.292  1.00 37.03 ? 422 GLY A O   1 
ATOM   740  N N   . GLY A 1 105 ? 12.178  32.079 58.586  1.00 33.67 ? 423 GLY A N   1 
ATOM   741  C CA  . GLY A 1 105 ? 12.589  30.795 58.020  1.00 33.01 ? 423 GLY A CA  1 
ATOM   742  C C   . GLY A 1 105 ? 11.724  29.687 58.600  1.00 33.17 ? 423 GLY A C   1 
ATOM   743  O O   . GLY A 1 105 ? 10.954  29.915 59.533  1.00 32.86 ? 423 GLY A O   1 
ATOM   744  N N   . ASP A 1 106 ? 11.807  28.480 58.060  1.00 33.61 ? 424 ASP A N   1 
ATOM   745  C CA  . ASP A 1 106 ? 10.889  27.447 58.550  1.00 35.11 ? 424 ASP A CA  1 
ATOM   746  C C   . ASP A 1 106 ? 11.411  26.618 59.716  1.00 34.43 ? 424 ASP A C   1 
ATOM   747  O O   . ASP A 1 106 ? 12.616  26.505 59.932  1.00 33.84 ? 424 ASP A O   1 
ATOM   748  C CB  . ASP A 1 106 ? 10.334  26.541 57.431  1.00 35.65 ? 424 ASP A CB  1 
ATOM   749  C CG  . ASP A 1 106 ? 11.203  26.527 56.188  1.00 39.82 ? 424 ASP A CG  1 
ATOM   750  O OD1 . ASP A 1 106 ? 12.080  25.634 56.079  1.00 42.80 ? 424 ASP A OD1 1 
ATOM   751  O OD2 . ASP A 1 106 ? 10.988  27.397 55.307  1.00 43.98 ? 424 ASP A OD2 1 
ATOM   752  N N   . LEU A 1 107 ? 10.481  26.049 60.474  1.00 34.62 ? 425 LEU A N   1 
ATOM   753  C CA  . LEU A 1 107 ? 10.843  25.125 61.539  1.00 34.63 ? 425 LEU A CA  1 
ATOM   754  C C   . LEU A 1 107 ? 11.838  24.111 61.005  1.00 34.65 ? 425 LEU A C   1 
ATOM   755  O O   . LEU A 1 107 ? 12.924  23.920 61.547  1.00 33.84 ? 425 LEU A O   1 
ATOM   756  C CB  . LEU A 1 107 ? 9.605   24.406 62.056  1.00 34.43 ? 425 LEU A CB  1 
ATOM   757  C CG  . LEU A 1 107 ? 8.683   25.167 63.008  1.00 32.44 ? 425 LEU A CG  1 
ATOM   758  C CD1 . LEU A 1 107 ? 7.903   24.140 63.832  1.00 33.20 ? 425 LEU A CD1 1 
ATOM   759  C CD2 . LEU A 1 107 ? 9.483   26.054 63.930  1.00 27.32 ? 425 LEU A CD2 1 
ATOM   760  N N   . MET A 1 108 ? 11.456  23.473 59.911  1.00 36.51 ? 426 MET A N   1 
ATOM   761  C CA  . MET A 1 108 ? 12.307  22.500 59.256  1.00 38.19 ? 426 MET A CA  1 
ATOM   762  C C   . MET A 1 108 ? 13.758  22.986 59.268  1.00 38.74 ? 426 MET A C   1 
ATOM   763  O O   . MET A 1 108 ? 14.655  22.310 59.771  1.00 39.59 ? 426 MET A O   1 
ATOM   764  C CB  . MET A 1 108 ? 11.798  22.311 57.838  1.00 39.26 ? 426 MET A CB  1 
ATOM   765  C CG  . MET A 1 108 ? 12.588  21.346 57.011  1.00 41.94 ? 426 MET A CG  1 
ATOM   766  S SD  . MET A 1 108 ? 12.627  19.696 57.679  1.00 38.82 ? 426 MET A SD  1 
ATOM   767  C CE  . MET A 1 108 ? 13.152  18.804 56.222  1.00 39.39 ? 426 MET A CE  1 
ATOM   768  N N   . TYR A 1 109 ? 13.971  24.180 58.734  1.00 39.19 ? 427 TYR A N   1 
ATOM   769  C CA  . TYR A 1 109 ? 15.285  24.801 58.715  1.00 39.32 ? 427 TYR A CA  1 
ATOM   770  C C   . TYR A 1 109 ? 15.876  24.886 60.113  1.00 40.10 ? 427 TYR A C   1 
ATOM   771  O O   . TYR A 1 109 ? 17.025  24.495 60.345  1.00 40.07 ? 427 TYR A O   1 
ATOM   772  C CB  . TYR A 1 109 ? 15.180  26.211 58.125  1.00 38.93 ? 427 TYR A CB  1 
ATOM   773  C CG  . TYR A 1 109 ? 16.436  27.010 58.283  1.00 39.66 ? 427 TYR A CG  1 
ATOM   774  C CD1 . TYR A 1 109 ? 17.442  26.929 57.331  1.00 39.30 ? 427 TYR A CD1 1 
ATOM   775  C CD2 . TYR A 1 109 ? 16.635  27.832 59.394  1.00 37.95 ? 427 TYR A CD2 1 
ATOM   776  C CE1 . TYR A 1 109 ? 18.612  27.649 57.458  1.00 36.90 ? 427 TYR A CE1 1 
ATOM   777  C CE2 . TYR A 1 109 ? 17.810  28.553 59.534  1.00 40.32 ? 427 TYR A CE2 1 
ATOM   778  C CZ  . TYR A 1 109 ? 18.796  28.454 58.549  1.00 38.51 ? 427 TYR A CZ  1 
ATOM   779  O OH  . TYR A 1 109 ? 19.967  29.170 58.641  1.00 38.29 ? 427 TYR A OH  1 
ATOM   780  N N   . HIS A 1 110 ? 15.086  25.413 61.041  1.00 40.20 ? 428 HIS A N   1 
ATOM   781  C CA  . HIS A 1 110 ? 15.590  25.739 62.367  1.00 40.60 ? 428 HIS A CA  1 
ATOM   782  C C   . HIS A 1 110 ? 15.891  24.519 63.215  1.00 40.67 ? 428 HIS A C   1 
ATOM   783  O O   . HIS A 1 110 ? 16.746  24.568 64.091  1.00 41.19 ? 428 HIS A O   1 
ATOM   784  C CB  . HIS A 1 110 ? 14.607  26.650 63.089  1.00 40.26 ? 428 HIS A CB  1 
ATOM   785  C CG  . HIS A 1 110 ? 14.684  28.077 62.648  1.00 43.57 ? 428 HIS A CG  1 
ATOM   786  N ND1 . HIS A 1 110 ? 15.885  28.742 62.484  1.00 43.47 ? 428 HIS A ND1 1 
ATOM   787  C CD2 . HIS A 1 110 ? 13.712  28.970 62.345  1.00 39.77 ? 428 HIS A CD2 1 
ATOM   788  C CE1 . HIS A 1 110 ? 15.645  29.980 62.097  1.00 40.80 ? 428 HIS A CE1 1 
ATOM   789  N NE2 . HIS A 1 110 ? 14.335  30.143 62.003  1.00 40.08 ? 428 HIS A NE2 1 
ATOM   790  N N   . ILE A 1 111 ? 15.177  23.432 62.959  1.00 41.09 ? 429 ILE A N   1 
ATOM   791  C CA  . ILE A 1 111 ? 15.428  22.177 63.642  1.00 41.59 ? 429 ILE A CA  1 
ATOM   792  C C   . ILE A 1 111 ? 16.697  21.557 63.093  1.00 42.61 ? 429 ILE A C   1 
ATOM   793  O O   . ILE A 1 111 ? 17.482  20.945 63.827  1.00 42.69 ? 429 ILE A O   1 
ATOM   794  C CB  . ILE A 1 111 ? 14.294  21.186 63.427  1.00 40.97 ? 429 ILE A CB  1 
ATOM   795  C CG1 . ILE A 1 111 ? 13.035  21.679 64.108  1.00 41.44 ? 429 ILE A CG1 1 
ATOM   796  C CG2 . ILE A 1 111 ? 14.659  19.833 64.003  1.00 42.30 ? 429 ILE A CG2 1 
ATOM   797  C CD1 . ILE A 1 111 ? 11.858  20.767 63.891  1.00 47.42 ? 429 ILE A CD1 1 
ATOM   798  N N   . GLN A 1 112 ? 16.903  21.702 61.790  1.00 43.27 ? 430 GLN A N   1 
ATOM   799  C CA  . GLN A 1 112 ? 18.182  21.294 61.220  1.00 44.05 ? 430 GLN A CA  1 
ATOM   800  C C   . GLN A 1 112 ? 19.367  22.034 61.865  1.00 43.35 ? 430 GLN A C   1 
ATOM   801  O O   . GLN A 1 112 ? 20.434  21.453 62.002  1.00 42.17 ? 430 GLN A O   1 
ATOM   802  C CB  . GLN A 1 112 ? 18.183  21.454 59.704  1.00 43.63 ? 430 GLN A CB  1 
ATOM   803  C CG  . GLN A 1 112 ? 17.284  20.468 59.014  1.00 43.92 ? 430 GLN A CG  1 
ATOM   804  C CD  . GLN A 1 112 ? 17.266  20.681 57.523  1.00 46.62 ? 430 GLN A CD  1 
ATOM   805  O OE1 . GLN A 1 112 ? 17.505  19.753 56.753  1.00 46.98 ? 430 GLN A OE1 1 
ATOM   806  N NE2 . GLN A 1 112 ? 16.993  21.914 57.102  1.00 46.19 ? 430 GLN A NE2 1 
ATOM   807  N N   . GLN A 1 113 ? 19.157  23.294 62.269  1.00 43.50 ? 431 GLN A N   1 
ATOM   808  C CA  . GLN A 1 113 ? 20.153  24.086 63.023  1.00 43.05 ? 431 GLN A CA  1 
ATOM   809  C C   . GLN A 1 113 ? 20.635  23.451 64.323  1.00 41.68 ? 431 GLN A C   1 
ATOM   810  O O   . GLN A 1 113 ? 21.798  23.568 64.668  1.00 42.82 ? 431 GLN A O   1 
ATOM   811  C CB  . GLN A 1 113 ? 19.629  25.492 63.363  1.00 44.40 ? 431 GLN A CB  1 
ATOM   812  C CG  . GLN A 1 113 ? 19.469  26.440 62.181  1.00 47.32 ? 431 GLN A CG  1 
ATOM   813  C CD  . GLN A 1 113 ? 20.606  26.321 61.200  1.00 47.08 ? 431 GLN A CD  1 
ATOM   814  O OE1 . GLN A 1 113 ? 20.426  25.803 60.095  1.00 47.62 ? 431 GLN A OE1 1 
ATOM   815  N NE2 . GLN A 1 113 ? 21.789  26.779 61.599  1.00 43.77 ? 431 GLN A NE2 1 
ATOM   816  N N   . VAL A 1 114 ? 19.755  22.790 65.058  1.00 40.63 ? 432 VAL A N   1 
ATOM   817  C CA  . VAL A 1 114 ? 20.135  22.275 66.365  1.00 39.88 ? 432 VAL A CA  1 
ATOM   818  C C   . VAL A 1 114 ? 19.910  20.781 66.557  1.00 40.25 ? 432 VAL A C   1 
ATOM   819  O O   . VAL A 1 114 ? 20.015  20.285 67.686  1.00 41.18 ? 432 VAL A O   1 
ATOM   820  C CB  . VAL A 1 114 ? 19.414  23.039 67.504  1.00 40.45 ? 432 VAL A CB  1 
ATOM   821  C CG1 . VAL A 1 114 ? 20.051  24.389 67.712  1.00 39.52 ? 432 VAL A CG1 1 
ATOM   822  C CG2 . VAL A 1 114 ? 17.912  23.188 67.217  1.00 39.81 ? 432 VAL A CG2 1 
ATOM   823  N N   . GLY A 1 115 ? 19.615  20.070 65.466  1.00 39.90 ? 433 GLY A N   1 
ATOM   824  C CA  . GLY A 1 115 ? 19.261  18.640 65.512  1.00 38.92 ? 433 GLY A CA  1 
ATOM   825  C C   . GLY A 1 115 ? 17.857  18.432 66.068  1.00 39.06 ? 433 GLY A C   1 
ATOM   826  O O   . GLY A 1 115 ? 17.036  17.702 65.496  1.00 37.39 ? 433 GLY A O   1 
ATOM   827  N N   . LYS A 1 116 ? 17.588  19.086 67.197  1.00 38.92 ? 434 LYS A N   1 
ATOM   828  C CA  . LYS A 1 116 ? 16.287  19.042 67.819  1.00 39.50 ? 434 LYS A CA  1 
ATOM   829  C C   . LYS A 1 116 ? 16.128  20.150 68.835  1.00 40.83 ? 434 LYS A C   1 
ATOM   830  O O   . LYS A 1 116 ? 17.097  20.628 69.427  1.00 41.81 ? 434 LYS A O   1 
ATOM   831  C CB  . LYS A 1 116 ? 16.037  17.687 68.481  1.00 39.66 ? 434 LYS A CB  1 
ATOM   832  C CG  . LYS A 1 116 ? 16.829  17.434 69.733  1.00 37.17 ? 434 LYS A CG  1 
ATOM   833  C CD  . LYS A 1 116 ? 17.173  15.958 69.798  1.00 37.58 ? 434 LYS A CD  1 
ATOM   834  C CE  . LYS A 1 116 ? 17.834  15.595 71.103  1.00 37.13 ? 434 LYS A CE  1 
ATOM   835  N NZ  . LYS A 1 116 ? 18.850  14.523 70.910  1.00 38.34 ? 434 LYS A NZ  1 
ATOM   836  N N   . PHE A 1 117 ? 14.884  20.561 69.027  1.00 41.40 ? 435 PHE A N   1 
ATOM   837  C CA  . PHE A 1 117 ? 14.570  21.557 70.010  1.00 40.90 ? 435 PHE A CA  1 
ATOM   838  C C   . PHE A 1 117 ? 14.652  20.988 71.417  1.00 41.69 ? 435 PHE A C   1 
ATOM   839  O O   . PHE A 1 117 ? 14.288  19.838 71.664  1.00 41.20 ? 435 PHE A O   1 
ATOM   840  C CB  . PHE A 1 117 ? 13.183  22.129 69.748  1.00 40.23 ? 435 PHE A CB  1 
ATOM   841  C CG  . PHE A 1 117 ? 13.091  22.905 68.471  1.00 38.82 ? 435 PHE A CG  1 
ATOM   842  C CD1 . PHE A 1 117 ? 14.133  23.710 68.066  1.00 35.47 ? 435 PHE A CD1 1 
ATOM   843  C CD2 . PHE A 1 117 ? 11.953  22.841 67.680  1.00 37.93 ? 435 PHE A CD2 1 
ATOM   844  C CE1 . PHE A 1 117 ? 14.049  24.426 66.890  1.00 33.49 ? 435 PHE A CE1 1 
ATOM   845  C CE2 . PHE A 1 117 ? 11.868  23.557 66.508  1.00 33.96 ? 435 PHE A CE2 1 
ATOM   846  C CZ  . PHE A 1 117 ? 12.922  24.344 66.111  1.00 32.23 ? 435 PHE A CZ  1 
ATOM   847  N N   . LYS A 1 118 ? 15.169  21.812 72.320  1.00 42.97 ? 436 LYS A N   1 
ATOM   848  C CA  . LYS A 1 118 ? 15.080  21.584 73.737  1.00 43.85 ? 436 LYS A CA  1 
ATOM   849  C C   . LYS A 1 118 ? 13.598  21.609 74.080  1.00 44.60 ? 436 LYS A C   1 
ATOM   850  O O   . LYS A 1 118 ? 12.837  22.408 73.523  1.00 45.05 ? 436 LYS A O   1 
ATOM   851  C CB  . LYS A 1 118 ? 15.827  22.697 74.468  1.00 44.58 ? 436 LYS A CB  1 
ATOM   852  C CG  . LYS A 1 118 ? 17.240  22.325 74.924  1.00 46.68 ? 436 LYS A CG  1 
ATOM   853  C CD  . LYS A 1 118 ? 17.149  21.367 76.108  1.00 52.10 ? 436 LYS A CD  1 
ATOM   854  C CE  . LYS A 1 118 ? 18.235  21.607 77.168  1.00 55.34 ? 436 LYS A CE  1 
ATOM   855  N NZ  . LYS A 1 118 ? 19.284  20.535 77.237  1.00 55.90 ? 436 LYS A NZ  1 
ATOM   856  N N   . GLU A 1 119 ? 13.185  20.731 74.987  1.00 44.91 ? 437 GLU A N   1 
ATOM   857  C CA  . GLU A 1 119 ? 11.765  20.568 75.331  1.00 44.46 ? 437 GLU A CA  1 
ATOM   858  C C   . GLU A 1 119 ? 10.973  21.858 75.651  1.00 43.25 ? 437 GLU A C   1 
ATOM   859  O O   . GLU A 1 119 ? 9.820   21.992 75.223  1.00 43.91 ? 437 GLU A O   1 
ATOM   860  C CB  . GLU A 1 119 ? 11.590  19.529 76.450  1.00 44.43 ? 437 GLU A CB  1 
ATOM   861  C CG  . GLU A 1 119 ? 10.231  19.570 77.131  1.00 45.87 ? 437 GLU A CG  1 
ATOM   862  C CD  . GLU A 1 119 ? 9.829   18.229 77.725  1.00 49.10 ? 437 GLU A CD  1 
ATOM   863  O OE1 . GLU A 1 119 ? 10.598  17.238 77.557  1.00 46.71 ? 437 GLU A OE1 1 
ATOM   864  O OE2 . GLU A 1 119 ? 8.740   18.179 78.352  1.00 47.45 ? 437 GLU A OE2 1 
ATOM   865  N N   . PRO A 1 120 ? 11.568  22.806 76.401  1.00 41.46 ? 438 PRO A N   1 
ATOM   866  C CA  . PRO A 1 120 ? 10.766  24.011 76.680  1.00 40.63 ? 438 PRO A CA  1 
ATOM   867  C C   . PRO A 1 120 ? 10.463  24.809 75.405  1.00 38.96 ? 438 PRO A C   1 
ATOM   868  O O   . PRO A 1 120 ? 9.404   25.426 75.274  1.00 37.57 ? 438 PRO A O   1 
ATOM   869  C CB  . PRO A 1 120 ? 11.657  24.810 77.643  1.00 39.91 ? 438 PRO A CB  1 
ATOM   870  C CG  . PRO A 1 120 ? 12.573  23.784 78.244  1.00 39.65 ? 438 PRO A CG  1 
ATOM   871  C CD  . PRO A 1 120 ? 12.848  22.820 77.128  1.00 40.69 ? 438 PRO A CD  1 
ATOM   872  N N   . GLN A 1 121 ? 11.396  24.762 74.465  1.00 38.02 ? 439 GLN A N   1 
ATOM   873  C CA  . GLN A 1 121 ? 11.220  25.393 73.165  1.00 37.00 ? 439 GLN A CA  1 
ATOM   874  C C   . GLN A 1 121 ? 10.161  24.671 72.332  1.00 34.57 ? 439 GLN A C   1 
ATOM   875  O O   . GLN A 1 121 ? 9.279   25.292 71.764  1.00 32.90 ? 439 GLN A O   1 
ATOM   876  C CB  . GLN A 1 121 ? 12.552  25.381 72.427  1.00 37.23 ? 439 GLN A CB  1 
ATOM   877  C CG  . GLN A 1 121 ? 12.528  26.063 71.080  1.00 39.15 ? 439 GLN A CG  1 
ATOM   878  C CD  . GLN A 1 121 ? 13.906  26.110 70.470  1.00 39.16 ? 439 GLN A CD  1 
ATOM   879  O OE1 . GLN A 1 121 ? 14.188  26.942 69.611  1.00 41.97 ? 439 GLN A OE1 1 
ATOM   880  N NE2 . GLN A 1 121 ? 14.785  25.224 70.929  1.00 36.32 ? 439 GLN A NE2 1 
ATOM   881  N N   . ALA A 1 122 ? 10.282  23.351 72.255  1.00 32.40 ? 440 ALA A N   1 
ATOM   882  C CA  . ALA A 1 122 ? 9.290   22.527 71.597  1.00 30.40 ? 440 ALA A CA  1 
ATOM   883  C C   . ALA A 1 122 ? 7.898   22.823 72.162  1.00 29.62 ? 440 ALA A C   1 
ATOM   884  O O   . ALA A 1 122 ? 6.964   23.121 71.408  1.00 30.53 ? 440 ALA A O   1 
ATOM   885  C CB  . ALA A 1 122 ? 9.644   21.043 71.743  1.00 28.56 ? 440 ALA A CB  1 
ATOM   886  N N   . VAL A 1 123 ? 7.774   22.741 73.484  1.00 28.00 ? 441 VAL A N   1 
ATOM   887  C CA  . VAL A 1 123 ? 6.548   23.100 74.191  1.00 27.27 ? 441 VAL A CA  1 
ATOM   888  C C   . VAL A 1 123 ? 5.984   24.447 73.733  1.00 28.44 ? 441 VAL A C   1 
ATOM   889  O O   . VAL A 1 123 ? 4.771   24.627 73.622  1.00 28.28 ? 441 VAL A O   1 
ATOM   890  C CB  . VAL A 1 123 ? 6.811   23.221 75.708  1.00 27.27 ? 441 VAL A CB  1 
ATOM   891  C CG1 . VAL A 1 123 ? 5.583   23.808 76.414  1.00 23.83 ? 441 VAL A CG1 1 
ATOM   892  C CG2 . VAL A 1 123 ? 7.224   21.880 76.297  1.00 23.29 ? 441 VAL A CG2 1 
ATOM   893  N N   . PHE A 1 124 ? 6.881   25.401 73.500  1.00 29.19 ? 442 PHE A N   1 
ATOM   894  C CA  . PHE A 1 124 ? 6.485   26.747 73.133  1.00 28.90 ? 442 PHE A CA  1 
ATOM   895  C C   . PHE A 1 124 ? 5.871   26.711 71.738  1.00 29.56 ? 442 PHE A C   1 
ATOM   896  O O   . PHE A 1 124 ? 4.746   27.165 71.517  1.00 30.91 ? 442 PHE A O   1 
ATOM   897  C CB  . PHE A 1 124 ? 7.692   27.698 73.203  1.00 27.76 ? 442 PHE A CB  1 
ATOM   898  C CG  . PHE A 1 124 ? 7.439   29.030 72.571  1.00 27.77 ? 442 PHE A CG  1 
ATOM   899  C CD1 . PHE A 1 124 ? 6.875   30.062 73.300  1.00 26.80 ? 442 PHE A CD1 1 
ATOM   900  C CD2 . PHE A 1 124 ? 7.736   29.244 71.229  1.00 28.26 ? 442 PHE A CD2 1 
ATOM   901  C CE1 . PHE A 1 124 ? 6.620   31.296 72.705  1.00 29.83 ? 442 PHE A CE1 1 
ATOM   902  C CE2 . PHE A 1 124 ? 7.494   30.473 70.622  1.00 31.63 ? 442 PHE A CE2 1 
ATOM   903  C CZ  . PHE A 1 124 ? 6.933   31.505 71.361  1.00 30.14 ? 442 PHE A CZ  1 
ATOM   904  N N   . TYR A 1 125 ? 6.610   26.141 70.798  1.00 30.03 ? 443 TYR A N   1 
ATOM   905  C CA  . TYR A 1 125 ? 6.129   26.036 69.433  1.00 29.95 ? 443 TYR A CA  1 
ATOM   906  C C   . TYR A 1 125 ? 4.831   25.250 69.397  1.00 30.40 ? 443 TYR A C   1 
ATOM   907  O O   . TYR A 1 125 ? 3.837   25.732 68.869  1.00 31.13 ? 443 TYR A O   1 
ATOM   908  C CB  . TYR A 1 125 ? 7.207   25.468 68.494  1.00 28.49 ? 443 TYR A CB  1 
ATOM   909  C CG  . TYR A 1 125 ? 8.398   26.389 68.365  1.00 26.06 ? 443 TYR A CG  1 
ATOM   910  C CD1 . TYR A 1 125 ? 8.231   27.766 68.428  1.00 29.93 ? 443 TYR A CD1 1 
ATOM   911  C CD2 . TYR A 1 125 ? 9.675   25.901 68.164  1.00 26.03 ? 443 TYR A CD2 1 
ATOM   912  C CE1 . TYR A 1 125 ? 9.294   28.630 68.307  1.00 28.88 ? 443 TYR A CE1 1 
ATOM   913  C CE2 . TYR A 1 125 ? 10.763  26.769 68.043  1.00 24.56 ? 443 TYR A CE2 1 
ATOM   914  C CZ  . TYR A 1 125 ? 10.562  28.129 68.120  1.00 26.69 ? 443 TYR A CZ  1 
ATOM   915  O OH  . TYR A 1 125 ? 11.610  29.022 68.018  1.00 28.44 ? 443 TYR A OH  1 
ATOM   916  N N   . ALA A 1 126 ? 4.814   24.066 69.996  1.00 30.97 ? 444 ALA A N   1 
ATOM   917  C CA  . ALA A 1 126 ? 3.598   23.251 69.970  1.00 32.98 ? 444 ALA A CA  1 
ATOM   918  C C   . ALA A 1 126 ? 2.368   24.043 70.431  1.00 34.71 ? 444 ALA A C   1 
ATOM   919  O O   . ALA A 1 126 ? 1.306   24.034 69.772  1.00 34.61 ? 444 ALA A O   1 
ATOM   920  C CB  . ALA A 1 126 ? 3.780   22.030 70.818  1.00 33.72 ? 444 ALA A CB  1 
ATOM   921  N N   . ALA A 1 127 ? 2.538   24.735 71.560  1.00 35.14 ? 445 ALA A N   1 
ATOM   922  C CA  . ALA A 1 127 ? 1.507   25.583 72.147  1.00 34.65 ? 445 ALA A CA  1 
ATOM   923  C C   . ALA A 1 127 ? 1.010   26.636 71.171  1.00 34.95 ? 445 ALA A C   1 
ATOM   924  O O   . ALA A 1 127 ? -0.203  26.806 70.987  1.00 35.73 ? 445 ALA A O   1 
ATOM   925  C CB  . ALA A 1 127 ? 2.028   26.239 73.392  1.00 34.61 ? 445 ALA A CB  1 
ATOM   926  N N   . GLU A 1 128 ? 1.934   27.345 70.531  1.00 34.72 ? 446 GLU A N   1 
ATOM   927  C CA  . GLU A 1 128 ? 1.508   28.373 69.589  1.00 34.07 ? 446 GLU A CA  1 
ATOM   928  C C   . GLU A 1 128 ? 0.758   27.779 68.411  1.00 34.47 ? 446 GLU A C   1 
ATOM   929  O O   . GLU A 1 128 ? -0.331  28.250 68.075  1.00 36.30 ? 446 GLU A O   1 
ATOM   930  C CB  . GLU A 1 128 ? 2.662   29.251 69.158  1.00 33.51 ? 446 GLU A CB  1 
ATOM   931  C CG  . GLU A 1 128 ? 3.119   30.141 70.282  1.00 31.51 ? 446 GLU A CG  1 
ATOM   932  C CD  . GLU A 1 128 ? 3.880   31.345 69.800  1.00 28.51 ? 446 GLU A CD  1 
ATOM   933  O OE1 . GLU A 1 128 ? 4.238   31.400 68.609  1.00 32.12 ? 446 GLU A OE1 1 
ATOM   934  O OE2 . GLU A 1 128 ? 4.131   32.244 70.618  1.00 33.22 ? 446 GLU A OE2 1 
ATOM   935  N N   . ILE A 1 129 ? 1.291   26.706 67.833  1.00 33.76 ? 447 ILE A N   1 
ATOM   936  C CA  . ILE A 1 129 ? 0.597   26.013 66.738  1.00 33.13 ? 447 ILE A CA  1 
ATOM   937  C C   . ILE A 1 129 ? -0.802  25.538 67.130  1.00 32.96 ? 447 ILE A C   1 
ATOM   938  O O   . ILE A 1 129 ? -1.744  25.636 66.338  1.00 32.78 ? 447 ILE A O   1 
ATOM   939  C CB  . ILE A 1 129 ? 1.403   24.802 66.196  1.00 33.62 ? 447 ILE A CB  1 
ATOM   940  C CG1 . ILE A 1 129 ? 2.845   25.219 65.851  1.00 33.77 ? 447 ILE A CG1 1 
ATOM   941  C CG2 . ILE A 1 129 ? 0.685   24.191 65.000  1.00 27.63 ? 447 ILE A CG2 1 
ATOM   942  C CD1 . ILE A 1 129 ? 3.813   24.063 65.619  1.00 29.57 ? 447 ILE A CD1 1 
ATOM   943  N N   . SER A 1 130 ? -0.938  25.017 68.346  1.00 32.35 ? 448 SER A N   1 
ATOM   944  C CA  . SER A 1 130 ? -2.220  24.483 68.753  1.00 33.44 ? 448 SER A CA  1 
ATOM   945  C C   . SER A 1 130 ? -3.271  25.574 68.699  1.00 33.88 ? 448 SER A C   1 
ATOM   946  O O   . SER A 1 130 ? -4.436  25.297 68.392  1.00 34.83 ? 448 SER A O   1 
ATOM   947  C CB  . SER A 1 130 ? -2.161  23.888 70.152  1.00 33.14 ? 448 SER A CB  1 
ATOM   948  O OG  . SER A 1 130 ? -2.264  24.919 71.114  1.00 38.64 ? 448 SER A OG  1 
ATOM   949  N N   . ILE A 1 131 ? -2.878  26.817 68.980  1.00 33.29 ? 449 ILE A N   1 
ATOM   950  C CA  . ILE A 1 131 ? -3.863  27.897 68.913  1.00 33.63 ? 449 ILE A CA  1 
ATOM   951  C C   . ILE A 1 131 ? -4.430  27.994 67.496  1.00 33.88 ? 449 ILE A C   1 
ATOM   952  O O   . ILE A 1 131 ? -5.633  28.230 67.303  1.00 34.04 ? 449 ILE A O   1 
ATOM   953  C CB  . ILE A 1 131 ? -3.325  29.262 69.424  1.00 33.90 ? 449 ILE A CB  1 
ATOM   954  C CG1 . ILE A 1 131 ? -3.655  29.448 70.910  1.00 29.07 ? 449 ILE A CG1 1 
ATOM   955  C CG2 . ILE A 1 131 ? -3.984  30.416 68.679  1.00 33.70 ? 449 ILE A CG2 1 
ATOM   956  C CD1 . ILE A 1 131 ? -3.341  28.257 71.793  1.00 21.75 ? 449 ILE A CD1 1 
ATOM   957  N N   . GLY A 1 132 ? -3.562  27.782 66.510  1.00 33.82 ? 450 GLY A N   1 
ATOM   958  C CA  . GLY A 1 132 ? -4.000  27.692 65.130  1.00 33.19 ? 450 GLY A CA  1 
ATOM   959  C C   . GLY A 1 132 ? -5.028  26.587 64.984  1.00 33.71 ? 450 GLY A C   1 
ATOM   960  O O   . GLY A 1 132 ? -6.121  26.776 64.423  1.00 34.58 ? 450 GLY A O   1 
ATOM   961  N N   . LEU A 1 133 ? -4.709  25.415 65.497  1.00 33.12 ? 451 LEU A N   1 
ATOM   962  C CA  . LEU A 1 133 ? -5.609  24.298 65.253  1.00 32.72 ? 451 LEU A CA  1 
ATOM   963  C C   . LEU A 1 133 ? -6.940  24.503 65.958  1.00 32.60 ? 451 LEU A C   1 
ATOM   964  O O   . LEU A 1 133 ? -7.997  24.104 65.452  1.00 33.04 ? 451 LEU A O   1 
ATOM   965  C CB  . LEU A 1 133 ? -4.950  22.985 65.652  1.00 32.71 ? 451 LEU A CB  1 
ATOM   966  C CG  . LEU A 1 133 ? -3.735  22.683 64.786  1.00 30.49 ? 451 LEU A CG  1 
ATOM   967  C CD1 . LEU A 1 133 ? -3.122  21.364 65.181  1.00 30.83 ? 451 LEU A CD1 1 
ATOM   968  C CD2 . LEU A 1 133 ? -4.139  22.703 63.327  1.00 24.13 ? 451 LEU A CD2 1 
ATOM   969  N N   . PHE A 1 134 ? -6.882  25.145 67.119  1.00 32.07 ? 452 PHE A N   1 
ATOM   970  C CA  . PHE A 1 134 ? -8.081  25.401 67.918  1.00 31.92 ? 452 PHE A CA  1 
ATOM   971  C C   . PHE A 1 134 ? -9.045  26.298 67.178  1.00 31.46 ? 452 PHE A C   1 
ATOM   972  O O   . PHE A 1 134 ? -10.268 26.083 67.159  1.00 30.65 ? 452 PHE A O   1 
ATOM   973  C CB  . PHE A 1 134 ? -7.701  26.090 69.225  1.00 31.05 ? 452 PHE A CB  1 
ATOM   974  C CG  . PHE A 1 134 ? -6.898  25.242 70.129  1.00 27.88 ? 452 PHE A CG  1 
ATOM   975  C CD1 . PHE A 1 134 ? -7.080  23.869 70.147  1.00 26.78 ? 452 PHE A CD1 1 
ATOM   976  C CD2 . PHE A 1 134 ? -5.967  25.809 70.980  1.00 27.31 ? 452 PHE A CD2 1 
ATOM   977  C CE1 . PHE A 1 134 ? -6.340  23.073 71.006  1.00 29.42 ? 452 PHE A CE1 1 
ATOM   978  C CE2 . PHE A 1 134 ? -5.224  25.027 71.854  1.00 25.17 ? 452 PHE A CE2 1 
ATOM   979  C CZ  . PHE A 1 134 ? -5.401  23.661 71.868  1.00 27.01 ? 452 PHE A CZ  1 
ATOM   980  N N   . PHE A 1 135 ? -8.467  27.330 66.595  1.00 31.86 ? 453 PHE A N   1 
ATOM   981  C CA  . PHE A 1 135 ? -9.251  28.341 65.964  1.00 34.07 ? 453 PHE A CA  1 
ATOM   982  C C   . PHE A 1 135 ? -9.989  27.696 64.812  1.00 34.73 ? 453 PHE A C   1 
ATOM   983  O O   . PHE A 1 135 ? -11.223 27.817 64.685  1.00 35.91 ? 453 PHE A O   1 
ATOM   984  C CB  . PHE A 1 135 ? -8.348  29.471 65.476  1.00 33.94 ? 453 PHE A CB  1 
ATOM   985  C CG  . PHE A 1 135 ? -9.046  30.446 64.601  1.00 33.01 ? 453 PHE A CG  1 
ATOM   986  C CD1 . PHE A 1 135 ? -10.090 31.207 65.091  1.00 35.52 ? 453 PHE A CD1 1 
ATOM   987  C CD2 . PHE A 1 135 ? -8.674  30.599 63.282  1.00 35.02 ? 453 PHE A CD2 1 
ATOM   988  C CE1 . PHE A 1 135 ? -10.744 32.118 64.281  1.00 35.22 ? 453 PHE A CE1 1 
ATOM   989  C CE2 . PHE A 1 135 ? -9.323  31.506 62.462  1.00 36.68 ? 453 PHE A CE2 1 
ATOM   990  C CZ  . PHE A 1 135 ? -10.364 32.265 62.965  1.00 36.80 ? 453 PHE A CZ  1 
ATOM   991  N N   . LEU A 1 136 ? -9.222  26.982 63.997  1.00 34.21 ? 454 LEU A N   1 
ATOM   992  C CA  . LEU A 1 136 ? -9.746  26.381 62.788  1.00 33.85 ? 454 LEU A CA  1 
ATOM   993  C C   . LEU A 1 136 ? -10.765 25.308 63.068  1.00 33.99 ? 454 LEU A C   1 
ATOM   994  O O   . LEU A 1 136 ? -11.682 25.125 62.292  1.00 34.51 ? 454 LEU A O   1 
ATOM   995  C CB  . LEU A 1 136 ? -8.618  25.779 61.969  1.00 33.11 ? 454 LEU A CB  1 
ATOM   996  C CG  . LEU A 1 136 ? -7.761  26.744 61.159  1.00 32.04 ? 454 LEU A CG  1 
ATOM   997  C CD1 . LEU A 1 136 ? -6.574  25.979 60.606  1.00 30.74 ? 454 LEU A CD1 1 
ATOM   998  C CD2 . LEU A 1 136 ? -8.546  27.386 60.030  1.00 24.93 ? 454 LEU A CD2 1 
ATOM   999  N N   . HIS A 1 137 ? -10.596 24.573 64.157  1.00 35.57 ? 455 HIS A N   1 
ATOM   1000 C CA  . HIS A 1 137 ? -11.520 23.487 64.442  1.00 37.44 ? 455 HIS A CA  1 
ATOM   1001 C C   . HIS A 1 137 ? -12.846 23.997 64.959  1.00 39.96 ? 455 HIS A C   1 
ATOM   1002 O O   . HIS A 1 137 ? -13.898 23.507 64.532  1.00 40.40 ? 455 HIS A O   1 
ATOM   1003 C CB  . HIS A 1 137 ? -10.915 22.488 65.407  1.00 36.75 ? 455 HIS A CB  1 
ATOM   1004 C CG  . HIS A 1 137 ? -9.813  21.690 64.806  1.00 35.97 ? 455 HIS A CG  1 
ATOM   1005 N ND1 . HIS A 1 137 ? -8.946  20.931 65.559  1.00 38.67 ? 455 HIS A ND1 1 
ATOM   1006 C CD2 . HIS A 1 137 ? -9.417  21.555 63.517  1.00 34.72 ? 455 HIS A CD2 1 
ATOM   1007 C CE1 . HIS A 1 137 ? -8.067  20.353 64.757  1.00 39.88 ? 455 HIS A CE1 1 
ATOM   1008 N NE2 . HIS A 1 137 ? -8.330  20.716 63.513  1.00 35.46 ? 455 HIS A NE2 1 
ATOM   1009 N N   . LYS A 1 138 ? -12.795 24.986 65.861  1.00 41.88 ? 456 LYS A N   1 
ATOM   1010 C CA  . LYS A 1 138 ? -14.008 25.657 66.341  1.00 42.75 ? 456 LYS A CA  1 
ATOM   1011 C C   . LYS A 1 138 ? -14.881 26.150 65.181  1.00 42.08 ? 456 LYS A C   1 
ATOM   1012 O O   . LYS A 1 138 ? -16.110 26.153 65.279  1.00 41.93 ? 456 LYS A O   1 
ATOM   1013 C CB  . LYS A 1 138 ? -13.677 26.803 67.297  1.00 43.33 ? 456 LYS A CB  1 
ATOM   1014 C CG  . LYS A 1 138 ? -13.435 26.356 68.745  1.00 48.70 ? 456 LYS A CG  1 
ATOM   1015 C CD  . LYS A 1 138 ? -13.983 27.373 69.755  1.00 53.44 ? 456 LYS A CD  1 
ATOM   1016 C CE  . LYS A 1 138 ? -13.077 27.505 70.992  1.00 57.56 ? 456 LYS A CE  1 
ATOM   1017 N NZ  . LYS A 1 138 ? -11.694 28.011 70.656  1.00 52.25 ? 456 LYS A NZ  1 
ATOM   1018 N N   . ARG A 1 139 ? -14.242 26.521 64.077  1.00 39.98 ? 457 ARG A N   1 
ATOM   1019 C CA  . ARG A 1 139 ? -14.958 26.997 62.910  1.00 39.73 ? 457 ARG A CA  1 
ATOM   1020 C C   . ARG A 1 139 ? -15.181 25.956 61.812  1.00 39.97 ? 457 ARG A C   1 
ATOM   1021 O O   . ARG A 1 139 ? -15.295 26.314 60.629  1.00 39.42 ? 457 ARG A O   1 
ATOM   1022 C CB  . ARG A 1 139 ? -14.210 28.173 62.309  1.00 40.12 ? 457 ARG A CB  1 
ATOM   1023 C CG  . ARG A 1 139 ? -14.709 29.492 62.777  1.00 39.92 ? 457 ARG A CG  1 
ATOM   1024 C CD  . ARG A 1 139 ? -13.629 30.505 62.640  1.00 40.47 ? 457 ARG A CD  1 
ATOM   1025 N NE  . ARG A 1 139 ? -13.839 31.592 63.583  1.00 44.87 ? 457 ARG A NE  1 
ATOM   1026 C CZ  . ARG A 1 139 ? -13.640 31.488 64.892  1.00 44.89 ? 457 ARG A CZ  1 
ATOM   1027 N NH1 . ARG A 1 139 ? -13.230 30.332 65.416  1.00 45.31 ? 457 ARG A NH1 1 
ATOM   1028 N NH2 . ARG A 1 139 ? -13.853 32.541 65.672  1.00 43.32 ? 457 ARG A NH2 1 
ATOM   1029 N N   . GLY A 1 140 ? -15.222 24.679 62.192  1.00 39.38 ? 458 GLY A N   1 
ATOM   1030 C CA  . GLY A 1 140 ? -15.468 23.592 61.238  1.00 38.10 ? 458 GLY A CA  1 
ATOM   1031 C C   . GLY A 1 140 ? -14.446 23.430 60.120  1.00 37.01 ? 458 GLY A C   1 
ATOM   1032 O O   . GLY A 1 140 ? -14.766 23.004 59.011  1.00 37.23 ? 458 GLY A O   1 
ATOM   1033 N N   . ILE A 1 141 ? -13.203 23.776 60.394  1.00 35.85 ? 459 ILE A N   1 
ATOM   1034 C CA  . ILE A 1 141 ? -12.183 23.568 59.402  1.00 34.45 ? 459 ILE A CA  1 
ATOM   1035 C C   . ILE A 1 141 ? -11.183 22.536 59.868  1.00 34.27 ? 459 ILE A C   1 
ATOM   1036 O O   . ILE A 1 141 ? -10.644 22.616 60.976  1.00 33.08 ? 459 ILE A O   1 
ATOM   1037 C CB  . ILE A 1 141 ? -11.476 24.868 59.018  1.00 34.59 ? 459 ILE A CB  1 
ATOM   1038 C CG1 . ILE A 1 141 ? -12.390 25.680 58.105  1.00 34.51 ? 459 ILE A CG1 1 
ATOM   1039 C CG2 . ILE A 1 141 ? -10.159 24.573 58.297  1.00 31.53 ? 459 ILE A CG2 1 
ATOM   1040 C CD1 . ILE A 1 141 ? -12.031 27.130 58.037  1.00 36.12 ? 459 ILE A CD1 1 
ATOM   1041 N N   . ILE A 1 142 ? -10.984 21.545 59.007  1.00 33.97 ? 460 ILE A N   1 
ATOM   1042 C CA  . ILE A 1 142 ? -9.921  20.576 59.130  1.00 32.59 ? 460 ILE A CA  1 
ATOM   1043 C C   . ILE A 1 142 ? -8.762  21.079 58.270  1.00 31.12 ? 460 ILE A C   1 
ATOM   1044 O O   . ILE A 1 142 ? -8.959  21.386 57.086  1.00 28.97 ? 460 ILE A O   1 
ATOM   1045 C CB  . ILE A 1 142 ? -10.395 19.255 58.555  1.00 34.29 ? 460 ILE A CB  1 
ATOM   1046 C CG1 . ILE A 1 142 ? -11.231 18.483 59.562  1.00 36.09 ? 460 ILE A CG1 1 
ATOM   1047 C CG2 . ILE A 1 142 ? -9.242  18.386 58.143  1.00 35.13 ? 460 ILE A CG2 1 
ATOM   1048 C CD1 . ILE A 1 142 ? -11.762 17.206 58.929  1.00 36.23 ? 460 ILE A CD1 1 
ATOM   1049 N N   . TYR A 1 143 ? -7.564  21.157 58.860  1.00 29.85 ? 461 TYR A N   1 
ATOM   1050 C CA  . TYR A 1 143 ? -6.364  21.686 58.172  1.00 29.70 ? 461 TYR A CA  1 
ATOM   1051 C C   . TYR A 1 143 ? -5.770  20.720 57.141  1.00 29.19 ? 461 TYR A C   1 
ATOM   1052 O O   . TYR A 1 143 ? -5.401  21.122 56.032  1.00 28.09 ? 461 TYR A O   1 
ATOM   1053 C CB  . TYR A 1 143 ? -5.292  22.079 59.203  1.00 29.86 ? 461 TYR A CB  1 
ATOM   1054 C CG  . TYR A 1 143 ? -4.043  22.733 58.639  1.00 29.58 ? 461 TYR A CG  1 
ATOM   1055 C CD1 . TYR A 1 143 ? -4.035  23.300 57.376  1.00 32.89 ? 461 TYR A CD1 1 
ATOM   1056 C CD2 . TYR A 1 143 ? -2.883  22.824 59.396  1.00 31.53 ? 461 TYR A CD2 1 
ATOM   1057 C CE1 . TYR A 1 143 ? -2.897  23.921 56.874  1.00 34.13 ? 461 TYR A CE1 1 
ATOM   1058 C CE2 . TYR A 1 143 ? -1.738  23.453 58.903  1.00 32.54 ? 461 TYR A CE2 1 
ATOM   1059 C CZ  . TYR A 1 143 ? -1.755  24.000 57.638  1.00 32.07 ? 461 TYR A CZ  1 
ATOM   1060 O OH  . TYR A 1 143 ? -0.632  24.622 57.125  1.00 32.46 ? 461 TYR A OH  1 
ATOM   1061 N N   . ARG A 1 144 ? -5.659  19.455 57.542  1.00 29.32 ? 462 ARG A N   1 
ATOM   1062 C CA  . ARG A 1 144 ? -5.170  18.372 56.692  1.00 29.69 ? 462 ARG A CA  1 
ATOM   1063 C C   . ARG A 1 144 ? -3.786  18.580 56.131  1.00 29.41 ? 462 ARG A C   1 
ATOM   1064 O O   . ARG A 1 144 ? -3.385  17.891 55.213  1.00 28.86 ? 462 ARG A O   1 
ATOM   1065 C CB  . ARG A 1 144 ? -6.142  18.097 55.552  1.00 30.41 ? 462 ARG A CB  1 
ATOM   1066 C CG  . ARG A 1 144 ? -7.427  17.378 55.995  1.00 35.22 ? 462 ARG A CG  1 
ATOM   1067 C CD  . ARG A 1 144 ? -8.239  16.861 54.803  1.00 37.65 ? 462 ARG A CD  1 
ATOM   1068 N NE  . ARG A 1 144 ? -8.425  17.918 53.816  1.00 37.42 ? 462 ARG A NE  1 
ATOM   1069 C CZ  . ARG A 1 144 ? -9.044  17.766 52.655  1.00 41.53 ? 462 ARG A CZ  1 
ATOM   1070 N NH1 . ARG A 1 144 ? -9.552  16.590 52.287  1.00 43.43 ? 462 ARG A NH1 1 
ATOM   1071 N NH2 . ARG A 1 144 ? -9.148  18.806 51.856  1.00 45.68 ? 462 ARG A NH2 1 
ATOM   1072 N N   . ASP A 1 145 ? -3.040  19.530 56.670  1.00 30.27 ? 463 ASP A N   1 
ATOM   1073 C CA  . ASP A 1 145 ? -1.712  19.745 56.129  1.00 30.03 ? 463 ASP A CA  1 
ATOM   1074 C C   . ASP A 1 145 ? -0.722  20.263 57.146  1.00 28.27 ? 463 ASP A C   1 
ATOM   1075 O O   . ASP A 1 145 ? 0.233   20.950 56.805  1.00 28.14 ? 463 ASP A O   1 
ATOM   1076 C CB  . ASP A 1 145 ? -1.744  20.641 54.891  1.00 30.76 ? 463 ASP A CB  1 
ATOM   1077 C CG  . ASP A 1 145 ? -0.703  20.237 53.889  1.00 33.12 ? 463 ASP A CG  1 
ATOM   1078 O OD1 . ASP A 1 145 ? -0.448  19.024 53.798  1.00 42.60 ? 463 ASP A OD1 1 
ATOM   1079 O OD2 . ASP A 1 145 ? -0.125  21.104 53.206  1.00 39.70 ? 463 ASP A OD2 1 
ATOM   1080 N N   . LEU A 1 146 ? -0.940  19.935 58.403  1.00 27.48 ? 464 LEU A N   1 
ATOM   1081 C CA  . LEU A 1 146 ? 0.046   20.309 59.393  1.00 28.22 ? 464 LEU A CA  1 
ATOM   1082 C C   . LEU A 1 146 ? 1.334   19.559 59.056  1.00 28.22 ? 464 LEU A C   1 
ATOM   1083 O O   . LEU A 1 146 ? 1.317   18.332 58.959  1.00 29.17 ? 464 LEU A O   1 
ATOM   1084 C CB  . LEU A 1 146 ? -0.456  19.966 60.784  1.00 27.82 ? 464 LEU A CB  1 
ATOM   1085 C CG  . LEU A 1 146 ? 0.433   20.337 61.966  1.00 31.30 ? 464 LEU A CG  1 
ATOM   1086 C CD1 . LEU A 1 146 ? 0.968   21.744 61.812  1.00 27.05 ? 464 LEU A CD1 1 
ATOM   1087 C CD2 . LEU A 1 146 ? -0.336  20.173 63.294  1.00 31.08 ? 464 LEU A CD2 1 
ATOM   1088 N N   . LYS A 1 147 ? 2.430   20.293 58.824  1.00 27.32 ? 465 LYS A N   1 
ATOM   1089 C CA  . LYS A 1 147 ? 3.748   19.684 58.581  1.00 26.43 ? 465 LYS A CA  1 
ATOM   1090 C C   . LYS A 1 147 ? 4.843   20.733 58.688  1.00 26.80 ? 465 LYS A C   1 
ATOM   1091 O O   . LYS A 1 147 ? 4.576   21.899 58.511  1.00 28.04 ? 465 LYS A O   1 
ATOM   1092 C CB  . LYS A 1 147 ? 3.786   19.014 57.216  1.00 25.65 ? 465 LYS A CB  1 
ATOM   1093 C CG  . LYS A 1 147 ? 3.870   19.981 56.064  1.00 25.30 ? 465 LYS A CG  1 
ATOM   1094 C CD  . LYS A 1 147 ? 3.572   19.297 54.766  1.00 21.83 ? 465 LYS A CD  1 
ATOM   1095 C CE  . LYS A 1 147 ? 3.846   20.216 53.602  1.00 25.31 ? 465 LYS A CE  1 
ATOM   1096 N NZ  . LYS A 1 147 ? 3.594   19.497 52.326  1.00 30.55 ? 465 LYS A NZ  1 
ATOM   1097 N N   . LEU A 1 148 ? 6.079   20.333 58.957  1.00 27.56 ? 466 LEU A N   1 
ATOM   1098 C CA  . LEU A 1 148 ? 7.130   21.315 59.244  1.00 28.04 ? 466 LEU A CA  1 
ATOM   1099 C C   . LEU A 1 148 ? 7.284   22.391 58.175  1.00 30.30 ? 466 LEU A C   1 
ATOM   1100 O O   . LEU A 1 148 ? 7.579   23.556 58.468  1.00 30.03 ? 466 LEU A O   1 
ATOM   1101 C CB  . LEU A 1 148 ? 8.454   20.617 59.482  1.00 26.57 ? 466 LEU A CB  1 
ATOM   1102 C CG  . LEU A 1 148 ? 8.548   20.036 60.895  1.00 28.29 ? 466 LEU A CG  1 
ATOM   1103 C CD1 . LEU A 1 148 ? 9.857   19.316 61.056  1.00 32.04 ? 466 LEU A CD1 1 
ATOM   1104 C CD2 . LEU A 1 148 ? 8.379   21.094 61.988  1.00 27.48 ? 466 LEU A CD2 1 
ATOM   1105 N N   . ASP A 1 149 ? 7.063   21.989 56.934  1.00 33.19 ? 467 ASP A N   1 
ATOM   1106 C CA  . ASP A 1 149 ? 7.235   22.860 55.779  1.00 35.80 ? 467 ASP A CA  1 
ATOM   1107 C C   . ASP A 1 149 ? 6.238   24.003 55.710  1.00 35.66 ? 467 ASP A C   1 
ATOM   1108 O O   . ASP A 1 149 ? 6.483   25.050 55.099  1.00 36.70 ? 467 ASP A O   1 
ATOM   1109 C CB  . ASP A 1 149 ? 7.046   22.044 54.528  1.00 36.90 ? 467 ASP A CB  1 
ATOM   1110 C CG  . ASP A 1 149 ? 8.128   22.271 53.575  1.00 42.35 ? 467 ASP A CG  1 
ATOM   1111 O OD1 . ASP A 1 149 ? 9.213   21.719 53.851  1.00 48.99 ? 467 ASP A OD1 1 
ATOM   1112 O OD2 . ASP A 1 149 ? 7.910   23.007 52.585  1.00 48.57 ? 467 ASP A OD2 1 
ATOM   1113 N N   . ASN A 1 150 ? 5.083   23.761 56.304  1.00 33.61 ? 468 ASN A N   1 
ATOM   1114 C CA  . ASN A 1 150 ? 4.027   24.717 56.300  1.00 31.00 ? 468 ASN A CA  1 
ATOM   1115 C C   . ASN A 1 150 ? 4.174   25.679 57.471  1.00 30.77 ? 468 ASN A C   1 
ATOM   1116 O O   . ASN A 1 150 ? 3.284   26.465 57.723  1.00 30.96 ? 468 ASN A O   1 
ATOM   1117 C CB  . ASN A 1 150 ? 2.708   23.969 56.414  1.00 30.57 ? 468 ASN A CB  1 
ATOM   1118 C CG  . ASN A 1 150 ? 2.147   23.560 55.079  1.00 27.18 ? 468 ASN A CG  1 
ATOM   1119 O OD1 . ASN A 1 150 ? 2.510   24.079 54.031  1.00 31.83 ? 468 ASN A OD1 1 
ATOM   1120 N ND2 . ASN A 1 150 ? 1.228   22.642 55.117  1.00 33.51 ? 468 ASN A ND2 1 
ATOM   1121 N N   . VAL A 1 151 ? 5.295   25.636 58.180  1.00 29.83 ? 469 VAL A N   1 
ATOM   1122 C CA  . VAL A 1 151 ? 5.379   26.319 59.466  1.00 31.03 ? 469 VAL A CA  1 
ATOM   1123 C C   . VAL A 1 151 ? 6.635   27.200 59.645  1.00 33.70 ? 469 VAL A C   1 
ATOM   1124 O O   . VAL A 1 151 ? 7.789   26.718 59.583  1.00 35.77 ? 469 VAL A O   1 
ATOM   1125 C CB  . VAL A 1 151 ? 5.280   25.292 60.608  1.00 30.69 ? 469 VAL A CB  1 
ATOM   1126 C CG1 . VAL A 1 151 ? 5.402   25.962 61.956  1.00 26.41 ? 469 VAL A CG1 1 
ATOM   1127 C CG2 . VAL A 1 151 ? 3.972   24.506 60.489  1.00 31.69 ? 469 VAL A CG2 1 
ATOM   1128 N N   . MET A 1 152 ? 6.411   28.483 59.893  1.00 32.84 ? 470 MET A N   1 
ATOM   1129 C CA  . MET A 1 152 ? 7.476   29.454 59.785  1.00 34.75 ? 470 MET A CA  1 
ATOM   1130 C C   . MET A 1 152 ? 7.616   30.234 61.075  1.00 36.95 ? 470 MET A C   1 
ATOM   1131 O O   . MET A 1 152 ? 6.789   30.091 61.980  1.00 38.10 ? 470 MET A O   1 
ATOM   1132 C CB  . MET A 1 152 ? 7.179   30.429 58.641  1.00 35.21 ? 470 MET A CB  1 
ATOM   1133 C CG  . MET A 1 152 ? 7.481   29.914 57.241  1.00 31.62 ? 470 MET A CG  1 
ATOM   1134 S SD  . MET A 1 152 ? 7.122   31.157 55.974  1.00 37.29 ? 470 MET A SD  1 
ATOM   1135 C CE  . MET A 1 152 ? 5.341   31.316 56.106  1.00 29.76 ? 470 MET A CE  1 
ATOM   1136 N N   . LEU A 1 153 ? 8.672   31.046 61.159  1.00 37.04 ? 471 LEU A N   1 
ATOM   1137 C CA  . LEU A 1 153 ? 8.820   32.013 62.242  1.00 37.54 ? 471 LEU A CA  1 
ATOM   1138 C C   . LEU A 1 153 ? 8.757   33.437 61.687  1.00 38.45 ? 471 LEU A C   1 
ATOM   1139 O O   . LEU A 1 153 ? 9.279   33.696 60.595  1.00 39.67 ? 471 LEU A O   1 
ATOM   1140 C CB  . LEU A 1 153 ? 10.151  31.802 62.960  1.00 35.66 ? 471 LEU A CB  1 
ATOM   1141 C CG  . LEU A 1 153 ? 10.314  30.391 63.533  1.00 36.75 ? 471 LEU A CG  1 
ATOM   1142 C CD1 . LEU A 1 153 ? 11.590  30.253 64.387  1.00 32.85 ? 471 LEU A CD1 1 
ATOM   1143 C CD2 . LEU A 1 153 ? 9.089   29.978 64.332  1.00 34.41 ? 471 LEU A CD2 1 
ATOM   1144 N N   . ASP A 1 154 ? 8.123   34.359 62.415  1.00 37.75 ? 472 ASP A N   1 
ATOM   1145 C CA  . ASP A 1 154 ? 8.285   35.780 62.094  1.00 37.55 ? 472 ASP A CA  1 
ATOM   1146 C C   . ASP A 1 154 ? 9.652   36.263 62.619  1.00 37.03 ? 472 ASP A C   1 
ATOM   1147 O O   . ASP A 1 154 ? 10.377  35.498 63.256  1.00 35.53 ? 472 ASP A O   1 
ATOM   1148 C CB  . ASP A 1 154 ? 7.090   36.653 62.570  1.00 37.91 ? 472 ASP A CB  1 
ATOM   1149 C CG  . ASP A 1 154 ? 6.691   36.411 64.038  1.00 39.33 ? 472 ASP A CG  1 
ATOM   1150 O OD1 . ASP A 1 154 ? 7.562   36.002 64.830  1.00 37.30 ? 472 ASP A OD1 1 
ATOM   1151 O OD2 . ASP A 1 154 ? 5.502   36.656 64.402  1.00 39.16 ? 472 ASP A OD2 1 
ATOM   1152 N N   . SER A 1 155 ? 10.014  37.513 62.347  1.00 37.27 ? 473 SER A N   1 
ATOM   1153 C CA  . SER A 1 155 ? 11.275  38.052 62.870  1.00 37.13 ? 473 SER A CA  1 
ATOM   1154 C C   . SER A 1 155 ? 11.402  37.990 64.397  1.00 36.85 ? 473 SER A C   1 
ATOM   1155 O O   . SER A 1 155 ? 12.497  37.867 64.910  1.00 37.60 ? 473 SER A O   1 
ATOM   1156 C CB  . SER A 1 155 ? 11.520  39.475 62.373  1.00 36.92 ? 473 SER A CB  1 
ATOM   1157 O OG  . SER A 1 155 ? 10.302  40.189 62.297  1.00 37.78 ? 473 SER A OG  1 
ATOM   1158 N N   . GLU A 1 156 ? 10.290  38.043 65.115  1.00 37.49 ? 474 GLU A N   1 
ATOM   1159 C CA  . GLU A 1 156 ? 10.313  38.009 66.575  1.00 39.10 ? 474 GLU A CA  1 
ATOM   1160 C C   . GLU A 1 156 ? 10.439  36.601 67.156  1.00 39.30 ? 474 GLU A C   1 
ATOM   1161 O O   . GLU A 1 156 ? 10.566  36.438 68.368  1.00 39.38 ? 474 GLU A O   1 
ATOM   1162 C CB  . GLU A 1 156 ? 9.041   38.649 67.130  1.00 39.72 ? 474 GLU A CB  1 
ATOM   1163 C CG  . GLU A 1 156 ? 8.513   39.802 66.291  1.00 45.02 ? 474 GLU A CG  1 
ATOM   1164 C CD  . GLU A 1 156 ? 9.306   41.086 66.489  1.00 50.76 ? 474 GLU A CD  1 
ATOM   1165 O OE1 . GLU A 1 156 ? 8.726   42.022 67.074  1.00 56.36 ? 474 GLU A OE1 1 
ATOM   1166 O OE2 . GLU A 1 156 ? 10.495  41.170 66.081  1.00 50.31 ? 474 GLU A OE2 1 
ATOM   1167 N N   . GLY A 1 157 ? 10.379  35.586 66.301  1.00 39.74 ? 475 GLY A N   1 
ATOM   1168 C CA  . GLY A 1 157 ? 10.461  34.191 66.759  1.00 39.86 ? 475 GLY A CA  1 
ATOM   1169 C C   . GLY A 1 157 ? 9.147   33.554 67.197  1.00 38.44 ? 475 GLY A C   1 
ATOM   1170 O O   . GLY A 1 157 ? 9.131   32.669 68.050  1.00 39.12 ? 475 GLY A O   1 
ATOM   1171 N N   . HIS A 1 158 ? 8.046   34.014 66.613  1.00 37.19 ? 476 HIS A N   1 
ATOM   1172 C CA  . HIS A 1 158 ? 6.731   33.436 66.838  1.00 35.77 ? 476 HIS A CA  1 
ATOM   1173 C C   . HIS A 1 158 ? 6.312   32.622 65.631  1.00 35.06 ? 476 HIS A C   1 
ATOM   1174 O O   . HIS A 1 158 ? 6.791   32.861 64.518  1.00 34.07 ? 476 HIS A O   1 
ATOM   1175 C CB  . HIS A 1 158 ? 5.711   34.529 67.077  1.00 36.14 ? 476 HIS A CB  1 
ATOM   1176 C CG  . HIS A 1 158 ? 5.777   35.113 68.448  1.00 38.69 ? 476 HIS A CG  1 
ATOM   1177 N ND1 . HIS A 1 158 ? 5.755   34.337 69.585  1.00 41.25 ? 476 HIS A ND1 1 
ATOM   1178 C CD2 . HIS A 1 158 ? 5.862   36.396 68.869  1.00 41.75 ? 476 HIS A CD2 1 
ATOM   1179 C CE1 . HIS A 1 158 ? 5.816   35.114 70.650  1.00 41.48 ? 476 HIS A CE1 1 
ATOM   1180 N NE2 . HIS A 1 158 ? 5.887   36.368 70.243  1.00 44.74 ? 476 HIS A NE2 1 
ATOM   1181 N N   . ILE A 1 159 ? 5.424   31.649 65.837  1.00 34.23 ? 477 ILE A N   1 
ATOM   1182 C CA  . ILE A 1 159 ? 5.085   30.769 64.730  1.00 32.86 ? 477 ILE A CA  1 
ATOM   1183 C C   . ILE A 1 159 ? 3.976   31.363 63.878  1.00 31.66 ? 477 ILE A C   1 
ATOM   1184 O O   . ILE A 1 159 ? 3.056   32.020 64.370  1.00 30.75 ? 477 ILE A O   1 
ATOM   1185 C CB  . ILE A 1 159 ? 4.766   29.290 65.125  1.00 33.11 ? 477 ILE A CB  1 
ATOM   1186 C CG1 . ILE A 1 159 ? 3.415   29.182 65.804  1.00 36.68 ? 477 ILE A CG1 1 
ATOM   1187 C CG2 . ILE A 1 159 ? 5.895   28.607 65.914  1.00 32.91 ? 477 ILE A CG2 1 
ATOM   1188 C CD1 . ILE A 1 159 ? 2.319   28.762 64.830  1.00 41.60 ? 477 ILE A CD1 1 
ATOM   1189 N N   . LYS A 1 160 ? 4.133   31.144 62.580  1.00 31.04 ? 478 LYS A N   1 
ATOM   1190 C CA  . LYS A 1 160 ? 3.188   31.519 61.558  1.00 30.90 ? 478 LYS A CA  1 
ATOM   1191 C C   . LYS A 1 160 ? 2.917   30.235 60.797  1.00 29.42 ? 478 LYS A C   1 
ATOM   1192 O O   . LYS A 1 160 ? 3.847   29.591 60.361  1.00 29.72 ? 478 LYS A O   1 
ATOM   1193 C CB  . LYS A 1 160 ? 3.820   32.560 60.609  1.00 31.57 ? 478 LYS A CB  1 
ATOM   1194 C CG  . LYS A 1 160 ? 3.903   33.986 61.159  1.00 29.33 ? 478 LYS A CG  1 
ATOM   1195 C CD  . LYS A 1 160 ? 2.491   34.564 61.313  1.00 36.03 ? 478 LYS A CD  1 
ATOM   1196 C CE  . LYS A 1 160 ? 2.463   36.002 61.829  1.00 31.33 ? 478 LYS A CE  1 
ATOM   1197 N NZ  . LYS A 1 160 ? 1.058   36.480 61.776  1.00 30.87 ? 478 LYS A NZ  1 
ATOM   1198 N N   . ILE A 1 161 ? 1.657   29.849 60.650  1.00 28.60 ? 479 ILE A N   1 
ATOM   1199 C CA  . ILE A 1 161 ? 1.319   28.676 59.843  1.00 28.45 ? 479 ILE A CA  1 
ATOM   1200 C C   . ILE A 1 161 ? 0.839   29.092 58.442  1.00 29.24 ? 479 ILE A C   1 
ATOM   1201 O O   . ILE A 1 161 ? -0.079  29.901 58.316  1.00 31.22 ? 479 ILE A O   1 
ATOM   1202 C CB  . ILE A 1 161 ? 0.246   27.838 60.547  1.00 28.45 ? 479 ILE A CB  1 
ATOM   1203 C CG1 . ILE A 1 161 ? 0.648   27.649 62.011  1.00 30.69 ? 479 ILE A CG1 1 
ATOM   1204 C CG2 . ILE A 1 161 ? 0.037   26.492 59.838  1.00 27.33 ? 479 ILE A CG2 1 
ATOM   1205 C CD1 . ILE A 1 161 ? -0.307  26.833 62.823  1.00 30.08 ? 479 ILE A CD1 1 
ATOM   1206 N N   . ALA A 1 162 ? 1.460   28.575 57.384  1.00 28.02 ? 480 ALA A N   1 
ATOM   1207 C CA  . ALA A 1 162 ? 1.060   28.982 56.034  1.00 27.03 ? 480 ALA A CA  1 
ATOM   1208 C C   . ALA A 1 162 ? 0.321   27.886 55.253  1.00 28.18 ? 480 ALA A C   1 
ATOM   1209 O O   . ALA A 1 162 ? 0.047   26.789 55.763  1.00 27.39 ? 480 ALA A O   1 
ATOM   1210 C CB  . ALA A 1 162 ? 2.268   29.491 55.241  1.00 24.84 ? 480 ALA A CB  1 
ATOM   1211 N N   . ASP A 1 163 ? -0.007  28.213 54.009  1.00 28.73 ? 481 ASP A N   1 
ATOM   1212 C CA  . ASP A 1 163 ? -0.494  27.242 53.068  1.00 28.97 ? 481 ASP A CA  1 
ATOM   1213 C C   . ASP A 1 163 ? -1.772  26.524 53.506  1.00 29.59 ? 481 ASP A C   1 
ATOM   1214 O O   . ASP A 1 163 ? -1.729  25.459 54.101  1.00 29.99 ? 481 ASP A O   1 
ATOM   1215 C CB  . ASP A 1 163 ? 0.588   26.221 52.790  1.00 28.50 ? 481 ASP A CB  1 
ATOM   1216 C CG  . ASP A 1 163 ? 0.210   25.298 51.675  1.00 30.60 ? 481 ASP A CG  1 
ATOM   1217 O OD1 . ASP A 1 163 ? -1.009  25.125 51.428  1.00 35.82 ? 481 ASP A OD1 1 
ATOM   1218 O OD2 . ASP A 1 163 ? 1.118   24.757 51.037  1.00 28.24 ? 481 ASP A OD2 1 
ATOM   1219 N N   . PHE A 1 164 ? -2.908  27.096 53.156  1.00 30.58 ? 482 PHE A N   1 
ATOM   1220 C CA  . PHE A 1 164 ? -4.187  26.516 53.494  1.00 31.04 ? 482 PHE A CA  1 
ATOM   1221 C C   . PHE A 1 164 ? -4.908  25.891 52.287  1.00 32.05 ? 482 PHE A C   1 
ATOM   1222 O O   . PHE A 1 164 ? -6.131  25.731 52.296  1.00 31.32 ? 482 PHE A O   1 
ATOM   1223 C CB  . PHE A 1 164 ? -5.042  27.590 54.157  1.00 30.10 ? 482 PHE A CB  1 
ATOM   1224 C CG  . PHE A 1 164 ? -4.493  28.045 55.464  1.00 31.60 ? 482 PHE A CG  1 
ATOM   1225 C CD1 . PHE A 1 164 ? -3.809  29.253 55.569  1.00 33.11 ? 482 PHE A CD1 1 
ATOM   1226 C CD2 . PHE A 1 164 ? -4.604  27.240 56.595  1.00 33.38 ? 482 PHE A CD2 1 
ATOM   1227 C CE1 . PHE A 1 164 ? -3.272  29.676 56.787  1.00 24.49 ? 482 PHE A CE1 1 
ATOM   1228 C CE2 . PHE A 1 164 ? -4.054  27.654 57.819  1.00 29.49 ? 482 PHE A CE2 1 
ATOM   1229 C CZ  . PHE A 1 164 ? -3.394  28.881 57.904  1.00 24.77 ? 482 PHE A CZ  1 
ATOM   1230 N N   . GLY A 1 165 ? -4.148  25.508 51.265  1.00 32.95 ? 483 GLY A N   1 
ATOM   1231 C CA  . GLY A 1 165 ? -4.748  24.968 50.043  1.00 35.90 ? 483 GLY A CA  1 
ATOM   1232 C C   . GLY A 1 165 ? -5.283  23.534 50.084  1.00 38.68 ? 483 GLY A C   1 
ATOM   1233 O O   . GLY A 1 165 ? -5.390  22.887 49.034  1.00 40.10 ? 483 GLY A O   1 
ATOM   1234 N N   . MET A 1 166 ? -5.627  23.030 51.274  1.00 38.68 ? 484 MET A N   1 
ATOM   1235 C CA  . MET A 1 166 ? -6.109  21.662 51.420  1.00 38.40 ? 484 MET A CA  1 
ATOM   1236 C C   . MET A 1 166 ? -7.034  21.495 52.611  1.00 38.50 ? 484 MET A C   1 
ATOM   1237 O O   . MET A 1 166 ? -7.165  20.406 53.154  1.00 39.95 ? 484 MET A O   1 
ATOM   1238 C CB  . MET A 1 166 ? -4.936  20.711 51.603  1.00 39.12 ? 484 MET A CB  1 
ATOM   1239 C CG  . MET A 1 166 ? -4.620  19.794 50.438  1.00 43.12 ? 484 MET A CG  1 
ATOM   1240 S SD  . MET A 1 166 ? -3.237  18.691 50.905  1.00 54.65 ? 484 MET A SD  1 
ATOM   1241 C CE  . MET A 1 166 ? -4.002  17.758 52.223  1.00 51.70 ? 484 MET A CE  1 
ATOM   1242 N N   . CYS A 1 167 ? -7.673  22.566 53.036  1.00 38.49 ? 485 CYS A N   1 
ATOM   1243 C CA  . CYS A 1 167 ? -8.532  22.488 54.194  1.00 38.15 ? 485 CYS A CA  1 
ATOM   1244 C C   . CYS A 1 167 ? -9.833  21.815 53.794  1.00 38.77 ? 485 CYS A C   1 
ATOM   1245 O O   . CYS A 1 167 ? -10.162 21.727 52.626  1.00 38.77 ? 485 CYS A O   1 
ATOM   1246 C CB  . CYS A 1 167 ? -8.812  23.894 54.742  1.00 38.72 ? 485 CYS A CB  1 
ATOM   1247 S SG  . CYS A 1 167 ? -7.363  24.852 55.321  1.00 37.98 ? 485 CYS A SG  1 
ATOM   1248 N N   . LYS A 1 168 ? -10.566 21.324 54.771  1.00 40.16 ? 486 LYS A N   1 
ATOM   1249 C CA  . LYS A 1 168 ? -11.917 20.909 54.536  1.00 41.80 ? 486 LYS A CA  1 
ATOM   1250 C C   . LYS A 1 168 ? -12.715 21.862 55.397  1.00 43.42 ? 486 LYS A C   1 
ATOM   1251 O O   . LYS A 1 168 ? -12.268 22.271 56.472  1.00 44.64 ? 486 LYS A O   1 
ATOM   1252 C CB  . LYS A 1 168 ? -12.132 19.460 54.975  1.00 42.06 ? 486 LYS A CB  1 
ATOM   1253 C CG  . LYS A 1 168 ? -13.198 18.702 54.179  1.00 44.16 ? 486 LYS A CG  1 
ATOM   1254 C CD  . LYS A 1 168 ? -12.662 18.244 52.817  1.00 51.44 ? 486 LYS A CD  1 
ATOM   1255 C CE  . LYS A 1 168 ? -13.666 17.362 52.042  1.00 53.76 ? 486 LYS A CE  1 
ATOM   1256 N NZ  . LYS A 1 168 ? -14.914 18.074 51.628  1.00 47.39 ? 486 LYS A NZ  1 
ATOM   1257 N N   . GLU A 1 169 ? -13.884 22.245 54.915  1.00 44.36 ? 487 GLU A N   1 
ATOM   1258 C CA  . GLU A 1 169 ? -14.712 23.184 55.634  1.00 44.43 ? 487 GLU A CA  1 
ATOM   1259 C C   . GLU A 1 169 ? -16.079 22.582 55.938  1.00 44.82 ? 487 GLU A C   1 
ATOM   1260 O O   . GLU A 1 169 ? -16.467 21.573 55.359  1.00 45.64 ? 487 GLU A O   1 
ATOM   1261 C CB  . GLU A 1 169 ? -14.843 24.476 54.834  1.00 44.66 ? 487 GLU A CB  1 
ATOM   1262 C CG  . GLU A 1 169 ? -14.921 24.298 53.339  1.00 45.00 ? 487 GLU A CG  1 
ATOM   1263 C CD  . GLU A 1 169 ? -15.387 25.568 52.639  1.00 51.10 ? 487 GLU A CD  1 
ATOM   1264 O OE1 . GLU A 1 169 ? -15.038 26.676 53.099  1.00 49.54 ? 487 GLU A OE1 1 
ATOM   1265 O OE2 . GLU A 1 169 ? -16.117 25.463 51.630  1.00 55.85 ? 487 GLU A OE2 1 
ATOM   1266 N N   . HIS A 1 170 ? -16.802 23.207 56.858  1.00 45.05 ? 488 HIS A N   1 
ATOM   1267 C CA  . HIS A 1 170 ? -18.094 22.698 57.307  1.00 44.81 ? 488 HIS A CA  1 
ATOM   1268 C C   . HIS A 1 170 ? -17.885 21.352 57.940  1.00 44.17 ? 488 HIS A C   1 
ATOM   1269 O O   . HIS A 1 170 ? -18.649 20.435 57.720  1.00 44.50 ? 488 HIS A O   1 
ATOM   1270 C CB  . HIS A 1 170 ? -19.099 22.637 56.154  1.00 44.20 ? 488 HIS A CB  1 
ATOM   1271 C CG  . HIS A 1 170 ? -19.205 23.926 55.399  1.00 48.31 ? 488 HIS A CG  1 
ATOM   1272 N ND1 . HIS A 1 170 ? -19.667 25.091 55.980  1.00 47.71 ? 488 HIS A ND1 1 
ATOM   1273 C CD2 . HIS A 1 170 ? -18.862 24.249 54.128  1.00 50.76 ? 488 HIS A CD2 1 
ATOM   1274 C CE1 . HIS A 1 170 ? -19.613 26.073 55.096  1.00 47.68 ? 488 HIS A CE1 1 
ATOM   1275 N NE2 . HIS A 1 170 ? -19.127 25.589 53.965  1.00 50.96 ? 488 HIS A NE2 1 
ATOM   1276 N N   . MET A 1 171 ? -16.821 21.241 58.723  1.00 44.89 ? 489 MET A N   1 
ATOM   1277 C CA  . MET A 1 171 ? -16.511 20.005 59.428  1.00 46.21 ? 489 MET A CA  1 
ATOM   1278 C C   . MET A 1 171 ? -16.897 20.143 60.888  1.00 47.37 ? 489 MET A C   1 
ATOM   1279 O O   . MET A 1 171 ? -16.069 20.313 61.777  1.00 47.92 ? 489 MET A O   1 
ATOM   1280 C CB  . MET A 1 171 ? -15.051 19.616 59.230  1.00 45.91 ? 489 MET A CB  1 
ATOM   1281 C CG  . MET A 1 171 ? -14.755 19.345 57.757  1.00 47.96 ? 489 MET A CG  1 
ATOM   1282 S SD  . MET A 1 171 ? -15.602 17.846 57.191  1.00 48.39 ? 489 MET A SD  1 
ATOM   1283 C CE  . MET A 1 171 ? -16.339 18.437 55.673  1.00 53.58 ? 489 MET A CE  1 
ATOM   1284 N N   . MET A 1 172 ? -18.202 20.094 61.103  1.00 48.75 ? 490 MET A N   1 
ATOM   1285 C CA  . MET A 1 172 ? -18.786 20.301 62.398  1.00 49.02 ? 490 MET A CA  1 
ATOM   1286 C C   . MET A 1 172 ? -19.026 18.953 63.060  1.00 48.37 ? 490 MET A C   1 
ATOM   1287 O O   . MET A 1 172 ? -18.486 17.937 62.650  1.00 48.32 ? 490 MET A O   1 
ATOM   1288 C CB  . MET A 1 172 ? -20.110 21.045 62.218  1.00 50.46 ? 490 MET A CB  1 
ATOM   1289 C CG  . MET A 1 172 ? -20.047 22.252 61.270  1.00 52.56 ? 490 MET A CG  1 
ATOM   1290 S SD  . MET A 1 172 ? -19.097 23.664 61.927  1.00 69.54 ? 490 MET A SD  1 
ATOM   1291 C CE  . MET A 1 172 ? -19.197 23.434 63.714  1.00 61.42 ? 490 MET A CE  1 
ATOM   1292 N N   . ASP A 1 173 ? -19.866 18.948 64.076  1.00 48.23 ? 491 ASP A N   1 
ATOM   1293 C CA  . ASP A 1 173 ? -20.137 17.746 64.846  1.00 48.49 ? 491 ASP A CA  1 
ATOM   1294 C C   . ASP A 1 173 ? -20.611 16.560 64.013  1.00 48.26 ? 491 ASP A C   1 
ATOM   1295 O O   . ASP A 1 173 ? -21.668 16.620 63.361  1.00 48.31 ? 491 ASP A O   1 
ATOM   1296 C CB  . ASP A 1 173 ? -21.211 18.057 65.881  1.00 49.64 ? 491 ASP A CB  1 
ATOM   1297 C CG  . ASP A 1 173 ? -20.793 17.679 67.267  1.00 49.40 ? 491 ASP A CG  1 
ATOM   1298 O OD1 . ASP A 1 173 ? -19.818 18.306 67.770  1.00 49.34 ? 491 ASP A OD1 1 
ATOM   1299 O OD2 . ASP A 1 173 ? -21.443 16.768 67.833  1.00 44.17 ? 491 ASP A OD2 1 
ATOM   1300 N N   . GLY A 1 174 ? -19.848 15.473 64.061  1.00 47.25 ? 492 GLY A N   1 
ATOM   1301 C CA  . GLY A 1 174 ? -20.227 14.247 63.352  1.00 45.40 ? 492 GLY A CA  1 
ATOM   1302 C C   . GLY A 1 174 ? -20.061 14.281 61.837  1.00 43.48 ? 492 GLY A C   1 
ATOM   1303 O O   . GLY A 1 174 ? -20.286 13.278 61.171  1.00 43.14 ? 492 GLY A O   1 
ATOM   1304 N N   . VAL A 1 175 ? -19.685 15.428 61.274  1.00 41.76 ? 493 VAL A N   1 
ATOM   1305 C CA  . VAL A 1 175 ? -19.371 15.466 59.852  1.00 40.52 ? 493 VAL A CA  1 
ATOM   1306 C C   . VAL A 1 175 ? -17.977 14.884 59.602  1.00 40.36 ? 493 VAL A C   1 
ATOM   1307 O O   . VAL A 1 175 ? -17.078 14.995 60.452  1.00 41.93 ? 493 VAL A O   1 
ATOM   1308 C CB  . VAL A 1 175 ? -19.471 16.876 59.270  1.00 41.10 ? 493 VAL A CB  1 
ATOM   1309 C CG1 . VAL A 1 175 ? -19.158 16.869 57.749  1.00 38.19 ? 493 VAL A CG1 1 
ATOM   1310 C CG2 . VAL A 1 175 ? -20.842 17.457 59.556  1.00 39.79 ? 493 VAL A CG2 1 
ATOM   1311 N N   . THR A 1 176 ? -17.814 14.256 58.438  1.00 37.83 ? 494 THR A N   1 
ATOM   1312 C CA  . THR A 1 176 ? -16.611 13.513 58.097  1.00 34.72 ? 494 THR A CA  1 
ATOM   1313 C C   . THR A 1 176 ? -16.434 13.427 56.573  1.00 35.83 ? 494 THR A C   1 
ATOM   1314 O O   . THR A 1 176 ? -17.403 13.495 55.824  1.00 36.54 ? 494 THR A O   1 
ATOM   1315 C CB  . THR A 1 176 ? -16.713 12.058 58.586  1.00 33.93 ? 494 THR A CB  1 
ATOM   1316 O OG1 . THR A 1 176 ? -17.567 11.328 57.700  1.00 28.12 ? 494 THR A OG1 1 
ATOM   1317 C CG2 . THR A 1 176 ? -17.256 11.973 59.984  1.00 28.52 ? 494 THR A CG2 1 
ATOM   1318 N N   . THR A 1 177 ? -15.197 13.244 56.119  1.00 35.48 ? 495 THR A N   1 
ATOM   1319 C CA  . THR A 1 177 ? -14.914 12.961 54.707  1.00 33.24 ? 495 THR A CA  1 
ATOM   1320 C C   . THR A 1 177 ? -14.067 11.670 54.628  1.00 32.30 ? 495 THR A C   1 
ATOM   1321 O O   . THR A 1 177 ? -13.636 11.149 55.650  1.00 32.76 ? 495 THR A O   1 
ATOM   1322 C CB  . THR A 1 177 ? -14.212 14.173 54.062  1.00 32.64 ? 495 THR A CB  1 
ATOM   1323 O OG1 . THR A 1 177 ? -13.749 13.841 52.753  1.00 36.23 ? 495 THR A OG1 1 
ATOM   1324 C CG2 . THR A 1 177 ? -13.039 14.639 54.912  1.00 29.36 ? 495 THR A CG2 1 
ATOM   1325 N N   . ARG A 1 178 ? -13.855 11.116 53.447  1.00 31.12 ? 496 ARG A N   1 
ATOM   1326 C CA  . ARG A 1 178 ? -12.929 9.980  53.342  1.00 30.94 ? 496 ARG A CA  1 
ATOM   1327 C C   . ARG A 1 178 ? -11.817 10.258 52.328  1.00 31.21 ? 496 ARG A C   1 
ATOM   1328 O O   . ARG A 1 178 ? -11.150 9.348  51.832  1.00 30.42 ? 496 ARG A O   1 
ATOM   1329 C CB  . ARG A 1 178 ? -13.651 8.689  52.966  1.00 29.78 ? 496 ARG A CB  1 
ATOM   1330 C CG  . ARG A 1 178 ? -14.545 8.130  54.019  1.00 31.37 ? 496 ARG A CG  1 
ATOM   1331 C CD  . ARG A 1 178 ? -15.398 7.036  53.414  1.00 37.63 ? 496 ARG A CD  1 
ATOM   1332 N NE  . ARG A 1 178 ? -14.808 5.706  53.540  1.00 41.66 ? 496 ARG A NE  1 
ATOM   1333 C CZ  . ARG A 1 178 ? -14.839 4.775  52.588  1.00 42.03 ? 496 ARG A CZ  1 
ATOM   1334 N NH1 . ARG A 1 178 ? -15.399 5.044  51.410  1.00 39.91 ? 496 ARG A NH1 1 
ATOM   1335 N NH2 . ARG A 1 178 ? -14.278 3.589  52.805  1.00 40.24 ? 496 ARG A NH2 1 
ATOM   1336 N N   . GLU A 1 179 ? -11.612 11.532 52.038  1.00 32.07 ? 497 GLU A N   1 
ATOM   1337 C CA  . GLU A 1 179 ? -10.698 11.928 50.997  1.00 33.34 ? 497 GLU A CA  1 
ATOM   1338 C C   . GLU A 1 179 ? -9.249  11.689 51.414  1.00 33.30 ? 497 GLU A C   1 
ATOM   1339 O O   . GLU A 1 179 ? -8.776  12.267 52.400  1.00 33.47 ? 497 GLU A O   1 
ATOM   1340 C CB  . GLU A 1 179 ? -10.931 13.398 50.673  1.00 34.94 ? 497 GLU A CB  1 
ATOM   1341 C CG  . GLU A 1 179 ? -10.425 13.855 49.313  1.00 40.95 ? 497 GLU A CG  1 
ATOM   1342 C CD  . GLU A 1 179 ? -10.392 15.373 49.219  1.00 49.40 ? 497 GLU A CD  1 
ATOM   1343 O OE1 . GLU A 1 179 ? -11.280 16.026 49.825  1.00 52.92 ? 497 GLU A OE1 1 
ATOM   1344 O OE2 . GLU A 1 179 ? -9.476  15.908 48.556  1.00 51.58 ? 497 GLU A OE2 1 
ATOM   1345 N N   . PHE A 1 180 ? -8.567  10.823 50.663  1.00 32.11 ? 498 PHE A N   1 
ATOM   1346 C CA  . PHE A 1 180 ? -7.140  10.563 50.844  1.00 30.91 ? 498 PHE A CA  1 
ATOM   1347 C C   . PHE A 1 180 ? -6.241  11.749 50.474  1.00 30.34 ? 498 PHE A C   1 
ATOM   1348 O O   . PHE A 1 180 ? -6.316  12.244 49.353  1.00 28.38 ? 498 PHE A O   1 
ATOM   1349 C CB  . PHE A 1 180 ? -6.709  9.354  50.003  1.00 29.90 ? 498 PHE A CB  1 
ATOM   1350 C CG  . PHE A 1 180 ? -5.241  9.053  50.110  1.00 29.00 ? 498 PHE A CG  1 
ATOM   1351 C CD1 . PHE A 1 180 ? -4.750  8.256  51.161  1.00 26.98 ? 498 PHE A CD1 1 
ATOM   1352 C CD2 . PHE A 1 180 ? -4.340  9.593  49.198  1.00 27.04 ? 498 PHE A CD2 1 
ATOM   1353 C CE1 . PHE A 1 180 ? -3.396  7.987  51.286  1.00 22.27 ? 498 PHE A CE1 1 
ATOM   1354 C CE2 . PHE A 1 180 ? -2.981  9.318  49.296  1.00 26.85 ? 498 PHE A CE2 1 
ATOM   1355 C CZ  . PHE A 1 180 ? -2.507  8.521  50.351  1.00 31.08 ? 498 PHE A CZ  1 
ATOM   1356 N N   . CYS A 1 181 ? -5.363  12.170 51.395  1.00 31.01 ? 499 CYS A N   1 
ATOM   1357 C CA  . CYS A 1 181 ? -4.424  13.278 51.123  1.00 30.49 ? 499 CYS A CA  1 
ATOM   1358 C C   . CYS A 1 181 ? -3.457  13.585 52.263  1.00 30.49 ? 499 CYS A C   1 
ATOM   1359 O O   . CYS A 1 181 ? -3.677  13.174 53.392  1.00 31.40 ? 499 CYS A O   1 
ATOM   1360 C CB  . CYS A 1 181 ? -5.213  14.546 50.812  1.00 31.41 ? 499 CYS A CB  1 
ATOM   1361 S SG  . CYS A 1 181 ? -6.222  15.146 52.211  1.00 32.57 ? 499 CYS A SG  1 
ATOM   1362 N N   . GLY A 1 182 ? -2.405  14.349 51.964  1.00 31.89 ? 500 GLY A N   1 
ATOM   1363 C CA  . GLY A 1 182 ? -1.424  14.820 52.972  1.00 30.65 ? 500 GLY A CA  1 
ATOM   1364 C C   . GLY A 1 182 ? -0.003  14.323 52.723  1.00 30.10 ? 500 GLY A C   1 
ATOM   1365 O O   . GLY A 1 182 ? 0.205   13.406 51.939  1.00 29.51 ? 500 GLY A O   1 
ATOM   1366 N N   . THR A 1 183 ? 0.994   14.913 53.375  1.00 30.23 ? 501 THR A N   1 
ATOM   1367 C CA  . THR A 1 183 ? 2.350   14.363 53.228  1.00 29.29 ? 501 THR A CA  1 
ATOM   1368 C C   . THR A 1 183 ? 2.458   13.044 54.008  1.00 28.78 ? 501 THR A C   1 
ATOM   1369 O O   . THR A 1 183 ? 2.240   13.022 55.228  1.00 28.95 ? 501 THR A O   1 
ATOM   1370 C CB  . THR A 1 183 ? 3.475   15.344 53.674  1.00 29.24 ? 501 THR A CB  1 
ATOM   1371 O OG1 . THR A 1 183 ? 3.480   16.521 52.847  1.00 29.97 ? 501 THR A OG1 1 
ATOM   1372 C CG2 . THR A 1 183 ? 4.829   14.663 53.566  1.00 27.00 ? 501 THR A CG2 1 
ATOM   1373 N N   . PRO A 1 184 ? 2.825   11.951 53.312  1.00 26.36 ? 502 PRO A N   1 
ATOM   1374 C CA  . PRO A 1 184 ? 2.758   10.618 53.892  1.00 25.98 ? 502 PRO A CA  1 
ATOM   1375 C C   . PRO A 1 184 ? 3.271   10.457 55.329  1.00 27.97 ? 502 PRO A C   1 
ATOM   1376 O O   . PRO A 1 184 ? 2.642   9.756  56.107  1.00 31.34 ? 502 PRO A O   1 
ATOM   1377 C CB  . PRO A 1 184 ? 3.556   9.765  52.906  1.00 25.86 ? 502 PRO A CB  1 
ATOM   1378 C CG  . PRO A 1 184 ? 3.345   10.449 51.582  1.00 23.16 ? 502 PRO A CG  1 
ATOM   1379 C CD  . PRO A 1 184 ? 3.278   11.925 51.908  1.00 25.04 ? 502 PRO A CD  1 
ATOM   1380 N N   . ASP A 1 185 ? 4.373   11.082 55.720  1.00 28.66 ? 503 ASP A N   1 
ATOM   1381 C CA  . ASP A 1 185 ? 4.828   10.881 57.093  1.00 27.01 ? 503 ASP A CA  1 
ATOM   1382 C C   . ASP A 1 185 ? 3.835   11.453 58.111  1.00 27.05 ? 503 ASP A C   1 
ATOM   1383 O O   . ASP A 1 185 ? 3.848   11.074 59.282  1.00 27.91 ? 503 ASP A O   1 
ATOM   1384 C CB  . ASP A 1 185 ? 6.217   11.468 57.314  1.00 28.04 ? 503 ASP A CB  1 
ATOM   1385 C CG  . ASP A 1 185 ? 7.327   10.548 56.830  1.00 34.50 ? 503 ASP A CG  1 
ATOM   1386 O OD1 . ASP A 1 185 ? 7.618   10.559 55.622  1.00 41.92 ? 503 ASP A OD1 1 
ATOM   1387 O OD2 . ASP A 1 185 ? 7.934   9.817  57.650  1.00 44.69 ? 503 ASP A OD2 1 
ATOM   1388 N N   . TYR A 1 186 ? 2.958   12.359 57.685  1.00 25.47 ? 504 TYR A N   1 
ATOM   1389 C CA  . TYR A 1 186 ? 2.041   12.983 58.647  1.00 22.78 ? 504 TYR A CA  1 
ATOM   1390 C C   . TYR A 1 186 ? 0.628   12.381 58.649  1.00 21.24 ? 504 TYR A C   1 
ATOM   1391 O O   . TYR A 1 186 ? -0.187  12.683 59.523  1.00 19.58 ? 504 TYR A O   1 
ATOM   1392 C CB  . TYR A 1 186 ? 1.982   14.490 58.426  1.00 23.15 ? 504 TYR A CB  1 
ATOM   1393 C CG  . TYR A 1 186 ? 3.305   15.222 58.601  1.00 24.69 ? 504 TYR A CG  1 
ATOM   1394 C CD1 . TYR A 1 186 ? 4.322   15.098 57.680  1.00 25.10 ? 504 TYR A CD1 1 
ATOM   1395 C CD2 . TYR A 1 186 ? 3.507   16.080 59.668  1.00 29.08 ? 504 TYR A CD2 1 
ATOM   1396 C CE1 . TYR A 1 186 ? 5.532   15.778 57.848  1.00 29.62 ? 504 TYR A CE1 1 
ATOM   1397 C CE2 . TYR A 1 186 ? 4.712   16.767 59.840  1.00 31.74 ? 504 TYR A CE2 1 
ATOM   1398 C CZ  . TYR A 1 186 ? 5.713   16.613 58.930  1.00 30.38 ? 504 TYR A CZ  1 
ATOM   1399 O OH  . TYR A 1 186 ? 6.893   17.300 59.095  1.00 33.64 ? 504 TYR A OH  1 
ATOM   1400 N N   . ILE A 1 187 ? 0.362   11.514 57.677  1.00 21.04 ? 505 ILE A N   1 
ATOM   1401 C CA  . ILE A 1 187 ? -0.955  10.910 57.472  1.00 22.05 ? 505 ILE A CA  1 
ATOM   1402 C C   . ILE A 1 187 ? -1.370  9.939  58.583  1.00 23.01 ? 505 ILE A C   1 
ATOM   1403 O O   . ILE A 1 187 ? -0.676  8.953  58.846  1.00 23.78 ? 505 ILE A O   1 
ATOM   1404 C CB  . ILE A 1 187 ? -1.007  10.140 56.143  1.00 21.79 ? 505 ILE A CB  1 
ATOM   1405 C CG1 . ILE A 1 187 ? -0.733  11.071 54.961  1.00 25.72 ? 505 ILE A CG1 1 
ATOM   1406 C CG2 . ILE A 1 187 ? -2.364  9.486  55.965  1.00 25.59 ? 505 ILE A CG2 1 
ATOM   1407 C CD1 . ILE A 1 187 ? -1.308  10.561 53.637  1.00 26.36 ? 505 ILE A CD1 1 
ATOM   1408 N N   . ALA A 1 188 ? -2.509  10.226 59.214  1.00 23.96 ? 506 ALA A N   1 
ATOM   1409 C CA  . ALA A 1 188 ? -3.094  9.394  60.269  1.00 24.42 ? 506 ALA A CA  1 
ATOM   1410 C C   . ALA A 1 188 ? -3.549  8.031  59.742  1.00 24.59 ? 506 ALA A C   1 
ATOM   1411 O O   . ALA A 1 188 ? -3.798  7.866  58.548  1.00 25.74 ? 506 ALA A O   1 
ATOM   1412 C CB  . ALA A 1 188 ? -4.274  10.119 60.898  1.00 25.12 ? 506 ALA A CB  1 
ATOM   1413 N N   . PRO A 1 189 ? -3.647  7.043  60.634  1.00 23.45 ? 507 PRO A N   1 
ATOM   1414 C CA  . PRO A 1 189 ? -4.092  5.725  60.211  1.00 23.38 ? 507 PRO A CA  1 
ATOM   1415 C C   . PRO A 1 189 ? -5.461  5.755  59.526  1.00 22.55 ? 507 PRO A C   1 
ATOM   1416 O O   . PRO A 1 189 ? -5.706  5.003  58.567  1.00 22.42 ? 507 PRO A O   1 
ATOM   1417 C CB  . PRO A 1 189 ? -4.168  4.947  61.536  1.00 23.61 ? 507 PRO A CB  1 
ATOM   1418 C CG  . PRO A 1 189 ? -3.149  5.568  62.388  1.00 22.27 ? 507 PRO A CG  1 
ATOM   1419 C CD  . PRO A 1 189 ? -3.061  7.026  61.984  1.00 23.29 ? 507 PRO A CD  1 
ATOM   1420 N N   . GLU A 1 190 ? -6.349  6.613  60.013  1.00 20.62 ? 508 GLU A N   1 
ATOM   1421 C CA  . GLU A 1 190 ? -7.714  6.594  59.511  1.00 19.90 ? 508 GLU A CA  1 
ATOM   1422 C C   . GLU A 1 190 ? -7.802  6.961  58.013  1.00 18.93 ? 508 GLU A C   1 
ATOM   1423 O O   . GLU A 1 190 ? -8.529  6.328  57.248  1.00 18.36 ? 508 GLU A O   1 
ATOM   1424 C CB  . GLU A 1 190 ? -8.691  7.367  60.422  1.00 18.09 ? 508 GLU A CB  1 
ATOM   1425 C CG  . GLU A 1 190 ? -8.436  8.819  60.595  1.00 16.23 ? 508 GLU A CG  1 
ATOM   1426 C CD  . GLU A 1 190 ? -7.544  9.153  61.788  1.00 20.40 ? 508 GLU A CD  1 
ATOM   1427 O OE1 . GLU A 1 190 ? -6.859  8.263  62.327  1.00 21.22 ? 508 GLU A OE1 1 
ATOM   1428 O OE2 . GLU A 1 190 ? -7.512  10.340 62.187  1.00 28.75 ? 508 GLU A OE2 1 
ATOM   1429 N N   . ILE A 1 191 ? -7.014  7.939  57.593  1.00 18.70 ? 509 ILE A N   1 
ATOM   1430 C CA  . ILE A 1 191 ? -6.887  8.259  56.171  1.00 18.07 ? 509 ILE A CA  1 
ATOM   1431 C C   . ILE A 1 191 ? -6.423  7.046  55.360  1.00 19.98 ? 509 ILE A C   1 
ATOM   1432 O O   . ILE A 1 191 ? -7.071  6.687  54.371  1.00 22.24 ? 509 ILE A O   1 
ATOM   1433 C CB  . ILE A 1 191 ? -5.879  9.374  55.928  1.00 16.89 ? 509 ILE A CB  1 
ATOM   1434 C CG1 . ILE A 1 191 ? -6.285  10.688 56.620  1.00 19.23 ? 509 ILE A CG1 1 
ATOM   1435 C CG2 . ILE A 1 191 ? -5.741  9.625  54.462  1.00 16.11 ? 509 ILE A CG2 1 
ATOM   1436 C CD1 . ILE A 1 191 ? -5.161  11.770 56.496  1.00 13.64 ? 509 ILE A CD1 1 
ATOM   1437 N N   . ILE A 1 192 ? -5.312  6.420  55.768  1.00 19.78 ? 510 ILE A N   1 
ATOM   1438 C CA  . ILE A 1 192 ? -4.790  5.222  55.099  1.00 20.45 ? 510 ILE A CA  1 
ATOM   1439 C C   . ILE A 1 192 ? -5.835  4.104  54.978  1.00 21.79 ? 510 ILE A C   1 
ATOM   1440 O O   . ILE A 1 192 ? -5.932  3.429  53.961  1.00 23.50 ? 510 ILE A O   1 
ATOM   1441 C CB  . ILE A 1 192 ? -3.521  4.657  55.820  1.00 21.31 ? 510 ILE A CB  1 
ATOM   1442 C CG1 . ILE A 1 192 ? -2.383  5.680  55.784  1.00 23.91 ? 510 ILE A CG1 1 
ATOM   1443 C CG2 . ILE A 1 192 ? -3.055  3.319  55.195  1.00 15.06 ? 510 ILE A CG2 1 
ATOM   1444 C CD1 . ILE A 1 192 ? -1.133  5.251  56.550  1.00 19.64 ? 510 ILE A CD1 1 
ATOM   1445 N N   . ALA A 1 193 ? -6.626  3.905  56.017  1.00 22.33 ? 511 ALA A N   1 
ATOM   1446 C CA  . ALA A 1 193 ? -7.642  2.884  55.962  1.00 21.77 ? 511 ALA A CA  1 
ATOM   1447 C C   . ALA A 1 193 ? -8.913  3.403  55.306  1.00 22.68 ? 511 ALA A C   1 
ATOM   1448 O O   . ALA A 1 193 ? -9.905  2.693  55.241  1.00 23.32 ? 511 ALA A O   1 
ATOM   1449 C CB  . ALA A 1 193 ? -7.933  2.382  57.363  1.00 22.47 ? 511 ALA A CB  1 
ATOM   1450 N N   . TYR A 1 194 ? -8.896  4.639  54.824  1.00 23.62 ? 512 TYR A N   1 
ATOM   1451 C CA  . TYR A 1 194 ? -10.119 5.275  54.347  1.00 26.73 ? 512 TYR A CA  1 
ATOM   1452 C C   . TYR A 1 194 ? -11.297 5.059  55.304  1.00 28.17 ? 512 TYR A C   1 
ATOM   1453 O O   . TYR A 1 194 ? -12.434 4.892  54.861  1.00 27.72 ? 512 TYR A O   1 
ATOM   1454 C CB  . TYR A 1 194 ? -10.515 4.787  52.936  1.00 27.99 ? 512 TYR A CB  1 
ATOM   1455 C CG  . TYR A 1 194 ? -9.457  4.990  51.865  1.00 30.42 ? 512 TYR A CG  1 
ATOM   1456 C CD1 . TYR A 1 194 ? -9.562  6.028  50.943  1.00 31.71 ? 512 TYR A CD1 1 
ATOM   1457 C CD2 . TYR A 1 194 ? -8.358  4.137  51.776  1.00 31.57 ? 512 TYR A CD2 1 
ATOM   1458 C CE1 . TYR A 1 194 ? -8.592  6.218  49.968  1.00 36.40 ? 512 TYR A CE1 1 
ATOM   1459 C CE2 . TYR A 1 194 ? -7.382  4.320  50.815  1.00 35.17 ? 512 TYR A CE2 1 
ATOM   1460 C CZ  . TYR A 1 194 ? -7.504  5.359  49.910  1.00 37.24 ? 512 TYR A CZ  1 
ATOM   1461 O OH  . TYR A 1 194 ? -6.536  5.540  48.949  1.00 37.70 ? 512 TYR A OH  1 
ATOM   1462 N N   . GLN A 1 195 ? -11.039 5.027  56.609  1.00 30.74 ? 513 GLN A N   1 
ATOM   1463 C CA  . GLN A 1 195 ? -12.148 5.132  57.551  1.00 33.25 ? 513 GLN A CA  1 
ATOM   1464 C C   . GLN A 1 195 ? -12.546 6.620  57.579  1.00 34.18 ? 513 GLN A C   1 
ATOM   1465 O O   . GLN A 1 195 ? -11.672 7.500  57.516  1.00 36.19 ? 513 GLN A O   1 
ATOM   1466 C CB  . GLN A 1 195 ? -11.812 4.556  58.948  1.00 34.01 ? 513 GLN A CB  1 
ATOM   1467 C CG  . GLN A 1 195 ? -11.722 2.971  59.066  1.00 39.88 ? 513 GLN A CG  1 
ATOM   1468 C CD  . GLN A 1 195 ? -12.865 2.169  58.331  1.00 44.54 ? 513 GLN A CD  1 
ATOM   1469 O OE1 . GLN A 1 195 ? -13.863 2.738  57.865  1.00 42.66 ? 513 GLN A OE1 1 
ATOM   1470 N NE2 . GLN A 1 195 ? -12.698 0.843  58.244  1.00 38.47 ? 513 GLN A NE2 1 
ATOM   1471 N N   . PRO A 1 196 ? -13.865 6.912  57.599  1.00 33.65 ? 514 PRO A N   1 
ATOM   1472 C CA  . PRO A 1 196 ? -14.339 8.294  57.606  1.00 32.18 ? 514 PRO A CA  1 
ATOM   1473 C C   . PRO A 1 196 ? -13.767 9.036  58.803  1.00 31.40 ? 514 PRO A C   1 
ATOM   1474 O O   . PRO A 1 196 ? -13.695 8.471  59.899  1.00 30.50 ? 514 PRO A O   1 
ATOM   1475 C CB  . PRO A 1 196 ? -15.854 8.136  57.755  1.00 33.06 ? 514 PRO A CB  1 
ATOM   1476 C CG  . PRO A 1 196 ? -16.152 6.769  57.221  1.00 32.48 ? 514 PRO A CG  1 
ATOM   1477 C CD  . PRO A 1 196 ? -14.984 5.949  57.642  1.00 33.47 ? 514 PRO A CD  1 
ATOM   1478 N N   . TYR A 1 197 ? -13.365 10.289 58.598  1.00 30.45 ? 515 TYR A N   1 
ATOM   1479 C CA  . TYR A 1 197 ? -12.567 10.994 59.598  1.00 30.41 ? 515 TYR A CA  1 
ATOM   1480 C C   . TYR A 1 197 ? -12.951 12.460 59.725  1.00 31.04 ? 515 TYR A C   1 
ATOM   1481 O O   . TYR A 1 197 ? -13.614 13.025 58.833  1.00 31.05 ? 515 TYR A O   1 
ATOM   1482 C CB  . TYR A 1 197 ? -11.069 10.876 59.248  1.00 29.53 ? 515 TYR A CB  1 
ATOM   1483 C CG  . TYR A 1 197 ? -10.669 11.635 57.995  1.00 24.85 ? 515 TYR A CG  1 
ATOM   1484 C CD1 . TYR A 1 197 ? -10.471 13.030 58.038  1.00 19.38 ? 515 TYR A CD1 1 
ATOM   1485 C CD2 . TYR A 1 197 ? -10.488 10.974 56.777  1.00 20.31 ? 515 TYR A CD2 1 
ATOM   1486 C CE1 . TYR A 1 197 ? -10.112 13.748 56.909  1.00 18.84 ? 515 TYR A CE1 1 
ATOM   1487 C CE2 . TYR A 1 197 ? -10.116 11.680 55.623  1.00 22.34 ? 515 TYR A CE2 1 
ATOM   1488 C CZ  . TYR A 1 197 ? -9.930  13.081 55.698  1.00 29.37 ? 515 TYR A CZ  1 
ATOM   1489 O OH  . TYR A 1 197 ? -9.567  13.832 54.580  1.00 29.76 ? 515 TYR A OH  1 
ATOM   1490 N N   . GLY A 1 198 ? -12.501 13.075 60.819  1.00 30.90 ? 516 GLY A N   1 
ATOM   1491 C CA  . GLY A 1 198 ? -12.756 14.492 61.071  1.00 31.49 ? 516 GLY A CA  1 
ATOM   1492 C C   . GLY A 1 198 ? -11.506 15.256 61.474  1.00 33.37 ? 516 GLY A C   1 
ATOM   1493 O O   . GLY A 1 198 ? -10.421 15.070 60.889  1.00 34.44 ? 516 GLY A O   1 
ATOM   1494 N N   . LYS A 1 199 ? -11.642 16.128 62.469  1.00 32.30 ? 517 LYS A N   1 
ATOM   1495 C CA  . LYS A 1 199 ? -10.508 16.928 62.909  1.00 31.68 ? 517 LYS A CA  1 
ATOM   1496 C C   . LYS A 1 199 ? -9.389  16.047 63.474  1.00 31.59 ? 517 LYS A C   1 
ATOM   1497 O O   . LYS A 1 199 ? -8.276  16.520 63.717  1.00 32.14 ? 517 LYS A O   1 
ATOM   1498 C CB  . LYS A 1 199 ? -10.942 17.972 63.934  1.00 31.54 ? 517 LYS A CB  1 
ATOM   1499 C CG  . LYS A 1 199 ? -11.172 17.426 65.333  1.00 36.01 ? 517 LYS A CG  1 
ATOM   1500 C CD  . LYS A 1 199 ? -11.101 18.545 66.387  1.00 47.37 ? 517 LYS A CD  1 
ATOM   1501 C CE  . LYS A 1 199 ? -11.221 18.014 67.822  1.00 48.64 ? 517 LYS A CE  1 
ATOM   1502 N NZ  . LYS A 1 199 ? -12.497 17.278 68.034  1.00 52.02 ? 517 LYS A NZ  1 
ATOM   1503 N N   . SER A 1 200 ? -9.674  14.765 63.669  1.00 30.34 ? 518 SER A N   1 
ATOM   1504 C CA  . SER A 1 200 ? -8.693  13.871 64.266  1.00 30.55 ? 518 SER A CA  1 
ATOM   1505 C C   . SER A 1 200 ? -7.348  13.849 63.515  1.00 29.38 ? 518 SER A C   1 
ATOM   1506 O O   . SER A 1 200 ? -6.296  13.651 64.115  1.00 28.43 ? 518 SER A O   1 
ATOM   1507 C CB  . SER A 1 200 ? -9.256  12.452 64.348  1.00 31.08 ? 518 SER A CB  1 
ATOM   1508 O OG  . SER A 1 200 ? -9.337  11.872 63.059  1.00 32.52 ? 518 SER A OG  1 
ATOM   1509 N N   . VAL A 1 201 ? -7.387  14.035 62.203  1.00 27.96 ? 519 VAL A N   1 
ATOM   1510 C CA  . VAL A 1 201 ? -6.174  13.934 61.414  1.00 28.20 ? 519 VAL A CA  1 
ATOM   1511 C C   . VAL A 1 201 ? -5.178  15.034 61.752  1.00 29.84 ? 519 VAL A C   1 
ATOM   1512 O O   . VAL A 1 201 ? -3.961  14.848 61.677  1.00 31.71 ? 519 VAL A O   1 
ATOM   1513 C CB  . VAL A 1 201 ? -6.452  13.959 59.885  1.00 28.40 ? 519 VAL A CB  1 
ATOM   1514 C CG1 . VAL A 1 201 ? -7.266  12.723 59.437  1.00 28.41 ? 519 VAL A CG1 1 
ATOM   1515 C CG2 . VAL A 1 201 ? -7.110  15.245 59.474  1.00 24.73 ? 519 VAL A CG2 1 
ATOM   1516 N N   . ASP A 1 202 ? -5.690  16.191 62.135  1.00 30.87 ? 520 ASP A N   1 
ATOM   1517 C CA  . ASP A 1 202 ? -4.818  17.321 62.374  1.00 29.46 ? 520 ASP A CA  1 
ATOM   1518 C C   . ASP A 1 202 ? -4.026  17.113 63.627  1.00 28.89 ? 520 ASP A C   1 
ATOM   1519 O O   . ASP A 1 202 ? -2.914  17.578 63.731  1.00 29.91 ? 520 ASP A O   1 
ATOM   1520 C CB  . ASP A 1 202 ? -5.616  18.627 62.389  1.00 29.14 ? 520 ASP A CB  1 
ATOM   1521 C CG  . ASP A 1 202 ? -5.833  19.190 60.973  1.00 29.89 ? 520 ASP A CG  1 
ATOM   1522 O OD1 . ASP A 1 202 ? -5.030  18.863 60.033  1.00 26.14 ? 520 ASP A OD1 1 
ATOM   1523 O OD2 . ASP A 1 202 ? -6.793  19.972 60.810  1.00 26.85 ? 520 ASP A OD2 1 
ATOM   1524 N N   . TRP A 1 203 ? -4.595  16.360 64.561  1.00 30.60 ? 521 TRP A N   1 
ATOM   1525 C CA  . TRP A 1 203 ? -3.967  16.099 65.858  1.00 29.85 ? 521 TRP A CA  1 
ATOM   1526 C C   . TRP A 1 203 ? -2.940  14.998 65.780  1.00 29.45 ? 521 TRP A C   1 
ATOM   1527 O O   . TRP A 1 203 ? -1.940  15.025 66.501  1.00 30.95 ? 521 TRP A O   1 
ATOM   1528 C CB  . TRP A 1 203 ? -5.025  15.746 66.896  1.00 29.96 ? 521 TRP A CB  1 
ATOM   1529 C CG  . TRP A 1 203 ? -5.829  16.925 67.269  1.00 29.79 ? 521 TRP A CG  1 
ATOM   1530 C CD1 . TRP A 1 203 ? -7.178  17.080 67.146  1.00 31.28 ? 521 TRP A CD1 1 
ATOM   1531 C CD2 . TRP A 1 203 ? -5.328  18.147 67.802  1.00 28.37 ? 521 TRP A CD2 1 
ATOM   1532 N NE1 . TRP A 1 203 ? -7.552  18.332 67.588  1.00 31.02 ? 521 TRP A NE1 1 
ATOM   1533 C CE2 . TRP A 1 203 ? -6.430  19.004 67.990  1.00 26.65 ? 521 TRP A CE2 1 
ATOM   1534 C CE3 . TRP A 1 203 ? -4.054  18.596 68.151  1.00 28.07 ? 521 TRP A CE3 1 
ATOM   1535 C CZ2 . TRP A 1 203 ? -6.296  20.273 68.498  1.00 23.87 ? 521 TRP A CZ2 1 
ATOM   1536 C CZ3 . TRP A 1 203 ? -3.924  19.851 68.662  1.00 26.87 ? 521 TRP A CZ3 1 
ATOM   1537 C CH2 . TRP A 1 203 ? -5.039  20.679 68.835  1.00 27.16 ? 521 TRP A CH2 1 
ATOM   1538 N N   . TRP A 1 204 ? -3.201  14.017 64.921  1.00 27.57 ? 522 TRP A N   1 
ATOM   1539 C CA  . TRP A 1 204 ? -2.234  12.967 64.661  1.00 25.63 ? 522 TRP A CA  1 
ATOM   1540 C C   . TRP A 1 204 ? -1.013  13.657 64.146  1.00 24.92 ? 522 TRP A C   1 
ATOM   1541 O O   . TRP A 1 204 ? 0.088   13.447 64.647  1.00 25.18 ? 522 TRP A O   1 
ATOM   1542 C CB  . TRP A 1 204 ? -2.737  12.017 63.572  1.00 26.55 ? 522 TRP A CB  1 
ATOM   1543 C CG  . TRP A 1 204 ? -1.694  11.005 63.109  1.00 27.26 ? 522 TRP A CG  1 
ATOM   1544 C CD1 . TRP A 1 204 ? -0.858  11.126 62.043  1.00 25.52 ? 522 TRP A CD1 1 
ATOM   1545 C CD2 . TRP A 1 204 ? -1.397  9.739  63.705  1.00 25.53 ? 522 TRP A CD2 1 
ATOM   1546 N NE1 . TRP A 1 204 ? -0.060  10.026 61.939  1.00 24.96 ? 522 TRP A NE1 1 
ATOM   1547 C CE2 . TRP A 1 204 ? -0.364  9.158  62.952  1.00 26.50 ? 522 TRP A CE2 1 
ATOM   1548 C CE3 . TRP A 1 204 ? -1.907  9.041  64.797  1.00 24.04 ? 522 TRP A CE3 1 
ATOM   1549 C CZ2 . TRP A 1 204 ? 0.177   7.905  63.255  1.00 25.32 ? 522 TRP A CZ2 1 
ATOM   1550 C CZ3 . TRP A 1 204 ? -1.374  7.795  65.094  1.00 26.19 ? 522 TRP A CZ3 1 
ATOM   1551 C CH2 . TRP A 1 204 ? -0.342  7.244  64.325  1.00 25.44 ? 522 TRP A CH2 1 
ATOM   1552 N N   . ALA A 1 205 ? -1.230  14.504 63.140  1.00 22.72 ? 523 ALA A N   1 
ATOM   1553 C CA  . ALA A 1 205 ? -0.146  15.155 62.424  1.00 20.20 ? 523 ALA A CA  1 
ATOM   1554 C C   . ALA A 1 205 ? 0.585   16.093 63.369  1.00 19.90 ? 523 ALA A C   1 
ATOM   1555 O O   . ALA A 1 205 ? 1.788   16.275 63.280  1.00 20.21 ? 523 ALA A O   1 
ATOM   1556 C CB  . ALA A 1 205 ? -0.707  15.919 61.233  1.00 19.09 ? 523 ALA A CB  1 
ATOM   1557 N N   . TYR A 1 206 ? -0.168  16.700 64.269  1.00 19.21 ? 524 TYR A N   1 
ATOM   1558 C CA  . TYR A 1 206 ? 0.389   17.581 65.250  1.00 20.16 ? 524 TYR A CA  1 
ATOM   1559 C C   . TYR A 1 206 ? 1.339   16.757 66.095  1.00 20.82 ? 524 TYR A C   1 
ATOM   1560 O O   . TYR A 1 206 ? 2.445   17.191 66.394  1.00 20.64 ? 524 TYR A O   1 
ATOM   1561 C CB  . TYR A 1 206 ? -0.752  18.112 66.100  1.00 20.97 ? 524 TYR A CB  1 
ATOM   1562 C CG  . TYR A 1 206 ? -0.371  19.023 67.248  1.00 20.30 ? 524 TYR A CG  1 
ATOM   1563 C CD1 . TYR A 1 206 ? -0.175  20.401 67.046  1.00 18.02 ? 524 TYR A CD1 1 
ATOM   1564 C CD2 . TYR A 1 206 ? -0.267  18.517 68.551  1.00 16.15 ? 524 TYR A CD2 1 
ATOM   1565 C CE1 . TYR A 1 206 ? 0.146   21.242 68.118  1.00 18.61 ? 524 TYR A CE1 1 
ATOM   1566 C CE2 . TYR A 1 206 ? 0.047   19.339 69.618  1.00 15.58 ? 524 TYR A CE2 1 
ATOM   1567 C CZ  . TYR A 1 206 ? 0.247   20.694 69.407  1.00 15.71 ? 524 TYR A CZ  1 
ATOM   1568 O OH  . TYR A 1 206 ? 0.555   21.486 70.480  1.00 12.32 ? 524 TYR A OH  1 
ATOM   1569 N N   . GLY A 1 207 ? 0.904   15.561 66.477  1.00 20.43 ? 525 GLY A N   1 
ATOM   1570 C CA  . GLY A 1 207 ? 1.778   14.658 67.190  1.00 22.92 ? 525 GLY A CA  1 
ATOM   1571 C C   . GLY A 1 207 ? 3.070   14.401 66.414  1.00 24.93 ? 525 GLY A C   1 
ATOM   1572 O O   . GLY A 1 207 ? 4.157   14.472 66.980  1.00 26.87 ? 525 GLY A O   1 
ATOM   1573 N N   . VAL A 1 208 ? 2.968   14.108 65.121  1.00 24.48 ? 526 VAL A N   1 
ATOM   1574 C CA  . VAL A 1 208 ? 4.161   13.777 64.329  1.00 25.04 ? 526 VAL A CA  1 
ATOM   1575 C C   . VAL A 1 208 ? 5.141   14.982 64.214  1.00 27.52 ? 526 VAL A C   1 
ATOM   1576 O O   . VAL A 1 208 ? 6.367   14.795 64.172  1.00 28.83 ? 526 VAL A O   1 
ATOM   1577 C CB  . VAL A 1 208 ? 3.798   13.180 62.894  1.00 24.50 ? 526 VAL A CB  1 
ATOM   1578 C CG1 . VAL A 1 208 ? 5.012   13.129 62.000  1.00 21.89 ? 526 VAL A CG1 1 
ATOM   1579 C CG2 . VAL A 1 208 ? 3.155   11.787 62.975  1.00 16.89 ? 526 VAL A CG2 1 
ATOM   1580 N N   . LEU A 1 209 ? 4.617   16.207 64.169  1.00 26.72 ? 527 LEU A N   1 
ATOM   1581 C CA  . LEU A 1 209 ? 5.483   17.360 63.997  1.00 27.31 ? 527 LEU A CA  1 
ATOM   1582 C C   . LEU A 1 209 ? 6.130   17.616 65.338  1.00 27.33 ? 527 LEU A C   1 
ATOM   1583 O O   . LEU A 1 209 ? 7.278   18.026 65.448  1.00 25.62 ? 527 LEU A O   1 
ATOM   1584 C CB  . LEU A 1 209 ? 4.693   18.582 63.511  1.00 27.29 ? 527 LEU A CB  1 
ATOM   1585 C CG  . LEU A 1 209 ? 5.248   19.982 63.838  1.00 29.58 ? 527 LEU A CG  1 
ATOM   1586 C CD1 . LEU A 1 209 ? 4.929   20.969 62.722  1.00 32.80 ? 527 LEU A CD1 1 
ATOM   1587 C CD2 . LEU A 1 209 ? 4.700   20.505 65.174  1.00 28.81 ? 527 LEU A CD2 1 
ATOM   1588 N N   . LEU A 1 210 ? 5.350   17.338 66.361  1.00 28.74 ? 528 LEU A N   1 
ATOM   1589 C CA  . LEU A 1 210 ? 5.761   17.517 67.725  1.00 29.96 ? 528 LEU A CA  1 
ATOM   1590 C C   . LEU A 1 210 ? 6.887   16.522 68.000  1.00 30.08 ? 528 LEU A C   1 
ATOM   1591 O O   . LEU A 1 210 ? 7.931   16.855 68.597  1.00 31.06 ? 528 LEU A O   1 
ATOM   1592 C CB  . LEU A 1 210 ? 4.565   17.187 68.603  1.00 30.26 ? 528 LEU A CB  1 
ATOM   1593 C CG  . LEU A 1 210 ? 4.333   18.099 69.776  1.00 33.19 ? 528 LEU A CG  1 
ATOM   1594 C CD1 . LEU A 1 210 ? 3.936   17.227 70.937  1.00 39.71 ? 528 LEU A CD1 1 
ATOM   1595 C CD2 . LEU A 1 210 ? 5.618   18.849 70.093  1.00 38.90 ? 528 LEU A CD2 1 
ATOM   1596 N N   . TYR A 1 211 ? 6.657   15.293 67.568  1.00 27.73 ? 529 TYR A N   1 
ATOM   1597 C CA  . TYR A 1 211 ? 7.664   14.276 67.658  1.00 29.51 ? 529 TYR A CA  1 
ATOM   1598 C C   . TYR A 1 211 ? 8.945   14.720 66.941  1.00 30.85 ? 529 TYR A C   1 
ATOM   1599 O O   . TYR A 1 211 ? 10.020  14.657 67.512  1.00 30.85 ? 529 TYR A O   1 
ATOM   1600 C CB  . TYR A 1 211 ? 7.161   12.970 67.050  1.00 30.10 ? 529 TYR A CB  1 
ATOM   1601 C CG  . TYR A 1 211 ? 8.173   11.883 67.186  1.00 29.81 ? 529 TYR A CG  1 
ATOM   1602 C CD1 . TYR A 1 211 ? 9.158   11.685 66.219  1.00 34.87 ? 529 TYR A CD1 1 
ATOM   1603 C CD2 . TYR A 1 211 ? 8.175   11.075 68.292  1.00 31.62 ? 529 TYR A CD2 1 
ATOM   1604 C CE1 . TYR A 1 211 ? 10.118  10.685 66.365  1.00 32.14 ? 529 TYR A CE1 1 
ATOM   1605 C CE2 . TYR A 1 211 ? 9.109   10.081 68.443  1.00 33.44 ? 529 TYR A CE2 1 
ATOM   1606 C CZ  . TYR A 1 211 ? 10.069  9.891  67.488  1.00 32.56 ? 529 TYR A CZ  1 
ATOM   1607 O OH  . TYR A 1 211 ? 10.972  8.891  67.692  1.00 37.47 ? 529 TYR A OH  1 
ATOM   1608 N N   . GLU A 1 212 ? 8.834   15.159 65.688  1.00 30.89 ? 530 GLU A N   1 
ATOM   1609 C CA  . GLU A 1 212 ? 10.007  15.604 64.960  1.00 30.06 ? 530 GLU A CA  1 
ATOM   1610 C C   . GLU A 1 212 ? 10.717  16.717 65.704  1.00 30.93 ? 530 GLU A C   1 
ATOM   1611 O O   . GLU A 1 212 ? 11.941  16.779 65.720  1.00 33.43 ? 530 GLU A O   1 
ATOM   1612 C CB  . GLU A 1 212 ? 9.626   16.126 63.589  1.00 28.64 ? 530 GLU A CB  1 
ATOM   1613 C CG  . GLU A 1 212 ? 9.217   15.079 62.599  1.00 27.90 ? 530 GLU A CG  1 
ATOM   1614 C CD  . GLU A 1 212 ? 8.770   15.695 61.271  1.00 28.91 ? 530 GLU A CD  1 
ATOM   1615 O OE1 . GLU A 1 212 ? 8.211   16.812 61.285  1.00 29.81 ? 530 GLU A OE1 1 
ATOM   1616 O OE2 . GLU A 1 212 ? 8.977   15.072 60.207  1.00 24.91 ? 530 GLU A OE2 1 
ATOM   1617 N N   . MET A 1 213 ? 9.958   17.622 66.299  1.00 30.12 ? 531 MET A N   1 
ATOM   1618 C CA  . MET A 1 213 ? 10.578  18.730 67.009  1.00 29.98 ? 531 MET A CA  1 
ATOM   1619 C C   . MET A 1 213 ? 11.434  18.201 68.126  1.00 30.55 ? 531 MET A C   1 
ATOM   1620 O O   . MET A 1 213 ? 12.519  18.706 68.364  1.00 31.30 ? 531 MET A O   1 
ATOM   1621 C CB  . MET A 1 213 ? 9.538   19.690 67.586  1.00 29.41 ? 531 MET A CB  1 
ATOM   1622 C CG  . MET A 1 213 ? 9.007   20.668 66.583  1.00 28.14 ? 531 MET A CG  1 
ATOM   1623 S SD  . MET A 1 213 ? 8.189   22.039 67.384  1.00 32.10 ? 531 MET A SD  1 
ATOM   1624 C CE  . MET A 1 213 ? 6.791   21.267 68.172  1.00 32.29 ? 531 MET A CE  1 
ATOM   1625 N N   . LEU A 1 214 ? 10.943  17.182 68.815  1.00 31.33 ? 532 LEU A N   1 
ATOM   1626 C CA  . LEU A 1 214 ? 11.659  16.636 69.968  1.00 33.22 ? 532 LEU A CA  1 
ATOM   1627 C C   . LEU A 1 214 ? 12.790  15.640 69.639  1.00 33.96 ? 532 LEU A C   1 
ATOM   1628 O O   . LEU A 1 214 ? 13.817  15.638 70.281  1.00 36.26 ? 532 LEU A O   1 
ATOM   1629 C CB  . LEU A 1 214 ? 10.668  15.962 70.901  1.00 32.80 ? 532 LEU A CB  1 
ATOM   1630 C CG  . LEU A 1 214 ? 9.634   16.876 71.551  1.00 33.94 ? 532 LEU A CG  1 
ATOM   1631 C CD1 . LEU A 1 214 ? 8.318   16.110 71.807  1.00 29.73 ? 532 LEU A CD1 1 
ATOM   1632 C CD2 . LEU A 1 214 ? 10.190  17.529 72.825  1.00 23.90 ? 532 LEU A CD2 1 
ATOM   1633 N N   . ALA A 1 215 ? 12.596  14.792 68.647  1.00 34.84 ? 533 ALA A N   1 
ATOM   1634 C CA  . ALA A 1 215 ? 13.515  13.698 68.398  1.00 34.88 ? 533 ALA A CA  1 
ATOM   1635 C C   . ALA A 1 215 ? 14.437  13.978 67.235  1.00 35.52 ? 533 ALA A C   1 
ATOM   1636 O O   . ALA A 1 215 ? 15.469  13.319 67.096  1.00 36.30 ? 533 ALA A O   1 
ATOM   1637 C CB  . ALA A 1 215 ? 12.749  12.410 68.149  1.00 34.88 ? 533 ALA A CB  1 
ATOM   1638 N N   . GLY A 1 216 ? 14.052  14.937 66.391  1.00 35.96 ? 534 GLY A N   1 
ATOM   1639 C CA  . GLY A 1 216 ? 14.844  15.309 65.220  1.00 33.17 ? 534 GLY A CA  1 
ATOM   1640 C C   . GLY A 1 216 ? 14.628  14.329 64.095  1.00 32.41 ? 534 GLY A C   1 
ATOM   1641 O O   . GLY A 1 216 ? 15.225  14.453 63.025  1.00 33.40 ? 534 GLY A O   1 
ATOM   1642 N N   . GLN A 1 217 ? 13.780  13.340 64.337  1.00 31.11 ? 535 GLN A N   1 
ATOM   1643 C CA  . GLN A 1 217 ? 13.519  12.299 63.357  1.00 31.28 ? 535 GLN A CA  1 
ATOM   1644 C C   . GLN A 1 217 ? 12.033  12.233 63.191  1.00 29.66 ? 535 GLN A C   1 
ATOM   1645 O O   . GLN A 1 217 ? 11.307  12.776 64.003  1.00 30.61 ? 535 GLN A O   1 
ATOM   1646 C CB  . GLN A 1 217 ? 13.991  10.922 63.846  1.00 32.89 ? 535 GLN A CB  1 
ATOM   1647 C CG  . GLN A 1 217 ? 15.474  10.777 64.125  1.00 39.40 ? 535 GLN A CG  1 
ATOM   1648 C CD  . GLN A 1 217 ? 16.288  10.851 62.861  1.00 49.45 ? 535 GLN A CD  1 
ATOM   1649 O OE1 . GLN A 1 217 ? 17.291  11.573 62.785  1.00 50.31 ? 535 GLN A OE1 1 
ATOM   1650 N NE2 . GLN A 1 217 ? 15.849  10.116 61.839  1.00 54.93 ? 535 GLN A NE2 1 
ATOM   1651 N N   . PRO A 1 218 ? 11.566  11.582 62.126  1.00 28.76 ? 536 PRO A N   1 
ATOM   1652 C CA  . PRO A 1 218 ? 10.166  11.264 62.064  1.00 28.31 ? 536 PRO A CA  1 
ATOM   1653 C C   . PRO A 1 218 ? 9.903   10.064 62.959  1.00 29.32 ? 536 PRO A C   1 
ATOM   1654 O O   . PRO A 1 218 ? 10.829  9.306  63.266  1.00 27.64 ? 536 PRO A O   1 
ATOM   1655 C CB  . PRO A 1 218 ? 9.961   10.857 60.605  1.00 26.94 ? 536 PRO A CB  1 
ATOM   1656 C CG  . PRO A 1 218 ? 11.137  11.317 59.907  1.00 27.55 ? 536 PRO A CG  1 
ATOM   1657 C CD  . PRO A 1 218 ? 12.247  11.263 60.869  1.00 28.67 ? 536 PRO A CD  1 
ATOM   1658 N N   . PRO A 1 219 ? 8.638   9.889  63.363  1.00 29.72 ? 537 PRO A N   1 
ATOM   1659 C CA  . PRO A 1 219 ? 8.183   8.770  64.166  1.00 30.50 ? 537 PRO A CA  1 
ATOM   1660 C C   . PRO A 1 219 ? 8.167   7.449  63.422  1.00 30.66 ? 537 PRO A C   1 
ATOM   1661 O O   . PRO A 1 219 ? 8.172   6.409  64.063  1.00 32.04 ? 537 PRO A O   1 
ATOM   1662 C CB  . PRO A 1 219 ? 6.745   9.150  64.527  1.00 30.53 ? 537 PRO A CB  1 
ATOM   1663 C CG  . PRO A 1 219 ? 6.550   10.536 64.052  1.00 30.46 ? 537 PRO A CG  1 
ATOM   1664 C CD  . PRO A 1 219 ? 7.549   10.814 63.026  1.00 28.77 ? 537 PRO A CD  1 
ATOM   1665 N N   . PHE A 1 220 ? 8.144   7.471  62.096  1.00 31.58 ? 538 PHE A N   1 
ATOM   1666 C CA  . PHE A 1 220 ? 7.872   6.240  61.337  1.00 33.19 ? 538 PHE A CA  1 
ATOM   1667 C C   . PHE A 1 220 ? 8.791   6.004  60.153  1.00 33.42 ? 538 PHE A C   1 
ATOM   1668 O O   . PHE A 1 220 ? 8.990   6.886  59.322  1.00 33.22 ? 538 PHE A O   1 
ATOM   1669 C CB  . PHE A 1 220 ? 6.412   6.211  60.849  1.00 33.88 ? 538 PHE A CB  1 
ATOM   1670 C CG  . PHE A 1 220 ? 5.395   6.158  61.967  1.00 35.49 ? 538 PHE A CG  1 
ATOM   1671 C CD1 . PHE A 1 220 ? 5.088   4.952  62.590  1.00 35.33 ? 538 PHE A CD1 1 
ATOM   1672 C CD2 . PHE A 1 220 ? 4.743   7.312  62.392  1.00 33.13 ? 538 PHE A CD2 1 
ATOM   1673 C CE1 . PHE A 1 220 ? 4.161   4.910  63.621  1.00 34.05 ? 538 PHE A CE1 1 
ATOM   1674 C CE2 . PHE A 1 220 ? 3.807   7.269  63.407  1.00 28.03 ? 538 PHE A CE2 1 
ATOM   1675 C CZ  . PHE A 1 220 ? 3.522   6.078  64.023  1.00 33.19 ? 538 PHE A CZ  1 
ATOM   1676 N N   . ASP A 1 221 ? 9.300   4.781  60.068  1.00 35.48 ? 539 ASP A N   1 
ATOM   1677 C CA  . ASP A 1 221 ? 10.268  4.373  59.048  1.00 37.88 ? 539 ASP A CA  1 
ATOM   1678 C C   . ASP A 1 221 ? 9.580   3.701  57.860  1.00 37.46 ? 539 ASP A C   1 
ATOM   1679 O O   . ASP A 1 221 ? 8.581   3.009  58.041  1.00 36.84 ? 539 ASP A O   1 
ATOM   1680 C CB  . ASP A 1 221 ? 11.239  3.351  59.657  1.00 38.87 ? 539 ASP A CB  1 
ATOM   1681 C CG  . ASP A 1 221 ? 11.622  3.685  61.088  1.00 44.01 ? 539 ASP A CG  1 
ATOM   1682 O OD1 . ASP A 1 221 ? 11.611  4.890  61.457  1.00 47.78 ? 539 ASP A OD1 1 
ATOM   1683 O OD2 . ASP A 1 221 ? 11.945  2.739  61.846  1.00 49.22 ? 539 ASP A OD2 1 
ATOM   1684 N N   . GLY A 1 222 ? 10.122  3.887  56.655  1.00 37.09 ? 540 GLY A N   1 
ATOM   1685 C CA  . GLY A 1 222 ? 9.646   3.130  55.502  1.00 37.42 ? 540 GLY A CA  1 
ATOM   1686 C C   . GLY A 1 222 ? 10.426  3.363  54.227  1.00 38.21 ? 540 GLY A C   1 
ATOM   1687 O O   . GLY A 1 222 ? 10.566  4.505  53.790  1.00 40.06 ? 540 GLY A O   1 
ATOM   1688 N N   . GLU A 1 223 ? 10.916  2.281  53.616  1.00 37.54 ? 541 GLU A N   1 
ATOM   1689 C CA  . GLU A 1 223 ? 11.712  2.353  52.382  1.00 37.17 ? 541 GLU A CA  1 
ATOM   1690 C C   . GLU A 1 223 ? 10.923  2.892  51.196  1.00 36.10 ? 541 GLU A C   1 
ATOM   1691 O O   . GLU A 1 223 ? 11.497  3.326  50.203  1.00 36.78 ? 541 GLU A O   1 
ATOM   1692 C CB  . GLU A 1 223 ? 12.271  0.975  52.030  1.00 38.19 ? 541 GLU A CB  1 
ATOM   1693 C CG  . GLU A 1 223 ? 13.522  0.585  52.807  1.00 43.25 ? 541 GLU A CG  1 
ATOM   1694 C CD  . GLU A 1 223 ? 13.744  -0.928 52.821  1.00 52.63 ? 541 GLU A CD  1 
ATOM   1695 O OE1 . GLU A 1 223 ? 13.585  -1.555 51.746  1.00 56.26 ? 541 GLU A OE1 1 
ATOM   1696 O OE2 . GLU A 1 223 ? 14.061  -1.494 53.903  1.00 55.28 ? 541 GLU A OE2 1 
ATOM   1697 N N   . ASP A 1 224 ? 9.601   2.834  51.295  1.00 35.36 ? 542 ASP A N   1 
ATOM   1698 C CA  . ASP A 1 224 ? 8.707   3.457  50.316  1.00 33.84 ? 542 ASP A CA  1 
ATOM   1699 C C   . ASP A 1 224 ? 7.355   3.751  50.977  1.00 32.03 ? 542 ASP A C   1 
ATOM   1700 O O   . ASP A 1 224 ? 7.183   3.492  52.161  1.00 32.58 ? 542 ASP A O   1 
ATOM   1701 C CB  . ASP A 1 224 ? 8.538   2.562  49.096  1.00 33.65 ? 542 ASP A CB  1 
ATOM   1702 C CG  . ASP A 1 224 ? 7.853   1.264  49.427  1.00 35.30 ? 542 ASP A CG  1 
ATOM   1703 O OD1 . ASP A 1 224 ? 7.262   1.161  50.525  1.00 36.46 ? 542 ASP A OD1 1 
ATOM   1704 O OD2 . ASP A 1 224 ? 7.899   0.344  48.586  1.00 37.74 ? 542 ASP A OD2 1 
ATOM   1705 N N   . GLU A 1 225 ? 6.406   4.293  50.224  1.00 30.74 ? 543 GLU A N   1 
ATOM   1706 C CA  . GLU A 1 225 ? 5.095   4.622  50.780  1.00 30.02 ? 543 GLU A CA  1 
ATOM   1707 C C   . GLU A 1 225 ? 4.358   3.422  51.414  1.00 31.72 ? 543 GLU A C   1 
ATOM   1708 O O   . GLU A 1 225 ? 3.934   3.509  52.554  1.00 33.35 ? 543 GLU A O   1 
ATOM   1709 C CB  . GLU A 1 225 ? 4.217   5.348  49.750  1.00 28.21 ? 543 GLU A CB  1 
ATOM   1710 C CG  . GLU A 1 225 ? 3.103   6.204  50.338  1.00 25.86 ? 543 GLU A CG  1 
ATOM   1711 C CD  . GLU A 1 225 ? 2.564   7.253  49.356  1.00 30.93 ? 543 GLU A CD  1 
ATOM   1712 O OE1 . GLU A 1 225 ? 2.537   7.001  48.137  1.00 32.78 ? 543 GLU A OE1 1 
ATOM   1713 O OE2 . GLU A 1 225 ? 2.166   8.347  49.796  1.00 30.94 ? 543 GLU A OE2 1 
ATOM   1714 N N   . ASP A 1 226 ? 4.218   2.295  50.728  1.00 32.75 ? 544 ASP A N   1 
ATOM   1715 C CA  . ASP A 1 226 ? 3.439   1.209  51.332  1.00 34.88 ? 544 ASP A CA  1 
ATOM   1716 C C   . ASP A 1 226 ? 4.041   0.723  52.642  1.00 34.34 ? 544 ASP A C   1 
ATOM   1717 O O   . ASP A 1 226 ? 3.329   0.396  53.593  1.00 34.03 ? 544 ASP A O   1 
ATOM   1718 C CB  . ASP A 1 226 ? 3.222   0.048  50.356  1.00 36.44 ? 544 ASP A CB  1 
ATOM   1719 C CG  . ASP A 1 226 ? 2.471   0.486  49.087  1.00 46.22 ? 544 ASP A CG  1 
ATOM   1720 O OD1 . ASP A 1 226 ? 2.496   -0.285 48.093  1.00 55.33 ? 544 ASP A OD1 1 
ATOM   1721 O OD2 . ASP A 1 226 ? 1.864   1.601  49.074  1.00 50.63 ? 544 ASP A OD2 1 
ATOM   1722 N N   . GLU A 1 227 ? 5.363   0.701  52.684  1.00 34.04 ? 545 GLU A N   1 
ATOM   1723 C CA  . GLU A 1 227 ? 6.088   0.275  53.859  1.00 33.61 ? 545 GLU A CA  1 
ATOM   1724 C C   . GLU A 1 227 ? 5.974   1.289  54.988  1.00 32.00 ? 545 GLU A C   1 
ATOM   1725 O O   . GLU A 1 227 ? 5.874   0.914  56.157  1.00 31.65 ? 545 GLU A O   1 
ATOM   1726 C CB  . GLU A 1 227 ? 7.550   0.076  53.500  1.00 34.88 ? 545 GLU A CB  1 
ATOM   1727 C CG  . GLU A 1 227 ? 8.292   -0.781 54.492  1.00 40.56 ? 545 GLU A CG  1 
ATOM   1728 C CD  . GLU A 1 227 ? 9.753   -0.914 54.126  1.00 47.22 ? 545 GLU A CD  1 
ATOM   1729 O OE1 . GLU A 1 227 ? 10.193  -2.058 53.867  1.00 54.06 ? 545 GLU A OE1 1 
ATOM   1730 O OE2 . GLU A 1 227 ? 10.453  0.127  54.083  1.00 44.97 ? 545 GLU A OE2 1 
ATOM   1731 N N   . LEU A 1 228 ? 6.012   2.572  54.628  1.00 29.06 ? 546 LEU A N   1 
ATOM   1732 C CA  . LEU A 1 228 ? 5.822   3.644  55.579  1.00 26.97 ? 546 LEU A CA  1 
ATOM   1733 C C   . LEU A 1 228 ? 4.438   3.555  56.200  1.00 28.25 ? 546 LEU A C   1 
ATOM   1734 O O   . LEU A 1 228 ? 4.283   3.653  57.423  1.00 27.79 ? 546 LEU A O   1 
ATOM   1735 C CB  . LEU A 1 228 ? 5.980   4.981  54.884  1.00 26.24 ? 546 LEU A CB  1 
ATOM   1736 C CG  . LEU A 1 228 ? 5.552   6.244  55.629  1.00 21.58 ? 546 LEU A CG  1 
ATOM   1737 C CD1 . LEU A 1 228 ? 6.388   6.444  56.875  1.00 18.07 ? 546 LEU A CD1 1 
ATOM   1738 C CD2 . LEU A 1 228 ? 5.687   7.428  54.705  1.00 16.40 ? 546 LEU A CD2 1 
ATOM   1739 N N   . PHE A 1 229 ? 3.426   3.380  55.353  1.00 28.63 ? 547 PHE A N   1 
ATOM   1740 C CA  . PHE A 1 229 ? 2.044   3.261  55.827  1.00 28.74 ? 547 PHE A CA  1 
ATOM   1741 C C   . PHE A 1 229 ? 1.893   2.060  56.736  1.00 29.82 ? 547 PHE A C   1 
ATOM   1742 O O   . PHE A 1 229 ? 1.426   2.177  57.858  1.00 28.98 ? 547 PHE A O   1 
ATOM   1743 C CB  . PHE A 1 229 ? 1.073   3.121  54.662  1.00 27.89 ? 547 PHE A CB  1 
ATOM   1744 C CG  . PHE A 1 229 ? 0.814   4.401  53.922  1.00 26.29 ? 547 PHE A CG  1 
ATOM   1745 C CD1 . PHE A 1 229 ? 1.239   5.617  54.436  1.00 22.53 ? 547 PHE A CD1 1 
ATOM   1746 C CD2 . PHE A 1 229 ? 0.115   4.387  52.724  1.00 24.94 ? 547 PHE A CD2 1 
ATOM   1747 C CE1 . PHE A 1 229 ? 1.008   6.784  53.759  1.00 17.74 ? 547 PHE A CE1 1 
ATOM   1748 C CE2 . PHE A 1 229 ? -0.130  5.563  52.039  1.00 24.28 ? 547 PHE A CE2 1 
ATOM   1749 C CZ  . PHE A 1 229 ? 0.322   6.760  52.559  1.00 23.77 ? 547 PHE A CZ  1 
ATOM   1750 N N   . GLN A 1 230 ? 2.299   0.904  56.227  1.00 32.47 ? 548 GLN A N   1 
ATOM   1751 C CA  . GLN A 1 230 ? 2.315   -0.326 56.990  1.00 35.06 ? 548 GLN A CA  1 
ATOM   1752 C C   . GLN A 1 230 ? 2.841   -0.010 58.382  1.00 35.82 ? 548 GLN A C   1 
ATOM   1753 O O   . GLN A 1 230 ? 2.359   -0.524 59.395  1.00 36.20 ? 548 GLN A O   1 
ATOM   1754 C CB  . GLN A 1 230 ? 3.242   -1.319 56.308  1.00 35.33 ? 548 GLN A CB  1 
ATOM   1755 C CG  . GLN A 1 230 ? 3.175   -2.732 56.857  1.00 43.77 ? 548 GLN A CG  1 
ATOM   1756 C CD  . GLN A 1 230 ? 4.514   -3.470 56.761  1.00 49.49 ? 548 GLN A CD  1 
ATOM   1757 O OE1 . GLN A 1 230 ? 4.602   -4.552 56.167  1.00 46.64 ? 548 GLN A OE1 1 
ATOM   1758 N NE2 . GLN A 1 230 ? 5.567   -2.874 57.348  1.00 50.77 ? 548 GLN A NE2 1 
ATOM   1759 N N   . SER A 1 231 ? 3.832   0.865  58.425  1.00 35.86 ? 549 SER A N   1 
ATOM   1760 C CA  . SER A 1 231 ? 4.495   1.164  59.664  1.00 34.58 ? 549 SER A CA  1 
ATOM   1761 C C   . SER A 1 231 ? 3.612   2.062  60.524  1.00 34.48 ? 549 SER A C   1 
ATOM   1762 O O   . SER A 1 231 ? 3.622   1.938  61.738  1.00 37.13 ? 549 SER A O   1 
ATOM   1763 C CB  . SER A 1 231 ? 5.847   1.798  59.363  1.00 33.41 ? 549 SER A CB  1 
ATOM   1764 O OG  . SER A 1 231 ? 6.528   2.128  60.543  1.00 36.25 ? 549 SER A OG  1 
ATOM   1765 N N   . ILE A 1 232 ? 2.835   2.943  59.892  1.00 34.24 ? 550 ILE A N   1 
ATOM   1766 C CA  . ILE A 1 232 ? 1.962   3.908  60.592  1.00 33.58 ? 550 ILE A CA  1 
ATOM   1767 C C   . ILE A 1 232 ? 0.777   3.200  61.234  1.00 33.83 ? 550 ILE A C   1 
ATOM   1768 O O   . ILE A 1 232 ? 0.264   3.626  62.247  1.00 32.21 ? 550 ILE A O   1 
ATOM   1769 C CB  . ILE A 1 232 ? 1.403   4.964  59.595  1.00 33.68 ? 550 ILE A CB  1 
ATOM   1770 C CG1 . ILE A 1 232 ? 2.374   6.124  59.391  1.00 31.14 ? 550 ILE A CG1 1 
ATOM   1771 C CG2 . ILE A 1 232 ? 0.057   5.507  60.044  1.00 32.40 ? 550 ILE A CG2 1 
ATOM   1772 C CD1 . ILE A 1 232 ? 1.903   7.064  58.287  1.00 27.71 ? 550 ILE A CD1 1 
ATOM   1773 N N   . MET A 1 233 ? 0.383   2.095  60.609  1.00 36.55 ? 551 MET A N   1 
ATOM   1774 C CA  . MET A 1 233 ? -0.821  1.313  60.898  1.00 37.14 ? 551 MET A CA  1 
ATOM   1775 C C   . MET A 1 233 ? -0.589  0.248  61.983  1.00 37.50 ? 551 MET A C   1 
ATOM   1776 O O   . MET A 1 233 ? -1.526  -0.172 62.679  1.00 36.18 ? 551 MET A O   1 
ATOM   1777 C CB  . MET A 1 233 ? -1.230  0.617  59.589  1.00 36.46 ? 551 MET A CB  1 
ATOM   1778 C CG  . MET A 1 233 ? -2.722  0.350  59.410  1.00 40.35 ? 551 MET A CG  1 
ATOM   1779 S SD  . MET A 1 233 ? -3.654  1.825  58.976  1.00 37.92 ? 551 MET A SD  1 
ATOM   1780 C CE  . MET A 1 233 ? -2.334  2.826  58.350  1.00 36.18 ? 551 MET A CE  1 
ATOM   1781 N N   . GLU A 1 234 ? 0.674   -0.165 62.118  1.00 39.32 ? 552 GLU A N   1 
ATOM   1782 C CA  . GLU A 1 234 ? 1.070   -1.356 62.879  1.00 41.11 ? 552 GLU A CA  1 
ATOM   1783 C C   . GLU A 1 234 ? 2.190   -1.141 63.901  1.00 42.58 ? 552 GLU A C   1 
ATOM   1784 O O   . GLU A 1 234 ? 2.247   -1.832 64.932  1.00 41.49 ? 552 GLU A O   1 
ATOM   1785 C CB  . GLU A 1 234 ? 1.507   -2.450 61.913  1.00 40.49 ? 552 GLU A CB  1 
ATOM   1786 C CG  . GLU A 1 234 ? 0.428   -2.863 60.948  1.00 41.81 ? 552 GLU A CG  1 
ATOM   1787 C CD  . GLU A 1 234 ? 0.924   -3.888 59.966  1.00 43.26 ? 552 GLU A CD  1 
ATOM   1788 O OE1 . GLU A 1 234 ? 2.153   -4.124 59.919  1.00 35.77 ? 552 GLU A OE1 1 
ATOM   1789 O OE2 . GLU A 1 234 ? 0.076   -4.460 59.250  1.00 49.24 ? 552 GLU A OE2 1 
ATOM   1790 N N   . HIS A 1 235 ? 3.087   -0.201 63.625  1.00 45.20 ? 553 HIS A N   1 
ATOM   1791 C CA  . HIS A 1 235 ? 4.143   0.048  64.581  1.00 49.37 ? 553 HIS A CA  1 
ATOM   1792 C C   . HIS A 1 235 ? 3.748   1.003  65.705  1.00 50.04 ? 553 HIS A C   1 
ATOM   1793 O O   . HIS A 1 235 ? 3.040   1.980  65.489  1.00 49.37 ? 553 HIS A O   1 
ATOM   1794 C CB  . HIS A 1 235 ? 5.431   0.508  63.921  1.00 50.45 ? 553 HIS A CB  1 
ATOM   1795 C CG  . HIS A 1 235 ? 6.635   0.277  64.779  1.00 58.49 ? 553 HIS A CG  1 
ATOM   1796 N ND1 . HIS A 1 235 ? 7.410   1.307  65.276  1.00 61.92 ? 553 HIS A ND1 1 
ATOM   1797 C CD2 . HIS A 1 235 ? 7.173   -0.871 65.261  1.00 60.19 ? 553 HIS A CD2 1 
ATOM   1798 C CE1 . HIS A 1 235 ? 8.389   0.801  66.008  1.00 63.33 ? 553 HIS A CE1 1 
ATOM   1799 N NE2 . HIS A 1 235 ? 8.266   -0.517 66.017  1.00 65.10 ? 553 HIS A NE2 1 
ATOM   1800 N N   . ASN A 1 236 ? 4.204   0.669  66.909  1.00 51.79 ? 554 ASN A N   1 
ATOM   1801 C CA  . ASN A 1 236 ? 4.114   1.538  68.072  1.00 53.29 ? 554 ASN A CA  1 
ATOM   1802 C C   . ASN A 1 236 ? 5.387   2.376  68.152  1.00 52.77 ? 554 ASN A C   1 
ATOM   1803 O O   . ASN A 1 236 ? 6.480   1.814  68.237  1.00 53.13 ? 554 ASN A O   1 
ATOM   1804 C CB  . ASN A 1 236 ? 3.982   0.689  69.346  1.00 53.95 ? 554 ASN A CB  1 
ATOM   1805 C CG  . ASN A 1 236 ? 2.531   0.514  69.796  1.00 55.76 ? 554 ASN A CG  1 
ATOM   1806 O OD1 . ASN A 1 236 ? 1.622   0.384  68.976  1.00 57.57 ? 554 ASN A OD1 1 
ATOM   1807 N ND2 . ASN A 1 236 ? 2.316   0.506  71.108  1.00 54.30 ? 554 ASN A ND2 1 
ATOM   1808 N N   . VAL A 1 237 ? 5.261   3.702  68.113  1.00 51.33 ? 555 VAL A N   1 
ATOM   1809 C CA  . VAL A 1 237 ? 6.443   4.570  68.143  1.00 49.53 ? 555 VAL A CA  1 
ATOM   1810 C C   . VAL A 1 237 ? 7.364   4.177  69.286  1.00 49.79 ? 555 VAL A C   1 
ATOM   1811 O O   . VAL A 1 237 ? 6.907   3.859  70.389  1.00 49.34 ? 555 VAL A O   1 
ATOM   1812 C CB  . VAL A 1 237 ? 6.073   6.062  68.298  1.00 50.09 ? 555 VAL A CB  1 
ATOM   1813 C CG1 . VAL A 1 237 ? 7.314   6.905  68.628  1.00 46.39 ? 555 VAL A CG1 1 
ATOM   1814 C CG2 . VAL A 1 237 ? 5.376   6.575  67.042  1.00 47.90 ? 555 VAL A CG2 1 
ATOM   1815 N N   . SER A 1 238 ? 8.663   4.199  69.011  1.00 49.71 ? 556 SER A N   1 
ATOM   1816 C CA  . SER A 1 238 ? 9.680   3.809  69.980  1.00 49.60 ? 556 SER A CA  1 
ATOM   1817 C C   . SER A 1 238 ? 10.417  5.076  70.421  1.00 48.27 ? 556 SER A C   1 
ATOM   1818 O O   . SER A 1 238 ? 11.240  5.583  69.671  1.00 47.83 ? 556 SER A O   1 
ATOM   1819 C CB  . SER A 1 238 ? 10.658  2.841  69.307  1.00 50.10 ? 556 SER A CB  1 
ATOM   1820 O OG  . SER A 1 238 ? 11.337  2.024  70.247  1.00 53.00 ? 556 SER A OG  1 
ATOM   1821 N N   . TYR A 1 239 ? 10.128  5.574  71.627  1.00 47.36 ? 557 TYR A N   1 
ATOM   1822 C CA  . TYR A 1 239 ? 10.588  6.917  72.066  1.00 47.23 ? 557 TYR A CA  1 
ATOM   1823 C C   . TYR A 1 239 ? 11.983  6.984  72.715  1.00 47.79 ? 557 TYR A C   1 
ATOM   1824 O O   . TYR A 1 239 ? 12.261  6.271  73.683  1.00 47.61 ? 557 TYR A O   1 
ATOM   1825 C CB  . TYR A 1 239 ? 9.578   7.548  73.039  1.00 46.68 ? 557 TYR A CB  1 
ATOM   1826 C CG  . TYR A 1 239 ? 8.194   7.697  72.485  1.00 41.98 ? 557 TYR A CG  1 
ATOM   1827 C CD1 . TYR A 1 239 ? 7.368   6.596  72.366  1.00 39.95 ? 557 TYR A CD1 1 
ATOM   1828 C CD2 . TYR A 1 239 ? 7.710   8.938  72.074  1.00 39.31 ? 557 TYR A CD2 1 
ATOM   1829 C CE1 . TYR A 1 239 ? 6.094   6.714  71.849  1.00 44.43 ? 557 TYR A CE1 1 
ATOM   1830 C CE2 . TYR A 1 239 ? 6.431   9.068  71.550  1.00 40.54 ? 557 TYR A CE2 1 
ATOM   1831 C CZ  . TYR A 1 239 ? 5.629   7.949  71.443  1.00 41.76 ? 557 TYR A CZ  1 
ATOM   1832 O OH  . TYR A 1 239 ? 4.359   8.025  70.944  1.00 42.44 ? 557 TYR A OH  1 
ATOM   1833 N N   . PRO A 1 240 ? 12.852  7.869  72.203  1.00 47.98 ? 558 PRO A N   1 
ATOM   1834 C CA  . PRO A 1 240 ? 14.175  8.050  72.782  1.00 48.88 ? 558 PRO A CA  1 
ATOM   1835 C C   . PRO A 1 240 ? 14.164  8.186  74.298  1.00 49.73 ? 558 PRO A C   1 
ATOM   1836 O O   . PRO A 1 240 ? 13.277  8.805  74.879  1.00 50.52 ? 558 PRO A O   1 
ATOM   1837 C CB  . PRO A 1 240 ? 14.662  9.348  72.140  1.00 48.01 ? 558 PRO A CB  1 
ATOM   1838 C CG  . PRO A 1 240 ? 14.059  9.302  70.789  1.00 48.62 ? 558 PRO A CG  1 
ATOM   1839 C CD  . PRO A 1 240 ? 12.691  8.654  70.970  1.00 48.36 ? 558 PRO A CD  1 
ATOM   1840 N N   . LYS A 1 241 ? 15.175  7.585  74.906  1.00 50.44 ? 559 LYS A N   1 
ATOM   1841 C CA  . LYS A 1 241 ? 15.410  7.588  76.343  1.00 51.35 ? 559 LYS A CA  1 
ATOM   1842 C C   . LYS A 1 241 ? 15.453  8.984  76.995  1.00 50.11 ? 559 LYS A C   1 
ATOM   1843 O O   . LYS A 1 241 ? 14.884  9.197  78.065  1.00 49.03 ? 559 LYS A O   1 
ATOM   1844 C CB  . LYS A 1 241 ? 16.716  6.818  76.583  1.00 52.21 ? 559 LYS A CB  1 
ATOM   1845 C CG  . LYS A 1 241 ? 17.563  6.674  75.291  1.00 54.13 ? 559 LYS A CG  1 
ATOM   1846 C CD  . LYS A 1 241 ? 17.783  5.201  74.937  1.00 58.98 ? 559 LYS A CD  1 
ATOM   1847 C CE  . LYS A 1 241 ? 17.968  4.369  76.226  1.00 59.97 ? 559 LYS A CE  1 
ATOM   1848 N NZ  . LYS A 1 241 ? 18.362  2.956  75.982  1.00 57.19 ? 559 LYS A NZ  1 
ATOM   1849 N N   . SER A 1 242 ? 16.127  9.924  76.341  1.00 49.30 ? 560 SER A N   1 
ATOM   1850 C CA  . SER A 1 242 ? 16.296  11.278 76.868  1.00 48.72 ? 560 SER A CA  1 
ATOM   1851 C C   . SER A 1 242 ? 15.025  12.155 76.833  1.00 47.57 ? 560 SER A C   1 
ATOM   1852 O O   . SER A 1 242 ? 15.087  13.363 77.078  1.00 47.37 ? 560 SER A O   1 
ATOM   1853 C CB  . SER A 1 242 ? 17.449  11.971 76.136  1.00 49.04 ? 560 SER A CB  1 
ATOM   1854 O OG  . SER A 1 242 ? 17.482  11.591 74.769  1.00 49.36 ? 560 SER A OG  1 
ATOM   1855 N N   . LEU A 1 243 ? 13.882  11.548 76.536  1.00 45.90 ? 561 LEU A N   1 
ATOM   1856 C CA  . LEU A 1 243 ? 12.619  12.279 76.479  1.00 44.38 ? 561 LEU A CA  1 
ATOM   1857 C C   . LEU A 1 243 ? 11.837  12.243 77.795  1.00 44.78 ? 561 LEU A C   1 
ATOM   1858 O O   . LEU A 1 243 ? 11.442  11.173 78.285  1.00 43.46 ? 561 LEU A O   1 
ATOM   1859 C CB  . LEU A 1 243 ? 11.737  11.729 75.364  1.00 44.11 ? 561 LEU A CB  1 
ATOM   1860 C CG  . LEU A 1 243 ? 11.405  12.571 74.136  1.00 41.93 ? 561 LEU A CG  1 
ATOM   1861 C CD1 . LEU A 1 243 ? 12.617  13.333 73.621  1.00 32.95 ? 561 LEU A CD1 1 
ATOM   1862 C CD2 . LEU A 1 243 ? 10.810  11.633 73.082  1.00 33.90 ? 561 LEU A CD2 1 
ATOM   1863 N N   . SER A 1 244 ? 11.598  13.429 78.344  1.00 44.38 ? 562 SER A N   1 
ATOM   1864 C CA  . SER A 1 244 ? 10.798  13.572 79.539  1.00 45.02 ? 562 SER A CA  1 
ATOM   1865 C C   . SER A 1 244 ? 9.476   12.812 79.474  1.00 44.93 ? 562 SER A C   1 
ATOM   1866 O O   . SER A 1 244 ? 8.854   12.690 78.426  1.00 45.34 ? 562 SER A O   1 
ATOM   1867 C CB  . SER A 1 244 ? 10.515  15.047 79.816  1.00 46.21 ? 562 SER A CB  1 
ATOM   1868 O OG  . SER A 1 244 ? 9.293   15.449 79.226  1.00 47.82 ? 562 SER A OG  1 
ATOM   1869 N N   . LYS A 1 245 ? 9.075   12.302 80.630  1.00 45.41 ? 563 LYS A N   1 
ATOM   1870 C CA  . LYS A 1 245 ? 7.782   11.673 80.858  1.00 45.14 ? 563 LYS A CA  1 
ATOM   1871 C C   . LYS A 1 245 ? 6.622   12.362 80.109  1.00 45.13 ? 563 LYS A C   1 
ATOM   1872 O O   . LYS A 1 245 ? 5.829   11.698 79.445  1.00 46.10 ? 563 LYS A O   1 
ATOM   1873 C CB  . LYS A 1 245 ? 7.524   11.701 82.365  1.00 45.16 ? 563 LYS A CB  1 
ATOM   1874 C CG  . LYS A 1 245 ? 6.649   10.603 82.921  1.00 45.49 ? 563 LYS A CG  1 
ATOM   1875 C CD  . LYS A 1 245 ? 6.394   10.891 84.393  1.00 44.48 ? 563 LYS A CD  1 
ATOM   1876 C CE  . LYS A 1 245 ? 6.360   12.397 84.622  1.00 40.07 ? 563 LYS A CE  1 
ATOM   1877 N NZ  . LYS A 1 245 ? 5.972   12.744 85.999  1.00 37.68 ? 563 LYS A NZ  1 
ATOM   1878 N N   . GLU A 1 246 ? 6.525   13.686 80.215  1.00 44.25 ? 564 GLU A N   1 
ATOM   1879 C CA  . GLU A 1 246 ? 5.440   14.428 79.578  1.00 43.88 ? 564 GLU A CA  1 
ATOM   1880 C C   . GLU A 1 246 ? 5.545   14.449 78.055  1.00 43.26 ? 564 GLU A C   1 
ATOM   1881 O O   . GLU A 1 246 ? 4.530   14.419 77.345  1.00 42.75 ? 564 GLU A O   1 
ATOM   1882 C CB  . GLU A 1 246 ? 5.376   15.856 80.105  1.00 43.68 ? 564 GLU A CB  1 
ATOM   1883 C CG  . GLU A 1 246 ? 4.775   15.950 81.489  1.00 47.30 ? 564 GLU A CG  1 
ATOM   1884 C CD  . GLU A 1 246 ? 5.758   15.597 82.601  1.00 51.08 ? 564 GLU A CD  1 
ATOM   1885 O OE1 . GLU A 1 246 ? 6.987   15.567 82.343  1.00 52.01 ? 564 GLU A OE1 1 
ATOM   1886 O OE2 . GLU A 1 246 ? 5.293   15.363 83.741  1.00 50.75 ? 564 GLU A OE2 1 
ATOM   1887 N N   . ALA A 1 247 ? 6.773   14.525 77.554  1.00 41.21 ? 565 ALA A N   1 
ATOM   1888 C CA  . ALA A 1 247 ? 6.980   14.506 76.119  1.00 38.20 ? 565 ALA A CA  1 
ATOM   1889 C C   . ALA A 1 247 ? 6.398   13.206 75.599  1.00 36.40 ? 565 ALA A C   1 
ATOM   1890 O O   . ALA A 1 247 ? 5.652   13.191 74.624  1.00 35.96 ? 565 ALA A O   1 
ATOM   1891 C CB  . ALA A 1 247 ? 8.457   14.598 75.789  1.00 37.50 ? 565 ALA A CB  1 
ATOM   1892 N N   . VAL A 1 248 ? 6.717   12.115 76.280  1.00 34.17 ? 566 VAL A N   1 
ATOM   1893 C CA  . VAL A 1 248 ? 6.350   10.803 75.782  1.00 32.56 ? 566 VAL A CA  1 
ATOM   1894 C C   . VAL A 1 248 ? 4.851   10.580 75.901  1.00 31.76 ? 566 VAL A C   1 
ATOM   1895 O O   . VAL A 1 248 ? 4.254   9.827  75.138  1.00 30.16 ? 566 VAL A O   1 
ATOM   1896 C CB  . VAL A 1 248 ? 7.136   9.709  76.495  1.00 31.07 ? 566 VAL A CB  1 
ATOM   1897 C CG1 . VAL A 1 248 ? 6.909   8.396  75.816  1.00 28.83 ? 566 VAL A CG1 1 
ATOM   1898 C CG2 . VAL A 1 248 ? 8.605   10.049 76.448  1.00 33.15 ? 566 VAL A CG2 1 
ATOM   1899 N N   . SER A 1 249 ? 4.242   11.267 76.851  1.00 32.20 ? 567 SER A N   1 
ATOM   1900 C CA  . SER A 1 249 ? 2.826   11.094 77.086  1.00 32.82 ? 567 SER A CA  1 
ATOM   1901 C C   . SER A 1 249 ? 2.017   11.757 75.971  1.00 33.30 ? 567 SER A C   1 
ATOM   1902 O O   . SER A 1 249 ? 1.177   11.126 75.330  1.00 34.87 ? 567 SER A O   1 
ATOM   1903 C CB  . SER A 1 249 ? 2.442   11.651 78.458  1.00 31.67 ? 567 SER A CB  1 
ATOM   1904 O OG  . SER A 1 249 ? 1.045   11.579 78.661  1.00 30.19 ? 567 SER A OG  1 
ATOM   1905 N N   . ILE A 1 250 ? 2.286   13.029 75.720  1.00 33.40 ? 568 ILE A N   1 
ATOM   1906 C CA  . ILE A 1 250 ? 1.514   13.760 74.731  1.00 32.31 ? 568 ILE A CA  1 
ATOM   1907 C C   . ILE A 1 250 ? 1.732   13.134 73.355  1.00 32.46 ? 568 ILE A C   1 
ATOM   1908 O O   . ILE A 1 250 ? 0.825   13.088 72.519  1.00 33.00 ? 568 ILE A O   1 
ATOM   1909 C CB  . ILE A 1 250 ? 1.811   15.278 74.772  1.00 31.39 ? 568 ILE A CB  1 
ATOM   1910 C CG1 . ILE A 1 250 ? 0.631   16.054 74.190  1.00 31.19 ? 568 ILE A CG1 1 
ATOM   1911 C CG2 . ILE A 1 250 ? 3.133   15.613 74.096  1.00 28.24 ? 568 ILE A CG2 1 
ATOM   1912 C CD1 . ILE A 1 250 ? 0.815   17.553 74.218  1.00 31.55 ? 568 ILE A CD1 1 
ATOM   1913 N N   . CYS A 1 251 ? 2.925   12.602 73.140  1.00 31.28 ? 569 CYS A N   1 
ATOM   1914 C CA  . CYS A 1 251 ? 3.174   11.895 71.898  1.00 31.42 ? 569 CYS A CA  1 
ATOM   1915 C C   . CYS A 1 251 ? 2.292   10.654 71.741  1.00 31.38 ? 569 CYS A C   1 
ATOM   1916 O O   . CYS A 1 251 ? 1.673   10.447 70.690  1.00 30.49 ? 569 CYS A O   1 
ATOM   1917 C CB  . CYS A 1 251 ? 4.659   11.587 71.738  1.00 31.24 ? 569 CYS A CB  1 
ATOM   1918 S SG  . CYS A 1 251 ? 5.624   13.100 71.349  1.00 30.14 ? 569 CYS A SG  1 
ATOM   1919 N N   . LYS A 1 252 ? 2.212   9.830  72.782  1.00 31.78 ? 570 LYS A N   1 
ATOM   1920 C CA  . LYS A 1 252 ? 1.350   8.659  72.684  1.00 31.50 ? 570 LYS A CA  1 
ATOM   1921 C C   . LYS A 1 252 ? -0.084  9.149  72.586  1.00 31.43 ? 570 LYS A C   1 
ATOM   1922 O O   . LYS A 1 252 ? -0.903  8.594  71.854  1.00 31.19 ? 570 LYS A O   1 
ATOM   1923 C CB  . LYS A 1 252 ? 1.565   7.682  73.841  1.00 30.15 ? 570 LYS A CB  1 
ATOM   1924 C CG  . LYS A 1 252 ? 2.976   7.111  73.875  1.00 32.37 ? 570 LYS A CG  1 
ATOM   1925 C CD  . LYS A 1 252 ? 3.086   5.774  74.631  1.00 36.83 ? 570 LYS A CD  1 
ATOM   1926 C CE  . LYS A 1 252 ? 4.576   5.440  74.878  1.00 38.48 ? 570 LYS A CE  1 
ATOM   1927 N NZ  . LYS A 1 252 ? 4.947   3.996  75.071  1.00 32.89 ? 570 LYS A NZ  1 
ATOM   1928 N N   . GLY A 1 253 ? -0.366  10.236 73.289  1.00 30.35 ? 571 GLY A N   1 
ATOM   1929 C CA  . GLY A 1 253 ? -1.688  10.792 73.264  1.00 29.38 ? 571 GLY A CA  1 
ATOM   1930 C C   . GLY A 1 253 ? -2.039  11.119 71.843  1.00 30.15 ? 571 GLY A C   1 
ATOM   1931 O O   . GLY A 1 253 ? -3.081  10.718 71.346  1.00 31.42 ? 571 GLY A O   1 
ATOM   1932 N N   . LEU A 1 254 ? -1.149  11.834 71.171  1.00 30.85 ? 572 LEU A N   1 
ATOM   1933 C CA  . LEU A 1 254 ? -1.454  12.336 69.846  1.00 30.69 ? 572 LEU A CA  1 
ATOM   1934 C C   . LEU A 1 254 ? -1.294  11.290 68.725  1.00 31.44 ? 572 LEU A C   1 
ATOM   1935 O O   . LEU A 1 254 ? -2.063  11.266 67.768  1.00 33.04 ? 572 LEU A O   1 
ATOM   1936 C CB  . LEU A 1 254 ? -0.642  13.592 69.568  1.00 30.37 ? 572 LEU A CB  1 
ATOM   1937 C CG  . LEU A 1 254 ? -1.075  14.757 70.451  1.00 28.05 ? 572 LEU A CG  1 
ATOM   1938 C CD1 . LEU A 1 254 ? 0.087   15.718 70.721  1.00 21.98 ? 572 LEU A CD1 1 
ATOM   1939 C CD2 . LEU A 1 254 ? -2.238  15.456 69.803  1.00 27.13 ? 572 LEU A CD2 1 
ATOM   1940 N N   . MET A 1 255 ? -0.310  10.419 68.808  1.00 30.57 ? 573 MET A N   1 
ATOM   1941 C CA  . MET A 1 255 ? -0.231  9.416  67.762  1.00 29.68 ? 573 MET A CA  1 
ATOM   1942 C C   . MET A 1 255 ? -0.857  8.113  68.232  1.00 29.14 ? 573 MET A C   1 
ATOM   1943 O O   . MET A 1 255 ? -0.264  7.046  68.125  1.00 26.43 ? 573 MET A O   1 
ATOM   1944 C CB  . MET A 1 255 ? 1.199   9.223  67.283  1.00 30.54 ? 573 MET A CB  1 
ATOM   1945 C CG  . MET A 1 255 ? 1.821   10.495 66.757  1.00 29.34 ? 573 MET A CG  1 
ATOM   1946 S SD  . MET A 1 255 ? 3.546   10.208 66.379  1.00 38.56 ? 573 MET A SD  1 
ATOM   1947 C CE  . MET A 1 255 ? 4.316   10.529 67.986  1.00 32.88 ? 573 MET A CE  1 
ATOM   1948 N N   . THR A 1 256 ? -2.064  8.231  68.769  1.00 29.72 ? 574 THR A N   1 
ATOM   1949 C CA  . THR A 1 256 ? -2.879  7.086  69.099  1.00 30.98 ? 574 THR A CA  1 
ATOM   1950 C C   . THR A 1 256 ? -3.566  6.648  67.824  1.00 32.20 ? 574 THR A C   1 
ATOM   1951 O O   . THR A 1 256 ? -4.208  7.460  67.145  1.00 31.19 ? 574 THR A O   1 
ATOM   1952 C CB  . THR A 1 256 ? -3.959  7.457  70.117  1.00 31.15 ? 574 THR A CB  1 
ATOM   1953 O OG1 . THR A 1 256 ? -3.363  7.598  71.401  1.00 29.70 ? 574 THR A OG1 1 
ATOM   1954 C CG2 . THR A 1 256 ? -5.024  6.384  70.192  1.00 32.99 ? 574 THR A CG2 1 
ATOM   1955 N N   . LYS A 1 257 ? -3.444  5.358  67.515  1.00 33.47 ? 575 LYS A N   1 
ATOM   1956 C CA  . LYS A 1 257 ? -3.939  4.825  66.264  1.00 33.75 ? 575 LYS A CA  1 
ATOM   1957 C C   . LYS A 1 257 ? -5.447  4.996  66.109  1.00 35.88 ? 575 LYS A C   1 
ATOM   1958 O O   . LYS A 1 257 ? -5.929  5.419  65.058  1.00 35.42 ? 575 LYS A O   1 
ATOM   1959 C CB  . LYS A 1 257 ? -3.477  3.382  66.082  1.00 32.63 ? 575 LYS A CB  1 
ATOM   1960 C CG  . LYS A 1 257 ? -1.957  3.284  65.898  1.00 30.79 ? 575 LYS A CG  1 
ATOM   1961 C CD  . LYS A 1 257 ? -1.545  2.062  65.090  1.00 25.34 ? 575 LYS A CD  1 
ATOM   1962 C CE  . LYS A 1 257 ? -0.033  1.808  65.181  1.00 20.05 ? 575 LYS A CE  1 
ATOM   1963 N NZ  . LYS A 1 257 ? 0.778   3.035  64.933  1.00 23.58 ? 575 LYS A NZ  1 
ATOM   1964 N N   . HIS A 1 258 ? -6.199  4.696  67.157  1.00 39.92 ? 576 HIS A N   1 
ATOM   1965 C CA  . HIS A 1 258 ? -7.646  4.812  67.049  1.00 43.58 ? 576 HIS A CA  1 
ATOM   1966 C C   . HIS A 1 258 ? -8.017  6.253  67.317  1.00 44.04 ? 576 HIS A C   1 
ATOM   1967 O O   . HIS A 1 258 ? -7.677  6.784  68.362  1.00 45.70 ? 576 HIS A O   1 
ATOM   1968 C CB  . HIS A 1 258 ? -8.363  3.864  68.016  1.00 45.29 ? 576 HIS A CB  1 
ATOM   1969 C CG  . HIS A 1 258 ? -8.180  2.411  67.688  1.00 50.12 ? 576 HIS A CG  1 
ATOM   1970 N ND1 . HIS A 1 258 ? -7.206  1.630  68.278  1.00 55.10 ? 576 HIS A ND1 1 
ATOM   1971 C CD2 . HIS A 1 258 ? -8.847  1.599  66.835  1.00 52.89 ? 576 HIS A CD2 1 
ATOM   1972 C CE1 . HIS A 1 258 ? -7.285  0.398  67.804  1.00 56.97 ? 576 HIS A CE1 1 
ATOM   1973 N NE2 . HIS A 1 258 ? -8.270  0.354  66.924  1.00 57.08 ? 576 HIS A NE2 1 
ATOM   1974 N N   . PRO A 1 259 ? -8.693  6.903  66.359  1.00 44.02 ? 577 PRO A N   1 
ATOM   1975 C CA  . PRO A 1 259 ? -8.999  8.317  66.516  1.00 43.77 ? 577 PRO A CA  1 
ATOM   1976 C C   . PRO A 1 259 ? -9.963  8.560  67.664  1.00 43.48 ? 577 PRO A C   1 
ATOM   1977 O O   . PRO A 1 259 ? -9.977  9.640  68.230  1.00 44.12 ? 577 PRO A O   1 
ATOM   1978 C CB  . PRO A 1 259 ? -9.648  8.699  65.177  1.00 43.43 ? 577 PRO A CB  1 
ATOM   1979 C CG  . PRO A 1 259 ? -9.328  7.588  64.239  1.00 43.45 ? 577 PRO A CG  1 
ATOM   1980 C CD  . PRO A 1 259 ? -9.177  6.366  65.078  1.00 44.35 ? 577 PRO A CD  1 
ATOM   1981 N N   . ALA A 1 260 ? -10.755 7.555  68.002  1.00 44.68 ? 578 ALA A N   1 
ATOM   1982 C CA  . ALA A 1 260 ? -11.736 7.673  69.070  1.00 45.54 ? 578 ALA A CA  1 
ATOM   1983 C C   . ALA A 1 260 ? -11.038 8.027  70.377  1.00 46.37 ? 578 ALA A C   1 
ATOM   1984 O O   . ALA A 1 260 ? -11.526 8.845  71.171  1.00 47.33 ? 578 ALA A O   1 
ATOM   1985 C CB  . ALA A 1 260 ? -12.526 6.373  69.215  1.00 45.02 ? 578 ALA A CB  1 
ATOM   1986 N N   . LYS A 1 261 ? -9.875  7.430  70.586  1.00 45.96 ? 579 LYS A N   1 
ATOM   1987 C CA  . LYS A 1 261 ? -9.145  7.627  71.820  1.00 45.63 ? 579 LYS A CA  1 
ATOM   1988 C C   . LYS A 1 261 ? -8.094  8.736  71.704  1.00 44.82 ? 579 LYS A C   1 
ATOM   1989 O O   . LYS A 1 261 ? -7.586  9.226  72.714  1.00 45.68 ? 579 LYS A O   1 
ATOM   1990 C CB  . LYS A 1 261 ? -8.499  6.310  72.239  1.00 46.54 ? 579 LYS A CB  1 
ATOM   1991 C CG  . LYS A 1 261 ? -9.484  5.142  72.475  1.00 49.43 ? 579 LYS A CG  1 
ATOM   1992 C CD  . LYS A 1 261 ? -8.847  3.781  72.090  1.00 55.42 ? 579 LYS A CD  1 
ATOM   1993 C CE  . LYS A 1 261 ? -7.374  3.634  72.597  1.00 60.42 ? 579 LYS A CE  1 
ATOM   1994 N NZ  . LYS A 1 261 ? -6.614  2.382  72.184  1.00 54.49 ? 579 LYS A NZ  1 
ATOM   1995 N N   . ARG A 1 262 ? -7.783  9.157  70.481  1.00 43.91 ? 580 ARG A N   1 
ATOM   1996 C CA  . ARG A 1 262 ? -6.679  10.105 70.258  1.00 42.60 ? 580 ARG A CA  1 
ATOM   1997 C C   . ARG A 1 262 ? -6.802  11.385 71.091  1.00 41.97 ? 580 ARG A C   1 
ATOM   1998 O O   . ARG A 1 262 ? -7.889  11.920 71.261  1.00 42.22 ? 580 ARG A O   1 
ATOM   1999 C CB  . ARG A 1 262 ? -6.545  10.446 68.771  1.00 41.41 ? 580 ARG A CB  1 
ATOM   2000 C CG  . ARG A 1 262 ? -5.298  11.273 68.431  1.00 39.46 ? 580 ARG A CG  1 
ATOM   2001 C CD  . ARG A 1 262 ? -5.112  11.438 66.925  1.00 31.87 ? 580 ARG A CD  1 
ATOM   2002 N NE  . ARG A 1 262 ? -5.180  10.129 66.296  1.00 30.65 ? 580 ARG A NE  1 
ATOM   2003 C CZ  . ARG A 1 262 ? -5.677  9.911  65.093  1.00 30.96 ? 580 ARG A CZ  1 
ATOM   2004 N NH1 . ARG A 1 262 ? -6.139  10.939 64.379  1.00 31.42 ? 580 ARG A NH1 1 
ATOM   2005 N NH2 . ARG A 1 262 ? -5.716  8.671  64.613  1.00 26.72 ? 580 ARG A NH2 1 
ATOM   2006 N N   . LEU A 1 263 ? -5.681  11.870 71.606  1.00 41.44 ? 581 LEU A N   1 
ATOM   2007 C CA  . LEU A 1 263 ? -5.682  13.116 72.351  1.00 42.46 ? 581 LEU A CA  1 
ATOM   2008 C C   . LEU A 1 263 ? -6.199  14.258 71.498  1.00 44.09 ? 581 LEU A C   1 
ATOM   2009 O O   . LEU A 1 263 ? -5.809  14.398 70.347  1.00 44.70 ? 581 LEU A O   1 
ATOM   2010 C CB  . LEU A 1 263 ? -4.277  13.454 72.836  1.00 41.37 ? 581 LEU A CB  1 
ATOM   2011 C CG  . LEU A 1 263 ? -4.134  14.803 73.534  1.00 38.79 ? 581 LEU A CG  1 
ATOM   2012 C CD1 . LEU A 1 263 ? -5.192  14.965 74.613  1.00 38.20 ? 581 LEU A CD1 1 
ATOM   2013 C CD2 . LEU A 1 263 ? -2.753  14.913 74.132  1.00 40.14 ? 581 LEU A CD2 1 
ATOM   2014 N N   . GLY A 1 264 ? -7.068  15.085 72.068  1.00 46.17 ? 582 GLY A N   1 
ATOM   2015 C CA  . GLY A 1 264 ? -7.585  16.246 71.357  1.00 48.20 ? 582 GLY A CA  1 
ATOM   2016 C C   . GLY A 1 264 ? -8.824  15.872 70.586  1.00 50.25 ? 582 GLY A C   1 
ATOM   2017 O O   . GLY A 1 264 ? -9.517  16.730 70.049  1.00 50.94 ? 582 GLY A O   1 
ATOM   2018 N N   . CYS A 1 265 ? -9.101  14.575 70.548  1.00 52.57 ? 583 CYS A N   1 
ATOM   2019 C CA  . CYS A 1 265 ? -10.228 14.034 69.799  1.00 55.35 ? 583 CYS A CA  1 
ATOM   2020 C C   . CYS A 1 265 ? -11.310 13.497 70.747  1.00 56.93 ? 583 CYS A C   1 
ATOM   2021 O O   . CYS A 1 265 ? -12.108 12.635 70.371  1.00 56.78 ? 583 CYS A O   1 
ATOM   2022 C CB  . CYS A 1 265 ? -9.750  12.926 68.845  1.00 55.64 ? 583 CYS A CB  1 
ATOM   2023 S SG  . CYS A 1 265 ? -8.461  13.413 67.630  1.00 56.26 ? 583 CYS A SG  1 
ATOM   2024 N N   . GLY A 1 266 ? -11.320 13.999 71.982  1.00 58.28 ? 584 GLY A N   1 
ATOM   2025 C CA  . GLY A 1 266 ? -12.368 13.657 72.943  1.00 59.06 ? 584 GLY A CA  1 
ATOM   2026 C C   . GLY A 1 266 ? -13.525 14.628 72.809  1.00 59.49 ? 584 GLY A C   1 
ATOM   2027 O O   . GLY A 1 266 ? -13.511 15.482 71.912  1.00 59.00 ? 584 GLY A O   1 
ATOM   2028 N N   . PRO A 1 267 ? -14.543 14.507 73.692  1.00 59.82 ? 585 PRO A N   1 
ATOM   2029 C CA  . PRO A 1 267 ? -15.637 15.492 73.683  1.00 58.83 ? 585 PRO A CA  1 
ATOM   2030 C C   . PRO A 1 267 ? -15.092 16.886 74.034  1.00 57.75 ? 585 PRO A C   1 
ATOM   2031 O O   . PRO A 1 267 ? -15.423 17.870 73.371  1.00 56.48 ? 585 PRO A O   1 
ATOM   2032 C CB  . PRO A 1 267 ? -16.596 14.978 74.775  1.00 58.42 ? 585 PRO A CB  1 
ATOM   2033 C CG  . PRO A 1 267 ? -16.185 13.548 75.048  1.00 57.75 ? 585 PRO A CG  1 
ATOM   2034 C CD  . PRO A 1 267 ? -14.712 13.492 74.752  1.00 59.93 ? 585 PRO A CD  1 
ATOM   2035 N N   . GLU A 1 268 ? -14.243 16.949 75.056  1.00 56.63 ? 586 GLU A N   1 
ATOM   2036 C CA  . GLU A 1 268 ? -13.604 18.195 75.446  1.00 56.51 ? 586 GLU A CA  1 
ATOM   2037 C C   . GLU A 1 268 ? -12.187 18.275 74.872  1.00 55.60 ? 586 GLU A C   1 
ATOM   2038 O O   . GLU A 1 268 ? -11.272 18.783 75.526  1.00 55.29 ? 586 GLU A O   1 
ATOM   2039 C CB  . GLU A 1 268 ? -13.532 18.305 76.975  1.00 57.54 ? 586 GLU A CB  1 
ATOM   2040 C CG  . GLU A 1 268 ? -14.869 18.234 77.707  1.00 56.90 ? 586 GLU A CG  1 
ATOM   2041 C CD  . GLU A 1 268 ? -15.577 19.573 77.784  1.00 56.46 ? 586 GLU A CD  1 
ATOM   2042 O OE1 . GLU A 1 268 ? -14.919 20.592 78.089  1.00 54.36 ? 586 GLU A OE1 1 
ATOM   2043 O OE2 . GLU A 1 268 ? -16.803 19.600 77.550  1.00 58.19 ? 586 GLU A OE2 1 
ATOM   2044 N N   . GLY A 1 269 ? -12.025 17.785 73.646  1.00 54.29 ? 587 GLY A N   1 
ATOM   2045 C CA  . GLY A 1 269 ? -10.717 17.621 73.004  1.00 53.00 ? 587 GLY A CA  1 
ATOM   2046 C C   . GLY A 1 269 ? -9.669  18.708 73.203  1.00 52.08 ? 587 GLY A C   1 
ATOM   2047 O O   . GLY A 1 269 ? -8.553  18.435 73.646  1.00 52.72 ? 587 GLY A O   1 
ATOM   2048 N N   . GLU A 1 270 ? -10.020 19.938 72.860  1.00 50.03 ? 588 GLU A N   1 
ATOM   2049 C CA  . GLU A 1 270 ? -9.108  21.070 72.976  1.00 47.63 ? 588 GLU A CA  1 
ATOM   2050 C C   . GLU A 1 270 ? -8.583  21.259 74.386  1.00 45.37 ? 588 GLU A C   1 
ATOM   2051 O O   . GLU A 1 270 ? -7.376  21.235 74.634  1.00 44.70 ? 588 GLU A O   1 
ATOM   2052 C CB  . GLU A 1 270 ? -9.850  22.332 72.558  1.00 49.05 ? 588 GLU A CB  1 
ATOM   2053 C CG  . GLU A 1 270 ? -9.334  23.622 73.149  1.00 48.75 ? 588 GLU A CG  1 
ATOM   2054 C CD  . GLU A 1 270 ? -10.050 24.790 72.543  1.00 51.48 ? 588 GLU A CD  1 
ATOM   2055 O OE1 . GLU A 1 270 ? -11.201 24.592 72.094  1.00 53.44 ? 588 GLU A OE1 1 
ATOM   2056 O OE2 . GLU A 1 270 ? -9.467  25.892 72.496  1.00 55.83 ? 588 GLU A OE2 1 
ATOM   2057 N N   . ARG A 1 271 ? -9.508  21.486 75.302  1.00 43.33 ? 589 ARG A N   1 
ATOM   2058 C CA  . ARG A 1 271 ? -9.178  21.586 76.702  1.00 41.87 ? 589 ARG A CA  1 
ATOM   2059 C C   . ARG A 1 271 ? -8.245  20.440 77.119  1.00 40.50 ? 589 ARG A C   1 
ATOM   2060 O O   . ARG A 1 271 ? -7.281  20.678 77.839  1.00 38.78 ? 589 ARG A O   1 
ATOM   2061 C CB  . ARG A 1 271 ? -10.471 21.631 77.515  1.00 42.47 ? 589 ARG A CB  1 
ATOM   2062 C CG  . ARG A 1 271 ? -10.524 20.752 78.740  1.00 41.64 ? 589 ARG A CG  1 
ATOM   2063 C CD  . ARG A 1 271 ? -11.933 20.695 79.266  1.00 37.68 ? 589 ARG A CD  1 
ATOM   2064 N NE  . ARG A 1 271 ? -11.936 20.976 80.690  1.00 37.82 ? 589 ARG A NE  1 
ATOM   2065 C CZ  . ARG A 1 271 ? -13.004 20.936 81.473  1.00 35.46 ? 589 ARG A CZ  1 
ATOM   2066 N NH1 . ARG A 1 271 ? -14.189 20.609 80.980  1.00 34.04 ? 589 ARG A NH1 1 
ATOM   2067 N NH2 . ARG A 1 271 ? -12.873 21.213 82.761  1.00 37.43 ? 589 ARG A NH2 1 
ATOM   2068 N N   . ASP A 1 272 ? -8.511  19.224 76.630  1.00 39.61 ? 590 ASP A N   1 
ATOM   2069 C CA  . ASP A 1 272 ? -7.637  18.049 76.853  1.00 40.59 ? 590 ASP A CA  1 
ATOM   2070 C C   . ASP A 1 272 ? -6.159  18.229 76.442  1.00 40.23 ? 590 ASP A C   1 
ATOM   2071 O O   . ASP A 1 272 ? -5.246  17.685 77.069  1.00 39.66 ? 590 ASP A O   1 
ATOM   2072 C CB  . ASP A 1 272 ? -8.190  16.815 76.139  1.00 40.57 ? 590 ASP A CB  1 
ATOM   2073 C CG  . ASP A 1 272 ? -9.415  16.251 76.817  1.00 45.27 ? 590 ASP A CG  1 
ATOM   2074 O OD1 . ASP A 1 272 ? -9.440  16.224 78.061  1.00 48.75 ? 590 ASP A OD1 1 
ATOM   2075 O OD2 . ASP A 1 272 ? -10.359 15.828 76.109  1.00 53.32 ? 590 ASP A OD2 1 
ATOM   2076 N N   . VAL A 1 273 ? -5.926  18.976 75.374  1.00 39.67 ? 591 VAL A N   1 
ATOM   2077 C CA  . VAL A 1 273 ? -4.577  19.222 74.949  1.00 38.22 ? 591 VAL A CA  1 
ATOM   2078 C C   . VAL A 1 273 ? -3.997  20.303 75.834  1.00 39.09 ? 591 VAL A C   1 
ATOM   2079 O O   . VAL A 1 273 ? -2.927  20.108 76.412  1.00 39.51 ? 591 VAL A O   1 
ATOM   2080 C CB  . VAL A 1 273 ? -4.506  19.672 73.478  1.00 38.82 ? 591 VAL A CB  1 
ATOM   2081 C CG1 . VAL A 1 273 ? -3.068  20.085 73.128  1.00 37.64 ? 591 VAL A CG1 1 
ATOM   2082 C CG2 . VAL A 1 273 ? -5.020  18.581 72.542  1.00 32.50 ? 591 VAL A CG2 1 
ATOM   2083 N N   . ARG A 1 274 ? -4.708  21.432 75.948  1.00 39.04 ? 592 ARG A N   1 
ATOM   2084 C CA  . ARG A 1 274 ? -4.247  22.563 76.774  1.00 38.96 ? 592 ARG A CA  1 
ATOM   2085 C C   . ARG A 1 274 ? -3.810  22.080 78.146  1.00 38.18 ? 592 ARG A C   1 
ATOM   2086 O O   . ARG A 1 274 ? -2.945  22.674 78.788  1.00 39.21 ? 592 ARG A O   1 
ATOM   2087 C CB  . ARG A 1 274 ? -5.343  23.620 76.985  1.00 38.65 ? 592 ARG A CB  1 
ATOM   2088 C CG  . ARG A 1 274 ? -6.159  23.976 75.778  1.00 39.81 ? 592 ARG A CG  1 
ATOM   2089 C CD  . ARG A 1 274 ? -7.105  25.100 76.119  1.00 38.99 ? 592 ARG A CD  1 
ATOM   2090 N NE  . ARG A 1 274 ? -6.435  26.395 76.011  1.00 41.66 ? 592 ARG A NE  1 
ATOM   2091 C CZ  . ARG A 1 274 ? -6.680  27.306 75.064  1.00 37.88 ? 592 ARG A CZ  1 
ATOM   2092 N NH1 . ARG A 1 274 ? -7.604  27.093 74.128  1.00 24.81 ? 592 ARG A NH1 1 
ATOM   2093 N NH2 . ARG A 1 274 ? -6.002  28.449 75.063  1.00 36.74 ? 592 ARG A NH2 1 
ATOM   2094 N N   . GLU A 1 275 ? -4.411  20.996 78.600  1.00 37.59 ? 593 GLU A N   1 
ATOM   2095 C CA  . GLU A 1 275 ? -4.255  20.627 79.981  1.00 37.56 ? 593 GLU A CA  1 
ATOM   2096 C C   . GLU A 1 275 ? -3.244  19.543 80.221  1.00 36.83 ? 593 GLU A C   1 
ATOM   2097 O O   . GLU A 1 275 ? -2.952  19.234 81.359  1.00 38.18 ? 593 GLU A O   1 
ATOM   2098 C CB  . GLU A 1 275 ? -5.610  20.276 80.586  1.00 38.38 ? 593 GLU A CB  1 
ATOM   2099 C CG  . GLU A 1 275 ? -6.630  21.407 80.396  1.00 41.36 ? 593 GLU A CG  1 
ATOM   2100 C CD  . GLU A 1 275 ? -7.741  21.399 81.423  1.00 40.34 ? 593 GLU A CD  1 
ATOM   2101 O OE1 . GLU A 1 275 ? -7.472  21.740 82.593  1.00 41.91 ? 593 GLU A OE1 1 
ATOM   2102 O OE2 . GLU A 1 275 ? -8.882  21.071 81.053  1.00 37.66 ? 593 GLU A OE2 1 
ATOM   2103 N N   . HIS A 1 276 ? -2.694  18.971 79.161  1.00 36.56 ? 594 HIS A N   1 
ATOM   2104 C CA  . HIS A 1 276 ? -1.730  17.886 79.316  1.00 36.45 ? 594 HIS A CA  1 
ATOM   2105 C C   . HIS A 1 276 ? -0.508  18.334 80.108  1.00 37.35 ? 594 HIS A C   1 
ATOM   2106 O O   . HIS A 1 276 ? -0.013  19.455 79.932  1.00 38.08 ? 594 HIS A O   1 
ATOM   2107 C CB  . HIS A 1 276 ? -1.293  17.367 77.955  1.00 36.29 ? 594 HIS A CB  1 
ATOM   2108 C CG  . HIS A 1 276 ? -0.559  16.063 78.009  1.00 34.85 ? 594 HIS A CG  1 
ATOM   2109 N ND1 . HIS A 1 276 ? 0.808   15.984 78.154  1.00 33.60 ? 594 HIS A ND1 1 
ATOM   2110 C CD2 . HIS A 1 276 ? -1.004  14.786 77.918  1.00 33.74 ? 594 HIS A CD2 1 
ATOM   2111 C CE1 . HIS A 1 276 ? 1.175   14.716 78.158  1.00 34.32 ? 594 HIS A CE1 1 
ATOM   2112 N NE2 . HIS A 1 276 ? 0.093   13.968 78.020  1.00 34.94 ? 594 HIS A NE2 1 
ATOM   2113 N N   . ALA A 1 277 ? -0.025  17.453 80.982  1.00 37.28 ? 595 ALA A N   1 
ATOM   2114 C CA  . ALA A 1 277 ? 1.125   17.762 81.820  1.00 36.02 ? 595 ALA A CA  1 
ATOM   2115 C C   . ALA A 1 277 ? 2.165   18.455 80.961  1.00 35.68 ? 595 ALA A C   1 
ATOM   2116 O O   . ALA A 1 277 ? 2.930   19.281 81.432  1.00 35.19 ? 595 ALA A O   1 
ATOM   2117 C CB  . ALA A 1 277 ? 1.691   16.498 82.435  1.00 35.38 ? 595 ALA A CB  1 
ATOM   2118 N N   . PHE A 1 278 ? 2.157   18.138 79.677  1.00 35.28 ? 596 PHE A N   1 
ATOM   2119 C CA  . PHE A 1 278 ? 3.138   18.686 78.763  1.00 35.82 ? 596 PHE A CA  1 
ATOM   2120 C C   . PHE A 1 278 ? 3.136   20.221 78.717  1.00 36.37 ? 596 PHE A C   1 
ATOM   2121 O O   . PHE A 1 278 ? 4.167   20.861 78.457  1.00 34.59 ? 596 PHE A O   1 
ATOM   2122 C CB  . PHE A 1 278 ? 2.899   18.118 77.378  1.00 35.49 ? 596 PHE A CB  1 
ATOM   2123 C CG  . PHE A 1 278 ? 4.014   18.374 76.429  1.00 34.10 ? 596 PHE A CG  1 
ATOM   2124 C CD1 . PHE A 1 278 ? 5.209   17.681 76.549  1.00 33.77 ? 596 PHE A CD1 1 
ATOM   2125 C CD2 . PHE A 1 278 ? 3.870   19.308 75.415  1.00 30.21 ? 596 PHE A CD2 1 
ATOM   2126 C CE1 . PHE A 1 278 ? 6.243   17.923 75.674  1.00 31.22 ? 596 PHE A CE1 1 
ATOM   2127 C CE2 . PHE A 1 278 ? 4.883   19.544 74.542  1.00 28.91 ? 596 PHE A CE2 1 
ATOM   2128 C CZ  . PHE A 1 278 ? 6.078   18.854 74.670  1.00 30.12 ? 596 PHE A CZ  1 
ATOM   2129 N N   . PHE A 1 279 ? 1.969   20.798 78.975  1.00 37.67 ? 597 PHE A N   1 
ATOM   2130 C CA  . PHE A 1 279 ? 1.813   22.242 79.000  1.00 39.30 ? 597 PHE A CA  1 
ATOM   2131 C C   . PHE A 1 279 ? 1.614   22.774 80.433  1.00 40.26 ? 597 PHE A C   1 
ATOM   2132 O O   . PHE A 1 279 ? 0.874   23.741 80.642  1.00 41.11 ? 597 PHE A O   1 
ATOM   2133 C CB  . PHE A 1 279 ? 0.625   22.656 78.127  1.00 38.86 ? 597 PHE A CB  1 
ATOM   2134 C CG  . PHE A 1 279 ? 0.826   22.413 76.650  1.00 41.03 ? 597 PHE A CG  1 
ATOM   2135 C CD1 . PHE A 1 279 ? 1.714   23.195 75.913  1.00 39.17 ? 597 PHE A CD1 1 
ATOM   2136 C CD2 . PHE A 1 279 ? 0.101   21.423 75.984  1.00 42.44 ? 597 PHE A CD2 1 
ATOM   2137 C CE1 . PHE A 1 279 ? 1.893   22.979 74.566  1.00 34.49 ? 597 PHE A CE1 1 
ATOM   2138 C CE2 . PHE A 1 279 ? 0.281   21.203 74.611  1.00 36.54 ? 597 PHE A CE2 1 
ATOM   2139 C CZ  . PHE A 1 279 ? 1.170   21.985 73.911  1.00 34.63 ? 597 PHE A CZ  1 
ATOM   2140 N N   . ARG A 1 280 ? 2.251   22.142 81.415  1.00 40.24 ? 598 ARG A N   1 
ATOM   2141 C CA  . ARG A 1 280 ? 2.237   22.667 82.779  1.00 41.41 ? 598 ARG A CA  1 
ATOM   2142 C C   . ARG A 1 280 ? 2.592   24.151 82.799  1.00 42.03 ? 598 ARG A C   1 
ATOM   2143 O O   . ARG A 1 280 ? 1.739   25.012 83.040  1.00 43.36 ? 598 ARG A O   1 
ATOM   2144 C CB  . ARG A 1 280 ? 3.259   21.951 83.658  1.00 41.10 ? 598 ARG A CB  1 
ATOM   2145 C CG  . ARG A 1 280 ? 2.940   20.514 83.981  1.00 42.52 ? 598 ARG A CG  1 
ATOM   2146 C CD  . ARG A 1 280 ? 4.163   19.822 84.624  1.00 44.96 ? 598 ARG A CD  1 
ATOM   2147 N NE  . ARG A 1 280 ? 5.446   20.197 84.020  1.00 43.67 ? 598 ARG A NE  1 
ATOM   2148 C CZ  . ARG A 1 280 ? 6.007   19.573 82.989  1.00 46.91 ? 598 ARG A CZ  1 
ATOM   2149 N NH1 . ARG A 1 280 ? 5.409   18.543 82.420  1.00 50.60 ? 598 ARG A NH1 1 
ATOM   2150 N NH2 . ARG A 1 280 ? 7.170   19.978 82.517  1.00 49.50 ? 598 ARG A NH2 1 
ATOM   2151 N N   . ARG A 1 281 ? 3.864   24.437 82.534  1.00 41.69 ? 599 ARG A N   1 
ATOM   2152 C CA  . ARG A 1 281 ? 4.430   25.763 82.756  1.00 41.81 ? 599 ARG A CA  1 
ATOM   2153 C C   . ARG A 1 281 ? 3.817   26.867 81.877  1.00 41.85 ? 599 ARG A C   1 
ATOM   2154 O O   . ARG A 1 281 ? 4.109   28.048 82.044  1.00 42.32 ? 599 ARG A O   1 
ATOM   2155 C CB  . ARG A 1 281 ? 5.961   25.694 82.649  1.00 41.08 ? 599 ARG A CB  1 
ATOM   2156 C CG  . ARG A 1 281 ? 6.550   24.472 83.395  1.00 45.44 ? 599 ARG A CG  1 
ATOM   2157 C CD  . ARG A 1 281 ? 8.066   24.526 83.672  1.00 50.16 ? 599 ARG A CD  1 
ATOM   2158 N NE  . ARG A 1 281 ? 8.456   25.635 84.556  1.00 61.01 ? 599 ARG A NE  1 
ATOM   2159 C CZ  . ARG A 1 281 ? 7.991   25.836 85.796  1.00 64.24 ? 599 ARG A CZ  1 
ATOM   2160 N NH1 . ARG A 1 281 ? 7.091   25.012 86.322  1.00 67.40 ? 599 ARG A NH1 1 
ATOM   2161 N NH2 . ARG A 1 281 ? 8.413   26.875 86.516  1.00 60.93 ? 599 ARG A NH2 1 
ATOM   2162 N N   . ILE A 1 282 ? 2.926   26.481 80.977  1.00 42.35 ? 600 ILE A N   1 
ATOM   2163 C CA  . ILE A 1 282 ? 2.380   27.398 79.984  1.00 43.00 ? 600 ILE A CA  1 
ATOM   2164 C C   . ILE A 1 282 ? 1.172   28.195 80.480  1.00 44.02 ? 600 ILE A C   1 
ATOM   2165 O O   . ILE A 1 282 ? 0.235   27.632 81.057  1.00 44.15 ? 600 ILE A O   1 
ATOM   2166 C CB  . ILE A 1 282 ? 1.993   26.639 78.687  1.00 43.38 ? 600 ILE A CB  1 
ATOM   2167 C CG1 . ILE A 1 282 ? 3.240   26.321 77.863  1.00 39.57 ? 600 ILE A CG1 1 
ATOM   2168 C CG2 . ILE A 1 282 ? 0.973   27.437 77.851  1.00 44.85 ? 600 ILE A CG2 1 
ATOM   2169 C CD1 . ILE A 1 282 ? 4.026   27.522 77.518  1.00 31.90 ? 600 ILE A CD1 1 
ATOM   2170 N N   . ASP A 1 283 ? 1.210   29.506 80.238  1.00 44.08 ? 601 ASP A N   1 
ATOM   2171 C CA  . ASP A 1 283 ? 0.097   30.393 80.525  1.00 43.47 ? 601 ASP A CA  1 
ATOM   2172 C C   . ASP A 1 283 ? -0.695  30.635 79.246  1.00 42.75 ? 601 ASP A C   1 
ATOM   2173 O O   . ASP A 1 283 ? -0.323  31.448 78.409  1.00 40.83 ? 601 ASP A O   1 
ATOM   2174 C CB  . ASP A 1 283 ? 0.613   31.714 81.078  1.00 44.13 ? 601 ASP A CB  1 
ATOM   2175 C CG  . ASP A 1 283 ? -0.471  32.529 81.769  1.00 46.76 ? 601 ASP A CG  1 
ATOM   2176 O OD1 . ASP A 1 283 ? -1.590  32.011 81.990  1.00 44.70 ? 601 ASP A OD1 1 
ATOM   2177 O OD2 . ASP A 1 283 ? -0.184  33.695 82.112  1.00 51.66 ? 601 ASP A OD2 1 
ATOM   2178 N N   . TRP A 1 284 ? -1.799  29.922 79.102  1.00 43.88 ? 602 TRP A N   1 
ATOM   2179 C CA  . TRP A 1 284 ? -2.538  29.982 77.858  1.00 45.60 ? 602 TRP A CA  1 
ATOM   2180 C C   . TRP A 1 284 ? -2.966  31.388 77.512  1.00 46.92 ? 602 TRP A C   1 
ATOM   2181 O O   . TRP A 1 284 ? -2.856  31.794 76.361  1.00 46.31 ? 602 TRP A O   1 
ATOM   2182 C CB  . TRP A 1 284 ? -3.709  28.985 77.835  1.00 45.30 ? 602 TRP A CB  1 
ATOM   2183 C CG  . TRP A 1 284 ? -3.169  27.613 77.743  1.00 43.11 ? 602 TRP A CG  1 
ATOM   2184 C CD1 . TRP A 1 284 ? -2.952  26.749 78.772  1.00 40.64 ? 602 TRP A CD1 1 
ATOM   2185 C CD2 . TRP A 1 284 ? -2.678  26.974 76.568  1.00 42.83 ? 602 TRP A CD2 1 
ATOM   2186 N NE1 . TRP A 1 284 ? -2.384  25.594 78.307  1.00 38.28 ? 602 TRP A NE1 1 
ATOM   2187 C CE2 . TRP A 1 284 ? -2.202  25.704 76.954  1.00 43.34 ? 602 TRP A CE2 1 
ATOM   2188 C CE3 . TRP A 1 284 ? -2.603  27.345 75.218  1.00 42.67 ? 602 TRP A CE3 1 
ATOM   2189 C CZ2 . TRP A 1 284 ? -1.661  24.790 76.032  1.00 42.89 ? 602 TRP A CZ2 1 
ATOM   2190 C CZ3 . TRP A 1 284 ? -2.062  26.441 74.303  1.00 41.22 ? 602 TRP A CZ3 1 
ATOM   2191 C CH2 . TRP A 1 284 ? -1.598  25.180 74.717  1.00 42.02 ? 602 TRP A CH2 1 
ATOM   2192 N N   . GLU A 1 285 ? -3.434  32.151 78.491  1.00 48.72 ? 603 GLU A N   1 
ATOM   2193 C CA  . GLU A 1 285 ? -3.889  33.481 78.136  1.00 50.55 ? 603 GLU A CA  1 
ATOM   2194 C C   . GLU A 1 285 ? -2.711  34.333 77.663  1.00 50.45 ? 603 GLU A C   1 
ATOM   2195 O O   . GLU A 1 285 ? -2.796  35.014 76.639  1.00 49.40 ? 603 GLU A O   1 
ATOM   2196 C CB  . GLU A 1 285 ? -4.693  34.147 79.251  1.00 51.36 ? 603 GLU A CB  1 
ATOM   2197 C CG  . GLU A 1 285 ? -5.999  34.752 78.719  1.00 55.87 ? 603 GLU A CG  1 
ATOM   2198 C CD  . GLU A 1 285 ? -6.780  35.538 79.760  1.00 60.95 ? 603 GLU A CD  1 
ATOM   2199 O OE1 . GLU A 1 285 ? -6.168  36.211 80.624  1.00 60.85 ? 603 GLU A OE1 1 
ATOM   2200 O OE2 . GLU A 1 285 ? -8.022  35.488 79.702  1.00 62.86 ? 603 GLU A OE2 1 
ATOM   2201 N N   . LYS A 1 286 ? -1.597  34.259 78.381  1.00 51.12 ? 604 LYS A N   1 
ATOM   2202 C CA  . LYS A 1 286 ? -0.413  35.018 77.995  1.00 51.83 ? 604 LYS A CA  1 
ATOM   2203 C C   . LYS A 1 286 ? 0.174   34.502 76.676  1.00 52.87 ? 604 LYS A C   1 
ATOM   2204 O O   . LYS A 1 286 ? 0.533   35.282 75.785  1.00 53.27 ? 604 LYS A O   1 
ATOM   2205 C CB  . LYS A 1 286 ? 0.628   34.991 79.111  1.00 51.35 ? 604 LYS A CB  1 
ATOM   2206 C CG  . LYS A 1 286 ? 1.690   36.042 78.949  1.00 51.18 ? 604 LYS A CG  1 
ATOM   2207 C CD  . LYS A 1 286 ? 1.935   36.832 80.228  1.00 52.38 ? 604 LYS A CD  1 
ATOM   2208 C CE  . LYS A 1 286 ? 3.176   37.689 80.049  1.00 53.43 ? 604 LYS A CE  1 
ATOM   2209 N NZ  . LYS A 1 286 ? 3.038   39.049 80.611  1.00 54.61 ? 604 LYS A NZ  1 
ATOM   2210 N N   . LEU A 1 287 ? 0.259   33.183 76.549  1.00 53.01 ? 605 LEU A N   1 
ATOM   2211 C CA  . LEU A 1 287 ? 0.707   32.593 75.306  1.00 53.16 ? 605 LEU A CA  1 
ATOM   2212 C C   . LEU A 1 287 ? -0.070  33.145 74.131  1.00 52.69 ? 605 LEU A C   1 
ATOM   2213 O O   . LEU A 1 287 ? 0.485   33.825 73.283  1.00 52.84 ? 605 LEU A O   1 
ATOM   2214 C CB  . LEU A 1 287 ? 0.536   31.081 75.334  1.00 53.06 ? 605 LEU A CB  1 
ATOM   2215 C CG  . LEU A 1 287 ? 1.098   30.426 74.075  1.00 54.51 ? 605 LEU A CG  1 
ATOM   2216 C CD1 . LEU A 1 287 ? 2.617   30.586 73.992  1.00 52.73 ? 605 LEU A CD1 1 
ATOM   2217 C CD2 . LEU A 1 287 ? 0.707   28.973 74.033  1.00 57.41 ? 605 LEU A CD2 1 
ATOM   2218 N N   . GLU A 1 288 ? -1.367  32.858 74.105  1.00 53.41 ? 606 GLU A N   1 
ATOM   2219 C CA  . GLU A 1 288 ? -2.210  33.142 72.944  1.00 54.09 ? 606 GLU A CA  1 
ATOM   2220 C C   . GLU A 1 288 ? -2.399  34.624 72.644  1.00 55.32 ? 606 GLU A C   1 
ATOM   2221 O O   . GLU A 1 288 ? -3.132  34.981 71.729  1.00 55.71 ? 606 GLU A O   1 
ATOM   2222 C CB  . GLU A 1 288 ? -3.562  32.402 73.031  1.00 53.23 ? 606 GLU A CB  1 
ATOM   2223 C CG  . GLU A 1 288 ? -4.612  32.998 73.954  1.00 53.13 ? 606 GLU A CG  1 
ATOM   2224 C CD  . GLU A 1 288 ? -5.764  32.030 74.270  1.00 51.52 ? 606 GLU A CD  1 
ATOM   2225 O OE1 . GLU A 1 288 ? -5.791  30.907 73.721  1.00 43.33 ? 606 GLU A OE1 1 
ATOM   2226 O OE2 . GLU A 1 288 ? -6.644  32.401 75.084  1.00 53.02 ? 606 GLU A OE2 1 
ATOM   2227 N N   . ASN A 1 289 ? -1.719  35.482 73.397  1.00 56.94 ? 607 ASN A N   1 
ATOM   2228 C CA  . ASN A 1 289 ? -1.760  36.916 73.138  1.00 58.31 ? 607 ASN A CA  1 
ATOM   2229 C C   . ASN A 1 289 ? -0.400  37.428 72.670  1.00 58.52 ? 607 ASN A C   1 
ATOM   2230 O O   . ASN A 1 289 ? -0.216  38.628 72.456  1.00 59.19 ? 607 ASN A O   1 
ATOM   2231 C CB  . ASN A 1 289 ? -2.242  37.683 74.376  1.00 59.19 ? 607 ASN A CB  1 
ATOM   2232 C CG  . ASN A 1 289 ? -3.666  37.307 74.787  1.00 62.66 ? 607 ASN A CG  1 
ATOM   2233 O OD1 . ASN A 1 289 ? -4.050  37.453 75.950  1.00 63.54 ? 607 ASN A OD1 1 
ATOM   2234 N ND2 . ASN A 1 289 ? -4.451  36.816 73.832  1.00 65.70 ? 607 ASN A ND2 1 
ATOM   2235 N N   . ARG A 1 290 ? 0.539   36.501 72.498  1.00 58.21 ? 608 ARG A N   1 
ATOM   2236 C CA  . ARG A 1 290 ? 1.889   36.821 72.035  1.00 58.60 ? 608 ARG A CA  1 
ATOM   2237 C C   . ARG A 1 290 ? 2.649   37.625 73.069  1.00 58.33 ? 608 ARG A C   1 
ATOM   2238 O O   . ARG A 1 290 ? 3.318   38.605 72.733  1.00 58.29 ? 608 ARG A O   1 
ATOM   2239 C CB  . ARG A 1 290 ? 1.851   37.600 70.721  1.00 58.92 ? 608 ARG A CB  1 
ATOM   2240 C CG  . ARG A 1 290 ? 1.359   36.798 69.536  1.00 60.37 ? 608 ARG A CG  1 
ATOM   2241 C CD  . ARG A 1 290 ? 1.497   37.600 68.267  1.00 59.51 ? 608 ARG A CD  1 
ATOM   2242 N NE  . ARG A 1 290 ? 2.892   37.818 67.940  1.00 62.46 ? 608 ARG A NE  1 
ATOM   2243 C CZ  . ARG A 1 290 ? 3.302   38.393 66.820  1.00 65.53 ? 608 ARG A CZ  1 
ATOM   2244 N NH1 . ARG A 1 290 ? 2.394   38.802 65.935  1.00 61.77 ? 608 ARG A NH1 1 
ATOM   2245 N NH2 . ARG A 1 290 ? 4.611   38.553 66.594  1.00 65.21 ? 608 ARG A NH2 1 
ATOM   2246 N N   . GLU A 1 291 ? 2.540   37.209 74.325  1.00 57.48 ? 609 GLU A N   1 
ATOM   2247 C CA  . GLU A 1 291 ? 3.115   37.970 75.415  1.00 57.11 ? 609 GLU A CA  1 
ATOM   2248 C C   . GLU A 1 291 ? 4.202   37.192 76.135  1.00 57.32 ? 609 GLU A C   1 
ATOM   2249 O O   . GLU A 1 291 ? 4.748   37.659 77.144  1.00 57.72 ? 609 GLU A O   1 
ATOM   2250 C CB  . GLU A 1 291 ? 2.024   38.391 76.389  1.00 57.12 ? 609 GLU A CB  1 
ATOM   2251 C CG  . GLU A 1 291 ? 0.742   38.767 75.696  1.00 57.92 ? 609 GLU A CG  1 
ATOM   2252 C CD  . GLU A 1 291 ? 0.014   39.887 76.389  1.00 58.23 ? 609 GLU A CD  1 
ATOM   2253 O OE1 . GLU A 1 291 ? -0.996  39.598 77.070  1.00 56.58 ? 609 GLU A OE1 1 
ATOM   2254 O OE2 . GLU A 1 291 ? 0.461   41.049 76.258  1.00 55.58 ? 609 GLU A OE2 1 
ATOM   2255 N N   . ILE A 1 292 ? 4.508   36.005 75.613  1.00 56.87 ? 610 ILE A N   1 
ATOM   2256 C CA  . ILE A 1 292 ? 5.623   35.193 76.108  1.00 56.60 ? 610 ILE A CA  1 
ATOM   2257 C C   . ILE A 1 292 ? 6.845   35.466 75.228  1.00 56.26 ? 610 ILE A C   1 
ATOM   2258 O O   . ILE A 1 292 ? 6.699   35.663 74.025  1.00 56.57 ? 610 ILE A O   1 
ATOM   2259 C CB  . ILE A 1 292 ? 5.267   33.679 76.122  1.00 56.30 ? 610 ILE A CB  1 
ATOM   2260 C CG1 . ILE A 1 292 ? 3.997   33.448 76.950  1.00 56.05 ? 610 ILE A CG1 1 
ATOM   2261 C CG2 . ILE A 1 292 ? 6.433   32.840 76.635  1.00 56.10 ? 610 ILE A CG2 1 
ATOM   2262 C CD1 . ILE A 1 292 ? 3.886   32.082 77.595  1.00 56.89 ? 610 ILE A CD1 1 
ATOM   2263 N N   . GLN A 1 293 ? 8.037   35.519 75.821  1.00 55.35 ? 611 GLN A N   1 
ATOM   2264 C CA  . GLN A 1 293 ? 9.243   35.728 75.029  1.00 54.38 ? 611 GLN A CA  1 
ATOM   2265 C C   . GLN A 1 293 ? 9.614   34.420 74.351  1.00 53.33 ? 611 GLN A C   1 
ATOM   2266 O O   . GLN A 1 293 ? 9.916   33.442 75.037  1.00 54.00 ? 611 GLN A O   1 
ATOM   2267 C CB  . GLN A 1 293 ? 10.400  36.217 75.904  1.00 55.35 ? 611 GLN A CB  1 
ATOM   2268 C CG  . GLN A 1 293 ? 11.523  36.945 75.142  1.00 56.59 ? 611 GLN A CG  1 
ATOM   2269 C CD  . GLN A 1 293 ? 11.106  38.329 74.619  1.00 58.59 ? 611 GLN A CD  1 
ATOM   2270 O OE1 . GLN A 1 293 ? 10.016  38.835 74.926  1.00 57.11 ? 611 GLN A OE1 1 
ATOM   2271 N NE2 . GLN A 1 293 ? 11.981  38.943 73.830  1.00 55.23 ? 611 GLN A NE2 1 
ATOM   2272 N N   . PRO A 1 294 ? 9.585   34.399 73.000  1.00 51.65 ? 612 PRO A N   1 
ATOM   2273 C CA  . PRO A 1 294 ? 9.903   33.229 72.176  1.00 49.86 ? 612 PRO A CA  1 
ATOM   2274 C C   . PRO A 1 294 ? 11.294  32.711 72.489  1.00 49.32 ? 612 PRO A C   1 
ATOM   2275 O O   . PRO A 1 294 ? 12.204  33.509 72.726  1.00 49.56 ? 612 PRO A O   1 
ATOM   2276 C CB  . PRO A 1 294 ? 9.882   33.780 70.748  1.00 49.11 ? 612 PRO A CB  1 
ATOM   2277 C CG  . PRO A 1 294 ? 9.098   35.004 70.813  1.00 51.03 ? 612 PRO A CG  1 
ATOM   2278 C CD  . PRO A 1 294 ? 9.305   35.586 72.176  1.00 51.51 ? 612 PRO A CD  1 
ATOM   2279 N N   . PRO A 1 295 ? 11.469  31.382 72.473  1.00 48.31 ? 613 PRO A N   1 
ATOM   2280 C CA  . PRO A 1 295 ? 12.714  30.757 72.863  1.00 47.58 ? 613 PRO A CA  1 
ATOM   2281 C C   . PRO A 1 295 ? 13.888  31.419 72.185  1.00 47.41 ? 613 PRO A C   1 
ATOM   2282 O O   . PRO A 1 295 ? 14.981  31.400 72.735  1.00 47.69 ? 613 PRO A O   1 
ATOM   2283 C CB  . PRO A 1 295 ? 12.560  29.329 72.359  1.00 47.94 ? 613 PRO A CB  1 
ATOM   2284 C CG  . PRO A 1 295 ? 11.117  29.090 72.393  1.00 49.33 ? 613 PRO A CG  1 
ATOM   2285 C CD  . PRO A 1 295 ? 10.497  30.396 71.986  1.00 48.62 ? 613 PRO A CD  1 
ATOM   2286 N N   . PHE A 1 296 ? 13.671  31.993 71.002  1.00 47.12 ? 614 PHE A N   1 
ATOM   2287 C CA  . PHE A 1 296 ? 14.697  32.803 70.352  1.00 47.45 ? 614 PHE A CA  1 
ATOM   2288 C C   . PHE A 1 296 ? 14.197  33.653 69.179  1.00 49.09 ? 614 PHE A C   1 
ATOM   2289 O O   . PHE A 1 296 ? 13.055  33.526 68.724  1.00 48.87 ? 614 PHE A O   1 
ATOM   2290 C CB  . PHE A 1 296 ? 15.896  31.954 69.914  1.00 46.52 ? 614 PHE A CB  1 
ATOM   2291 C CG  . PHE A 1 296 ? 15.799  31.446 68.508  1.00 46.41 ? 614 PHE A CG  1 
ATOM   2292 C CD1 . PHE A 1 296 ? 16.542  32.028 67.498  1.00 46.48 ? 614 PHE A CD1 1 
ATOM   2293 C CD2 . PHE A 1 296 ? 14.966  30.384 68.194  1.00 45.53 ? 614 PHE A CD2 1 
ATOM   2294 C CE1 . PHE A 1 296 ? 16.456  31.561 66.200  1.00 47.94 ? 614 PHE A CE1 1 
ATOM   2295 C CE2 . PHE A 1 296 ? 14.878  29.914 66.905  1.00 44.24 ? 614 PHE A CE2 1 
ATOM   2296 C CZ  . PHE A 1 296 ? 15.619  30.504 65.903  1.00 45.93 ? 614 PHE A CZ  1 
ATOM   2297 N N   . LYS A 1 297 ? 15.102  34.504 68.695  1.00 50.88 ? 615 LYS A N   1 
ATOM   2298 C CA  . LYS A 1 297 ? 14.836  35.497 67.659  1.00 51.18 ? 615 LYS A CA  1 
ATOM   2299 C C   . LYS A 1 297 ? 15.690  35.142 66.449  1.00 51.83 ? 615 LYS A C   1 
ATOM   2300 O O   . LYS A 1 297 ? 16.894  34.960 66.570  1.00 50.73 ? 615 LYS A O   1 
ATOM   2301 C CB  . LYS A 1 297 ? 15.221  36.879 68.196  1.00 50.89 ? 615 LYS A CB  1 
ATOM   2302 C CG  . LYS A 1 297 ? 14.688  38.073 67.438  1.00 49.93 ? 615 LYS A CG  1 
ATOM   2303 C CD  . LYS A 1 297 ? 14.889  39.352 68.249  1.00 48.07 ? 615 LYS A CD  1 
ATOM   2304 C CE  . LYS A 1 297 ? 14.175  40.516 67.605  1.00 49.34 ? 615 LYS A CE  1 
ATOM   2305 N NZ  . LYS A 1 297 ? 14.742  40.787 66.256  1.00 49.58 ? 615 LYS A NZ  1 
ATOM   2306 N N   . PRO A 1 298 ? 15.072  35.026 65.272  1.00 53.64 ? 616 PRO A N   1 
ATOM   2307 C CA  . PRO A 1 298 ? 15.864  34.457 64.206  1.00 55.65 ? 616 PRO A CA  1 
ATOM   2308 C C   . PRO A 1 298 ? 16.646  35.503 63.423  1.00 57.92 ? 616 PRO A C   1 
ATOM   2309 O O   . PRO A 1 298 ? 16.257  36.673 63.392  1.00 57.98 ? 616 PRO A O   1 
ATOM   2310 C CB  . PRO A 1 298 ? 14.814  33.768 63.318  1.00 55.47 ? 616 PRO A CB  1 
ATOM   2311 C CG  . PRO A 1 298 ? 13.462  34.121 63.909  1.00 53.25 ? 616 PRO A CG  1 
ATOM   2312 C CD  . PRO A 1 298 ? 13.679  35.236 64.862  1.00 53.40 ? 616 PRO A CD  1 
ATOM   2313 N N   . LYS A 1 299 ? 17.738  35.050 62.804  1.00 60.62 ? 617 LYS A N   1 
ATOM   2314 C CA  . LYS A 1 299 ? 18.630  35.851 61.963  1.00 62.49 ? 617 LYS A CA  1 
ATOM   2315 C C   . LYS A 1 299 ? 17.859  36.851 61.130  1.00 63.78 ? 617 LYS A C   1 
ATOM   2316 O O   . LYS A 1 299 ? 16.793  36.522 60.607  1.00 63.35 ? 617 LYS A O   1 
ATOM   2317 C CB  . LYS A 1 299 ? 19.393  34.921 61.027  1.00 62.70 ? 617 LYS A CB  1 
ATOM   2318 C CG  . LYS A 1 299 ? 20.851  35.272 60.822  1.00 64.46 ? 617 LYS A CG  1 
ATOM   2319 C CD  . LYS A 1 299 ? 21.691  33.988 60.797  1.00 66.07 ? 617 LYS A CD  1 
ATOM   2320 C CE  . LYS A 1 299 ? 21.611  33.274 62.153  1.00 66.66 ? 617 LYS A CE  1 
ATOM   2321 N NZ  . LYS A 1 299 ? 22.035  31.843 62.119  1.00 65.28 ? 617 LYS A NZ  1 
ATOM   2322 N N   . VAL A 1 300 ? 18.417  38.056 60.988  1.00 65.95 ? 618 VAL A N   1 
ATOM   2323 C CA  . VAL A 1 300 ? 17.736  39.189 60.321  1.00 67.62 ? 618 VAL A CA  1 
ATOM   2324 C C   . VAL A 1 300 ? 17.225  38.896 58.899  1.00 68.13 ? 618 VAL A C   1 
ATOM   2325 O O   . VAL A 1 300 ? 17.972  38.437 58.036  1.00 68.79 ? 618 VAL A O   1 
ATOM   2326 C CB  . VAL A 1 300 ? 18.599  40.499 60.349  1.00 67.63 ? 618 VAL A CB  1 
ATOM   2327 C CG1 . VAL A 1 300 ? 18.550  41.238 59.004  1.00 67.22 ? 618 VAL A CG1 1 
ATOM   2328 C CG2 . VAL A 1 300 ? 18.148  41.416 61.501  1.00 67.58 ? 618 VAL A CG2 1 
ATOM   2329 N N   . PHE A 1 308 ? 23.876  43.178 40.923  1.00 58.63 ? 626 PHE A N   1 
ATOM   2330 C CA  . PHE A 1 308 ? 24.754  42.860 42.041  1.00 59.54 ? 626 PHE A CA  1 
ATOM   2331 C C   . PHE A 1 308 ? 26.036  42.224 41.520  1.00 60.31 ? 626 PHE A C   1 
ATOM   2332 O O   . PHE A 1 308 ? 27.137  42.722 41.767  1.00 61.10 ? 626 PHE A O   1 
ATOM   2333 C CB  . PHE A 1 308 ? 24.055  41.926 43.036  1.00 59.37 ? 626 PHE A CB  1 
ATOM   2334 N N   . ASP A 1 309 ? 25.881  41.120 40.795  1.00 60.59 ? 627 ASP A N   1 
ATOM   2335 C CA  . ASP A 1 309 ? 26.997  40.452 40.125  1.00 60.42 ? 627 ASP A CA  1 
ATOM   2336 C C   . ASP A 1 309 ? 27.137  40.994 38.702  1.00 60.03 ? 627 ASP A C   1 
ATOM   2337 O O   . ASP A 1 309 ? 26.147  41.206 38.006  1.00 60.47 ? 627 ASP A O   1 
ATOM   2338 C CB  . ASP A 1 309 ? 26.761  38.940 40.109  1.00 60.59 ? 627 ASP A CB  1 
ATOM   2339 C CG  . ASP A 1 309 ? 27.920  38.168 39.513  1.00 61.21 ? 627 ASP A CG  1 
ATOM   2340 O OD1 . ASP A 1 309 ? 28.648  38.710 38.651  1.00 59.60 ? 627 ASP A OD1 1 
ATOM   2341 O OD2 . ASP A 1 309 ? 28.096  37.001 39.912  1.00 62.98 ? 627 ASP A OD2 1 
ATOM   2342 N N   . LYS A 1 310 ? 28.370  41.201 38.266  1.00 59.83 ? 628 LYS A N   1 
ATOM   2343 C CA  . LYS A 1 310 ? 28.632  41.938 37.024  1.00 59.72 ? 628 LYS A CA  1 
ATOM   2344 C C   . LYS A 1 310 ? 28.612  41.083 35.750  1.00 57.96 ? 628 LYS A C   1 
ATOM   2345 O O   . LYS A 1 310 ? 28.440  41.595 34.642  1.00 57.94 ? 628 LYS A O   1 
ATOM   2346 C CB  . LYS A 1 310 ? 29.972  42.688 37.133  1.00 60.30 ? 628 LYS A CB  1 
ATOM   2347 C CG  . LYS A 1 310 ? 30.034  44.006 36.356  1.00 64.13 ? 628 LYS A CG  1 
ATOM   2348 C CD  . LYS A 1 310 ? 29.497  45.219 37.160  1.00 71.03 ? 628 LYS A CD  1 
ATOM   2349 C CE  . LYS A 1 310 ? 27.982  45.156 37.469  1.00 73.35 ? 628 LYS A CE  1 
ATOM   2350 N NZ  . LYS A 1 310 ? 27.114  44.993 36.259  1.00 74.81 ? 628 LYS A NZ  1 
ATOM   2351 N N   . PHE A 1 311 ? 28.795  39.781 35.909  1.00 56.11 ? 629 PHE A N   1 
ATOM   2352 C CA  . PHE A 1 311 ? 28.944  38.909 34.761  1.00 54.07 ? 629 PHE A CA  1 
ATOM   2353 C C   . PHE A 1 311 ? 27.766  37.952 34.685  1.00 54.33 ? 629 PHE A C   1 
ATOM   2354 O O   . PHE A 1 311 ? 27.686  37.115 33.791  1.00 54.08 ? 629 PHE A O   1 
ATOM   2355 C CB  . PHE A 1 311 ? 30.286  38.179 34.846  1.00 52.64 ? 629 PHE A CB  1 
ATOM   2356 C CG  . PHE A 1 311 ? 31.431  39.092 35.167  1.00 48.93 ? 629 PHE A CG  1 
ATOM   2357 C CD1 . PHE A 1 311 ? 31.854  39.264 36.472  1.00 45.65 ? 629 PHE A CD1 1 
ATOM   2358 C CD2 . PHE A 1 311 ? 32.057  39.823 34.169  1.00 43.90 ? 629 PHE A CD2 1 
ATOM   2359 C CE1 . PHE A 1 311 ? 32.899  40.129 36.763  1.00 42.66 ? 629 PHE A CE1 1 
ATOM   2360 C CE2 . PHE A 1 311 ? 33.096  40.684 34.466  1.00 38.82 ? 629 PHE A CE2 1 
ATOM   2361 C CZ  . PHE A 1 311 ? 33.515  40.831 35.762  1.00 37.44 ? 629 PHE A CZ  1 
ATOM   2362 N N   . PHE A 1 312 ? 26.838  38.110 35.621  1.00 54.47 ? 630 PHE A N   1 
ATOM   2363 C CA  . PHE A 1 312 ? 25.652  37.284 35.663  1.00 55.36 ? 630 PHE A CA  1 
ATOM   2364 C C   . PHE A 1 312 ? 24.506  37.982 36.428  1.00 57.89 ? 630 PHE A C   1 
ATOM   2365 O O   . PHE A 1 312 ? 24.724  38.542 37.508  1.00 58.59 ? 630 PHE A O   1 
ATOM   2366 C CB  . PHE A 1 312 ? 26.001  35.926 36.286  1.00 54.10 ? 630 PHE A CB  1 
ATOM   2367 C CG  . PHE A 1 312 ? 24.828  35.020 36.441  1.00 52.08 ? 630 PHE A CG  1 
ATOM   2368 C CD1 . PHE A 1 312 ? 24.341  34.313 35.356  1.00 51.71 ? 630 PHE A CD1 1 
ATOM   2369 C CD2 . PHE A 1 312 ? 24.195  34.887 37.672  1.00 50.73 ? 630 PHE A CD2 1 
ATOM   2370 C CE1 . PHE A 1 312 ? 23.239  33.485 35.493  1.00 52.39 ? 630 PHE A CE1 1 
ATOM   2371 C CE2 . PHE A 1 312 ? 23.093  34.063 37.820  1.00 50.51 ? 630 PHE A CE2 1 
ATOM   2372 C CZ  . PHE A 1 312 ? 22.610  33.361 36.729  1.00 51.00 ? 630 PHE A CZ  1 
ATOM   2373 N N   . THR A 1 313 ? 23.304  37.988 35.843  1.00 59.78 ? 631 THR A N   1 
ATOM   2374 C CA  . THR A 1 313 ? 22.066  38.314 36.569  1.00 61.19 ? 631 THR A CA  1 
ATOM   2375 C C   . THR A 1 313 ? 21.041  37.242 36.262  1.00 62.79 ? 631 THR A C   1 
ATOM   2376 O O   . THR A 1 313 ? 21.008  36.707 35.151  1.00 62.74 ? 631 THR A O   1 
ATOM   2377 C CB  . THR A 1 313 ? 21.443  39.682 36.191  1.00 60.57 ? 631 THR A CB  1 
ATOM   2378 O OG1 . THR A 1 313 ? 21.504  39.863 34.775  1.00 60.77 ? 631 THR A OG1 1 
ATOM   2379 C CG2 . THR A 1 313 ? 22.161  40.830 36.878  1.00 60.79 ? 631 THR A CG2 1 
ATOM   2380 N N   . ARG A 1 314 ? 20.213  36.932 37.256  1.00 64.64 ? 632 ARG A N   1 
ATOM   2381 C CA  . ARG A 1 314 ? 19.103  35.993 37.102  1.00 66.10 ? 632 ARG A CA  1 
ATOM   2382 C C   . ARG A 1 314 ? 18.031  36.516 36.135  1.00 66.93 ? 632 ARG A C   1 
ATOM   2383 O O   . ARG A 1 314 ? 17.252  35.742 35.578  1.00 67.13 ? 632 ARG A O   1 
ATOM   2384 C CB  . ARG A 1 314 ? 18.448  35.733 38.463  1.00 66.19 ? 632 ARG A CB  1 
ATOM   2385 C CG  . ARG A 1 314 ? 19.263  34.907 39.451  1.00 67.71 ? 632 ARG A CG  1 
ATOM   2386 C CD  . ARG A 1 314 ? 19.113  33.415 39.202  1.00 69.19 ? 632 ARG A CD  1 
ATOM   2387 N NE  . ARG A 1 314 ? 19.442  32.612 40.384  1.00 71.77 ? 632 ARG A NE  1 
ATOM   2388 C CZ  . ARG A 1 314 ? 19.864  31.347 40.334  1.00 72.92 ? 632 ARG A CZ  1 
ATOM   2389 N NH1 . ARG A 1 314 ? 20.030  30.747 39.158  1.00 72.24 ? 632 ARG A NH1 1 
ATOM   2390 N NH2 . ARG A 1 314 ? 20.135  30.682 41.454  1.00 69.58 ? 632 ARG A NH2 1 
ATOM   2391 N N   . GLY A 1 315 ? 17.995  37.830 35.940  1.00 67.83 ? 633 GLY A N   1 
ATOM   2392 C CA  . GLY A 1 315 ? 16.875  38.478 35.266  1.00 68.34 ? 633 GLY A CA  1 
ATOM   2393 C C   . GLY A 1 315 ? 15.983  39.125 36.309  1.00 69.37 ? 633 GLY A C   1 
ATOM   2394 O O   . GLY A 1 315 ? 16.211  38.972 37.511  1.00 70.27 ? 633 GLY A O   1 
ATOM   2395 N N   . GLN A 1 316 ? 14.972  39.859 35.856  1.00 70.44 ? 634 GLN A N   1 
ATOM   2396 C CA  . GLN A 1 316 ? 13.984  40.481 36.754  1.00 70.69 ? 634 GLN A CA  1 
ATOM   2397 C C   . GLN A 1 316 ? 12.591  39.923 36.428  1.00 69.83 ? 634 GLN A C   1 
ATOM   2398 O O   . GLN A 1 316 ? 12.047  40.200 35.358  1.00 69.82 ? 634 GLN A O   1 
ATOM   2399 C CB  . GLN A 1 316 ? 14.027  42.012 36.623  1.00 70.78 ? 634 GLN A CB  1 
ATOM   2400 C CG  . GLN A 1 316 ? 15.415  42.603 36.895  1.00 72.79 ? 634 GLN A CG  1 
ATOM   2401 C CD  . GLN A 1 316 ? 15.525  44.076 36.538  1.00 75.20 ? 634 GLN A CD  1 
ATOM   2402 O OE1 . GLN A 1 316 ? 16.626  44.627 36.462  1.00 75.63 ? 634 GLN A OE1 1 
ATOM   2403 N NE2 . GLN A 1 316 ? 14.384  44.722 36.320  1.00 75.61 ? 634 GLN A NE2 1 
ATOM   2404 N N   . PRO A 1 317 ? 12.013  39.140 37.358  1.00 68.82 ? 635 PRO A N   1 
ATOM   2405 C CA  . PRO A 1 317 ? 10.857  38.275 37.071  1.00 68.55 ? 635 PRO A CA  1 
ATOM   2406 C C   . PRO A 1 317 ? 9.652   38.978 36.405  1.00 68.58 ? 635 PRO A C   1 
ATOM   2407 O O   . PRO A 1 317 ? 8.962   39.764 37.053  1.00 68.99 ? 635 PRO A O   1 
ATOM   2408 C CB  . PRO A 1 317 ? 10.472  37.720 38.458  1.00 68.30 ? 635 PRO A CB  1 
ATOM   2409 C CG  . PRO A 1 317 ? 11.661  37.935 39.328  1.00 66.84 ? 635 PRO A CG  1 
ATOM   2410 C CD  . PRO A 1 317 ? 12.365  39.146 38.791  1.00 68.63 ? 635 PRO A CD  1 
ATOM   2411 N N   . VAL A 1 318 ? 9.400   38.695 35.126  1.00 68.20 ? 636 VAL A N   1 
ATOM   2412 C CA  . VAL A 1 318 ? 8.193   39.200 34.463  1.00 68.02 ? 636 VAL A CA  1 
ATOM   2413 C C   . VAL A 1 318 ? 7.124   38.111 34.396  1.00 68.72 ? 636 VAL A C   1 
ATOM   2414 O O   . VAL A 1 318 ? 7.399   36.936 34.670  1.00 68.52 ? 636 VAL A O   1 
ATOM   2415 C CB  . VAL A 1 318 ? 8.453   39.740 33.030  1.00 67.77 ? 636 VAL A CB  1 
ATOM   2416 C CG1 . VAL A 1 318 ? 9.508   40.837 33.043  1.00 66.10 ? 636 VAL A CG1 1 
ATOM   2417 C CG2 . VAL A 1 318 ? 8.831   38.609 32.080  1.00 67.04 ? 636 VAL A CG2 1 
ATOM   2418 N N   . LEU A 1 319 ? 5.900   38.500 34.050  1.00 68.64 ? 637 LEU A N   1 
ATOM   2419 C CA  . LEU A 1 319 ? 4.847   37.512 33.849  1.00 67.90 ? 637 LEU A CA  1 
ATOM   2420 C C   . LEU A 1 319 ? 4.698   37.165 32.379  1.00 66.89 ? 637 LEU A C   1 
ATOM   2421 O O   . LEU A 1 319 ? 4.636   38.039 31.507  1.00 66.37 ? 637 LEU A O   1 
ATOM   2422 C CB  . LEU A 1 319 ? 3.514   37.952 34.466  1.00 68.01 ? 637 LEU A CB  1 
ATOM   2423 C CG  . LEU A 1 319 ? 3.188   37.307 35.824  1.00 69.15 ? 637 LEU A CG  1 
ATOM   2424 C CD1 . LEU A 1 319 ? 4.436   37.056 36.671  1.00 67.79 ? 637 LEU A CD1 1 
ATOM   2425 C CD2 . LEU A 1 319 ? 2.150   38.114 36.613  1.00 69.12 ? 637 LEU A CD2 1 
HETATM 2426 N N   . TPO A 1 320 ? 4.688   35.869 32.117  1.00 65.63 ? 638 TPO A N   1 
HETATM 2427 C CA  . TPO A 1 320 ? 4.448   35.370 30.791  1.00 64.97 ? 638 TPO A CA  1 
HETATM 2428 C CB  . TPO A 1 320 ? 3.960   33.944 30.973  1.00 65.10 ? 638 TPO A CB  1 
HETATM 2429 C CG2 . TPO A 1 320 ? 3.752   33.234 29.641  1.00 65.60 ? 638 TPO A CG2 1 
HETATM 2430 O OG1 . TPO A 1 320 ? 4.922   33.229 31.745  1.00 67.90 ? 638 TPO A OG1 1 
HETATM 2431 P P   . TPO A 1 320 ? 4.831   33.039 33.355  1.00 70.27 ? 638 TPO A P   1 
HETATM 2432 O O1P . TPO A 1 320 ? 6.193   32.484 33.726  1.00 69.23 ? 638 TPO A O1P 1 
HETATM 2433 O O2P . TPO A 1 320 ? 3.727   32.027 33.588  1.00 67.55 ? 638 TPO A O2P 1 
HETATM 2434 O O3P . TPO A 1 320 ? 4.550   34.448 33.843  1.00 68.64 ? 638 TPO A O3P 1 
HETATM 2435 C C   . TPO A 1 320 ? 3.389   36.219 30.173  1.00 63.93 ? 638 TPO A C   1 
HETATM 2436 O O   . TPO A 1 320 ? 2.416   36.578 30.834  1.00 64.05 ? 638 TPO A O   1 
ATOM   2437 N N   . PRO A 1 321 ? 3.561   36.576 28.896  1.00 63.09 ? 639 PRO A N   1 
ATOM   2438 C CA  . PRO A 1 321 ? 2.506   37.345 28.255  1.00 62.17 ? 639 PRO A CA  1 
ATOM   2439 C C   . PRO A 1 321 ? 1.240   36.487 28.170  1.00 60.56 ? 639 PRO A C   1 
ATOM   2440 O O   . PRO A 1 321 ? 1.311   35.268 28.340  1.00 60.38 ? 639 PRO A O   1 
ATOM   2441 C CB  . PRO A 1 321 ? 3.084   37.631 26.865  1.00 62.71 ? 639 PRO A CB  1 
ATOM   2442 C CG  . PRO A 1 321 ? 4.028   36.501 26.608  1.00 62.12 ? 639 PRO A CG  1 
ATOM   2443 C CD  . PRO A 1 321 ? 4.597   36.134 27.945  1.00 63.09 ? 639 PRO A CD  1 
ATOM   2444 N N   . PRO A 1 322 ? 0.086   37.111 27.912  1.00 58.90 ? 640 PRO A N   1 
ATOM   2445 C CA  . PRO A 1 322 ? -1.156  36.345 27.958  1.00 57.85 ? 640 PRO A CA  1 
ATOM   2446 C C   . PRO A 1 322 ? -1.352  35.460 26.724  1.00 56.23 ? 640 PRO A C   1 
ATOM   2447 O O   . PRO A 1 322 ? -1.064  35.894 25.612  1.00 57.05 ? 640 PRO A O   1 
ATOM   2448 C CB  . PRO A 1 322 ? -2.225  37.441 27.987  1.00 58.62 ? 640 PRO A CB  1 
ATOM   2449 C CG  . PRO A 1 322 ? -1.605  38.583 27.226  1.00 57.98 ? 640 PRO A CG  1 
ATOM   2450 C CD  . PRO A 1 322 ? -0.124  38.513 27.499  1.00 58.55 ? 640 PRO A CD  1 
ATOM   2451 N N   . ASP A 1 323 ? -1.832  34.233 26.908  1.00 53.48 ? 641 ASP A N   1 
ATOM   2452 C CA  . ASP A 1 323 ? -2.275  33.447 25.760  1.00 50.99 ? 641 ASP A CA  1 
ATOM   2453 C C   . ASP A 1 323 ? -3.773  33.670 25.536  1.00 51.02 ? 641 ASP A C   1 
ATOM   2454 O O   . ASP A 1 323 ? -4.611  33.002 26.147  1.00 51.94 ? 641 ASP A O   1 
ATOM   2455 C CB  . ASP A 1 323 ? -1.985  31.964 25.939  1.00 50.00 ? 641 ASP A CB  1 
ATOM   2456 C CG  . ASP A 1 323 ? -2.306  31.170 24.701  1.00 49.12 ? 641 ASP A CG  1 
ATOM   2457 O OD1 . ASP A 1 323 ? -2.599  31.801 23.675  1.00 52.51 ? 641 ASP A OD1 1 
ATOM   2458 O OD2 . ASP A 1 323 ? -2.269  29.926 24.731  1.00 49.78 ? 641 ASP A OD2 1 
ATOM   2459 N N   . GLN A 1 324 ? -4.106  34.608 24.652  1.00 48.93 ? 642 GLN A N   1 
ATOM   2460 C CA  . GLN A 1 324 ? -5.486  35.044 24.475  1.00 46.18 ? 642 GLN A CA  1 
ATOM   2461 C C   . GLN A 1 324 ? -6.451  33.892 24.306  1.00 42.89 ? 642 GLN A C   1 
ATOM   2462 O O   . GLN A 1 324 ? -7.581  33.943 24.804  1.00 41.97 ? 642 GLN A O   1 
ATOM   2463 C CB  . GLN A 1 324 ? -5.593  35.988 23.287  1.00 47.06 ? 642 GLN A CB  1 
ATOM   2464 C CG  . GLN A 1 324 ? -4.911  37.330 23.531  1.00 52.80 ? 642 GLN A CG  1 
ATOM   2465 C CD  . GLN A 1 324 ? -5.756  38.288 24.356  1.00 56.28 ? 642 GLN A CD  1 
ATOM   2466 O OE1 . GLN A 1 324 ? -5.372  38.692 25.457  1.00 54.87 ? 642 GLN A OE1 1 
ATOM   2467 N NE2 . GLN A 1 324 ? -6.917  38.659 23.820  1.00 61.29 ? 642 GLN A NE2 1 
ATOM   2468 N N   . LEU A 1 325 ? -5.994  32.855 23.611  1.00 39.69 ? 643 LEU A N   1 
ATOM   2469 C CA  . LEU A 1 325 ? -6.827  31.689 23.327  1.00 36.85 ? 643 LEU A CA  1 
ATOM   2470 C C   . LEU A 1 325 ? -7.230  30.966 24.599  1.00 35.96 ? 643 LEU A C   1 
ATOM   2471 O O   . LEU A 1 325 ? -8.406  30.592 24.784  1.00 35.71 ? 643 LEU A O   1 
ATOM   2472 C CB  . LEU A 1 325 ? -6.109  30.715 22.411  1.00 35.22 ? 643 LEU A CB  1 
ATOM   2473 C CG  . LEU A 1 325 ? -7.054  29.598 22.007  1.00 32.15 ? 643 LEU A CG  1 
ATOM   2474 C CD1 . LEU A 1 325 ? -8.301  30.189 21.399  1.00 33.50 ? 643 LEU A CD1 1 
ATOM   2475 C CD2 . LEU A 1 325 ? -6.403  28.649 21.041  1.00 31.35 ? 643 LEU A CD2 1 
ATOM   2476 N N   . VAL A 1 326 ? -6.243  30.759 25.464  1.00 33.45 ? 644 VAL A N   1 
ATOM   2477 C CA  . VAL A 1 326 ? -6.510  30.204 26.767  1.00 31.52 ? 644 VAL A CA  1 
ATOM   2478 C C   . VAL A 1 326 ? -7.511  31.100 27.459  1.00 30.99 ? 644 VAL A C   1 
ATOM   2479 O O   . VAL A 1 326 ? -8.586  30.658 27.787  1.00 33.14 ? 644 VAL A O   1 
ATOM   2480 C CB  . VAL A 1 326 ? -5.244  30.076 27.608  1.00 31.47 ? 644 VAL A CB  1 
ATOM   2481 C CG1 . VAL A 1 326 ? -5.598  29.809 29.062  1.00 27.19 ? 644 VAL A CG1 1 
ATOM   2482 C CG2 . VAL A 1 326 ? -4.366  28.980 27.043  1.00 30.43 ? 644 VAL A CG2 1 
ATOM   2483 N N   . ILE A 1 327 ? -7.181  32.368 27.647  1.00 30.25 ? 645 ILE A N   1 
ATOM   2484 C CA  . ILE A 1 327 ? -8.081  33.286 28.347  1.00 29.89 ? 645 ILE A CA  1 
ATOM   2485 C C   . ILE A 1 327 ? -9.534  33.141 27.911  1.00 30.95 ? 645 ILE A C   1 
ATOM   2486 O O   . ILE A 1 327 ? -10.426 32.878 28.728  1.00 31.01 ? 645 ILE A O   1 
ATOM   2487 C CB  . ILE A 1 327 ? -7.669  34.747 28.145  1.00 29.26 ? 645 ILE A CB  1 
ATOM   2488 C CG1 . ILE A 1 327 ? -6.308  34.978 28.813  1.00 30.70 ? 645 ILE A CG1 1 
ATOM   2489 C CG2 . ILE A 1 327 ? -8.750  35.664 28.688  1.00 21.04 ? 645 ILE A CG2 1 
ATOM   2490 C CD1 . ILE A 1 327 ? -5.790  36.391 28.774  1.00 33.64 ? 645 ILE A CD1 1 
ATOM   2491 N N   . ALA A 1 328 ? -9.762  33.314 26.616  1.00 31.19 ? 646 ALA A N   1 
ATOM   2492 C CA  . ALA A 1 328 ? -11.093 33.176 26.036  1.00 30.63 ? 646 ALA A CA  1 
ATOM   2493 C C   . ALA A 1 328 ? -11.895 32.032 26.640  1.00 30.78 ? 646 ALA A C   1 
ATOM   2494 O O   . ALA A 1 328 ? -13.129 32.108 26.739  1.00 31.67 ? 646 ALA A O   1 
ATOM   2495 C CB  . ALA A 1 328 ? -10.983 33.002 24.532  1.00 30.57 ? 646 ALA A CB  1 
ATOM   2496 N N   . ASN A 1 329 ? -11.192 30.976 27.047  1.00 31.01 ? 647 ASN A N   1 
ATOM   2497 C CA  . ASN A 1 329 ? -11.839 29.730 27.451  1.00 31.00 ? 647 ASN A CA  1 
ATOM   2498 C C   . ASN A 1 329 ? -11.791 29.400 28.921  1.00 30.17 ? 647 ASN A C   1 
ATOM   2499 O O   . ASN A 1 329 ? -12.220 28.334 29.327  1.00 31.55 ? 647 ASN A O   1 
ATOM   2500 C CB  . ASN A 1 329 ? -11.301 28.558 26.644  1.00 32.16 ? 647 ASN A CB  1 
ATOM   2501 C CG  . ASN A 1 329 ? -11.709 28.636 25.188  1.00 37.44 ? 647 ASN A CG  1 
ATOM   2502 O OD1 . ASN A 1 329 ? -11.157 29.440 24.419  1.00 39.63 ? 647 ASN A OD1 1 
ATOM   2503 N ND2 . ASN A 1 329 ? -12.691 27.807 24.797  1.00 36.81 ? 647 ASN A ND2 1 
ATOM   2504 N N   . ILE A 1 330 ? -11.284 30.320 29.719  1.00 28.76 ? 648 ILE A N   1 
ATOM   2505 C CA  . ILE A 1 330 ? -11.328 30.158 31.146  1.00 28.27 ? 648 ILE A CA  1 
ATOM   2506 C C   . ILE A 1 330 ? -12.742 30.232 31.661  1.00 29.69 ? 648 ILE A C   1 
ATOM   2507 O O   . ILE A 1 330 ? -13.360 31.274 31.580  1.00 31.87 ? 648 ILE A O   1 
ATOM   2508 C CB  . ILE A 1 330 ? -10.534 31.257 31.803  1.00 27.41 ? 648 ILE A CB  1 
ATOM   2509 C CG1 . ILE A 1 330 ? -9.060  30.882 31.750  1.00 27.32 ? 648 ILE A CG1 1 
ATOM   2510 C CG2 . ILE A 1 330 ? -10.990 31.463 33.228  1.00 24.54 ? 648 ILE A CG2 1 
ATOM   2511 C CD1 . ILE A 1 330 ? -8.196  31.786 32.529  1.00 31.64 ? 648 ILE A CD1 1 
ATOM   2512 N N   . ASP A 1 331 ? -13.281 29.150 32.203  1.00 31.78 ? 649 ASP A N   1 
ATOM   2513 C CA  . ASP A 1 331 ? -14.580 29.306 32.854  1.00 33.52 ? 649 ASP A CA  1 
ATOM   2514 C C   . ASP A 1 331 ? -14.401 30.337 33.969  1.00 33.06 ? 649 ASP A C   1 
ATOM   2515 O O   . ASP A 1 331 ? -13.976 29.988 35.078  1.00 33.20 ? 649 ASP A O   1 
ATOM   2516 C CB  . ASP A 1 331 ? -15.131 27.987 33.419  1.00 33.96 ? 649 ASP A CB  1 
ATOM   2517 C CG  . ASP A 1 331 ? -16.639 28.065 33.745  1.00 37.14 ? 649 ASP A CG  1 
ATOM   2518 O OD1 . ASP A 1 331 ? -17.171 29.162 34.024  1.00 34.50 ? 649 ASP A OD1 1 
ATOM   2519 O OD2 . ASP A 1 331 ? -17.310 27.015 33.718  1.00 45.54 ? 649 ASP A OD2 1 
ATOM   2520 N N   . GLN A 1 332 ? -14.711 31.601 33.673  1.00 31.90 ? 650 GLN A N   1 
ATOM   2521 C CA  . GLN A 1 332 ? -14.515 32.670 34.658  1.00 31.52 ? 650 GLN A CA  1 
ATOM   2522 C C   . GLN A 1 332 ? -15.397 32.510 35.912  1.00 32.48 ? 650 GLN A C   1 
ATOM   2523 O O   . GLN A 1 332 ? -15.045 32.994 36.982  1.00 33.53 ? 650 GLN A O   1 
ATOM   2524 C CB  . GLN A 1 332 ? -14.705 34.067 34.042  1.00 29.75 ? 650 GLN A CB  1 
ATOM   2525 C CG  . GLN A 1 332 ? -13.760 34.440 32.900  1.00 26.81 ? 650 GLN A CG  1 
ATOM   2526 C CD  . GLN A 1 332 ? -12.283 34.568 33.298  1.00 29.39 ? 650 GLN A CD  1 
ATOM   2527 O OE1 . GLN A 1 332 ? -11.894 34.485 34.471  1.00 28.56 ? 650 GLN A OE1 1 
ATOM   2528 N NE2 . GLN A 1 332 ? -11.448 34.768 32.296  1.00 32.83 ? 650 GLN A NE2 1 
ATOM   2529 N N   . SER A 1 333 ? -16.523 31.812 35.786  1.00 32.82 ? 651 SER A N   1 
ATOM   2530 C CA  . SER A 1 333 ? -17.466 31.663 36.891  1.00 32.85 ? 651 SER A CA  1 
ATOM   2531 C C   . SER A 1 333 ? -16.810 30.973 38.061  1.00 33.90 ? 651 SER A C   1 
ATOM   2532 O O   . SER A 1 333 ? -17.100 31.283 39.210  1.00 34.55 ? 651 SER A O   1 
ATOM   2533 C CB  . SER A 1 333 ? -18.668 30.837 36.462  1.00 31.44 ? 651 SER A CB  1 
ATOM   2534 O OG  . SER A 1 333 ? -18.332 29.465 36.470  1.00 31.90 ? 651 SER A OG  1 
ATOM   2535 N N   . ASP A 1 334 ? -15.939 30.017 37.752  1.00 35.46 ? 652 ASP A N   1 
ATOM   2536 C CA  . ASP A 1 334 ? -15.210 29.245 38.756  1.00 36.02 ? 652 ASP A CA  1 
ATOM   2537 C C   . ASP A 1 334 ? -14.608 30.082 39.877  1.00 36.43 ? 652 ASP A C   1 
ATOM   2538 O O   . ASP A 1 334 ? -14.235 29.553 40.918  1.00 38.39 ? 652 ASP A O   1 
ATOM   2539 C CB  . ASP A 1 334 ? -14.098 28.443 38.084  1.00 35.03 ? 652 ASP A CB  1 
ATOM   2540 C CG  . ASP A 1 334 ? -14.597 27.150 37.507  1.00 39.72 ? 652 ASP A CG  1 
ATOM   2541 O OD1 . ASP A 1 334 ? -15.432 26.485 38.159  1.00 47.74 ? 652 ASP A OD1 1 
ATOM   2542 O OD2 . ASP A 1 334 ? -14.165 26.781 36.400  1.00 45.68 ? 652 ASP A OD2 1 
ATOM   2543 N N   . PHE A 1 335 ? -14.495 31.385 39.675  1.00 36.35 ? 653 PHE A N   1 
ATOM   2544 C CA  . PHE A 1 335 ? -13.796 32.202 40.645  1.00 35.87 ? 653 PHE A CA  1 
ATOM   2545 C C   . PHE A 1 335 ? -14.655 33.332 41.125  1.00 36.74 ? 653 PHE A C   1 
ATOM   2546 O O   . PHE A 1 335 ? -14.132 34.320 41.603  1.00 38.51 ? 653 PHE A O   1 
ATOM   2547 C CB  . PHE A 1 335 ? -12.492 32.734 40.052  1.00 35.22 ? 653 PHE A CB  1 
ATOM   2548 C CG  . PHE A 1 335 ? -11.676 31.674 39.368  1.00 33.51 ? 653 PHE A CG  1 
ATOM   2549 C CD1 . PHE A 1 335 ? -11.821 31.446 37.992  1.00 31.93 ? 653 PHE A CD1 1 
ATOM   2550 C CD2 . PHE A 1 335 ? -10.799 30.882 40.102  1.00 24.71 ? 653 PHE A CD2 1 
ATOM   2551 C CE1 . PHE A 1 335 ? -11.095 30.449 37.350  1.00 32.77 ? 653 PHE A CE1 1 
ATOM   2552 C CE2 . PHE A 1 335 ? -10.071 29.890 39.483  1.00 29.35 ? 653 PHE A CE2 1 
ATOM   2553 C CZ  . PHE A 1 335 ? -10.217 29.660 38.091  1.00 32.02 ? 653 PHE A CZ  1 
ATOM   2554 N N   . GLU A 1 336 ? -15.972 33.187 41.013  1.00 36.89 ? 654 GLU A N   1 
ATOM   2555 C CA  . GLU A 1 336 ? -16.893 34.197 41.516  1.00 36.62 ? 654 GLU A CA  1 
ATOM   2556 C C   . GLU A 1 336 ? -16.534 34.647 42.926  1.00 35.95 ? 654 GLU A C   1 
ATOM   2557 O O   . GLU A 1 336 ? -16.163 33.842 43.771  1.00 36.47 ? 654 GLU A O   1 
ATOM   2558 C CB  . GLU A 1 336 ? -18.316 33.670 41.511  1.00 37.30 ? 654 GLU A CB  1 
ATOM   2559 C CG  . GLU A 1 336 ? -19.360 34.762 41.705  1.00 41.90 ? 654 GLU A CG  1 
ATOM   2560 C CD  . GLU A 1 336 ? -20.773 34.263 41.463  1.00 48.26 ? 654 GLU A CD  1 
ATOM   2561 O OE1 . GLU A 1 336 ? -20.974 33.029 41.466  1.00 51.06 ? 654 GLU A OE1 1 
ATOM   2562 O OE2 . GLU A 1 336 ? -21.683 35.100 41.274  1.00 50.75 ? 654 GLU A OE2 1 
ATOM   2563 N N   . GLY A 1 337 ? -16.641 35.940 43.177  1.00 35.69 ? 655 GLY A N   1 
ATOM   2564 C CA  . GLY A 1 337 ? -16.387 36.463 44.510  1.00 37.69 ? 655 GLY A CA  1 
ATOM   2565 C C   . GLY A 1 337 ? -15.127 35.926 45.165  1.00 38.04 ? 655 GLY A C   1 
ATOM   2566 O O   . GLY A 1 337 ? -15.142 35.468 46.303  1.00 39.67 ? 655 GLY A O   1 
ATOM   2567 N N   . PHE A 1 338 ? -14.024 35.980 44.439  1.00 37.44 ? 656 PHE A N   1 
ATOM   2568 C CA  . PHE A 1 338 ? -12.740 35.602 44.971  1.00 35.30 ? 656 PHE A CA  1 
ATOM   2569 C C   . PHE A 1 338 ? -12.083 36.814 45.574  1.00 35.33 ? 656 PHE A C   1 
ATOM   2570 O O   . PHE A 1 338 ? -11.276 36.695 46.486  1.00 37.05 ? 656 PHE A O   1 
ATOM   2571 C CB  . PHE A 1 338 ? -11.889 35.092 43.839  1.00 34.94 ? 656 PHE A CB  1 
ATOM   2572 C CG  . PHE A 1 338 ? -10.448 34.983 44.158  1.00 33.40 ? 656 PHE A CG  1 
ATOM   2573 C CD1 . PHE A 1 338 ? -9.963  33.889 44.835  1.00 36.55 ? 656 PHE A CD1 1 
ATOM   2574 C CD2 . PHE A 1 338 ? -9.564  35.940 43.721  1.00 36.57 ? 656 PHE A CD2 1 
ATOM   2575 C CE1 . PHE A 1 338 ? -8.612  33.765 45.092  1.00 41.10 ? 656 PHE A CE1 1 
ATOM   2576 C CE2 . PHE A 1 338 ? -8.221  35.830 43.978  1.00 40.70 ? 656 PHE A CE2 1 
ATOM   2577 C CZ  . PHE A 1 338 ? -7.739  34.736 44.662  1.00 40.37 ? 656 PHE A CZ  1 
HETATM 2578 N N   . SEP A 1 339 ? -12.401 37.992 45.056  1.00 34.62 ? 657 SEP A N   1 
HETATM 2579 C CA  . SEP A 1 339 ? -11.807 39.188 45.610  1.00 34.46 ? 657 SEP A CA  1 
HETATM 2580 C CB  . SEP A 1 339 ? -12.118 40.391 44.764  1.00 33.97 ? 657 SEP A CB  1 
HETATM 2581 O OG  . SEP A 1 339 ? -11.134 40.472 43.768  1.00 40.79 ? 657 SEP A OG  1 
HETATM 2582 C C   . SEP A 1 339 ? -12.260 39.422 47.023  1.00 34.02 ? 657 SEP A C   1 
HETATM 2583 O O   . SEP A 1 339 ? -13.425 39.206 47.362  1.00 33.67 ? 657 SEP A O   1 
HETATM 2584 P P   . SEP A 1 339 ? -11.871 40.741 42.381  1.00 46.02 ? 657 SEP A P   1 
HETATM 2585 O O1P . SEP A 1 339 ? -13.143 39.728 42.341  1.00 35.48 ? 657 SEP A O1P 1 
HETATM 2586 O O2P . SEP A 1 339 ? -10.840 40.497 41.161  1.00 41.75 ? 657 SEP A O2P 1 
HETATM 2587 O O3P . SEP A 1 339 ? -12.300 42.294 42.375  1.00 44.02 ? 657 SEP A O3P 1 
ATOM   2588 N N   . TYR A 1 340 ? -11.318 39.842 47.853  1.00 33.56 ? 658 TYR A N   1 
ATOM   2589 C CA  . TYR A 1 340 ? -11.633 40.220 49.214  1.00 35.25 ? 658 TYR A CA  1 
ATOM   2590 C C   . TYR A 1 340 ? -10.527 41.160 49.675  1.00 36.86 ? 658 TYR A C   1 
ATOM   2591 O O   . TYR A 1 340 ? -9.432  41.124 49.107  1.00 38.67 ? 658 TYR A O   1 
ATOM   2592 C CB  . TYR A 1 340 ? -11.734 38.968 50.090  1.00 34.24 ? 658 TYR A CB  1 
ATOM   2593 C CG  . TYR A 1 340 ? -11.776 39.222 51.576  1.00 31.62 ? 658 TYR A CG  1 
ATOM   2594 C CD1 . TYR A 1 340 ? -12.979 39.284 52.256  1.00 28.89 ? 658 TYR A CD1 1 
ATOM   2595 C CD2 . TYR A 1 340 ? -10.605 39.384 52.303  1.00 32.90 ? 658 TYR A CD2 1 
ATOM   2596 C CE1 . TYR A 1 340 ? -13.018 39.508 53.626  1.00 33.74 ? 658 TYR A CE1 1 
ATOM   2597 C CE2 . TYR A 1 340 ? -10.630 39.613 53.669  1.00 36.20 ? 658 TYR A CE2 1 
ATOM   2598 C CZ  . TYR A 1 340 ? -11.838 39.681 54.330  1.00 35.60 ? 658 TYR A CZ  1 
ATOM   2599 O OH  . TYR A 1 340 ? -11.856 39.912 55.690  1.00 32.69 ? 658 TYR A OH  1 
ATOM   2600 N N   . VAL A 1 341 ? -10.815 42.025 50.654  1.00 36.48 ? 659 VAL A N   1 
ATOM   2601 C CA  . VAL A 1 341 ? -9.793  42.894 51.246  1.00 36.84 ? 659 VAL A CA  1 
ATOM   2602 C C   . VAL A 1 341 ? -9.873  42.951 52.789  1.00 38.05 ? 659 VAL A C   1 
ATOM   2603 O O   . VAL A 1 341 ? -10.874 43.364 53.346  1.00 36.96 ? 659 VAL A O   1 
ATOM   2604 C CB  . VAL A 1 341 ? -9.813  44.304 50.637  1.00 35.90 ? 659 VAL A CB  1 
ATOM   2605 C CG1 . VAL A 1 341 ? -8.662  45.121 51.190  1.00 37.32 ? 659 VAL A CG1 1 
ATOM   2606 C CG2 . VAL A 1 341 ? -9.723  44.229 49.114  1.00 35.71 ? 659 VAL A CG2 1 
ATOM   2607 N N   . ASN A 1 342 ? -8.808  42.520 53.469  1.00 40.21 ? 660 ASN A N   1 
ATOM   2608 C CA  . ASN A 1 342 ? -8.839  42.348 54.922  1.00 41.61 ? 660 ASN A CA  1 
ATOM   2609 C C   . ASN A 1 342 ? -8.841  43.664 55.664  1.00 43.09 ? 660 ASN A C   1 
ATOM   2610 O O   . ASN A 1 342 ? -7.806  44.323 55.773  1.00 42.21 ? 660 ASN A O   1 
ATOM   2611 C CB  . ASN A 1 342 ? -7.689  41.455 55.417  1.00 41.06 ? 660 ASN A CB  1 
ATOM   2612 C CG  . ASN A 1 342 ? -7.718  41.242 56.942  1.00 41.23 ? 660 ASN A CG  1 
ATOM   2613 O OD1 . ASN A 1 342 ? -8.681  41.619 57.631  1.00 37.96 ? 660 ASN A OD1 1 
ATOM   2614 N ND2 . ASN A 1 342 ? -6.652  40.641 57.470  1.00 37.02 ? 660 ASN A ND2 1 
ATOM   2615 N N   . PRO A 1 343 ? -10.011 44.042 56.198  1.00 45.40 ? 661 PRO A N   1 
ATOM   2616 C CA  . PRO A 1 343 ? -10.155 45.349 56.825  1.00 46.98 ? 661 PRO A CA  1 
ATOM   2617 C C   . PRO A 1 343 ? -9.123  45.516 57.929  1.00 48.48 ? 661 PRO A C   1 
ATOM   2618 O O   . PRO A 1 343 ? -8.566  46.603 58.102  1.00 48.00 ? 661 PRO A O   1 
ATOM   2619 C CB  . PRO A 1 343 ? -11.577 45.304 57.418  1.00 46.98 ? 661 PRO A CB  1 
ATOM   2620 C CG  . PRO A 1 343 ? -11.954 43.864 57.476  1.00 45.08 ? 661 PRO A CG  1 
ATOM   2621 C CD  . PRO A 1 343 ? -11.226 43.217 56.341  1.00 45.60 ? 661 PRO A CD  1 
ATOM   2622 N N   . GLN A 1 344 ? -8.853  44.419 58.638  1.00 50.30 ? 662 GLN A N   1 
ATOM   2623 C CA  . GLN A 1 344 ? -8.090  44.459 59.882  1.00 50.87 ? 662 GLN A CA  1 
ATOM   2624 C C   . GLN A 1 344 ? -6.650  43.968 59.739  1.00 50.13 ? 662 GLN A C   1 
ATOM   2625 O O   . GLN A 1 344 ? -6.102  43.373 60.663  1.00 50.40 ? 662 GLN A O   1 
ATOM   2626 C CB  . GLN A 1 344 ? -8.846  43.691 60.974  1.00 51.65 ? 662 GLN A CB  1 
ATOM   2627 C CG  . GLN A 1 344 ? -10.002 44.500 61.585  1.00 54.55 ? 662 GLN A CG  1 
ATOM   2628 C CD  . GLN A 1 344 ? -9.513  45.811 62.233  1.00 59.67 ? 662 GLN A CD  1 
ATOM   2629 O OE1 . GLN A 1 344 ? -9.986  46.899 61.899  1.00 61.35 ? 662 GLN A OE1 1 
ATOM   2630 N NE2 . GLN A 1 344 ? -8.550  45.703 63.151  1.00 59.11 ? 662 GLN A NE2 1 
ATOM   2631 N N   . PHE A 1 345 ? -6.052  44.240 58.578  1.00 49.28 ? 663 PHE A N   1 
ATOM   2632 C CA  . PHE A 1 345 ? -4.682  43.847 58.279  1.00 48.47 ? 663 PHE A CA  1 
ATOM   2633 C C   . PHE A 1 345 ? -3.677  44.645 59.086  1.00 48.87 ? 663 PHE A C   1 
ATOM   2634 O O   . PHE A 1 345 ? -3.685  45.877 59.076  1.00 48.77 ? 663 PHE A O   1 
ATOM   2635 C CB  . PHE A 1 345 ? -4.373  43.993 56.790  1.00 48.22 ? 663 PHE A CB  1 
ATOM   2636 C CG  . PHE A 1 345 ? -3.063  43.390 56.398  1.00 49.65 ? 663 PHE A CG  1 
ATOM   2637 C CD1 . PHE A 1 345 ? -2.905  42.012 56.366  1.00 49.55 ? 663 PHE A CD1 1 
ATOM   2638 C CD2 . PHE A 1 345 ? -1.980  44.194 56.086  1.00 52.43 ? 663 PHE A CD2 1 
ATOM   2639 C CE1 . PHE A 1 345 ? -1.700  41.445 56.021  1.00 51.87 ? 663 PHE A CE1 1 
ATOM   2640 C CE2 . PHE A 1 345 ? -0.759  43.637 55.737  1.00 52.78 ? 663 PHE A CE2 1 
ATOM   2641 C CZ  . PHE A 1 345 ? -0.618  42.256 55.702  1.00 54.44 ? 663 PHE A CZ  1 
ATOM   2642 N N   . VAL A 1 346 ? -2.799  43.917 59.770  1.00 49.56 ? 664 VAL A N   1 
ATOM   2643 C CA  . VAL A 1 346 ? -1.869  44.487 60.739  1.00 49.27 ? 664 VAL A CA  1 
ATOM   2644 C C   . VAL A 1 346 ? -0.480  44.598 60.134  1.00 50.19 ? 664 VAL A C   1 
ATOM   2645 O O   . VAL A 1 346 ? 0.294   43.632 60.113  1.00 49.83 ? 664 VAL A O   1 
ATOM   2646 C CB  . VAL A 1 346 ? -1.797  43.619 62.028  1.00 49.16 ? 664 VAL A CB  1 
ATOM   2647 C CG1 . VAL A 1 346 ? -1.015  44.313 63.105  1.00 47.64 ? 664 VAL A CG1 1 
ATOM   2648 C CG2 . VAL A 1 346 ? -3.186  43.292 62.538  1.00 49.37 ? 664 VAL A CG2 1 
ATOM   2649 N N   . HIS A 1 347 ? -0.170  45.784 59.631  1.00 51.34 ? 665 HIS A N   1 
ATOM   2650 C CA  . HIS A 1 347 ? 1.167   46.075 59.137  1.00 51.86 ? 665 HIS A CA  1 
ATOM   2651 C C   . HIS A 1 347 ? 2.168   45.955 60.274  1.00 53.24 ? 665 HIS A C   1 
ATOM   2652 O O   . HIS A 1 347 ? 1.821   46.174 61.437  1.00 53.86 ? 665 HIS A O   1 
ATOM   2653 C CB  . HIS A 1 347 ? 1.197   47.472 58.539  1.00 50.75 ? 665 HIS A CB  1 
ATOM   2654 C CG  . HIS A 1 347 ? 0.265   47.633 57.388  1.00 47.52 ? 665 HIS A CG  1 
ATOM   2655 N ND1 . HIS A 1 347 ? 0.654   47.420 56.084  1.00 45.86 ? 665 HIS A ND1 1 
ATOM   2656 C CD2 . HIS A 1 347 ? -1.050  47.949 57.343  1.00 47.22 ? 665 HIS A CD2 1 
ATOM   2657 C CE1 . HIS A 1 347 ? -0.377  47.614 55.281  1.00 44.35 ? 665 HIS A CE1 1 
ATOM   2658 N NE2 . HIS A 1 347 ? -1.423  47.935 56.021  1.00 47.00 ? 665 HIS A NE2 1 
ATOM   2659 N N   . PRO A 1 348 ? 3.418   45.600 59.950  1.00 54.18 ? 666 PRO A N   1 
ATOM   2660 C CA  . PRO A 1 348 ? 4.358   45.413 61.049  1.00 53.74 ? 666 PRO A CA  1 
ATOM   2661 C C   . PRO A 1 348 ? 4.604   46.718 61.790  1.00 52.87 ? 666 PRO A C   1 
ATOM   2662 O O   . PRO A 1 348 ? 4.840   47.753 61.177  1.00 51.95 ? 666 PRO A O   1 
ATOM   2663 C CB  . PRO A 1 348 ? 5.636   44.937 60.352  1.00 53.53 ? 666 PRO A CB  1 
ATOM   2664 C CG  . PRO A 1 348 ? 5.541   45.501 58.966  1.00 54.25 ? 666 PRO A CG  1 
ATOM   2665 C CD  . PRO A 1 348 ? 4.067   45.526 58.627  1.00 54.52 ? 666 PRO A CD  1 
ATOM   2666 N N   . ILE A 1 349 ? 4.499   46.643 63.106  1.00 53.16 ? 667 ILE A N   1 
ATOM   2667 C CA  . ILE A 1 349 ? 4.884   47.704 64.021  1.00 54.27 ? 667 ILE A CA  1 
ATOM   2668 C C   . ILE A 1 349 ? 6.290   48.285 63.713  1.00 53.01 ? 667 ILE A C   1 
ATOM   2669 O O   . ILE A 1 349 ? 7.161   47.578 63.209  1.00 53.14 ? 667 ILE A O   1 
ATOM   2670 C CB  . ILE A 1 349 ? 4.853   47.141 65.480  1.00 55.03 ? 667 ILE A CB  1 
ATOM   2671 C CG1 . ILE A 1 349 ? 3.544   46.369 65.738  1.00 58.80 ? 667 ILE A CG1 1 
ATOM   2672 C CG2 . ILE A 1 349 ? 5.059   48.245 66.506  1.00 57.27 ? 667 ILE A CG2 1 
ATOM   2673 C CD1 . ILE A 1 349 ? 3.511   45.583 67.062  1.00 59.55 ? 667 ILE A CD1 1 
ATOM   2674 N N   . LEU A 1 350 ? 6.503   49.570 64.000  1.00 51.41 ? 668 LEU A N   1 
ATOM   2675 C CA  . LEU A 1 350 ? 7.853   50.130 64.004  1.00 50.25 ? 668 LEU A CA  1 
ATOM   2676 C C   . LEU A 1 350 ? 8.671   49.406 65.065  1.00 50.85 ? 668 LEU A C   1 
ATOM   2677 O O   . LEU A 1 350 ? 8.169   49.144 66.151  1.00 51.06 ? 668 LEU A O   1 
ATOM   2678 C CB  . LEU A 1 350 ? 7.830   51.621 64.357  1.00 49.01 ? 668 LEU A CB  1 
ATOM   2679 C CG  . LEU A 1 350 ? 8.032   52.678 63.281  1.00 45.78 ? 668 LEU A CG  1 
ATOM   2680 C CD1 . LEU A 1 350 ? 7.026   52.473 62.175  1.00 49.08 ? 668 LEU A CD1 1 
ATOM   2681 C CD2 . LEU A 1 350 ? 7.896   54.072 63.879  1.00 44.68 ? 668 LEU A CD2 1 
ATOM   2682 N N   . GLN A 1 351 ? 9.928   49.094 64.771  1.00 50.80 ? 669 GLN A N   1 
ATOM   2683 C CA  . GLN A 1 351 ? 10.812  48.565 65.806  1.00 51.25 ? 669 GLN A CA  1 
ATOM   2684 C C   . GLN A 1 351 ? 10.997  49.604 66.928  1.00 50.82 ? 669 GLN A C   1 
ATOM   2685 O O   . GLN A 1 351 ? 10.373  49.533 67.994  1.00 49.08 ? 669 GLN A O   1 
ATOM   2686 C CB  . GLN A 1 351 ? 12.173  48.155 65.211  1.00 51.53 ? 669 GLN A CB  1 
ATOM   2687 N N   . ASP B 1 14  ? -29.379 -3.316 29.322  1.00 55.56 ? 332 ASP B N   1 
ATOM   2688 C CA  . ASP B 1 14  ? -28.540 -3.803 30.457  1.00 55.21 ? 332 ASP B CA  1 
ATOM   2689 C C   . ASP B 1 14  ? -28.440 -2.647 31.462  1.00 54.01 ? 332 ASP B C   1 
ATOM   2690 O O   . ASP B 1 14  ? -27.674 -1.699 31.247  1.00 53.06 ? 332 ASP B O   1 
ATOM   2691 C CB  . ASP B 1 14  ? -27.140 -4.250 29.969  1.00 55.58 ? 332 ASP B CB  1 
ATOM   2692 C CG  . ASP B 1 14  ? -27.054 -4.414 28.421  1.00 60.37 ? 332 ASP B CG  1 
ATOM   2693 O OD1 . ASP B 1 14  ? -27.060 -5.575 27.903  1.00 58.14 ? 332 ASP B OD1 1 
ATOM   2694 O OD2 . ASP B 1 14  ? -26.976 -3.368 27.719  1.00 62.15 ? 332 ASP B OD2 1 
ATOM   2695 N N   . ARG B 1 15  ? -29.250 -2.722 32.527  1.00 52.59 ? 333 ARG B N   1 
ATOM   2696 C CA  . ARG B 1 15  ? -29.291 -1.713 33.614  1.00 50.47 ? 333 ARG B CA  1 
ATOM   2697 C C   . ARG B 1 15  ? -28.147 -1.884 34.606  1.00 48.38 ? 333 ARG B C   1 
ATOM   2698 O O   . ARG B 1 15  ? -27.736 -2.999 34.888  1.00 48.47 ? 333 ARG B O   1 
ATOM   2699 C CB  . ARG B 1 15  ? -30.625 -1.767 34.386  1.00 50.36 ? 333 ARG B CB  1 
ATOM   2700 C CG  . ARG B 1 15  ? -30.487 -1.434 35.895  1.00 50.62 ? 333 ARG B CG  1 
ATOM   2701 C CD  . ARG B 1 15  ? -31.804 -1.533 36.677  1.00 49.82 ? 333 ARG B CD  1 
ATOM   2702 N NE  . ARG B 1 15  ? -32.845 -0.716 36.066  1.00 49.93 ? 333 ARG B NE  1 
ATOM   2703 C CZ  . ARG B 1 15  ? -33.820 -1.199 35.297  1.00 51.93 ? 333 ARG B CZ  1 
ATOM   2704 N NH1 . ARG B 1 15  ? -33.899 -2.505 35.066  1.00 56.29 ? 333 ARG B NH1 1 
ATOM   2705 N NH2 . ARG B 1 15  ? -34.724 -0.384 34.767  1.00 45.16 ? 333 ARG B NH2 1 
ATOM   2706 N N   . VAL B 1 16  ? -27.652 -0.778 35.150  1.00 45.96 ? 334 VAL B N   1 
ATOM   2707 C CA  . VAL B 1 16  ? -26.545 -0.839 36.090  1.00 44.85 ? 334 VAL B CA  1 
ATOM   2708 C C   . VAL B 1 16  ? -26.850 -0.085 37.378  1.00 44.43 ? 334 VAL B C   1 
ATOM   2709 O O   . VAL B 1 16  ? -27.726 0.771  37.400  1.00 45.18 ? 334 VAL B O   1 
ATOM   2710 C CB  . VAL B 1 16  ? -25.223 -0.291 35.469  1.00 45.33 ? 334 VAL B CB  1 
ATOM   2711 C CG1 . VAL B 1 16  ? -24.506 -1.380 34.668  1.00 43.81 ? 334 VAL B CG1 1 
ATOM   2712 C CG2 . VAL B 1 16  ? -25.481 0.970  34.621  1.00 40.91 ? 334 VAL B CG2 1 
ATOM   2713 N N   . LYS B 1 17  ? -26.124 -0.410 38.446  1.00 43.45 ? 335 LYS B N   1 
ATOM   2714 C CA  . LYS B 1 17  ? -26.196 0.349  39.693  1.00 42.48 ? 335 LYS B CA  1 
ATOM   2715 C C   . LYS B 1 17  ? -24.820 0.721  40.226  1.00 41.98 ? 335 LYS B C   1 
ATOM   2716 O O   . LYS B 1 17  ? -23.799 0.316  39.681  1.00 41.53 ? 335 LYS B O   1 
ATOM   2717 C CB  . LYS B 1 17  ? -26.995 -0.399 40.751  1.00 42.03 ? 335 LYS B CB  1 
ATOM   2718 C CG  . LYS B 1 17  ? -26.428 -1.731 41.161  1.00 43.20 ? 335 LYS B CG  1 
ATOM   2719 C CD  . LYS B 1 17  ? -27.529 -2.546 41.815  1.00 47.64 ? 335 LYS B CD  1 
ATOM   2720 C CE  . LYS B 1 17  ? -27.124 -3.030 43.199  1.00 52.26 ? 335 LYS B CE  1 
ATOM   2721 N NZ  . LYS B 1 17  ? -26.841 -4.487 43.218  1.00 54.93 ? 335 LYS B NZ  1 
ATOM   2722 N N   . LEU B 1 18  ? -24.794 1.493  41.305  1.00 42.79 ? 336 LEU B N   1 
ATOM   2723 C CA  . LEU B 1 18  ? -23.528 2.056  41.794  1.00 42.16 ? 336 LEU B CA  1 
ATOM   2724 C C   . LEU B 1 18  ? -22.470 0.997  42.042  1.00 41.58 ? 336 LEU B C   1 
ATOM   2725 O O   . LEU B 1 18  ? -21.292 1.226  41.790  1.00 41.85 ? 336 LEU B O   1 
ATOM   2726 C CB  . LEU B 1 18  ? -23.725 2.899  43.060  1.00 41.26 ? 336 LEU B CB  1 
ATOM   2727 C CG  . LEU B 1 18  ? -22.421 3.498  43.611  1.00 44.18 ? 336 LEU B CG  1 
ATOM   2728 C CD1 . LEU B 1 18  ? -21.615 4.165  42.500  1.00 45.47 ? 336 LEU B CD1 1 
ATOM   2729 C CD2 . LEU B 1 18  ? -22.645 4.496  44.730  1.00 39.06 ? 336 LEU B CD2 1 
ATOM   2730 N N   . THR B 1 19  ? -22.891 -0.164 42.532  1.00 41.22 ? 337 THR B N   1 
ATOM   2731 C CA  . THR B 1 19  ? -21.936 -1.158 43.005  1.00 39.46 ? 337 THR B CA  1 
ATOM   2732 C C   . THR B 1 19  ? -21.339 -1.943 41.859  1.00 38.33 ? 337 THR B C   1 
ATOM   2733 O O   . THR B 1 19  ? -20.371 -2.681 42.070  1.00 37.97 ? 337 THR B O   1 
ATOM   2734 C CB  . THR B 1 19  ? -22.533 -2.082 44.086  1.00 39.13 ? 337 THR B CB  1 
ATOM   2735 O OG1 . THR B 1 19  ? -23.754 -2.686 43.612  1.00 40.09 ? 337 THR B OG1 1 
ATOM   2736 C CG2 . THR B 1 19  ? -22.818 -1.274 45.345  1.00 35.86 ? 337 THR B CG2 1 
ATOM   2737 N N   . ASP B 1 20  ? -21.904 -1.756 40.659  1.00 36.78 ? 338 ASP B N   1 
ATOM   2738 C CA  . ASP B 1 20  ? -21.415 -2.416 39.430  1.00 37.54 ? 338 ASP B CA  1 
ATOM   2739 C C   . ASP B 1 20  ? -20.119 -1.799 38.931  1.00 37.83 ? 338 ASP B C   1 
ATOM   2740 O O   . ASP B 1 20  ? -19.639 -2.180 37.867  1.00 36.40 ? 338 ASP B O   1 
ATOM   2741 C CB  . ASP B 1 20  ? -22.398 -2.254 38.269  1.00 37.63 ? 338 ASP B CB  1 
ATOM   2742 C CG  . ASP B 1 20  ? -23.704 -2.972 38.478  1.00 38.65 ? 338 ASP B CG  1 
ATOM   2743 O OD1 . ASP B 1 20  ? -23.768 -3.913 39.295  1.00 41.16 ? 338 ASP B OD1 1 
ATOM   2744 O OD2 . ASP B 1 20  ? -24.672 -2.602 37.784  1.00 35.00 ? 338 ASP B OD2 1 
ATOM   2745 N N   . PHE B 1 21  ? -19.582 -0.828 39.673  1.00 38.23 ? 339 PHE B N   1 
ATOM   2746 C CA  . PHE B 1 21  ? -18.477 -0.001 39.183  1.00 38.69 ? 339 PHE B CA  1 
ATOM   2747 C C   . PHE B 1 21  ? -17.369 0.222  40.198  1.00 39.86 ? 339 PHE B C   1 
ATOM   2748 O O   . PHE B 1 21  ? -17.621 0.358  41.409  1.00 39.23 ? 339 PHE B O   1 
ATOM   2749 C CB  . PHE B 1 21  ? -18.980 1.383  38.781  1.00 37.60 ? 339 PHE B CB  1 
ATOM   2750 C CG  . PHE B 1 21  ? -19.872 1.387  37.569  1.00 39.97 ? 339 PHE B CG  1 
ATOM   2751 C CD1 . PHE B 1 21  ? -19.328 1.335  36.287  1.00 40.82 ? 339 PHE B CD1 1 
ATOM   2752 C CD2 . PHE B 1 21  ? -21.258 1.474  37.703  1.00 35.46 ? 339 PHE B CD2 1 
ATOM   2753 C CE1 . PHE B 1 21  ? -20.157 1.355  35.177  1.00 39.08 ? 339 PHE B CE1 1 
ATOM   2754 C CE2 . PHE B 1 21  ? -22.095 1.497  36.592  1.00 30.46 ? 339 PHE B CE2 1 
ATOM   2755 C CZ  . PHE B 1 21  ? -21.554 1.434  35.337  1.00 34.12 ? 339 PHE B CZ  1 
ATOM   2756 N N   . ASN B 1 22  ? -16.146 0.288  39.676  1.00 40.68 ? 340 ASN B N   1 
ATOM   2757 C CA  . ASN B 1 22  ? -15.001 0.781  40.424  1.00 41.75 ? 340 ASN B CA  1 
ATOM   2758 C C   . ASN B 1 22  ? -14.537 2.140  39.929  1.00 40.53 ? 340 ASN B C   1 
ATOM   2759 O O   . ASN B 1 22  ? -14.246 2.305  38.749  1.00 41.07 ? 340 ASN B O   1 
ATOM   2760 C CB  . ASN B 1 22  ? -13.851 -0.214 40.357  1.00 43.15 ? 340 ASN B CB  1 
ATOM   2761 C CG  . ASN B 1 22  ? -14.125 -1.444 41.179  1.00 49.85 ? 340 ASN B CG  1 
ATOM   2762 O OD1 . ASN B 1 22  ? -13.999 -2.577 40.696  1.00 55.78 ? 340 ASN B OD1 1 
ATOM   2763 N ND2 . ASN B 1 22  ? -14.547 -1.233 42.430  1.00 54.53 ? 340 ASN B ND2 1 
ATOM   2764 N N   . PHE B 1 23  ? -14.480 3.111  40.835  1.00 39.17 ? 341 PHE B N   1 
ATOM   2765 C CA  . PHE B 1 23  ? -13.864 4.390  40.537  1.00 39.36 ? 341 PHE B CA  1 
ATOM   2766 C C   . PHE B 1 23  ? -12.356 4.263  40.346  1.00 39.56 ? 341 PHE B C   1 
ATOM   2767 O O   . PHE B 1 23  ? -11.649 3.864  41.264  1.00 38.47 ? 341 PHE B O   1 
ATOM   2768 C CB  . PHE B 1 23  ? -14.136 5.391  41.659  1.00 39.32 ? 341 PHE B CB  1 
ATOM   2769 C CG  . PHE B 1 23  ? -15.571 5.717  41.818  1.00 38.87 ? 341 PHE B CG  1 
ATOM   2770 C CD1 . PHE B 1 23  ? -16.459 5.484  40.767  1.00 37.17 ? 341 PHE B CD1 1 
ATOM   2771 C CD2 . PHE B 1 23  ? -16.039 6.268  42.998  1.00 39.87 ? 341 PHE B CD2 1 
ATOM   2772 C CE1 . PHE B 1 23  ? -17.791 5.775  40.889  1.00 33.95 ? 341 PHE B CE1 1 
ATOM   2773 C CE2 . PHE B 1 23  ? -17.380 6.574  43.143  1.00 42.32 ? 341 PHE B CE2 1 
ATOM   2774 C CZ  . PHE B 1 23  ? -18.263 6.327  42.078  1.00 41.95 ? 341 PHE B CZ  1 
ATOM   2775 N N   . LEU B 1 24  ? -11.874 4.606  39.152  1.00 40.56 ? 342 LEU B N   1 
ATOM   2776 C CA  . LEU B 1 24  ? -10.432 4.675  38.887  1.00 40.73 ? 342 LEU B CA  1 
ATOM   2777 C C   . LEU B 1 24  ? -9.884  6.048  39.275  1.00 41.60 ? 342 LEU B C   1 
ATOM   2778 O O   . LEU B 1 24  ? -8.959  6.140  40.080  1.00 43.21 ? 342 LEU B O   1 
ATOM   2779 C CB  . LEU B 1 24  ? -10.117 4.354  37.421  1.00 39.56 ? 342 LEU B CB  1 
ATOM   2780 C CG  . LEU B 1 24  ? -9.970  2.875  37.053  1.00 36.14 ? 342 LEU B CG  1 
ATOM   2781 C CD1 . LEU B 1 24  ? -10.190 1.932  38.234  1.00 26.14 ? 342 LEU B CD1 1 
ATOM   2782 C CD2 . LEU B 1 24  ? -10.887 2.548  35.892  1.00 37.44 ? 342 LEU B CD2 1 
ATOM   2783 N N   . MET B 1 25  ? -10.463 7.112  38.724  1.00 41.40 ? 343 MET B N   1 
ATOM   2784 C CA  . MET B 1 25  ? -10.024 8.462  39.055  1.00 41.60 ? 343 MET B CA  1 
ATOM   2785 C C   . MET B 1 25  ? -11.000 9.529  38.580  1.00 40.92 ? 343 MET B C   1 
ATOM   2786 O O   . MET B 1 25  ? -11.947 9.248  37.859  1.00 40.63 ? 343 MET B O   1 
ATOM   2787 C CB  . MET B 1 25  ? -8.668  8.728  38.428  1.00 41.98 ? 343 MET B CB  1 
ATOM   2788 C CG  . MET B 1 25  ? -8.586  8.226  37.004  1.00 46.36 ? 343 MET B CG  1 
ATOM   2789 S SD  . MET B 1 25  ? -7.329  9.073  36.028  1.00 59.23 ? 343 MET B SD  1 
ATOM   2790 C CE  . MET B 1 25  ? -8.289  10.237 35.047  1.00 59.23 ? 343 MET B CE  1 
ATOM   2791 N N   . VAL B 1 26  ? -10.748 10.765 38.982  1.00 40.52 ? 344 VAL B N   1 
ATOM   2792 C CA  . VAL B 1 26  ? -11.555 11.881 38.540  1.00 40.01 ? 344 VAL B CA  1 
ATOM   2793 C C   . VAL B 1 26  ? -11.103 12.288 37.146  1.00 40.32 ? 344 VAL B C   1 
ATOM   2794 O O   . VAL B 1 26  ? -9.920  12.522 36.908  1.00 40.91 ? 344 VAL B O   1 
ATOM   2795 C CB  . VAL B 1 26  ? -11.404 13.092 39.489  1.00 40.08 ? 344 VAL B CB  1 
ATOM   2796 C CG1 . VAL B 1 26  ? -12.518 14.084 39.269  1.00 41.84 ? 344 VAL B CG1 1 
ATOM   2797 C CG2 . VAL B 1 26  ? -11.413 12.645 40.934  1.00 39.13 ? 344 VAL B CG2 1 
ATOM   2798 N N   . LEU B 1 27  ? -12.036 12.351 36.209  1.00 40.02 ? 345 LEU B N   1 
ATOM   2799 C CA  . LEU B 1 27  ? -11.732 12.964 34.938  1.00 38.79 ? 345 LEU B CA  1 
ATOM   2800 C C   . LEU B 1 27  ? -11.705 14.478 35.125  1.00 39.09 ? 345 LEU B C   1 
ATOM   2801 O O   . LEU B 1 27  ? -10.902 15.160 34.506  1.00 39.43 ? 345 LEU B O   1 
ATOM   2802 C CB  . LEU B 1 27  ? -12.747 12.558 33.868  1.00 38.68 ? 345 LEU B CB  1 
ATOM   2803 C CG  . LEU B 1 27  ? -12.707 11.100 33.395  1.00 37.42 ? 345 LEU B CG  1 
ATOM   2804 C CD1 . LEU B 1 27  ? -13.620 10.926 32.205  1.00 35.35 ? 345 LEU B CD1 1 
ATOM   2805 C CD2 . LEU B 1 27  ? -11.305 10.679 33.032  1.00 33.66 ? 345 LEU B CD2 1 
ATOM   2806 N N   . GLY B 1 28  ? -12.575 15.006 35.985  1.00 39.33 ? 346 GLY B N   1 
ATOM   2807 C CA  . GLY B 1 28  ? -12.576 16.442 36.256  1.00 39.62 ? 346 GLY B CA  1 
ATOM   2808 C C   . GLY B 1 28  ? -13.698 16.959 37.137  1.00 40.40 ? 346 GLY B C   1 
ATOM   2809 O O   . GLY B 1 28  ? -14.634 16.226 37.443  1.00 40.11 ? 346 GLY B O   1 
ATOM   2810 N N   . LYS B 1 29  ? -13.581 18.227 37.549  1.00 41.27 ? 347 LYS B N   1 
ATOM   2811 C CA  . LYS B 1 29  ? -14.566 18.910 38.393  1.00 42.27 ? 347 LYS B CA  1 
ATOM   2812 C C   . LYS B 1 29  ? -14.796 20.298 37.847  1.00 43.81 ? 347 LYS B C   1 
ATOM   2813 O O   . LYS B 1 29  ? -13.838 20.988 37.508  1.00 44.83 ? 347 LYS B O   1 
ATOM   2814 C CB  . LYS B 1 29  ? -14.053 19.074 39.814  1.00 40.66 ? 347 LYS B CB  1 
ATOM   2815 C CG  . LYS B 1 29  ? -13.682 17.788 40.486  1.00 43.88 ? 347 LYS B CG  1 
ATOM   2816 C CD  . LYS B 1 29  ? -12.355 17.943 41.220  1.00 48.68 ? 347 LYS B CD  1 
ATOM   2817 C CE  . LYS B 1 29  ? -12.583 18.391 42.637  1.00 49.28 ? 347 LYS B CE  1 
ATOM   2818 N NZ  . LYS B 1 29  ? -13.505 17.416 43.268  1.00 52.56 ? 347 LYS B NZ  1 
ATOM   2819 N N   . GLY B 1 30  ? -16.061 20.717 37.787  1.00 45.13 ? 348 GLY B N   1 
ATOM   2820 C CA  . GLY B 1 30  ? -16.422 22.047 37.294  1.00 44.97 ? 348 GLY B CA  1 
ATOM   2821 C C   . GLY B 1 30  ? -17.921 22.207 37.328  1.00 45.45 ? 348 GLY B C   1 
ATOM   2822 O O   . GLY B 1 30  ? -18.624 21.364 37.894  1.00 45.65 ? 348 GLY B O   1 
ATOM   2823 N N   . SER B 1 31  ? -18.419 23.280 36.720  1.00 45.71 ? 349 SER B N   1 
ATOM   2824 C CA  . SER B 1 31  ? -19.865 23.505 36.635  1.00 46.44 ? 349 SER B CA  1 
ATOM   2825 C C   . SER B 1 31  ? -20.625 22.312 36.051  1.00 45.63 ? 349 SER B C   1 
ATOM   2826 O O   . SER B 1 31  ? -21.823 22.187 36.250  1.00 47.10 ? 349 SER B O   1 
ATOM   2827 C CB  . SER B 1 31  ? -20.182 24.754 35.817  1.00 46.85 ? 349 SER B CB  1 
ATOM   2828 O OG  . SER B 1 31  ? -19.999 24.491 34.438  1.00 52.38 ? 349 SER B OG  1 
ATOM   2829 N N   . PHE B 1 32  ? -19.934 21.440 35.327  1.00 44.21 ? 350 PHE B N   1 
ATOM   2830 C CA  . PHE B 1 32  ? -20.551 20.220 34.851  1.00 42.67 ? 350 PHE B CA  1 
ATOM   2831 C C   . PHE B 1 32  ? -20.636 19.182 35.959  1.00 41.56 ? 350 PHE B C   1 
ATOM   2832 O O   . PHE B 1 32  ? -20.965 18.035 35.695  1.00 41.36 ? 350 PHE B O   1 
ATOM   2833 C CB  . PHE B 1 32  ? -19.763 19.648 33.679  1.00 42.80 ? 350 PHE B CB  1 
ATOM   2834 C CG  . PHE B 1 32  ? -18.302 19.457 33.969  1.00 46.93 ? 350 PHE B CG  1 
ATOM   2835 C CD1 . PHE B 1 32  ? -17.361 20.362 33.491  1.00 47.87 ? 350 PHE B CD1 1 
ATOM   2836 C CD2 . PHE B 1 32  ? -17.860 18.366 34.711  1.00 49.48 ? 350 PHE B CD2 1 
ATOM   2837 C CE1 . PHE B 1 32  ? -16.000 20.186 33.750  1.00 50.73 ? 350 PHE B CE1 1 
ATOM   2838 C CE2 . PHE B 1 32  ? -16.501 18.187 34.980  1.00 50.34 ? 350 PHE B CE2 1 
ATOM   2839 C CZ  . PHE B 1 32  ? -15.568 19.097 34.492  1.00 50.89 ? 350 PHE B CZ  1 
ATOM   2840 N N   . GLY B 1 33  ? -20.328 19.583 37.190  1.00 40.81 ? 351 GLY B N   1 
ATOM   2841 C CA  . GLY B 1 33  ? -20.246 18.655 38.316  1.00 38.97 ? 351 GLY B CA  1 
ATOM   2842 C C   . GLY B 1 33  ? -18.915 17.913 38.369  1.00 39.25 ? 351 GLY B C   1 
ATOM   2843 O O   . GLY B 1 33  ? -17.871 18.410 37.930  1.00 39.75 ? 351 GLY B O   1 
ATOM   2844 N N   . LYS B 1 34  ? -18.949 16.705 38.915  1.00 38.29 ? 352 LYS B N   1 
ATOM   2845 C CA  . LYS B 1 34  ? -17.749 15.890 39.058  1.00 35.91 ? 352 LYS B CA  1 
ATOM   2846 C C   . LYS B 1 34  ? -17.861 14.684 38.141  1.00 34.28 ? 352 LYS B C   1 
ATOM   2847 O O   . LYS B 1 34  ? -18.679 13.798 38.381  1.00 33.72 ? 352 LYS B O   1 
ATOM   2848 C CB  . LYS B 1 34  ? -17.592 15.426 40.517  1.00 35.51 ? 352 LYS B CB  1 
ATOM   2849 C CG  . LYS B 1 34  ? -16.562 14.334 40.741  1.00 32.55 ? 352 LYS B CG  1 
ATOM   2850 C CD  . LYS B 1 34  ? -16.436 14.022 42.215  1.00 38.18 ? 352 LYS B CD  1 
ATOM   2851 C CE  . LYS B 1 34  ? -15.526 15.058 42.920  1.00 48.14 ? 352 LYS B CE  1 
ATOM   2852 N NZ  . LYS B 1 34  ? -15.543 15.089 44.452  1.00 47.49 ? 352 LYS B NZ  1 
ATOM   2853 N N   . VAL B 1 35  ? -17.052 14.655 37.087  1.00 32.86 ? 353 VAL B N   1 
ATOM   2854 C CA  . VAL B 1 35  ? -16.967 13.469 36.230  1.00 32.77 ? 353 VAL B CA  1 
ATOM   2855 C C   . VAL B 1 35  ? -15.789 12.534 36.570  1.00 32.53 ? 353 VAL B C   1 
ATOM   2856 O O   . VAL B 1 35  ? -14.653 12.967 36.773  1.00 32.87 ? 353 VAL B O   1 
ATOM   2857 C CB  . VAL B 1 35  ? -16.965 13.828 34.748  1.00 32.33 ? 353 VAL B CB  1 
ATOM   2858 C CG1 . VAL B 1 35  ? -17.263 12.581 33.923  1.00 32.07 ? 353 VAL B CG1 1 
ATOM   2859 C CG2 . VAL B 1 35  ? -18.010 14.924 34.479  1.00 31.91 ? 353 VAL B CG2 1 
ATOM   2860 N N   . MET B 1 36  ? -16.085 11.245 36.611  1.00 31.30 ? 354 MET B N   1 
ATOM   2861 C CA  . MET B 1 36  ? -15.214 10.268 37.233  1.00 31.32 ? 354 MET B CA  1 
ATOM   2862 C C   . MET B 1 36  ? -14.937 9.114  36.280  1.00 30.61 ? 354 MET B C   1 
ATOM   2863 O O   . MET B 1 36  ? -15.841 8.642  35.594  1.00 30.68 ? 354 MET B O   1 
ATOM   2864 C CB  . MET B 1 36  ? -15.913 9.734  38.482  1.00 32.10 ? 354 MET B CB  1 
ATOM   2865 C CG  . MET B 1 36  ? -15.183 8.642  39.210  1.00 32.63 ? 354 MET B CG  1 
ATOM   2866 S SD  . MET B 1 36  ? -14.111 9.370  40.441  1.00 38.65 ? 354 MET B SD  1 
ATOM   2867 C CE  . MET B 1 36  ? -15.307 10.131 41.529  1.00 30.33 ? 354 MET B CE  1 
ATOM   2868 N N   . LEU B 1 37  ? -13.689 8.663  36.225  1.00 30.47 ? 355 LEU B N   1 
ATOM   2869 C CA  . LEU B 1 37  ? -13.347 7.521  35.386  1.00 29.88 ? 355 LEU B CA  1 
ATOM   2870 C C   . LEU B 1 37  ? -13.702 6.243  36.107  1.00 29.55 ? 355 LEU B C   1 
ATOM   2871 O O   . LEU B 1 37  ? -13.319 6.059  37.263  1.00 28.61 ? 355 LEU B O   1 
ATOM   2872 C CB  . LEU B 1 37  ? -11.861 7.505  35.057  1.00 29.31 ? 355 LEU B CB  1 
ATOM   2873 C CG  . LEU B 1 37  ? -11.570 6.362  34.089  1.00 30.10 ? 355 LEU B CG  1 
ATOM   2874 C CD1 . LEU B 1 37  ? -12.521 6.438  32.870  1.00 26.09 ? 355 LEU B CD1 1 
ATOM   2875 C CD2 . LEU B 1 37  ? -10.112 6.379  33.681  1.00 25.75 ? 355 LEU B CD2 1 
ATOM   2876 N N   . ALA B 1 38  ? -14.413 5.348  35.429  1.00 30.47 ? 356 ALA B N   1 
ATOM   2877 C CA  . ALA B 1 38  ? -14.856 4.120  36.090  1.00 32.19 ? 356 ALA B CA  1 
ATOM   2878 C C   . ALA B 1 38  ? -14.841 2.925  35.179  1.00 32.92 ? 356 ALA B C   1 
ATOM   2879 O O   . ALA B 1 38  ? -15.149 3.034  33.991  1.00 33.95 ? 356 ALA B O   1 
ATOM   2880 C CB  . ALA B 1 38  ? -16.259 4.300  36.666  1.00 32.15 ? 356 ALA B CB  1 
ATOM   2881 N N   . ASP B 1 39  ? -14.508 1.772  35.736  1.00 33.51 ? 357 ASP B N   1 
ATOM   2882 C CA  . ASP B 1 39  ? -14.649 0.553  34.968  1.00 36.11 ? 357 ASP B CA  1 
ATOM   2883 C C   . ASP B 1 39  ? -15.746 -0.343 35.525  1.00 37.46 ? 357 ASP B C   1 
ATOM   2884 O O   . ASP B 1 39  ? -15.940 -0.442 36.744  1.00 37.64 ? 357 ASP B O   1 
ATOM   2885 C CB  . ASP B 1 39  ? -13.328 -0.204 34.866  1.00 36.43 ? 357 ASP B CB  1 
ATOM   2886 C CG  . ASP B 1 39  ? -13.098 -1.100 36.028  1.00 40.07 ? 357 ASP B CG  1 
ATOM   2887 O OD1 . ASP B 1 39  ? -12.717 -0.572 37.090  1.00 46.23 ? 357 ASP B OD1 1 
ATOM   2888 O OD2 . ASP B 1 39  ? -13.307 -2.330 35.882  1.00 43.95 ? 357 ASP B OD2 1 
ATOM   2889 N N   . ARG B 1 40  ? -16.467 -0.991 34.616  1.00 39.15 ? 358 ARG B N   1 
ATOM   2890 C CA  . ARG B 1 40  ? -17.489 -1.937 35.011  1.00 40.98 ? 358 ARG B CA  1 
ATOM   2891 C C   . ARG B 1 40  ? -16.792 -3.106 35.690  1.00 41.15 ? 358 ARG B C   1 
ATOM   2892 O O   . ARG B 1 40  ? -15.802 -3.627 35.192  1.00 40.97 ? 358 ARG B O   1 
ATOM   2893 C CB  . ARG B 1 40  ? -18.290 -2.405 33.797  1.00 41.40 ? 358 ARG B CB  1 
ATOM   2894 C CG  . ARG B 1 40  ? -19.740 -2.757 34.093  1.00 42.54 ? 358 ARG B CG  1 
ATOM   2895 C CD  . ARG B 1 40  ? -20.504 -3.065 32.795  1.00 50.65 ? 358 ARG B CD  1 
ATOM   2896 N NE  . ARG B 1 40  ? -21.944 -3.240 33.018  1.00 57.36 ? 358 ARG B NE  1 
ATOM   2897 C CZ  . ARG B 1 40  ? -22.728 -4.049 32.305  1.00 57.96 ? 358 ARG B CZ  1 
ATOM   2898 N NH1 . ARG B 1 40  ? -22.207 -4.776 31.325  1.00 61.22 ? 358 ARG B NH1 1 
ATOM   2899 N NH2 . ARG B 1 40  ? -24.026 -4.145 32.581  1.00 55.72 ? 358 ARG B NH2 1 
ATOM   2900 N N   . LYS B 1 41  ? -17.282 -3.485 36.860  1.00 42.19 ? 359 LYS B N   1 
ATOM   2901 C CA  . LYS B 1 41  ? -16.713 -4.603 37.568  1.00 42.98 ? 359 LYS B CA  1 
ATOM   2902 C C   . LYS B 1 41  ? -16.804 -5.809 36.648  1.00 44.50 ? 359 LYS B C   1 
ATOM   2903 O O   . LYS B 1 41  ? -17.832 -6.015 36.012  1.00 45.39 ? 359 LYS B O   1 
ATOM   2904 C CB  . LYS B 1 41  ? -17.470 -4.845 38.882  1.00 42.22 ? 359 LYS B CB  1 
ATOM   2905 C CG  . LYS B 1 41  ? -16.824 -4.188 40.105  1.00 42.77 ? 359 LYS B CG  1 
ATOM   2906 C CD  . LYS B 1 41  ? -17.722 -4.228 41.359  1.00 41.87 ? 359 LYS B CD  1 
ATOM   2907 C CE  . LYS B 1 41  ? -16.985 -3.656 42.589  1.00 34.99 ? 359 LYS B CE  1 
ATOM   2908 N NZ  . LYS B 1 41  ? -17.934 -3.038 43.561  1.00 34.37 ? 359 LYS B NZ  1 
ATOM   2909 N N   . GLY B 1 42  ? -15.720 -6.580 36.552  1.00 45.81 ? 360 GLY B N   1 
ATOM   2910 C CA  . GLY B 1 42  ? -15.750 -7.887 35.888  1.00 47.78 ? 360 GLY B CA  1 
ATOM   2911 C C   . GLY B 1 42  ? -15.654 -7.831 34.375  1.00 48.71 ? 360 GLY B C   1 
ATOM   2912 O O   . GLY B 1 42  ? -15.903 -8.820 33.673  1.00 48.08 ? 360 GLY B O   1 
ATOM   2913 N N   . THR B 1 43  ? -15.282 -6.657 33.882  1.00 50.08 ? 361 THR B N   1 
ATOM   2914 C CA  . THR B 1 43  ? -15.178 -6.395 32.457  1.00 49.68 ? 361 THR B CA  1 
ATOM   2915 C C   . THR B 1 43  ? -14.408 -5.093 32.255  1.00 49.73 ? 361 THR B C   1 
ATOM   2916 O O   . THR B 1 43  ? -14.849 -4.030 32.692  1.00 51.39 ? 361 THR B O   1 
ATOM   2917 C CB  . THR B 1 43  ? -16.576 -6.348 31.767  1.00 48.63 ? 361 THR B CB  1 
ATOM   2918 O OG1 . THR B 1 43  ? -16.431 -5.874 30.426  1.00 50.85 ? 361 THR B OG1 1 
ATOM   2919 C CG2 . THR B 1 43  ? -17.536 -5.439 32.504  1.00 46.08 ? 361 THR B CG2 1 
ATOM   2920 N N   . GLU B 1 44  ? -13.252 -5.193 31.603  1.00 49.79 ? 362 GLU B N   1 
ATOM   2921 C CA  . GLU B 1 44  ? -12.397 -4.038 31.269  1.00 49.90 ? 362 GLU B CA  1 
ATOM   2922 C C   . GLU B 1 44  ? -13.090 -2.768 30.713  1.00 49.24 ? 362 GLU B C   1 
ATOM   2923 O O   . GLU B 1 44  ? -12.419 -1.766 30.510  1.00 50.52 ? 362 GLU B O   1 
ATOM   2924 C CB  . GLU B 1 44  ? -11.274 -4.465 30.303  1.00 49.72 ? 362 GLU B CB  1 
ATOM   2925 C CG  . GLU B 1 44  ? -10.138 -5.232 30.960  1.00 52.81 ? 362 GLU B CG  1 
ATOM   2926 C CD  . GLU B 1 44  ? -10.597 -6.533 31.638  1.00 57.00 ? 362 GLU B CD  1 
ATOM   2927 O OE1 . GLU B 1 44  ? -11.194 -7.397 30.954  1.00 54.87 ? 362 GLU B OE1 1 
ATOM   2928 O OE2 . GLU B 1 44  ? -10.349 -6.699 32.857  1.00 59.38 ? 362 GLU B OE2 1 
ATOM   2929 N N   . GLU B 1 45  ? -14.401 -2.803 30.454  1.00 47.50 ? 363 GLU B N   1 
ATOM   2930 C CA  . GLU B 1 45  ? -15.124 -1.626 29.956  1.00 45.11 ? 363 GLU B CA  1 
ATOM   2931 C C   . GLU B 1 45  ? -14.900 -0.407 30.820  1.00 43.39 ? 363 GLU B C   1 
ATOM   2932 O O   . GLU B 1 45  ? -14.855 -0.494 32.046  1.00 44.72 ? 363 GLU B O   1 
ATOM   2933 C CB  . GLU B 1 45  ? -16.617 -1.881 29.944  1.00 45.48 ? 363 GLU B CB  1 
ATOM   2934 C CG  . GLU B 1 45  ? -17.238 -1.980 28.602  1.00 47.03 ? 363 GLU B CG  1 
ATOM   2935 C CD  . GLU B 1 45  ? -18.265 -3.077 28.603  1.00 51.77 ? 363 GLU B CD  1 
ATOM   2936 O OE1 . GLU B 1 45  ? -19.271 -2.957 29.348  1.00 49.96 ? 363 GLU B OE1 1 
ATOM   2937 O OE2 . GLU B 1 45  ? -18.042 -4.081 27.889  1.00 52.27 ? 363 GLU B OE2 1 
ATOM   2938 N N   . LEU B 1 46  ? -14.806 0.741  30.180  1.00 39.85 ? 364 LEU B N   1 
ATOM   2939 C CA  . LEU B 1 46  ? -14.619 1.981  30.899  1.00 36.05 ? 364 LEU B CA  1 
ATOM   2940 C C   . LEU B 1 46  ? -15.790 2.926  30.623  1.00 34.18 ? 364 LEU B C   1 
ATOM   2941 O O   . LEU B 1 46  ? -16.453 2.848  29.580  1.00 32.43 ? 364 LEU B O   1 
ATOM   2942 C CB  . LEU B 1 46  ? -13.303 2.622  30.456  1.00 35.93 ? 364 LEU B CB  1 
ATOM   2943 C CG  . LEU B 1 46  ? -12.040 2.529  31.322  1.00 34.67 ? 364 LEU B CG  1 
ATOM   2944 C CD1 . LEU B 1 46  ? -12.111 1.480  32.392  1.00 28.67 ? 364 LEU B CD1 1 
ATOM   2945 C CD2 . LEU B 1 46  ? -10.825 2.319  30.442  1.00 33.15 ? 364 LEU B CD2 1 
ATOM   2946 N N   . TYR B 1 47  ? -16.056 3.811  31.573  1.00 31.93 ? 365 TYR B N   1 
ATOM   2947 C CA  . TYR B 1 47  ? -17.084 4.812  31.394  1.00 29.24 ? 365 TYR B CA  1 
ATOM   2948 C C   . TYR B 1 47  ? -16.705 6.033  32.183  1.00 29.26 ? 365 TYR B C   1 
ATOM   2949 O O   . TYR B 1 47  ? -15.989 5.946  33.189  1.00 28.23 ? 365 TYR B O   1 
ATOM   2950 C CB  . TYR B 1 47  ? -18.404 4.331  31.958  1.00 29.23 ? 365 TYR B CB  1 
ATOM   2951 C CG  . TYR B 1 47  ? -18.944 3.055  31.395  1.00 24.84 ? 365 TYR B CG  1 
ATOM   2952 C CD1 . TYR B 1 47  ? -18.581 1.831  31.916  1.00 26.09 ? 365 TYR B CD1 1 
ATOM   2953 C CD2 . TYR B 1 47  ? -19.859 3.079  30.373  1.00 27.31 ? 365 TYR B CD2 1 
ATOM   2954 C CE1 . TYR B 1 47  ? -19.100 0.658  31.405  1.00 28.63 ? 365 TYR B CE1 1 
ATOM   2955 C CE2 . TYR B 1 47  ? -20.391 1.927  29.861  1.00 30.36 ? 365 TYR B CE2 1 
ATOM   2956 C CZ  . TYR B 1 47  ? -20.016 0.717  30.374  1.00 30.65 ? 365 TYR B CZ  1 
ATOM   2957 O OH  . TYR B 1 47  ? -20.571 -0.422 29.830  1.00 36.93 ? 365 TYR B OH  1 
ATOM   2958 N N   . ALA B 1 48  ? -17.202 7.174  31.727  1.00 30.22 ? 366 ALA B N   1 
ATOM   2959 C CA  . ALA B 1 48  ? -17.190 8.387  32.531  1.00 30.53 ? 366 ALA B CA  1 
ATOM   2960 C C   . ALA B 1 48  ? -18.533 8.444  33.244  1.00 32.01 ? 366 ALA B C   1 
ATOM   2961 O O   . ALA B 1 48  ? -19.584 8.181  32.633  1.00 33.27 ? 366 ALA B O   1 
ATOM   2962 C CB  . ALA B 1 48  ? -17.003 9.598  31.668  1.00 28.84 ? 366 ALA B CB  1 
ATOM   2963 N N   . ILE B 1 49  ? -18.500 8.748  34.540  1.00 31.48 ? 367 ILE B N   1 
ATOM   2964 C CA  . ILE B 1 49  ? -19.727 8.894  35.303  1.00 31.62 ? 367 ILE B CA  1 
ATOM   2965 C C   . ILE B 1 49  ? -19.824 10.287 35.925  1.00 32.60 ? 367 ILE B C   1 
ATOM   2966 O O   . ILE B 1 49  ? -18.954 10.686 36.704  1.00 34.21 ? 367 ILE B O   1 
ATOM   2967 C CB  . ILE B 1 49  ? -19.831 7.845  36.413  1.00 30.61 ? 367 ILE B CB  1 
ATOM   2968 C CG1 . ILE B 1 49  ? -19.396 6.473  35.904  1.00 31.08 ? 367 ILE B CG1 1 
ATOM   2969 C CG2 . ILE B 1 49  ? -21.267 7.755  36.926  1.00 33.23 ? 367 ILE B CG2 1 
ATOM   2970 C CD1 . ILE B 1 49  ? -19.677 5.334  36.902  1.00 26.12 ? 367 ILE B CD1 1 
ATOM   2971 N N   . LYS B 1 50  ? -20.867 11.039 35.575  1.00 31.87 ? 368 LYS B N   1 
ATOM   2972 C CA  . LYS B 1 50  ? -21.112 12.299 36.260  1.00 30.33 ? 368 LYS B CA  1 
ATOM   2973 C C   . LYS B 1 50  ? -21.829 11.940 37.540  1.00 30.98 ? 368 LYS B C   1 
ATOM   2974 O O   . LYS B 1 50  ? -22.680 11.046 37.525  1.00 31.04 ? 368 LYS B O   1 
ATOM   2975 C CB  . LYS B 1 50  ? -21.972 13.242 35.434  1.00 29.24 ? 368 LYS B CB  1 
ATOM   2976 C CG  . LYS B 1 50  ? -22.371 14.518 36.162  1.00 28.17 ? 368 LYS B CG  1 
ATOM   2977 C CD  . LYS B 1 50  ? -22.915 15.528 35.161  1.00 33.12 ? 368 LYS B CD  1 
ATOM   2978 C CE  . LYS B 1 50  ? -23.621 16.701 35.802  1.00 31.31 ? 368 LYS B CE  1 
ATOM   2979 N NZ  . LYS B 1 50  ? -24.006 17.670 34.729  1.00 38.34 ? 368 LYS B NZ  1 
ATOM   2980 N N   . ILE B 1 51  ? -21.462 12.630 38.629  1.00 29.58 ? 369 ILE B N   1 
ATOM   2981 C CA  . ILE B 1 51  ? -22.014 12.426 39.943  1.00 27.23 ? 369 ILE B CA  1 
ATOM   2982 C C   . ILE B 1 51  ? -22.329 13.773 40.545  1.00 28.49 ? 369 ILE B C   1 
ATOM   2983 O O   . ILE B 1 51  ? -21.517 14.688 40.487  1.00 29.33 ? 369 ILE B O   1 
ATOM   2984 C CB  . ILE B 1 51  ? -20.994 11.796 40.840  1.00 26.68 ? 369 ILE B CB  1 
ATOM   2985 C CG1 . ILE B 1 51  ? -20.369 10.595 40.149  1.00 27.99 ? 369 ILE B CG1 1 
ATOM   2986 C CG2 . ILE B 1 51  ? -21.631 11.367 42.139  1.00 27.40 ? 369 ILE B CG2 1 
ATOM   2987 C CD1 . ILE B 1 51  ? -19.104 10.136 40.820  1.00 29.71 ? 369 ILE B CD1 1 
ATOM   2988 N N   . LEU B 1 52  ? -23.508 13.887 41.146  1.00 28.32 ? 370 LEU B N   1 
ATOM   2989 C CA  . LEU B 1 52  ? -23.952 15.131 41.727  1.00 26.70 ? 370 LEU B CA  1 
ATOM   2990 C C   . LEU B 1 52  ? -24.504 14.829 43.087  1.00 28.06 ? 370 LEU B C   1 
ATOM   2991 O O   . LEU B 1 52  ? -25.289 13.892 43.230  1.00 30.80 ? 370 LEU B O   1 
ATOM   2992 C CB  . LEU B 1 52  ? -25.086 15.705 40.899  1.00 25.11 ? 370 LEU B CB  1 
ATOM   2993 C CG  . LEU B 1 52  ? -24.727 16.212 39.516  1.00 23.21 ? 370 LEU B CG  1 
ATOM   2994 C CD1 . LEU B 1 52  ? -25.982 16.301 38.712  1.00 15.91 ? 370 LEU B CD1 1 
ATOM   2995 C CD2 . LEU B 1 52  ? -24.024 17.560 39.603  1.00 21.31 ? 370 LEU B CD2 1 
ATOM   2996 N N   . LYS B 1 53  ? -24.123 15.615 44.090  1.00 26.17 ? 371 LYS B N   1 
ATOM   2997 C CA  . LYS B 1 53  ? -24.804 15.511 45.358  1.00 25.43 ? 371 LYS B CA  1 
ATOM   2998 C C   . LYS B 1 53  ? -26.236 16.030 45.237  1.00 24.64 ? 371 LYS B C   1 
ATOM   2999 O O   . LYS B 1 53  ? -26.481 17.126 44.701  1.00 23.45 ? 371 LYS B O   1 
ATOM   3000 C CB  . LYS B 1 53  ? -24.006 16.202 46.454  1.00 25.61 ? 371 LYS B CB  1 
ATOM   3001 C CG  . LYS B 1 53  ? -22.819 15.335 46.871  1.00 28.34 ? 371 LYS B CG  1 
ATOM   3002 C CD  . LYS B 1 53  ? -21.685 16.126 47.502  1.00 30.13 ? 371 LYS B CD  1 
ATOM   3003 C CE  . LYS B 1 53  ? -21.655 15.941 48.996  1.00 28.43 ? 371 LYS B CE  1 
ATOM   3004 N NZ  . LYS B 1 53  ? -22.936 16.391 49.609  1.00 35.56 ? 371 LYS B NZ  1 
ATOM   3005 N N   . LYS B 1 54  ? -27.196 15.229 45.698  1.00 24.48 ? 372 LYS B N   1 
ATOM   3006 C CA  . LYS B 1 54  ? -28.601 15.665 45.621  1.00 24.45 ? 372 LYS B CA  1 
ATOM   3007 C C   . LYS B 1 54  ? -28.807 16.977 46.349  1.00 24.70 ? 372 LYS B C   1 
ATOM   3008 O O   . LYS B 1 54  ? -29.268 17.949 45.762  1.00 25.67 ? 372 LYS B O   1 
ATOM   3009 C CB  . LYS B 1 54  ? -29.570 14.610 46.128  1.00 23.56 ? 372 LYS B CB  1 
ATOM   3010 C CG  . LYS B 1 54  ? -30.179 13.810 45.011  1.00 21.89 ? 372 LYS B CG  1 
ATOM   3011 C CD  . LYS B 1 54  ? -30.610 12.469 45.528  1.00 22.69 ? 372 LYS B CD  1 
ATOM   3012 C CE  . LYS B 1 54  ? -31.451 11.750 44.498  1.00 25.68 ? 372 LYS B CE  1 
ATOM   3013 N NZ  . LYS B 1 54  ? -32.318 10.735 45.139  1.00 26.08 ? 372 LYS B NZ  1 
ATOM   3014 N N   . ASP B 1 55  ? -28.422 17.017 47.616  1.00 24.98 ? 373 ASP B N   1 
ATOM   3015 C CA  . ASP B 1 55  ? -28.499 18.244 48.361  1.00 26.41 ? 373 ASP B CA  1 
ATOM   3016 C C   . ASP B 1 55  ? -27.914 19.437 47.573  1.00 26.95 ? 373 ASP B C   1 
ATOM   3017 O O   . ASP B 1 55  ? -28.549 20.499 47.506  1.00 27.00 ? 373 ASP B O   1 
ATOM   3018 C CB  . ASP B 1 55  ? -27.875 18.081 49.751  1.00 27.34 ? 373 ASP B CB  1 
ATOM   3019 C CG  . ASP B 1 55  ? -26.350 17.990 49.723  1.00 38.63 ? 373 ASP B CG  1 
ATOM   3020 O OD1 . ASP B 1 55  ? -25.785 17.471 48.718  1.00 47.24 ? 373 ASP B OD1 1 
ATOM   3021 O OD2 . ASP B 1 55  ? -25.714 18.438 50.718  1.00 43.48 ? 373 ASP B OD2 1 
ATOM   3022 N N   . VAL B 1 56  ? -26.750 19.257 46.935  1.00 26.24 ? 374 VAL B N   1 
ATOM   3023 C CA  . VAL B 1 56  ? -26.044 20.392 46.343  1.00 25.79 ? 374 VAL B CA  1 
ATOM   3024 C C   . VAL B 1 56  ? -26.781 20.905 45.134  1.00 27.24 ? 374 VAL B C   1 
ATOM   3025 O O   . VAL B 1 56  ? -27.016 22.134 45.008  1.00 25.95 ? 374 VAL B O   1 
ATOM   3026 C CB  . VAL B 1 56  ? -24.579 20.097 45.988  1.00 25.05 ? 374 VAL B CB  1 
ATOM   3027 C CG1 . VAL B 1 56  ? -23.982 21.260 45.264  1.00 23.99 ? 374 VAL B CG1 1 
ATOM   3028 C CG2 . VAL B 1 56  ? -23.789 19.853 47.245  1.00 24.29 ? 374 VAL B CG2 1 
ATOM   3029 N N   . VAL B 1 57  ? -27.169 19.970 44.263  1.00 27.71 ? 375 VAL B N   1 
ATOM   3030 C CA  . VAL B 1 57  ? -28.006 20.325 43.106  1.00 28.72 ? 375 VAL B CA  1 
ATOM   3031 C C   . VAL B 1 57  ? -29.177 21.200 43.573  1.00 29.48 ? 375 VAL B C   1 
ATOM   3032 O O   . VAL B 1 57  ? -29.406 22.296 43.033  1.00 28.50 ? 375 VAL B O   1 
ATOM   3033 C CB  . VAL B 1 57  ? -28.552 19.078 42.376  1.00 28.30 ? 375 VAL B CB  1 
ATOM   3034 C CG1 . VAL B 1 57  ? -29.633 19.460 41.376  1.00 25.61 ? 375 VAL B CG1 1 
ATOM   3035 C CG2 . VAL B 1 57  ? -27.431 18.367 41.663  1.00 31.81 ? 375 VAL B CG2 1 
ATOM   3036 N N   . ILE B 1 58  ? -29.881 20.713 44.600  1.00 29.70 ? 376 ILE B N   1 
ATOM   3037 C CA  . ILE B 1 58  ? -31.006 21.422 45.190  1.00 30.58 ? 376 ILE B CA  1 
ATOM   3038 C C   . ILE B 1 58  ? -30.582 22.786 45.697  1.00 31.78 ? 376 ILE B C   1 
ATOM   3039 O O   . ILE B 1 58  ? -31.139 23.801 45.322  1.00 31.62 ? 376 ILE B O   1 
ATOM   3040 C CB  . ILE B 1 58  ? -31.614 20.648 46.368  1.00 30.98 ? 376 ILE B CB  1 
ATOM   3041 C CG1 . ILE B 1 58  ? -32.599 19.601 45.858  1.00 28.06 ? 376 ILE B CG1 1 
ATOM   3042 C CG2 . ILE B 1 58  ? -32.318 21.611 47.330  1.00 25.87 ? 376 ILE B CG2 1 
ATOM   3043 C CD1 . ILE B 1 58  ? -33.009 18.620 46.907  1.00 31.52 ? 376 ILE B CD1 1 
ATOM   3044 N N   . GLN B 1 59  ? -29.575 22.794 46.541  1.00 33.02 ? 377 GLN B N   1 
ATOM   3045 C CA  . GLN B 1 59  ? -29.081 24.007 47.127  1.00 36.38 ? 377 GLN B CA  1 
ATOM   3046 C C   . GLN B 1 59  ? -28.673 25.043 46.088  1.00 36.31 ? 377 GLN B C   1 
ATOM   3047 O O   . GLN B 1 59  ? -28.642 26.229 46.392  1.00 36.04 ? 377 GLN B O   1 
ATOM   3048 C CB  . GLN B 1 59  ? -27.877 23.626 47.951  1.00 39.39 ? 377 GLN B CB  1 
ATOM   3049 C CG  . GLN B 1 59  ? -27.437 24.553 49.033  1.00 44.51 ? 377 GLN B CG  1 
ATOM   3050 C CD  . GLN B 1 59  ? -26.013 24.183 49.412  1.00 55.92 ? 377 GLN B CD  1 
ATOM   3051 O OE1 . GLN B 1 59  ? -25.064 24.895 49.053  1.00 59.84 ? 377 GLN B OE1 1 
ATOM   3052 N NE2 . GLN B 1 59  ? -25.844 23.015 50.062  1.00 51.66 ? 377 GLN B NE2 1 
ATOM   3053 N N   . ASP B 1 60  ? -28.365 24.592 44.870  1.00 36.92 ? 378 ASP B N   1 
ATOM   3054 C CA  . ASP B 1 60  ? -27.898 25.468 43.792  1.00 35.72 ? 378 ASP B CA  1 
ATOM   3055 C C   . ASP B 1 60  ? -28.979 25.783 42.757  1.00 35.41 ? 378 ASP B C   1 
ATOM   3056 O O   . ASP B 1 60  ? -28.673 26.115 41.613  1.00 34.65 ? 378 ASP B O   1 
ATOM   3057 C CB  . ASP B 1 60  ? -26.714 24.814 43.076  1.00 36.86 ? 378 ASP B CB  1 
ATOM   3058 C CG  . ASP B 1 60  ? -25.389 25.019 43.807  1.00 39.16 ? 378 ASP B CG  1 
ATOM   3059 O OD1 . ASP B 1 60  ? -25.273 26.061 44.490  1.00 38.80 ? 378 ASP B OD1 1 
ATOM   3060 O OD2 . ASP B 1 60  ? -24.469 24.153 43.691  1.00 32.00 ? 378 ASP B OD2 1 
ATOM   3061 N N   . ASP B 1 61  ? -30.240 25.673 43.151  1.00 35.38 ? 379 ASP B N   1 
ATOM   3062 C CA  . ASP B 1 61  ? -31.361 25.942 42.245  1.00 37.06 ? 379 ASP B CA  1 
ATOM   3063 C C   . ASP B 1 61  ? -31.164 25.274 40.907  1.00 37.26 ? 379 ASP B C   1 
ATOM   3064 O O   . ASP B 1 61  ? -31.372 25.896 39.860  1.00 38.80 ? 379 ASP B O   1 
ATOM   3065 C CB  . ASP B 1 61  ? -31.509 27.437 42.001  1.00 38.15 ? 379 ASP B CB  1 
ATOM   3066 C CG  . ASP B 1 61  ? -31.650 28.225 43.285  1.00 43.89 ? 379 ASP B CG  1 
ATOM   3067 O OD1 . ASP B 1 61  ? -32.550 27.885 44.093  1.00 46.74 ? 379 ASP B OD1 1 
ATOM   3068 O OD2 . ASP B 1 61  ? -30.868 29.191 43.476  1.00 47.82 ? 379 ASP B OD2 1 
ATOM   3069 N N   . ASP B 1 62  ? -30.766 24.010 40.935  1.00 35.75 ? 380 ASP B N   1 
ATOM   3070 C CA  . ASP B 1 62  ? -30.303 23.352 39.729  1.00 33.73 ? 380 ASP B CA  1 
ATOM   3071 C C   . ASP B 1 62  ? -31.162 22.174 39.320  1.00 33.18 ? 380 ASP B C   1 
ATOM   3072 O O   . ASP B 1 62  ? -30.830 21.459 38.366  1.00 32.81 ? 380 ASP B O   1 
ATOM   3073 C CB  . ASP B 1 62  ? -28.872 22.853 39.919  1.00 33.45 ? 380 ASP B CB  1 
ATOM   3074 C CG  . ASP B 1 62  ? -27.840 23.878 39.534  1.00 32.77 ? 380 ASP B CG  1 
ATOM   3075 O OD1 . ASP B 1 62  ? -27.977 24.488 38.458  1.00 32.66 ? 380 ASP B OD1 1 
ATOM   3076 O OD2 . ASP B 1 62  ? -26.870 24.060 40.296  1.00 37.93 ? 380 ASP B OD2 1 
ATOM   3077 N N   . VAL B 1 63  ? -32.255 21.938 40.029  1.00 31.72 ? 381 VAL B N   1 
ATOM   3078 C CA  . VAL B 1 63  ? -32.996 20.730 39.730  1.00 30.67 ? 381 VAL B CA  1 
ATOM   3079 C C   . VAL B 1 63  ? -33.454 20.710 38.268  1.00 31.45 ? 381 VAL B C   1 
ATOM   3080 O O   . VAL B 1 63  ? -33.310 19.689 37.574  1.00 30.78 ? 381 VAL B O   1 
ATOM   3081 C CB  . VAL B 1 63  ? -34.132 20.500 40.709  1.00 30.22 ? 381 VAL B CB  1 
ATOM   3082 C CG1 . VAL B 1 63  ? -34.872 19.230 40.352  1.00 31.43 ? 381 VAL B CG1 1 
ATOM   3083 C CG2 . VAL B 1 63  ? -33.576 20.401 42.116  1.00 27.73 ? 381 VAL B CG2 1 
ATOM   3084 N N   . GLU B 1 64  ? -33.950 21.847 37.789  1.00 31.84 ? 382 GLU B N   1 
ATOM   3085 C CA  . GLU B 1 64  ? -34.399 21.957 36.406  1.00 34.90 ? 382 GLU B CA  1 
ATOM   3086 C C   . GLU B 1 64  ? -33.324 21.498 35.431  1.00 34.50 ? 382 GLU B C   1 
ATOM   3087 O O   . GLU B 1 64  ? -33.511 20.553 34.671  1.00 34.26 ? 382 GLU B O   1 
ATOM   3088 C CB  . GLU B 1 64  ? -34.809 23.392 36.062  1.00 37.29 ? 382 GLU B CB  1 
ATOM   3089 C CG  . GLU B 1 64  ? -35.417 24.223 37.232  1.00 49.29 ? 382 GLU B CG  1 
ATOM   3090 C CD  . GLU B 1 64  ? -34.387 24.633 38.312  1.00 59.95 ? 382 GLU B CD  1 
ATOM   3091 O OE1 . GLU B 1 64  ? -33.195 24.868 37.981  1.00 63.58 ? 382 GLU B OE1 1 
ATOM   3092 O OE2 . GLU B 1 64  ? -34.777 24.714 39.500  1.00 64.16 ? 382 GLU B OE2 1 
ATOM   3093 N N   . CYS B 1 65  ? -32.182 22.152 35.426  1.00 34.29 ? 383 CYS B N   1 
ATOM   3094 C CA  . CYS B 1 65  ? -31.293 21.857 34.321  1.00 37.09 ? 383 CYS B CA  1 
ATOM   3095 C C   . CYS B 1 65  ? -30.621 20.472 34.431  1.00 35.88 ? 383 CYS B C   1 
ATOM   3096 O O   . CYS B 1 65  ? -30.250 19.859 33.422  1.00 34.90 ? 383 CYS B O   1 
ATOM   3097 C CB  . CYS B 1 65  ? -30.300 22.992 34.096  1.00 36.95 ? 383 CYS B CB  1 
ATOM   3098 S SG  . CYS B 1 65  ? -29.410 23.343 35.572  1.00 49.04 ? 383 CYS B SG  1 
ATOM   3099 N N   . THR B 1 66  ? -30.489 19.966 35.646  1.00 35.06 ? 384 THR B N   1 
ATOM   3100 C CA  . THR B 1 66  ? -30.088 18.589 35.782  1.00 35.67 ? 384 THR B CA  1 
ATOM   3101 C C   . THR B 1 66  ? -31.055 17.708 34.995  1.00 36.81 ? 384 THR B C   1 
ATOM   3102 O O   . THR B 1 66  ? -30.632 16.917 34.139  1.00 37.45 ? 384 THR B O   1 
ATOM   3103 C CB  . THR B 1 66  ? -30.155 18.140 37.204  1.00 34.76 ? 384 THR B CB  1 
ATOM   3104 O OG1 . THR B 1 66  ? -29.392 19.035 38.010  1.00 38.31 ? 384 THR B OG1 1 
ATOM   3105 C CG2 . THR B 1 66  ? -29.575 16.766 37.317  1.00 34.94 ? 384 THR B CG2 1 
ATOM   3106 N N   . MET B 1 67  ? -32.352 17.856 35.286  1.00 36.66 ? 385 MET B N   1 
ATOM   3107 C CA  . MET B 1 67  ? -33.389 17.046 34.638  1.00 35.82 ? 385 MET B CA  1 
ATOM   3108 C C   . MET B 1 67  ? -33.370 17.271 33.141  1.00 34.81 ? 385 MET B C   1 
ATOM   3109 O O   . MET B 1 67  ? -33.411 16.319 32.361  1.00 35.73 ? 385 MET B O   1 
ATOM   3110 C CB  . MET B 1 67  ? -34.783 17.358 35.194  1.00 36.24 ? 385 MET B CB  1 
ATOM   3111 C CG  . MET B 1 67  ? -34.990 17.007 36.646  1.00 33.96 ? 385 MET B CG  1 
ATOM   3112 S SD  . MET B 1 67  ? -34.546 15.304 36.985  1.00 38.11 ? 385 MET B SD  1 
ATOM   3113 C CE  . MET B 1 67  ? -35.618 14.431 35.853  1.00 35.68 ? 385 MET B CE  1 
ATOM   3114 N N   . VAL B 1 68  ? -33.297 18.534 32.742  1.00 33.63 ? 386 VAL B N   1 
ATOM   3115 C CA  . VAL B 1 68  ? -33.111 18.868 31.329  1.00 32.50 ? 386 VAL B CA  1 
ATOM   3116 C C   . VAL B 1 68  ? -31.891 18.139 30.737  1.00 33.21 ? 386 VAL B C   1 
ATOM   3117 O O   . VAL B 1 68  ? -32.031 17.431 29.716  1.00 33.42 ? 386 VAL B O   1 
ATOM   3118 C CB  . VAL B 1 68  ? -32.985 20.384 31.113  1.00 31.92 ? 386 VAL B CB  1 
ATOM   3119 C CG1 . VAL B 1 68  ? -32.722 20.690 29.661  1.00 28.54 ? 386 VAL B CG1 1 
ATOM   3120 C CG2 . VAL B 1 68  ? -34.234 21.080 31.580  1.00 30.05 ? 386 VAL B CG2 1 
ATOM   3121 N N   . GLU B 1 69  ? -30.710 18.290 31.372  1.00 31.87 ? 387 GLU B N   1 
ATOM   3122 C CA  . GLU B 1 69  ? -29.532 17.516 30.949  1.00 29.90 ? 387 GLU B CA  1 
ATOM   3123 C C   . GLU B 1 69  ? -29.906 16.056 30.760  1.00 29.66 ? 387 GLU B C   1 
ATOM   3124 O O   . GLU B 1 69  ? -29.726 15.517 29.687  1.00 30.90 ? 387 GLU B O   1 
ATOM   3125 C CB  . GLU B 1 69  ? -28.327 17.637 31.887  1.00 29.20 ? 387 GLU B CB  1 
ATOM   3126 C CG  . GLU B 1 69  ? -27.160 16.711 31.447  1.00 28.06 ? 387 GLU B CG  1 
ATOM   3127 C CD  . GLU B 1 69  ? -25.769 17.066 32.028  1.00 33.64 ? 387 GLU B CD  1 
ATOM   3128 O OE1 . GLU B 1 69  ? -25.661 17.584 33.167  1.00 35.32 ? 387 GLU B OE1 1 
ATOM   3129 O OE2 . GLU B 1 69  ? -24.758 16.798 31.333  1.00 36.11 ? 387 GLU B OE2 1 
ATOM   3130 N N   . LYS B 1 70  ? -30.461 15.417 31.779  1.00 29.20 ? 388 LYS B N   1 
ATOM   3131 C CA  . LYS B 1 70  ? -30.882 14.038 31.611  1.00 29.55 ? 388 LYS B CA  1 
ATOM   3132 C C   . LYS B 1 70  ? -31.751 13.842 30.354  1.00 30.42 ? 388 LYS B C   1 
ATOM   3133 O O   . LYS B 1 70  ? -31.474 12.997 29.509  1.00 30.03 ? 388 LYS B O   1 
ATOM   3134 C CB  . LYS B 1 70  ? -31.604 13.551 32.858  1.00 29.32 ? 388 LYS B CB  1 
ATOM   3135 C CG  . LYS B 1 70  ? -32.062 12.105 32.780  1.00 30.76 ? 388 LYS B CG  1 
ATOM   3136 C CD  . LYS B 1 70  ? -33.462 12.029 32.164  1.00 33.31 ? 388 LYS B CD  1 
ATOM   3137 C CE  . LYS B 1 70  ? -34.138 10.712 32.465  1.00 29.77 ? 388 LYS B CE  1 
ATOM   3138 N NZ  . LYS B 1 70  ? -35.595 10.897 32.394  1.00 32.66 ? 388 LYS B NZ  1 
ATOM   3139 N N   . ARG B 1 71  ? -32.809 14.621 30.228  1.00 31.53 ? 389 ARG B N   1 
ATOM   3140 C CA  . ARG B 1 71  ? -33.693 14.468 29.089  1.00 31.79 ? 389 ARG B CA  1 
ATOM   3141 C C   . ARG B 1 71  ? -32.963 14.649 27.773  1.00 31.50 ? 389 ARG B C   1 
ATOM   3142 O O   . ARG B 1 71  ? -33.208 13.929 26.816  1.00 31.79 ? 389 ARG B O   1 
ATOM   3143 C CB  . ARG B 1 71  ? -34.802 15.497 29.166  1.00 32.50 ? 389 ARG B CB  1 
ATOM   3144 C CG  . ARG B 1 71  ? -35.899 15.124 30.100  1.00 34.27 ? 389 ARG B CG  1 
ATOM   3145 C CD  . ARG B 1 71  ? -37.142 15.916 29.780  1.00 32.76 ? 389 ARG B CD  1 
ATOM   3146 N NE  . ARG B 1 71  ? -37.033 17.299 30.230  1.00 36.79 ? 389 ARG B NE  1 
ATOM   3147 C CZ  . ARG B 1 71  ? -37.054 17.679 31.510  1.00 39.82 ? 389 ARG B CZ  1 
ATOM   3148 N NH1 . ARG B 1 71  ? -37.158 16.776 32.483  1.00 33.46 ? 389 ARG B NH1 1 
ATOM   3149 N NH2 . ARG B 1 71  ? -36.974 18.972 31.817  1.00 39.37 ? 389 ARG B NH2 1 
ATOM   3150 N N   . VAL B 1 72  ? -32.091 15.644 27.718  1.00 31.65 ? 390 VAL B N   1 
ATOM   3151 C CA  . VAL B 1 72  ? -31.379 15.942 26.484  1.00 31.82 ? 390 VAL B CA  1 
ATOM   3152 C C   . VAL B 1 72  ? -30.389 14.832 26.124  1.00 33.72 ? 390 VAL B C   1 
ATOM   3153 O O   . VAL B 1 72  ? -30.309 14.409 24.969  1.00 35.27 ? 390 VAL B O   1 
ATOM   3154 C CB  . VAL B 1 72  ? -30.633 17.253 26.586  1.00 30.62 ? 390 VAL B CB  1 
ATOM   3155 C CG1 . VAL B 1 72  ? -29.752 17.421 25.373  1.00 27.05 ? 390 VAL B CG1 1 
ATOM   3156 C CG2 . VAL B 1 72  ? -31.625 18.395 26.715  1.00 30.15 ? 390 VAL B CG2 1 
ATOM   3157 N N   . LEU B 1 73  ? -29.630 14.386 27.123  1.00 33.44 ? 391 LEU B N   1 
ATOM   3158 C CA  . LEU B 1 73  ? -28.815 13.186 27.047  1.00 32.88 ? 391 LEU B CA  1 
ATOM   3159 C C   . LEU B 1 73  ? -29.614 11.936 26.610  1.00 34.48 ? 391 LEU B C   1 
ATOM   3160 O O   . LEU B 1 73  ? -29.063 11.009 26.020  1.00 33.93 ? 391 LEU B O   1 
ATOM   3161 C CB  . LEU B 1 73  ? -28.179 12.942 28.417  1.00 31.35 ? 391 LEU B CB  1 
ATOM   3162 C CG  . LEU B 1 73  ? -26.858 13.668 28.631  1.00 29.61 ? 391 LEU B CG  1 
ATOM   3163 C CD1 . LEU B 1 73  ? -26.152 13.187 29.889  1.00 28.25 ? 391 LEU B CD1 1 
ATOM   3164 C CD2 . LEU B 1 73  ? -26.014 13.370 27.431  1.00 25.94 ? 391 LEU B CD2 1 
ATOM   3165 N N   . ALA B 1 74  ? -30.914 11.918 26.889  1.00 35.95 ? 392 ALA B N   1 
ATOM   3166 C CA  . ALA B 1 74  ? -31.681 10.687 26.755  1.00 37.80 ? 392 ALA B CA  1 
ATOM   3167 C C   . ALA B 1 74  ? -32.359 10.548 25.400  1.00 39.19 ? 392 ALA B C   1 
ATOM   3168 O O   . ALA B 1 74  ? -32.793 9.453  25.025  1.00 40.34 ? 392 ALA B O   1 
ATOM   3169 C CB  . ALA B 1 74  ? -32.694 10.547 27.894  1.00 36.71 ? 392 ALA B CB  1 
ATOM   3170 N N   . LEU B 1 75  ? -32.430 11.648 24.661  1.00 40.14 ? 393 LEU B N   1 
ATOM   3171 C CA  . LEU B 1 75  ? -33.072 11.648 23.348  1.00 42.07 ? 393 LEU B CA  1 
ATOM   3172 C C   . LEU B 1 75  ? -32.696 10.434 22.478  1.00 44.33 ? 393 LEU B C   1 
ATOM   3173 O O   . LEU B 1 75  ? -31.527 10.040 22.425  1.00 46.78 ? 393 LEU B O   1 
ATOM   3174 C CB  . LEU B 1 75  ? -32.758 12.956 22.622  1.00 41.44 ? 393 LEU B CB  1 
ATOM   3175 C CG  . LEU B 1 75  ? -33.400 14.191 23.256  1.00 38.23 ? 393 LEU B CG  1 
ATOM   3176 C CD1 . LEU B 1 75  ? -32.688 15.417 22.770  1.00 39.52 ? 393 LEU B CD1 1 
ATOM   3177 C CD2 . LEU B 1 75  ? -34.888 14.261 22.938  1.00 34.45 ? 393 LEU B CD2 1 
ATOM   3178 N N   . LEU B 1 76  ? -33.685 9.834  21.814  1.00 45.12 ? 394 LEU B N   1 
ATOM   3179 C CA  . LEU B 1 76  ? -33.420 8.701  20.920  1.00 45.41 ? 394 LEU B CA  1 
ATOM   3180 C C   . LEU B 1 76  ? -32.817 9.198  19.613  1.00 46.17 ? 394 LEU B C   1 
ATOM   3181 O O   . LEU B 1 76  ? -32.945 10.381 19.284  1.00 46.72 ? 394 LEU B O   1 
ATOM   3182 C CB  . LEU B 1 76  ? -34.707 7.934  20.628  1.00 45.20 ? 394 LEU B CB  1 
ATOM   3183 C CG  . LEU B 1 76  ? -35.482 7.341  21.812  1.00 45.98 ? 394 LEU B CG  1 
ATOM   3184 C CD1 . LEU B 1 76  ? -36.957 7.165  21.468  1.00 46.83 ? 394 LEU B CD1 1 
ATOM   3185 C CD2 . LEU B 1 76  ? -34.886 6.021  22.288  1.00 45.29 ? 394 LEU B CD2 1 
ATOM   3186 N N   . ASP B 1 77  ? -32.148 8.302  18.886  1.00 46.50 ? 395 ASP B N   1 
ATOM   3187 C CA  . ASP B 1 77  ? -31.630 8.589  17.525  1.00 46.15 ? 395 ASP B CA  1 
ATOM   3188 C C   . ASP B 1 77  ? -30.369 9.474  17.431  1.00 44.63 ? 395 ASP B C   1 
ATOM   3189 O O   . ASP B 1 77  ? -29.975 9.883  16.335  1.00 44.71 ? 395 ASP B O   1 
ATOM   3190 C CB  . ASP B 1 77  ? -32.736 9.176  16.623  1.00 46.73 ? 395 ASP B CB  1 
ATOM   3191 C CG  . ASP B 1 77  ? -33.766 8.139  16.192  1.00 47.62 ? 395 ASP B CG  1 
ATOM   3192 O OD1 . ASP B 1 77  ? -33.430 6.937  16.115  1.00 43.31 ? 395 ASP B OD1 1 
ATOM   3193 O OD2 . ASP B 1 77  ? -34.916 8.542  15.913  1.00 51.48 ? 395 ASP B OD2 1 
ATOM   3194 N N   . LYS B 1 78  ? -29.735 9.765  18.561  1.00 42.71 ? 396 LYS B N   1 
ATOM   3195 C CA  . LYS B 1 78  ? -28.635 10.719 18.574  1.00 40.68 ? 396 LYS B CA  1 
ATOM   3196 C C   . LYS B 1 78  ? -27.524 10.341 17.613  1.00 40.11 ? 396 LYS B C   1 
ATOM   3197 O O   . LYS B 1 78  ? -27.174 9.173  17.511  1.00 39.55 ? 396 LYS B O   1 
ATOM   3198 C CB  . LYS B 1 78  ? -28.087 10.877 19.991  1.00 40.92 ? 396 LYS B CB  1 
ATOM   3199 C CG  . LYS B 1 78  ? -28.860 11.875 20.847  1.00 38.42 ? 396 LYS B CG  1 
ATOM   3200 C CD  . LYS B 1 78  ? -28.705 11.564 22.313  1.00 34.86 ? 396 LYS B CD  1 
ATOM   3201 C CE  . LYS B 1 78  ? -27.241 11.521 22.672  1.00 37.36 ? 396 LYS B CE  1 
ATOM   3202 N NZ  . LYS B 1 78  ? -27.073 11.090 24.068  1.00 36.88 ? 396 LYS B NZ  1 
ATOM   3203 N N   . PRO B 1 79  ? -26.977 11.339 16.890  1.00 40.50 ? 397 PRO B N   1 
ATOM   3204 C CA  . PRO B 1 79  ? -25.804 11.162 16.034  1.00 40.46 ? 397 PRO B CA  1 
ATOM   3205 C C   . PRO B 1 79  ? -24.625 10.756 16.886  1.00 41.25 ? 397 PRO B C   1 
ATOM   3206 O O   . PRO B 1 79  ? -24.566 11.132 18.055  1.00 41.66 ? 397 PRO B O   1 
ATOM   3207 C CB  . PRO B 1 79  ? -25.558 12.565 15.466  1.00 39.11 ? 397 PRO B CB  1 
ATOM   3208 C CG  . PRO B 1 79  ? -26.275 13.482 16.367  1.00 39.42 ? 397 PRO B CG  1 
ATOM   3209 C CD  . PRO B 1 79  ? -27.465 12.727 16.854  1.00 40.52 ? 397 PRO B CD  1 
ATOM   3210 N N   . PRO B 1 80  ? -23.676 10.009 16.309  1.00 41.56 ? 398 PRO B N   1 
ATOM   3211 C CA  . PRO B 1 80  ? -22.577 9.456  17.089  1.00 41.94 ? 398 PRO B CA  1 
ATOM   3212 C C   . PRO B 1 80  ? -21.691 10.550 17.711  1.00 42.01 ? 398 PRO B C   1 
ATOM   3213 O O   . PRO B 1 80  ? -20.943 10.290 18.666  1.00 42.37 ? 398 PRO B O   1 
ATOM   3214 C CB  . PRO B 1 80  ? -21.799 8.658  16.043  1.00 42.80 ? 398 PRO B CB  1 
ATOM   3215 C CG  . PRO B 1 80  ? -22.080 9.379  14.758  1.00 40.53 ? 398 PRO B CG  1 
ATOM   3216 C CD  . PRO B 1 80  ? -23.504 9.773  14.864  1.00 41.21 ? 398 PRO B CD  1 
ATOM   3217 N N   . PHE B 1 81  ? -21.804 11.765 17.184  1.00 41.06 ? 399 PHE B N   1 
ATOM   3218 C CA  . PHE B 1 81  ? -20.932 12.877 17.566  1.00 41.62 ? 399 PHE B CA  1 
ATOM   3219 C C   . PHE B 1 81  ? -21.299 13.552 18.880  1.00 41.21 ? 399 PHE B C   1 
ATOM   3220 O O   . PHE B 1 81  ? -20.696 14.557 19.262  1.00 42.26 ? 399 PHE B O   1 
ATOM   3221 C CB  . PHE B 1 81  ? -20.887 13.920 16.443  1.00 42.66 ? 399 PHE B CB  1 
ATOM   3222 C CG  . PHE B 1 81  ? -20.557 13.335 15.101  1.00 42.50 ? 399 PHE B CG  1 
ATOM   3223 C CD1 . PHE B 1 81  ? -19.409 12.569 14.931  1.00 42.92 ? 399 PHE B CD1 1 
ATOM   3224 C CD2 . PHE B 1 81  ? -21.392 13.535 14.020  1.00 36.62 ? 399 PHE B CD2 1 
ATOM   3225 C CE1 . PHE B 1 81  ? -19.102 12.019 13.700  1.00 42.83 ? 399 PHE B CE1 1 
ATOM   3226 C CE2 . PHE B 1 81  ? -21.088 12.990 12.798  1.00 38.89 ? 399 PHE B CE2 1 
ATOM   3227 C CZ  . PHE B 1 81  ? -19.942 12.231 12.631  1.00 38.85 ? 399 PHE B CZ  1 
ATOM   3228 N N   . LEU B 1 82  ? -22.305 13.008 19.553  1.00 40.00 ? 400 LEU B N   1 
ATOM   3229 C CA  . LEU B 1 82  ? -22.662 13.431 20.891  1.00 36.90 ? 400 LEU B CA  1 
ATOM   3230 C C   . LEU B 1 82  ? -22.258 12.297 21.849  1.00 38.81 ? 400 LEU B C   1 
ATOM   3231 O O   . LEU B 1 82  ? -22.244 11.107 21.465  1.00 39.49 ? 400 LEU B O   1 
ATOM   3232 C CB  . LEU B 1 82  ? -24.167 13.731 20.975  1.00 35.66 ? 400 LEU B CB  1 
ATOM   3233 C CG  . LEU B 1 82  ? -24.854 14.745 20.030  1.00 29.98 ? 400 LEU B CG  1 
ATOM   3234 C CD1 . LEU B 1 82  ? -26.384 14.695 20.174  1.00 24.98 ? 400 LEU B CD1 1 
ATOM   3235 C CD2 . LEU B 1 82  ? -24.374 16.142 20.261  1.00 20.73 ? 400 LEU B CD2 1 
ATOM   3236 N N   . THR B 1 83  ? -21.887 12.668 23.079  1.00 39.07 ? 401 THR B N   1 
ATOM   3237 C CA  . THR B 1 83  ? -21.584 11.704 24.142  1.00 37.31 ? 401 THR B CA  1 
ATOM   3238 C C   . THR B 1 83  ? -22.758 10.762 24.339  1.00 36.11 ? 401 THR B C   1 
ATOM   3239 O O   . THR B 1 83  ? -23.910 11.171 24.312  1.00 34.46 ? 401 THR B O   1 
ATOM   3240 C CB  . THR B 1 83  ? -21.311 12.411 25.470  1.00 37.83 ? 401 THR B CB  1 
ATOM   3241 O OG1 . THR B 1 83  ? -22.130 13.585 25.560  1.00 39.76 ? 401 THR B OG1 1 
ATOM   3242 C CG2 . THR B 1 83  ? -19.875 12.826 25.563  1.00 38.00 ? 401 THR B CG2 1 
ATOM   3243 N N   . GLN B 1 84  ? -22.471 9.488  24.515  1.00 36.38 ? 402 GLN B N   1 
ATOM   3244 C CA  . GLN B 1 84  ? -23.543 8.529  24.604  1.00 36.08 ? 402 GLN B CA  1 
ATOM   3245 C C   . GLN B 1 84  ? -23.947 8.415  26.047  1.00 35.64 ? 402 GLN B C   1 
ATOM   3246 O O   . GLN B 1 84  ? -23.101 8.390  26.943  1.00 37.30 ? 402 GLN B O   1 
ATOM   3247 C CB  . GLN B 1 84  ? -23.113 7.165  24.062  1.00 35.95 ? 402 GLN B CB  1 
ATOM   3248 C CG  . GLN B 1 84  ? -23.216 7.008  22.542  1.00 35.91 ? 402 GLN B CG  1 
ATOM   3249 C CD  . GLN B 1 84  ? -23.350 5.538  22.123  1.00 41.65 ? 402 GLN B CD  1 
ATOM   3250 O OE1 . GLN B 1 84  ? -24.453 5.060  21.849  1.00 43.21 ? 402 GLN B OE1 1 
ATOM   3251 N NE2 . GLN B 1 84  ? -22.232 4.812  22.105  1.00 37.66 ? 402 GLN B NE2 1 
ATOM   3252 N N   . LEU B 1 85  ? -25.248 8.370  26.276  1.00 33.26 ? 403 LEU B N   1 
ATOM   3253 C CA  . LEU B 1 85  ? -25.743 8.033  27.585  1.00 30.56 ? 403 LEU B CA  1 
ATOM   3254 C C   . LEU B 1 85  ? -25.760 6.531  27.650  1.00 29.02 ? 403 LEU B C   1 
ATOM   3255 O O   . LEU B 1 85  ? -26.428 5.885  26.863  1.00 27.44 ? 403 LEU B O   1 
ATOM   3256 C CB  . LEU B 1 85  ? -27.162 8.535  27.751  1.00 30.43 ? 403 LEU B CB  1 
ATOM   3257 C CG  . LEU B 1 85  ? -27.733 8.391  29.149  1.00 27.49 ? 403 LEU B CG  1 
ATOM   3258 C CD1 . LEU B 1 85  ? -26.744 8.891  30.162  1.00 32.72 ? 403 LEU B CD1 1 
ATOM   3259 C CD2 . LEU B 1 85  ? -28.984 9.201  29.226  1.00 29.83 ? 403 LEU B CD2 1 
ATOM   3260 N N   . HIS B 1 86  ? -25.014 5.953  28.568  1.00 28.77 ? 404 HIS B N   1 
ATOM   3261 C CA  . HIS B 1 86  ? -25.245 4.557  28.777  1.00 29.09 ? 404 HIS B CA  1 
ATOM   3262 C C   . HIS B 1 86  ? -26.604 4.413  29.464  1.00 28.97 ? 404 HIS B C   1 
ATOM   3263 O O   . HIS B 1 86  ? -27.513 3.747  28.953  1.00 27.50 ? 404 HIS B O   1 
ATOM   3264 C CB  . HIS B 1 86  ? -24.162 3.884  29.598  1.00 29.38 ? 404 HIS B CB  1 
ATOM   3265 C CG  . HIS B 1 86  ? -24.544 2.494  30.000  1.00 32.97 ? 404 HIS B CG  1 
ATOM   3266 N ND1 . HIS B 1 86  ? -25.140 2.206  31.209  1.00 35.56 ? 404 HIS B ND1 1 
ATOM   3267 C CD2 . HIS B 1 86  ? -24.507 1.329  29.314  1.00 31.72 ? 404 HIS B CD2 1 
ATOM   3268 C CE1 . HIS B 1 86  ? -25.410 0.915  31.267  1.00 33.76 ? 404 HIS B CE1 1 
ATOM   3269 N NE2 . HIS B 1 86  ? -25.036 0.360  30.130  1.00 30.92 ? 404 HIS B NE2 1 
ATOM   3270 N N   . SER B 1 87  ? -26.732 5.056  30.620  1.00 28.41 ? 405 SER B N   1 
ATOM   3271 C CA  . SER B 1 87  ? -27.977 5.090  31.334  1.00 28.99 ? 405 SER B CA  1 
ATOM   3272 C C   . SER B 1 87  ? -27.669 5.888  32.545  1.00 30.31 ? 405 SER B C   1 
ATOM   3273 O O   . SER B 1 87  ? -26.506 6.020  32.902  1.00 32.42 ? 405 SER B O   1 
ATOM   3274 C CB  . SER B 1 87  ? -28.322 3.701  31.789  1.00 29.51 ? 405 SER B CB  1 
ATOM   3275 O OG  . SER B 1 87  ? -27.352 3.282  32.723  1.00 35.80 ? 405 SER B OG  1 
ATOM   3276 N N   . CYS B 1 88  ? -28.692 6.407  33.208  1.00 30.49 ? 406 CYS B N   1 
ATOM   3277 C CA  . CYS B 1 88  ? -28.462 7.185  34.427  1.00 30.15 ? 406 CYS B CA  1 
ATOM   3278 C C   . CYS B 1 88  ? -29.392 6.742  35.554  1.00 28.46 ? 406 CYS B C   1 
ATOM   3279 O O   . CYS B 1 88  ? -30.488 6.223  35.299  1.00 29.11 ? 406 CYS B O   1 
ATOM   3280 C CB  . CYS B 1 88  ? -28.645 8.671  34.146  1.00 31.14 ? 406 CYS B CB  1 
ATOM   3281 S SG  . CYS B 1 88  ? -30.278 9.053  33.495  1.00 35.56 ? 406 CYS B SG  1 
ATOM   3282 N N   . PHE B 1 89  ? -28.966 6.946  36.795  1.00 24.74 ? 407 PHE B N   1 
ATOM   3283 C CA  . PHE B 1 89  ? -29.738 6.467  37.919  1.00 22.99 ? 407 PHE B CA  1 
ATOM   3284 C C   . PHE B 1 89  ? -29.426 7.288  39.151  1.00 23.39 ? 407 PHE B C   1 
ATOM   3285 O O   . PHE B 1 89  ? -28.570 8.174  39.120  1.00 23.53 ? 407 PHE B O   1 
ATOM   3286 C CB  . PHE B 1 89  ? -29.409 5.003  38.183  1.00 22.12 ? 407 PHE B CB  1 
ATOM   3287 C CG  . PHE B 1 89  ? -28.004 4.784  38.576  1.00 19.03 ? 407 PHE B CG  1 
ATOM   3288 C CD1 . PHE B 1 89  ? -27.650 4.758  39.891  1.00 15.02 ? 407 PHE B CD1 1 
ATOM   3289 C CD2 . PHE B 1 89  ? -27.017 4.659  37.615  1.00 24.35 ? 407 PHE B CD2 1 
ATOM   3290 C CE1 . PHE B 1 89  ? -26.333 4.592  40.251  1.00 20.02 ? 407 PHE B CE1 1 
ATOM   3291 C CE2 . PHE B 1 89  ? -25.687 4.488  37.962  1.00 23.37 ? 407 PHE B CE2 1 
ATOM   3292 C CZ  . PHE B 1 89  ? -25.342 4.454  39.282  1.00 20.84 ? 407 PHE B CZ  1 
ATOM   3293 N N   . GLN B 1 90  ? -30.100 6.985  40.249  1.00 21.94 ? 408 GLN B N   1 
ATOM   3294 C CA  . GLN B 1 90  ? -29.892 7.768  41.439  1.00 22.82 ? 408 GLN B CA  1 
ATOM   3295 C C   . GLN B 1 90  ? -29.816 6.873  42.659  1.00 23.79 ? 408 GLN B C   1 
ATOM   3296 O O   . GLN B 1 90  ? -30.235 5.738  42.613  1.00 25.31 ? 408 GLN B O   1 
ATOM   3297 C CB  . GLN B 1 90  ? -31.025 8.770  41.592  1.00 22.35 ? 408 GLN B CB  1 
ATOM   3298 C CG  . GLN B 1 90  ? -32.380 8.110  41.734  1.00 22.70 ? 408 GLN B CG  1 
ATOM   3299 C CD  . GLN B 1 90  ? -33.510 9.090  41.974  1.00 22.73 ? 408 GLN B CD  1 
ATOM   3300 O OE1 . GLN B 1 90  ? -33.462 9.902  42.889  1.00 26.35 ? 408 GLN B OE1 1 
ATOM   3301 N NE2 . GLN B 1 90  ? -34.540 9.002  41.160  1.00 20.39 ? 408 GLN B NE2 1 
ATOM   3302 N N   . THR B 1 91  ? -29.272 7.391  43.750  1.00 24.45 ? 409 THR B N   1 
ATOM   3303 C CA  . THR B 1 91  ? -29.301 6.711  45.042  1.00 24.53 ? 409 THR B CA  1 
ATOM   3304 C C   . THR B 1 91  ? -29.986 7.698  46.015  1.00 25.25 ? 409 THR B C   1 
ATOM   3305 O O   . THR B 1 91  ? -30.470 8.726  45.557  1.00 25.97 ? 409 THR B O   1 
ATOM   3306 C CB  . THR B 1 91  ? -27.876 6.454  45.487  1.00 23.85 ? 409 THR B CB  1 
ATOM   3307 O OG1 . THR B 1 91  ? -27.232 7.726  45.623  1.00 28.32 ? 409 THR B OG1 1 
ATOM   3308 C CG2 . THR B 1 91  ? -27.141 5.630  44.444  1.00 15.35 ? 409 THR B CG2 1 
ATOM   3309 N N   . VAL B 1 92  ? -30.026 7.430  47.327  1.00 24.97 ? 410 VAL B N   1 
ATOM   3310 C CA  . VAL B 1 92  ? -30.654 8.400  48.233  1.00 25.87 ? 410 VAL B CA  1 
ATOM   3311 C C   . VAL B 1 92  ? -30.069 9.781  48.069  1.00 28.82 ? 410 VAL B C   1 
ATOM   3312 O O   . VAL B 1 92  ? -30.811 10.748 47.856  1.00 29.81 ? 410 VAL B O   1 
ATOM   3313 C CB  . VAL B 1 92  ? -30.562 8.077  49.766  1.00 26.94 ? 410 VAL B CB  1 
ATOM   3314 C CG1 . VAL B 1 92  ? -31.750 7.277  50.228  1.00 24.31 ? 410 VAL B CG1 1 
ATOM   3315 C CG2 . VAL B 1 92  ? -29.185 7.473  50.191  1.00 23.52 ? 410 VAL B CG2 1 
ATOM   3316 N N   . ASP B 1 93  ? -28.740 9.878  48.179  1.00 30.92 ? 411 ASP B N   1 
ATOM   3317 C CA  . ASP B 1 93  ? -28.065 11.185 48.264  1.00 30.94 ? 411 ASP B CA  1 
ATOM   3318 C C   . ASP B 1 93  ? -27.439 11.696 46.965  1.00 29.17 ? 411 ASP B C   1 
ATOM   3319 O O   . ASP B 1 93  ? -26.960 12.822 46.912  1.00 31.01 ? 411 ASP B O   1 
ATOM   3320 C CB  . ASP B 1 93  ? -27.020 11.176 49.386  1.00 31.51 ? 411 ASP B CB  1 
ATOM   3321 C CG  . ASP B 1 93  ? -26.006 10.055 49.230  1.00 39.62 ? 411 ASP B CG  1 
ATOM   3322 O OD1 . ASP B 1 93  ? -26.173 9.229  48.300  1.00 43.05 ? 411 ASP B OD1 1 
ATOM   3323 O OD2 . ASP B 1 93  ? -25.044 9.996  50.041  1.00 45.26 ? 411 ASP B OD2 1 
ATOM   3324 N N   . ARG B 1 94  ? -27.445 10.906 45.907  1.00 26.53 ? 412 ARG B N   1 
ATOM   3325 C CA  . ARG B 1 94  ? -26.660 11.323 44.763  1.00 25.40 ? 412 ARG B CA  1 
ATOM   3326 C C   . ARG B 1 94  ? -27.258 10.943 43.436  1.00 25.27 ? 412 ARG B C   1 
ATOM   3327 O O   . ARG B 1 94  ? -28.078 10.020 43.355  1.00 27.39 ? 412 ARG B O   1 
ATOM   3328 C CB  . ARG B 1 94  ? -25.277 10.715 44.850  1.00 24.82 ? 412 ARG B CB  1 
ATOM   3329 C CG  . ARG B 1 94  ? -24.206 11.655 45.344  1.00 27.92 ? 412 ARG B CG  1 
ATOM   3330 C CD  . ARG B 1 94  ? -22.946 10.858 45.720  1.00 31.49 ? 412 ARG B CD  1 
ATOM   3331 N NE  . ARG B 1 94  ? -22.762 10.858 47.156  1.00 34.66 ? 412 ARG B NE  1 
ATOM   3332 C CZ  . ARG B 1 94  ? -21.806 11.550 47.754  1.00 41.26 ? 412 ARG B CZ  1 
ATOM   3333 N NH1 . ARG B 1 94  ? -20.943 12.240 47.018  1.00 44.09 ? 412 ARG B NH1 1 
ATOM   3334 N NH2 . ARG B 1 94  ? -21.694 11.539 49.075  1.00 44.73 ? 412 ARG B NH2 1 
ATOM   3335 N N   . LEU B 1 95  ? -26.819 11.639 42.394  1.00 22.03 ? 413 LEU B N   1 
ATOM   3336 C CA  . LEU B 1 95  ? -27.269 11.371 41.049  1.00 21.03 ? 413 LEU B CA  1 
ATOM   3337 C C   . LEU B 1 95  ? -26.095 10.959 40.169  1.00 20.16 ? 413 LEU B C   1 
ATOM   3338 O O   . LEU B 1 95  ? -24.967 11.356 40.413  1.00 18.73 ? 413 LEU B O   1 
ATOM   3339 C CB  . LEU B 1 95  ? -27.952 12.601 40.461  1.00 20.49 ? 413 LEU B CB  1 
ATOM   3340 C CG  . LEU B 1 95  ? -29.266 13.041 41.085  1.00 22.18 ? 413 LEU B CG  1 
ATOM   3341 C CD1 . LEU B 1 95  ? -29.409 14.522 40.908  1.00 26.67 ? 413 LEU B CD1 1 
ATOM   3342 C CD2 . LEU B 1 95  ? -30.451 12.343 40.459  1.00 22.33 ? 413 LEU B CD2 1 
ATOM   3343 N N   . TYR B 1 96  ? -26.381 10.197 39.118  1.00 20.01 ? 414 TYR B N   1 
ATOM   3344 C CA  . TYR B 1 96  ? -25.347 9.543  38.336  1.00 19.82 ? 414 TYR B CA  1 
ATOM   3345 C C   . TYR B 1 96  ? -25.730 9.427  36.885  1.00 20.39 ? 414 TYR B C   1 
ATOM   3346 O O   . TYR B 1 96  ? -26.794 8.915  36.563  1.00 21.82 ? 414 TYR B O   1 
ATOM   3347 C CB  . TYR B 1 96  ? -25.151 8.126  38.841  1.00 19.92 ? 414 TYR B CB  1 
ATOM   3348 C CG  . TYR B 1 96  ? -24.586 8.035  40.225  1.00 18.85 ? 414 TYR B CG  1 
ATOM   3349 C CD1 . TYR B 1 96  ? -23.217 7.942  40.437  1.00 17.39 ? 414 TYR B CD1 1 
ATOM   3350 C CD2 . TYR B 1 96  ? -25.421 8.028  41.323  1.00 21.48 ? 414 TYR B CD2 1 
ATOM   3351 C CE1 . TYR B 1 96  ? -22.701 7.844  41.719  1.00 22.23 ? 414 TYR B CE1 1 
ATOM   3352 C CE2 . TYR B 1 96  ? -24.914 7.943  42.619  1.00 21.45 ? 414 TYR B CE2 1 
ATOM   3353 C CZ  . TYR B 1 96  ? -23.561 7.846  42.810  1.00 23.38 ? 414 TYR B CZ  1 
ATOM   3354 O OH  . TYR B 1 96  ? -23.079 7.757  44.100  1.00 31.04 ? 414 TYR B OH  1 
ATOM   3355 N N   . PHE B 1 97  ? -24.853 9.872  36.001  1.00 21.26 ? 415 PHE B N   1 
ATOM   3356 C CA  . PHE B 1 97  ? -25.030 9.629  34.577  1.00 21.53 ? 415 PHE B CA  1 
ATOM   3357 C C   . PHE B 1 97  ? -23.867 8.771  34.091  1.00 23.24 ? 415 PHE B C   1 
ATOM   3358 O O   . PHE B 1 97  ? -22.701 9.193  34.149  1.00 25.08 ? 415 PHE B O   1 
ATOM   3359 C CB  . PHE B 1 97  ? -25.014 10.919 33.794  1.00 19.28 ? 415 PHE B CB  1 
ATOM   3360 C CG  . PHE B 1 97  ? -25.967 11.975 34.299  1.00 21.91 ? 415 PHE B CG  1 
ATOM   3361 C CD1 . PHE B 1 97  ? -25.844 12.495 35.577  1.00 20.28 ? 415 PHE B CD1 1 
ATOM   3362 C CD2 . PHE B 1 97  ? -26.937 12.510 33.447  1.00 25.12 ? 415 PHE B CD2 1 
ATOM   3363 C CE1 . PHE B 1 97  ? -26.687 13.497 36.015  1.00 26.64 ? 415 PHE B CE1 1 
ATOM   3364 C CE2 . PHE B 1 97  ? -27.789 13.503 33.863  1.00 26.74 ? 415 PHE B CE2 1 
ATOM   3365 C CZ  . PHE B 1 97  ? -27.671 14.009 35.152  1.00 31.62 ? 415 PHE B CZ  1 
ATOM   3366 N N   . VAL B 1 98  ? -24.183 7.578  33.603  1.00 22.63 ? 416 VAL B N   1 
ATOM   3367 C CA  . VAL B 1 98  ? -23.181 6.686  33.068  1.00 22.07 ? 416 VAL B CA  1 
ATOM   3368 C C   . VAL B 1 98  ? -22.984 6.945  31.577  1.00 23.28 ? 416 VAL B C   1 
ATOM   3369 O O   . VAL B 1 98  ? -23.804 6.542  30.756  1.00 23.97 ? 416 VAL B O   1 
ATOM   3370 C CB  . VAL B 1 98  ? -23.599 5.233  33.323  1.00 23.51 ? 416 VAL B CB  1 
ATOM   3371 C CG1 . VAL B 1 98  ? -22.691 4.238  32.569  1.00 22.22 ? 416 VAL B CG1 1 
ATOM   3372 C CG2 . VAL B 1 98  ? -23.612 4.973  34.825  1.00 16.22 ? 416 VAL B CG2 1 
ATOM   3373 N N   . MET B 1 99  ? -21.878 7.620  31.248  1.00 24.60 ? 417 MET B N   1 
ATOM   3374 C CA  . MET B 1 99  ? -21.602 8.111  29.895  1.00 24.86 ? 417 MET B CA  1 
ATOM   3375 C C   . MET B 1 99  ? -20.507 7.296  29.272  1.00 25.42 ? 417 MET B C   1 
ATOM   3376 O O   . MET B 1 99  ? -19.617 6.826  29.979  1.00 26.27 ? 417 MET B O   1 
ATOM   3377 C CB  . MET B 1 99  ? -21.070 9.540  29.943  1.00 24.76 ? 417 MET B CB  1 
ATOM   3378 C CG  . MET B 1 99  ? -21.940 10.545 30.643  1.00 26.06 ? 417 MET B CG  1 
ATOM   3379 S SD  . MET B 1 99  ? -23.547 10.599 29.889  1.00 35.90 ? 417 MET B SD  1 
ATOM   3380 C CE  . MET B 1 99  ? -23.084 11.175 28.262  1.00 34.42 ? 417 MET B CE  1 
ATOM   3381 N N   . GLU B 1 100 ? -20.538 7.160  27.951  1.00 25.93 ? 418 GLU B N   1 
ATOM   3382 C CA  . GLU B 1 100 ? -19.420 6.555  27.239  1.00 26.99 ? 418 GLU B CA  1 
ATOM   3383 C C   . GLU B 1 100 ? -18.122 7.278  27.587  1.00 28.02 ? 418 GLU B C   1 
ATOM   3384 O O   . GLU B 1 100 ? -18.132 8.483  27.861  1.00 27.74 ? 418 GLU B O   1 
ATOM   3385 C CB  . GLU B 1 100 ? -19.652 6.584  25.727  1.00 26.65 ? 418 GLU B CB  1 
ATOM   3386 C CG  . GLU B 1 100 ? -19.495 7.933  25.039  1.00 27.48 ? 418 GLU B CG  1 
ATOM   3387 C CD  . GLU B 1 100 ? -19.741 7.854  23.518  1.00 32.77 ? 418 GLU B CD  1 
ATOM   3388 O OE1 . GLU B 1 100 ? -19.206 6.936  22.857  1.00 35.44 ? 418 GLU B OE1 1 
ATOM   3389 O OE2 . GLU B 1 100 ? -20.472 8.710  22.975  1.00 34.03 ? 418 GLU B OE2 1 
ATOM   3390 N N   . TYR B 1 101 ? -17.009 6.547  27.595  1.00 28.47 ? 419 TYR B N   1 
ATOM   3391 C CA  . TYR B 1 101 ? -15.720 7.170  27.857  1.00 31.00 ? 419 TYR B CA  1 
ATOM   3392 C C   . TYR B 1 101 ? -15.084 7.725  26.580  1.00 32.44 ? 419 TYR B C   1 
ATOM   3393 O O   . TYR B 1 101 ? -14.915 7.000  25.600  1.00 34.73 ? 419 TYR B O   1 
ATOM   3394 C CB  . TYR B 1 101 ? -14.762 6.175  28.505  1.00 30.58 ? 419 TYR B CB  1 
ATOM   3395 C CG  . TYR B 1 101 ? -13.408 6.775  28.834  1.00 34.00 ? 419 TYR B CG  1 
ATOM   3396 C CD1 . TYR B 1 101 ? -13.308 8.063  29.363  1.00 36.39 ? 419 TYR B CD1 1 
ATOM   3397 C CD2 . TYR B 1 101 ? -12.226 6.057  28.629  1.00 35.94 ? 419 TYR B CD2 1 
ATOM   3398 C CE1 . TYR B 1 101 ? -12.069 8.621  29.669  1.00 35.40 ? 419 TYR B CE1 1 
ATOM   3399 C CE2 . TYR B 1 101 ? -10.976 6.606  28.943  1.00 32.48 ? 419 TYR B CE2 1 
ATOM   3400 C CZ  . TYR B 1 101 ? -10.908 7.885  29.459  1.00 36.35 ? 419 TYR B CZ  1 
ATOM   3401 O OH  . TYR B 1 101 ? -9.686  8.452  29.772  1.00 38.23 ? 419 TYR B OH  1 
ATOM   3402 N N   . VAL B 1 102 ? -14.703 8.994  26.592  1.00 32.18 ? 420 VAL B N   1 
ATOM   3403 C CA  . VAL B 1 102 ? -14.041 9.581  25.428  1.00 33.40 ? 420 VAL B CA  1 
ATOM   3404 C C   . VAL B 1 102 ? -12.545 9.888  25.662  1.00 34.79 ? 420 VAL B C   1 
ATOM   3405 O O   . VAL B 1 102 ? -12.185 10.616 26.585  1.00 35.32 ? 420 VAL B O   1 
ATOM   3406 C CB  . VAL B 1 102 ? -14.862 10.759 24.893  1.00 32.63 ? 420 VAL B CB  1 
ATOM   3407 C CG1 . VAL B 1 102 ? -14.024 11.678 24.031  1.00 34.22 ? 420 VAL B CG1 1 
ATOM   3408 C CG2 . VAL B 1 102 ? -16.033 10.217 24.114  1.00 31.06 ? 420 VAL B CG2 1 
ATOM   3409 N N   . ASN B 1 103 ? -11.688 9.342  24.802  1.00 37.64 ? 421 ASN B N   1 
ATOM   3410 C CA  . ASN B 1 103 ? -10.239 9.198  25.082  1.00 41.28 ? 421 ASN B CA  1 
ATOM   3411 C C   . ASN B 1 103 ? -9.288  10.357 24.781  1.00 41.89 ? 421 ASN B C   1 
ATOM   3412 O O   . ASN B 1 103 ? -8.493  10.746 25.637  1.00 42.52 ? 421 ASN B O   1 
ATOM   3413 C CB  . ASN B 1 103 ? -9.671  7.984  24.334  1.00 41.65 ? 421 ASN B CB  1 
ATOM   3414 C CG  . ASN B 1 103 ? -10.634 6.830  24.295  1.00 46.41 ? 421 ASN B CG  1 
ATOM   3415 O OD1 . ASN B 1 103 ? -10.488 5.874  25.049  1.00 51.60 ? 421 ASN B OD1 1 
ATOM   3416 N ND2 . ASN B 1 103 ? -11.640 6.912  23.421  1.00 49.20 ? 421 ASN B ND2 1 
ATOM   3417 N N   . GLY B 1 104 ? -9.331  10.872 23.555  1.00 41.46 ? 422 GLY B N   1 
ATOM   3418 C CA  . GLY B 1 104 ? -8.203  11.640 23.043  1.00 40.60 ? 422 GLY B CA  1 
ATOM   3419 C C   . GLY B 1 104 ? -8.206  13.150 23.117  1.00 39.64 ? 422 GLY B C   1 
ATOM   3420 O O   . GLY B 1 104 ? -7.913  13.791 22.132  1.00 39.65 ? 422 GLY B O   1 
ATOM   3421 N N   . GLY B 1 105 ? -8.522  13.714 24.280  1.00 39.61 ? 423 GLY B N   1 
ATOM   3422 C CA  . GLY B 1 105 ? -8.397  15.155 24.517  1.00 38.13 ? 423 GLY B CA  1 
ATOM   3423 C C   . GLY B 1 105 ? -9.525  16.015 23.961  1.00 38.40 ? 423 GLY B C   1 
ATOM   3424 O O   . GLY B 1 105 ? -10.201 15.637 22.990  1.00 36.61 ? 423 GLY B O   1 
ATOM   3425 N N   . ASP B 1 106 ? -9.730  17.175 24.581  1.00 38.20 ? 424 ASP B N   1 
ATOM   3426 C CA  . ASP B 1 106 ? -10.663 18.152 24.054  1.00 40.24 ? 424 ASP B CA  1 
ATOM   3427 C C   . ASP B 1 106 ? -10.038 19.011 22.948  1.00 40.68 ? 424 ASP B C   1 
ATOM   3428 O O   . ASP B 1 106 ? -8.818  19.032 22.766  1.00 39.75 ? 424 ASP B O   1 
ATOM   3429 C CB  . ASP B 1 106 ? -11.192 19.038 25.174  1.00 41.57 ? 424 ASP B CB  1 
ATOM   3430 C CG  . ASP B 1 106 ? -10.084 19.654 26.008  1.00 46.45 ? 424 ASP B CG  1 
ATOM   3431 O OD1 . ASP B 1 106 ? -9.267  20.420 25.446  1.00 50.35 ? 424 ASP B OD1 1 
ATOM   3432 O OD2 . ASP B 1 106 ? -10.046 19.394 27.234  1.00 50.40 ? 424 ASP B OD2 1 
ATOM   3433 N N   . LEU B 1 107 ? -10.877 19.727 22.214  1.00 41.76 ? 425 LEU B N   1 
ATOM   3434 C CA  . LEU B 1 107 ? -10.383 20.560 21.130  1.00 43.72 ? 425 LEU B CA  1 
ATOM   3435 C C   . LEU B 1 107 ? -9.440  21.655 21.601  1.00 45.65 ? 425 LEU B C   1 
ATOM   3436 O O   . LEU B 1 107 ? -8.413  21.897 20.985  1.00 45.27 ? 425 LEU B O   1 
ATOM   3437 C CB  . LEU B 1 107 ? -11.519 21.142 20.277  1.00 43.16 ? 425 LEU B CB  1 
ATOM   3438 C CG  . LEU B 1 107 ? -11.977 20.212 19.149  1.00 42.95 ? 425 LEU B CG  1 
ATOM   3439 C CD1 . LEU B 1 107 ? -12.534 20.970 17.962  1.00 39.87 ? 425 LEU B CD1 1 
ATOM   3440 C CD2 . LEU B 1 107 ? -10.819 19.357 18.699  1.00 43.57 ? 425 LEU B CD2 1 
ATOM   3441 N N   . MET B 1 108 ? -9.778  22.335 22.685  1.00 49.31 ? 426 MET B N   1 
ATOM   3442 C CA  . MET B 1 108 ? -8.846  23.331 23.206  1.00 52.38 ? 426 MET B CA  1 
ATOM   3443 C C   . MET B 1 108 ? -7.434  22.726 23.221  1.00 54.91 ? 426 MET B C   1 
ATOM   3444 O O   . MET B 1 108 ? -6.487  23.304 22.676  1.00 55.58 ? 426 MET B O   1 
ATOM   3445 C CB  . MET B 1 108 ? -9.249  23.758 24.616  1.00 52.35 ? 426 MET B CB  1 
ATOM   3446 C CG  . MET B 1 108 ? -8.219  24.598 25.334  1.00 51.14 ? 426 MET B CG  1 
ATOM   3447 S SD  . MET B 1 108 ? -8.340  26.309 24.829  1.00 54.59 ? 426 MET B SD  1 
ATOM   3448 C CE  . MET B 1 108 ? -7.359  27.140 26.080  1.00 51.39 ? 426 MET B CE  1 
ATOM   3449 N N   . TYR B 1 109 ? -7.310  21.549 23.832  1.00 56.16 ? 427 TYR B N   1 
ATOM   3450 C CA  . TYR B 1 109 ? -6.021  20.893 23.975  1.00 57.45 ? 427 TYR B CA  1 
ATOM   3451 C C   . TYR B 1 109 ? -5.353  20.676 22.637  1.00 56.91 ? 427 TYR B C   1 
ATOM   3452 O O   . TYR B 1 109 ? -4.208  21.046 22.439  1.00 57.31 ? 427 TYR B O   1 
ATOM   3453 C CB  . TYR B 1 109 ? -6.194  19.552 24.671  1.00 58.83 ? 427 TYR B CB  1 
ATOM   3454 C CG  . TYR B 1 109 ? -4.967  18.686 24.640  1.00 63.35 ? 427 TYR B CG  1 
ATOM   3455 C CD1 . TYR B 1 109 ? -4.162  18.554 25.766  1.00 68.41 ? 427 TYR B CD1 1 
ATOM   3456 C CD2 . TYR B 1 109 ? -4.615  17.991 23.490  1.00 67.53 ? 427 TYR B CD2 1 
ATOM   3457 C CE1 . TYR B 1 109 ? -3.038  17.753 25.751  1.00 70.32 ? 427 TYR B CE1 1 
ATOM   3458 C CE2 . TYR B 1 109 ? -3.494  17.191 23.459  1.00 72.13 ? 427 TYR B CE2 1 
ATOM   3459 C CZ  . TYR B 1 109 ? -2.710  17.071 24.596  1.00 73.05 ? 427 TYR B CZ  1 
ATOM   3460 O OH  . TYR B 1 109 ? -1.593  16.270 24.570  1.00 74.59 ? 427 TYR B OH  1 
ATOM   3461 N N   . HIS B 1 110 ? -6.068  20.062 21.712  1.00 56.50 ? 428 HIS B N   1 
ATOM   3462 C CA  . HIS B 1 110 ? -5.454  19.700 20.464  1.00 55.88 ? 428 HIS B CA  1 
ATOM   3463 C C   . HIS B 1 110 ? -4.984  20.911 19.723  1.00 56.46 ? 428 HIS B C   1 
ATOM   3464 O O   . HIS B 1 110 ? -3.786  21.117 19.591  1.00 57.02 ? 428 HIS B O   1 
ATOM   3465 C CB  . HIS B 1 110 ? -6.397  18.857 19.641  1.00 55.64 ? 428 HIS B CB  1 
ATOM   3466 C CG  . HIS B 1 110 ? -6.518  17.467 20.166  1.00 57.20 ? 428 HIS B CG  1 
ATOM   3467 N ND1 . HIS B 1 110 ? -5.499  16.859 20.866  1.00 55.09 ? 428 HIS B ND1 1 
ATOM   3468 C CD2 . HIS B 1 110 ? -7.524  16.566 20.101  1.00 55.60 ? 428 HIS B CD2 1 
ATOM   3469 C CE1 . HIS B 1 110 ? -5.872  15.642 21.207  1.00 56.88 ? 428 HIS B CE1 1 
ATOM   3470 N NE2 . HIS B 1 110 ? -7.095  15.438 20.752  1.00 57.39 ? 428 HIS B NE2 1 
ATOM   3471 N N   . ILE B 1 111 ? -5.928  21.713 19.251  1.00 57.38 ? 429 ILE B N   1 
ATOM   3472 C CA  . ILE B 1 111 ? -5.631  23.024 18.701  1.00 57.86 ? 429 ILE B CA  1 
ATOM   3473 C C   . ILE B 1 111 ? -4.377  23.603 19.373  1.00 58.15 ? 429 ILE B C   1 
ATOM   3474 O O   . ILE B 1 111 ? -3.453  24.056 18.694  1.00 58.25 ? 429 ILE B O   1 
ATOM   3475 C CB  . ILE B 1 111 ? -6.835  23.992 18.900  1.00 58.32 ? 429 ILE B CB  1 
ATOM   3476 C CG1 . ILE B 1 111 ? -7.295  24.594 17.578  1.00 59.11 ? 429 ILE B CG1 1 
ATOM   3477 C CG2 . ILE B 1 111 ? -6.501  25.100 19.886  1.00 57.88 ? 429 ILE B CG2 1 
ATOM   3478 C CD1 . ILE B 1 111 ? -8.314  25.692 17.760  1.00 61.90 ? 429 ILE B CD1 1 
ATOM   3479 N N   . GLN B 1 112 ? -4.334  23.553 20.705  1.00 57.79 ? 430 GLN B N   1 
ATOM   3480 C CA  . GLN B 1 112 ? -3.209  24.094 21.466  1.00 58.03 ? 430 GLN B CA  1 
ATOM   3481 C C   . GLN B 1 112 ? -1.839  23.456 21.193  1.00 58.42 ? 430 GLN B C   1 
ATOM   3482 O O   . GLN B 1 112 ? -0.857  23.846 21.817  1.00 58.86 ? 430 GLN B O   1 
ATOM   3483 C CB  . GLN B 1 112 ? -3.485  23.995 22.957  1.00 57.34 ? 430 GLN B CB  1 
ATOM   3484 C CG  . GLN B 1 112 ? -3.866  25.285 23.627  1.00 60.52 ? 430 GLN B CG  1 
ATOM   3485 C CD  . GLN B 1 112 ? -3.673  25.206 25.135  1.00 62.46 ? 430 GLN B CD  1 
ATOM   3486 O OE1 . GLN B 1 112 ? -2.822  24.464 25.615  1.00 64.46 ? 430 GLN B OE1 1 
ATOM   3487 N NE2 . GLN B 1 112 ? -4.458  25.968 25.884  1.00 62.04 ? 430 GLN B NE2 1 
ATOM   3488 N N   . GLN B 1 113 ? -1.761  22.463 20.311  1.00 58.39 ? 431 GLN B N   1 
ATOM   3489 C CA  . GLN B 1 113 ? -0.460  21.877 19.987  1.00 58.66 ? 431 GLN B CA  1 
ATOM   3490 C C   . GLN B 1 113 ? 0.048   22.511 18.699  1.00 58.91 ? 431 GLN B C   1 
ATOM   3491 O O   . GLN B 1 113 ? 1.233   22.828 18.564  1.00 58.72 ? 431 GLN B O   1 
ATOM   3492 C CB  . GLN B 1 113 ? -0.524  20.341 19.842  1.00 58.89 ? 431 GLN B CB  1 
ATOM   3493 C CG  . GLN B 1 113 ? -1.262  19.548 20.934  1.00 56.74 ? 431 GLN B CG  1 
ATOM   3494 C CD  . GLN B 1 113 ? -0.897  19.953 22.361  1.00 57.64 ? 431 GLN B CD  1 
ATOM   3495 O OE1 . GLN B 1 113 ? -0.806  21.140 22.689  1.00 54.75 ? 431 GLN B OE1 1 
ATOM   3496 N NE2 . GLN B 1 113 ? -0.716  18.958 23.226  1.00 57.28 ? 431 GLN B NE2 1 
ATOM   3497 N N   . VAL B 1 114 ? -0.882  22.710 17.768  1.00 59.62 ? 432 VAL B N   1 
ATOM   3498 C CA  . VAL B 1 114 ? -0.595  23.275 16.450  1.00 59.60 ? 432 VAL B CA  1 
ATOM   3499 C C   . VAL B 1 114 ? -0.648  24.807 16.415  1.00 60.00 ? 432 VAL B C   1 
ATOM   3500 O O   . VAL B 1 114 ? -0.027  25.427 15.549  1.00 61.39 ? 432 VAL B O   1 
ATOM   3501 C CB  . VAL B 1 114 ? -1.585  22.750 15.378  1.00 59.22 ? 432 VAL B CB  1 
ATOM   3502 C CG1 . VAL B 1 114 ? -1.181  23.245 13.982  1.00 59.02 ? 432 VAL B CG1 1 
ATOM   3503 C CG2 . VAL B 1 114 ? -1.676  21.233 15.417  1.00 57.18 ? 432 VAL B CG2 1 
ATOM   3504 N N   . GLY B 1 115 ? -1.394  25.413 17.338  1.00 59.47 ? 433 GLY B N   1 
ATOM   3505 C CA  . GLY B 1 115 ? -1.611  26.867 17.327  1.00 58.61 ? 433 GLY B CA  1 
ATOM   3506 C C   . GLY B 1 115 ? -2.896  27.272 16.611  1.00 57.86 ? 433 GLY B C   1 
ATOM   3507 O O   . GLY B 1 115 ? -3.611  28.173 17.058  1.00 56.56 ? 433 GLY B O   1 
ATOM   3508 N N   . LYS B 1 116 ? -3.165  26.606 15.489  1.00 57.67 ? 434 LYS B N   1 
ATOM   3509 C CA  . LYS B 1 116 ? -4.420  26.714 14.760  1.00 58.46 ? 434 LYS B CA  1 
ATOM   3510 C C   . LYS B 1 116 ? -4.539  25.464 13.916  1.00 59.75 ? 434 LYS B C   1 
ATOM   3511 O O   . LYS B 1 116 ? -3.579  24.713 13.798  1.00 60.24 ? 434 LYS B O   1 
ATOM   3512 C CB  . LYS B 1 116 ? -4.432  27.934 13.847  1.00 58.39 ? 434 LYS B CB  1 
ATOM   3513 C CG  . LYS B 1 116 ? -3.994  27.649 12.411  1.00 58.26 ? 434 LYS B CG  1 
ATOM   3514 C CD  . LYS B 1 116 ? -4.221  28.846 11.509  1.00 58.05 ? 434 LYS B CD  1 
ATOM   3515 C CE  . LYS B 1 116 ? -3.443  28.739 10.210  1.00 57.94 ? 434 LYS B CE  1 
ATOM   3516 N NZ  . LYS B 1 116 ? -2.001  29.026 10.420  1.00 59.44 ? 434 LYS B NZ  1 
ATOM   3517 N N   . PHE B 1 117 ? -5.703  25.234 13.321  1.00 61.37 ? 435 PHE B N   1 
ATOM   3518 C CA  . PHE B 1 117 ? -5.885  24.056 12.482  1.00 62.92 ? 435 PHE B CA  1 
ATOM   3519 C C   . PHE B 1 117 ? -5.725  24.358 11.003  1.00 63.48 ? 435 PHE B C   1 
ATOM   3520 O O   . PHE B 1 117 ? -5.875  25.498 10.573  1.00 63.79 ? 435 PHE B O   1 
ATOM   3521 C CB  . PHE B 1 117 ? -7.253  23.426 12.720  1.00 63.27 ? 435 PHE B CB  1 
ATOM   3522 C CG  . PHE B 1 117 ? -7.356  22.687 14.012  1.00 65.79 ? 435 PHE B CG  1 
ATOM   3523 C CD1 . PHE B 1 117 ? -6.253  22.029 14.535  1.00 67.15 ? 435 PHE B CD1 1 
ATOM   3524 C CD2 . PHE B 1 117 ? -8.561  22.632 14.701  1.00 67.51 ? 435 PHE B CD2 1 
ATOM   3525 C CE1 . PHE B 1 117 ? -6.347  21.342 15.734  1.00 69.64 ? 435 PHE B CE1 1 
ATOM   3526 C CE2 . PHE B 1 117 ? -8.668  21.947 15.895  1.00 67.28 ? 435 PHE B CE2 1 
ATOM   3527 C CZ  . PHE B 1 117 ? -7.561  21.302 16.416  1.00 69.48 ? 435 PHE B CZ  1 
ATOM   3528 N N   . LYS B 1 118 ? -5.416  23.323 10.227  1.00 64.23 ? 436 LYS B N   1 
ATOM   3529 C CA  . LYS B 1 118 ? -5.435  23.422 8.774   1.00 64.08 ? 436 LYS B CA  1 
ATOM   3530 C C   . LYS B 1 118 ? -6.877  23.482 8.318   1.00 63.75 ? 436 LYS B C   1 
ATOM   3531 O O   . LYS B 1 118 ? -7.757  22.835 8.889   1.00 63.51 ? 436 LYS B O   1 
ATOM   3532 C CB  . LYS B 1 118 ? -4.761  22.213 8.136   1.00 64.03 ? 436 LYS B CB  1 
ATOM   3533 C CG  . LYS B 1 118 ? -3.471  21.803 8.811   1.00 66.10 ? 436 LYS B CG  1 
ATOM   3534 C CD  . LYS B 1 118 ? -2.559  21.100 7.825   1.00 67.40 ? 436 LYS B CD  1 
ATOM   3535 C CE  . LYS B 1 118 ? -2.402  21.931 6.563   1.00 67.93 ? 436 LYS B CE  1 
ATOM   3536 N NZ  . LYS B 1 118 ? -1.464  21.282 5.616   1.00 69.59 ? 436 LYS B NZ  1 
ATOM   3537 N N   . GLU B 1 119 ? -7.124  24.262 7.283   1.00 63.41 ? 437 GLU B N   1 
ATOM   3538 C CA  . GLU B 1 119 ? -8.481  24.406 6.810   1.00 63.71 ? 437 GLU B CA  1 
ATOM   3539 C C   . GLU B 1 119 ? -9.178  23.049 6.646   1.00 62.78 ? 437 GLU B C   1 
ATOM   3540 O O   . GLU B 1 119 ? -10.130 22.765 7.376   1.00 62.61 ? 437 GLU B O   1 
ATOM   3541 C CB  . GLU B 1 119 ? -8.537  25.244 5.529   1.00 64.45 ? 437 GLU B CB  1 
ATOM   3542 C CG  . GLU B 1 119 ? -9.935  25.421 4.981   1.00 65.28 ? 437 GLU B CG  1 
ATOM   3543 C CD  . GLU B 1 119 ? -10.125 26.757 4.325   1.00 64.21 ? 437 GLU B CD  1 
ATOM   3544 O OE1 . GLU B 1 119 ? -9.301  27.661 4.578   1.00 64.20 ? 437 GLU B OE1 1 
ATOM   3545 O OE2 . GLU B 1 119 ? -11.106 26.905 3.569   1.00 64.05 ? 437 GLU B OE2 1 
ATOM   3546 N N   . PRO B 1 120 ? -8.693  22.195 5.718   1.00 62.02 ? 438 PRO B N   1 
ATOM   3547 C CA  . PRO B 1 120 ? -9.472  20.988 5.442   1.00 61.10 ? 438 PRO B CA  1 
ATOM   3548 C C   . PRO B 1 120 ? -9.808  20.250 6.737   1.00 59.98 ? 438 PRO B C   1 
ATOM   3549 O O   . PRO B 1 120 ? -10.898 19.688 6.857   1.00 59.20 ? 438 PRO B O   1 
ATOM   3550 C CB  . PRO B 1 120 ? -8.537  20.150 4.552   1.00 60.77 ? 438 PRO B CB  1 
ATOM   3551 C CG  . PRO B 1 120 ? -7.597  21.134 3.951   1.00 61.31 ? 438 PRO B CG  1 
ATOM   3552 C CD  . PRO B 1 120 ? -7.390  22.169 5.027   1.00 62.35 ? 438 PRO B CD  1 
ATOM   3553 N N   . GLN B 1 121 ? -8.881  20.277 7.695   1.00 58.33 ? 439 GLN B N   1 
ATOM   3554 C CA  . GLN B 1 121 ? -9.092  19.653 8.994   1.00 57.05 ? 439 GLN B CA  1 
ATOM   3555 C C   . GLN B 1 121 ? -10.141 20.406 9.797   1.00 56.65 ? 439 GLN B C   1 
ATOM   3556 O O   . GLN B 1 121 ? -11.092 19.811 10.323  1.00 56.76 ? 439 GLN B O   1 
ATOM   3557 C CB  . GLN B 1 121 ? -7.791  19.615 9.797   1.00 57.29 ? 439 GLN B CB  1 
ATOM   3558 C CG  . GLN B 1 121 ? -7.960  19.035 11.208  1.00 55.63 ? 439 GLN B CG  1 
ATOM   3559 C CD  . GLN B 1 121 ? -6.769  19.302 12.110  1.00 52.92 ? 439 GLN B CD  1 
ATOM   3560 O OE1 . GLN B 1 121 ? -6.590  18.647 13.138  1.00 44.88 ? 439 GLN B OE1 1 
ATOM   3561 N NE2 . GLN B 1 121 ? -5.949  20.276 11.728  1.00 54.66 ? 439 GLN B NE2 1 
ATOM   3562 N N   . ALA B 1 122 ? -9.952  21.719 9.898   1.00 55.10 ? 440 ALA B N   1 
ATOM   3563 C CA  . ALA B 1 122 ? -10.860 22.560 10.651  1.00 52.21 ? 440 ALA B CA  1 
ATOM   3564 C C   . ALA B 1 122 ? -12.243 22.560 10.011  1.00 50.96 ? 440 ALA B C   1 
ATOM   3565 O O   . ALA B 1 122 ? -13.226 22.820 10.677  1.00 51.10 ? 440 ALA B O   1 
ATOM   3566 C CB  . ALA B 1 122 ? -10.311 23.956 10.767  1.00 51.69 ? 440 ALA B CB  1 
ATOM   3567 N N   . VAL B 1 123 ? -12.326 22.251 8.724   1.00 50.12 ? 441 VAL B N   1 
ATOM   3568 C CA  . VAL B 1 123 ? -13.625 22.007 8.098   1.00 49.94 ? 441 VAL B CA  1 
ATOM   3569 C C   . VAL B 1 123 ? -14.293 20.749 8.661   1.00 49.88 ? 441 VAL B C   1 
ATOM   3570 O O   . VAL B 1 123 ? -15.509 20.715 8.887   1.00 49.26 ? 441 VAL B O   1 
ATOM   3571 C CB  . VAL B 1 123 ? -13.497 21.817 6.582   1.00 49.96 ? 441 VAL B CB  1 
ATOM   3572 C CG1 . VAL B 1 123 ? -14.863 21.516 5.978   1.00 49.20 ? 441 VAL B CG1 1 
ATOM   3573 C CG2 . VAL B 1 123 ? -12.865 23.048 5.938   1.00 51.15 ? 441 VAL B CG2 1 
ATOM   3574 N N   . PHE B 1 124 ? -13.478 19.717 8.873   1.00 50.21 ? 442 PHE B N   1 
ATOM   3575 C CA  . PHE B 1 124 ? -13.945 18.399 9.295   1.00 50.16 ? 442 PHE B CA  1 
ATOM   3576 C C   . PHE B 1 124 ? -14.598 18.495 10.663  1.00 49.14 ? 442 PHE B C   1 
ATOM   3577 O O   . PHE B 1 124 ? -15.781 18.176 10.836  1.00 48.50 ? 442 PHE B O   1 
ATOM   3578 C CB  . PHE B 1 124 ? -12.771 17.403 9.325   1.00 51.02 ? 442 PHE B CB  1 
ATOM   3579 C CG  . PHE B 1 124 ? -13.168 15.992 9.691   1.00 53.73 ? 442 PHE B CG  1 
ATOM   3580 C CD1 . PHE B 1 124 ? -13.737 15.148 8.748   1.00 54.63 ? 442 PHE B CD1 1 
ATOM   3581 C CD2 . PHE B 1 124 ? -12.970 15.511 10.982  1.00 54.39 ? 442 PHE B CD2 1 
ATOM   3582 C CE1 . PHE B 1 124 ? -14.108 13.842 9.089   1.00 58.06 ? 442 PHE B CE1 1 
ATOM   3583 C CE2 . PHE B 1 124 ? -13.332 14.216 11.326  1.00 56.63 ? 442 PHE B CE2 1 
ATOM   3584 C CZ  . PHE B 1 124 ? -13.901 13.376 10.378  1.00 57.09 ? 442 PHE B CZ  1 
ATOM   3585 N N   . TYR B 1 125 ? -13.813 18.942 11.632  1.00 47.56 ? 443 TYR B N   1 
ATOM   3586 C CA  . TYR B 1 125 ? -14.322 19.153 12.963  1.00 46.11 ? 443 TYR B CA  1 
ATOM   3587 C C   . TYR B 1 125 ? -15.579 20.013 12.909  1.00 45.42 ? 443 TYR B C   1 
ATOM   3588 O O   . TYR B 1 125 ? -16.630 19.621 13.417  1.00 46.05 ? 443 TYR B O   1 
ATOM   3589 C CB  . TYR B 1 125 ? -13.248 19.790 13.823  1.00 46.01 ? 443 TYR B CB  1 
ATOM   3590 C CG  . TYR B 1 125 ? -12.067 18.880 14.052  1.00 46.59 ? 443 TYR B CG  1 
ATOM   3591 C CD1 . TYR B 1 125 ? -12.194 17.504 13.932  1.00 45.43 ? 443 TYR B CD1 1 
ATOM   3592 C CD2 . TYR B 1 125 ? -10.830 19.390 14.423  1.00 48.45 ? 443 TYR B CD2 1 
ATOM   3593 C CE1 . TYR B 1 125 ? -11.116 16.656 14.150  1.00 44.92 ? 443 TYR B CE1 1 
ATOM   3594 C CE2 . TYR B 1 125 ? -9.749  18.547 14.650  1.00 48.02 ? 443 TYR B CE2 1 
ATOM   3595 C CZ  . TYR B 1 125 ? -9.896  17.181 14.511  1.00 45.49 ? 443 TYR B CZ  1 
ATOM   3596 O OH  . TYR B 1 125 ? -8.815  16.342 14.732  1.00 49.40 ? 443 TYR B OH  1 
ATOM   3597 N N   . ALA B 1 126 ? -15.480 21.167 12.265  1.00 44.28 ? 444 ALA B N   1 
ATOM   3598 C CA  . ALA B 1 126 ? -16.636 22.044 12.081  1.00 44.71 ? 444 ALA B CA  1 
ATOM   3599 C C   . ALA B 1 126 ? -17.855 21.293 11.550  1.00 44.66 ? 444 ALA B C   1 
ATOM   3600 O O   . ALA B 1 126 ? -18.982 21.503 12.007  1.00 43.62 ? 444 ALA B O   1 
ATOM   3601 C CB  . ALA B 1 126 ? -16.287 23.192 11.139  1.00 44.32 ? 444 ALA B CB  1 
ATOM   3602 N N   . ALA B 1 127 ? -17.625 20.431 10.564  1.00 44.95 ? 445 ALA B N   1 
ATOM   3603 C CA  . ALA B 1 127 ? -18.725 19.721 9.924   1.00 44.32 ? 445 ALA B CA  1 
ATOM   3604 C C   . ALA B 1 127 ? -19.375 18.733 10.896  1.00 43.25 ? 445 ALA B C   1 
ATOM   3605 O O   . ALA B 1 127 ? -20.600 18.720 11.042  1.00 43.16 ? 445 ALA B O   1 
ATOM   3606 C CB  . ALA B 1 127 ? -18.250 19.024 8.645   1.00 43.33 ? 445 ALA B CB  1 
ATOM   3607 N N   . GLU B 1 128 ? -18.550 17.935 11.578  1.00 41.99 ? 446 GLU B N   1 
ATOM   3608 C CA  . GLU B 1 128 ? -19.058 16.888 12.478  1.00 40.85 ? 446 GLU B CA  1 
ATOM   3609 C C   . GLU B 1 128 ? -19.864 17.492 13.617  1.00 39.36 ? 446 GLU B C   1 
ATOM   3610 O O   . GLU B 1 128 ? -20.804 16.885 14.120  1.00 40.46 ? 446 GLU B O   1 
ATOM   3611 C CB  . GLU B 1 128 ? -17.935 15.971 13.008  1.00 40.98 ? 446 GLU B CB  1 
ATOM   3612 C CG  . GLU B 1 128 ? -17.423 14.923 11.982  1.00 41.69 ? 446 GLU B CG  1 
ATOM   3613 C CD  . GLU B 1 128 ? -16.354 13.962 12.532  1.00 46.62 ? 446 GLU B CD  1 
ATOM   3614 O OE1 . GLU B 1 128 ? -15.874 14.152 13.674  1.00 48.18 ? 446 GLU B OE1 1 
ATOM   3615 O OE2 . GLU B 1 128 ? -15.991 13.001 11.811  1.00 50.13 ? 446 GLU B OE2 1 
ATOM   3616 N N   . ILE B 1 129 ? -19.503 18.703 14.010  1.00 36.16 ? 447 ILE B N   1 
ATOM   3617 C CA  . ILE B 1 129 ? -20.255 19.410 15.014  1.00 32.53 ? 447 ILE B CA  1 
ATOM   3618 C C   . ILE B 1 129 ? -21.627 19.777 14.486  1.00 34.45 ? 447 ILE B C   1 
ATOM   3619 O O   . ILE B 1 129 ? -22.632 19.540 15.146  1.00 35.04 ? 447 ILE B O   1 
ATOM   3620 C CB  . ILE B 1 129 ? -19.501 20.648 15.434  1.00 30.80 ? 447 ILE B CB  1 
ATOM   3621 C CG1 . ILE B 1 129 ? -18.307 20.213 16.268  1.00 28.12 ? 447 ILE B CG1 1 
ATOM   3622 C CG2 . ILE B 1 129 ? -20.406 21.618 16.151  1.00 23.84 ? 447 ILE B CG2 1 
ATOM   3623 C CD1 . ILE B 1 129 ? -17.306 21.268 16.477  1.00 29.98 ? 447 ILE B CD1 1 
ATOM   3624 N N   . SER B 1 130 ? -21.671 20.332 13.280  1.00 35.95 ? 448 SER B N   1 
ATOM   3625 C CA  . SER B 1 130 ? -22.923 20.820 12.733  1.00 36.89 ? 448 SER B CA  1 
ATOM   3626 C C   . SER B 1 130 ? -23.999 19.772 12.944  1.00 37.31 ? 448 SER B C   1 
ATOM   3627 O O   . SER B 1 130 ? -25.103 20.073 13.390  1.00 36.15 ? 448 SER B O   1 
ATOM   3628 C CB  . SER B 1 130 ? -22.775 21.149 11.251  1.00 37.47 ? 448 SER B CB  1 
ATOM   3629 O OG  . SER B 1 130 ? -22.317 20.022 10.528  1.00 37.47 ? 448 SER B OG  1 
ATOM   3630 N N   . ILE B 1 131 ? -23.659 18.526 12.645  1.00 39.27 ? 449 ILE B N   1 
ATOM   3631 C CA  . ILE B 1 131 ? -24.635 17.450 12.738  1.00 41.07 ? 449 ILE B CA  1 
ATOM   3632 C C   . ILE B 1 131 ? -25.344 17.458 14.091  1.00 41.71 ? 449 ILE B C   1 
ATOM   3633 O O   . ILE B 1 131 ? -26.585 17.476 14.150  1.00 42.27 ? 449 ILE B O   1 
ATOM   3634 C CB  . ILE B 1 131 ? -23.989 16.103 12.440  1.00 41.10 ? 449 ILE B CB  1 
ATOM   3635 C CG1 . ILE B 1 131 ? -23.331 16.184 11.069  1.00 42.40 ? 449 ILE B CG1 1 
ATOM   3636 C CG2 . ILE B 1 131 ? -25.034 14.990 12.434  1.00 41.63 ? 449 ILE B CG2 1 
ATOM   3637 C CD1 . ILE B 1 131 ? -24.330 16.452 9.960   1.00 40.20 ? 449 ILE B CD1 1 
ATOM   3638 N N   . GLY B 1 132 ? -24.556 17.474 15.165  1.00 40.98 ? 450 GLY B N   1 
ATOM   3639 C CA  . GLY B 1 132 ? -25.096 17.641 16.502  1.00 41.35 ? 450 GLY B CA  1 
ATOM   3640 C C   . GLY B 1 132 ? -26.117 18.766 16.596  1.00 42.92 ? 450 GLY B C   1 
ATOM   3641 O O   . GLY B 1 132 ? -27.271 18.555 17.008  1.00 44.16 ? 450 GLY B O   1 
ATOM   3642 N N   . LEU B 1 133 ? -25.711 19.969 16.205  1.00 41.76 ? 451 LEU B N   1 
ATOM   3643 C CA  . LEU B 1 133 ? -26.569 21.117 16.391  1.00 40.58 ? 451 LEU B CA  1 
ATOM   3644 C C   . LEU B 1 133 ? -27.893 20.907 15.682  1.00 42.24 ? 451 LEU B C   1 
ATOM   3645 O O   . LEU B 1 133 ? -28.962 21.101 16.277  1.00 42.79 ? 451 LEU B O   1 
ATOM   3646 C CB  . LEU B 1 133 ? -25.880 22.375 15.899  1.00 40.19 ? 451 LEU B CB  1 
ATOM   3647 C CG  . LEU B 1 133 ? -24.622 22.681 16.705  1.00 37.60 ? 451 LEU B CG  1 
ATOM   3648 C CD1 . LEU B 1 133 ? -24.096 24.079 16.423  1.00 30.97 ? 451 LEU B CD1 1 
ATOM   3649 C CD2 . LEU B 1 133 ? -24.946 22.514 18.166  1.00 28.54 ? 451 LEU B CD2 1 
ATOM   3650 N N   . PHE B 1 134 ? -27.811 20.500 14.415  1.00 42.98 ? 452 PHE B N   1 
ATOM   3651 C CA  . PHE B 1 134 ? -28.989 20.146 13.631  1.00 43.11 ? 452 PHE B CA  1 
ATOM   3652 C C   . PHE B 1 134 ? -29.883 19.224 14.443  1.00 43.32 ? 452 PHE B C   1 
ATOM   3653 O O   . PHE B 1 134 ? -31.038 19.538 14.728  1.00 43.44 ? 452 PHE B O   1 
ATOM   3654 C CB  . PHE B 1 134 ? -28.595 19.403 12.360  1.00 43.05 ? 452 PHE B CB  1 
ATOM   3655 C CG  . PHE B 1 134 ? -27.761 20.201 11.410  1.00 42.60 ? 452 PHE B CG  1 
ATOM   3656 C CD1 . PHE B 1 134 ? -28.044 21.531 11.160  1.00 42.03 ? 452 PHE B CD1 1 
ATOM   3657 C CD2 . PHE B 1 134 ? -26.715 19.599 10.724  1.00 43.05 ? 452 PHE B CD2 1 
ATOM   3658 C CE1 . PHE B 1 134 ? -27.279 22.255 10.254  1.00 42.28 ? 452 PHE B CE1 1 
ATOM   3659 C CE2 . PHE B 1 134 ? -25.939 20.323 9.817   1.00 44.04 ? 452 PHE B CE2 1 
ATOM   3660 C CZ  . PHE B 1 134 ? -26.223 21.646 9.581   1.00 39.59 ? 452 PHE B CZ  1 
ATOM   3661 N N   . PHE B 1 135 ? -29.347 18.071 14.808  1.00 43.94 ? 453 PHE B N   1 
ATOM   3662 C CA  . PHE B 1 135 ? -30.123 17.128 15.595  1.00 45.20 ? 453 PHE B CA  1 
ATOM   3663 C C   . PHE B 1 135 ? -30.823 17.834 16.754  1.00 45.97 ? 453 PHE B C   1 
ATOM   3664 O O   . PHE B 1 135 ? -32.046 17.808 16.850  1.00 47.31 ? 453 PHE B O   1 
ATOM   3665 C CB  . PHE B 1 135 ? -29.241 16.005 16.121  1.00 44.50 ? 453 PHE B CB  1 
ATOM   3666 C CG  . PHE B 1 135 ? -29.963 15.043 16.989  1.00 42.47 ? 453 PHE B CG  1 
ATOM   3667 C CD1 . PHE B 1 135 ? -30.402 13.830 16.485  1.00 43.03 ? 453 PHE B CD1 1 
ATOM   3668 C CD2 . PHE B 1 135 ? -30.213 15.341 18.311  1.00 42.26 ? 453 PHE B CD2 1 
ATOM   3669 C CE1 . PHE B 1 135 ? -31.072 12.926 17.292  1.00 38.87 ? 453 PHE B CE1 1 
ATOM   3670 C CE2 . PHE B 1 135 ? -30.885 14.438 19.120  1.00 41.60 ? 453 PHE B CE2 1 
ATOM   3671 C CZ  . PHE B 1 135 ? -31.315 13.231 18.602  1.00 38.41 ? 453 PHE B CZ  1 
ATOM   3672 N N   . LEU B 1 136 ? -30.048 18.474 17.622  1.00 45.52 ? 454 LEU B N   1 
ATOM   3673 C CA  . LEU B 1 136 ? -30.612 19.184 18.760  1.00 45.25 ? 454 LEU B CA  1 
ATOM   3674 C C   . LEU B 1 136 ? -31.710 20.178 18.389  1.00 46.39 ? 454 LEU B C   1 
ATOM   3675 O O   . LEU B 1 136 ? -32.773 20.177 18.998  1.00 46.34 ? 454 LEU B O   1 
ATOM   3676 C CB  . LEU B 1 136 ? -29.506 19.913 19.505  1.00 44.13 ? 454 LEU B CB  1 
ATOM   3677 C CG  . LEU B 1 136 ? -28.490 19.001 20.176  1.00 40.71 ? 454 LEU B CG  1 
ATOM   3678 C CD1 . LEU B 1 136 ? -27.359 19.829 20.715  1.00 35.79 ? 454 LEU B CD1 1 
ATOM   3679 C CD2 . LEU B 1 136 ? -29.151 18.204 21.293  1.00 34.73 ? 454 LEU B CD2 1 
ATOM   3680 N N   . HIS B 1 137 ? -31.443 21.023 17.395  1.00 48.19 ? 455 HIS B N   1 
ATOM   3681 C CA  . HIS B 1 137 ? -32.375 22.091 16.992  1.00 49.87 ? 455 HIS B CA  1 
ATOM   3682 C C   . HIS B 1 137 ? -33.673 21.608 16.350  1.00 51.01 ? 455 HIS B C   1 
ATOM   3683 O O   . HIS B 1 137 ? -34.728 22.223 16.529  1.00 51.21 ? 455 HIS B O   1 
ATOM   3684 C CB  . HIS B 1 137 ? -31.705 23.061 16.029  1.00 49.42 ? 455 HIS B CB  1 
ATOM   3685 C CG  . HIS B 1 137 ? -30.514 23.744 16.602  1.00 49.21 ? 455 HIS B CG  1 
ATOM   3686 N ND1 . HIS B 1 137 ? -29.430 24.109 15.838  1.00 51.12 ? 455 HIS B ND1 1 
ATOM   3687 C CD2 . HIS B 1 137 ? -30.231 24.126 17.867  1.00 50.21 ? 455 HIS B CD2 1 
ATOM   3688 C CE1 . HIS B 1 137 ? -28.530 24.695 16.606  1.00 49.84 ? 455 HIS B CE1 1 
ATOM   3689 N NE2 . HIS B 1 137 ? -28.992 24.717 17.843  1.00 50.85 ? 455 HIS B NE2 1 
ATOM   3690 N N   . LYS B 1 138 ? -33.580 20.542 15.561  1.00 51.88 ? 456 LYS B N   1 
ATOM   3691 C CA  . LYS B 1 138 ? -34.758 19.921 14.979  1.00 51.89 ? 456 LYS B CA  1 
ATOM   3692 C C   . LYS B 1 138 ? -35.653 19.457 16.121  1.00 51.35 ? 456 LYS B C   1 
ATOM   3693 O O   . LYS B 1 138 ? -36.871 19.483 16.010  1.00 51.48 ? 456 LYS B O   1 
ATOM   3694 C CB  . LYS B 1 138 ? -34.346 18.741 14.106  1.00 52.38 ? 456 LYS B CB  1 
ATOM   3695 C CG  . LYS B 1 138 ? -35.272 18.426 12.945  1.00 54.27 ? 456 LYS B CG  1 
ATOM   3696 C CD  . LYS B 1 138 ? -34.439 17.947 11.758  1.00 58.32 ? 456 LYS B CD  1 
ATOM   3697 C CE  . LYS B 1 138 ? -33.310 17.002 12.213  1.00 59.47 ? 456 LYS B CE  1 
ATOM   3698 N NZ  . LYS B 1 138 ? -32.128 17.001 11.297  1.00 56.88 ? 456 LYS B NZ  1 
ATOM   3699 N N   . ARG B 1 139 ? -35.040 19.063 17.233  1.00 50.58 ? 457 ARG B N   1 
ATOM   3700 C CA  . ARG B 1 139 ? -35.789 18.637 18.406  1.00 50.53 ? 457 ARG B CA  1 
ATOM   3701 C C   . ARG B 1 139 ? -36.147 19.833 19.270  1.00 49.62 ? 457 ARG B C   1 
ATOM   3702 O O   . ARG B 1 139 ? -36.493 19.683 20.444  1.00 49.51 ? 457 ARG B O   1 
ATOM   3703 C CB  . ARG B 1 139 ? -34.971 17.657 19.240  1.00 51.12 ? 457 ARG B CB  1 
ATOM   3704 C CG  . ARG B 1 139 ? -34.236 16.610 18.437  1.00 56.19 ? 457 ARG B CG  1 
ATOM   3705 C CD  . ARG B 1 139 ? -35.195 15.750 17.639  1.00 63.98 ? 457 ARG B CD  1 
ATOM   3706 N NE  . ARG B 1 139 ? -34.620 14.445 17.327  1.00 70.60 ? 457 ARG B NE  1 
ATOM   3707 C CZ  . ARG B 1 139 ? -34.614 13.412 18.170  1.00 75.38 ? 457 ARG B CZ  1 
ATOM   3708 N NH1 . ARG B 1 139 ? -35.150 13.534 19.382  1.00 77.24 ? 457 ARG B NH1 1 
ATOM   3709 N NH2 . ARG B 1 139 ? -34.074 12.252 17.805  1.00 75.69 ? 457 ARG B NH2 1 
ATOM   3710 N N   . GLY B 1 140 ? -36.046 21.026 18.698  1.00 48.55 ? 458 GLY B N   1 
ATOM   3711 C CA  . GLY B 1 140 ? -36.401 22.243 19.431  1.00 47.11 ? 458 GLY B CA  1 
ATOM   3712 C C   . GLY B 1 140 ? -35.618 22.386 20.720  1.00 45.27 ? 458 GLY B C   1 
ATOM   3713 O O   . GLY B 1 140 ? -36.186 22.643 21.786  1.00 44.74 ? 458 GLY B O   1 
ATOM   3714 N N   . ILE B 1 141 ? -34.305 22.204 20.608  1.00 44.17 ? 459 ILE B N   1 
ATOM   3715 C CA  . ILE B 1 141 ? -33.395 22.331 21.740  1.00 42.47 ? 459 ILE B CA  1 
ATOM   3716 C C   . ILE B 1 141 ? -32.247 23.282 21.426  1.00 43.30 ? 459 ILE B C   1 
ATOM   3717 O O   . ILE B 1 141 ? -31.641 23.212 20.349  1.00 43.65 ? 459 ILE B O   1 
ATOM   3718 C CB  . ILE B 1 141 ? -32.841 20.978 22.173  1.00 40.19 ? 459 ILE B CB  1 
ATOM   3719 C CG1 . ILE B 1 141 ? -33.873 20.292 23.059  1.00 41.28 ? 459 ILE B CG1 1 
ATOM   3720 C CG2 . ILE B 1 141 ? -31.576 21.168 22.947  1.00 34.29 ? 459 ILE B CG2 1 
ATOM   3721 C CD1 . ILE B 1 141 ? -33.761 18.781 23.114  1.00 40.02 ? 459 ILE B CD1 1 
ATOM   3722 N N   . ILE B 1 142 ? -31.979 24.187 22.366  1.00 42.72 ? 460 ILE B N   1 
ATOM   3723 C CA  . ILE B 1 142 ? -30.842 25.080 22.267  1.00 42.11 ? 460 ILE B CA  1 
ATOM   3724 C C   . ILE B 1 142 ? -29.730 24.571 23.174  1.00 41.20 ? 460 ILE B C   1 
ATOM   3725 O O   . ILE B 1 142 ? -29.955 24.281 24.342  1.00 41.54 ? 460 ILE B O   1 
ATOM   3726 C CB  . ILE B 1 142 ? -31.185 26.500 22.722  1.00 42.63 ? 460 ILE B CB  1 
ATOM   3727 C CG1 . ILE B 1 142 ? -32.536 26.939 22.178  1.00 42.17 ? 460 ILE B CG1 1 
ATOM   3728 C CG2 . ILE B 1 142 ? -30.082 27.476 22.310  1.00 42.61 ? 460 ILE B CG2 1 
ATOM   3729 C CD1 . ILE B 1 142 ? -33.074 28.152 22.890  1.00 38.49 ? 460 ILE B CD1 1 
ATOM   3730 N N   . TYR B 1 143 ? -28.526 24.481 22.634  1.00 39.12 ? 461 TYR B N   1 
ATOM   3731 C CA  . TYR B 1 143 ? -27.406 24.019 23.397  1.00 37.87 ? 461 TYR B CA  1 
ATOM   3732 C C   . TYR B 1 143 ? -26.905 25.119 24.322  1.00 38.05 ? 461 TYR B C   1 
ATOM   3733 O O   . TYR B 1 143 ? -26.810 24.927 25.527  1.00 39.18 ? 461 TYR B O   1 
ATOM   3734 C CB  . TYR B 1 143 ? -26.324 23.552 22.440  1.00 38.58 ? 461 TYR B CB  1 
ATOM   3735 C CG  . TYR B 1 143 ? -25.122 22.930 23.102  1.00 39.10 ? 461 TYR B CG  1 
ATOM   3736 C CD1 . TYR B 1 143 ? -25.233 22.277 24.315  1.00 39.80 ? 461 TYR B CD1 1 
ATOM   3737 C CD2 . TYR B 1 143 ? -23.874 22.990 22.499  1.00 39.37 ? 461 TYR B CD2 1 
ATOM   3738 C CE1 . TYR B 1 143 ? -24.132 21.711 24.913  1.00 44.92 ? 461 TYR B CE1 1 
ATOM   3739 C CE2 . TYR B 1 143 ? -22.778 22.430 23.084  1.00 42.80 ? 461 TYR B CE2 1 
ATOM   3740 C CZ  . TYR B 1 143 ? -22.909 21.785 24.286  1.00 43.86 ? 461 TYR B CZ  1 
ATOM   3741 O OH  . TYR B 1 143 ? -21.805 21.224 24.867  1.00 47.65 ? 461 TYR B OH  1 
ATOM   3742 N N   . ARG B 1 144 ? -26.578 26.273 23.760  1.00 37.96 ? 462 ARG B N   1 
ATOM   3743 C CA  . ARG B 1 144 ? -26.224 27.434 24.572  1.00 37.97 ? 462 ARG B CA  1 
ATOM   3744 C C   . ARG B 1 144 ? -24.881 27.330 25.267  1.00 37.38 ? 462 ARG B C   1 
ATOM   3745 O O   . ARG B 1 144 ? -24.606 28.095 26.201  1.00 38.06 ? 462 ARG B O   1 
ATOM   3746 C CB  . ARG B 1 144 ? -27.296 27.686 25.632  1.00 38.37 ? 462 ARG B CB  1 
ATOM   3747 C CG  . ARG B 1 144 ? -28.674 27.986 25.065  1.00 41.08 ? 462 ARG B CG  1 
ATOM   3748 C CD  . ARG B 1 144 ? -29.512 28.785 26.053  1.00 45.32 ? 462 ARG B CD  1 
ATOM   3749 N NE  . ARG B 1 144 ? -29.846 28.006 27.244  1.00 50.19 ? 462 ARG B NE  1 
ATOM   3750 C CZ  . ARG B 1 144 ? -30.759 28.359 28.141  1.00 50.31 ? 462 ARG B CZ  1 
ATOM   3751 N NH1 . ARG B 1 144 ? -31.446 29.482 27.988  1.00 58.23 ? 462 ARG B NH1 1 
ATOM   3752 N NH2 . ARG B 1 144 ? -30.994 27.590 29.184  1.00 48.90 ? 462 ARG B NH2 1 
ATOM   3753 N N   . ASP B 1 145 ? -24.048 26.389 24.828  1.00 35.67 ? 463 ASP B N   1 
ATOM   3754 C CA  . ASP B 1 145 ? -22.778 26.131 25.517  1.00 34.05 ? 463 ASP B CA  1 
ATOM   3755 C C   . ASP B 1 145 ? -21.741 25.498 24.606  1.00 33.25 ? 463 ASP B C   1 
ATOM   3756 O O   . ASP B 1 145 ? -20.881 24.737 25.060  1.00 33.16 ? 463 ASP B O   1 
ATOM   3757 C CB  . ASP B 1 145 ? -22.980 25.260 26.765  1.00 34.01 ? 463 ASP B CB  1 
ATOM   3758 C CG  . ASP B 1 145 ? -21.907 25.481 27.815  1.00 32.69 ? 463 ASP B CG  1 
ATOM   3759 O OD1 . ASP B 1 145 ? -21.167 26.481 27.710  1.00 35.35 ? 463 ASP B OD1 1 
ATOM   3760 O OD2 . ASP B 1 145 ? -21.804 24.664 28.753  1.00 31.28 ? 463 ASP B OD2 1 
ATOM   3761 N N   . LEU B 1 146 ? -21.824 25.814 23.320  1.00 31.66 ? 464 LEU B N   1 
ATOM   3762 C CA  . LEU B 1 146 ? -20.724 25.535 22.419  1.00 31.11 ? 464 LEU B CA  1 
ATOM   3763 C C   . LEU B 1 146 ? -19.464 26.305 22.852  1.00 32.19 ? 464 LEU B C   1 
ATOM   3764 O O   . LEU B 1 146 ? -19.472 27.532 22.999  1.00 31.35 ? 464 LEU B O   1 
ATOM   3765 C CB  . LEU B 1 146 ? -21.106 25.890 20.993  1.00 29.83 ? 464 LEU B CB  1 
ATOM   3766 C CG  . LEU B 1 146 ? -20.313 25.124 19.939  1.00 30.07 ? 464 LEU B CG  1 
ATOM   3767 C CD1 . LEU B 1 146 ? -19.965 23.754 20.455  1.00 22.98 ? 464 LEU B CD1 1 
ATOM   3768 C CD2 . LEU B 1 146 ? -21.089 25.036 18.627  1.00 26.49 ? 464 LEU B CD2 1 
ATOM   3769 N N   . LYS B 1 147 ? -18.403 25.546 23.110  1.00 34.37 ? 465 LYS B N   1 
ATOM   3770 C CA  . LYS B 1 147 ? -17.063 26.066 23.420  1.00 34.77 ? 465 LYS B CA  1 
ATOM   3771 C C   . LYS B 1 147 ? -16.090 24.906 23.268  1.00 33.95 ? 465 LYS B C   1 
ATOM   3772 O O   . LYS B 1 147 ? -16.493 23.751 23.367  1.00 33.13 ? 465 LYS B O   1 
ATOM   3773 C CB  . LYS B 1 147 ? -16.991 26.686 24.832  1.00 35.45 ? 465 LYS B CB  1 
ATOM   3774 C CG  . LYS B 1 147 ? -17.533 25.833 26.005  1.00 36.97 ? 465 LYS B CG  1 
ATOM   3775 C CD  . LYS B 1 147 ? -17.477 26.666 27.307  1.00 41.43 ? 465 LYS B CD  1 
ATOM   3776 C CE  . LYS B 1 147 ? -17.380 25.843 28.600  1.00 43.33 ? 465 LYS B CE  1 
ATOM   3777 N NZ  . LYS B 1 147 ? -18.711 25.361 29.095  1.00 45.65 ? 465 LYS B NZ  1 
ATOM   3778 N N   . LEU B 1 148 ? -14.823 25.202 23.014  1.00 35.19 ? 466 LEU B N   1 
ATOM   3779 C CA  . LEU B 1 148 ? -13.808 24.145 22.802  1.00 37.11 ? 466 LEU B CA  1 
ATOM   3780 C C   . LEU B 1 148 ? -13.764 23.031 23.858  1.00 38.66 ? 466 LEU B C   1 
ATOM   3781 O O   . LEU B 1 148 ? -13.566 21.866 23.515  1.00 38.66 ? 466 LEU B O   1 
ATOM   3782 C CB  . LEU B 1 148 ? -12.413 24.756 22.675  1.00 36.18 ? 466 LEU B CB  1 
ATOM   3783 C CG  . LEU B 1 148 ? -12.176 25.619 21.448  1.00 33.65 ? 466 LEU B CG  1 
ATOM   3784 C CD1 . LEU B 1 148 ? -10.868 26.370 21.586  1.00 33.17 ? 466 LEU B CD1 1 
ATOM   3785 C CD2 . LEU B 1 148 ? -12.189 24.764 20.202  1.00 29.41 ? 466 LEU B CD2 1 
ATOM   3786 N N   . ASP B 1 149 ? -13.935 23.401 25.130  1.00 40.96 ? 467 ASP B N   1 
ATOM   3787 C CA  . ASP B 1 149 ? -13.869 22.448 26.247  1.00 43.52 ? 467 ASP B CA  1 
ATOM   3788 C C   . ASP B 1 149 ? -14.960 21.423 26.210  1.00 42.67 ? 467 ASP B C   1 
ATOM   3789 O O   . ASP B 1 149 ? -14.810 20.338 26.758  1.00 44.92 ? 467 ASP B O   1 
ATOM   3790 C CB  . ASP B 1 149 ? -13.929 23.167 27.591  1.00 44.32 ? 467 ASP B CB  1 
ATOM   3791 C CG  . ASP B 1 149 ? -12.665 23.912 27.874  1.00 52.20 ? 467 ASP B CG  1 
ATOM   3792 O OD1 . ASP B 1 149 ? -11.586 23.311 27.662  1.00 60.62 ? 467 ASP B OD1 1 
ATOM   3793 O OD2 . ASP B 1 149 ? -12.734 25.096 28.266  1.00 58.69 ? 467 ASP B OD2 1 
ATOM   3794 N N   . ASN B 1 150 ? -16.072 21.770 25.586  1.00 40.83 ? 468 ASN B N   1 
ATOM   3795 C CA  . ASN B 1 150 ? -17.177 20.849 25.536  1.00 39.44 ? 468 ASN B CA  1 
ATOM   3796 C C   . ASN B 1 150 ? -17.027 19.885 24.361  1.00 39.81 ? 468 ASN B C   1 
ATOM   3797 O O   . ASN B 1 150 ? -17.862 19.000 24.162  1.00 41.35 ? 468 ASN B O   1 
ATOM   3798 C CB  . ASN B 1 150 ? -18.506 21.607 25.533  1.00 38.75 ? 468 ASN B CB  1 
ATOM   3799 C CG  . ASN B 1 150 ? -18.897 22.103 26.934  1.00 37.70 ? 468 ASN B CG  1 
ATOM   3800 O OD1 . ASN B 1 150 ? -18.070 22.154 27.837  1.00 36.59 ? 468 ASN B OD1 1 
ATOM   3801 N ND2 . ASN B 1 150 ? -20.160 22.458 27.112  1.00 37.38 ? 468 ASN B ND2 1 
ATOM   3802 N N   . VAL B 1 151 ? -15.940 20.028 23.607  1.00 38.07 ? 469 VAL B N   1 
ATOM   3803 C CA  . VAL B 1 151 ? -15.735 19.186 22.440  1.00 37.73 ? 469 VAL B CA  1 
ATOM   3804 C C   . VAL B 1 151 ? -14.431 18.375 22.499  1.00 39.17 ? 469 VAL B C   1 
ATOM   3805 O O   . VAL B 1 151 ? -13.342 18.920 22.699  1.00 39.70 ? 469 VAL B O   1 
ATOM   3806 C CB  . VAL B 1 151 ? -15.730 20.016 21.161  1.00 38.05 ? 469 VAL B CB  1 
ATOM   3807 C CG1 . VAL B 1 151 ? -15.696 19.096 19.947  1.00 36.01 ? 469 VAL B CG1 1 
ATOM   3808 C CG2 . VAL B 1 151 ? -16.929 20.951 21.122  1.00 35.53 ? 469 VAL B CG2 1 
ATOM   3809 N N   . MET B 1 152 ? -14.546 17.070 22.302  1.00 38.74 ? 470 MET B N   1 
ATOM   3810 C CA  . MET B 1 152 ? -13.409 16.195 22.427  1.00 38.93 ? 470 MET B CA  1 
ATOM   3811 C C   . MET B 1 152 ? -13.235 15.398 21.147  1.00 39.25 ? 470 MET B C   1 
ATOM   3812 O O   . MET B 1 152 ? -14.009 15.543 20.195  1.00 38.29 ? 470 MET B O   1 
ATOM   3813 C CB  . MET B 1 152 ? -13.626 15.221 23.595  1.00 40.27 ? 470 MET B CB  1 
ATOM   3814 C CG  . MET B 1 152 ? -13.621 15.846 24.996  1.00 41.02 ? 470 MET B CG  1 
ATOM   3815 S SD  . MET B 1 152 ? -14.038 14.621 26.272  1.00 47.70 ? 470 MET B SD  1 
ATOM   3816 C CE  . MET B 1 152 ? -15.724 14.207 25.826  1.00 40.16 ? 470 MET B CE  1 
ATOM   3817 N N   . LEU B 1 153 ? -12.221 14.541 21.136  1.00 39.36 ? 471 LEU B N   1 
ATOM   3818 C CA  . LEU B 1 153 ? -12.067 13.570 20.078  1.00 40.02 ? 471 LEU B CA  1 
ATOM   3819 C C   . LEU B 1 153 ? -12.028 12.160 20.661  1.00 41.28 ? 471 LEU B C   1 
ATOM   3820 O O   . LEU B 1 153 ? -11.283 11.885 21.608  1.00 41.55 ? 471 LEU B O   1 
ATOM   3821 C CB  . LEU B 1 153 ? -10.778 13.842 19.306  1.00 40.50 ? 471 LEU B CB  1 
ATOM   3822 C CG  . LEU B 1 153 ? -10.547 15.236 18.712  1.00 39.25 ? 471 LEU B CG  1 
ATOM   3823 C CD1 . LEU B 1 153 ? -9.156  15.319 18.114  1.00 38.57 ? 471 LEU B CD1 1 
ATOM   3824 C CD2 . LEU B 1 153 ? -11.600 15.578 17.670  1.00 35.50 ? 471 LEU B CD2 1 
ATOM   3825 N N   . ASP B 1 154 ? -12.816 11.254 20.101  1.00 42.88 ? 472 ASP B N   1 
ATOM   3826 C CA  . ASP B 1 154 ? -12.674 9.854  20.493  1.00 45.99 ? 472 ASP B CA  1 
ATOM   3827 C C   . ASP B 1 154 ? -11.411 9.258  19.853  1.00 47.55 ? 472 ASP B C   1 
ATOM   3828 O O   . ASP B 1 154 ? -10.707 9.952  19.107  1.00 48.43 ? 472 ASP B O   1 
ATOM   3829 C CB  . ASP B 1 154 ? -13.924 9.039  20.156  1.00 45.87 ? 472 ASP B CB  1 
ATOM   3830 C CG  . ASP B 1 154 ? -14.247 9.057  18.690  1.00 45.85 ? 472 ASP B CG  1 
ATOM   3831 O OD1 . ASP B 1 154 ? -13.369 9.426  17.886  1.00 44.56 ? 472 ASP B OD1 1 
ATOM   3832 O OD2 . ASP B 1 154 ? -15.383 8.695  18.338  1.00 49.75 ? 472 ASP B OD2 1 
ATOM   3833 N N   . SER B 1 155 ? -11.130 7.987  20.148  1.00 48.23 ? 473 SER B N   1 
ATOM   3834 C CA  . SER B 1 155 ? -9.890  7.330  19.734  1.00 48.68 ? 473 SER B CA  1 
ATOM   3835 C C   . SER B 1 155 ? -9.567  7.518  18.255  1.00 48.88 ? 473 SER B C   1 
ATOM   3836 O O   . SER B 1 155 ? -8.423  7.772  17.891  1.00 48.55 ? 473 SER B O   1 
ATOM   3837 C CB  . SER B 1 155 ? -9.981  5.842  20.020  1.00 48.87 ? 473 SER B CB  1 
ATOM   3838 O OG  . SER B 1 155 ? -11.017 5.586  20.940  1.00 52.75 ? 473 SER B OG  1 
ATOM   3839 N N   . GLU B 1 156 ? -10.582 7.374  17.413  1.00 49.39 ? 474 GLU B N   1 
ATOM   3840 C CA  . GLU B 1 156 ? -10.431 7.514  15.976  1.00 50.93 ? 474 GLU B CA  1 
ATOM   3841 C C   . GLU B 1 156 ? -10.054 8.943  15.553  1.00 51.87 ? 474 GLU B C   1 
ATOM   3842 O O   . GLU B 1 156 ? -9.421  9.148  14.516  1.00 51.50 ? 474 GLU B O   1 
ATOM   3843 C CB  . GLU B 1 156 ? -11.727 7.098  15.288  1.00 51.22 ? 474 GLU B CB  1 
ATOM   3844 C CG  . GLU B 1 156 ? -12.547 6.074  16.076  1.00 56.37 ? 474 GLU B CG  1 
ATOM   3845 C CD  . GLU B 1 156 ? -12.032 4.641  15.933  1.00 59.52 ? 474 GLU B CD  1 
ATOM   3846 O OE1 . GLU B 1 156 ? -12.138 4.059  14.826  1.00 57.66 ? 474 GLU B OE1 1 
ATOM   3847 O OE2 . GLU B 1 156 ? -11.538 4.089  16.940  1.00 60.91 ? 474 GLU B OE2 1 
ATOM   3848 N N   . GLY B 1 157 ? -10.437 9.932  16.357  1.00 52.73 ? 475 GLY B N   1 
ATOM   3849 C CA  . GLY B 1 157 ? -10.210 11.335 16.003  1.00 53.15 ? 475 GLY B CA  1 
ATOM   3850 C C   . GLY B 1 157 ? -11.450 12.059 15.484  1.00 52.94 ? 475 GLY B C   1 
ATOM   3851 O O   . GLY B 1 157 ? -11.348 13.112 14.830  1.00 52.80 ? 475 GLY B O   1 
ATOM   3852 N N   . HIS B 1 158 ? -12.616 11.479 15.772  1.00 52.00 ? 476 HIS B N   1 
ATOM   3853 C CA  . HIS B 1 158 ? -13.912 12.065 15.447  1.00 50.74 ? 476 HIS B CA  1 
ATOM   3854 C C   . HIS B 1 158 ? -14.401 12.969 16.573  1.00 48.71 ? 476 HIS B C   1 
ATOM   3855 O O   . HIS B 1 158 ? -13.908 12.919 17.700  1.00 48.11 ? 476 HIS B O   1 
ATOM   3856 C CB  . HIS B 1 158 ? -14.950 10.968 15.228  1.00 51.70 ? 476 HIS B CB  1 
ATOM   3857 C CG  . HIS B 1 158 ? -14.807 10.255 13.926  1.00 55.55 ? 476 HIS B CG  1 
ATOM   3858 N ND1 . HIS B 1 158 ? -15.604 10.534 12.836  1.00 59.25 ? 476 HIS B ND1 1 
ATOM   3859 C CD2 . HIS B 1 158 ? -13.961 9.274  13.535  1.00 57.12 ? 476 HIS B CD2 1 
ATOM   3860 C CE1 . HIS B 1 158 ? -15.254 9.754  11.829  1.00 60.04 ? 476 HIS B CE1 1 
ATOM   3861 N NE2 . HIS B 1 158 ? -14.258 8.982  12.226  1.00 58.27 ? 476 HIS B NE2 1 
ATOM   3862 N N   . ILE B 1 159 ? -15.400 13.778 16.261  1.00 45.94 ? 477 ILE B N   1 
ATOM   3863 C CA  . ILE B 1 159 ? -15.935 14.711 17.217  1.00 43.15 ? 477 ILE B CA  1 
ATOM   3864 C C   . ILE B 1 159 ? -16.928 14.056 18.173  1.00 42.61 ? 477 ILE B C   1 
ATOM   3865 O O   . ILE B 1 159 ? -17.738 13.222 17.773  1.00 41.61 ? 477 ILE B O   1 
ATOM   3866 C CB  . ILE B 1 159 ? -16.570 15.905 16.491  1.00 42.23 ? 477 ILE B CB  1 
ATOM   3867 C CG1 . ILE B 1 159 ? -15.477 16.869 16.076  1.00 42.77 ? 477 ILE B CG1 1 
ATOM   3868 C CG2 . ILE B 1 159 ? -17.533 16.643 17.370  1.00 40.90 ? 477 ILE B CG2 1 
ATOM   3869 C CD1 . ILE B 1 159 ? -14.526 17.189 17.190  1.00 42.55 ? 477 ILE B CD1 1 
ATOM   3870 N N   . LYS B 1 160 ? -16.819 14.434 19.447  1.00 41.84 ? 478 LYS B N   1 
ATOM   3871 C CA  . LYS B 1 160 ? -17.824 14.160 20.464  1.00 40.75 ? 478 LYS B CA  1 
ATOM   3872 C C   . LYS B 1 160 ? -18.152 15.450 21.223  1.00 39.44 ? 478 LYS B C   1 
ATOM   3873 O O   . LYS B 1 160 ? -17.289 16.025 21.882  1.00 39.85 ? 478 LYS B O   1 
ATOM   3874 C CB  . LYS B 1 160 ? -17.313 13.114 21.468  1.00 41.27 ? 478 LYS B CB  1 
ATOM   3875 C CG  . LYS B 1 160 ? -17.054 11.715 20.899  1.00 42.17 ? 478 LYS B CG  1 
ATOM   3876 C CD  . LYS B 1 160 ? -18.357 10.972 20.626  1.00 40.78 ? 478 LYS B CD  1 
ATOM   3877 C CE  . LYS B 1 160 ? -18.185 9.464  20.754  1.00 32.96 ? 478 LYS B CE  1 
ATOM   3878 N NZ  . LYS B 1 160 ? -19.448 8.792  20.362  1.00 25.81 ? 478 LYS B NZ  1 
ATOM   3879 N N   . ILE B 1 161 ? -19.398 15.899 21.156  1.00 38.59 ? 479 ILE B N   1 
ATOM   3880 C CA  . ILE B 1 161 ? -19.825 17.004 22.022  1.00 38.53 ? 479 ILE B CA  1 
ATOM   3881 C C   . ILE B 1 161 ? -20.374 16.496 23.355  1.00 39.40 ? 479 ILE B C   1 
ATOM   3882 O O   . ILE B 1 161 ? -21.246 15.603 23.379  1.00 39.45 ? 479 ILE B O   1 
ATOM   3883 C CB  . ILE B 1 161 ? -20.932 17.834 21.390  1.00 38.07 ? 479 ILE B CB  1 
ATOM   3884 C CG1 . ILE B 1 161 ? -20.786 17.848 19.875  1.00 38.40 ? 479 ILE B CG1 1 
ATOM   3885 C CG2 . ILE B 1 161 ? -20.938 19.228 21.990  1.00 36.82 ? 479 ILE B CG2 1 
ATOM   3886 C CD1 . ILE B 1 161 ? -21.747 18.778 19.197  1.00 40.33 ? 479 ILE B CD1 1 
ATOM   3887 N N   . ALA B 1 162 ? -19.889 17.083 24.455  1.00 37.94 ? 480 ALA B N   1 
ATOM   3888 C CA  . ALA B 1 162 ? -20.297 16.680 25.798  1.00 36.03 ? 480 ALA B CA  1 
ATOM   3889 C C   . ALA B 1 162 ? -20.889 17.851 26.552  1.00 36.47 ? 480 ALA B C   1 
ATOM   3890 O O   . ALA B 1 162 ? -20.995 18.942 26.031  1.00 36.97 ? 480 ALA B O   1 
ATOM   3891 C CB  . ALA B 1 162 ? -19.125 16.135 26.554  1.00 35.53 ? 480 ALA B CB  1 
ATOM   3892 N N   . ASP B 1 163 ? -21.270 17.609 27.795  1.00 37.12 ? 481 ASP B N   1 
ATOM   3893 C CA  . ASP B 1 163 ? -21.800 18.631 28.666  1.00 36.62 ? 481 ASP B CA  1 
ATOM   3894 C C   . ASP B 1 163 ? -23.077 19.280 28.157  1.00 38.57 ? 481 ASP B C   1 
ATOM   3895 O O   . ASP B 1 163 ? -23.031 20.156 27.300  1.00 39.31 ? 481 ASP B O   1 
ATOM   3896 C CB  . ASP B 1 163 ? -20.755 19.697 28.955  1.00 35.89 ? 481 ASP B CB  1 
ATOM   3897 C CG  . ASP B 1 163 ? -21.153 20.561 30.117  1.00 35.51 ? 481 ASP B CG  1 
ATOM   3898 O OD1 . ASP B 1 163 ? -22.367 20.594 30.403  1.00 34.39 ? 481 ASP B OD1 1 
ATOM   3899 O OD2 . ASP B 1 163 ? -20.276 21.171 30.755  1.00 33.17 ? 481 ASP B OD2 1 
ATOM   3900 N N   . PHE B 1 164 ? -24.218 18.882 28.715  1.00 40.65 ? 482 PHE B N   1 
ATOM   3901 C CA  . PHE B 1 164 ? -25.516 19.447 28.289  1.00 42.27 ? 482 PHE B CA  1 
ATOM   3902 C C   . PHE B 1 164 ? -26.278 20.138 29.424  1.00 43.10 ? 482 PHE B C   1 
ATOM   3903 O O   . PHE B 1 164 ? -27.506 20.248 29.394  1.00 43.57 ? 482 PHE B O   1 
ATOM   3904 C CB  . PHE B 1 164 ? -26.367 18.376 27.579  1.00 41.88 ? 482 PHE B CB  1 
ATOM   3905 C CG  . PHE B 1 164 ? -25.681 17.786 26.377  1.00 43.25 ? 482 PHE B CG  1 
ATOM   3906 C CD1 . PHE B 1 164 ? -24.785 16.736 26.518  1.00 43.47 ? 482 PHE B CD1 1 
ATOM   3907 C CD2 . PHE B 1 164 ? -25.877 18.323 25.113  1.00 40.62 ? 482 PHE B CD2 1 
ATOM   3908 C CE1 . PHE B 1 164 ? -24.122 16.214 25.405  1.00 45.76 ? 482 PHE B CE1 1 
ATOM   3909 C CE2 . PHE B 1 164 ? -25.220 17.810 24.007  1.00 42.63 ? 482 PHE B CE2 1 
ATOM   3910 C CZ  . PHE B 1 164 ? -24.340 16.757 24.147  1.00 43.75 ? 482 PHE B CZ  1 
ATOM   3911 N N   . GLY B 1 165 ? -25.533 20.630 30.409  1.00 43.70 ? 483 GLY B N   1 
ATOM   3912 C CA  . GLY B 1 165 ? -26.126 21.308 31.551  1.00 44.41 ? 483 GLY B CA  1 
ATOM   3913 C C   . GLY B 1 165 ? -26.862 22.621 31.308  1.00 45.23 ? 483 GLY B C   1 
ATOM   3914 O O   . GLY B 1 165 ? -27.528 23.119 32.212  1.00 45.73 ? 483 GLY B O   1 
ATOM   3915 N N   . MET B 1 166 ? -26.762 23.197 30.114  1.00 45.15 ? 484 MET B N   1 
ATOM   3916 C CA  . MET B 1 166 ? -27.321 24.533 29.912  1.00 45.79 ? 484 MET B CA  1 
ATOM   3917 C C   . MET B 1 166 ? -28.397 24.569 28.851  1.00 45.14 ? 484 MET B C   1 
ATOM   3918 O O   . MET B 1 166 ? -28.967 25.618 28.588  1.00 44.23 ? 484 MET B O   1 
ATOM   3919 C CB  . MET B 1 166 ? -26.228 25.543 29.552  1.00 46.75 ? 484 MET B CB  1 
ATOM   3920 C CG  . MET B 1 166 ? -25.244 25.825 30.671  1.00 52.03 ? 484 MET B CG  1 
ATOM   3921 S SD  . MET B 1 166 ? -24.101 27.177 30.282  1.00 63.90 ? 484 MET B SD  1 
ATOM   3922 C CE  . MET B 1 166 ? -24.977 28.594 30.965  1.00 60.76 ? 484 MET B CE  1 
ATOM   3923 N N   . CYS B 1 167 ? -28.665 23.429 28.230  1.00 44.88 ? 485 CYS B N   1 
ATOM   3924 C CA  . CYS B 1 167 ? -29.654 23.372 27.169  1.00 44.92 ? 485 CYS B CA  1 
ATOM   3925 C C   . CYS B 1 167 ? -30.981 24.022 27.583  1.00 46.71 ? 485 CYS B C   1 
ATOM   3926 O O   . CYS B 1 167 ? -31.291 24.103 28.763  1.00 46.90 ? 485 CYS B O   1 
ATOM   3927 C CB  . CYS B 1 167 ? -29.889 21.920 26.763  1.00 44.60 ? 485 CYS B CB  1 
ATOM   3928 S SG  . CYS B 1 167 ? -28.451 21.087 26.031  1.00 43.34 ? 485 CYS B SG  1 
ATOM   3929 N N   . LYS B 1 168 ? -31.750 24.492 26.604  1.00 48.55 ? 486 LYS B N   1 
ATOM   3930 C CA  . LYS B 1 168 ? -33.109 24.956 26.832  1.00 50.07 ? 486 LYS B CA  1 
ATOM   3931 C C   . LYS B 1 168 ? -34.052 24.121 25.982  1.00 50.05 ? 486 LYS B C   1 
ATOM   3932 O O   . LYS B 1 168 ? -33.834 23.967 24.784  1.00 49.27 ? 486 LYS B O   1 
ATOM   3933 C CB  . LYS B 1 168 ? -33.242 26.427 26.437  1.00 52.52 ? 486 LYS B CB  1 
ATOM   3934 C CG  . LYS B 1 168 ? -34.575 27.090 26.825  1.00 55.35 ? 486 LYS B CG  1 
ATOM   3935 C CD  . LYS B 1 168 ? -34.574 27.473 28.302  1.00 59.94 ? 486 LYS B CD  1 
ATOM   3936 C CE  . LYS B 1 168 ? -35.973 27.555 28.876  1.00 59.61 ? 486 LYS B CE  1 
ATOM   3937 N NZ  . LYS B 1 168 ? -35.855 27.755 30.346  1.00 60.71 ? 486 LYS B NZ  1 
ATOM   3938 N N   . GLU B 1 169 ? -35.101 23.594 26.604  1.00 50.93 ? 487 GLU B N   1 
ATOM   3939 C CA  . GLU B 1 169 ? -36.056 22.734 25.912  1.00 52.73 ? 487 GLU B CA  1 
ATOM   3940 C C   . GLU B 1 169 ? -37.153 23.480 25.169  1.00 54.02 ? 487 GLU B C   1 
ATOM   3941 O O   . GLU B 1 169 ? -37.375 24.669 25.381  1.00 53.61 ? 487 GLU B O   1 
ATOM   3942 C CB  . GLU B 1 169 ? -36.737 21.792 26.902  1.00 52.85 ? 487 GLU B CB  1 
ATOM   3943 C CG  . GLU B 1 169 ? -35.838 20.746 27.498  1.00 51.78 ? 487 GLU B CG  1 
ATOM   3944 C CD  . GLU B 1 169 ? -36.581 19.806 28.425  1.00 51.32 ? 487 GLU B CD  1 
ATOM   3945 O OE1 . GLU B 1 169 ? -36.907 20.217 29.562  1.00 48.39 ? 487 GLU B OE1 1 
ATOM   3946 O OE2 . GLU B 1 169 ? -36.819 18.646 28.022  1.00 52.74 ? 487 GLU B OE2 1 
ATOM   3947 N N   . HIS B 1 170 ? -37.849 22.735 24.315  1.00 56.52 ? 488 HIS B N   1 
ATOM   3948 C CA  . HIS B 1 170 ? -39.086 23.173 23.666  1.00 59.12 ? 488 HIS B CA  1 
ATOM   3949 C C   . HIS B 1 170 ? -38.922 24.468 22.865  1.00 60.64 ? 488 HIS B C   1 
ATOM   3950 O O   . HIS B 1 170 ? -39.817 25.321 22.844  1.00 60.83 ? 488 HIS B O   1 
ATOM   3951 C CB  . HIS B 1 170 ? -40.229 23.287 24.694  1.00 58.96 ? 488 HIS B CB  1 
ATOM   3952 C CG  . HIS B 1 170 ? -40.373 22.084 25.578  1.00 61.45 ? 488 HIS B CG  1 
ATOM   3953 N ND1 . HIS B 1 170 ? -40.536 22.178 26.944  1.00 63.76 ? 488 HIS B ND1 1 
ATOM   3954 C CD2 . HIS B 1 170 ? -40.362 20.759 25.293  1.00 65.01 ? 488 HIS B CD2 1 
ATOM   3955 C CE1 . HIS B 1 170 ? -40.625 20.965 27.463  1.00 64.57 ? 488 HIS B CE1 1 
ATOM   3956 N NE2 . HIS B 1 170 ? -40.522 20.085 26.481  1.00 66.32 ? 488 HIS B NE2 1 
ATOM   3957 N N   . MET B 1 171 ? -37.778 24.603 22.198  1.00 61.93 ? 489 MET B N   1 
ATOM   3958 C CA  . MET B 1 171 ? -37.455 25.837 21.488  1.00 62.71 ? 489 MET B CA  1 
ATOM   3959 C C   . MET B 1 171 ? -37.621 25.732 19.992  1.00 63.91 ? 489 MET B C   1 
ATOM   3960 O O   . MET B 1 171 ? -36.634 25.721 19.256  1.00 64.25 ? 489 MET B O   1 
ATOM   3961 C CB  . MET B 1 171 ? -36.038 26.294 21.812  1.00 61.47 ? 489 MET B CB  1 
ATOM   3962 C CG  . MET B 1 171 ? -35.854 26.621 23.273  1.00 63.17 ? 489 MET B CG  1 
ATOM   3963 S SD  . MET B 1 171 ? -36.897 27.993 23.810  1.00 61.54 ? 489 MET B SD  1 
ATOM   3964 C CE  . MET B 1 171 ? -37.250 27.507 25.498  1.00 63.01 ? 489 MET B CE  1 
ATOM   3965 N N   . MET B 1 172 ? -38.871 25.637 19.548  1.00 65.80 ? 490 MET B N   1 
ATOM   3966 C CA  . MET B 1 172 ? -39.198 25.845 18.137  1.00 67.75 ? 490 MET B CA  1 
ATOM   3967 C C   . MET B 1 172 ? -40.628 26.340 17.965  1.00 66.82 ? 490 MET B C   1 
ATOM   3968 O O   . MET B 1 172 ? -40.952 27.456 18.364  1.00 65.26 ? 490 MET B O   1 
ATOM   3969 C CB  . MET B 1 172 ? -38.909 24.602 17.280  1.00 69.00 ? 490 MET B CB  1 
ATOM   3970 C CG  . MET B 1 172 ? -37.462 24.564 16.750  1.00 75.30 ? 490 MET B CG  1 
ATOM   3971 S SD  . MET B 1 172 ? -37.226 23.723 15.158  1.00 87.38 ? 490 MET B SD  1 
ATOM   3972 C CE  . MET B 1 172 ? -35.616 24.349 14.651  1.00 85.00 ? 490 MET B CE  1 
ATOM   3973 N N   . GLY B 1 174 ? -40.018 29.816 16.215  1.00 51.81 ? 492 GLY B N   1 
ATOM   3974 C CA  . GLY B 1 174 ? -41.198 30.152 16.997  1.00 53.74 ? 492 GLY B CA  1 
ATOM   3975 C C   . GLY B 1 174 ? -40.900 30.669 18.399  1.00 54.92 ? 492 GLY B C   1 
ATOM   3976 O O   . GLY B 1 174 ? -40.943 31.878 18.633  1.00 55.00 ? 492 GLY B O   1 
ATOM   3977 N N   . VAL B 1 175 ? -40.596 29.754 19.329  1.00 55.56 ? 493 VAL B N   1 
ATOM   3978 C CA  . VAL B 1 175 ? -40.412 30.078 20.762  1.00 55.55 ? 493 VAL B CA  1 
ATOM   3979 C C   . VAL B 1 175 ? -39.116 30.863 21.055  1.00 56.26 ? 493 VAL B C   1 
ATOM   3980 O O   . VAL B 1 175 ? -38.152 30.769 20.291  1.00 56.60 ? 493 VAL B O   1 
ATOM   3981 C CB  . VAL B 1 175 ? -40.428 28.787 21.629  1.00 55.47 ? 493 VAL B CB  1 
ATOM   3982 C CG1 . VAL B 1 175 ? -40.695 29.120 23.092  1.00 54.53 ? 493 VAL B CG1 1 
ATOM   3983 C CG2 . VAL B 1 175 ? -41.462 27.795 21.111  1.00 53.67 ? 493 VAL B CG2 1 
ATOM   3984 N N   . THR B 1 176 ? -39.090 31.633 22.148  1.00 56.33 ? 494 THR B N   1 
ATOM   3985 C CA  . THR B 1 176 ? -37.883 32.403 22.522  1.00 57.18 ? 494 THR B CA  1 
ATOM   3986 C C   . THR B 1 176 ? -37.694 32.594 24.042  1.00 57.80 ? 494 THR B C   1 
ATOM   3987 O O   . THR B 1 176 ? -38.651 32.499 24.806  1.00 57.97 ? 494 THR B O   1 
ATOM   3988 C CB  . THR B 1 176 ? -37.831 33.817 21.845  1.00 57.23 ? 494 THR B CB  1 
ATOM   3989 O OG1 . THR B 1 176 ? -38.777 34.702 22.469  1.00 59.23 ? 494 THR B OG1 1 
ATOM   3990 C CG2 . THR B 1 176 ? -38.096 33.748 20.339  1.00 55.65 ? 494 THR B CG2 1 
ATOM   3991 N N   . THR B 1 177 ? -36.460 32.890 24.462  1.00 57.92 ? 495 THR B N   1 
ATOM   3992 C CA  . THR B 1 177 ? -36.139 33.159 25.874  1.00 57.98 ? 495 THR B CA  1 
ATOM   3993 C C   . THR B 1 177 ? -35.143 34.326 26.036  1.00 57.85 ? 495 THR B C   1 
ATOM   3994 O O   . THR B 1 177 ? -34.357 34.596 25.124  1.00 58.08 ? 495 THR B O   1 
ATOM   3995 C CB  . THR B 1 177 ? -35.576 31.889 26.547  1.00 58.34 ? 495 THR B CB  1 
ATOM   3996 O OG1 . THR B 1 177 ? -34.607 32.246 27.546  1.00 57.87 ? 495 THR B OG1 1 
ATOM   3997 C CG2 . THR B 1 177 ? -34.920 31.001 25.505  1.00 57.74 ? 495 THR B CG2 1 
ATOM   3998 N N   . ARG B 1 178 ? -35.177 35.016 27.181  1.00 56.62 ? 496 ARG B N   1 
ATOM   3999 C CA  . ARG B 1 178 ? -34.222 36.104 27.442  1.00 55.50 ? 496 ARG B CA  1 
ATOM   4000 C C   . ARG B 1 178 ? -33.299 35.805 28.617  1.00 54.95 ? 496 ARG B C   1 
ATOM   4001 O O   . ARG B 1 178 ? -32.854 36.729 29.319  1.00 54.53 ? 496 ARG B O   1 
ATOM   4002 C CB  . ARG B 1 178 ? -34.929 37.419 27.749  1.00 55.51 ? 496 ARG B CB  1 
ATOM   4003 C CG  . ARG B 1 178 ? -36.309 37.559 27.206  1.00 56.18 ? 496 ARG B CG  1 
ATOM   4004 C CD  . ARG B 1 178 ? -36.961 38.737 27.877  1.00 57.66 ? 496 ARG B CD  1 
ATOM   4005 N NE  . ARG B 1 178 ? -36.062 39.884 27.870  1.00 59.95 ? 496 ARG B NE  1 
ATOM   4006 C CZ  . ARG B 1 178 ? -36.227 40.988 28.596  1.00 61.21 ? 496 ARG B CZ  1 
ATOM   4007 N NH1 . ARG B 1 178 ? -37.265 41.115 29.417  1.00 58.92 ? 496 ARG B NH1 1 
ATOM   4008 N NH2 . ARG B 1 178 ? -35.343 41.976 28.499  1.00 62.09 ? 496 ARG B NH2 1 
ATOM   4009 N N   . GLU B 1 179 ? -33.019 34.524 28.837  1.00 53.79 ? 497 GLU B N   1 
ATOM   4010 C CA  . GLU B 1 179 ? -32.181 34.091 29.955  1.00 52.31 ? 497 GLU B CA  1 
ATOM   4011 C C   . GLU B 1 179 ? -30.682 34.208 29.639  1.00 50.07 ? 497 GLU B C   1 
ATOM   4012 O O   . GLU B 1 179 ? -30.176 33.546 28.737  1.00 47.80 ? 497 GLU B O   1 
ATOM   4013 C CB  . GLU B 1 179 ? -32.549 32.657 30.335  1.00 53.28 ? 497 GLU B CB  1 
ATOM   4014 C CG  . GLU B 1 179 ? -31.600 31.977 31.311  1.00 57.53 ? 497 GLU B CG  1 
ATOM   4015 C CD  . GLU B 1 179 ? -31.902 30.490 31.469  1.00 63.53 ? 497 GLU B CD  1 
ATOM   4016 O OE1 . GLU B 1 179 ? -32.858 30.008 30.806  1.00 67.68 ? 497 GLU B OE1 1 
ATOM   4017 O OE2 . GLU B 1 179 ? -31.189 29.809 32.252  1.00 63.13 ? 497 GLU B OE2 1 
ATOM   4018 N N   . PHE B 1 180 ? -29.988 35.052 30.401  1.00 48.89 ? 498 PHE B N   1 
ATOM   4019 C CA  . PHE B 1 180 ? -28.563 35.346 30.189  1.00 48.02 ? 498 PHE B CA  1 
ATOM   4020 C C   . PHE B 1 180 ? -27.585 34.226 30.604  1.00 47.73 ? 498 PHE B C   1 
ATOM   4021 O O   . PHE B 1 180 ? -27.485 33.890 31.787  1.00 48.85 ? 498 PHE B O   1 
ATOM   4022 C CB  . PHE B 1 180 ? -28.181 36.639 30.931  1.00 47.62 ? 498 PHE B CB  1 
ATOM   4023 C CG  . PHE B 1 180 ? -26.690 36.850 31.034  1.00 48.72 ? 498 PHE B CG  1 
ATOM   4024 C CD1 . PHE B 1 180 ? -26.002 37.527 30.035  1.00 44.53 ? 498 PHE B CD1 1 
ATOM   4025 C CD2 . PHE B 1 180 ? -25.973 36.333 32.110  1.00 46.30 ? 498 PHE B CD2 1 
ATOM   4026 C CE1 . PHE B 1 180 ? -24.653 37.692 30.115  1.00 42.07 ? 498 PHE B CE1 1 
ATOM   4027 C CE2 . PHE B 1 180 ? -24.622 36.499 32.190  1.00 45.36 ? 498 PHE B CE2 1 
ATOM   4028 C CZ  . PHE B 1 180 ? -23.958 37.175 31.193  1.00 46.94 ? 498 PHE B CZ  1 
ATOM   4029 N N   . CYS B 1 181 ? -26.821 33.677 29.663  1.00 46.74 ? 499 CYS B N   1 
ATOM   4030 C CA  . CYS B 1 181 ? -25.899 32.601 30.036  1.00 46.25 ? 499 CYS B CA  1 
ATOM   4031 C C   . CYS B 1 181 ? -24.998 32.066 28.926  1.00 45.02 ? 499 CYS B C   1 
ATOM   4032 O O   . CYS B 1 181 ? -25.334 32.115 27.740  1.00 43.74 ? 499 CYS B O   1 
ATOM   4033 C CB  . CYS B 1 181 ? -26.697 31.428 30.576  1.00 46.48 ? 499 CYS B CB  1 
ATOM   4034 S SG  . CYS B 1 181 ? -27.827 30.810 29.321  1.00 50.03 ? 499 CYS B SG  1 
ATOM   4035 N N   . GLY B 1 182 ? -23.865 31.505 29.341  1.00 43.81 ? 500 GLY B N   1 
ATOM   4036 C CA  . GLY B 1 182 ? -22.949 30.851 28.419  1.00 40.78 ? 500 GLY B CA  1 
ATOM   4037 C C   . GLY B 1 182 ? -21.597 31.350 28.810  1.00 38.57 ? 500 GLY B C   1 
ATOM   4038 O O   . GLY B 1 182 ? -21.497 32.117 29.755  1.00 36.28 ? 500 GLY B O   1 
ATOM   4039 N N   . THR B 1 183 ? -20.559 30.915 28.099  1.00 39.64 ? 501 THR B N   1 
ATOM   4040 C CA  . THR B 1 183 ? -19.201 31.421 28.354  1.00 40.10 ? 501 THR B CA  1 
ATOM   4041 C C   . THR B 1 183 ? -18.969 32.726 27.592  1.00 39.27 ? 501 THR B C   1 
ATOM   4042 O O   . THR B 1 183 ? -19.058 32.767 26.359  1.00 38.07 ? 501 THR B O   1 
ATOM   4043 C CB  . THR B 1 183 ? -18.139 30.375 28.028  1.00 39.88 ? 501 THR B CB  1 
ATOM   4044 O OG1 . THR B 1 183 ? -18.511 29.145 28.660  1.00 45.70 ? 501 THR B OG1 1 
ATOM   4045 C CG2 . THR B 1 183 ? -16.787 30.805 28.546  1.00 36.82 ? 501 THR B CG2 1 
ATOM   4046 N N   . PRO B 1 184 ? -18.700 33.803 28.341  1.00 38.43 ? 502 PRO B N   1 
ATOM   4047 C CA  . PRO B 1 184 ? -18.651 35.173 27.831  1.00 38.91 ? 502 PRO B CA  1 
ATOM   4048 C C   . PRO B 1 184 ? -18.191 35.320 26.371  1.00 38.14 ? 502 PRO B C   1 
ATOM   4049 O O   . PRO B 1 184 ? -18.969 35.766 25.531  1.00 37.45 ? 502 PRO B O   1 
ATOM   4050 C CB  . PRO B 1 184 ? -17.701 35.855 28.813  1.00 38.79 ? 502 PRO B CB  1 
ATOM   4051 C CG  . PRO B 1 184 ? -18.061 35.210 30.118  1.00 38.02 ? 502 PRO B CG  1 
ATOM   4052 C CD  . PRO B 1 184 ? -18.406 33.757 29.783  1.00 37.75 ? 502 PRO B CD  1 
ATOM   4053 N N   . ASP B 1 185 ? -16.956 34.925 26.074  1.00 38.52 ? 503 ASP B N   1 
ATOM   4054 C CA  . ASP B 1 185 ? -16.414 35.012 24.713  1.00 38.42 ? 503 ASP B CA  1 
ATOM   4055 C C   . ASP B 1 185 ? -17.302 34.382 23.622  1.00 37.61 ? 503 ASP B C   1 
ATOM   4056 O O   . ASP B 1 185 ? -17.183 34.725 22.451  1.00 38.33 ? 503 ASP B O   1 
ATOM   4057 C CB  . ASP B 1 185 ? -15.013 34.378 24.654  1.00 39.49 ? 503 ASP B CB  1 
ATOM   4058 C CG  . ASP B 1 185 ? -13.930 35.257 25.299  1.00 41.42 ? 503 ASP B CG  1 
ATOM   4059 O OD1 . ASP B 1 185 ? -13.863 35.315 26.550  1.00 38.06 ? 503 ASP B OD1 1 
ATOM   4060 O OD2 . ASP B 1 185 ? -13.130 35.873 24.553  1.00 42.19 ? 503 ASP B OD2 1 
ATOM   4061 N N   . TYR B 1 186 ? -18.179 33.458 23.994  1.00 36.01 ? 504 TYR B N   1 
ATOM   4062 C CA  . TYR B 1 186 ? -18.996 32.764 23.009  1.00 33.95 ? 504 TYR B CA  1 
ATOM   4063 C C   . TYR B 1 186 ? -20.419 33.292 22.896  1.00 34.54 ? 504 TYR B C   1 
ATOM   4064 O O   . TYR B 1 186 ? -21.198 32.770 22.098  1.00 34.81 ? 504 TYR B O   1 
ATOM   4065 C CB  . TYR B 1 186 ? -19.063 31.281 23.346  1.00 33.57 ? 504 TYR B CB  1 
ATOM   4066 C CG  . TYR B 1 186 ? -17.734 30.598 23.268  1.00 31.57 ? 504 TYR B CG  1 
ATOM   4067 C CD1 . TYR B 1 186 ? -16.775 30.802 24.234  1.00 30.94 ? 504 TYR B CD1 1 
ATOM   4068 C CD2 . TYR B 1 186 ? -17.429 29.764 22.202  1.00 34.09 ? 504 TYR B CD2 1 
ATOM   4069 C CE1 . TYR B 1 186 ? -15.554 30.180 24.152  1.00 34.81 ? 504 TYR B CE1 1 
ATOM   4070 C CE2 . TYR B 1 186 ? -16.213 29.143 22.098  1.00 32.55 ? 504 TYR B CE2 1 
ATOM   4071 C CZ  . TYR B 1 186 ? -15.278 29.345 23.075  1.00 36.86 ? 504 TYR B CZ  1 
ATOM   4072 O OH  . TYR B 1 186 ? -14.052 28.713 22.975  1.00 42.06 ? 504 TYR B OH  1 
ATOM   4073 N N   . ILE B 1 187 ? -20.779 34.302 23.687  1.00 34.56 ? 505 ILE B N   1 
ATOM   4074 C CA  . ILE B 1 187 ? -22.175 34.756 23.697  1.00 35.76 ? 505 ILE B CA  1 
ATOM   4075 C C   . ILE B 1 187 ? -22.571 35.631 22.489  1.00 37.26 ? 505 ILE B C   1 
ATOM   4076 O O   . ILE B 1 187 ? -21.800 36.476 22.020  1.00 39.04 ? 505 ILE B O   1 
ATOM   4077 C CB  . ILE B 1 187 ? -22.568 35.453 25.022  1.00 35.82 ? 505 ILE B CB  1 
ATOM   4078 C CG1 . ILE B 1 187 ? -22.436 34.492 26.210  1.00 36.54 ? 505 ILE B CG1 1 
ATOM   4079 C CG2 . ILE B 1 187 ? -24.007 35.938 24.969  1.00 35.28 ? 505 ILE B CG2 1 
ATOM   4080 C CD1 . ILE B 1 187 ? -22.835 35.117 27.550  1.00 28.61 ? 505 ILE B CD1 1 
ATOM   4081 N N   . ALA B 1 188 ? -23.778 35.404 21.983  1.00 36.73 ? 506 ALA B N   1 
ATOM   4082 C CA  . ALA B 1 188 ? -24.315 36.199 20.908  1.00 36.55 ? 506 ALA B CA  1 
ATOM   4083 C C   . ALA B 1 188 ? -24.670 37.578 21.445  1.00 37.46 ? 506 ALA B C   1 
ATOM   4084 O O   . ALA B 1 188 ? -24.869 37.750 22.665  1.00 36.91 ? 506 ALA B O   1 
ATOM   4085 C CB  . ALA B 1 188 ? -25.554 35.530 20.337  1.00 36.37 ? 506 ALA B CB  1 
ATOM   4086 N N   . PRO B 1 189 ? -24.736 38.570 20.535  1.00 36.94 ? 507 PRO B N   1 
ATOM   4087 C CA  . PRO B 1 189 ? -25.260 39.910 20.796  1.00 36.22 ? 507 PRO B CA  1 
ATOM   4088 C C   . PRO B 1 189 ? -26.622 39.898 21.502  1.00 36.12 ? 507 PRO B C   1 
ATOM   4089 O O   . PRO B 1 189 ? -26.789 40.571 22.523  1.00 36.09 ? 507 PRO B O   1 
ATOM   4090 C CB  . PRO B 1 189 ? -25.388 40.495 19.401  1.00 35.48 ? 507 PRO B CB  1 
ATOM   4091 C CG  . PRO B 1 189 ? -24.248 39.850 18.656  1.00 37.81 ? 507 PRO B CG  1 
ATOM   4092 C CD  . PRO B 1 189 ? -24.096 38.471 19.210  1.00 36.02 ? 507 PRO B CD  1 
ATOM   4093 N N   . GLU B 1 190 ? -27.579 39.136 20.981  1.00 35.75 ? 508 GLU B N   1 
ATOM   4094 C CA  . GLU B 1 190 ? -28.919 39.135 21.553  1.00 36.32 ? 508 GLU B CA  1 
ATOM   4095 C C   . GLU B 1 190 ? -28.891 38.844 23.031  1.00 36.74 ? 508 GLU B C   1 
ATOM   4096 O O   . GLU B 1 190 ? -29.626 39.449 23.801  1.00 38.09 ? 508 GLU B O   1 
ATOM   4097 C CB  . GLU B 1 190 ? -29.824 38.122 20.867  1.00 36.90 ? 508 GLU B CB  1 
ATOM   4098 C CG  . GLU B 1 190 ? -29.207 36.743 20.707  1.00 38.33 ? 508 GLU B CG  1 
ATOM   4099 C CD  . GLU B 1 190 ? -28.376 36.646 19.454  1.00 38.27 ? 508 GLU B CD  1 
ATOM   4100 O OE1 . GLU B 1 190 ? -27.717 37.647 19.115  1.00 39.90 ? 508 GLU B OE1 1 
ATOM   4101 O OE2 . GLU B 1 190 ? -28.394 35.584 18.801  1.00 39.32 ? 508 GLU B OE2 1 
ATOM   4102 N N   . ILE B 1 191 ? -28.052 37.912 23.446  1.00 37.21 ? 509 ILE B N   1 
ATOM   4103 C CA  . ILE B 1 191 ? -28.035 37.560 24.856  1.00 37.92 ? 509 ILE B CA  1 
ATOM   4104 C C   . ILE B 1 191 ? -27.692 38.776 25.688  1.00 39.43 ? 509 ILE B C   1 
ATOM   4105 O O   . ILE B 1 191 ? -28.247 38.977 26.761  1.00 41.06 ? 509 ILE B O   1 
ATOM   4106 C CB  . ILE B 1 191 ? -27.086 36.378 25.157  1.00 38.30 ? 509 ILE B CB  1 
ATOM   4107 C CG1 . ILE B 1 191 ? -27.734 35.065 24.691  1.00 34.75 ? 509 ILE B CG1 1 
ATOM   4108 C CG2 . ILE B 1 191 ? -26.712 36.325 26.648  1.00 33.64 ? 509 ILE B CG2 1 
ATOM   4109 C CD1 . ILE B 1 191 ? -26.812 33.869 24.726  1.00 29.25 ? 509 ILE B CD1 1 
ATOM   4110 N N   . ILE B 1 192 ? -26.800 39.608 25.175  1.00 40.88 ? 510 ILE B N   1 
ATOM   4111 C CA  . ILE B 1 192 ? -26.339 40.767 25.925  1.00 42.08 ? 510 ILE B CA  1 
ATOM   4112 C C   . ILE B 1 192 ? -27.370 41.894 25.944  1.00 44.46 ? 510 ILE B C   1 
ATOM   4113 O O   . ILE B 1 192 ? -27.665 42.482 26.990  1.00 45.36 ? 510 ILE B O   1 
ATOM   4114 C CB  . ILE B 1 192 ? -25.043 41.286 25.342  1.00 41.35 ? 510 ILE B CB  1 
ATOM   4115 C CG1 . ILE B 1 192 ? -23.927 40.279 25.630  1.00 38.23 ? 510 ILE B CG1 1 
ATOM   4116 C CG2 . ILE B 1 192 ? -24.740 42.666 25.913  1.00 41.55 ? 510 ILE B CG2 1 
ATOM   4117 C CD1 . ILE B 1 192 ? -22.760 40.369 24.694  1.00 33.60 ? 510 ILE B CD1 1 
ATOM   4118 N N   . ALA B 1 193 ? -27.912 42.207 24.779  1.00 45.91 ? 511 ALA B N   1 
ATOM   4119 C CA  . ALA B 1 193 ? -28.951 43.202 24.701  1.00 46.52 ? 511 ALA B CA  1 
ATOM   4120 C C   . ALA B 1 193 ? -30.074 42.754 25.630  1.00 47.80 ? 511 ALA B C   1 
ATOM   4121 O O   . ALA B 1 193 ? -30.822 43.570 26.162  1.00 48.02 ? 511 ALA B O   1 
ATOM   4122 C CB  . ALA B 1 193 ? -29.436 43.314 23.284  1.00 46.32 ? 511 ALA B CB  1 
ATOM   4123 N N   . TYR B 1 194 ? -30.151 41.443 25.844  1.00 49.14 ? 512 TYR B N   1 
ATOM   4124 C CA  . TYR B 1 194 ? -31.192 40.817 26.657  1.00 49.68 ? 512 TYR B CA  1 
ATOM   4125 C C   . TYR B 1 194 ? -32.441 40.689 25.846  1.00 49.07 ? 512 TYR B C   1 
ATOM   4126 O O   . TYR B 1 194 ? -33.522 40.569 26.396  1.00 49.67 ? 512 TYR B O   1 
ATOM   4127 C CB  . TYR B 1 194 ? -31.483 41.591 27.940  1.00 50.92 ? 512 TYR B CB  1 
ATOM   4128 C CG  . TYR B 1 194 ? -30.594 41.210 29.111  1.00 54.94 ? 512 TYR B CG  1 
ATOM   4129 C CD1 . TYR B 1 194 ? -30.876 40.088 29.883  1.00 56.30 ? 512 TYR B CD1 1 
ATOM   4130 C CD2 . TYR B 1 194 ? -29.482 41.982 29.452  1.00 56.35 ? 512 TYR B CD2 1 
ATOM   4131 C CE1 . TYR B 1 194 ? -30.078 39.739 30.957  1.00 58.54 ? 512 TYR B CE1 1 
ATOM   4132 C CE2 . TYR B 1 194 ? -28.674 41.641 30.526  1.00 59.91 ? 512 TYR B CE2 1 
ATOM   4133 C CZ  . TYR B 1 194 ? -28.977 40.513 31.280  1.00 61.01 ? 512 TYR B CZ  1 
ATOM   4134 O OH  . TYR B 1 194 ? -28.180 40.152 32.354  1.00 59.79 ? 512 TYR B OH  1 
ATOM   4135 N N   . GLN B 1 195 ? -32.277 40.734 24.530  1.00 48.43 ? 513 GLN B N   1 
ATOM   4136 C CA  . GLN B 1 195 ? -33.304 40.296 23.606  1.00 49.36 ? 513 GLN B CA  1 
ATOM   4137 C C   . GLN B 1 195 ? -33.714 38.835 23.822  1.00 49.85 ? 513 GLN B C   1 
ATOM   4138 O O   . GLN B 1 195 ? -32.892 37.985 24.201  1.00 49.91 ? 513 GLN B O   1 
ATOM   4139 C CB  . GLN B 1 195 ? -32.784 40.395 22.180  1.00 50.05 ? 513 GLN B CB  1 
ATOM   4140 C CG  . GLN B 1 195 ? -32.557 41.801 21.674  1.00 53.88 ? 513 GLN B CG  1 
ATOM   4141 C CD  . GLN B 1 195 ? -32.702 41.892 20.161  1.00 56.25 ? 513 GLN B CD  1 
ATOM   4142 O OE1 . GLN B 1 195 ? -32.209 41.037 19.413  1.00 54.56 ? 513 GLN B OE1 1 
ATOM   4143 N NE2 . GLN B 1 195 ? -33.398 42.928 19.704  1.00 56.78 ? 513 GLN B NE2 1 
ATOM   4144 N N   . PRO B 1 196 ? -34.999 38.541 23.591  1.00 49.50 ? 514 PRO B N   1 
ATOM   4145 C CA  . PRO B 1 196 ? -35.449 37.168 23.399  1.00 48.55 ? 514 PRO B CA  1 
ATOM   4146 C C   . PRO B 1 196 ? -34.770 36.561 22.180  1.00 47.15 ? 514 PRO B C   1 
ATOM   4147 O O   . PRO B 1 196 ? -34.702 37.203 21.137  1.00 46.76 ? 514 PRO B O   1 
ATOM   4148 C CB  . PRO B 1 196 ? -36.948 37.340 23.152  1.00 49.06 ? 514 PRO B CB  1 
ATOM   4149 C CG  . PRO B 1 196 ? -37.304 38.536 23.992  1.00 49.26 ? 514 PRO B CG  1 
ATOM   4150 C CD  . PRO B 1 196 ? -36.121 39.461 23.861  1.00 49.46 ? 514 PRO B CD  1 
ATOM   4151 N N   . TYR B 1 197 ? -34.264 35.339 22.311  1.00 46.09 ? 515 TYR B N   1 
ATOM   4152 C CA  . TYR B 1 197 ? -33.469 34.748 21.241  1.00 44.93 ? 515 TYR B CA  1 
ATOM   4153 C C   . TYR B 1 197 ? -33.867 33.326 20.947  1.00 45.80 ? 515 TYR B C   1 
ATOM   4154 O O   . TYR B 1 197 ? -34.455 32.647 21.788  1.00 44.97 ? 515 TYR B O   1 
ATOM   4155 C CB  . TYR B 1 197 ? -31.984 34.776 21.596  1.00 44.35 ? 515 TYR B CB  1 
ATOM   4156 C CG  . TYR B 1 197 ? -31.659 34.013 22.847  1.00 40.08 ? 515 TYR B CG  1 
ATOM   4157 C CD1 . TYR B 1 197 ? -31.446 32.645 22.808  1.00 34.82 ? 515 TYR B CD1 1 
ATOM   4158 C CD2 . TYR B 1 197 ? -31.574 34.664 24.072  1.00 39.98 ? 515 TYR B CD2 1 
ATOM   4159 C CE1 . TYR B 1 197 ? -31.161 31.942 23.948  1.00 34.75 ? 515 TYR B CE1 1 
ATOM   4160 C CE2 . TYR B 1 197 ? -31.285 33.980 25.223  1.00 39.56 ? 515 TYR B CE2 1 
ATOM   4161 C CZ  . TYR B 1 197 ? -31.079 32.609 25.160  1.00 39.35 ? 515 TYR B CZ  1 
ATOM   4162 O OH  . TYR B 1 197 ? -30.808 31.907 26.320  1.00 36.25 ? 515 TYR B OH  1 
ATOM   4163 N N   . GLY B 1 198 ? -33.517 32.871 19.749  1.00 47.42 ? 516 GLY B N   1 
ATOM   4164 C CA  . GLY B 1 198 ? -33.792 31.498 19.356  1.00 49.06 ? 516 GLY B CA  1 
ATOM   4165 C C   . GLY B 1 198 ? -32.565 30.602 19.309  1.00 49.97 ? 516 GLY B C   1 
ATOM   4166 O O   . GLY B 1 198 ? -31.545 30.849 19.974  1.00 49.82 ? 516 GLY B O   1 
ATOM   4167 N N   . LYS B 1 199 ? -32.681 29.540 18.521  1.00 50.17 ? 517 LYS B N   1 
ATOM   4168 C CA  . LYS B 1 199 ? -31.559 28.667 18.215  1.00 49.95 ? 517 LYS B CA  1 
ATOM   4169 C C   . LYS B 1 199 ? -30.375 29.486 17.655  1.00 49.54 ? 517 LYS B C   1 
ATOM   4170 O O   . LYS B 1 199 ? -29.280 28.966 17.442  1.00 49.99 ? 517 LYS B O   1 
ATOM   4171 C CB  . LYS B 1 199 ? -32.048 27.560 17.262  1.00 49.34 ? 517 LYS B CB  1 
ATOM   4172 C CG  . LYS B 1 199 ? -31.110 27.177 16.146  1.00 51.01 ? 517 LYS B CG  1 
ATOM   4173 C CD  . LYS B 1 199 ? -31.871 26.542 14.988  1.00 54.24 ? 517 LYS B CD  1 
ATOM   4174 C CE  . LYS B 1 199 ? -32.803 27.541 14.320  1.00 53.39 ? 517 LYS B CE  1 
ATOM   4175 N NZ  . LYS B 1 199 ? -33.286 27.008 13.029  1.00 53.03 ? 517 LYS B NZ  1 
ATOM   4176 N N   . SER B 1 200 ? -30.597 30.784 17.449  1.00 48.96 ? 518 SER B N   1 
ATOM   4177 C CA  . SER B 1 200 ? -29.553 31.681 16.918  1.00 47.33 ? 518 SER B CA  1 
ATOM   4178 C C   . SER B 1 200 ? -28.232 31.681 17.716  1.00 46.07 ? 518 SER B C   1 
ATOM   4179 O O   . SER B 1 200 ? -27.146 31.686 17.129  1.00 47.24 ? 518 SER B O   1 
ATOM   4180 C CB  . SER B 1 200 ? -30.081 33.119 16.775  1.00 46.63 ? 518 SER B CB  1 
ATOM   4181 O OG  . SER B 1 200 ? -30.065 33.814 18.015  1.00 43.25 ? 518 SER B OG  1 
ATOM   4182 N N   . VAL B 1 201 ? -28.312 31.683 19.039  1.00 42.81 ? 519 VAL B N   1 
ATOM   4183 C CA  . VAL B 1 201 ? -27.102 31.869 19.829  1.00 40.86 ? 519 VAL B CA  1 
ATOM   4184 C C   . VAL B 1 201 ? -26.067 30.763 19.601  1.00 40.78 ? 519 VAL B C   1 
ATOM   4185 O O   . VAL B 1 201 ? -24.859 31.007 19.719  1.00 40.72 ? 519 VAL B O   1 
ATOM   4186 C CB  . VAL B 1 201 ? -27.401 32.006 21.336  1.00 40.37 ? 519 VAL B CB  1 
ATOM   4187 C CG1 . VAL B 1 201 ? -28.174 33.288 21.609  1.00 38.47 ? 519 VAL B CG1 1 
ATOM   4188 C CG2 . VAL B 1 201 ? -28.147 30.795 21.840  1.00 36.73 ? 519 VAL B CG2 1 
ATOM   4189 N N   . ASP B 1 202 ? -26.547 29.558 19.275  1.00 39.68 ? 520 ASP B N   1 
ATOM   4190 C CA  . ASP B 1 202 ? -25.680 28.401 18.994  1.00 37.03 ? 520 ASP B CA  1 
ATOM   4191 C C   . ASP B 1 202 ? -24.890 28.584 17.725  1.00 35.83 ? 520 ASP B C   1 
ATOM   4192 O O   . ASP B 1 202 ? -23.752 28.165 17.625  1.00 33.58 ? 520 ASP B O   1 
ATOM   4193 C CB  . ASP B 1 202 ? -26.500 27.125 18.874  1.00 36.12 ? 520 ASP B CB  1 
ATOM   4194 C CG  . ASP B 1 202 ? -26.776 26.495 20.214  1.00 37.79 ? 520 ASP B CG  1 
ATOM   4195 O OD1 . ASP B 1 202 ? -26.160 26.927 21.211  1.00 39.08 ? 520 ASP B OD1 1 
ATOM   4196 O OD2 . ASP B 1 202 ? -27.601 25.563 20.273  1.00 39.99 ? 520 ASP B OD2 1 
ATOM   4197 N N   . TRP B 1 203 ? -25.502 29.223 16.742  1.00 37.13 ? 521 TRP B N   1 
ATOM   4198 C CA  . TRP B 1 203 ? -24.812 29.449 15.482  1.00 37.63 ? 521 TRP B CA  1 
ATOM   4199 C C   . TRP B 1 203 ? -23.751 30.495 15.645  1.00 35.82 ? 521 TRP B C   1 
ATOM   4200 O O   . TRP B 1 203 ? -22.700 30.431 15.011  1.00 35.11 ? 521 TRP B O   1 
ATOM   4201 C CB  . TRP B 1 203 ? -25.797 29.804 14.385  1.00 38.83 ? 521 TRP B CB  1 
ATOM   4202 C CG  . TRP B 1 203 ? -26.582 28.605 14.032  1.00 43.49 ? 521 TRP B CG  1 
ATOM   4203 C CD1 . TRP B 1 203 ? -27.939 28.442 14.125  1.00 47.94 ? 521 TRP B CD1 1 
ATOM   4204 C CD2 . TRP B 1 203 ? -26.050 27.353 13.585  1.00 44.39 ? 521 TRP B CD2 1 
ATOM   4205 N NE1 . TRP B 1 203 ? -28.283 27.170 13.726  1.00 52.17 ? 521 TRP B NE1 1 
ATOM   4206 C CE2 . TRP B 1 203 ? -27.142 26.481 13.394  1.00 48.34 ? 521 TRP B CE2 1 
ATOM   4207 C CE3 . TRP B 1 203 ? -24.755 26.892 13.312  1.00 42.47 ? 521 TRP B CE3 1 
ATOM   4208 C CZ2 . TRP B 1 203 ? -26.979 25.169 12.943  1.00 48.65 ? 521 TRP B CZ2 1 
ATOM   4209 C CZ3 . TRP B 1 203 ? -24.594 25.598 12.860  1.00 43.67 ? 521 TRP B CZ3 1 
ATOM   4210 C CH2 . TRP B 1 203 ? -25.699 24.748 12.683  1.00 46.73 ? 521 TRP B CH2 1 
ATOM   4211 N N   . TRP B 1 204 ? -24.027 31.453 16.517  1.00 35.16 ? 522 TRP B N   1 
ATOM   4212 C CA  . TRP B 1 204 ? -23.007 32.407 16.880  1.00 34.62 ? 522 TRP B CA  1 
ATOM   4213 C C   . TRP B 1 204 ? -21.866 31.638 17.529  1.00 34.90 ? 522 TRP B C   1 
ATOM   4214 O O   . TRP B 1 204 ? -20.714 31.737 17.094  1.00 35.87 ? 522 TRP B O   1 
ATOM   4215 C CB  . TRP B 1 204 ? -23.542 33.472 17.829  1.00 33.05 ? 522 TRP B CB  1 
ATOM   4216 C CG  . TRP B 1 204 ? -22.503 34.441 18.176  1.00 33.09 ? 522 TRP B CG  1 
ATOM   4217 C CD1 . TRP B 1 204 ? -21.551 34.304 19.139  1.00 35.39 ? 522 TRP B CD1 1 
ATOM   4218 C CD2 . TRP B 1 204 ? -22.264 35.705 17.548  1.00 37.38 ? 522 TRP B CD2 1 
ATOM   4219 N NE1 . TRP B 1 204 ? -20.737 35.406 19.159  1.00 35.81 ? 522 TRP B NE1 1 
ATOM   4220 C CE2 . TRP B 1 204 ? -21.156 36.287 18.192  1.00 36.52 ? 522 TRP B CE2 1 
ATOM   4221 C CE3 . TRP B 1 204 ? -22.884 36.407 16.500  1.00 39.87 ? 522 TRP B CE3 1 
ATOM   4222 C CZ2 . TRP B 1 204 ? -20.657 37.542 17.833  1.00 31.66 ? 522 TRP B CZ2 1 
ATOM   4223 C CZ3 . TRP B 1 204 ? -22.387 37.646 16.145  1.00 37.49 ? 522 TRP B CZ3 1 
ATOM   4224 C CH2 . TRP B 1 204 ? -21.284 38.201 16.814  1.00 37.61 ? 522 TRP B CH2 1 
ATOM   4225 N N   . ALA B 1 205 ? -22.182 30.853 18.554  1.00 32.69 ? 523 ALA B N   1 
ATOM   4226 C CA  . ALA B 1 205 ? -21.127 30.209 19.301  1.00 32.52 ? 523 ALA B CA  1 
ATOM   4227 C C   . ALA B 1 205 ? -20.282 29.330 18.371  1.00 32.70 ? 523 ALA B C   1 
ATOM   4228 O O   . ALA B 1 205 ? -19.055 29.296 18.477  1.00 31.96 ? 523 ALA B O   1 
ATOM   4229 C CB  . ALA B 1 205 ? -21.699 29.420 20.474  1.00 32.34 ? 523 ALA B CB  1 
ATOM   4230 N N   . TYR B 1 206 ? -20.955 28.652 17.444  1.00 33.26 ? 524 TYR B N   1 
ATOM   4231 C CA  . TYR B 1 206 ? -20.320 27.798 16.445  1.00 34.30 ? 524 TYR B CA  1 
ATOM   4232 C C   . TYR B 1 206 ? -19.389 28.626 15.568  1.00 33.98 ? 524 TYR B C   1 
ATOM   4233 O O   . TYR B 1 206 ? -18.300 28.188 15.194  1.00 34.30 ? 524 TYR B O   1 
ATOM   4234 C CB  . TYR B 1 206 ? -21.412 27.136 15.605  1.00 34.85 ? 524 TYR B CB  1 
ATOM   4235 C CG  . TYR B 1 206 ? -20.951 26.300 14.427  1.00 40.21 ? 524 TYR B CG  1 
ATOM   4236 C CD1 . TYR B 1 206 ? -20.508 24.994 14.604  1.00 42.60 ? 524 TYR B CD1 1 
ATOM   4237 C CD2 . TYR B 1 206 ? -21.005 26.801 13.125  1.00 43.65 ? 524 TYR B CD2 1 
ATOM   4238 C CE1 . TYR B 1 206 ? -20.104 24.218 13.519  1.00 45.64 ? 524 TYR B CE1 1 
ATOM   4239 C CE2 . TYR B 1 206 ? -20.602 26.033 12.032  1.00 42.70 ? 524 TYR B CE2 1 
ATOM   4240 C CZ  . TYR B 1 206 ? -20.155 24.741 12.234  1.00 45.93 ? 524 TYR B CZ  1 
ATOM   4241 O OH  . TYR B 1 206 ? -19.752 23.967 11.162  1.00 43.43 ? 524 TYR B OH  1 
ATOM   4242 N N   . GLY B 1 207 ? -19.826 29.833 15.247  1.00 33.63 ? 525 GLY B N   1 
ATOM   4243 C CA  . GLY B 1 207 ? -19.000 30.752 14.491  1.00 34.03 ? 525 GLY B CA  1 
ATOM   4244 C C   . GLY B 1 207 ? -17.755 31.093 15.271  1.00 34.04 ? 525 GLY B C   1 
ATOM   4245 O O   . GLY B 1 207 ? -16.652 31.091 14.743  1.00 33.93 ? 525 GLY B O   1 
ATOM   4246 N N   . VAL B 1 208 ? -17.931 31.380 16.548  1.00 34.82 ? 526 VAL B N   1 
ATOM   4247 C CA  . VAL B 1 208 ? -16.810 31.816 17.364  1.00 35.46 ? 526 VAL B CA  1 
ATOM   4248 C C   . VAL B 1 208 ? -15.810 30.695 17.487  1.00 35.90 ? 526 VAL B C   1 
ATOM   4249 O O   . VAL B 1 208 ? -14.616 30.898 17.363  1.00 35.90 ? 526 VAL B O   1 
ATOM   4250 C CB  . VAL B 1 208 ? -17.266 32.199 18.762  1.00 35.03 ? 526 VAL B CB  1 
ATOM   4251 C CG1 . VAL B 1 208 ? -16.072 32.423 19.637  1.00 35.15 ? 526 VAL B CG1 1 
ATOM   4252 C CG2 . VAL B 1 208 ? -18.141 33.435 18.700  1.00 36.21 ? 526 VAL B CG2 1 
ATOM   4253 N N   . LEU B 1 209 ? -16.321 29.500 17.729  1.00 37.14 ? 527 LEU B N   1 
ATOM   4254 C CA  . LEU B 1 209 ? -15.486 28.342 17.916  1.00 38.48 ? 527 LEU B CA  1 
ATOM   4255 C C   . LEU B 1 209 ? -14.832 28.025 16.592  1.00 39.41 ? 527 LEU B C   1 
ATOM   4256 O O   . LEU B 1 209 ? -13.628 27.735 16.505  1.00 39.75 ? 527 LEU B O   1 
ATOM   4257 C CB  . LEU B 1 209 ? -16.353 27.180 18.362  1.00 38.54 ? 527 LEU B CB  1 
ATOM   4258 C CG  . LEU B 1 209 ? -15.763 25.789 18.523  1.00 39.40 ? 527 LEU B CG  1 
ATOM   4259 C CD1 . LEU B 1 209 ? -16.681 25.029 19.435  1.00 42.93 ? 527 LEU B CD1 1 
ATOM   4260 C CD2 . LEU B 1 209 ? -15.636 25.064 17.198  1.00 37.44 ? 527 LEU B CD2 1 
ATOM   4261 N N   . LEU B 1 210 ? -15.640 28.097 15.545  1.00 39.85 ? 528 LEU B N   1 
ATOM   4262 C CA  . LEU B 1 210 ? -15.147 27.808 14.215  1.00 38.96 ? 528 LEU B CA  1 
ATOM   4263 C C   . LEU B 1 210 ? -14.000 28.763 13.852  1.00 38.21 ? 528 LEU B C   1 
ATOM   4264 O O   . LEU B 1 210 ? -13.012 28.363 13.227  1.00 38.43 ? 528 LEU B O   1 
ATOM   4265 C CB  . LEU B 1 210 ? -16.294 27.886 13.226  1.00 38.26 ? 528 LEU B CB  1 
ATOM   4266 C CG  . LEU B 1 210 ? -16.079 27.145 11.917  1.00 38.25 ? 528 LEU B CG  1 
ATOM   4267 C CD1 . LEU B 1 210 ? -17.434 26.841 11.297  1.00 39.81 ? 528 LEU B CD1 1 
ATOM   4268 C CD2 . LEU B 1 210 ? -15.201 27.947 10.951  1.00 34.09 ? 528 LEU B CD2 1 
ATOM   4269 N N   . TYR B 1 211 ? -14.122 30.017 14.275  1.00 37.72 ? 529 TYR B N   1 
ATOM   4270 C CA  . TYR B 1 211 ? -13.083 31.014 14.035  1.00 37.34 ? 529 TYR B CA  1 
ATOM   4271 C C   . TYR B 1 211 ? -11.793 30.657 14.741  1.00 36.70 ? 529 TYR B C   1 
ATOM   4272 O O   . TYR B 1 211 ? -10.711 30.821 14.193  1.00 35.92 ? 529 TYR B O   1 
ATOM   4273 C CB  . TYR B 1 211 ? -13.528 32.381 14.531  1.00 37.53 ? 529 TYR B CB  1 
ATOM   4274 C CG  . TYR B 1 211 ? -12.469 33.458 14.372  1.00 41.48 ? 529 TYR B CG  1 
ATOM   4275 C CD1 . TYR B 1 211 ? -11.567 33.758 15.404  1.00 43.10 ? 529 TYR B CD1 1 
ATOM   4276 C CD2 . TYR B 1 211 ? -12.370 34.180 13.189  1.00 40.47 ? 529 TYR B CD2 1 
ATOM   4277 C CE1 . TYR B 1 211 ? -10.597 34.762 15.247  1.00 42.04 ? 529 TYR B CE1 1 
ATOM   4278 C CE2 . TYR B 1 211 ? -11.408 35.169 13.023  1.00 42.58 ? 529 TYR B CE2 1 
ATOM   4279 C CZ  . TYR B 1 211 ? -10.528 35.460 14.046  1.00 41.85 ? 529 TYR B CZ  1 
ATOM   4280 O OH  . TYR B 1 211 ? -9.599  36.460 13.837  1.00 39.73 ? 529 TYR B OH  1 
ATOM   4281 N N   . GLU B 1 212 ? -11.914 30.192 15.977  1.00 36.78 ? 530 GLU B N   1 
ATOM   4282 C CA  . GLU B 1 212 ? -10.746 29.891 16.765  1.00 36.63 ? 530 GLU B CA  1 
ATOM   4283 C C   . GLU B 1 212 ? -9.965  28.791 16.081  1.00 37.56 ? 530 GLU B C   1 
ATOM   4284 O O   . GLU B 1 212 ? -8.760  28.898 15.862  1.00 37.19 ? 530 GLU B O   1 
ATOM   4285 C CB  . GLU B 1 212 ? -11.164 29.416 18.125  1.00 35.89 ? 530 GLU B CB  1 
ATOM   4286 C CG  . GLU B 1 212 ? -11.870 30.421 18.942  1.00 34.14 ? 530 GLU B CG  1 
ATOM   4287 C CD  . GLU B 1 212 ? -12.256 29.819 20.267  1.00 36.96 ? 530 GLU B CD  1 
ATOM   4288 O OE1 . GLU B 1 212 ? -12.821 28.704 20.252  1.00 33.92 ? 530 GLU B OE1 1 
ATOM   4289 O OE2 . GLU B 1 212 ? -11.972 30.434 21.316  1.00 34.25 ? 530 GLU B OE2 1 
ATOM   4290 N N   . MET B 1 213 ? -10.662 27.721 15.744  1.00 38.27 ? 531 MET B N   1 
ATOM   4291 C CA  . MET B 1 213 ? -10.044 26.699 14.957  1.00 39.56 ? 531 MET B CA  1 
ATOM   4292 C C   . MET B 1 213 ? -9.237  27.360 13.837  1.00 41.06 ? 531 MET B C   1 
ATOM   4293 O O   . MET B 1 213 ? -8.011  27.224 13.775  1.00 41.99 ? 531 MET B O   1 
ATOM   4294 C CB  . MET B 1 213 ? -11.102 25.766 14.397  1.00 39.30 ? 531 MET B CB  1 
ATOM   4295 C CG  . MET B 1 213 ? -11.793 24.950 15.465  1.00 39.03 ? 531 MET B CG  1 
ATOM   4296 S SD  . MET B 1 213 ? -12.386 23.402 14.750  1.00 40.86 ? 531 MET B SD  1 
ATOM   4297 C CE  . MET B 1 213 ? -13.735 23.987 13.733  1.00 38.18 ? 531 MET B CE  1 
ATOM   4298 N N   . LEU B 1 214 ? -9.913  28.102 12.968  1.00 40.99 ? 532 LEU B N   1 
ATOM   4299 C CA  . LEU B 1 214 ? -9.242  28.694 11.814  1.00 40.67 ? 532 LEU B CA  1 
ATOM   4300 C C   . LEU B 1 214 ? -8.106  29.646 12.143  1.00 40.30 ? 532 LEU B C   1 
ATOM   4301 O O   . LEU B 1 214 ? -7.071  29.593 11.511  1.00 40.84 ? 532 LEU B O   1 
ATOM   4302 C CB  . LEU B 1 214 ? -10.252 29.398 10.921  1.00 41.36 ? 532 LEU B CB  1 
ATOM   4303 C CG  . LEU B 1 214 ? -11.129 28.389 10.192  1.00 41.98 ? 532 LEU B CG  1 
ATOM   4304 C CD1 . LEU B 1 214 ? -11.947 29.074 9.118   1.00 40.53 ? 532 LEU B CD1 1 
ATOM   4305 C CD2 . LEU B 1 214 ? -10.255 27.294 9.602   1.00 39.77 ? 532 LEU B CD2 1 
ATOM   4306 N N   . ALA B 1 215 ? -8.293  30.523 13.119  1.00 40.26 ? 533 ALA B N   1 
ATOM   4307 C CA  . ALA B 1 215 ? -7.286  31.543 13.401  1.00 40.25 ? 533 ALA B CA  1 
ATOM   4308 C C   . ALA B 1 215 ? -6.410  31.268 14.616  1.00 40.90 ? 533 ALA B C   1 
ATOM   4309 O O   . ALA B 1 215 ? -5.441  31.990 14.848  1.00 40.74 ? 533 ALA B O   1 
ATOM   4310 C CB  . ALA B 1 215 ? -7.942  32.894 13.553  1.00 40.23 ? 533 ALA B CB  1 
ATOM   4311 N N   . GLY B 1 216 ? -6.753  30.247 15.402  1.00 41.37 ? 534 GLY B N   1 
ATOM   4312 C CA  . GLY B 1 216 ? -6.059  29.991 16.666  1.00 41.33 ? 534 GLY B CA  1 
ATOM   4313 C C   . GLY B 1 216 ? -6.206  31.166 17.623  1.00 42.02 ? 534 GLY B C   1 
ATOM   4314 O O   . GLY B 1 216 ? -5.410  31.340 18.543  1.00 41.61 ? 534 GLY B O   1 
ATOM   4315 N N   . GLN B 1 217 ? -7.242  31.970 17.402  1.00 43.19 ? 535 GLN B N   1 
ATOM   4316 C CA  . GLN B 1 217 ? -7.467  33.186 18.169  1.00 43.92 ? 535 GLN B CA  1 
ATOM   4317 C C   . GLN B 1 217 ? -8.936  33.380 18.450  1.00 42.46 ? 535 GLN B C   1 
ATOM   4318 O O   . GLN B 1 217 ? -9.779  32.837 17.735  1.00 41.78 ? 535 GLN B O   1 
ATOM   4319 C CB  . GLN B 1 217 ? -6.971  34.389 17.376  1.00 45.62 ? 535 GLN B CB  1 
ATOM   4320 C CG  . GLN B 1 217 ? -5.469  34.470 17.272  1.00 52.96 ? 535 GLN B CG  1 
ATOM   4321 C CD  . GLN B 1 217 ? -4.812  34.697 18.625  1.00 60.85 ? 535 GLN B CD  1 
ATOM   4322 O OE1 . GLN B 1 217 ? -5.303  34.228 19.660  1.00 61.79 ? 535 GLN B OE1 1 
ATOM   4323 N NE2 . GLN B 1 217 ? -3.689  35.422 18.622  1.00 63.67 ? 535 GLN B NE2 1 
ATOM   4324 N N   . PRO B 1 218 ? -9.247  34.159 19.497  1.00 42.36 ? 536 PRO B N   1 
ATOM   4325 C CA  . PRO B 1 218 ? -10.607 34.613 19.797  1.00 42.27 ? 536 PRO B CA  1 
ATOM   4326 C C   . PRO B 1 218 ? -11.027 35.760 18.867  1.00 42.17 ? 536 PRO B C   1 
ATOM   4327 O O   . PRO B 1 218 ? -10.252 36.675 18.611  1.00 41.44 ? 536 PRO B O   1 
ATOM   4328 C CB  . PRO B 1 218 ? -10.495 35.106 21.241  1.00 41.80 ? 536 PRO B CB  1 
ATOM   4329 C CG  . PRO B 1 218 ? -9.094  35.552 21.366  1.00 41.94 ? 536 PRO B CG  1 
ATOM   4330 C CD  . PRO B 1 218 ? -8.294  34.576 20.538  1.00 42.22 ? 536 PRO B CD  1 
ATOM   4331 N N   . PRO B 1 219 ? -12.257 35.709 18.355  1.00 42.09 ? 537 PRO B N   1 
ATOM   4332 C CA  . PRO B 1 219 ? -12.701 36.734 17.422  1.00 41.29 ? 537 PRO B CA  1 
ATOM   4333 C C   . PRO B 1 219 ? -12.945 38.079 18.112  1.00 41.56 ? 537 PRO B C   1 
ATOM   4334 O O   . PRO B 1 219 ? -13.093 39.100 17.429  1.00 42.18 ? 537 PRO B O   1 
ATOM   4335 C CB  . PRO B 1 219 ? -14.014 36.169 16.875  1.00 40.08 ? 537 PRO B CB  1 
ATOM   4336 C CG  . PRO B 1 219 ? -14.107 34.766 17.396  1.00 41.46 ? 537 PRO B CG  1 
ATOM   4337 C CD  . PRO B 1 219 ? -13.305 34.721 18.639  1.00 41.54 ? 537 PRO B CD  1 
ATOM   4338 N N   . PHE B 1 220 ? -12.972 38.070 19.445  1.00 41.61 ? 538 PHE B N   1 
ATOM   4339 C CA  . PHE B 1 220 ? -13.235 39.266 20.254  1.00 42.82 ? 538 PHE B CA  1 
ATOM   4340 C C   . PHE B 1 220 ? -12.318 39.327 21.468  1.00 44.50 ? 538 PHE B C   1 
ATOM   4341 O O   . PHE B 1 220 ? -11.759 38.307 21.894  1.00 44.89 ? 538 PHE B O   1 
ATOM   4342 C CB  . PHE B 1 220 ? -14.692 39.294 20.722  1.00 41.63 ? 538 PHE B CB  1 
ATOM   4343 C CG  . PHE B 1 220 ? -15.662 39.341 19.603  1.00 41.46 ? 538 PHE B CG  1 
ATOM   4344 C CD1 . PHE B 1 220 ? -15.981 40.545 19.003  1.00 42.40 ? 538 PHE B CD1 1 
ATOM   4345 C CD2 . PHE B 1 220 ? -16.225 38.177 19.106  1.00 43.35 ? 538 PHE B CD2 1 
ATOM   4346 C CE1 . PHE B 1 220 ? -16.872 40.595 17.944  1.00 42.35 ? 538 PHE B CE1 1 
ATOM   4347 C CE2 . PHE B 1 220 ? -17.117 38.214 18.040  1.00 41.93 ? 538 PHE B CE2 1 
ATOM   4348 C CZ  . PHE B 1 220 ? -17.440 39.427 17.461  1.00 43.98 ? 538 PHE B CZ  1 
ATOM   4349 N N   . ASP B 1 221 ? -12.164 40.525 22.028  1.00 45.65 ? 539 ASP B N   1 
ATOM   4350 C CA  . ASP B 1 221 ? -11.321 40.698 23.219  1.00 46.97 ? 539 ASP B CA  1 
ATOM   4351 C C   . ASP B 1 221 ? -11.720 41.902 24.091  1.00 45.34 ? 539 ASP B C   1 
ATOM   4352 O O   . ASP B 1 221 ? -12.575 42.707 23.707  1.00 43.10 ? 539 ASP B O   1 
ATOM   4353 C CB  . ASP B 1 221 ? -9.816  40.717 22.850  1.00 47.87 ? 539 ASP B CB  1 
ATOM   4354 C CG  . ASP B 1 221 ? -9.515  41.587 21.622  1.00 51.72 ? 539 ASP B CG  1 
ATOM   4355 O OD1 . ASP B 1 221 ? -9.917  42.773 21.602  1.00 53.91 ? 539 ASP B OD1 1 
ATOM   4356 O OD2 . ASP B 1 221 ? -8.863  41.087 20.675  1.00 55.75 ? 539 ASP B OD2 1 
ATOM   4357 N N   . GLY B 1 222 ? -11.095 41.994 25.266  1.00 44.94 ? 540 GLY B N   1 
ATOM   4358 C CA  . GLY B 1 222 ? -11.379 43.046 26.238  1.00 45.90 ? 540 GLY B CA  1 
ATOM   4359 C C   . GLY B 1 222 ? -10.789 42.806 27.622  1.00 46.59 ? 540 GLY B C   1 
ATOM   4360 O O   . GLY B 1 222 ? -10.605 41.671 28.051  1.00 46.76 ? 540 GLY B O   1 
ATOM   4361 N N   . GLU B 1 223 ? -10.487 43.888 28.325  1.00 47.60 ? 541 GLU B N   1 
ATOM   4362 C CA  . GLU B 1 223 ? -9.910  43.811 29.664  1.00 49.35 ? 541 GLU B CA  1 
ATOM   4363 C C   . GLU B 1 223 ? -10.749 42.929 30.580  1.00 48.71 ? 541 GLU B C   1 
ATOM   4364 O O   . GLU B 1 223 ? -10.252 42.005 31.207  1.00 47.70 ? 541 GLU B O   1 
ATOM   4365 C CB  . GLU B 1 223 ? -9.796  45.220 30.260  1.00 50.50 ? 541 GLU B CB  1 
ATOM   4366 C CG  . GLU B 1 223 ? -8.927  46.172 29.440  1.00 54.21 ? 541 GLU B CG  1 
ATOM   4367 C CD  . GLU B 1 223 ? -7.448  45.816 29.517  1.00 59.48 ? 541 GLU B CD  1 
ATOM   4368 O OE1 . GLU B 1 223 ? -6.794  46.250 30.490  1.00 61.73 ? 541 GLU B OE1 1 
ATOM   4369 O OE2 . GLU B 1 223 ? -6.941  45.104 28.616  1.00 56.73 ? 541 GLU B OE2 1 
ATOM   4370 N N   . ASP B 1 224 ? -12.032 43.237 30.651  1.00 49.07 ? 542 ASP B N   1 
ATOM   4371 C CA  . ASP B 1 224 ? -12.947 42.495 31.493  1.00 49.88 ? 542 ASP B CA  1 
ATOM   4372 C C   . ASP B 1 224 ? -14.188 42.062 30.706  1.00 49.97 ? 542 ASP B C   1 
ATOM   4373 O O   . ASP B 1 224 ? -14.290 42.307 29.506  1.00 50.85 ? 542 ASP B O   1 
ATOM   4374 C CB  . ASP B 1 224 ? -13.347 43.355 32.689  1.00 49.76 ? 542 ASP B CB  1 
ATOM   4375 C CG  . ASP B 1 224 ? -13.899 44.721 32.279  1.00 50.56 ? 542 ASP B CG  1 
ATOM   4376 O OD1 . ASP B 1 224 ? -14.653 44.806 31.279  1.00 48.27 ? 542 ASP B OD1 1 
ATOM   4377 O OD2 . ASP B 1 224 ? -13.590 45.710 32.980  1.00 49.84 ? 542 ASP B OD2 1 
ATOM   4378 N N   . GLU B 1 225 ? -15.137 41.431 31.382  1.00 49.63 ? 543 GLU B N   1 
ATOM   4379 C CA  . GLU B 1 225 ? -16.361 41.013 30.725  1.00 48.82 ? 543 GLU B CA  1 
ATOM   4380 C C   . GLU B 1 225 ? -17.033 42.149 29.965  1.00 48.58 ? 543 GLU B C   1 
ATOM   4381 O O   . GLU B 1 225 ? -17.381 41.990 28.801  1.00 49.33 ? 543 GLU B O   1 
ATOM   4382 C CB  . GLU B 1 225 ? -17.340 40.414 31.726  1.00 48.83 ? 543 GLU B CB  1 
ATOM   4383 C CG  . GLU B 1 225 ? -18.551 39.792 31.065  1.00 50.69 ? 543 GLU B CG  1 
ATOM   4384 C CD  . GLU B 1 225 ? -19.383 38.961 32.023  1.00 56.80 ? 543 GLU B CD  1 
ATOM   4385 O OE1 . GLU B 1 225 ? -19.546 39.393 33.195  1.00 59.79 ? 543 GLU B OE1 1 
ATOM   4386 O OE2 . GLU B 1 225 ? -19.879 37.884 31.600  1.00 57.49 ? 543 GLU B OE2 1 
ATOM   4387 N N   . ASP B 1 226 ? -17.213 43.295 30.611  1.00 48.07 ? 544 ASP B N   1 
ATOM   4388 C CA  . ASP B 1 226 ? -17.934 44.417 29.994  1.00 47.98 ? 544 ASP B CA  1 
ATOM   4389 C C   . ASP B 1 226 ? -17.232 44.917 28.734  1.00 45.83 ? 544 ASP B C   1 
ATOM   4390 O O   . ASP B 1 226 ? -17.851 45.046 27.679  1.00 44.86 ? 544 ASP B O   1 
ATOM   4391 C CB  . ASP B 1 226 ? -18.140 45.529 31.020  1.00 49.57 ? 544 ASP B CB  1 
ATOM   4392 C CG  . ASP B 1 226 ? -18.379 44.965 32.436  1.00 57.21 ? 544 ASP B CG  1 
ATOM   4393 O OD1 . ASP B 1 226 ? -17.443 44.344 33.022  1.00 58.48 ? 544 ASP B OD1 1 
ATOM   4394 O OD2 . ASP B 1 226 ? -19.515 45.121 32.951  1.00 62.60 ? 544 ASP B OD2 1 
ATOM   4395 N N   . GLU B 1 227 ? -15.933 45.166 28.848  1.00 44.50 ? 545 GLU B N   1 
ATOM   4396 C CA  . GLU B 1 227 ? -15.070 45.415 27.695  1.00 43.81 ? 545 GLU B CA  1 
ATOM   4397 C C   . GLU B 1 227 ? -15.280 44.366 26.568  1.00 43.65 ? 545 GLU B C   1 
ATOM   4398 O O   . GLU B 1 227 ? -15.419 44.699 25.375  1.00 42.71 ? 545 GLU B O   1 
ATOM   4399 C CB  . GLU B 1 227 ? -13.622 45.370 28.161  1.00 43.46 ? 545 GLU B CB  1 
ATOM   4400 C CG  . GLU B 1 227 ? -12.619 45.835 27.131  1.00 46.37 ? 545 GLU B CG  1 
ATOM   4401 C CD  . GLU B 1 227 ? -12.090 47.226 27.415  1.00 48.39 ? 545 GLU B CD  1 
ATOM   4402 O OE1 . GLU B 1 227 ? -11.984 47.605 28.613  1.00 42.98 ? 545 GLU B OE1 1 
ATOM   4403 O OE2 . GLU B 1 227 ? -11.773 47.930 26.428  1.00 50.44 ? 545 GLU B OE2 1 
ATOM   4404 N N   . LEU B 1 228 ? -15.298 43.092 26.959  1.00 42.60 ? 546 LEU B N   1 
ATOM   4405 C CA  . LEU B 1 228 ? -15.533 42.009 26.022  1.00 40.29 ? 546 LEU B CA  1 
ATOM   4406 C C   . LEU B 1 228 ? -16.892 42.110 25.322  1.00 40.72 ? 546 LEU B C   1 
ATOM   4407 O O   . LEU B 1 228 ? -16.962 41.957 24.106  1.00 41.62 ? 546 LEU B O   1 
ATOM   4408 C CB  . LEU B 1 228 ? -15.396 40.669 26.730  1.00 39.01 ? 546 LEU B CB  1 
ATOM   4409 C CG  . LEU B 1 228 ? -15.699 39.470 25.839  1.00 36.08 ? 546 LEU B CG  1 
ATOM   4410 C CD1 . LEU B 1 228 ? -14.605 39.352 24.786  1.00 30.23 ? 546 LEU B CD1 1 
ATOM   4411 C CD2 . LEU B 1 228 ? -15.867 38.184 26.662  1.00 24.36 ? 546 LEU B CD2 1 
ATOM   4412 N N   . PHE B 1 229 ? -17.960 42.371 26.081  1.00 39.96 ? 547 PHE B N   1 
ATOM   4413 C CA  . PHE B 1 229 ? -19.318 42.406 25.529  1.00 40.14 ? 547 PHE B CA  1 
ATOM   4414 C C   . PHE B 1 229 ? -19.486 43.593 24.617  1.00 40.40 ? 547 PHE B C   1 
ATOM   4415 O O   . PHE B 1 229 ? -20.154 43.535 23.590  1.00 40.53 ? 547 PHE B O   1 
ATOM   4416 C CB  . PHE B 1 229 ? -20.347 42.539 26.650  1.00 41.13 ? 547 PHE B CB  1 
ATOM   4417 C CG  . PHE B 1 229 ? -20.648 41.247 27.379  1.00 43.58 ? 547 PHE B CG  1 
ATOM   4418 C CD1 . PHE B 1 229 ? -19.831 40.123 27.223  1.00 41.39 ? 547 PHE B CD1 1 
ATOM   4419 C CD2 . PHE B 1 229 ? -21.731 41.171 28.251  1.00 41.72 ? 547 PHE B CD2 1 
ATOM   4420 C CE1 . PHE B 1 229 ? -20.097 38.951 27.898  1.00 36.65 ? 547 PHE B CE1 1 
ATOM   4421 C CE2 . PHE B 1 229 ? -22.004 40.004 28.930  1.00 41.87 ? 547 PHE B CE2 1 
ATOM   4422 C CZ  . PHE B 1 229 ? -21.181 38.887 28.754  1.00 41.48 ? 547 PHE B CZ  1 
ATOM   4423 N N   . GLN B 1 230 ? -18.902 44.698 25.040  1.00 40.86 ? 548 GLN B N   1 
ATOM   4424 C CA  . GLN B 1 230 ? -18.866 45.900 24.247  1.00 41.33 ? 548 GLN B CA  1 
ATOM   4425 C C   . GLN B 1 230 ? -18.179 45.584 22.910  1.00 40.81 ? 548 GLN B C   1 
ATOM   4426 O O   . GLN B 1 230 ? -18.630 46.012 21.845  1.00 40.69 ? 548 GLN B O   1 
ATOM   4427 C CB  . GLN B 1 230 ? -18.103 46.945 25.044  1.00 41.75 ? 548 GLN B CB  1 
ATOM   4428 C CG  . GLN B 1 230 ? -18.710 48.305 25.056  1.00 44.09 ? 548 GLN B CG  1 
ATOM   4429 C CD  . GLN B 1 230 ? -17.862 49.243 24.275  1.00 48.37 ? 548 GLN B CD  1 
ATOM   4430 O OE1 . GLN B 1 230 ? -16.829 48.832 23.743  1.00 47.27 ? 548 GLN B OE1 1 
ATOM   4431 N NE2 . GLN B 1 230 ? -18.269 50.516 24.196  1.00 50.99 ? 548 GLN B NE2 1 
ATOM   4432 N N   . SER B 1 231 ? -17.107 44.801 22.980  1.00 39.97 ? 549 SER B N   1 
ATOM   4433 C CA  . SER B 1 231 ? -16.409 44.302 21.796  1.00 39.72 ? 549 SER B CA  1 
ATOM   4434 C C   . SER B 1 231 ? -17.330 43.485 20.884  1.00 39.73 ? 549 SER B C   1 
ATOM   4435 O O   . SER B 1 231 ? -17.357 43.660 19.668  1.00 39.11 ? 549 SER B O   1 
ATOM   4436 C CB  . SER B 1 231 ? -15.201 43.459 22.229  1.00 39.29 ? 549 SER B CB  1 
ATOM   4437 O OG  . SER B 1 231 ? -14.493 42.947 21.118  1.00 36.20 ? 549 SER B OG  1 
ATOM   4438 N N   . ILE B 1 232 ? -18.088 42.590 21.492  1.00 41.06 ? 550 ILE B N   1 
ATOM   4439 C CA  . ILE B 1 232 ? -19.005 41.708 20.768  1.00 41.80 ? 550 ILE B CA  1 
ATOM   4440 C C   . ILE B 1 232 ? -20.142 42.442 20.038  1.00 42.07 ? 550 ILE B C   1 
ATOM   4441 O O   . ILE B 1 232 ? -20.685 41.941 19.059  1.00 41.51 ? 550 ILE B O   1 
ATOM   4442 C CB  . ILE B 1 232 ? -19.575 40.629 21.732  1.00 41.60 ? 550 ILE B CB  1 
ATOM   4443 C CG1 . ILE B 1 232 ? -18.499 39.551 21.997  1.00 42.71 ? 550 ILE B CG1 1 
ATOM   4444 C CG2 . ILE B 1 232 ? -20.904 40.063 21.208  1.00 38.73 ? 550 ILE B CG2 1 
ATOM   4445 C CD1 . ILE B 1 232 ? -18.649 38.803 23.322  1.00 39.39 ? 550 ILE B CD1 1 
ATOM   4446 N N   . MET B 1 233 ? -20.492 43.634 20.498  1.00 42.96 ? 551 MET B N   1 
ATOM   4447 C CA  . MET B 1 233 ? -21.620 44.318 19.903  1.00 44.23 ? 551 MET B CA  1 
ATOM   4448 C C   . MET B 1 233 ? -21.186 45.318 18.855  1.00 44.96 ? 551 MET B C   1 
ATOM   4449 O O   . MET B 1 233 ? -21.946 45.642 17.946  1.00 46.06 ? 551 MET B O   1 
ATOM   4450 C CB  . MET B 1 233 ? -22.448 45.027 20.961  1.00 44.61 ? 551 MET B CB  1 
ATOM   4451 C CG  . MET B 1 233 ? -23.946 44.798 20.794  1.00 46.04 ? 551 MET B CG  1 
ATOM   4452 S SD  . MET B 1 233 ? -24.592 43.738 22.092  1.00 43.75 ? 551 MET B SD  1 
ATOM   4453 C CE  . MET B 1 233 ? -23.825 44.522 23.499  1.00 43.89 ? 551 MET B CE  1 
ATOM   4454 N N   . GLU B 1 234 ? -19.954 45.793 18.964  1.00 44.94 ? 552 GLU B N   1 
ATOM   4455 C CA  . GLU B 1 234 ? -19.508 46.871 18.109  1.00 44.88 ? 552 GLU B CA  1 
ATOM   4456 C C   . GLU B 1 234 ? -18.279 46.540 17.283  1.00 45.72 ? 552 GLU B C   1 
ATOM   4457 O O   . GLU B 1 234 ? -17.897 47.318 16.401  1.00 46.29 ? 552 GLU B O   1 
ATOM   4458 C CB  . GLU B 1 234 ? -19.210 48.087 18.966  1.00 44.70 ? 552 GLU B CB  1 
ATOM   4459 C CG  . GLU B 1 234 ? -20.243 48.330 20.011  1.00 46.19 ? 552 GLU B CG  1 
ATOM   4460 C CD  . GLU B 1 234 ? -19.911 49.529 20.841  1.00 50.07 ? 552 GLU B CD  1 
ATOM   4461 O OE1 . GLU B 1 234 ? -18.737 49.948 20.801  1.00 51.67 ? 552 GLU B OE1 1 
ATOM   4462 O OE2 . GLU B 1 234 ? -20.814 50.050 21.533  1.00 51.49 ? 552 GLU B OE2 1 
ATOM   4463 N N   . HIS B 1 235 ? -17.636 45.410 17.571  1.00 45.92 ? 553 HIS B N   1 
ATOM   4464 C CA  . HIS B 1 235 ? -16.362 45.113 16.927  1.00 45.57 ? 553 HIS B CA  1 
ATOM   4465 C C   . HIS B 1 235 ? -16.594 44.422 15.595  1.00 45.33 ? 553 HIS B C   1 
ATOM   4466 O O   . HIS B 1 235 ? -17.482 43.592 15.473  1.00 44.75 ? 553 HIS B O   1 
ATOM   4467 C CB  . HIS B 1 235 ? -15.468 44.282 17.851  1.00 45.40 ? 553 HIS B CB  1 
ATOM   4468 C CG  . HIS B 1 235 ? -14.121 43.969 17.274  1.00 47.48 ? 553 HIS B CG  1 
ATOM   4469 N ND1 . HIS B 1 235 ? -13.713 42.682 16.987  1.00 47.07 ? 553 HIS B ND1 1 
ATOM   4470 C CD2 . HIS B 1 235 ? -13.095 44.776 16.916  1.00 46.60 ? 553 HIS B CD2 1 
ATOM   4471 C CE1 . HIS B 1 235 ? -12.493 42.709 16.484  1.00 45.71 ? 553 HIS B CE1 1 
ATOM   4472 N NE2 . HIS B 1 235 ? -12.096 43.968 16.429  1.00 47.10 ? 553 HIS B NE2 1 
ATOM   4473 N N   . ASN B 1 236 ? -15.815 44.793 14.585  1.00 46.46 ? 554 ASN B N   1 
ATOM   4474 C CA  . ASN B 1 236 ? -15.879 44.122 13.289  1.00 46.77 ? 554 ASN B CA  1 
ATOM   4475 C C   . ASN B 1 236 ? -14.767 43.103 13.239  1.00 47.71 ? 554 ASN B C   1 
ATOM   4476 O O   . ASN B 1 236 ? -13.599 43.475 13.219  1.00 47.84 ? 554 ASN B O   1 
ATOM   4477 C CB  . ASN B 1 236 ? -15.709 45.127 12.154  1.00 46.02 ? 554 ASN B CB  1 
ATOM   4478 C CG  . ASN B 1 236 ? -16.755 46.222 12.184  1.00 45.70 ? 554 ASN B CG  1 
ATOM   4479 O OD1 . ASN B 1 236 ? -16.436 47.413 12.179  1.00 46.75 ? 554 ASN B OD1 1 
ATOM   4480 N ND2 . ASN B 1 236 ? -18.014 45.824 12.218  1.00 46.14 ? 554 ASN B ND2 1 
ATOM   4481 N N   . VAL B 1 237 ? -15.121 41.820 13.236  1.00 49.24 ? 555 VAL B N   1 
ATOM   4482 C CA  . VAL B 1 237 ? -14.121 40.748 13.360  1.00 51.14 ? 555 VAL B CA  1 
ATOM   4483 C C   . VAL B 1 237 ? -13.001 40.834 12.325  1.00 52.04 ? 555 VAL B C   1 
ATOM   4484 O O   . VAL B 1 237 ? -13.256 40.786 11.119  1.00 52.34 ? 555 VAL B O   1 
ATOM   4485 C CB  . VAL B 1 237 ? -14.773 39.348 13.303  1.00 51.81 ? 555 VAL B CB  1 
ATOM   4486 C CG1 . VAL B 1 237 ? -13.757 38.298 12.852  1.00 51.21 ? 555 VAL B CG1 1 
ATOM   4487 C CG2 . VAL B 1 237 ? -15.376 38.981 14.665  1.00 51.20 ? 555 VAL B CG2 1 
ATOM   4488 N N   . SER B 1 238 ? -11.761 40.950 12.794  1.00 52.85 ? 556 SER B N   1 
ATOM   4489 C CA  . SER B 1 238 ? -10.643 41.161 11.881  1.00 54.13 ? 556 SER B CA  1 
ATOM   4490 C C   . SER B 1 238 ? -9.917  39.880 11.492  1.00 55.43 ? 556 SER B C   1 
ATOM   4491 O O   . SER B 1 238 ? -9.029  39.420 12.200  1.00 55.88 ? 556 SER B O   1 
ATOM   4492 C CB  . SER B 1 238 ? -9.664  42.193 12.442  1.00 54.28 ? 556 SER B CB  1 
ATOM   4493 O OG  . SER B 1 238 ? -8.871  41.633 13.462  1.00 53.25 ? 556 SER B OG  1 
ATOM   4494 N N   . TYR B 1 239 ? -10.299 39.333 10.342  1.00 57.82 ? 557 TYR B N   1 
ATOM   4495 C CA  . TYR B 1 239 ? -9.721  38.103 9.781   1.00 59.95 ? 557 TYR B CA  1 
ATOM   4496 C C   . TYR B 1 239 ? -8.268  38.241 9.274   1.00 61.44 ? 557 TYR B C   1 
ATOM   4497 O O   . TYR B 1 239 ? -7.957  39.158 8.502   1.00 61.28 ? 557 TYR B O   1 
ATOM   4498 C CB  . TYR B 1 239 ? -10.621 37.593 8.644   1.00 59.63 ? 557 TYR B CB  1 
ATOM   4499 C CG  . TYR B 1 239 ? -12.074 37.447 9.048   1.00 59.86 ? 557 TYR B CG  1 
ATOM   4500 C CD1 . TYR B 1 239 ? -12.975 38.485 8.858   1.00 59.18 ? 557 TYR B CD1 1 
ATOM   4501 C CD2 . TYR B 1 239 ? -12.539 36.275 9.636   1.00 60.52 ? 557 TYR B CD2 1 
ATOM   4502 C CE1 . TYR B 1 239 ? -14.299 38.359 9.233   1.00 61.27 ? 557 TYR B CE1 1 
ATOM   4503 C CE2 . TYR B 1 239 ? -13.862 36.137 10.013  1.00 60.61 ? 557 TYR B CE2 1 
ATOM   4504 C CZ  . TYR B 1 239 ? -14.738 37.183 9.810   1.00 62.39 ? 557 TYR B CZ  1 
ATOM   4505 O OH  . TYR B 1 239 ? -16.054 37.056 10.186  1.00 62.65 ? 557 TYR B OH  1 
ATOM   4506 N N   . PRO B 1 240 ? -7.375  37.323 9.712   1.00 62.78 ? 558 PRO B N   1 
ATOM   4507 C CA  . PRO B 1 240 ? -5.994  37.251 9.219   1.00 63.32 ? 558 PRO B CA  1 
ATOM   4508 C C   . PRO B 1 240 ? -5.968  36.745 7.789   1.00 63.99 ? 558 PRO B C   1 
ATOM   4509 O O   . PRO B 1 240 ? -6.319  35.594 7.532   1.00 63.44 ? 558 PRO B O   1 
ATOM   4510 C CB  . PRO B 1 240 ? -5.337  36.222 10.140  1.00 63.22 ? 558 PRO B CB  1 
ATOM   4511 C CG  . PRO B 1 240 ? -6.472  35.380 10.634  1.00 63.14 ? 558 PRO B CG  1 
ATOM   4512 C CD  . PRO B 1 240 ? -7.639  36.313 10.755  1.00 62.76 ? 558 PRO B CD  1 
ATOM   4513 N N   . LYS B 1 241 ? -5.537  37.606 6.874   1.00 65.14 ? 559 LYS B N   1 
ATOM   4514 C CA  . LYS B 1 241 ? -5.641  37.344 5.437   1.00 66.09 ? 559 LYS B CA  1 
ATOM   4515 C C   . LYS B 1 241 ? -4.930  36.063 4.947   1.00 65.46 ? 559 LYS B C   1 
ATOM   4516 O O   . LYS B 1 241 ? -4.765  35.872 3.742   1.00 65.44 ? 559 LYS B O   1 
ATOM   4517 C CB  . LYS B 1 241 ? -5.211  38.590 4.629   1.00 66.99 ? 559 LYS B CB  1 
ATOM   4518 C CG  . LYS B 1 241 ? -6.198  39.780 4.742   1.00 69.67 ? 559 LYS B CG  1 
ATOM   4519 C CD  . LYS B 1 241 ? -5.733  41.040 3.988   1.00 72.20 ? 559 LYS B CD  1 
ATOM   4520 C CE  . LYS B 1 241 ? -4.970  42.007 4.891   1.00 72.71 ? 559 LYS B CE  1 
ATOM   4521 N NZ  . LYS B 1 241 ? -3.781  41.344 5.499   1.00 73.70 ? 559 LYS B NZ  1 
ATOM   4522 N N   . SER B 1 242 ? -4.532  35.194 5.878   1.00 64.85 ? 560 SER B N   1 
ATOM   4523 C CA  . SER B 1 242 ? -4.006  33.861 5.546   1.00 63.76 ? 560 SER B CA  1 
ATOM   4524 C C   . SER B 1 242 ? -5.155  32.918 5.213   1.00 63.41 ? 560 SER B C   1 
ATOM   4525 O O   . SER B 1 242 ? -5.009  31.970 4.434   1.00 62.70 ? 560 SER B O   1 
ATOM   4526 C CB  . SER B 1 242 ? -3.243  33.281 6.733   1.00 63.79 ? 560 SER B CB  1 
ATOM   4527 O OG  . SER B 1 242 ? -2.575  34.298 7.446   1.00 63.13 ? 560 SER B OG  1 
ATOM   4528 N N   . LEU B 1 243 ? -6.297  33.194 5.834   1.00 62.83 ? 561 LEU B N   1 
ATOM   4529 C CA  . LEU B 1 243 ? -7.509  32.411 5.660   1.00 61.70 ? 561 LEU B CA  1 
ATOM   4530 C C   . LEU B 1 243 ? -7.996  32.434 4.226   1.00 61.00 ? 561 LEU B C   1 
ATOM   4531 O O   . LEU B 1 243 ? -7.699  33.341 3.468   1.00 59.96 ? 561 LEU B O   1 
ATOM   4532 C CB  . LEU B 1 243 ? -8.621  32.955 6.560   1.00 61.56 ? 561 LEU B CB  1 
ATOM   4533 C CG  . LEU B 1 243 ? -8.571  32.693 8.066   1.00 58.84 ? 561 LEU B CG  1 
ATOM   4534 C CD1 . LEU B 1 243 ? -7.167  32.358 8.572   1.00 59.24 ? 561 LEU B CD1 1 
ATOM   4535 C CD2 . LEU B 1 243 ? -9.138  33.894 8.789   1.00 56.19 ? 561 LEU B CD2 1 
ATOM   4536 N N   . SER B 1 244 ? -8.765  31.420 3.875   1.00 61.06 ? 562 SER B N   1 
ATOM   4537 C CA  . SER B 1 244 ? -9.408  31.361 2.590   1.00 61.38 ? 562 SER B CA  1 
ATOM   4538 C C   . SER B 1 244 ? -10.533 32.370 2.530   1.00 61.47 ? 562 SER B C   1 
ATOM   4539 O O   . SER B 1 244 ? -10.728 33.153 3.462   1.00 60.82 ? 562 SER B O   1 
ATOM   4540 C CB  . SER B 1 244 ? -9.993  29.976 2.404   1.00 61.69 ? 562 SER B CB  1 
ATOM   4541 O OG  . SER B 1 244 ? -10.718 29.607 3.561   1.00 62.50 ? 562 SER B OG  1 
ATOM   4542 N N   . LYS B 1 245 ? -11.281 32.335 1.429   1.00 62.32 ? 563 LYS B N   1 
ATOM   4543 C CA  . LYS B 1 245 ? -12.459 33.178 1.276   1.00 63.20 ? 563 LYS B CA  1 
ATOM   4544 C C   . LYS B 1 245 ? -13.713 32.418 1.713   1.00 62.75 ? 563 LYS B C   1 
ATOM   4545 O O   . LYS B 1 245 ? -14.688 33.023 2.151   1.00 63.26 ? 563 LYS B O   1 
ATOM   4546 C CB  . LYS B 1 245 ? -12.596 33.727 -0.160  1.00 63.54 ? 563 LYS B CB  1 
ATOM   4547 C CG  . LYS B 1 245 ? -13.680 33.062 -1.033  1.00 65.25 ? 563 LYS B CG  1 
ATOM   4548 C CD  . LYS B 1 245 ? -14.368 34.080 -1.957  1.00 65.06 ? 563 LYS B CD  1 
ATOM   4549 C CE  . LYS B 1 245 ? -15.484 33.451 -2.793  1.00 63.79 ? 563 LYS B CE  1 
ATOM   4550 N NZ  . LYS B 1 245 ? -14.983 32.782 -4.031  1.00 61.89 ? 563 LYS B NZ  1 
ATOM   4551 N N   . GLU B 1 246 ? -13.683 31.094 1.600   1.00 61.93 ? 564 GLU B N   1 
ATOM   4552 C CA  . GLU B 1 246 ? -14.774 30.279 2.120   1.00 61.79 ? 564 GLU B CA  1 
ATOM   4553 C C   . GLU B 1 246 ? -14.743 30.290 3.646   1.00 59.88 ? 564 GLU B C   1 
ATOM   4554 O O   . GLU B 1 246 ? -15.782 30.334 4.299   1.00 59.63 ? 564 GLU B O   1 
ATOM   4555 C CB  . GLU B 1 246 ? -14.705 28.847 1.583   1.00 63.36 ? 564 GLU B CB  1 
ATOM   4556 C CG  . GLU B 1 246 ? -15.307 28.661 0.192   1.00 66.60 ? 564 GLU B CG  1 
ATOM   4557 C CD  . GLU B 1 246 ? -14.447 29.266 -0.902  1.00 72.45 ? 564 GLU B CD  1 
ATOM   4558 O OE1 . GLU B 1 246 ? -13.385 29.843 -0.580  1.00 74.77 ? 564 GLU B OE1 1 
ATOM   4559 O OE2 . GLU B 1 246 ? -14.828 29.162 -2.087  1.00 75.77 ? 564 GLU B OE2 1 
ATOM   4560 N N   . ALA B 1 247 ? -13.538 30.257 4.202   1.00 58.00 ? 565 ALA B N   1 
ATOM   4561 C CA  . ALA B 1 247 ? -13.338 30.477 5.622   1.00 56.35 ? 565 ALA B CA  1 
ATOM   4562 C C   . ALA B 1 247 ? -13.921 31.832 6.023   1.00 55.67 ? 565 ALA B C   1 
ATOM   4563 O O   . ALA B 1 247 ? -14.949 31.900 6.699   1.00 56.47 ? 565 ALA B O   1 
ATOM   4564 C CB  . ALA B 1 247 ? -11.860 30.418 5.953   1.00 55.78 ? 565 ALA B CB  1 
ATOM   4565 N N   . VAL B 1 248 ? -13.270 32.906 5.588   1.00 53.84 ? 566 VAL B N   1 
ATOM   4566 C CA  . VAL B 1 248 ? -13.694 34.260 5.930   1.00 51.55 ? 566 VAL B CA  1 
ATOM   4567 C C   . VAL B 1 248 ? -15.172 34.513 5.673   1.00 49.77 ? 566 VAL B C   1 
ATOM   4568 O O   . VAL B 1 248 ? -15.777 35.337 6.341   1.00 50.39 ? 566 VAL B O   1 
ATOM   4569 C CB  . VAL B 1 248 ? -12.872 35.321 5.172   1.00 51.79 ? 566 VAL B CB  1 
ATOM   4570 C CG1 . VAL B 1 248 ? -13.640 36.626 5.082   1.00 50.82 ? 566 VAL B CG1 1 
ATOM   4571 C CG2 . VAL B 1 248 ? -11.514 35.524 5.835   1.00 51.60 ? 566 VAL B CG2 1 
ATOM   4572 N N   . SER B 1 249 ? -15.755 33.807 4.712   1.00 47.62 ? 567 SER B N   1 
ATOM   4573 C CA  . SER B 1 249 ? -17.166 34.006 4.381   1.00 45.73 ? 567 SER B CA  1 
ATOM   4574 C C   . SER B 1 249 ? -18.120 33.364 5.383   1.00 45.07 ? 567 SER B C   1 
ATOM   4575 O O   . SER B 1 249 ? -19.121 33.963 5.764   1.00 44.78 ? 567 SER B O   1 
ATOM   4576 C CB  . SER B 1 249 ? -17.479 33.478 2.983   1.00 45.27 ? 567 SER B CB  1 
ATOM   4577 O OG  . SER B 1 249 ? -18.865 33.208 2.857   1.00 43.55 ? 567 SER B OG  1 
ATOM   4578 N N   . ILE B 1 250 ? -17.826 32.134 5.791   1.00 44.39 ? 568 ILE B N   1 
ATOM   4579 C CA  . ILE B 1 250 ? -18.701 31.429 6.721   1.00 42.65 ? 568 ILE B CA  1 
ATOM   4580 C C   . ILE B 1 250 ? -18.725 32.133 8.077   1.00 43.07 ? 568 ILE B C   1 
ATOM   4581 O O   . ILE B 1 250 ? -19.763 32.198 8.736   1.00 42.63 ? 568 ILE B O   1 
ATOM   4582 C CB  . ILE B 1 250 ? -18.315 29.933 6.870   1.00 42.04 ? 568 ILE B CB  1 
ATOM   4583 C CG1 . ILE B 1 250 ? -19.387 29.187 7.656   1.00 40.94 ? 568 ILE B CG1 1 
ATOM   4584 C CG2 . ILE B 1 250 ? -16.942 29.763 7.505   1.00 37.58 ? 568 ILE B CG2 1 
ATOM   4585 C CD1 . ILE B 1 250 ? -19.225 27.711 7.624   1.00 42.56 ? 568 ILE B CD1 1 
ATOM   4586 N N   . CYS B 1 251 ? -17.583 32.688 8.472   1.00 42.89 ? 569 CYS B N   1 
ATOM   4587 C CA  . CYS B 1 251 ? -17.466 33.359 9.761   1.00 42.99 ? 569 CYS B CA  1 
ATOM   4588 C C   . CYS B 1 251 ? -18.343 34.595 9.851   1.00 42.54 ? 569 CYS B C   1 
ATOM   4589 O O   . CYS B 1 251 ? -19.037 34.800 10.849  1.00 41.36 ? 569 CYS B O   1 
ATOM   4590 C CB  . CYS B 1 251 ? -16.010 33.700 10.039  1.00 42.56 ? 569 CYS B CB  1 
ATOM   4591 S SG  . CYS B 1 251 ? -15.066 32.200 10.354  1.00 43.84 ? 569 CYS B SG  1 
ATOM   4592 N N   . LYS B 1 252 ? -18.310 35.404 8.797   1.00 41.87 ? 570 LYS B N   1 
ATOM   4593 C CA  . LYS B 1 252 ? -19.189 36.552 8.691   1.00 42.38 ? 570 LYS B CA  1 
ATOM   4594 C C   . LYS B 1 252 ? -20.625 36.071 8.786   1.00 41.84 ? 570 LYS B C   1 
ATOM   4595 O O   . LYS B 1 252 ? -21.427 36.636 9.533   1.00 42.25 ? 570 LYS B O   1 
ATOM   4596 C CB  . LYS B 1 252 ? -18.965 37.287 7.366   1.00 43.58 ? 570 LYS B CB  1 
ATOM   4597 C CG  . LYS B 1 252 ? -17.538 37.819 7.158   1.00 46.92 ? 570 LYS B CG  1 
ATOM   4598 C CD  . LYS B 1 252 ? -17.411 38.657 5.882   1.00 48.67 ? 570 LYS B CD  1 
ATOM   4599 C CE  . LYS B 1 252 ? -16.080 39.406 5.836   1.00 49.49 ? 570 LYS B CE  1 
ATOM   4600 N NZ  . LYS B 1 252 ? -16.195 40.682 5.078   1.00 49.83 ? 570 LYS B NZ  1 
ATOM   4601 N N   . GLY B 1 253 ? -20.932 35.011 8.039   1.00 41.44 ? 571 GLY B N   1 
ATOM   4602 C CA  . GLY B 1 253 ? -22.269 34.419 8.012   1.00 40.96 ? 571 GLY B CA  1 
ATOM   4603 C C   . GLY B 1 253 ? -22.766 34.024 9.390   1.00 41.54 ? 571 GLY B C   1 
ATOM   4604 O O   . GLY B 1 253 ? -23.936 34.247 9.729   1.00 40.67 ? 571 GLY B O   1 
ATOM   4605 N N   . LEU B 1 254 ? -21.865 33.442 10.187  1.00 42.00 ? 572 LEU B N   1 
ATOM   4606 C CA  . LEU B 1 254 ? -22.188 32.960 11.532  1.00 41.38 ? 572 LEU B CA  1 
ATOM   4607 C C   . LEU B 1 254 ? -22.028 34.062 12.567  1.00 40.61 ? 572 LEU B C   1 
ATOM   4608 O O   . LEU B 1 254 ? -22.810 34.152 13.501  1.00 40.01 ? 572 LEU B O   1 
ATOM   4609 C CB  . LEU B 1 254 ? -21.281 31.794 11.912  1.00 42.17 ? 572 LEU B CB  1 
ATOM   4610 C CG  . LEU B 1 254 ? -21.207 30.576 10.985  1.00 43.21 ? 572 LEU B CG  1 
ATOM   4611 C CD1 . LEU B 1 254 ? -19.871 29.826 11.154  1.00 39.57 ? 572 LEU B CD1 1 
ATOM   4612 C CD2 . LEU B 1 254 ? -22.396 29.661 11.211  1.00 42.03 ? 572 LEU B CD2 1 
ATOM   4613 N N   . MET B 1 255 ? -21.008 34.896 12.406  1.00 39.96 ? 573 MET B N   1 
ATOM   4614 C CA  . MET B 1 255 ? -20.799 35.999 13.337  1.00 39.44 ? 573 MET B CA  1 
ATOM   4615 C C   . MET B 1 255 ? -21.429 37.311 12.852  1.00 39.21 ? 573 MET B C   1 
ATOM   4616 O O   . MET B 1 255 ? -20.903 38.401 13.127  1.00 38.85 ? 573 MET B O   1 
ATOM   4617 C CB  . MET B 1 255 ? -19.316 36.172 13.668  1.00 38.79 ? 573 MET B CB  1 
ATOM   4618 C CG  . MET B 1 255 ? -18.772 35.056 14.565  1.00 38.26 ? 573 MET B CG  1 
ATOM   4619 S SD  . MET B 1 255 ? -17.071 35.287 15.180  1.00 39.15 ? 573 MET B SD  1 
ATOM   4620 C CE  . MET B 1 255 ? -16.085 35.021 13.716  1.00 36.53 ? 573 MET B CE  1 
ATOM   4621 N N   . THR B 1 256 ? -22.552 37.191 12.138  1.00 37.72 ? 574 THR B N   1 
ATOM   4622 C CA  . THR B 1 256 ? -23.437 38.332 11.894  1.00 37.16 ? 574 THR B CA  1 
ATOM   4623 C C   . THR B 1 256 ? -24.218 38.671 13.168  1.00 36.10 ? 574 THR B C   1 
ATOM   4624 O O   . THR B 1 256 ? -24.951 37.849 13.706  1.00 36.07 ? 574 THR B O   1 
ATOM   4625 C CB  . THR B 1 256 ? -24.440 38.088 10.728  1.00 37.49 ? 574 THR B CB  1 
ATOM   4626 O OG1 . THR B 1 256 ? -23.780 37.446 9.635   1.00 36.31 ? 574 THR B OG1 1 
ATOM   4627 C CG2 . THR B 1 256 ? -25.002 39.402 10.239  1.00 35.35 ? 574 THR B CG2 1 
ATOM   4628 N N   . LYS B 1 257 ? -24.060 39.897 13.634  1.00 35.93 ? 575 LYS B N   1 
ATOM   4629 C CA  . LYS B 1 257 ? -24.598 40.308 14.916  1.00 36.59 ? 575 LYS B CA  1 
ATOM   4630 C C   . LYS B 1 257 ? -26.120 40.249 15.024  1.00 39.50 ? 575 LYS B C   1 
ATOM   4631 O O   . LYS B 1 257 ? -26.652 40.036 16.118  1.00 39.92 ? 575 LYS B O   1 
ATOM   4632 C CB  . LYS B 1 257 ? -24.126 41.720 15.232  1.00 35.00 ? 575 LYS B CB  1 
ATOM   4633 C CG  . LYS B 1 257 ? -22.697 41.906 14.898  1.00 28.94 ? 575 LYS B CG  1 
ATOM   4634 C CD  . LYS B 1 257 ? -22.118 43.058 15.630  1.00 22.84 ? 575 LYS B CD  1 
ATOM   4635 C CE  . LYS B 1 257 ? -20.647 42.838 15.724  1.00 27.24 ? 575 LYS B CE  1 
ATOM   4636 N NZ  . LYS B 1 257 ? -20.113 43.787 16.711  1.00 35.87 ? 575 LYS B NZ  1 
ATOM   4637 N N   . HIS B 1 258 ? -26.816 40.470 13.910  1.00 41.72 ? 576 HIS B N   1 
ATOM   4638 C CA  . HIS B 1 258 ? -28.273 40.383 13.893  1.00 43.66 ? 576 HIS B CA  1 
ATOM   4639 C C   . HIS B 1 258 ? -28.693 38.974 13.487  1.00 43.40 ? 576 HIS B C   1 
ATOM   4640 O O   . HIS B 1 258 ? -28.520 38.588 12.331  1.00 43.52 ? 576 HIS B O   1 
ATOM   4641 C CB  . HIS B 1 258 ? -28.863 41.375 12.893  1.00 45.72 ? 576 HIS B CB  1 
ATOM   4642 C CG  . HIS B 1 258 ? -28.882 42.798 13.366  1.00 50.92 ? 576 HIS B CG  1 
ATOM   4643 N ND1 . HIS B 1 258 ? -27.886 43.700 13.056  1.00 53.40 ? 576 HIS B ND1 1 
ATOM   4644 C CD2 . HIS B 1 258 ? -29.802 43.487 14.085  1.00 55.14 ? 576 HIS B CD2 1 
ATOM   4645 C CE1 . HIS B 1 258 ? -28.182 44.877 13.578  1.00 55.93 ? 576 HIS B CE1 1 
ATOM   4646 N NE2 . HIS B 1 258 ? -29.341 44.776 14.206  1.00 57.36 ? 576 HIS B NE2 1 
ATOM   4647 N N   . PRO B 1 259 ? -29.244 38.201 14.439  1.00 42.91 ? 577 PRO B N   1 
ATOM   4648 C CA  . PRO B 1 259 ? -29.728 36.862 14.194  1.00 42.33 ? 577 PRO B CA  1 
ATOM   4649 C C   . PRO B 1 259 ? -30.463 36.806 12.885  1.00 43.42 ? 577 PRO B C   1 
ATOM   4650 O O   . PRO B 1 259 ? -30.065 36.073 11.987  1.00 43.69 ? 577 PRO B O   1 
ATOM   4651 C CB  . PRO B 1 259 ? -30.727 36.659 15.321  1.00 41.76 ? 577 PRO B CB  1 
ATOM   4652 C CG  . PRO B 1 259 ? -30.159 37.416 16.437  1.00 41.27 ? 577 PRO B CG  1 
ATOM   4653 C CD  . PRO B 1 259 ? -29.486 38.613 15.832  1.00 43.16 ? 577 PRO B CD  1 
ATOM   4654 N N   . ALA B 1 260 ? -31.520 37.601 12.778  1.00 44.34 ? 578 ALA B N   1 
ATOM   4655 C CA  . ALA B 1 260 ? -32.389 37.573 11.620  1.00 45.66 ? 578 ALA B CA  1 
ATOM   4656 C C   . ALA B 1 260 ? -31.658 37.249 10.309  1.00 46.46 ? 578 ALA B C   1 
ATOM   4657 O O   . ALA B 1 260 ? -32.180 36.518 9.465   1.00 46.45 ? 578 ALA B O   1 
ATOM   4658 C CB  . ALA B 1 260 ? -33.138 38.874 11.510  1.00 46.90 ? 578 ALA B CB  1 
ATOM   4659 N N   . LYS B 1 261 ? -30.453 37.780 10.139  1.00 47.00 ? 579 LYS B N   1 
ATOM   4660 C CA  . LYS B 1 261 ? -29.705 37.554 8.901   1.00 48.95 ? 579 LYS B CA  1 
ATOM   4661 C C   . LYS B 1 261 ? -28.559 36.552 9.055   1.00 49.64 ? 579 LYS B C   1 
ATOM   4662 O O   . LYS B 1 261 ? -27.874 36.218 8.086   1.00 49.73 ? 579 LYS B O   1 
ATOM   4663 C CB  . LYS B 1 261 ? -29.188 38.883 8.336   1.00 49.04 ? 579 LYS B CB  1 
ATOM   4664 C CG  . LYS B 1 261 ? -30.215 39.599 7.467   1.00 51.64 ? 579 LYS B CG  1 
ATOM   4665 C CD  . LYS B 1 261 ? -30.268 41.079 7.759   1.00 52.35 ? 579 LYS B CD  1 
ATOM   4666 C CE  . LYS B 1 261 ? -31.694 41.557 7.670   1.00 53.60 ? 579 LYS B CE  1 
ATOM   4667 N NZ  . LYS B 1 261 ? -31.840 42.942 8.185   1.00 57.80 ? 579 LYS B NZ  1 
ATOM   4668 N N   . ARG B 1 262 ? -28.366 36.064 10.272  1.00 49.87 ? 580 ARG B N   1 
ATOM   4669 C CA  . ARG B 1 262 ? -27.225 35.219 10.592  1.00 50.29 ? 580 ARG B CA  1 
ATOM   4670 C C   . ARG B 1 262 ? -27.346 33.819 10.007  1.00 51.43 ? 580 ARG B C   1 
ATOM   4671 O O   . ARG B 1 262 ? -28.367 33.147 10.164  1.00 51.43 ? 580 ARG B O   1 
ATOM   4672 C CB  . ARG B 1 262 ? -27.057 35.145 12.107  1.00 50.14 ? 580 ARG B CB  1 
ATOM   4673 C CG  . ARG B 1 262 ? -25.857 34.365 12.582  1.00 47.33 ? 580 ARG B CG  1 
ATOM   4674 C CD  . ARG B 1 262 ? -25.937 34.166 14.078  1.00 42.14 ? 580 ARG B CD  1 
ATOM   4675 N NE  . ARG B 1 262 ? -25.975 35.435 14.797  1.00 37.82 ? 580 ARG B NE  1 
ATOM   4676 C CZ  . ARG B 1 262 ? -26.497 35.577 16.010  1.00 35.59 ? 580 ARG B CZ  1 
ATOM   4677 N NH1 . ARG B 1 262 ? -27.028 34.529 16.628  1.00 34.69 ? 580 ARG B NH1 1 
ATOM   4678 N NH2 . ARG B 1 262 ? -26.497 36.761 16.598  1.00 33.22 ? 580 ARG B NH2 1 
ATOM   4679 N N   . LEU B 1 263 ? -26.282 33.380 9.347   1.00 53.26 ? 581 LEU B N   1 
ATOM   4680 C CA  . LEU B 1 263 ? -26.269 32.086 8.673   1.00 55.95 ? 581 LEU B CA  1 
ATOM   4681 C C   . LEU B 1 263 ? -26.752 30.956 9.582   1.00 57.97 ? 581 LEU B C   1 
ATOM   4682 O O   . LEU B 1 263 ? -26.043 30.532 10.494  1.00 57.94 ? 581 LEU B O   1 
ATOM   4683 C CB  . LEU B 1 263 ? -24.864 31.787 8.123   1.00 55.63 ? 581 LEU B CB  1 
ATOM   4684 C CG  . LEU B 1 263 ? -24.507 30.415 7.528   1.00 55.99 ? 581 LEU B CG  1 
ATOM   4685 C CD1 . LEU B 1 263 ? -25.293 30.084 6.254   1.00 54.17 ? 581 LEU B CD1 1 
ATOM   4686 C CD2 . LEU B 1 263 ? -23.003 30.333 7.270   1.00 54.48 ? 581 LEU B CD2 1 
ATOM   4687 N N   . GLY B 1 264 ? -27.967 30.481 9.331   1.00 60.19 ? 582 GLY B N   1 
ATOM   4688 C CA  . GLY B 1 264 ? -28.482 29.319 10.033  1.00 62.64 ? 582 GLY B CA  1 
ATOM   4689 C C   . GLY B 1 264 ? -29.704 29.623 10.863  1.00 64.76 ? 582 GLY B C   1 
ATOM   4690 O O   . GLY B 1 264 ? -30.336 28.720 11.400  1.00 65.17 ? 582 GLY B O   1 
ATOM   4691 N N   . CYS B 1 265 ? -30.034 30.899 10.987  1.00 67.03 ? 583 CYS B N   1 
ATOM   4692 C CA  . CYS B 1 265 ? -31.242 31.275 11.696  1.00 69.95 ? 583 CYS B CA  1 
ATOM   4693 C C   . CYS B 1 265 ? -32.378 31.418 10.708  1.00 71.29 ? 583 CYS B C   1 
ATOM   4694 O O   . CYS B 1 265 ? -32.145 31.737 9.543   1.00 71.29 ? 583 CYS B O   1 
ATOM   4695 C CB  . CYS B 1 265 ? -31.034 32.583 12.434  1.00 69.56 ? 583 CYS B CB  1 
ATOM   4696 S SG  . CYS B 1 265 ? -29.568 32.550 13.441  1.00 76.05 ? 583 CYS B SG  1 
ATOM   4697 N N   . GLY B 1 266 ? -33.602 31.169 11.171  1.00 73.22 ? 584 GLY B N   1 
ATOM   4698 C CA  . GLY B 1 266 ? -34.801 31.364 10.347  1.00 75.60 ? 584 GLY B CA  1 
ATOM   4699 C C   . GLY B 1 266 ? -35.405 30.112 9.722   1.00 77.01 ? 584 GLY B C   1 
ATOM   4700 O O   . GLY B 1 266 ? -35.305 29.011 10.288  1.00 76.89 ? 584 GLY B O   1 
ATOM   4701 N N   . PRO B 1 267 ? -36.049 30.276 8.548   1.00 77.54 ? 585 PRO B N   1 
ATOM   4702 C CA  . PRO B 1 267 ? -36.688 29.172 7.820   1.00 78.33 ? 585 PRO B CA  1 
ATOM   4703 C C   . PRO B 1 267 ? -35.723 28.042 7.430   1.00 78.85 ? 585 PRO B C   1 
ATOM   4704 O O   . PRO B 1 267 ? -35.782 26.951 8.003   1.00 78.50 ? 585 PRO B O   1 
ATOM   4705 C CB  . PRO B 1 267 ? -37.247 29.857 6.566   1.00 78.22 ? 585 PRO B CB  1 
ATOM   4706 C CG  . PRO B 1 267 ? -37.428 31.287 6.971   1.00 77.90 ? 585 PRO B CG  1 
ATOM   4707 C CD  . PRO B 1 267 ? -36.289 31.577 7.901   1.00 77.11 ? 585 PRO B CD  1 
ATOM   4708 N N   . GLU B 1 268 ? -34.832 28.321 6.482   1.00 79.62 ? 586 GLU B N   1 
ATOM   4709 C CA  . GLU B 1 268 ? -33.979 27.294 5.868   1.00 80.25 ? 586 GLU B CA  1 
ATOM   4710 C C   . GLU B 1 268 ? -32.622 27.075 6.571   1.00 79.73 ? 586 GLU B C   1 
ATOM   4711 O O   . GLU B 1 268 ? -31.663 26.596 5.956   1.00 79.37 ? 586 GLU B O   1 
ATOM   4712 C CB  . GLU B 1 268 ? -33.753 27.650 4.389   1.00 80.71 ? 586 GLU B CB  1 
ATOM   4713 C CG  . GLU B 1 268 ? -33.597 26.452 3.459   1.00 82.74 ? 586 GLU B CG  1 
ATOM   4714 C CD  . GLU B 1 268 ? -34.894 25.675 3.280   1.00 85.64 ? 586 GLU B CD  1 
ATOM   4715 O OE1 . GLU B 1 268 ? -34.836 24.428 3.184   1.00 85.16 ? 586 GLU B OE1 1 
ATOM   4716 O OE2 . GLU B 1 268 ? -35.973 26.310 3.237   1.00 87.40 ? 586 GLU B OE2 1 
ATOM   4717 N N   . GLY B 1 269 ? -32.549 27.408 7.856   1.00 79.23 ? 587 GLY B N   1 
ATOM   4718 C CA  . GLY B 1 269 ? -31.281 27.384 8.584   1.00 78.99 ? 587 GLY B CA  1 
ATOM   4719 C C   . GLY B 1 269 ? -30.383 26.212 8.237   1.00 78.73 ? 587 GLY B C   1 
ATOM   4720 O O   . GLY B 1 269 ? -29.273 26.387 7.721   1.00 78.37 ? 587 GLY B O   1 
ATOM   4721 N N   . GLU B 1 270 ? -30.878 25.014 8.525   1.00 78.29 ? 588 GLU B N   1 
ATOM   4722 C CA  . GLU B 1 270 ? -30.138 23.776 8.302   1.00 78.05 ? 588 GLU B CA  1 
ATOM   4723 C C   . GLU B 1 270 ? -29.336 23.869 7.006   1.00 76.77 ? 588 GLU B C   1 
ATOM   4724 O O   . GLU B 1 270 ? -28.109 23.995 7.022   1.00 75.56 ? 588 GLU B O   1 
ATOM   4725 C CB  . GLU B 1 270 ? -31.120 22.585 8.266   1.00 79.14 ? 588 GLU B CB  1 
ATOM   4726 C CG  . GLU B 1 270 ? -30.701 21.334 9.068   1.00 79.74 ? 588 GLU B CG  1 
ATOM   4727 C CD  . GLU B 1 270 ? -31.815 20.810 9.989   1.00 80.74 ? 588 GLU B CD  1 
ATOM   4728 O OE1 . GLU B 1 270 ? -32.515 21.640 10.616  1.00 80.37 ? 588 GLU B OE1 1 
ATOM   4729 O OE2 . GLU B 1 270 ? -31.979 19.573 10.104  1.00 79.33 ? 588 GLU B OE2 1 
ATOM   4730 N N   . ARG B 1 271 ? -30.041 23.831 5.883   1.00 75.97 ? 589 ARG B N   1 
ATOM   4731 C CA  . ARG B 1 271 ? -29.386 23.871 4.591   1.00 75.54 ? 589 ARG B CA  1 
ATOM   4732 C C   . ARG B 1 271 ? -28.317 24.962 4.542   1.00 74.47 ? 589 ARG B C   1 
ATOM   4733 O O   . ARG B 1 271 ? -27.142 24.669 4.327   1.00 74.93 ? 589 ARG B O   1 
ATOM   4734 C CB  . ARG B 1 271 ? -30.402 24.078 3.473   1.00 75.86 ? 589 ARG B CB  1 
ATOM   4735 C CG  . ARG B 1 271 ? -29.767 24.050 2.092   1.00 79.35 ? 589 ARG B CG  1 
ATOM   4736 C CD  . ARG B 1 271 ? -30.522 24.898 1.056   1.00 84.13 ? 589 ARG B CD  1 
ATOM   4737 N NE  . ARG B 1 271 ? -31.773 24.277 0.624   1.00 87.33 ? 589 ARG B NE  1 
ATOM   4738 C CZ  . ARG B 1 271 ? -31.850 23.155 -0.089  1.00 88.99 ? 589 ARG B CZ  1 
ATOM   4739 N NH1 . ARG B 1 271 ? -30.748 22.508 -0.450  1.00 89.98 ? 589 ARG B NH1 1 
ATOM   4740 N NH2 . ARG B 1 271 ? -33.036 22.670 -0.430  1.00 89.90 ? 589 ARG B NH2 1 
ATOM   4741 N N   . ASP B 1 272 ? -28.733 26.211 4.750   1.00 72.71 ? 590 ASP B N   1 
ATOM   4742 C CA  . ASP B 1 272 ? -27.832 27.369 4.698   1.00 70.74 ? 590 ASP B CA  1 
ATOM   4743 C C   . ASP B 1 272 ? -26.387 26.960 4.882   1.00 68.75 ? 590 ASP B C   1 
ATOM   4744 O O   . ASP B 1 272 ? -25.534 27.143 4.010   1.00 67.67 ? 590 ASP B O   1 
ATOM   4745 C CB  . ASP B 1 272 ? -28.173 28.355 5.822   1.00 71.29 ? 590 ASP B CB  1 
ATOM   4746 C CG  . ASP B 1 272 ? -29.480 29.088 5.594   1.00 72.33 ? 590 ASP B CG  1 
ATOM   4747 O OD1 . ASP B 1 272 ? -30.245 28.692 4.690   1.00 75.13 ? 590 ASP B OD1 1 
ATOM   4748 O OD2 . ASP B 1 272 ? -29.740 30.069 6.325   1.00 71.07 ? 590 ASP B OD2 1 
ATOM   4749 N N   . VAL B 1 273 ? -26.143 26.404 6.059   1.00 66.94 ? 591 VAL B N   1 
ATOM   4750 C CA  . VAL B 1 273 ? -24.826 26.049 6.516   1.00 64.74 ? 591 VAL B CA  1 
ATOM   4751 C C   . VAL B 1 273 ? -24.290 24.841 5.782   1.00 64.47 ? 591 VAL B C   1 
ATOM   4752 O O   . VAL B 1 273 ? -23.183 24.875 5.255   1.00 63.95 ? 591 VAL B O   1 
ATOM   4753 C CB  . VAL B 1 273 ? -24.878 25.720 7.995   1.00 64.19 ? 591 VAL B CB  1 
ATOM   4754 C CG1 . VAL B 1 273 ? -23.485 25.487 8.524   1.00 62.43 ? 591 VAL B CG1 1 
ATOM   4755 C CG2 . VAL B 1 273 ? -25.580 26.841 8.744   1.00 62.96 ? 591 VAL B CG2 1 
ATOM   4756 N N   . ARG B 1 274 ? -25.072 23.767 5.759   1.00 64.67 ? 592 ARG B N   1 
ATOM   4757 C CA  . ARG B 1 274 ? -24.666 22.562 5.050   1.00 65.24 ? 592 ARG B CA  1 
ATOM   4758 C C   . ARG B 1 274 ? -24.315 22.990 3.631   1.00 65.73 ? 592 ARG B C   1 
ATOM   4759 O O   . ARG B 1 274 ? -23.371 22.477 3.012   1.00 64.91 ? 592 ARG B O   1 
ATOM   4760 C CB  . ARG B 1 274 ? -25.800 21.531 5.045   1.00 65.02 ? 592 ARG B CB  1 
ATOM   4761 C CG  . ARG B 1 274 ? -25.339 20.091 4.821   1.00 65.52 ? 592 ARG B CG  1 
ATOM   4762 C CD  . ARG B 1 274 ? -26.500 19.112 4.819   1.00 66.57 ? 592 ARG B CD  1 
ATOM   4763 N NE  . ARG B 1 274 ? -26.925 18.719 6.164   1.00 69.25 ? 592 ARG B NE  1 
ATOM   4764 C CZ  . ARG B 1 274 ? -27.806 19.390 6.907   1.00 70.65 ? 592 ARG B CZ  1 
ATOM   4765 N NH1 . ARG B 1 274 ? -28.357 20.508 6.451   1.00 72.37 ? 592 ARG B NH1 1 
ATOM   4766 N NH2 . ARG B 1 274 ? -28.136 18.946 8.114   1.00 68.81 ? 592 ARG B NH2 1 
ATOM   4767 N N   . GLU B 1 275 ? -25.080 23.971 3.152   1.00 66.29 ? 593 GLU B N   1 
ATOM   4768 C CA  . GLU B 1 275 ? -24.922 24.553 1.827   1.00 66.57 ? 593 GLU B CA  1 
ATOM   4769 C C   . GLU B 1 275 ? -23.568 25.230 1.685   1.00 65.06 ? 593 GLU B C   1 
ATOM   4770 O O   . GLU B 1 275 ? -22.631 24.674 1.109   1.00 64.00 ? 593 GLU B O   1 
ATOM   4771 C CB  . GLU B 1 275 ? -26.036 25.582 1.578   1.00 67.71 ? 593 GLU B CB  1 
ATOM   4772 C CG  . GLU B 1 275 ? -26.619 25.563 0.167   1.00 70.95 ? 593 GLU B CG  1 
ATOM   4773 C CD  . GLU B 1 275 ? -27.141 24.181 -0.221  1.00 74.94 ? 593 GLU B CD  1 
ATOM   4774 O OE1 . GLU B 1 275 ? -27.022 23.239 0.598   1.00 75.61 ? 593 GLU B OE1 1 
ATOM   4775 O OE2 . GLU B 1 275 ? -27.669 24.032 -1.346  1.00 77.27 ? 593 GLU B OE2 1 
ATOM   4776 N N   . HIS B 1 276 ? -23.484 26.436 2.230   1.00 63.89 ? 594 HIS B N   1 
ATOM   4777 C CA  . HIS B 1 276 ? -22.280 27.239 2.152   1.00 62.83 ? 594 HIS B CA  1 
ATOM   4778 C C   . HIS B 1 276 ? -21.086 26.512 1.522   1.00 62.11 ? 594 HIS B C   1 
ATOM   4779 O O   . HIS B 1 276 ? -20.809 25.342 1.795   1.00 60.57 ? 594 HIS B O   1 
ATOM   4780 C CB  . HIS B 1 276 ? -21.918 27.789 3.534   1.00 62.23 ? 594 HIS B CB  1 
ATOM   4781 C CG  . HIS B 1 276 ? -20.868 28.856 3.505   1.00 59.90 ? 594 HIS B CG  1 
ATOM   4782 N ND1 . HIS B 1 276 ? -19.597 28.637 3.016   1.00 56.68 ? 594 HIS B ND1 1 
ATOM   4783 C CD2 . HIS B 1 276 ? -20.895 30.147 3.916   1.00 57.68 ? 594 HIS B CD2 1 
ATOM   4784 C CE1 . HIS B 1 276 ? -18.889 29.747 3.121   1.00 55.45 ? 594 HIS B CE1 1 
ATOM   4785 N NE2 . HIS B 1 276 ? -19.653 30.678 3.664   1.00 55.55 ? 594 HIS B NE2 1 
ATOM   4786 N N   . ALA B 1 277 ? -20.374 27.247 0.682   1.00 62.71 ? 595 ALA B N   1 
ATOM   4787 C CA  . ALA B 1 277 ? -19.273 26.696 -0.089  1.00 63.71 ? 595 ALA B CA  1 
ATOM   4788 C C   . ALA B 1 277 ? -18.052 26.365 0.769   1.00 63.82 ? 595 ALA B C   1 
ATOM   4789 O O   . ALA B 1 277 ? -17.033 25.888 0.263   1.00 64.15 ? 595 ALA B O   1 
ATOM   4790 C CB  . ALA B 1 277 ? -18.901 27.653 -1.217  1.00 63.30 ? 595 ALA B CB  1 
ATOM   4791 N N   . PHE B 1 278 ? -18.155 26.617 2.065   1.00 63.68 ? 596 PHE B N   1 
ATOM   4792 C CA  . PHE B 1 278 ? -17.053 26.342 2.969   1.00 64.21 ? 596 PHE B CA  1 
ATOM   4793 C C   . PHE B 1 278 ? -16.817 24.837 3.003   1.00 65.04 ? 596 PHE B C   1 
ATOM   4794 O O   . PHE B 1 278 ? -15.683 24.368 3.130   1.00 63.82 ? 596 PHE B O   1 
ATOM   4795 C CB  . PHE B 1 278 ? -17.379 26.895 4.365   1.00 64.18 ? 596 PHE B CB  1 
ATOM   4796 C CG  . PHE B 1 278 ? -16.329 26.613 5.402   1.00 61.23 ? 596 PHE B CG  1 
ATOM   4797 C CD1 . PHE B 1 278 ? -15.106 27.258 5.361   1.00 57.48 ? 596 PHE B CD1 1 
ATOM   4798 C CD2 . PHE B 1 278 ? -16.575 25.711 6.428   1.00 60.46 ? 596 PHE B CD2 1 
ATOM   4799 C CE1 . PHE B 1 278 ? -14.140 26.999 6.308   1.00 56.41 ? 596 PHE B CE1 1 
ATOM   4800 C CE2 . PHE B 1 278 ? -15.612 25.447 7.386   1.00 58.52 ? 596 PHE B CE2 1 
ATOM   4801 C CZ  . PHE B 1 278 ? -14.391 26.094 7.324   1.00 57.15 ? 596 PHE B CZ  1 
ATOM   4802 N N   . PHE B 1 279 ? -17.904 24.088 2.855   1.00 66.88 ? 597 PHE B N   1 
ATOM   4803 C CA  . PHE B 1 279 ? -17.846 22.637 2.902   1.00 69.47 ? 597 PHE B CA  1 
ATOM   4804 C C   . PHE B 1 279 ? -17.788 22.024 1.511   1.00 70.60 ? 597 PHE B C   1 
ATOM   4805 O O   . PHE B 1 279 ? -18.064 20.833 1.354   1.00 70.94 ? 597 PHE B O   1 
ATOM   4806 C CB  . PHE B 1 279 ? -19.083 22.071 3.609   1.00 70.48 ? 597 PHE B CB  1 
ATOM   4807 C CG  . PHE B 1 279 ? -19.379 22.692 4.955   1.00 71.23 ? 597 PHE B CG  1 
ATOM   4808 C CD1 . PHE B 1 279 ? -18.482 22.571 6.012   1.00 71.05 ? 597 PHE B CD1 1 
ATOM   4809 C CD2 . PHE B 1 279 ? -20.579 23.355 5.172   1.00 69.67 ? 597 PHE B CD2 1 
ATOM   4810 C CE1 . PHE B 1 279 ? -18.763 23.126 7.240   1.00 68.62 ? 597 PHE B CE1 1 
ATOM   4811 C CE2 . PHE B 1 279 ? -20.862 23.903 6.395   1.00 67.55 ? 597 PHE B CE2 1 
ATOM   4812 C CZ  . PHE B 1 279 ? -19.951 23.792 7.429   1.00 68.90 ? 597 PHE B CZ  1 
ATOM   4813 N N   . ARG B 1 280 ? -17.446 22.830 0.506   1.00 71.91 ? 598 ARG B N   1 
ATOM   4814 C CA  . ARG B 1 280 ? -17.471 22.383 -0.895  1.00 72.62 ? 598 ARG B CA  1 
ATOM   4815 C C   . ARG B 1 280 ? -16.892 20.981 -1.144  1.00 72.39 ? 598 ARG B C   1 
ATOM   4816 O O   . ARG B 1 280 ? -17.272 20.323 -2.106  1.00 73.01 ? 598 ARG B O   1 
ATOM   4817 C CB  . ARG B 1 280 ? -16.803 23.410 -1.824  1.00 72.92 ? 598 ARG B CB  1 
ATOM   4818 C CG  . ARG B 1 280 ? -17.781 24.375 -2.489  1.00 75.87 ? 598 ARG B CG  1 
ATOM   4819 C CD  . ARG B 1 280 ? -17.132 25.237 -3.595  1.00 81.80 ? 598 ARG B CD  1 
ATOM   4820 N NE  . ARG B 1 280 ? -17.180 24.628 -4.934  1.00 83.86 ? 598 ARG B NE  1 
ATOM   4821 C CZ  . ARG B 1 280 ? -17.055 25.299 -6.082  1.00 83.46 ? 598 ARG B CZ  1 
ATOM   4822 N NH1 . ARG B 1 280 ? -16.880 26.614 -6.083  1.00 83.44 ? 598 ARG B NH1 1 
ATOM   4823 N NH2 . ARG B 1 280 ? -17.113 24.654 -7.239  1.00 83.86 ? 598 ARG B NH2 1 
ATOM   4824 N N   . ARG B 1 281 ? -15.993 20.525 -0.277  1.00 71.91 ? 599 ARG B N   1 
ATOM   4825 C CA  . ARG B 1 281 ? -15.319 19.247 -0.482  1.00 71.44 ? 599 ARG B CA  1 
ATOM   4826 C C   . ARG B 1 281 ? -15.779 18.175 0.493   1.00 70.88 ? 599 ARG B C   1 
ATOM   4827 O O   . ARG B 1 281 ? -14.974 17.356 0.934   1.00 70.31 ? 599 ARG B O   1 
ATOM   4828 C CB  . ARG B 1 281 ? -13.810 19.427 -0.327  1.00 71.68 ? 599 ARG B CB  1 
ATOM   4829 C CG  . ARG B 1 281 ? -13.265 20.650 -1.030  1.00 74.36 ? 599 ARG B CG  1 
ATOM   4830 C CD  . ARG B 1 281 ? -11.750 20.781 -0.877  1.00 78.60 ? 599 ARG B CD  1 
ATOM   4831 N NE  . ARG B 1 281 ? -11.034 19.551 -1.222  1.00 80.29 ? 599 ARG B NE  1 
ATOM   4832 C CZ  . ARG B 1 281 ? -9.848  19.519 -1.827  1.00 80.57 ? 599 ARG B CZ  1 
ATOM   4833 N NH1 . ARG B 1 281 ? -9.246  20.651 -2.174  1.00 81.24 ? 599 ARG B NH1 1 
ATOM   4834 N NH2 . ARG B 1 281 ? -9.268  18.354 -2.097  1.00 78.86 ? 599 ARG B NH2 1 
ATOM   4835 N N   . ILE B 1 282 ? -17.064 18.172 0.832   1.00 70.42 ? 600 ILE B N   1 
ATOM   4836 C CA  . ILE B 1 282 ? -17.551 17.281 1.886   1.00 69.54 ? 600 ILE B CA  1 
ATOM   4837 C C   . ILE B 1 282 ? -18.817 16.540 1.521   1.00 69.45 ? 600 ILE B C   1 
ATOM   4838 O O   . ILE B 1 282 ? -19.831 17.155 1.197   1.00 69.25 ? 600 ILE B O   1 
ATOM   4839 C CB  . ILE B 1 282 ? -17.832 18.051 3.191   1.00 69.51 ? 600 ILE B CB  1 
ATOM   4840 C CG1 . ILE B 1 282 ? -16.534 18.276 3.971   1.00 68.94 ? 600 ILE B CG1 1 
ATOM   4841 C CG2 . ILE B 1 282 ? -18.870 17.317 4.036   1.00 67.07 ? 600 ILE B CG2 1 
ATOM   4842 C CD1 . ILE B 1 282 ? -15.700 19.445 3.456   1.00 70.65 ? 600 ILE B CD1 1 
ATOM   4843 N N   . ASP B 1 283 ? -18.753 15.213 1.591   1.00 69.60 ? 601 ASP B N   1 
ATOM   4844 C CA  . ASP B 1 283 ? -19.945 14.389 1.438   1.00 70.27 ? 601 ASP B CA  1 
ATOM   4845 C C   . ASP B 1 283 ? -20.660 14.229 2.775   1.00 70.27 ? 601 ASP B C   1 
ATOM   4846 O O   . ASP B 1 283 ? -20.236 13.459 3.637   1.00 69.46 ? 601 ASP B O   1 
ATOM   4847 C CB  . ASP B 1 283 ? -19.625 13.012 0.850   1.00 70.14 ? 601 ASP B CB  1 
ATOM   4848 C CG  . ASP B 1 283 ? -20.880 12.204 0.575   1.00 71.60 ? 601 ASP B CG  1 
ATOM   4849 O OD1 . ASP B 1 283 ? -21.883 12.814 0.148   1.00 74.69 ? 601 ASP B OD1 1 
ATOM   4850 O OD2 . ASP B 1 283 ? -20.885 10.975 0.788   1.00 71.81 ? 601 ASP B OD2 1 
ATOM   4851 N N   . TRP B 1 284 ? -21.759 14.954 2.927   1.00 70.99 ? 602 TRP B N   1 
ATOM   4852 C CA  . TRP B 1 284 ? -22.499 14.981 4.178   1.00 71.87 ? 602 TRP B CA  1 
ATOM   4853 C C   . TRP B 1 284 ? -23.135 13.652 4.564   1.00 71.91 ? 602 TRP B C   1 
ATOM   4854 O O   . TRP B 1 284 ? -23.546 13.474 5.706   1.00 72.65 ? 602 TRP B O   1 
ATOM   4855 C CB  . TRP B 1 284 ? -23.533 16.109 4.157   1.00 72.30 ? 602 TRP B CB  1 
ATOM   4856 C CG  . TRP B 1 284 ? -22.875 17.441 4.204   1.00 74.27 ? 602 TRP B CG  1 
ATOM   4857 C CD1 . TRP B 1 284 ? -22.388 18.156 3.148   1.00 75.72 ? 602 TRP B CD1 1 
ATOM   4858 C CD2 . TRP B 1 284 ? -22.589 18.208 5.375   1.00 75.71 ? 602 TRP B CD2 1 
ATOM   4859 N NE1 . TRP B 1 284 ? -21.831 19.329 3.589   1.00 76.64 ? 602 TRP B NE1 1 
ATOM   4860 C CE2 . TRP B 1 284 ? -21.942 19.385 4.955   1.00 77.05 ? 602 TRP B CE2 1 
ATOM   4861 C CE3 . TRP B 1 284 ? -22.826 18.019 6.738   1.00 73.80 ? 602 TRP B CE3 1 
ATOM   4862 C CZ2 . TRP B 1 284 ? -21.531 20.370 5.852   1.00 76.37 ? 602 TRP B CZ2 1 
ATOM   4863 C CZ3 . TRP B 1 284 ? -22.412 18.992 7.623   1.00 74.48 ? 602 TRP B CZ3 1 
ATOM   4864 C CH2 . TRP B 1 284 ? -21.772 20.153 7.178   1.00 75.24 ? 602 TRP B CH2 1 
ATOM   4865 N N   . GLU B 1 285 ? -23.207 12.713 3.629   1.00 71.50 ? 603 GLU B N   1 
ATOM   4866 C CA  . GLU B 1 285 ? -23.640 11.369 3.979   1.00 70.89 ? 603 GLU B CA  1 
ATOM   4867 C C   . GLU B 1 285 ? -22.484 10.590 4.601   1.00 70.60 ? 603 GLU B C   1 
ATOM   4868 O O   . GLU B 1 285 ? -22.657 9.944  5.631   1.00 70.32 ? 603 GLU B O   1 
ATOM   4869 C CB  . GLU B 1 285 ? -24.215 10.637 2.769   1.00 70.75 ? 603 GLU B CB  1 
ATOM   4870 C CG  . GLU B 1 285 ? -25.674 10.960 2.508   1.00 71.05 ? 603 GLU B CG  1 
ATOM   4871 C CD  . GLU B 1 285 ? -26.209 10.287 1.259   1.00 71.81 ? 603 GLU B CD  1 
ATOM   4872 O OE1 . GLU B 1 285 ? -26.226 9.039  1.213   1.00 71.67 ? 603 GLU B OE1 1 
ATOM   4873 O OE2 . GLU B 1 285 ? -26.622 11.006 0.323   1.00 71.38 ? 603 GLU B OE2 1 
ATOM   4874 N N   . LYS B 1 286 ? -21.306 10.678 3.981   1.00 70.71 ? 604 LYS B N   1 
ATOM   4875 C CA  . LYS B 1 286 ? -20.095 9.992  4.464   1.00 70.55 ? 604 LYS B CA  1 
ATOM   4876 C C   . LYS B 1 286 ? -19.641 10.511 5.825   1.00 69.63 ? 604 LYS B C   1 
ATOM   4877 O O   . LYS B 1 286 ? -19.033 9.781  6.607   1.00 69.54 ? 604 LYS B O   1 
ATOM   4878 C CB  . LYS B 1 286 ? -18.937 10.163 3.474   1.00 71.13 ? 604 LYS B CB  1 
ATOM   4879 C CG  . LYS B 1 286 ? -19.032 9.361  2.190   1.00 72.67 ? 604 LYS B CG  1 
ATOM   4880 C CD  . LYS B 1 286 ? -18.068 9.913  1.133   1.00 74.05 ? 604 LYS B CD  1 
ATOM   4881 C CE  . LYS B 1 286 ? -18.383 9.363  -0.260  1.00 73.97 ? 604 LYS B CE  1 
ATOM   4882 N NZ  . LYS B 1 286 ? -17.801 10.193 -1.354  1.00 72.96 ? 604 LYS B NZ  1 
ATOM   4883 N N   . LEU B 1 287 ? -19.917 11.784 6.081   1.00 68.65 ? 605 LEU B N   1 
ATOM   4884 C CA  . LEU B 1 287 ? -19.583 12.416 7.345   1.00 67.59 ? 605 LEU B CA  1 
ATOM   4885 C C   . LEU B 1 287 ? -20.428 11.814 8.443   1.00 67.46 ? 605 LEU B C   1 
ATOM   4886 O O   . LEU B 1 287 ? -19.943 11.053 9.286   1.00 67.65 ? 605 LEU B O   1 
ATOM   4887 C CB  . LEU B 1 287 ? -19.885 13.908 7.271   1.00 67.40 ? 605 LEU B CB  1 
ATOM   4888 C CG  . LEU B 1 287 ? -19.335 14.744 8.417   1.00 67.11 ? 605 LEU B CG  1 
ATOM   4889 C CD1 . LEU B 1 287 ? -17.887 15.064 8.149   1.00 68.79 ? 605 LEU B CD1 1 
ATOM   4890 C CD2 . LEU B 1 287 ? -20.130 16.015 8.587   1.00 67.33 ? 605 LEU B CD2 1 
ATOM   4891 N N   . GLU B 1 288 ? -21.709 12.163 8.414   1.00 67.10 ? 606 GLU B N   1 
ATOM   4892 C CA  . GLU B 1 288 ? -22.640 11.762 9.454   1.00 67.21 ? 606 GLU B CA  1 
ATOM   4893 C C   . GLU B 1 288 ? -22.736 10.253 9.585   1.00 67.01 ? 606 GLU B C   1 
ATOM   4894 O O   . GLU B 1 288 ? -23.668 9.733  10.189  1.00 67.33 ? 606 GLU B O   1 
ATOM   4895 C CB  . GLU B 1 288 ? -24.022 12.393 9.230   1.00 67.46 ? 606 GLU B CB  1 
ATOM   4896 C CG  . GLU B 1 288 ? -24.676 12.075 7.899   1.00 67.23 ? 606 GLU B CG  1 
ATOM   4897 C CD  . GLU B 1 288 ? -25.998 12.804 7.712   1.00 67.71 ? 606 GLU B CD  1 
ATOM   4898 O OE1 . GLU B 1 288 ? -26.768 12.928 8.689   1.00 68.26 ? 606 GLU B OE1 1 
ATOM   4899 O OE2 . GLU B 1 288 ? -26.275 13.253 6.583   1.00 68.95 ? 606 GLU B OE2 1 
ATOM   4900 N N   . ASN B 1 289 ? -21.752 9.558  9.029   1.00 66.86 ? 607 ASN B N   1 
ATOM   4901 C CA  . ASN B 1 289 ? -21.691 8.112  9.103   1.00 66.89 ? 607 ASN B CA  1 
ATOM   4902 C C   . ASN B 1 289 ? -20.310 7.667  9.502   1.00 66.93 ? 607 ASN B C   1 
ATOM   4903 O O   . ASN B 1 289 ? -19.952 6.494  9.358   1.00 66.66 ? 607 ASN B O   1 
ATOM   4904 C CB  . ASN B 1 289 ? -22.076 7.492  7.765   1.00 67.12 ? 607 ASN B CB  1 
ATOM   4905 C CG  . ASN B 1 289 ? -23.553 7.193  7.677   1.00 67.76 ? 607 ASN B CG  1 
ATOM   4906 O OD1 . ASN B 1 289 ? -24.292 7.870  6.962   1.00 65.24 ? 607 ASN B OD1 1 
ATOM   4907 N ND2 . ASN B 1 289 ? -24.001 6.185  8.431   1.00 67.74 ? 607 ASN B ND2 1 
ATOM   4908 N N   . ARG B 1 290 ? -19.532 8.626  9.989   1.00 67.18 ? 608 ARG B N   1 
ATOM   4909 C CA  . ARG B 1 290 ? -18.200 8.353  10.510  1.00 68.00 ? 608 ARG B CA  1 
ATOM   4910 C C   . ARG B 1 290 ? -17.337 7.598  9.506   1.00 67.21 ? 608 ARG B C   1 
ATOM   4911 O O   . ARG B 1 290 ? -16.427 6.866  9.887   1.00 66.95 ? 608 ARG B O   1 
ATOM   4912 C CB  . ARG B 1 290 ? -18.295 7.573  11.825  1.00 68.65 ? 608 ARG B CB  1 
ATOM   4913 C CG  . ARG B 1 290 ? -19.328 8.139  12.798  1.00 70.87 ? 608 ARG B CG  1 
ATOM   4914 C CD  . ARG B 1 290 ? -19.134 7.606  14.201  1.00 72.28 ? 608 ARG B CD  1 
ATOM   4915 N NE  . ARG B 1 290 ? -17.810 7.933  14.699  1.00 74.18 ? 608 ARG B NE  1 
ATOM   4916 C CZ  . ARG B 1 290 ? -17.404 7.682  15.933  1.00 77.25 ? 608 ARG B CZ  1 
ATOM   4917 N NH1 . ARG B 1 290 ? -18.231 7.103  16.797  1.00 76.71 ? 608 ARG B NH1 1 
ATOM   4918 N NH2 . ARG B 1 290 ? -16.171 8.011  16.295  1.00 79.31 ? 608 ARG B NH2 1 
ATOM   4919 N N   . GLU B 1 291 ? -17.634 7.782  8.224   1.00 66.70 ? 609 GLU B N   1 
ATOM   4920 C CA  . GLU B 1 291 ? -16.868 7.149  7.155   1.00 65.99 ? 609 GLU B CA  1 
ATOM   4921 C C   . GLU B 1 291 ? -15.678 8.007  6.751   1.00 64.76 ? 609 GLU B C   1 
ATOM   4922 O O   . GLU B 1 291 ? -14.584 7.490  6.564   1.00 64.97 ? 609 GLU B O   1 
ATOM   4923 C CB  . GLU B 1 291 ? -17.754 6.859  5.937   1.00 66.27 ? 609 GLU B CB  1 
ATOM   4924 C CG  . GLU B 1 291 ? -18.757 5.728  6.153   1.00 66.87 ? 609 GLU B CG  1 
ATOM   4925 C CD  . GLU B 1 291 ? -19.934 5.811  5.205   1.00 66.83 ? 609 GLU B CD  1 
ATOM   4926 O OE1 . GLU B 1 291 ? -19.739 6.236  4.050   1.00 68.56 ? 609 GLU B OE1 1 
ATOM   4927 O OE2 . GLU B 1 291 ? -21.057 5.454  5.614   1.00 66.09 ? 609 GLU B OE2 1 
ATOM   4928 N N   . ILE B 1 292 ? -15.889 9.314  6.625   1.00 63.09 ? 610 ILE B N   1 
ATOM   4929 C CA  . ILE B 1 292 ? -14.814 10.217 6.243   1.00 61.76 ? 610 ILE B CA  1 
ATOM   4930 C C   . ILE B 1 292 ? -13.690 10.150 7.246   1.00 61.93 ? 610 ILE B C   1 
ATOM   4931 O O   . ILE B 1 292 ? -13.805 10.670 8.351   1.00 61.49 ? 610 ILE B O   1 
ATOM   4932 C CB  . ILE B 1 292 ? -15.288 11.659 6.175   1.00 61.81 ? 610 ILE B CB  1 
ATOM   4933 C CG1 . ILE B 1 292 ? -16.574 11.736 5.362   1.00 60.83 ? 610 ILE B CG1 1 
ATOM   4934 C CG2 . ILE B 1 292 ? -14.190 12.547 5.593   1.00 59.96 ? 610 ILE B CG2 1 
ATOM   4935 C CD1 . ILE B 1 292 ? -16.990 13.124 5.017   1.00 61.02 ? 610 ILE B CD1 1 
ATOM   4936 N N   . GLN B 1 293 ? -12.599 9.511  6.848   1.00 62.38 ? 611 GLN B N   1 
ATOM   4937 C CA  . GLN B 1 293 ? -11.474 9.291  7.741   1.00 62.97 ? 611 GLN B CA  1 
ATOM   4938 C C   . GLN B 1 293 ? -11.044 10.628 8.307   1.00 62.21 ? 611 GLN B C   1 
ATOM   4939 O O   . GLN B 1 293 ? -10.960 11.611 7.575   1.00 61.56 ? 611 GLN B O   1 
ATOM   4940 C CB  . GLN B 1 293 ? -10.322 8.613  6.998   1.00 63.74 ? 611 GLN B CB  1 
ATOM   4941 C CG  . GLN B 1 293 ? -9.431  7.746  7.875   1.00 66.80 ? 611 GLN B CG  1 
ATOM   4942 C CD  . GLN B 1 293 ? -8.217  7.231  7.131   1.00 71.04 ? 611 GLN B CD  1 
ATOM   4943 O OE1 . GLN B 1 293 ? -8.336  6.511  6.135   1.00 71.68 ? 611 GLN B OE1 1 
ATOM   4944 N NE2 . GLN B 1 293 ? -7.033  7.595  7.614   1.00 73.53 ? 611 GLN B NE2 1 
ATOM   4945 N N   . PRO B 1 294 ? -10.787 10.672 9.624   1.00 62.47 ? 612 PRO B N   1 
ATOM   4946 C CA  . PRO B 1 294 ? -10.569 11.938 10.324  1.00 62.11 ? 612 PRO B CA  1 
ATOM   4947 C C   . PRO B 1 294 ? -9.122  12.443 10.316  1.00 61.59 ? 612 PRO B C   1 
ATOM   4948 O O   . PRO B 1 294 ? -8.194  11.668 10.543  1.00 61.52 ? 612 PRO B O   1 
ATOM   4949 C CB  . PRO B 1 294 ? -11.026 11.629 11.758  1.00 61.47 ? 612 PRO B CB  1 
ATOM   4950 C CG  . PRO B 1 294 ? -10.988 10.127 11.885  1.00 62.32 ? 612 PRO B CG  1 
ATOM   4951 C CD  . PRO B 1 294 ? -10.721 9.518  10.537  1.00 62.24 ? 612 PRO B CD  1 
ATOM   4952 N N   . PRO B 1 295 ? -8.942  13.748 10.070  1.00 60.92 ? 613 PRO B N   1 
ATOM   4953 C CA  . PRO B 1 295 ? -7.685  14.450 10.144  1.00 61.03 ? 613 PRO B CA  1 
ATOM   4954 C C   . PRO B 1 295 ? -6.579  13.673 10.837  1.00 61.38 ? 613 PRO B C   1 
ATOM   4955 O O   . PRO B 1 295 ? -5.612  13.293 10.192  1.00 61.20 ? 613 PRO B O   1 
ATOM   4956 C CB  . PRO B 1 295 ? -8.063  15.689 10.951  1.00 60.73 ? 613 PRO B CB  1 
ATOM   4957 C CG  . PRO B 1 295 ? -9.502  15.976 10.501  1.00 60.51 ? 613 PRO B CG  1 
ATOM   4958 C CD  . PRO B 1 295 ? -10.039 14.704 9.859   1.00 60.77 ? 613 PRO B CD  1 
ATOM   4959 N N   . PHE B 1 296 ? -6.711  13.438 12.136  1.00 62.71 ? 614 PHE B N   1 
ATOM   4960 C CA  . PHE B 1 296 ? -5.671  12.719 12.861  1.00 63.01 ? 614 PHE B CA  1 
ATOM   4961 C C   . PHE B 1 296 ? -6.198  11.929 14.057  1.00 62.68 ? 614 PHE B C   1 
ATOM   4962 O O   . PHE B 1 296 ? -7.222  12.279 14.644  1.00 62.30 ? 614 PHE B O   1 
ATOM   4963 C CB  . PHE B 1 296 ? -4.560  13.679 13.288  1.00 63.49 ? 614 PHE B CB  1 
ATOM   4964 C CG  . PHE B 1 296 ? -4.738  14.245 14.661  1.00 66.33 ? 614 PHE B CG  1 
ATOM   4965 C CD1 . PHE B 1 296 ? -3.894  13.858 15.693  1.00 67.45 ? 614 PHE B CD1 1 
ATOM   4966 C CD2 . PHE B 1 296 ? -5.737  15.168 14.921  1.00 69.03 ? 614 PHE B CD2 1 
ATOM   4967 C CE1 . PHE B 1 296 ? -4.038  14.377 16.962  1.00 69.72 ? 614 PHE B CE1 1 
ATOM   4968 C CE2 . PHE B 1 296 ? -5.891  15.696 16.191  1.00 72.83 ? 614 PHE B CE2 1 
ATOM   4969 C CZ  . PHE B 1 296 ? -5.035  15.296 17.218  1.00 72.43 ? 614 PHE B CZ  1 
ATOM   4970 N N   . LYS B 1 297 ? -5.477  10.858 14.391  1.00 62.82 ? 615 LYS B N   1 
ATOM   4971 C CA  . LYS B 1 297 ? -5.820  9.936  15.478  1.00 62.42 ? 615 LYS B CA  1 
ATOM   4972 C C   . LYS B 1 297 ? -5.003  10.284 16.722  1.00 62.97 ? 615 LYS B C   1 
ATOM   4973 O O   . LYS B 1 297 ? -3.809  10.010 16.784  1.00 62.95 ? 615 LYS B O   1 
ATOM   4974 C CB  . LYS B 1 297 ? -5.566  8.486  15.029  1.00 61.43 ? 615 LYS B CB  1 
ATOM   4975 C CG  . LYS B 1 297 ? -5.667  7.427  16.113  1.00 57.15 ? 615 LYS B CG  1 
ATOM   4976 C CD  . LYS B 1 297 ? -5.793  6.046  15.503  1.00 52.00 ? 615 LYS B CD  1 
ATOM   4977 C CE  . LYS B 1 297 ? -5.669  4.969  16.565  1.00 52.00 ? 615 LYS B CE  1 
ATOM   4978 N NZ  . LYS B 1 297 ? -5.934  3.625  16.012  1.00 48.45 ? 615 LYS B NZ  1 
ATOM   4979 N N   . PRO B 1 298 ? -5.652  10.886 17.726  1.00 63.70 ? 616 PRO B N   1 
ATOM   4980 C CA  . PRO B 1 298 ? -4.903  11.477 18.836  1.00 64.73 ? 616 PRO B CA  1 
ATOM   4981 C C   . PRO B 1 298 ? -4.085  10.466 19.637  1.00 65.50 ? 616 PRO B C   1 
ATOM   4982 O O   . PRO B 1 298 ? -4.293  9.258  19.524  1.00 64.98 ? 616 PRO B O   1 
ATOM   4983 C CB  . PRO B 1 298 ? -5.991  12.121 19.706  1.00 64.53 ? 616 PRO B CB  1 
ATOM   4984 C CG  . PRO B 1 298 ? -7.252  11.420 19.341  1.00 64.31 ? 616 PRO B CG  1 
ATOM   4985 C CD  . PRO B 1 298 ? -7.111  10.932 17.929  1.00 63.26 ? 616 PRO B CD  1 
ATOM   4986 N N   . LYS B 1 299 ? -3.153  10.977 20.432  1.00 67.05 ? 617 LYS B N   1 
ATOM   4987 C CA  . LYS B 1 299 ? -2.266  10.147 21.229  1.00 68.68 ? 617 LYS B CA  1 
ATOM   4988 C C   . LYS B 1 299 ? -3.068  9.189  22.102  1.00 69.81 ? 617 LYS B C   1 
ATOM   4989 O O   . LYS B 1 299 ? -4.106  9.563  22.658  1.00 70.49 ? 617 LYS B O   1 
ATOM   4990 C CB  . LYS B 1 299 ? -1.357  11.028 22.097  1.00 69.11 ? 617 LYS B CB  1 
ATOM   4991 C CG  . LYS B 1 299 ? -0.357  10.266 22.976  1.00 70.79 ? 617 LYS B CG  1 
ATOM   4992 C CD  . LYS B 1 299 ? 0.530   11.207 23.798  1.00 70.93 ? 617 LYS B CD  1 
ATOM   4993 C CE  . LYS B 1 299 ? 1.772   10.487 24.321  1.00 70.69 ? 617 LYS B CE  1 
ATOM   4994 N NZ  . LYS B 1 299 ? 2.812   11.447 24.789  1.00 69.94 ? 617 LYS B NZ  1 
ATOM   4995 N N   . VAL B 1 300 ? -2.574  7.953  22.210  1.00 70.53 ? 618 VAL B N   1 
ATOM   4996 C CA  . VAL B 1 300 ? -3.191  6.892  23.018  1.00 69.86 ? 618 VAL B CA  1 
ATOM   4997 C C   . VAL B 1 300 ? -2.978  7.099  24.521  1.00 69.56 ? 618 VAL B C   1 
ATOM   4998 O O   . VAL B 1 300 ? -3.774  7.761  25.192  1.00 69.26 ? 618 VAL B O   1 
ATOM   4999 C CB  . VAL B 1 300 ? -2.621  5.513  22.630  1.00 69.79 ? 618 VAL B CB  1 
ATOM   5000 C CG1 . VAL B 1 300 ? -3.287  4.410  23.445  1.00 68.25 ? 618 VAL B CG1 1 
ATOM   5001 C CG2 . VAL B 1 300 ? -2.766  5.277  21.116  1.00 68.68 ? 618 VAL B CG2 1 
ATOM   5002 N N   . PHE B 1 308 ? 2.761   2.204  40.201  1.00 50.32 ? 626 PHE B N   1 
ATOM   5003 C CA  . PHE B 1 308 ? 3.323   3.145  39.261  1.00 50.23 ? 626 PHE B CA  1 
ATOM   5004 C C   . PHE B 1 308 ? 4.524   3.761  39.985  1.00 49.09 ? 626 PHE B C   1 
ATOM   5005 O O   . PHE B 1 308 ? 5.668   3.363  39.754  1.00 48.87 ? 626 PHE B O   1 
ATOM   5006 C CB  . PHE B 1 308 ? 2.284   4.225  38.892  1.00 51.26 ? 626 PHE B CB  1 
ATOM   5007 C CG  . PHE B 1 308 ? 2.179   4.517  37.400  1.00 55.10 ? 626 PHE B CG  1 
ATOM   5008 C CD1 . PHE B 1 308 ? 1.073   5.206  36.892  1.00 56.85 ? 626 PHE B CD1 1 
ATOM   5009 C CD2 . PHE B 1 308 ? 3.165   4.092  36.505  1.00 56.91 ? 626 PHE B CD2 1 
ATOM   5010 C CE1 . PHE B 1 308 ? 0.960   5.485  35.520  1.00 56.93 ? 626 PHE B CE1 1 
ATOM   5011 C CE2 . PHE B 1 308 ? 3.057   4.362  35.132  1.00 57.09 ? 626 PHE B CE2 1 
ATOM   5012 C CZ  . PHE B 1 308 ? 1.952   5.059  34.643  1.00 57.41 ? 626 PHE B CZ  1 
ATOM   5013 N N   . ASP B 1 309 ? 4.238   4.696  40.896  1.00 46.46 ? 627 ASP B N   1 
ATOM   5014 C CA  . ASP B 1 309 ? 5.254   5.444  41.650  1.00 42.19 ? 627 ASP B CA  1 
ATOM   5015 C C   . ASP B 1 309 ? 5.199   5.071  43.144  1.00 40.13 ? 627 ASP B C   1 
ATOM   5016 O O   . ASP B 1 309 ? 4.178   5.277  43.795  1.00 40.78 ? 627 ASP B O   1 
ATOM   5017 C CB  . ASP B 1 309 ? 5.017   6.943  41.438  1.00 41.36 ? 627 ASP B CB  1 
ATOM   5018 C CG  . ASP B 1 309 ? 5.824   7.808  42.372  1.00 38.10 ? 627 ASP B CG  1 
ATOM   5019 O OD1 . ASP B 1 309 ? 6.552   7.275  43.227  1.00 34.43 ? 627 ASP B OD1 1 
ATOM   5020 O OD2 . ASP B 1 309 ? 5.730   9.042  42.239  1.00 41.64 ? 627 ASP B OD2 1 
ATOM   5021 N N   . LYS B 1 310 ? 6.292   4.530  43.686  1.00 36.40 ? 628 LYS B N   1 
ATOM   5022 C CA  . LYS B 1 310 ? 6.278   3.931  45.037  1.00 32.87 ? 628 LYS B CA  1 
ATOM   5023 C C   . LYS B 1 310 ? 6.313   4.938  46.183  1.00 29.55 ? 628 LYS B C   1 
ATOM   5024 O O   . LYS B 1 310 ? 6.400   4.561  47.341  1.00 28.19 ? 628 LYS B O   1 
ATOM   5025 C CB  . LYS B 1 310 ? 7.485   3.015  45.190  1.00 32.26 ? 628 LYS B CB  1 
ATOM   5026 C CG  . LYS B 1 310 ? 8.228   2.827  43.887  1.00 37.69 ? 628 LYS B CG  1 
ATOM   5027 C CD  . LYS B 1 310 ? 9.716   2.574  44.107  1.00 41.51 ? 628 LYS B CD  1 
ATOM   5028 C CE  . LYS B 1 310 ? 9.965   1.221  44.757  1.00 38.04 ? 628 LYS B CE  1 
ATOM   5029 N NZ  . LYS B 1 310 ? 11.409  1.045  45.032  1.00 39.27 ? 628 LYS B NZ  1 
ATOM   5030 N N   . PHE B 1 311 ? 6.273   6.219  45.860  1.00 27.50 ? 629 PHE B N   1 
ATOM   5031 C CA  . PHE B 1 311 ? 6.642   7.238  46.819  1.00 26.44 ? 629 PHE B CA  1 
ATOM   5032 C C   . PHE B 1 311 ? 5.523   8.236  46.995  1.00 28.43 ? 629 PHE B C   1 
ATOM   5033 O O   . PHE B 1 311 ? 5.427   8.912  48.022  1.00 30.42 ? 629 PHE B O   1 
ATOM   5034 C CB  . PHE B 1 311 ? 7.927   7.952  46.373  1.00 24.55 ? 629 PHE B CB  1 
ATOM   5035 C CG  . PHE B 1 311 ? 9.160   7.075  46.420  1.00 21.39 ? 629 PHE B CG  1 
ATOM   5036 C CD1 . PHE B 1 311 ? 9.472   6.342  47.567  1.00 19.71 ? 629 PHE B CD1 1 
ATOM   5037 C CD2 . PHE B 1 311 ? 9.997   6.976  45.329  1.00 17.39 ? 629 PHE B CD2 1 
ATOM   5038 C CE1 . PHE B 1 311 ? 10.589  5.528  47.617  1.00 15.23 ? 629 PHE B CE1 1 
ATOM   5039 C CE2 . PHE B 1 311 ? 11.112  6.173  45.380  1.00 17.03 ? 629 PHE B CE2 1 
ATOM   5040 C CZ  . PHE B 1 311 ? 11.408  5.450  46.526  1.00 17.40 ? 629 PHE B CZ  1 
ATOM   5041 N N   . PHE B 1 312 ? 4.688   8.336  45.969  1.00 28.31 ? 630 PHE B N   1 
ATOM   5042 C CA  . PHE B 1 312 ? 3.548   9.211  45.980  1.00 27.95 ? 630 PHE B CA  1 
ATOM   5043 C C   . PHE B 1 312 ? 2.384   8.462  45.333  1.00 30.30 ? 630 PHE B C   1 
ATOM   5044 O O   . PHE B 1 312 ? 2.515   7.870  44.258  1.00 31.38 ? 630 PHE B O   1 
ATOM   5045 C CB  . PHE B 1 312 ? 3.852   10.497 45.210  1.00 26.56 ? 630 PHE B CB  1 
ATOM   5046 C CG  . PHE B 1 312 ? 2.616   11.214 44.716  1.00 26.28 ? 630 PHE B CG  1 
ATOM   5047 C CD1 . PHE B 1 312 ? 2.210   11.104 43.398  1.00 25.29 ? 630 PHE B CD1 1 
ATOM   5048 C CD2 . PHE B 1 312 ? 1.848   11.984 45.581  1.00 23.36 ? 630 PHE B CD2 1 
ATOM   5049 C CE1 . PHE B 1 312 ? 1.058   11.751 42.950  1.00 22.06 ? 630 PHE B CE1 1 
ATOM   5050 C CE2 . PHE B 1 312 ? 0.707   12.631 45.143  1.00 20.75 ? 630 PHE B CE2 1 
ATOM   5051 C CZ  . PHE B 1 312 ? 0.311   12.512 43.822  1.00 23.42 ? 630 PHE B CZ  1 
ATOM   5052 N N   . THR B 1 313 ? 1.241   8.453  46.000  1.00 31.75 ? 631 THR B N   1 
ATOM   5053 C CA  . THR B 1 313 ? 0.041   7.996  45.338  1.00 31.40 ? 631 THR B CA  1 
ATOM   5054 C C   . THR B 1 313 ? -0.958  9.130  45.336  1.00 32.79 ? 631 THR B C   1 
ATOM   5055 O O   . THR B 1 313 ? -0.711  10.184 45.885  1.00 34.87 ? 631 THR B O   1 
ATOM   5056 C CB  . THR B 1 313 ? -0.556  6.746  45.972  1.00 30.04 ? 631 THR B CB  1 
ATOM   5057 O OG1 . THR B 1 313 ? -1.858  6.548  45.422  1.00 28.21 ? 631 THR B OG1 1 
ATOM   5058 C CG2 . THR B 1 313 ? -0.657  6.903  47.469  1.00 28.55 ? 631 THR B CG2 1 
ATOM   5059 N N   . ARG B 1 314 ? -2.083  8.931  44.690  1.00 33.88 ? 632 ARG B N   1 
ATOM   5060 C CA  . ARG B 1 314 ? -3.062  9.979  44.623  1.00 33.96 ? 632 ARG B CA  1 
ATOM   5061 C C   . ARG B 1 314 ? -4.254  9.403  45.355  1.00 33.70 ? 632 ARG B C   1 
ATOM   5062 O O   . ARG B 1 314 ? -5.226  10.089 45.650  1.00 33.45 ? 632 ARG B O   1 
ATOM   5063 C CB  . ARG B 1 314 ? -3.370  10.285 43.166  1.00 33.05 ? 632 ARG B CB  1 
ATOM   5064 C CG  . ARG B 1 314 ? -3.956  11.642 42.952  1.00 39.06 ? 632 ARG B CG  1 
ATOM   5065 C CD  . ARG B 1 314 ? -3.629  12.172 41.553  1.00 45.45 ? 632 ARG B CD  1 
ATOM   5066 N NE  . ARG B 1 314 ? -2.469  13.056 41.556  1.00 46.77 ? 632 ARG B NE  1 
ATOM   5067 C CZ  . ARG B 1 314 ? -1.902  13.538 40.459  1.00 49.30 ? 632 ARG B CZ  1 
ATOM   5068 N NH1 . ARG B 1 314 ? -2.394  13.201 39.272  1.00 50.63 ? 632 ARG B NH1 1 
ATOM   5069 N NH2 . ARG B 1 314 ? -0.845  14.345 40.549  1.00 49.24 ? 632 ARG B NH2 1 
ATOM   5070 N N   . GLY B 1 315 ? -4.154  8.119  45.665  1.00 33.38 ? 633 GLY B N   1 
ATOM   5071 C CA  . GLY B 1 315 ? -5.202  7.452  46.399  1.00 35.15 ? 633 GLY B CA  1 
ATOM   5072 C C   . GLY B 1 315 ? -6.358  6.967  45.547  1.00 36.00 ? 633 GLY B C   1 
ATOM   5073 O O   . GLY B 1 315 ? -6.350  7.095  44.328  1.00 35.64 ? 633 GLY B O   1 
ATOM   5074 N N   . GLN B 1 316 ? -7.347  6.380  46.209  1.00 37.17 ? 634 GLN B N   1 
ATOM   5075 C CA  . GLN B 1 316 ? -8.554  5.921  45.558  1.00 39.27 ? 634 GLN B CA  1 
ATOM   5076 C C   . GLN B 1 316 ? -9.740  6.893  45.732  1.00 39.77 ? 634 GLN B C   1 
ATOM   5077 O O   . GLN B 1 316 ? -10.044 7.322  46.856  1.00 40.36 ? 634 GLN B O   1 
ATOM   5078 C CB  . GLN B 1 316 ? -8.933  4.570  46.121  1.00 39.30 ? 634 GLN B CB  1 
ATOM   5079 C CG  . GLN B 1 316 ? -8.523  3.408  45.266  1.00 46.31 ? 634 GLN B CG  1 
ATOM   5080 C CD  . GLN B 1 316 ? -9.626  2.362  45.209  1.00 53.04 ? 634 GLN B CD  1 
ATOM   5081 O OE1 . GLN B 1 316 ? -10.660 2.585  44.578  1.00 53.62 ? 634 GLN B OE1 1 
ATOM   5082 N NE2 . GLN B 1 316 ? -9.419  1.225  45.880  1.00 52.73 ? 634 GLN B NE2 1 
ATOM   5083 N N   . PRO B 1 317 ? -10.415 7.251  44.619  1.00 39.88 ? 635 PRO B N   1 
ATOM   5084 C CA  . PRO B 1 317 ? -11.665 7.995  44.760  1.00 40.79 ? 635 PRO B CA  1 
ATOM   5085 C C   . PRO B 1 317 ? -12.708 7.153  45.502  1.00 42.15 ? 635 PRO B C   1 
ATOM   5086 O O   . PRO B 1 317 ? -13.148 6.109  45.000  1.00 42.90 ? 635 PRO B O   1 
ATOM   5087 C CB  . PRO B 1 317 ? -12.113 8.214  43.308  1.00 40.21 ? 635 PRO B CB  1 
ATOM   5088 C CG  . PRO B 1 317 ? -10.922 7.980  42.489  1.00 37.85 ? 635 PRO B CG  1 
ATOM   5089 C CD  . PRO B 1 317 ? -10.098 6.977  43.208  1.00 38.60 ? 635 PRO B CD  1 
ATOM   5090 N N   . VAL B 1 318 ? -13.082 7.574  46.701  1.00 43.31 ? 636 VAL B N   1 
ATOM   5091 C CA  . VAL B 1 318 ? -14.189 6.917  47.382  1.00 44.17 ? 636 VAL B CA  1 
ATOM   5092 C C   . VAL B 1 318 ? -15.297 7.945  47.558  1.00 45.59 ? 636 VAL B C   1 
ATOM   5093 O O   . VAL B 1 318 ? -15.080 9.131  47.300  1.00 45.06 ? 636 VAL B O   1 
ATOM   5094 C CB  . VAL B 1 318 ? -13.776 6.336  48.742  1.00 43.67 ? 636 VAL B CB  1 
ATOM   5095 C CG1 . VAL B 1 318 ? -12.825 5.140  48.554  1.00 40.20 ? 636 VAL B CG1 1 
ATOM   5096 C CG2 . VAL B 1 318 ? -13.175 7.418  49.593  1.00 40.78 ? 636 VAL B CG2 1 
ATOM   5097 N N   . LEU B 1 319 ? -16.483 7.492  47.965  1.00 47.51 ? 637 LEU B N   1 
ATOM   5098 C CA  . LEU B 1 319 ? -17.564 8.426  48.292  1.00 49.62 ? 637 LEU B CA  1 
ATOM   5099 C C   . LEU B 1 319 ? -17.736 8.572  49.807  1.00 50.34 ? 637 LEU B C   1 
ATOM   5100 O O   . LEU B 1 319 ? -17.651 7.579  50.553  1.00 48.93 ? 637 LEU B O   1 
ATOM   5101 C CB  . LEU B 1 319 ? -18.875 8.008  47.618  1.00 50.09 ? 637 LEU B CB  1 
ATOM   5102 C CG  . LEU B 1 319 ? -18.827 8.008  46.086  1.00 52.34 ? 637 LEU B CG  1 
ATOM   5103 C CD1 . LEU B 1 319 ? -19.746 6.946  45.511  1.00 56.63 ? 637 LEU B CD1 1 
ATOM   5104 C CD2 . LEU B 1 319 ? -19.155 9.378  45.517  1.00 53.37 ? 637 LEU B CD2 1 
HETATM 5105 N N   . TPO B 1 320 ? -17.946 9.818  50.250  1.00 51.34 ? 638 TPO B N   1 
HETATM 5106 C CA  . TPO B 1 320 ? -18.195 10.111 51.658  1.00 52.34 ? 638 TPO B CA  1 
HETATM 5107 C CB  . TPO B 1 320 ? -18.559 11.550 51.936  1.00 53.13 ? 638 TPO B CB  1 
HETATM 5108 C CG2 . TPO B 1 320 ? -18.601 11.699 53.452  1.00 54.77 ? 638 TPO B CG2 1 
HETATM 5109 O OG1 . TPO B 1 320 ? -17.611 12.452 51.386  1.00 59.18 ? 638 TPO B OG1 1 
HETATM 5110 P P   . TPO B 1 320 ? -17.675 12.996 49.854  1.00 72.94 ? 638 TPO B P   1 
HETATM 5111 O O1P . TPO B 1 320 ? -17.695 11.761 48.958  1.00 64.38 ? 638 TPO B O1P 1 
HETATM 5112 O O2P . TPO B 1 320 ? -16.404 13.823 49.827  1.00 71.79 ? 638 TPO B O2P 1 
HETATM 5113 O O3P . TPO B 1 320 ? -18.899 13.882 49.684  1.00 70.71 ? 638 TPO B O3P 1 
HETATM 5114 C C   . TPO B 1 320 ? -19.467 9.450  51.981  1.00 51.06 ? 638 TPO B C   1 
HETATM 5115 O O   . TPO B 1 320 ? -20.454 9.706  51.302  1.00 50.00 ? 638 TPO B O   1 
ATOM   5116 N N   . PRO B 1 321 ? -19.489 8.626  53.041  1.00 50.79 ? 639 PRO B N   1 
ATOM   5117 C CA  . PRO B 1 321 ? -20.742 7.912  53.207  1.00 49.98 ? 639 PRO B CA  1 
ATOM   5118 C C   . PRO B 1 321 ? -21.856 8.914  53.523  1.00 48.49 ? 639 PRO B C   1 
ATOM   5119 O O   . PRO B 1 321 ? -21.585 10.106 53.812  1.00 47.98 ? 639 PRO B O   1 
ATOM   5120 C CB  . PRO B 1 321 ? -20.467 6.951  54.370  1.00 50.09 ? 639 PRO B CB  1 
ATOM   5121 C CG  . PRO B 1 321 ? -19.309 7.588  55.146  1.00 52.60 ? 639 PRO B CG  1 
ATOM   5122 C CD  . PRO B 1 321 ? -18.701 8.682  54.286  1.00 50.82 ? 639 PRO B CD  1 
ATOM   5123 N N   . PRO B 1 322 ? -23.103 8.443  53.451  1.00 46.24 ? 640 PRO B N   1 
ATOM   5124 C CA  . PRO B 1 322 ? -24.226 9.351  53.385  1.00 44.32 ? 640 PRO B CA  1 
ATOM   5125 C C   . PRO B 1 322 ? -24.311 10.058 54.708  1.00 41.24 ? 640 PRO B C   1 
ATOM   5126 O O   . PRO B 1 322 ? -23.859 9.502  55.693  1.00 43.57 ? 640 PRO B O   1 
ATOM   5127 C CB  . PRO B 1 322 ? -25.420 8.406  53.192  1.00 45.28 ? 640 PRO B CB  1 
ATOM   5128 C CG  . PRO B 1 322 ? -24.818 7.065  52.795  1.00 47.91 ? 640 PRO B CG  1 
ATOM   5129 C CD  . PRO B 1 322 ? -23.530 7.041  53.546  1.00 46.88 ? 640 PRO B CD  1 
ATOM   5130 N N   . ASP B 1 323 ? -24.837 11.275 54.739  1.00 36.85 ? 641 ASP B N   1 
ATOM   5131 C CA  . ASP B 1 323 ? -25.106 11.941 56.009  1.00 34.33 ? 641 ASP B CA  1 
ATOM   5132 C C   . ASP B 1 323 ? -26.618 11.909 56.334  1.00 33.32 ? 641 ASP B C   1 
ATOM   5133 O O   . ASP B 1 323 ? -27.424 12.579 55.687  1.00 32.92 ? 641 ASP B O   1 
ATOM   5134 C CB  . ASP B 1 323 ? -24.567 13.364 55.982  1.00 33.45 ? 641 ASP B CB  1 
ATOM   5135 C CG  . ASP B 1 323 ? -25.254 14.255 56.972  1.00 36.03 ? 641 ASP B CG  1 
ATOM   5136 O OD1 . ASP B 1 323 ? -26.017 13.725 57.811  1.00 38.89 ? 641 ASP B OD1 1 
ATOM   5137 O OD2 . ASP B 1 323 ? -25.043 15.487 56.913  1.00 39.54 ? 641 ASP B OD2 1 
ATOM   5138 N N   . GLN B 1 324 ? -27.002 11.126 57.337  1.00 31.44 ? 642 GLN B N   1 
ATOM   5139 C CA  . GLN B 1 324 ? -28.421 10.844 57.576  1.00 29.45 ? 642 GLN B CA  1 
ATOM   5140 C C   . GLN B 1 324 ? -29.368 12.061 57.662  1.00 28.13 ? 642 GLN B C   1 
ATOM   5141 O O   . GLN B 1 324 ? -30.403 12.093 56.991  1.00 28.65 ? 642 GLN B O   1 
ATOM   5142 C CB  . GLN B 1 324 ? -28.577 9.931  58.785  1.00 29.31 ? 642 GLN B CB  1 
ATOM   5143 C CG  . GLN B 1 324 ? -27.848 8.620  58.615  1.00 32.39 ? 642 GLN B CG  1 
ATOM   5144 C CD  . GLN B 1 324 ? -28.177 7.925  57.288  1.00 34.40 ? 642 GLN B CD  1 
ATOM   5145 O OE1 . GLN B 1 324 ? -29.337 7.842  56.897  1.00 35.93 ? 642 GLN B OE1 1 
ATOM   5146 N NE2 . GLN B 1 324 ? -27.152 7.417  56.600  1.00 34.01 ? 642 GLN B NE2 1 
ATOM   5147 N N   . LEU B 1 325 ? -29.006 13.060 58.461  1.00 25.18 ? 643 LEU B N   1 
ATOM   5148 C CA  . LEU B 1 325 ? -29.827 14.248 58.634  1.00 22.29 ? 643 LEU B CA  1 
ATOM   5149 C C   . LEU B 1 325 ? -30.034 15.035 57.352  1.00 22.63 ? 643 LEU B C   1 
ATOM   5150 O O   . LEU B 1 325 ? -31.047 15.705 57.181  1.00 21.69 ? 643 LEU B O   1 
ATOM   5151 C CB  . LEU B 1 325 ? -29.190 15.172 59.650  1.00 21.74 ? 643 LEU B CB  1 
ATOM   5152 C CG  . LEU B 1 325 ? -30.142 16.262 60.125  1.00 22.40 ? 643 LEU B CG  1 
ATOM   5153 C CD1 . LEU B 1 325 ? -31.228 15.617 60.982  1.00 17.01 ? 643 LEU B CD1 1 
ATOM   5154 C CD2 . LEU B 1 325 ? -29.405 17.364 60.889  1.00 23.77 ? 643 LEU B CD2 1 
ATOM   5155 N N   . VAL B 1 326 ? -29.053 14.992 56.461  1.00 23.86 ? 644 VAL B N   1 
ATOM   5156 C CA  . VAL B 1 326 ? -29.186 15.679 55.186  1.00 23.82 ? 644 VAL B CA  1 
ATOM   5157 C C   . VAL B 1 326 ? -30.121 14.909 54.262  1.00 25.06 ? 644 VAL B C   1 
ATOM   5158 O O   . VAL B 1 326 ? -30.962 15.508 53.592  1.00 26.69 ? 644 VAL B O   1 
ATOM   5159 C CB  . VAL B 1 326 ? -27.817 15.942 54.516  1.00 23.36 ? 644 VAL B CB  1 
ATOM   5160 C CG1 . VAL B 1 326 ? -27.969 16.110 52.999  1.00 18.99 ? 644 VAL B CG1 1 
ATOM   5161 C CG2 . VAL B 1 326 ? -27.205 17.156 55.124  1.00 18.83 ? 644 VAL B CG2 1 
ATOM   5162 N N   . ILE B 1 327 ? -29.984 13.586 54.267  1.00 24.78 ? 645 ILE B N   1 
ATOM   5163 C CA  . ILE B 1 327 ? -30.773 12.701 53.428  1.00 25.27 ? 645 ILE B CA  1 
ATOM   5164 C C   . ILE B 1 327 ? -32.247 12.667 53.835  1.00 25.43 ? 645 ILE B C   1 
ATOM   5165 O O   . ILE B 1 327 ? -33.132 12.658 52.995  1.00 27.10 ? 645 ILE B O   1 
ATOM   5166 C CB  . ILE B 1 327 ? -30.229 11.266 53.515  1.00 26.76 ? 645 ILE B CB  1 
ATOM   5167 C CG1 . ILE B 1 327 ? -28.872 11.167 52.829  1.00 27.16 ? 645 ILE B CG1 1 
ATOM   5168 C CG2 . ILE B 1 327 ? -31.217 10.247 52.912  1.00 25.67 ? 645 ILE B CG2 1 
ATOM   5169 C CD1 . ILE B 1 327 ? -28.232 9.802  52.999  1.00 30.26 ? 645 ILE B CD1 1 
ATOM   5170 N N   . ALA B 1 328 ? -32.524 12.616 55.126  1.00 24.08 ? 646 ALA B N   1 
ATOM   5171 C CA  . ALA B 1 328 ? -33.907 12.553 55.557  1.00 21.91 ? 646 ALA B CA  1 
ATOM   5172 C C   . ALA B 1 328 ? -34.609 13.832 55.183  1.00 20.73 ? 646 ALA B C   1 
ATOM   5173 O O   . ALA B 1 328 ? -35.827 13.915 55.266  1.00 20.52 ? 646 ALA B O   1 
ATOM   5174 C CB  . ALA B 1 328 ? -33.998 12.322 57.062  1.00 21.10 ? 646 ALA B CB  1 
ATOM   5175 N N   . ASN B 1 329 ? -33.837 14.834 54.782  1.00 20.87 ? 647 ASN B N   1 
ATOM   5176 C CA  . ASN B 1 329 ? -34.393 16.155 54.541  1.00 22.71 ? 647 ASN B CA  1 
ATOM   5177 C C   . ASN B 1 329 ? -34.306 16.621 53.095  1.00 24.81 ? 647 ASN B C   1 
ATOM   5178 O O   . ASN B 1 329 ? -34.736 17.725 52.784  1.00 26.45 ? 647 ASN B O   1 
ATOM   5179 C CB  . ASN B 1 329 ? -33.795 17.191 55.490  1.00 21.65 ? 647 ASN B CB  1 
ATOM   5180 C CG  . ASN B 1 329 ? -34.426 17.144 56.877  1.00 24.31 ? 647 ASN B CG  1 
ATOM   5181 O OD1 . ASN B 1 329 ? -35.466 17.771 57.143  1.00 25.42 ? 647 ASN B OD1 1 
ATOM   5182 N ND2 . ASN B 1 329 ? -33.794 16.406 57.773  1.00 24.45 ? 647 ASN B ND2 1 
ATOM   5183 N N   . ILE B 1 330 ? -33.767 15.770 52.220  1.00 25.60 ? 648 ILE B N   1 
ATOM   5184 C CA  . ILE B 1 330 ? -33.768 16.007 50.787  1.00 25.15 ? 648 ILE B CA  1 
ATOM   5185 C C   . ILE B 1 330 ? -35.180 15.851 50.245  1.00 25.82 ? 648 ILE B C   1 
ATOM   5186 O O   . ILE B 1 330 ? -35.881 14.903 50.593  1.00 25.38 ? 648 ILE B O   1 
ATOM   5187 C CB  . ILE B 1 330 ? -32.925 14.956 50.061  1.00 25.33 ? 648 ILE B CB  1 
ATOM   5188 C CG1 . ILE B 1 330 ? -31.524 14.873 50.641  1.00 25.95 ? 648 ILE B CG1 1 
ATOM   5189 C CG2 . ILE B 1 330 ? -32.821 15.280 48.587  1.00 28.13 ? 648 ILE B CG2 1 
ATOM   5190 C CD1 . ILE B 1 330 ? -30.492 14.485 49.614  1.00 25.76 ? 648 ILE B CD1 1 
ATOM   5191 N N   . ASP B 1 331 ? -35.591 16.784 49.388  1.00 26.18 ? 649 ASP B N   1 
ATOM   5192 C CA  . ASP B 1 331 ? -36.871 16.706 48.697  1.00 25.31 ? 649 ASP B CA  1 
ATOM   5193 C C   . ASP B 1 331 ? -36.747 15.789 47.495  1.00 25.05 ? 649 ASP B C   1 
ATOM   5194 O O   . ASP B 1 331 ? -36.544 16.260 46.378  1.00 25.65 ? 649 ASP B O   1 
ATOM   5195 C CB  . ASP B 1 331 ? -37.293 18.098 48.228  1.00 26.47 ? 649 ASP B CB  1 
ATOM   5196 C CG  . ASP B 1 331 ? -38.631 18.098 47.473  1.00 32.91 ? 649 ASP B CG  1 
ATOM   5197 O OD1 . ASP B 1 331 ? -39.084 17.014 47.035  1.00 33.57 ? 649 ASP B OD1 1 
ATOM   5198 O OD2 . ASP B 1 331 ? -39.227 19.195 47.316  1.00 36.14 ? 649 ASP B OD2 1 
ATOM   5199 N N   . GLN B 1 332 ? -36.887 14.484 47.721  1.00 24.52 ? 650 GLN B N   1 
ATOM   5200 C CA  . GLN B 1 332 ? -36.728 13.486 46.661  1.00 23.06 ? 650 GLN B CA  1 
ATOM   5201 C C   . GLN B 1 332 ? -37.560 13.730 45.383  1.00 23.90 ? 650 GLN B C   1 
ATOM   5202 O O   . GLN B 1 332 ? -37.098 13.415 44.276  1.00 25.04 ? 650 GLN B O   1 
ATOM   5203 C CB  . GLN B 1 332 ? -36.940 12.056 47.194  1.00 22.39 ? 650 GLN B CB  1 
ATOM   5204 C CG  . GLN B 1 332 ? -35.904 11.565 48.236  1.00 17.38 ? 650 GLN B CG  1 
ATOM   5205 C CD  . GLN B 1 332 ? -34.409 11.603 47.798  1.00 17.89 ? 650 GLN B CD  1 
ATOM   5206 O OE1 . GLN B 1 332 ? -34.051 11.746 46.628  1.00 13.24 ? 650 GLN B OE1 1 
ATOM   5207 N NE2 . GLN B 1 332 ? -33.539 11.469 48.774  1.00 23.29 ? 650 GLN B NE2 1 
ATOM   5208 N N   . SER B 1 333 ? -38.757 14.298 45.512  1.00 23.21 ? 651 SER B N   1 
ATOM   5209 C CA  . SER B 1 333 ? -39.643 14.482 44.347  1.00 24.54 ? 651 SER B CA  1 
ATOM   5210 C C   . SER B 1 333 ? -38.989 15.160 43.146  1.00 25.57 ? 651 SER B C   1 
ATOM   5211 O O   . SER B 1 333 ? -39.332 14.884 41.994  1.00 25.20 ? 651 SER B O   1 
ATOM   5212 C CB  . SER B 1 333 ? -40.842 15.317 44.735  1.00 24.88 ? 651 SER B CB  1 
ATOM   5213 O OG  . SER B 1 333 ? -40.453 16.676 44.840  1.00 28.88 ? 651 SER B OG  1 
ATOM   5214 N N   . ASP B 1 334 ? -38.080 16.085 43.442  1.00 28.20 ? 652 ASP B N   1 
ATOM   5215 C CA  . ASP B 1 334 ? -37.275 16.813 42.450  1.00 28.93 ? 652 ASP B CA  1 
ATOM   5216 C C   . ASP B 1 334 ? -36.684 15.931 41.382  1.00 29.92 ? 652 ASP B C   1 
ATOM   5217 O O   . ASP B 1 334 ? -36.378 16.423 40.297  1.00 30.36 ? 652 ASP B O   1 
ATOM   5218 C CB  . ASP B 1 334 ? -36.086 17.486 43.134  1.00 28.66 ? 652 ASP B CB  1 
ATOM   5219 C CG  . ASP B 1 334 ? -36.481 18.694 43.919  1.00 29.45 ? 652 ASP B CG  1 
ATOM   5220 O OD1 . ASP B 1 334 ? -37.633 19.115 43.752  1.00 30.32 ? 652 ASP B OD1 1 
ATOM   5221 O OD2 . ASP B 1 334 ? -35.647 19.226 44.692  1.00 31.68 ? 652 ASP B OD2 1 
ATOM   5222 N N   . PHE B 1 335 ? -36.484 14.649 41.713  1.00 30.16 ? 653 PHE B N   1 
ATOM   5223 C CA  . PHE B 1 335 ? -35.701 13.720 40.891  1.00 29.29 ? 653 PHE B CA  1 
ATOM   5224 C C   . PHE B 1 335 ? -36.580 12.576 40.452  1.00 30.36 ? 653 PHE B C   1 
ATOM   5225 O O   . PHE B 1 335 ? -36.140 11.428 40.363  1.00 31.96 ? 653 PHE B O   1 
ATOM   5226 C CB  . PHE B 1 335 ? -34.514 13.187 41.685  1.00 26.72 ? 653 PHE B CB  1 
ATOM   5227 C CG  . PHE B 1 335 ? -33.781 14.258 42.432  1.00 28.68 ? 653 PHE B CG  1 
ATOM   5228 C CD1 . PHE B 1 335 ? -33.936 14.396 43.810  1.00 27.99 ? 653 PHE B CD1 1 
ATOM   5229 C CD2 . PHE B 1 335 ? -32.959 15.163 41.750  1.00 25.45 ? 653 PHE B CD2 1 
ATOM   5230 C CE1 . PHE B 1 335 ? -33.263 15.395 44.495  1.00 28.63 ? 653 PHE B CE1 1 
ATOM   5231 C CE2 . PHE B 1 335 ? -32.293 16.166 42.420  1.00 23.98 ? 653 PHE B CE2 1 
ATOM   5232 C CZ  . PHE B 1 335 ? -32.436 16.285 43.797  1.00 28.62 ? 653 PHE B CZ  1 
ATOM   5233 N N   . GLU B 1 336 ? -37.834 12.893 40.194  1.00 28.80 ? 654 GLU B N   1 
ATOM   5234 C CA  . GLU B 1 336 ? -38.763 11.872 39.854  1.00 29.43 ? 654 GLU B CA  1 
ATOM   5235 C C   . GLU B 1 336 ? -38.529 11.518 38.401  1.00 31.14 ? 654 GLU B C   1 
ATOM   5236 O O   . GLU B 1 336 ? -38.334 12.406 37.563  1.00 31.33 ? 654 GLU B O   1 
ATOM   5237 C CB  . GLU B 1 336 ? -40.167 12.398 40.052  1.00 28.66 ? 654 GLU B CB  1 
ATOM   5238 C CG  . GLU B 1 336 ? -41.227 11.462 39.573  1.00 28.00 ? 654 GLU B CG  1 
ATOM   5239 C CD  . GLU B 1 336 ? -42.523 12.185 39.336  1.00 31.88 ? 654 GLU B CD  1 
ATOM   5240 O OE1 . GLU B 1 336 ? -42.510 13.301 38.760  1.00 35.55 ? 654 GLU B OE1 1 
ATOM   5241 O OE2 . GLU B 1 336 ? -43.560 11.635 39.730  1.00 33.18 ? 654 GLU B OE2 1 
ATOM   5242 N N   . GLY B 1 337 ? -38.555 10.224 38.092  1.00 31.22 ? 655 GLY B N   1 
ATOM   5243 C CA  . GLY B 1 337 ? -38.328 9.796  36.718  1.00 30.97 ? 655 GLY B CA  1 
ATOM   5244 C C   . GLY B 1 337 ? -36.970 10.214 36.176  1.00 31.40 ? 655 GLY B C   1 
ATOM   5245 O O   . GLY B 1 337 ? -36.836 10.540 35.022  1.00 32.41 ? 655 GLY B O   1 
ATOM   5246 N N   . PHE B 1 338 ? -35.952 10.203 37.019  1.00 31.35 ? 656 PHE B N   1 
ATOM   5247 C CA  . PHE B 1 338 ? -34.589 10.420 36.579  1.00 31.11 ? 656 PHE B CA  1 
ATOM   5248 C C   . PHE B 1 338 ? -34.004 9.207  35.835  1.00 31.24 ? 656 PHE B C   1 
ATOM   5249 O O   . PHE B 1 338 ? -33.377 9.328  34.784  1.00 32.52 ? 656 PHE B O   1 
ATOM   5250 C CB  . PHE B 1 338 ? -33.722 10.735 37.806  1.00 30.44 ? 656 PHE B CB  1 
ATOM   5251 C CG  . PHE B 1 338 ? -32.289 11.021 37.485  1.00 24.59 ? 656 PHE B CG  1 
ATOM   5252 C CD1 . PHE B 1 338 ? -31.938 12.154 36.769  1.00 23.40 ? 656 PHE B CD1 1 
ATOM   5253 C CD2 . PHE B 1 338 ? -31.298 10.166 37.909  1.00 24.56 ? 656 PHE B CD2 1 
ATOM   5254 C CE1 . PHE B 1 338 ? -30.606 12.438 36.479  1.00 25.38 ? 656 PHE B CE1 1 
ATOM   5255 C CE2 . PHE B 1 338 ? -29.967 10.432 37.623  1.00 31.44 ? 656 PHE B CE2 1 
ATOM   5256 C CZ  . PHE B 1 338 ? -29.620 11.580 36.906  1.00 27.71 ? 656 PHE B CZ  1 
HETATM 5257 N N   . SEP B 1 339 ? -34.187 8.035  36.403  1.00 31.01 ? 657 SEP B N   1 
HETATM 5258 C CA  . SEP B 1 339 ? -33.533 6.845  35.896  1.00 31.92 ? 657 SEP B CA  1 
HETATM 5259 C CB  . SEP B 1 339 ? -33.877 5.689  36.814  1.00 32.81 ? 657 SEP B CB  1 
HETATM 5260 O OG  . SEP B 1 339 ? -34.289 6.230  38.058  1.00 38.18 ? 657 SEP B OG  1 
HETATM 5261 C C   . SEP B 1 339 ? -33.962 6.550  34.471  1.00 30.85 ? 657 SEP B C   1 
HETATM 5262 O O   . SEP B 1 339 ? -35.092 6.817  34.090  1.00 31.18 ? 657 SEP B O   1 
HETATM 5263 P P   . SEP B 1 339 ? -33.915 5.202  39.214  1.00 46.47 ? 657 SEP B P   1 
HETATM 5264 O O1P . SEP B 1 339 ? -35.277 4.678  39.909  1.00 49.12 ? 657 SEP B O1P 1 
HETATM 5265 O O2P . SEP B 1 339 ? -33.002 5.936  40.319  1.00 50.29 ? 657 SEP B O2P 1 
HETATM 5266 O O3P . SEP B 1 339 ? -33.064 3.968  38.616  1.00 44.50 ? 657 SEP B O3P 1 
ATOM   5267 N N   . TYR B 1 340 ? -33.044 6.004  33.688  1.00 30.57 ? 658 TYR B N   1 
ATOM   5268 C CA  . TYR B 1 340 ? -33.275 5.730  32.273  1.00 29.97 ? 658 TYR B CA  1 
ATOM   5269 C C   . TYR B 1 340 ? -32.198 4.766  31.849  1.00 31.51 ? 658 TYR B C   1 
ATOM   5270 O O   . TYR B 1 340 ? -31.122 4.751  32.457  1.00 32.80 ? 658 TYR B O   1 
ATOM   5271 C CB  . TYR B 1 340 ? -33.153 7.013  31.462  1.00 27.55 ? 658 TYR B CB  1 
ATOM   5272 C CG  . TYR B 1 340 ? -33.319 6.816  29.984  1.00 27.93 ? 658 TYR B CG  1 
ATOM   5273 C CD1 . TYR B 1 340 ? -34.500 6.299  29.447  1.00 30.08 ? 658 TYR B CD1 1 
ATOM   5274 C CD2 . TYR B 1 340 ? -32.304 7.165  29.109  1.00 32.82 ? 658 TYR B CD2 1 
ATOM   5275 C CE1 . TYR B 1 340 ? -34.654 6.125  28.064  1.00 30.46 ? 658 TYR B CE1 1 
ATOM   5276 C CE2 . TYR B 1 340 ? -32.441 6.997  27.730  1.00 34.78 ? 658 TYR B CE2 1 
ATOM   5277 C CZ  . TYR B 1 340 ? -33.613 6.470  27.212  1.00 34.32 ? 658 TYR B CZ  1 
ATOM   5278 O OH  . TYR B 1 340 ? -33.719 6.314  25.846  1.00 35.08 ? 658 TYR B OH  1 
ATOM   5279 N N   . VAL B 1 341 ? -32.468 3.933  30.846  1.00 31.36 ? 659 VAL B N   1 
ATOM   5280 C CA  . VAL B 1 341 ? -31.404 3.081  30.318  1.00 31.97 ? 659 VAL B CA  1 
ATOM   5281 C C   . VAL B 1 341 ? -31.371 3.267  28.823  1.00 35.17 ? 659 VAL B C   1 
ATOM   5282 O O   . VAL B 1 341 ? -32.423 3.294  28.209  1.00 37.62 ? 659 VAL B O   1 
ATOM   5283 C CB  . VAL B 1 341 ? -31.567 1.592  30.687  1.00 30.48 ? 659 VAL B CB  1 
ATOM   5284 C CG1 . VAL B 1 341 ? -30.655 0.738  29.826  1.00 28.18 ? 659 VAL B CG1 1 
ATOM   5285 C CG2 . VAL B 1 341 ? -31.245 1.377  32.148  1.00 25.93 ? 659 VAL B CG2 1 
ATOM   5286 N N   . ASN B 1 342 ? -30.187 3.432  28.231  1.00 37.38 ? 660 ASN B N   1 
ATOM   5287 C CA  . ASN B 1 342 ? -30.114 3.677  26.786  1.00 38.75 ? 660 ASN B CA  1 
ATOM   5288 C C   . ASN B 1 342 ? -30.185 2.402  25.977  1.00 38.95 ? 660 ASN B C   1 
ATOM   5289 O O   . ASN B 1 342 ? -29.227 1.647  25.900  1.00 38.61 ? 660 ASN B O   1 
ATOM   5290 C CB  . ASN B 1 342 ? -28.857 4.441  26.413  1.00 39.90 ? 660 ASN B CB  1 
ATOM   5291 C CG  . ASN B 1 342 ? -28.912 4.966  25.009  1.00 41.22 ? 660 ASN B CG  1 
ATOM   5292 O OD1 . ASN B 1 342 ? -29.906 4.783  24.305  1.00 43.72 ? 660 ASN B OD1 1 
ATOM   5293 N ND2 . ASN B 1 342 ? -27.850 5.634  24.590  1.00 43.85 ? 660 ASN B ND2 1 
ATOM   5294 N N   . PRO B 1 343 ? -31.330 2.163  25.349  1.00 40.66 ? 661 PRO B N   1 
ATOM   5295 C CA  . PRO B 1 343 ? -31.512 0.843  24.794  1.00 42.50 ? 661 PRO B CA  1 
ATOM   5296 C C   . PRO B 1 343 ? -30.619 0.626  23.582  1.00 44.68 ? 661 PRO B C   1 
ATOM   5297 O O   . PRO B 1 343 ? -30.601 -0.479 23.031  1.00 45.33 ? 661 PRO B O   1 
ATOM   5298 C CB  . PRO B 1 343 ? -32.989 0.843  24.395  1.00 42.23 ? 661 PRO B CB  1 
ATOM   5299 C CG  . PRO B 1 343 ? -33.296 2.257  24.114  1.00 39.22 ? 661 PRO B CG  1 
ATOM   5300 C CD  . PRO B 1 343 ? -32.468 3.052  25.068  1.00 40.68 ? 661 PRO B CD  1 
ATOM   5301 N N   . GLN B 1 344 ? -29.881 1.667  23.184  1.00 45.73 ? 662 GLN B N   1 
ATOM   5302 C CA  . GLN B 1 344 ? -29.039 1.607  21.988  1.00 46.14 ? 662 GLN B CA  1 
ATOM   5303 C C   . GLN B 1 344 ? -27.559 1.936  22.231  1.00 45.24 ? 662 GLN B C   1 
ATOM   5304 O O   . GLN B 1 344 ? -26.856 2.322  21.303  1.00 45.97 ? 662 GLN B O   1 
ATOM   5305 C CB  . GLN B 1 344 ? -29.583 2.556  20.924  1.00 47.21 ? 662 GLN B CB  1 
ATOM   5306 C CG  . GLN B 1 344 ? -31.081 2.501  20.719  1.00 50.44 ? 662 GLN B CG  1 
ATOM   5307 C CD  . GLN B 1 344 ? -31.695 3.902  20.613  1.00 54.84 ? 662 GLN B CD  1 
ATOM   5308 O OE1 . GLN B 1 344 ? -31.260 4.738  19.813  1.00 50.45 ? 662 GLN B OE1 1 
ATOM   5309 N NE2 . GLN B 1 344 ? -32.710 4.158  21.432  1.00 55.80 ? 662 GLN B NE2 1 
ATOM   5310 N N   . PHE B 1 345 ? -27.076 1.796  23.458  1.00 43.85 ? 663 PHE B N   1 
ATOM   5311 C CA  . PHE B 1 345 ? -25.696 2.155  23.729  1.00 43.07 ? 663 PHE B CA  1 
ATOM   5312 C C   . PHE B 1 345 ? -24.769 1.273  22.906  1.00 44.97 ? 663 PHE B C   1 
ATOM   5313 O O   . PHE B 1 345 ? -25.155 0.174  22.552  1.00 44.00 ? 663 PHE B O   1 
ATOM   5314 C CB  . PHE B 1 345 ? -25.382 2.002  25.207  1.00 41.88 ? 663 PHE B CB  1 
ATOM   5315 C CG  . PHE B 1 345 ? -24.064 2.554  25.580  1.00 36.08 ? 663 PHE B CG  1 
ATOM   5316 C CD1 . PHE B 1 345 ? -23.882 3.926  25.675  1.00 37.08 ? 663 PHE B CD1 1 
ATOM   5317 C CD2 . PHE B 1 345 ? -22.997 1.721  25.798  1.00 33.06 ? 663 PHE B CD2 1 
ATOM   5318 C CE1 . PHE B 1 345 ? -22.662 4.463  26.009  1.00 32.68 ? 663 PHE B CE1 1 
ATOM   5319 C CE2 . PHE B 1 345 ? -21.767 2.241  26.135  1.00 34.65 ? 663 PHE B CE2 1 
ATOM   5320 C CZ  . PHE B 1 345 ? -21.600 3.628  26.243  1.00 33.16 ? 663 PHE B CZ  1 
ATOM   5321 N N   . VAL B 1 346 ? -23.556 1.752  22.605  1.00 47.70 ? 664 VAL B N   1 
ATOM   5322 C CA  . VAL B 1 346 ? -22.601 1.028  21.745  1.00 49.75 ? 664 VAL B CA  1 
ATOM   5323 C C   . VAL B 1 346 ? -21.155 1.124  22.269  1.00 52.84 ? 664 VAL B C   1 
ATOM   5324 O O   . VAL B 1 346 ? -20.629 2.218  22.415  1.00 52.97 ? 664 VAL B O   1 
ATOM   5325 C CB  . VAL B 1 346 ? -22.619 1.605  20.306  1.00 49.97 ? 664 VAL B CB  1 
ATOM   5326 C CG1 . VAL B 1 346 ? -21.834 0.718  19.352  1.00 49.85 ? 664 VAL B CG1 1 
ATOM   5327 C CG2 . VAL B 1 346 ? -24.044 1.815  19.802  1.00 47.45 ? 664 VAL B CG2 1 
ATOM   5328 N N   . HIS B 1 347 ? -20.491 -0.002 22.524  1.00 56.76 ? 665 HIS B N   1 
ATOM   5329 C CA  . HIS B 1 347 ? -19.158 0.049  23.165  1.00 60.39 ? 665 HIS B CA  1 
ATOM   5330 C C   . HIS B 1 347 ? -17.900 -0.244 22.297  1.00 62.50 ? 665 HIS B C   1 
ATOM   5331 O O   . HIS B 1 347 ? -16.838 0.346  22.550  1.00 61.25 ? 665 HIS B O   1 
ATOM   5332 C CB  . HIS B 1 347 ? -19.072 -0.859 24.417  1.00 61.16 ? 665 HIS B CB  1 
ATOM   5333 C CG  . HIS B 1 347 ? -20.362 -1.051 25.169  1.00 63.23 ? 665 HIS B CG  1 
ATOM   5334 N ND1 . HIS B 1 347 ? -20.464 -0.840 26.529  1.00 64.34 ? 665 HIS B ND1 1 
ATOM   5335 C CD2 . HIS B 1 347 ? -21.577 -1.505 24.770  1.00 61.91 ? 665 HIS B CD2 1 
ATOM   5336 C CE1 . HIS B 1 347 ? -21.692 -1.124 26.928  1.00 62.41 ? 665 HIS B CE1 1 
ATOM   5337 N NE2 . HIS B 1 347 ? -22.388 -1.529 25.880  1.00 60.66 ? 665 HIS B NE2 1 
ATOM   5338 N N   . PRO B 1 348 ? -18.011 -1.143 21.281  1.00 64.90 ? 666 PRO B N   1 
ATOM   5339 C CA  . PRO B 1 348 ? -16.843 -1.846 20.699  1.00 65.65 ? 666 PRO B CA  1 
ATOM   5340 C C   . PRO B 1 348 ? -15.492 -1.287 21.143  1.00 65.85 ? 666 PRO B C   1 
ATOM   5341 O O   . PRO B 1 348 ? -14.680 -2.027 21.696  1.00 65.93 ? 666 PRO B O   1 
ATOM   5342 C CB  . PRO B 1 348 ? -17.029 -1.669 19.179  1.00 65.46 ? 666 PRO B CB  1 
ATOM   5343 C CG  . PRO B 1 348 ? -18.518 -1.444 18.983  1.00 66.24 ? 666 PRO B CG  1 
ATOM   5344 C CD  . PRO B 1 348 ? -19.168 -1.232 20.372  1.00 65.35 ? 666 PRO B CD  1 
ATOM   5345 N N   . ASN C 1 12  ? -7.411  44.029 4.280   1.00 71.59 ? 330 ASN C N   1 
ATOM   5346 C CA  . ASN C 1 12  ? -8.487  43.665 5.247   1.00 71.94 ? 330 ASN C CA  1 
ATOM   5347 C C   . ASN C 1 12  ? -9.332  44.868 5.682   1.00 71.60 ? 330 ASN C C   1 
ATOM   5348 O O   . ASN C 1 12  ? -9.406  45.177 6.874   1.00 71.96 ? 330 ASN C O   1 
ATOM   5349 C CB  . ASN C 1 12  ? -7.884  42.984 6.481   1.00 72.60 ? 330 ASN C CB  1 
ATOM   5350 C CG  . ASN C 1 12  ? -8.948  42.387 7.407   1.00 74.00 ? 330 ASN C CG  1 
ATOM   5351 O OD1 . ASN C 1 12  ? -10.047 42.030 6.969   1.00 73.35 ? 330 ASN C OD1 1 
ATOM   5352 N ND2 . ASN C 1 12  ? -8.617  42.273 8.693   1.00 72.37 ? 330 ASN C ND2 1 
ATOM   5353 N N   . LEU C 1 13  ? -9.969  45.543 4.720   1.00 70.51 ? 331 LEU C N   1 
ATOM   5354 C CA  . LEU C 1 13  ? -10.757 46.754 5.004   1.00 68.35 ? 331 LEU C CA  1 
ATOM   5355 C C   . LEU C 1 13  ? -12.069 46.828 4.212   1.00 67.27 ? 331 LEU C C   1 
ATOM   5356 O O   . LEU C 1 13  ? -12.173 46.308 3.100   1.00 66.98 ? 331 LEU C O   1 
ATOM   5357 C CB  . LEU C 1 13  ? -9.921  48.022 4.767   1.00 68.20 ? 331 LEU C CB  1 
ATOM   5358 C CG  . LEU C 1 13  ? -8.933  48.473 5.857   1.00 68.13 ? 331 LEU C CG  1 
ATOM   5359 C CD1 . LEU C 1 13  ? -7.595  47.717 5.812   1.00 69.83 ? 331 LEU C CD1 1 
ATOM   5360 C CD2 . LEU C 1 13  ? -8.681  49.965 5.759   1.00 66.59 ? 331 LEU C CD2 1 
ATOM   5361 N N   . ASP C 1 14  ? -13.056 47.500 4.798   1.00 65.84 ? 332 ASP C N   1 
ATOM   5362 C CA  . ASP C 1 14  ? -14.415 47.580 4.260   1.00 65.15 ? 332 ASP C CA  1 
ATOM   5363 C C   . ASP C 1 14  ? -14.557 48.679 3.189   1.00 64.49 ? 332 ASP C C   1 
ATOM   5364 O O   . ASP C 1 14  ? -15.509 49.462 3.232   1.00 65.04 ? 332 ASP C O   1 
ATOM   5365 C CB  . ASP C 1 14  ? -15.391 47.841 5.433   1.00 65.48 ? 332 ASP C CB  1 
ATOM   5366 C CG  . ASP C 1 14  ? -16.869 47.551 5.088   1.00 67.13 ? 332 ASP C CG  1 
ATOM   5367 O OD1 . ASP C 1 14  ? -17.161 46.811 4.120   1.00 68.42 ? 332 ASP C OD1 1 
ATOM   5368 O OD2 . ASP C 1 14  ? -17.753 48.057 5.818   1.00 67.07 ? 332 ASP C OD2 1 
ATOM   5369 N N   . ARG C 1 15  ? -13.629 48.739 2.228   1.00 63.22 ? 333 ARG C N   1 
ATOM   5370 C CA  . ARG C 1 15  ? -13.621 49.835 1.228   1.00 60.97 ? 333 ARG C CA  1 
ATOM   5371 C C   . ARG C 1 15  ? -14.789 49.791 0.242   1.00 58.87 ? 333 ARG C C   1 
ATOM   5372 O O   . ARG C 1 15  ? -15.132 48.732 -0.276  1.00 58.83 ? 333 ARG C O   1 
ATOM   5373 C CB  . ARG C 1 15  ? -12.299 49.891 0.453   1.00 61.27 ? 333 ARG C CB  1 
ATOM   5374 C CG  . ARG C 1 15  ? -12.289 50.951 -0.644  1.00 61.90 ? 333 ARG C CG  1 
ATOM   5375 C CD  . ARG C 1 15  ? -11.019 50.910 -1.470  1.00 66.78 ? 333 ARG C CD  1 
ATOM   5376 N NE  . ARG C 1 15  ? -9.922  51.607 -0.805  1.00 71.19 ? 333 ARG C NE  1 
ATOM   5377 C CZ  . ARG C 1 15  ? -9.057  51.036 0.031   1.00 72.47 ? 333 ARG C CZ  1 
ATOM   5378 N NH1 . ARG C 1 15  ? -9.147  49.742 0.315   1.00 72.59 ? 333 ARG C NH1 1 
ATOM   5379 N NH2 . ARG C 1 15  ? -8.098  51.766 0.587   1.00 71.89 ? 333 ARG C NH2 1 
ATOM   5380 N N   . VAL C 1 16  ? -15.373 50.950 -0.039  1.00 56.19 ? 334 VAL C N   1 
ATOM   5381 C CA  . VAL C 1 16  ? -16.579 50.999 -0.841  1.00 54.15 ? 334 VAL C CA  1 
ATOM   5382 C C   . VAL C 1 16  ? -16.517 52.083 -1.921  1.00 53.01 ? 334 VAL C C   1 
ATOM   5383 O O   . VAL C 1 16  ? -15.843 53.094 -1.744  1.00 52.44 ? 334 VAL C O   1 
ATOM   5384 C CB  . VAL C 1 16  ? -17.786 51.235 0.063   1.00 54.18 ? 334 VAL C CB  1 
ATOM   5385 C CG1 . VAL C 1 16  ? -17.991 52.728 0.297   1.00 52.84 ? 334 VAL C CG1 1 
ATOM   5386 C CG2 . VAL C 1 16  ? -19.019 50.594 -0.521  1.00 54.96 ? 334 VAL C CG2 1 
ATOM   5387 N N   . LYS C 1 17  ? -17.223 51.854 -3.030  1.00 51.31 ? 335 LYS C N   1 
ATOM   5388 C CA  . LYS C 1 17  ? -17.268 52.774 -4.164  1.00 49.86 ? 335 LYS C CA  1 
ATOM   5389 C C   . LYS C 1 17  ? -18.672 53.322 -4.335  1.00 48.52 ? 335 LYS C C   1 
ATOM   5390 O O   . LYS C 1 17  ? -19.610 52.847 -3.714  1.00 49.24 ? 335 LYS C O   1 
ATOM   5391 C CB  . LYS C 1 17  ? -16.862 52.050 -5.446  1.00 50.78 ? 335 LYS C CB  1 
ATOM   5392 C CG  . LYS C 1 17  ? -15.402 51.643 -5.488  1.00 54.83 ? 335 LYS C CG  1 
ATOM   5393 C CD  . LYS C 1 17  ? -15.232 50.202 -5.970  1.00 59.47 ? 335 LYS C CD  1 
ATOM   5394 C CE  . LYS C 1 17  ? -14.109 49.494 -5.188  1.00 60.54 ? 335 LYS C CE  1 
ATOM   5395 N NZ  . LYS C 1 17  ? -13.902 48.077 -5.600  1.00 57.98 ? 335 LYS C NZ  1 
ATOM   5396 N N   . LEU C 1 18  ? -18.821 54.306 -5.210  1.00 46.82 ? 336 LEU C N   1 
ATOM   5397 C CA  . LEU C 1 18  ? -20.090 54.992 -5.395  1.00 43.90 ? 336 LEU C CA  1 
ATOM   5398 C C   . LEU C 1 18  ? -21.159 54.065 -5.921  1.00 42.78 ? 336 LEU C C   1 
ATOM   5399 O O   . LEU C 1 18  ? -22.326 54.154 -5.556  1.00 42.49 ? 336 LEU C O   1 
ATOM   5400 C CB  . LEU C 1 18  ? -19.908 56.135 -6.380  1.00 44.12 ? 336 LEU C CB  1 
ATOM   5401 C CG  . LEU C 1 18  ? -21.219 56.788 -6.812  1.00 43.95 ? 336 LEU C CG  1 
ATOM   5402 C CD1 . LEU C 1 18  ? -21.999 57.221 -5.585  1.00 39.44 ? 336 LEU C CD1 1 
ATOM   5403 C CD2 . LEU C 1 18  ? -20.955 57.964 -7.738  1.00 38.83 ? 336 LEU C CD2 1 
ATOM   5404 N N   . THR C 1 19  ? -20.751 53.181 -6.807  1.00 42.11 ? 337 THR C N   1 
ATOM   5405 C CA  . THR C 1 19  ? -21.664 52.246 -7.444  1.00 41.58 ? 337 THR C CA  1 
ATOM   5406 C C   . THR C 1 19  ? -22.253 51.251 -6.434  1.00 40.01 ? 337 THR C C   1 
ATOM   5407 O O   . THR C 1 19  ? -23.129 50.452 -6.767  1.00 39.08 ? 337 THR C O   1 
ATOM   5408 C CB  . THR C 1 19  ? -20.901 51.460 -8.494  1.00 42.11 ? 337 THR C CB  1 
ATOM   5409 O OG1 . THR C 1 19  ? -19.796 50.818 -7.846  1.00 40.07 ? 337 THR C OG1 1 
ATOM   5410 C CG2 . THR C 1 19  ? -20.362 52.405 -9.565  1.00 41.90 ? 337 THR C CG2 1 
ATOM   5411 N N   . ASP C 1 20  ? -21.768 51.310 -5.199  1.00 38.10 ? 338 ASP C N   1 
ATOM   5412 C CA  . ASP C 1 20  ? -22.220 50.403 -4.155  1.00 36.87 ? 338 ASP C CA  1 
ATOM   5413 C C   . ASP C 1 20  ? -23.528 50.800 -3.481  1.00 36.69 ? 338 ASP C C   1 
ATOM   5414 O O   . ASP C 1 20  ? -24.080 50.015 -2.722  1.00 35.99 ? 338 ASP C O   1 
ATOM   5415 C CB  . ASP C 1 20  ? -21.152 50.288 -3.081  1.00 36.64 ? 338 ASP C CB  1 
ATOM   5416 C CG  . ASP C 1 20  ? -19.958 49.514 -3.543  1.00 38.15 ? 338 ASP C CG  1 
ATOM   5417 O OD1 . ASP C 1 20  ? -20.166 48.416 -4.096  1.00 40.16 ? 338 ASP C OD1 1 
ATOM   5418 O OD2 . ASP C 1 20  ? -18.815 49.997 -3.362  1.00 39.68 ? 338 ASP C OD2 1 
ATOM   5419 N N   . PHE C 1 21  ? -24.013 52.014 -3.728  1.00 36.41 ? 339 PHE C N   1 
ATOM   5420 C CA  . PHE C 1 21  ? -25.171 52.512 -2.997  1.00 37.07 ? 339 PHE C CA  1 
ATOM   5421 C C   . PHE C 1 21  ? -26.282 52.909 -3.932  1.00 38.76 ? 339 PHE C C   1 
ATOM   5422 O O   . PHE C 1 21  ? -26.042 53.215 -5.088  1.00 40.48 ? 339 PHE C O   1 
ATOM   5423 C CB  . PHE C 1 21  ? -24.808 53.746 -2.191  1.00 36.29 ? 339 PHE C CB  1 
ATOM   5424 C CG  . PHE C 1 21  ? -23.642 53.556 -1.292  1.00 36.52 ? 339 PHE C CG  1 
ATOM   5425 C CD1 . PHE C 1 21  ? -23.823 53.372 0.072   1.00 30.86 ? 339 PHE C CD1 1 
ATOM   5426 C CD2 . PHE C 1 21  ? -22.347 53.573 -1.803  1.00 36.99 ? 339 PHE C CD2 1 
ATOM   5427 C CE1 . PHE C 1 21  ? -22.730 53.198 0.915   1.00 28.72 ? 339 PHE C CE1 1 
ATOM   5428 C CE2 . PHE C 1 21  ? -21.250 53.395 -0.968  1.00 34.24 ? 339 PHE C CE2 1 
ATOM   5429 C CZ  . PHE C 1 21  ? -21.446 53.210 0.397   1.00 31.44 ? 339 PHE C CZ  1 
ATOM   5430 N N   . ASN C 1 22  ? -27.503 52.918 -3.425  1.00 39.69 ? 340 ASN C N   1 
ATOM   5431 C CA  . ASN C 1 22  ? -28.602 53.534 -4.137  1.00 41.83 ? 340 ASN C CA  1 
ATOM   5432 C C   . ASN C 1 22  ? -28.944 54.833 -3.418  1.00 42.44 ? 340 ASN C C   1 
ATOM   5433 O O   . ASN C 1 22  ? -29.270 54.811 -2.231  1.00 44.62 ? 340 ASN C O   1 
ATOM   5434 C CB  . ASN C 1 22  ? -29.839 52.614 -4.156  1.00 42.75 ? 340 ASN C CB  1 
ATOM   5435 C CG  . ASN C 1 22  ? -29.596 51.295 -4.897  1.00 47.18 ? 340 ASN C CG  1 
ATOM   5436 O OD1 . ASN C 1 22  ? -28.810 51.230 -5.847  1.00 47.76 ? 340 ASN C OD1 1 
ATOM   5437 N ND2 . ASN C 1 22  ? -30.284 50.237 -4.460  1.00 49.49 ? 340 ASN C ND2 1 
ATOM   5438 N N   . PHE C 1 23  ? -28.866 55.966 -4.100  1.00 41.31 ? 341 PHE C N   1 
ATOM   5439 C CA  . PHE C 1 23  ? -29.347 57.181 -3.490  1.00 41.11 ? 341 PHE C CA  1 
ATOM   5440 C C   . PHE C 1 23  ? -30.867 57.114 -3.255  1.00 42.23 ? 341 PHE C C   1 
ATOM   5441 O O   . PHE C 1 23  ? -31.638 56.987 -4.205  1.00 42.86 ? 341 PHE C O   1 
ATOM   5442 C CB  . PHE C 1 23  ? -29.045 58.359 -4.385  1.00 42.01 ? 341 PHE C CB  1 
ATOM   5443 C CG  . PHE C 1 23  ? -27.601 58.655 -4.526  1.00 42.25 ? 341 PHE C CG  1 
ATOM   5444 C CD1 . PHE C 1 23  ? -26.695 58.186 -3.591  1.00 44.37 ? 341 PHE C CD1 1 
ATOM   5445 C CD2 . PHE C 1 23  ? -27.147 59.434 -5.587  1.00 41.22 ? 341 PHE C CD2 1 
ATOM   5446 C CE1 . PHE C 1 23  ? -25.343 58.475 -3.710  1.00 46.99 ? 341 PHE C CE1 1 
ATOM   5447 C CE2 . PHE C 1 23  ? -25.805 59.729 -5.721  1.00 47.12 ? 341 PHE C CE2 1 
ATOM   5448 C CZ  . PHE C 1 23  ? -24.892 59.249 -4.776  1.00 46.00 ? 341 PHE C CZ  1 
ATOM   5449 N N   . LEU C 1 24  ? -31.302 57.219 -1.999  1.00 42.24 ? 342 LEU C N   1 
ATOM   5450 C CA  . LEU C 1 24  ? -32.740 57.260 -1.690  1.00 41.39 ? 342 LEU C CA  1 
ATOM   5451 C C   . LEU C 1 24  ? -33.326 58.677 -1.775  1.00 41.11 ? 342 LEU C C   1 
ATOM   5452 O O   . LEU C 1 24  ? -34.194 58.953 -2.587  1.00 42.34 ? 342 LEU C O   1 
ATOM   5453 C CB  . LEU C 1 24  ? -33.020 56.648 -0.319  1.00 40.77 ? 342 LEU C CB  1 
ATOM   5454 C CG  . LEU C 1 24  ? -32.474 55.225 -0.162  1.00 39.63 ? 342 LEU C CG  1 
ATOM   5455 C CD1 . LEU C 1 24  ? -32.756 54.662 1.236   1.00 30.73 ? 342 LEU C CD1 1 
ATOM   5456 C CD2 . LEU C 1 24  ? -33.026 54.325 -1.258  1.00 30.75 ? 342 LEU C CD2 1 
ATOM   5457 N N   . MET C 1 25  ? -32.834 59.585 -0.953  1.00 40.24 ? 343 MET C N   1 
ATOM   5458 C CA  . MET C 1 25  ? -33.328 60.948 -0.976  1.00 38.24 ? 343 MET C CA  1 
ATOM   5459 C C   . MET C 1 25  ? -32.328 61.908 -0.322  1.00 37.36 ? 343 MET C C   1 
ATOM   5460 O O   . MET C 1 25  ? -31.345 61.488 0.319   1.00 37.05 ? 343 MET C O   1 
ATOM   5461 C CB  . MET C 1 25  ? -34.584 60.975 -0.172  1.00 38.67 ? 343 MET C CB  1 
ATOM   5462 C CG  . MET C 1 25  ? -34.344 60.344 1.177   1.00 42.64 ? 343 MET C CG  1 
ATOM   5463 S SD  . MET C 1 25  ? -35.568 60.941 2.325   1.00 51.53 ? 343 MET C SD  1 
ATOM   5464 C CE  . MET C 1 25  ? -35.655 62.686 1.902   1.00 48.75 ? 343 MET C CE  1 
ATOM   5465 N N   . VAL C 1 26  ? -32.583 63.201 -0.468  1.00 34.90 ? 344 VAL C N   1 
ATOM   5466 C CA  . VAL C 1 26  ? -31.762 64.195 0.214   1.00 33.05 ? 344 VAL C CA  1 
ATOM   5467 C C   . VAL C 1 26  ? -32.102 64.298 1.703   1.00 31.51 ? 344 VAL C C   1 
ATOM   5468 O O   . VAL C 1 26  ? -33.243 64.567 2.072   1.00 31.30 ? 344 VAL C O   1 
ATOM   5469 C CB  . VAL C 1 26  ? -31.905 65.559 -0.448  1.00 33.02 ? 344 VAL C CB  1 
ATOM   5470 C CG1 . VAL C 1 26  ? -31.025 66.578 0.243   1.00 34.21 ? 344 VAL C CG1 1 
ATOM   5471 C CG2 . VAL C 1 26  ? -31.542 65.453 -1.916  1.00 32.44 ? 344 VAL C CG2 1 
ATOM   5472 N N   . LEU C 1 27  ? -31.126 64.055 2.569   1.00 30.35 ? 345 LEU C N   1 
ATOM   5473 C CA  . LEU C 1 27  ? -31.401 64.186 3.990   1.00 30.05 ? 345 LEU C CA  1 
ATOM   5474 C C   . LEU C 1 27  ? -31.495 65.674 4.209   1.00 31.07 ? 345 LEU C C   1 
ATOM   5475 O O   . LEU C 1 27  ? -32.381 66.138 4.917   1.00 34.40 ? 345 LEU C O   1 
ATOM   5476 C CB  . LEU C 1 27  ? -30.325 63.542 4.874   1.00 29.08 ? 345 LEU C CB  1 
ATOM   5477 C CG  . LEU C 1 27  ? -30.308 62.007 4.910   1.00 26.54 ? 345 LEU C CG  1 
ATOM   5478 C CD1 . LEU C 1 27  ? -29.294 61.521 5.903   1.00 32.45 ? 345 LEU C CD1 1 
ATOM   5479 C CD2 . LEU C 1 27  ? -31.637 61.453 5.288   1.00 17.93 ? 345 LEU C CD2 1 
ATOM   5480 N N   . GLY C 1 28  ? -30.616 66.424 3.548   1.00 29.82 ? 346 GLY C N   1 
ATOM   5481 C CA  . GLY C 1 28  ? -30.693 67.874 3.561   1.00 28.57 ? 346 GLY C CA  1 
ATOM   5482 C C   . GLY C 1 28  ? -29.554 68.550 2.817   1.00 29.04 ? 346 GLY C C   1 
ATOM   5483 O O   . GLY C 1 28  ? -28.659 67.883 2.282   1.00 26.29 ? 346 GLY C O   1 
ATOM   5484 N N   . LYS C 1 29  ? -29.609 69.887 2.808   1.00 29.84 ? 347 LYS C N   1 
ATOM   5485 C CA  . LYS C 1 29  ? -28.629 70.759 2.159   1.00 30.86 ? 347 LYS C CA  1 
ATOM   5486 C C   . LYS C 1 29  ? -28.373 72.013 2.998   1.00 33.40 ? 347 LYS C C   1 
ATOM   5487 O O   . LYS C 1 29  ? -29.226 72.452 3.781   1.00 34.04 ? 347 LYS C O   1 
ATOM   5488 C CB  . LYS C 1 29  ? -29.137 71.234 0.809   1.00 28.97 ? 347 LYS C CB  1 
ATOM   5489 C CG  . LYS C 1 29  ? -29.106 70.239 -0.300  1.00 26.49 ? 347 LYS C CG  1 
ATOM   5490 C CD  . LYS C 1 29  ? -29.881 70.822 -1.473  1.00 32.86 ? 347 LYS C CD  1 
ATOM   5491 C CE  . LYS C 1 29  ? -29.710 70.001 -2.738  1.00 39.16 ? 347 LYS C CE  1 
ATOM   5492 N NZ  . LYS C 1 29  ? -29.899 70.827 -3.968  1.00 40.45 ? 347 LYS C NZ  1 
ATOM   5493 N N   . GLY C 1 30  ? -27.208 72.618 2.797   1.00 34.95 ? 348 GLY C N   1 
ATOM   5494 C CA  . GLY C 1 30  ? -26.836 73.821 3.539   1.00 35.36 ? 348 GLY C CA  1 
ATOM   5495 C C   . GLY C 1 30  ? -25.347 74.007 3.405   1.00 36.20 ? 348 GLY C C   1 
ATOM   5496 O O   . GLY C 1 30  ? -24.712 73.380 2.532   1.00 37.19 ? 348 GLY C O   1 
ATOM   5497 N N   . SER C 1 31  ? -24.782 74.852 4.264   1.00 35.23 ? 349 SER C N   1 
ATOM   5498 C CA  . SER C 1 31  ? -23.344 75.083 4.256   1.00 34.23 ? 349 SER C CA  1 
ATOM   5499 C C   . SER C 1 31  ? -22.618 73.759 4.302   1.00 34.27 ? 349 SER C C   1 
ATOM   5500 O O   . SER C 1 31  ? -21.570 73.598 3.689   1.00 36.70 ? 349 SER C O   1 
ATOM   5501 C CB  . SER C 1 31  ? -22.948 75.926 5.441   1.00 33.19 ? 349 SER C CB  1 
ATOM   5502 O OG  . SER C 1 31  ? -23.960 75.835 6.422   1.00 39.33 ? 349 SER C OG  1 
ATOM   5503 N N   . PHE C 1 32  ? -23.192 72.791 5.001   1.00 32.87 ? 350 PHE C N   1 
ATOM   5504 C CA  . PHE C 1 32  ? -22.554 71.502 5.145   1.00 31.57 ? 350 PHE C CA  1 
ATOM   5505 C C   . PHE C 1 32  ? -22.567 70.670 3.860   1.00 31.35 ? 350 PHE C C   1 
ATOM   5506 O O   . PHE C 1 32  ? -22.298 69.476 3.902   1.00 31.40 ? 350 PHE C O   1 
ATOM   5507 C CB  . PHE C 1 32  ? -23.242 70.736 6.258   1.00 30.88 ? 350 PHE C CB  1 
ATOM   5508 C CG  . PHE C 1 32  ? -24.689 70.540 6.026   1.00 32.26 ? 350 PHE C CG  1 
ATOM   5509 C CD1 . PHE C 1 32  ? -25.615 70.915 6.978   1.00 32.65 ? 350 PHE C CD1 1 
ATOM   5510 C CD2 . PHE C 1 32  ? -25.141 69.997 4.836   1.00 33.25 ? 350 PHE C CD2 1 
ATOM   5511 C CE1 . PHE C 1 32  ? -26.977 70.729 6.753   1.00 34.64 ? 350 PHE C CE1 1 
ATOM   5512 C CE2 . PHE C 1 32  ? -26.507 69.812 4.593   1.00 33.45 ? 350 PHE C CE2 1 
ATOM   5513 C CZ  . PHE C 1 32  ? -27.426 70.177 5.548   1.00 34.14 ? 350 PHE C CZ  1 
ATOM   5514 N N   . GLY C 1 33  ? -22.885 71.280 2.723   1.00 30.74 ? 351 GLY C N   1 
ATOM   5515 C CA  . GLY C 1 33  ? -22.944 70.531 1.467   1.00 31.14 ? 351 GLY C CA  1 
ATOM   5516 C C   . GLY C 1 33  ? -24.255 69.777 1.260   1.00 32.10 ? 351 GLY C C   1 
ATOM   5517 O O   . GLY C 1 33  ? -25.291 70.120 1.827   1.00 31.17 ? 351 GLY C O   1 
ATOM   5518 N N   . LYS C 1 34  ? -24.223 68.756 0.418   1.00 33.04 ? 352 LYS C N   1 
ATOM   5519 C CA  . LYS C 1 34  ? -25.418 67.968 0.142   1.00 33.63 ? 352 LYS C CA  1 
ATOM   5520 C C   . LYS C 1 34  ? -25.322 66.668 0.897   1.00 34.91 ? 352 LYS C C   1 
ATOM   5521 O O   . LYS C 1 34  ? -24.337 65.943 0.748   1.00 37.30 ? 352 LYS C O   1 
ATOM   5522 C CB  . LYS C 1 34  ? -25.515 67.648 -1.338  1.00 33.24 ? 352 LYS C CB  1 
ATOM   5523 C CG  . LYS C 1 34  ? -26.771 66.908 -1.713  1.00 33.92 ? 352 LYS C CG  1 
ATOM   5524 C CD  . LYS C 1 34  ? -26.805 66.543 -3.201  1.00 36.55 ? 352 LYS C CD  1 
ATOM   5525 C CE  . LYS C 1 34  ? -26.752 67.772 -4.115  1.00 45.63 ? 352 LYS C CE  1 
ATOM   5526 N NZ  . LYS C 1 34  ? -26.229 67.535 -5.529  1.00 48.82 ? 352 LYS C NZ  1 
ATOM   5527 N N   . VAL C 1 35  ? -26.320 66.372 1.726   1.00 34.62 ? 353 VAL C N   1 
ATOM   5528 C CA  . VAL C 1 35  ? -26.327 65.126 2.475   1.00 32.21 ? 353 VAL C CA  1 
ATOM   5529 C C   . VAL C 1 35  ? -27.442 64.193 2.004   1.00 32.33 ? 353 VAL C C   1 
ATOM   5530 O O   . VAL C 1 35  ? -28.631 64.488 2.151   1.00 32.39 ? 353 VAL C O   1 
ATOM   5531 C CB  . VAL C 1 35  ? -26.414 65.398 3.958   1.00 32.36 ? 353 VAL C CB  1 
ATOM   5532 C CG1 . VAL C 1 35  ? -26.469 64.070 4.760   1.00 31.82 ? 353 VAL C CG1 1 
ATOM   5533 C CG2 . VAL C 1 35  ? -25.222 66.219 4.357   1.00 30.56 ? 353 VAL C CG2 1 
ATOM   5534 N N   . MET C 1 36  ? -27.046 63.069 1.423   1.00 31.51 ? 354 MET C N   1 
ATOM   5535 C CA  . MET C 1 36  ? -27.992 62.177 0.780   1.00 33.16 ? 354 MET C CA  1 
ATOM   5536 C C   . MET C 1 36  ? -28.236 60.979 1.655   1.00 33.34 ? 354 MET C C   1 
ATOM   5537 O O   . MET C 1 36  ? -27.307 60.467 2.275   1.00 36.10 ? 354 MET C O   1 
ATOM   5538 C CB  . MET C 1 36  ? -27.409 61.677 -0.534  1.00 34.20 ? 354 MET C CB  1 
ATOM   5539 C CG  . MET C 1 36  ? -28.442 61.193 -1.508  1.00 38.07 ? 354 MET C CG  1 
ATOM   5540 S SD  . MET C 1 36  ? -28.806 62.568 -2.568  1.00 45.30 ? 354 MET C SD  1 
ATOM   5541 C CE  . MET C 1 36  ? -28.034 62.021 -4.086  1.00 46.76 ? 354 MET C CE  1 
ATOM   5542 N N   . LEU C 1 37  ? -29.463 60.496 1.718   1.00 32.26 ? 355 LEU C N   1 
ATOM   5543 C CA  . LEU C 1 37  ? -29.633 59.205 2.351   1.00 32.04 ? 355 LEU C CA  1 
ATOM   5544 C C   . LEU C 1 37  ? -29.457 58.120 1.287   1.00 32.62 ? 355 LEU C C   1 
ATOM   5545 O O   . LEU C 1 37  ? -30.132 58.125 0.239   1.00 30.99 ? 355 LEU C O   1 
ATOM   5546 C CB  . LEU C 1 37  ? -30.986 59.084 3.029   1.00 31.59 ? 355 LEU C CB  1 
ATOM   5547 C CG  . LEU C 1 37  ? -31.290 57.663 3.499   1.00 30.84 ? 355 LEU C CG  1 
ATOM   5548 C CD1 . LEU C 1 37  ? -30.417 57.306 4.701   1.00 31.71 ? 355 LEU C CD1 1 
ATOM   5549 C CD2 . LEU C 1 37  ? -32.759 57.512 3.836   1.00 27.23 ? 355 LEU C CD2 1 
ATOM   5550 N N   . ALA C 1 38  ? -28.534 57.200 1.539   1.00 32.34 ? 356 ALA C N   1 
ATOM   5551 C CA  . ALA C 1 38  ? -28.333 56.116 0.598   1.00 33.79 ? 356 ALA C CA  1 
ATOM   5552 C C   . ALA C 1 38  ? -28.422 54.791 1.278   1.00 34.92 ? 356 ALA C C   1 
ATOM   5553 O O   . ALA C 1 38  ? -28.259 54.674 2.491   1.00 33.93 ? 356 ALA C O   1 
ATOM   5554 C CB  . ALA C 1 38  ? -27.014 56.238 -0.130  1.00 34.53 ? 356 ALA C CB  1 
ATOM   5555 N N   . ASP C 1 39  ? -28.677 53.790 0.456   1.00 36.80 ? 357 ASP C N   1 
ATOM   5556 C CA  . ASP C 1 39  ? -28.931 52.454 0.917   1.00 39.46 ? 357 ASP C CA  1 
ATOM   5557 C C   . ASP C 1 39  ? -27.811 51.629 0.339   1.00 39.61 ? 357 ASP C C   1 
ATOM   5558 O O   . ASP C 1 39  ? -27.414 51.849 -0.798  1.00 40.08 ? 357 ASP C O   1 
ATOM   5559 C CB  . ASP C 1 39  ? -30.306 52.023 0.396   1.00 40.19 ? 357 ASP C CB  1 
ATOM   5560 C CG  . ASP C 1 39  ? -30.362 50.566 -0.013  1.00 44.80 ? 357 ASP C CG  1 
ATOM   5561 O OD1 . ASP C 1 39  ? -30.108 49.666 0.836   1.00 46.05 ? 357 ASP C OD1 1 
ATOM   5562 O OD2 . ASP C 1 39  ? -30.694 50.334 -1.197  1.00 46.94 ? 357 ASP C OD2 1 
ATOM   5563 N N   . ARG C 1 40  ? -27.266 50.709 1.118   1.00 40.63 ? 358 ARG C N   1 
ATOM   5564 C CA  . ARG C 1 40  ? -26.158 49.921 0.614   1.00 43.04 ? 358 ARG C CA  1 
ATOM   5565 C C   . ARG C 1 40  ? -26.613 48.631 -0.080  1.00 45.72 ? 358 ARG C C   1 
ATOM   5566 O O   . ARG C 1 40  ? -27.065 47.689 0.570   1.00 46.03 ? 358 ARG C O   1 
ATOM   5567 C CB  . ARG C 1 40  ? -25.146 49.623 1.714   1.00 42.70 ? 358 ARG C CB  1 
ATOM   5568 C CG  . ARG C 1 40  ? -23.912 48.891 1.223   1.00 42.93 ? 358 ARG C CG  1 
ATOM   5569 C CD  . ARG C 1 40  ? -22.766 49.019 2.219   1.00 43.59 ? 358 ARG C CD  1 
ATOM   5570 N NE  . ARG C 1 40  ? -21.579 48.244 1.847   1.00 42.31 ? 358 ARG C NE  1 
ATOM   5571 C CZ  . ARG C 1 40  ? -20.673 47.803 2.720   1.00 41.57 ? 358 ARG C CZ  1 
ATOM   5572 N NH1 . ARG C 1 40  ? -20.812 48.052 4.019   1.00 40.38 ? 358 ARG C NH1 1 
ATOM   5573 N NH2 . ARG C 1 40  ? -19.630 47.106 2.302   1.00 41.93 ? 358 ARG C NH2 1 
ATOM   5574 N N   . LYS C 1 41  ? -26.517 48.636 -1.412  1.00 48.05 ? 359 LYS C N   1 
ATOM   5575 C CA  . LYS C 1 41  ? -26.561 47.449 -2.255  1.00 49.78 ? 359 LYS C CA  1 
ATOM   5576 C C   . LYS C 1 41  ? -26.026 46.234 -1.503  1.00 52.19 ? 359 LYS C C   1 
ATOM   5577 O O   . LYS C 1 41  ? -24.940 46.290 -0.912  1.00 53.03 ? 359 LYS C O   1 
ATOM   5578 C CB  . LYS C 1 41  ? -25.711 47.719 -3.495  1.00 49.59 ? 359 LYS C CB  1 
ATOM   5579 C CG  . LYS C 1 41  ? -25.572 46.596 -4.521  1.00 50.45 ? 359 LYS C CG  1 
ATOM   5580 C CD  . LYS C 1 41  ? -25.351 47.258 -5.869  1.00 48.11 ? 359 LYS C CD  1 
ATOM   5581 C CE  . LYS C 1 41  ? -26.181 48.564 -5.886  1.00 45.99 ? 359 LYS C CE  1 
ATOM   5582 N NZ  . LYS C 1 41  ? -26.073 49.367 -7.126  1.00 42.08 ? 359 LYS C NZ  1 
ATOM   5583 N N   . GLY C 1 42  ? -26.786 45.137 -1.523  1.00 53.67 ? 360 GLY C N   1 
ATOM   5584 C CA  . GLY C 1 42  ? -26.421 43.945 -0.768  1.00 53.60 ? 360 GLY C CA  1 
ATOM   5585 C C   . GLY C 1 42  ? -27.135 43.893 0.570   1.00 54.36 ? 360 GLY C C   1 
ATOM   5586 O O   . GLY C 1 42  ? -27.920 42.979 0.824   1.00 54.40 ? 360 GLY C O   1 
ATOM   5587 N N   . THR C 1 43  ? -26.874 44.882 1.425   1.00 54.89 ? 361 THR C N   1 
ATOM   5588 C CA  . THR C 1 43  ? -27.401 44.873 2.792   1.00 55.11 ? 361 THR C CA  1 
ATOM   5589 C C   . THR C 1 43  ? -28.713 45.619 2.985   1.00 55.39 ? 361 THR C C   1 
ATOM   5590 O O   . THR C 1 43  ? -29.326 46.137 2.048   1.00 55.05 ? 361 THR C O   1 
ATOM   5591 C CB  . THR C 1 43  ? -26.399 45.443 3.826   1.00 55.08 ? 361 THR C CB  1 
ATOM   5592 O OG1 . THR C 1 43  ? -26.380 46.877 3.749   1.00 56.87 ? 361 THR C OG1 1 
ATOM   5593 C CG2 . THR C 1 43  ? -25.007 44.889 3.585   1.00 55.11 ? 361 THR C CG2 1 
ATOM   5594 N N   . GLU C 1 44  ? -29.128 45.652 4.242   1.00 56.07 ? 362 GLU C N   1 
ATOM   5595 C CA  . GLU C 1 44  ? -30.345 46.310 4.643   1.00 56.53 ? 362 GLU C CA  1 
ATOM   5596 C C   . GLU C 1 44  ? -29.916 47.671 5.142   1.00 55.51 ? 362 GLU C C   1 
ATOM   5597 O O   . GLU C 1 44  ? -30.749 48.502 5.508   1.00 56.63 ? 362 GLU C O   1 
ATOM   5598 C CB  . GLU C 1 44  ? -31.007 45.528 5.787   1.00 57.59 ? 362 GLU C CB  1 
ATOM   5599 C CG  . GLU C 1 44  ? -32.535 45.590 5.817   1.00 61.02 ? 362 GLU C CG  1 
ATOM   5600 C CD  . GLU C 1 44  ? -33.168 44.808 4.673   1.00 64.76 ? 362 GLU C CD  1 
ATOM   5601 O OE1 . GLU C 1 44  ? -33.931 45.417 3.891   1.00 61.75 ? 362 GLU C OE1 1 
ATOM   5602 O OE2 . GLU C 1 44  ? -32.886 43.590 4.550   1.00 67.48 ? 362 GLU C OE2 1 
ATOM   5603 N N   . GLU C 1 45  ? -28.606 47.900 5.141   1.00 53.21 ? 363 GLU C N   1 
ATOM   5604 C CA  . GLU C 1 45  ? -28.052 49.036 5.862   1.00 50.75 ? 363 GLU C CA  1 
ATOM   5605 C C   . GLU C 1 45  ? -28.002 50.340 5.096   1.00 47.65 ? 363 GLU C C   1 
ATOM   5606 O O   . GLU C 1 45  ? -27.662 50.377 3.920   1.00 48.54 ? 363 GLU C O   1 
ATOM   5607 C CB  . GLU C 1 45  ? -26.679 48.709 6.424   1.00 51.22 ? 363 GLU C CB  1 
ATOM   5608 C CG  . GLU C 1 45  ? -26.453 49.398 7.739   1.00 53.95 ? 363 GLU C CG  1 
ATOM   5609 C CD  . GLU C 1 45  ? -25.032 49.311 8.168   1.00 57.42 ? 363 GLU C CD  1 
ATOM   5610 O OE1 . GLU C 1 45  ? -24.341 48.390 7.671   1.00 58.55 ? 363 GLU C OE1 1 
ATOM   5611 O OE2 . GLU C 1 45  ? -24.611 50.160 8.985   1.00 57.05 ? 363 GLU C OE2 1 
ATOM   5612 N N   . LEU C 1 46  ? -28.323 51.408 5.814   1.00 44.18 ? 364 LEU C N   1 
ATOM   5613 C CA  . LEU C 1 46  ? -28.471 52.744 5.268   1.00 41.64 ? 364 LEU C CA  1 
ATOM   5614 C C   . LEU C 1 46  ? -27.326 53.653 5.721   1.00 40.69 ? 364 LEU C C   1 
ATOM   5615 O O   . LEU C 1 46  ? -26.840 53.526 6.842   1.00 41.93 ? 364 LEU C O   1 
ATOM   5616 C CB  . LEU C 1 46  ? -29.793 53.322 5.771   1.00 40.17 ? 364 LEU C CB  1 
ATOM   5617 C CG  . LEU C 1 46  ? -31.110 53.155 4.998   1.00 39.79 ? 364 LEU C CG  1 
ATOM   5618 C CD1 . LEU C 1 46  ? -31.236 51.846 4.218   1.00 39.84 ? 364 LEU C CD1 1 
ATOM   5619 C CD2 . LEU C 1 46  ? -32.304 53.353 5.931   1.00 36.24 ? 364 LEU C CD2 1 
ATOM   5620 N N   . TYR C 1 47  ? -26.901 54.579 4.866   1.00 39.42 ? 365 TYR C N   1 
ATOM   5621 C CA  . TYR C 1 47  ? -25.894 55.589 5.258   1.00 37.51 ? 365 TYR C CA  1 
ATOM   5622 C C   . TYR C 1 47  ? -26.310 57.030 4.919   1.00 36.10 ? 365 TYR C C   1 
ATOM   5623 O O   . TYR C 1 47  ? -27.147 57.264 4.040   1.00 37.14 ? 365 TYR C O   1 
ATOM   5624 C CB  . TYR C 1 47  ? -24.531 55.291 4.612   1.00 37.16 ? 365 TYR C CB  1 
ATOM   5625 C CG  . TYR C 1 47  ? -23.940 53.939 4.963   1.00 37.79 ? 365 TYR C CG  1 
ATOM   5626 C CD1 . TYR C 1 47  ? -24.427 52.779 4.390   1.00 36.15 ? 365 TYR C CD1 1 
ATOM   5627 C CD2 . TYR C 1 47  ? -22.890 53.830 5.876   1.00 40.65 ? 365 TYR C CD2 1 
ATOM   5628 C CE1 . TYR C 1 47  ? -23.888 51.560 4.705   1.00 38.45 ? 365 TYR C CE1 1 
ATOM   5629 C CE2 . TYR C 1 47  ? -22.340 52.611 6.196   1.00 34.45 ? 365 TYR C CE2 1 
ATOM   5630 C CZ  . TYR C 1 47  ? -22.843 51.480 5.611   1.00 37.24 ? 365 TYR C CZ  1 
ATOM   5631 O OH  . TYR C 1 47  ? -22.312 50.248 5.927   1.00 39.37 ? 365 TYR C OH  1 
ATOM   5632 N N   . ALA C 1 48  ? -25.733 58.004 5.612   1.00 33.74 ? 366 ALA C N   1 
ATOM   5633 C CA  . ALA C 1 48  ? -25.807 59.371 5.119   1.00 31.66 ? 366 ALA C CA  1 
ATOM   5634 C C   . ALA C 1 48  ? -24.515 59.674 4.339   1.00 31.11 ? 366 ALA C C   1 
ATOM   5635 O O   . ALA C 1 48  ? -23.406 59.333 4.758   1.00 30.08 ? 366 ALA C O   1 
ATOM   5636 C CB  . ALA C 1 48  ? -25.994 60.328 6.245   1.00 32.85 ? 366 ALA C CB  1 
ATOM   5637 N N   . ILE C 1 49  ? -24.653 60.288 3.179   1.00 29.94 ? 367 ILE C N   1 
ATOM   5638 C CA  . ILE C 1 49  ? -23.498 60.475 2.333   1.00 27.78 ? 367 ILE C CA  1 
ATOM   5639 C C   . ILE C 1 49  ? -23.388 61.919 1.949   1.00 27.12 ? 367 ILE C C   1 
ATOM   5640 O O   . ILE C 1 49  ? -24.183 62.415 1.184   1.00 27.84 ? 367 ILE C O   1 
ATOM   5641 C CB  . ILE C 1 49  ? -23.593 59.598 1.082   1.00 28.30 ? 367 ILE C CB  1 
ATOM   5642 C CG1 . ILE C 1 49  ? -23.859 58.144 1.515   1.00 26.97 ? 367 ILE C CG1 1 
ATOM   5643 C CG2 . ILE C 1 49  ? -22.321 59.738 0.239   1.00 24.20 ? 367 ILE C CG2 1 
ATOM   5644 C CD1 . ILE C 1 49  ? -23.639 57.101 0.450   1.00 23.97 ? 367 ILE C CD1 1 
ATOM   5645 N N   . LYS C 1 50  ? -22.414 62.615 2.515   1.00 27.13 ? 368 LYS C N   1 
ATOM   5646 C CA  . LYS C 1 50  ? -22.187 64.000 2.139   1.00 24.62 ? 368 LYS C CA  1 
ATOM   5647 C C   . LYS C 1 50  ? -21.477 64.004 0.816   1.00 23.63 ? 368 LYS C C   1 
ATOM   5648 O O   . LYS C 1 50  ? -20.493 63.282 0.642   1.00 24.64 ? 368 LYS C O   1 
ATOM   5649 C CB  . LYS C 1 50  ? -21.341 64.705 3.182   1.00 23.89 ? 368 LYS C CB  1 
ATOM   5650 C CG  . LYS C 1 50  ? -20.909 66.080 2.722   1.00 26.90 ? 368 LYS C CG  1 
ATOM   5651 C CD  . LYS C 1 50  ? -20.312 66.890 3.849   1.00 25.18 ? 368 LYS C CD  1 
ATOM   5652 C CE  . LYS C 1 50  ? -19.471 68.036 3.327   1.00 22.19 ? 368 LYS C CE  1 
ATOM   5653 N NZ  . LYS C 1 50  ? -19.071 68.843 4.515   1.00 30.57 ? 368 LYS C NZ  1 
ATOM   5654 N N   . ILE C 1 51  ? -21.972 64.792 -0.124  1.00 22.19 ? 369 ILE C N   1 
ATOM   5655 C CA  . ILE C 1 51  ? -21.360 64.863 -1.440  1.00 21.45 ? 369 ILE C CA  1 
ATOM   5656 C C   . ILE C 1 51  ? -20.920 66.275 -1.713  1.00 21.80 ? 369 ILE C C   1 
ATOM   5657 O O   . ILE C 1 51  ? -21.659 67.215 -1.454  1.00 21.62 ? 369 ILE C O   1 
ATOM   5658 C CB  . ILE C 1 51  ? -22.366 64.513 -2.526  1.00 22.89 ? 369 ILE C CB  1 
ATOM   5659 C CG1 . ILE C 1 51  ? -22.905 63.086 -2.333  1.00 25.99 ? 369 ILE C CG1 1 
ATOM   5660 C CG2 . ILE C 1 51  ? -21.762 64.690 -3.907  1.00 19.63 ? 369 ILE C CG2 1 
ATOM   5661 C CD1 . ILE C 1 51  ? -23.832 62.644 -3.479  1.00 26.46 ? 369 ILE C CD1 1 
ATOM   5662 N N   . LEU C 1 52  ? -19.713 66.429 -2.239  1.00 22.82 ? 370 LEU C N   1 
ATOM   5663 C CA  . LEU C 1 52  ? -19.252 67.715 -2.726  1.00 21.57 ? 370 LEU C CA  1 
ATOM   5664 C C   . LEU C 1 52  ? -18.794 67.629 -4.170  1.00 23.29 ? 370 LEU C C   1 
ATOM   5665 O O   . LEU C 1 52  ? -18.197 66.623 -4.596  1.00 20.85 ? 370 LEU C O   1 
ATOM   5666 C CB  . LEU C 1 52  ? -18.081 68.198 -1.899  1.00 20.57 ? 370 LEU C CB  1 
ATOM   5667 C CG  . LEU C 1 52  ? -18.426 68.423 -0.440  1.00 20.17 ? 370 LEU C CG  1 
ATOM   5668 C CD1 . LEU C 1 52  ? -17.186 68.823 0.334   1.00 18.08 ? 370 LEU C CD1 1 
ATOM   5669 C CD2 . LEU C 1 52  ? -19.501 69.455 -0.322  1.00 11.79 ? 370 LEU C CD2 1 
ATOM   5670 N N   . LYS C 1 53  ? -19.084 68.701 -4.912  1.00 25.09 ? 371 LYS C N   1 
ATOM   5671 C CA  . LYS C 1 53  ? -18.510 68.938 -6.231  1.00 25.01 ? 371 LYS C CA  1 
ATOM   5672 C C   . LYS C 1 53  ? -17.153 69.643 -6.030  1.00 25.35 ? 371 LYS C C   1 
ATOM   5673 O O   . LYS C 1 53  ? -17.083 70.779 -5.516  1.00 24.76 ? 371 LYS C O   1 
ATOM   5674 C CB  . LYS C 1 53  ? -19.425 69.858 -7.031  1.00 25.17 ? 371 LYS C CB  1 
ATOM   5675 C CG  . LYS C 1 53  ? -20.597 69.229 -7.835  1.00 29.75 ? 371 LYS C CG  1 
ATOM   5676 C CD  . LYS C 1 53  ? -21.419 70.390 -8.508  1.00 31.47 ? 371 LYS C CD  1 
ATOM   5677 C CE  . LYS C 1 53  ? -22.202 70.001 -9.780  1.00 35.98 ? 371 LYS C CE  1 
ATOM   5678 N NZ  . LYS C 1 53  ? -23.585 69.409 -9.525  1.00 39.80 ? 371 LYS C NZ  1 
ATOM   5679 N N   . LYS C 1 54  ? -16.076 68.982 -6.447  1.00 24.86 ? 372 LYS C N   1 
ATOM   5680 C CA  . LYS C 1 54  ? -14.733 69.542 -6.282  1.00 24.14 ? 372 LYS C CA  1 
ATOM   5681 C C   . LYS C 1 54  ? -14.627 70.971 -6.797  1.00 24.98 ? 372 LYS C C   1 
ATOM   5682 O O   . LYS C 1 54  ? -14.076 71.836 -6.121  1.00 26.13 ? 372 LYS C O   1 
ATOM   5683 C CB  . LYS C 1 54  ? -13.698 68.673 -6.972  1.00 22.14 ? 372 LYS C CB  1 
ATOM   5684 C CG  . LYS C 1 54  ? -13.390 67.407 -6.237  1.00 22.07 ? 372 LYS C CG  1 
ATOM   5685 C CD  . LYS C 1 54  ? -12.466 66.535 -7.070  1.00 25.89 ? 372 LYS C CD  1 
ATOM   5686 C CE  . LYS C 1 54  ? -12.220 65.172 -6.431  1.00 24.68 ? 372 LYS C CE  1 
ATOM   5687 N NZ  . LYS C 1 54  ? -11.330 64.349 -7.303  1.00 22.93 ? 372 LYS C NZ  1 
ATOM   5688 N N   . ASP C 1 55  ? -15.159 71.229 -7.983  1.00 25.16 ? 373 ASP C N   1 
ATOM   5689 C CA  . ASP C 1 55  ? -15.030 72.557 -8.542  1.00 26.93 ? 373 ASP C CA  1 
ATOM   5690 C C   . ASP C 1 55  ? -15.818 73.570 -7.739  1.00 26.57 ? 373 ASP C C   1 
ATOM   5691 O O   . ASP C 1 55  ? -15.415 74.732 -7.674  1.00 28.61 ? 373 ASP C O   1 
ATOM   5692 C CB  . ASP C 1 55  ? -15.435 72.609 -10.013 1.00 28.37 ? 373 ASP C CB  1 
ATOM   5693 C CG  . ASP C 1 55  ? -16.900 72.282 -10.222 1.00 38.58 ? 373 ASP C CG  1 
ATOM   5694 O OD1 . ASP C 1 55  ? -17.432 71.453 -9.438  1.00 48.10 ? 373 ASP C OD1 1 
ATOM   5695 O OD2 . ASP C 1 55  ? -17.521 72.848 -11.162 1.00 42.52 ? 373 ASP C OD2 1 
ATOM   5696 N N   . VAL C 1 56  ? -16.934 73.167 -7.129  1.00 24.86 ? 374 VAL C N   1 
ATOM   5697 C CA  . VAL C 1 56  ? -17.628 74.119 -6.256  1.00 22.54 ? 374 VAL C CA  1 
ATOM   5698 C C   . VAL C 1 56  ? -16.794 74.353 -4.997  1.00 22.08 ? 374 VAL C C   1 
ATOM   5699 O O   . VAL C 1 56  ? -16.499 75.501 -4.643  1.00 21.64 ? 374 VAL C O   1 
ATOM   5700 C CB  . VAL C 1 56  ? -19.021 73.655 -5.807  1.00 23.11 ? 374 VAL C CB  1 
ATOM   5701 C CG1 . VAL C 1 56  ? -19.585 74.642 -4.788  1.00 18.16 ? 374 VAL C CG1 1 
ATOM   5702 C CG2 . VAL C 1 56  ? -19.946 73.476 -6.971  1.00 16.89 ? 374 VAL C CG2 1 
ATOM   5703 N N   . VAL C 1 57  ? -16.420 73.266 -4.324  1.00 19.64 ? 375 VAL C N   1 
ATOM   5704 C CA  . VAL C 1 57  ? -15.542 73.389 -3.175  1.00 20.70 ? 375 VAL C CA  1 
ATOM   5705 C C   . VAL C 1 57  ? -14.408 74.397 -3.459  1.00 22.12 ? 375 VAL C C   1 
ATOM   5706 O O   . VAL C 1 57  ? -14.090 75.259 -2.611  1.00 20.40 ? 375 VAL C O   1 
ATOM   5707 C CB  . VAL C 1 57  ? -14.950 72.024 -2.760  1.00 21.00 ? 375 VAL C CB  1 
ATOM   5708 C CG1 . VAL C 1 57  ? -13.628 72.205 -2.000  1.00 19.84 ? 375 VAL C CG1 1 
ATOM   5709 C CG2 . VAL C 1 57  ? -15.940 71.259 -1.920  1.00 18.84 ? 375 VAL C CG2 1 
ATOM   5710 N N   . ILE C 1 58  ? -13.828 74.300 -4.658  1.00 22.55 ? 376 ILE C N   1 
ATOM   5711 C CA  . ILE C 1 58  ? -12.681 75.127 -5.030  1.00 25.84 ? 376 ILE C CA  1 
ATOM   5712 C C   . ILE C 1 58  ? -13.001 76.604 -5.273  1.00 27.89 ? 376 ILE C C   1 
ATOM   5713 O O   . ILE C 1 58  ? -12.280 77.462 -4.787  1.00 29.05 ? 376 ILE C O   1 
ATOM   5714 C CB  . ILE C 1 58  ? -11.909 74.533 -6.231  1.00 28.05 ? 376 ILE C CB  1 
ATOM   5715 C CG1 . ILE C 1 58  ? -11.376 73.142 -5.863  1.00 26.45 ? 376 ILE C CG1 1 
ATOM   5716 C CG2 . ILE C 1 58  ? -10.781 75.476 -6.679  1.00 24.20 ? 376 ILE C CG2 1 
ATOM   5717 C CD1 . ILE C 1 58  ? -10.311 72.642 -6.742  1.00 22.17 ? 376 ILE C CD1 1 
ATOM   5718 N N   . GLN C 1 59  ? -14.084 76.901 -5.988  1.00 30.10 ? 377 GLN C N   1 
ATOM   5719 C CA  . GLN C 1 59  ? -14.581 78.277 -6.111  1.00 32.82 ? 377 GLN C CA  1 
ATOM   5720 C C   . GLN C 1 59  ? -14.950 78.923 -4.767  1.00 33.31 ? 377 GLN C C   1 
ATOM   5721 O O   . GLN C 1 59  ? -15.075 80.144 -4.656  1.00 33.65 ? 377 GLN C O   1 
ATOM   5722 C CB  . GLN C 1 59  ? -15.825 78.328 -7.006  1.00 34.76 ? 377 GLN C CB  1 
ATOM   5723 C CG  . GLN C 1 59  ? -15.666 77.763 -8.413  1.00 43.89 ? 377 GLN C CG  1 
ATOM   5724 C CD  . GLN C 1 59  ? -14.861 78.681 -9.320  1.00 53.43 ? 377 GLN C CD  1 
ATOM   5725 O OE1 . GLN C 1 59  ? -13.982 79.411 -8.852  1.00 55.58 ? 377 GLN C OE1 1 
ATOM   5726 N NE2 . GLN C 1 59  ? -15.152 78.643 -10.628 1.00 52.27 ? 377 GLN C NE2 1 
ATOM   5727 N N   . ASP C 1 60  ? -15.170 78.119 -3.743  1.00 33.97 ? 378 ASP C N   1 
ATOM   5728 C CA  . ASP C 1 60  ? -15.628 78.693 -2.498  1.00 33.66 ? 378 ASP C CA  1 
ATOM   5729 C C   . ASP C 1 60  ? -14.506 78.741 -1.485  1.00 33.86 ? 378 ASP C C   1 
ATOM   5730 O O   . ASP C 1 60  ? -14.736 78.867 -0.293  1.00 34.58 ? 378 ASP C O   1 
ATOM   5731 C CB  . ASP C 1 60  ? -16.832 77.916 -1.974  1.00 33.88 ? 378 ASP C CB  1 
ATOM   5732 C CG  . ASP C 1 60  ? -18.020 77.969 -2.929  1.00 36.48 ? 378 ASP C CG  1 
ATOM   5733 O OD1 . ASP C 1 60  ? -17.996 78.783 -3.886  1.00 34.55 ? 378 ASP C OD1 1 
ATOM   5734 O OD2 . ASP C 1 60  ? -18.976 77.194 -2.728  1.00 35.91 ? 378 ASP C OD2 1 
ATOM   5735 N N   . ASP C 1 61  ? -13.275 78.663 -1.959  1.00 34.08 ? 379 ASP C N   1 
ATOM   5736 C CA  . ASP C 1 61  ? -12.150 78.569 -1.033  1.00 34.51 ? 379 ASP C CA  1 
ATOM   5737 C C   . ASP C 1 61  ? -12.417 77.641 0.130   1.00 33.49 ? 379 ASP C C   1 
ATOM   5738 O O   . ASP C 1 61  ? -11.976 77.934 1.236   1.00 34.54 ? 379 ASP C O   1 
ATOM   5739 C CB  . ASP C 1 61  ? -11.841 79.914 -0.403  1.00 34.92 ? 379 ASP C CB  1 
ATOM   5740 C CG  . ASP C 1 61  ? -11.424 80.941 -1.395  1.00 35.16 ? 379 ASP C CG  1 
ATOM   5741 O OD1 . ASP C 1 61  ? -10.842 80.565 -2.430  1.00 31.65 ? 379 ASP C OD1 1 
ATOM   5742 O OD2 . ASP C 1 61  ? -11.682 82.136 -1.115  1.00 40.95 ? 379 ASP C OD2 1 
ATOM   5743 N N   . ASP C 1 62  ? -13.131 76.543 -0.087  1.00 32.74 ? 380 ASP C N   1 
ATOM   5744 C CA  . ASP C 1 62  ? -13.381 75.590 1.010   1.00 31.35 ? 380 ASP C CA  1 
ATOM   5745 C C   . ASP C 1 62  ? -12.499 74.323 1.047   1.00 28.56 ? 380 ASP C C   1 
ATOM   5746 O O   . ASP C 1 62  ? -12.688 73.466 1.878   1.00 25.96 ? 380 ASP C O   1 
ATOM   5747 C CB  . ASP C 1 62  ? -14.855 75.220 1.034   1.00 32.43 ? 380 ASP C CB  1 
ATOM   5748 C CG  . ASP C 1 62  ? -15.733 76.391 1.426   1.00 36.92 ? 380 ASP C CG  1 
ATOM   5749 O OD1 . ASP C 1 62  ? -15.238 77.271 2.169   1.00 39.50 ? 380 ASP C OD1 1 
ATOM   5750 O OD2 . ASP C 1 62  ? -16.916 76.430 1.001   1.00 39.17 ? 380 ASP C OD2 1 
ATOM   5751 N N   . VAL C 1 63  ? -11.528 74.212 0.153   1.00 28.24 ? 381 VAL C N   1 
ATOM   5752 C CA  . VAL C 1 63  ? -10.683 73.029 0.114   1.00 27.69 ? 381 VAL C CA  1 
ATOM   5753 C C   . VAL C 1 63  ? -10.113 72.674 1.483   1.00 29.42 ? 381 VAL C C   1 
ATOM   5754 O O   . VAL C 1 63  ? -10.245 71.560 1.961   1.00 30.89 ? 381 VAL C O   1 
ATOM   5755 C CB  . VAL C 1 63  ? -9.517  73.213 -0.862  1.00 25.54 ? 381 VAL C CB  1 
ATOM   5756 C CG1 . VAL C 1 63  ? -8.368  72.282 -0.494  1.00 23.11 ? 381 VAL C CG1 1 
ATOM   5757 C CG2 . VAL C 1 63  ? -9.985  72.943 -2.255  1.00 24.33 ? 381 VAL C CG2 1 
ATOM   5758 N N   . GLU C 1 64  ? -9.462  73.649 2.089   1.00 31.57 ? 382 GLU C N   1 
ATOM   5759 C CA  . GLU C 1 64  ? -8.782  73.506 3.350   1.00 31.88 ? 382 GLU C CA  1 
ATOM   5760 C C   . GLU C 1 64  ? -9.745  72.957 4.378   1.00 30.88 ? 382 GLU C C   1 
ATOM   5761 O O   . GLU C 1 64  ? -9.499  71.924 5.011   1.00 31.04 ? 382 GLU C O   1 
ATOM   5762 C CB  . GLU C 1 64  ? -8.252  74.889 3.750   1.00 33.78 ? 382 GLU C CB  1 
ATOM   5763 C CG  . GLU C 1 64  ? -8.289  75.225 5.215   1.00 41.08 ? 382 GLU C CG  1 
ATOM   5764 C CD  . GLU C 1 64  ? -7.058  74.740 5.922   1.00 53.61 ? 382 GLU C CD  1 
ATOM   5765 O OE1 . GLU C 1 64  ? -6.598  73.621 5.585   1.00 58.63 ? 382 GLU C OE1 1 
ATOM   5766 O OE2 . GLU C 1 64  ? -6.546  75.470 6.810   1.00 58.37 ? 382 GLU C OE2 1 
ATOM   5767 N N   . CYS C 1 65  ? -10.872 73.621 4.536   1.00 29.15 ? 383 CYS C N   1 
ATOM   5768 C CA  . CYS C 1 65  ? -11.768 73.154 5.553   1.00 29.79 ? 383 CYS C CA  1 
ATOM   5769 C C   . CYS C 1 65  ? -12.465 71.839 5.144   1.00 27.48 ? 383 CYS C C   1 
ATOM   5770 O O   . CYS C 1 65  ? -12.947 71.096 5.998   1.00 28.12 ? 383 CYS C O   1 
ATOM   5771 C CB  . CYS C 1 65  ? -12.726 74.261 5.944   1.00 28.64 ? 383 CYS C CB  1 
ATOM   5772 S SG  . CYS C 1 65  ? -13.650 74.721 4.555   1.00 44.20 ? 383 CYS C SG  1 
ATOM   5773 N N   . THR C 1 66  ? -12.477 71.505 3.862   1.00 26.11 ? 384 THR C N   1 
ATOM   5774 C CA  . THR C 1 66  ? -12.886 70.159 3.507   1.00 26.00 ? 384 THR C CA  1 
ATOM   5775 C C   . THR C 1 66  ? -11.890 69.138 4.024   1.00 27.95 ? 384 THR C C   1 
ATOM   5776 O O   . THR C 1 66  ? -12.304 68.105 4.537   1.00 31.91 ? 384 THR C O   1 
ATOM   5777 C CB  . THR C 1 66  ? -13.065 69.894 2.007   1.00 25.72 ? 384 THR C CB  1 
ATOM   5778 O OG1 . THR C 1 66  ? -14.210 70.590 1.505   1.00 25.65 ? 384 THR C OG1 1 
ATOM   5779 C CG2 . THR C 1 66  ? -13.347 68.412 1.809   1.00 28.44 ? 384 THR C CG2 1 
ATOM   5780 N N   . MET C 1 67  ? -10.587 69.387 3.893   1.00 27.19 ? 385 MET C N   1 
ATOM   5781 C CA  . MET C 1 67  ? -9.621  68.381 4.328   1.00 26.40 ? 385 MET C CA  1 
ATOM   5782 C C   . MET C 1 67  ? -9.620  68.271 5.837   1.00 26.43 ? 385 MET C C   1 
ATOM   5783 O O   . MET C 1 67  ? -9.402  67.192 6.392   1.00 27.83 ? 385 MET C O   1 
ATOM   5784 C CB  . MET C 1 67  ? -8.205  68.649 3.817   1.00 26.63 ? 385 MET C CB  1 
ATOM   5785 C CG  . MET C 1 67  ? -8.072  68.603 2.303   1.00 28.68 ? 385 MET C CG  1 
ATOM   5786 S SD  . MET C 1 67  ? -8.775  67.162 1.472   1.00 29.48 ? 385 MET C SD  1 
ATOM   5787 C CE  . MET C 1 67  ? -7.531  65.903 1.798   1.00 16.76 ? 385 MET C CE  1 
ATOM   5788 N N   . VAL C 1 68  ? -9.872  69.384 6.507   1.00 25.21 ? 386 VAL C N   1 
ATOM   5789 C CA  . VAL C 1 68  ? -9.915  69.358 7.954   1.00 24.26 ? 386 VAL C CA  1 
ATOM   5790 C C   . VAL C 1 68  ? -11.081 68.493 8.427   1.00 24.65 ? 386 VAL C C   1 
ATOM   5791 O O   . VAL C 1 68  ? -10.908 67.637 9.293   1.00 26.01 ? 386 VAL C O   1 
ATOM   5792 C CB  . VAL C 1 68  ? -10.052 70.758 8.540   1.00 24.51 ? 386 VAL C CB  1 
ATOM   5793 C CG1 . VAL C 1 68  ? -10.223 70.662 10.019  1.00 24.81 ? 386 VAL C CG1 1 
ATOM   5794 C CG2 . VAL C 1 68  ? -8.850  71.620 8.189   1.00 21.49 ? 386 VAL C CG2 1 
ATOM   5795 N N   . GLU C 1 69  ? -12.259 68.689 7.843   1.00 24.22 ? 387 GLU C N   1 
ATOM   5796 C CA  . GLU C 1 69  ? -13.426 67.927 8.262   1.00 24.74 ? 387 GLU C CA  1 
ATOM   5797 C C   . GLU C 1 69  ? -13.113 66.446 8.150   1.00 24.69 ? 387 GLU C C   1 
ATOM   5798 O O   . GLU C 1 69  ? -13.457 65.653 9.042   1.00 24.00 ? 387 GLU C O   1 
ATOM   5799 C CB  . GLU C 1 69  ? -14.656 68.280 7.427   1.00 25.34 ? 387 GLU C CB  1 
ATOM   5800 C CG  . GLU C 1 69  ? -15.956 67.822 8.056   1.00 29.22 ? 387 GLU C CG  1 
ATOM   5801 C CD  . GLU C 1 69  ? -17.165 67.950 7.126   1.00 36.23 ? 387 GLU C CD  1 
ATOM   5802 O OE1 . GLU C 1 69  ? -17.040 68.591 6.067   1.00 34.69 ? 387 GLU C OE1 1 
ATOM   5803 O OE2 . GLU C 1 69  ? -18.252 67.411 7.460   1.00 40.95 ? 387 GLU C OE2 1 
ATOM   5804 N N   . LYS C 1 70  ? -12.429 66.090 7.063   1.00 23.41 ? 388 LYS C N   1 
ATOM   5805 C CA  . LYS C 1 70  ? -12.023 64.721 6.827   1.00 22.37 ? 388 LYS C CA  1 
ATOM   5806 C C   . LYS C 1 70  ? -11.052 64.271 7.909   1.00 24.10 ? 388 LYS C C   1 
ATOM   5807 O O   . LYS C 1 70  ? -11.294 63.284 8.584   1.00 25.13 ? 388 LYS C O   1 
ATOM   5808 C CB  . LYS C 1 70  ? -11.431 64.588 5.425   1.00 22.61 ? 388 LYS C CB  1 
ATOM   5809 C CG  . LYS C 1 70  ? -11.044 63.171 4.998   1.00 23.47 ? 388 LYS C CG  1 
ATOM   5810 C CD  . LYS C 1 70  ? -9.576  62.870 5.350   1.00 27.53 ? 388 LYS C CD  1 
ATOM   5811 C CE  . LYS C 1 70  ? -9.219  61.429 5.043   1.00 29.50 ? 388 LYS C CE  1 
ATOM   5812 N NZ  . LYS C 1 70  ? -7.753  61.214 4.909   1.00 31.48 ? 388 LYS C NZ  1 
ATOM   5813 N N   . ARG C 1 71  ? -9.961  64.995 8.110   1.00 25.75 ? 389 ARG C N   1 
ATOM   5814 C CA  . ARG C 1 71  ? -9.034  64.616 9.175   1.00 26.91 ? 389 ARG C CA  1 
ATOM   5815 C C   . ARG C 1 71  ? -9.769  64.467 10.500  1.00 27.75 ? 389 ARG C C   1 
ATOM   5816 O O   . ARG C 1 71  ? -9.490  63.546 11.273  1.00 30.43 ? 389 ARG C O   1 
ATOM   5817 C CB  . ARG C 1 71  ? -7.884  65.625 9.318   1.00 26.77 ? 389 ARG C CB  1 
ATOM   5818 C CG  . ARG C 1 71  ? -6.859  65.522 8.202   1.00 24.63 ? 389 ARG C CG  1 
ATOM   5819 C CD  . ARG C 1 71  ? -5.604  66.301 8.493   1.00 28.22 ? 389 ARG C CD  1 
ATOM   5820 N NE  . ARG C 1 71  ? -5.753  67.724 8.199   1.00 29.70 ? 389 ARG C NE  1 
ATOM   5821 C CZ  . ARG C 1 71  ? -5.909  68.215 6.975   1.00 30.95 ? 389 ARG C CZ  1 
ATOM   5822 N NH1 . ARG C 1 71  ? -5.950  67.394 5.926   1.00 32.93 ? 389 ARG C NH1 1 
ATOM   5823 N NH2 . ARG C 1 71  ? -6.043  69.521 6.799   1.00 27.95 ? 389 ARG C NH2 1 
ATOM   5824 N N   . VAL C 1 72  ? -10.717 65.360 10.769  1.00 25.77 ? 390 VAL C N   1 
ATOM   5825 C CA  . VAL C 1 72  ? -11.411 65.308 12.052  1.00 23.59 ? 390 VAL C CA  1 
ATOM   5826 C C   . VAL C 1 72  ? -12.338 64.113 12.122  1.00 24.32 ? 390 VAL C C   1 
ATOM   5827 O O   . VAL C 1 72  ? -12.390 63.443 13.143  1.00 25.55 ? 390 VAL C O   1 
ATOM   5828 C CB  . VAL C 1 72  ? -12.223 66.583 12.349  1.00 22.73 ? 390 VAL C CB  1 
ATOM   5829 C CG1 . VAL C 1 72  ? -13.175 66.338 13.502  1.00 17.21 ? 390 VAL C CG1 1 
ATOM   5830 C CG2 . VAL C 1 72  ? -11.299 67.764 12.626  1.00 18.53 ? 390 VAL C CG2 1 
ATOM   5831 N N   . LEU C 1 73  ? -13.075 63.840 11.049  1.00 23.48 ? 391 LEU C N   1 
ATOM   5832 C CA  . LEU C 1 73  ? -13.954 62.678 11.061  1.00 23.96 ? 391 LEU C CA  1 
ATOM   5833 C C   . LEU C 1 73  ? -13.113 61.408 11.064  1.00 24.53 ? 391 LEU C C   1 
ATOM   5834 O O   . LEU C 1 73  ? -13.576 60.356 11.494  1.00 26.02 ? 391 LEU C O   1 
ATOM   5835 C CB  . LEU C 1 73  ? -14.915 62.655 9.860   1.00 23.36 ? 391 LEU C CB  1 
ATOM   5836 C CG  . LEU C 1 73  ? -16.071 63.655 9.702   1.00 23.99 ? 391 LEU C CG  1 
ATOM   5837 C CD1 . LEU C 1 73  ? -16.676 63.672 8.276   1.00 18.57 ? 391 LEU C CD1 1 
ATOM   5838 C CD2 . LEU C 1 73  ? -17.149 63.366 10.715  1.00 23.63 ? 391 LEU C CD2 1 
ATOM   5839 N N   . ALA C 1 74  ? -11.878 61.493 10.585  1.00 24.05 ? 392 ALA C N   1 
ATOM   5840 C CA  . ALA C 1 74  ? -11.074 60.277 10.458  1.00 24.41 ? 392 ALA C CA  1 
ATOM   5841 C C   . ALA C 1 74  ? -10.247 59.935 11.698  1.00 24.71 ? 392 ALA C C   1 
ATOM   5842 O O   . ALA C 1 74  ? -9.638  58.862 11.752  1.00 26.23 ? 392 ALA C O   1 
ATOM   5843 C CB  . ALA C 1 74  ? -10.208 60.308 9.232   1.00 22.23 ? 392 ALA C CB  1 
ATOM   5844 N N   . LEU C 1 75  ? -10.259 60.807 12.702  1.00 24.05 ? 393 LEU C N   1 
ATOM   5845 C CA  . LEU C 1 75  ? -9.569  60.517 13.964  1.00 25.25 ? 393 LEU C CA  1 
ATOM   5846 C C   . LEU C 1 75  ? -9.876  59.120 14.505  1.00 26.95 ? 393 LEU C C   1 
ATOM   5847 O O   . LEU C 1 75  ? -10.902 58.538 14.192  1.00 28.66 ? 393 LEU C O   1 
ATOM   5848 C CB  . LEU C 1 75  ? -9.936  61.564 15.002  1.00 24.50 ? 393 LEU C CB  1 
ATOM   5849 C CG  . LEU C 1 75  ? -9.391  62.949 14.668  1.00 22.15 ? 393 LEU C CG  1 
ATOM   5850 C CD1 . LEU C 1 75  ? -10.031 63.987 15.570  1.00 24.53 ? 393 LEU C CD1 1 
ATOM   5851 C CD2 . LEU C 1 75  ? -7.901  62.947 14.858  1.00 14.04 ? 393 LEU C CD2 1 
ATOM   5852 N N   . LEU C 1 76  ? -8.980  58.572 15.313  1.00 29.13 ? 394 LEU C N   1 
ATOM   5853 C CA  . LEU C 1 76  ? -9.235  57.279 15.946  1.00 30.79 ? 394 LEU C CA  1 
ATOM   5854 C C   . LEU C 1 76  ? -9.820  57.515 17.320  1.00 31.51 ? 394 LEU C C   1 
ATOM   5855 O O   . LEU C 1 76  ? -9.582  58.562 17.940  1.00 31.20 ? 394 LEU C O   1 
ATOM   5856 C CB  . LEU C 1 76  ? -7.940  56.481 16.106  1.00 31.18 ? 394 LEU C CB  1 
ATOM   5857 C CG  . LEU C 1 76  ? -7.103  56.294 14.837  1.00 35.85 ? 394 LEU C CG  1 
ATOM   5858 C CD1 . LEU C 1 76  ? -5.607  56.530 15.095  1.00 38.22 ? 394 LEU C CD1 1 
ATOM   5859 C CD2 . LEU C 1 76  ? -7.375  54.934 14.186  1.00 35.11 ? 394 LEU C CD2 1 
ATOM   5860 N N   . ASP C 1 77  ? -10.573 56.532 17.796  1.00 32.00 ? 395 ASP C N   1 
ATOM   5861 C CA  . ASP C 1 77  ? -11.008 56.503 19.183  1.00 32.65 ? 395 ASP C CA  1 
ATOM   5862 C C   . ASP C 1 77  ? -11.994 57.580 19.446  1.00 33.07 ? 395 ASP C C   1 
ATOM   5863 O O   . ASP C 1 77  ? -12.029 58.134 20.544  1.00 34.28 ? 395 ASP C O   1 
ATOM   5864 C CB  . ASP C 1 77  ? -9.816  56.684 20.112  1.00 32.10 ? 395 ASP C CB  1 
ATOM   5865 C CG  . ASP C 1 77  ? -8.853  55.536 20.015  1.00 32.83 ? 395 ASP C CG  1 
ATOM   5866 O OD1 . ASP C 1 77  ? -9.335  54.386 20.098  1.00 33.28 ? 395 ASP C OD1 1 
ATOM   5867 O OD2 . ASP C 1 77  ? -7.635  55.772 19.839  1.00 32.10 ? 395 ASP C OD2 1 
ATOM   5868 N N   . LYS C 1 78  ? -12.766 57.904 18.418  1.00 33.72 ? 396 LYS C N   1 
ATOM   5869 C CA  . LYS C 1 78  ? -13.777 58.935 18.528  1.00 34.03 ? 396 LYS C CA  1 
ATOM   5870 C C   . LYS C 1 78  ? -14.832 58.362 19.436  1.00 33.44 ? 396 LYS C C   1 
ATOM   5871 O O   . LYS C 1 78  ? -15.172 57.187 19.314  1.00 33.93 ? 396 LYS C O   1 
ATOM   5872 C CB  . LYS C 1 78  ? -14.365 59.301 17.147  1.00 34.76 ? 396 LYS C CB  1 
ATOM   5873 C CG  . LYS C 1 78  ? -13.577 60.391 16.369  1.00 35.29 ? 396 LYS C CG  1 
ATOM   5874 C CD  . LYS C 1 78  ? -13.850 60.361 14.872  1.00 36.47 ? 396 LYS C CD  1 
ATOM   5875 C CE  . LYS C 1 78  ? -15.350 60.426 14.570  1.00 37.08 ? 396 LYS C CE  1 
ATOM   5876 N NZ  . LYS C 1 78  ? -15.713 59.544 13.404  1.00 39.40 ? 396 LYS C NZ  1 
ATOM   5877 N N   . PRO C 1 79  ? -15.321 59.176 20.378  1.00 32.81 ? 397 PRO C N   1 
ATOM   5878 C CA  . PRO C 1 79  ? -16.454 58.834 21.225  1.00 32.61 ? 397 PRO C CA  1 
ATOM   5879 C C   . PRO C 1 79  ? -17.660 58.462 20.357  1.00 32.10 ? 397 PRO C C   1 
ATOM   5880 O O   . PRO C 1 79  ? -17.683 58.788 19.167  1.00 32.77 ? 397 PRO C O   1 
ATOM   5881 C CB  . PRO C 1 79  ? -16.728 60.144 21.969  1.00 33.19 ? 397 PRO C CB  1 
ATOM   5882 C CG  . PRO C 1 79  ? -15.432 60.841 21.991  1.00 33.85 ? 397 PRO C CG  1 
ATOM   5883 C CD  . PRO C 1 79  ? -14.781 60.508 20.681  1.00 32.57 ? 397 PRO C CD  1 
ATOM   5884 N N   . PRO C 1 80  ? -18.674 57.797 20.934  1.00 31.37 ? 398 PRO C N   1 
ATOM   5885 C CA  . PRO C 1 80  ? -19.803 57.490 20.055  1.00 30.10 ? 398 PRO C CA  1 
ATOM   5886 C C   . PRO C 1 80  ? -20.749 58.694 19.911  1.00 29.30 ? 398 PRO C C   1 
ATOM   5887 O O   . PRO C 1 80  ? -21.743 58.614 19.176  1.00 29.47 ? 398 PRO C O   1 
ATOM   5888 C CB  . PRO C 1 80  ? -20.482 56.319 20.759  1.00 28.97 ? 398 PRO C CB  1 
ATOM   5889 C CG  . PRO C 1 80  ? -20.193 56.553 22.222  1.00 31.24 ? 398 PRO C CG  1 
ATOM   5890 C CD  . PRO C 1 80  ? -18.932 57.406 22.332  1.00 31.37 ? 398 PRO C CD  1 
ATOM   5891 N N   . PHE C 1 81  ? -20.417 59.803 20.580  1.00 27.21 ? 399 PHE C N   1 
ATOM   5892 C CA  . PHE C 1 81  ? -21.194 61.044 20.460  1.00 27.21 ? 399 PHE C CA  1 
ATOM   5893 C C   . PHE C 1 81  ? -20.792 61.955 19.295  1.00 25.55 ? 399 PHE C C   1 
ATOM   5894 O O   . PHE C 1 81  ? -21.409 62.981 19.067  1.00 26.04 ? 399 PHE C O   1 
ATOM   5895 C CB  . PHE C 1 81  ? -21.203 61.817 21.788  1.00 28.40 ? 399 PHE C CB  1 
ATOM   5896 C CG  . PHE C 1 81  ? -21.467 60.943 22.964  1.00 31.82 ? 399 PHE C CG  1 
ATOM   5897 C CD1 . PHE C 1 81  ? -22.713 60.374 23.150  1.00 34.41 ? 399 PHE C CD1 1 
ATOM   5898 C CD2 . PHE C 1 81  ? -20.454 60.637 23.857  1.00 37.50 ? 399 PHE C CD2 1 
ATOM   5899 C CE1 . PHE C 1 81  ? -22.945 59.531 24.222  1.00 39.99 ? 399 PHE C CE1 1 
ATOM   5900 C CE2 . PHE C 1 81  ? -20.682 59.793 24.940  1.00 38.92 ? 399 PHE C CE2 1 
ATOM   5901 C CZ  . PHE C 1 81  ? -21.926 59.246 25.126  1.00 37.76 ? 399 PHE C CZ  1 
ATOM   5902 N N   . LEU C 1 82  ? -19.754 61.598 18.560  1.00 24.14 ? 400 LEU C N   1 
ATOM   5903 C CA  . LEU C 1 82  ? -19.519 62.268 17.310  1.00 23.25 ? 400 LEU C CA  1 
ATOM   5904 C C   . LEU C 1 82  ? -19.960 61.324 16.220  1.00 23.92 ? 400 LEU C C   1 
ATOM   5905 O O   . LEU C 1 82  ? -19.796 60.122 16.354  1.00 26.59 ? 400 LEU C O   1 
ATOM   5906 C CB  . LEU C 1 82  ? -18.056 62.588 17.145  1.00 22.04 ? 400 LEU C CB  1 
ATOM   5907 C CG  . LEU C 1 82  ? -17.342 63.052 18.399  1.00 23.06 ? 400 LEU C CG  1 
ATOM   5908 C CD1 . LEU C 1 82  ? -15.830 63.061 18.140  1.00 26.65 ? 400 LEU C CD1 1 
ATOM   5909 C CD2 . LEU C 1 82  ? -17.812 64.408 18.816  1.00 20.58 ? 400 LEU C CD2 1 
ATOM   5910 N N   . THR C 1 83  ? -20.535 61.864 15.154  1.00 24.32 ? 401 THR C N   1 
ATOM   5911 C CA  . THR C 1 83  ? -21.045 61.049 14.053  1.00 24.41 ? 401 THR C CA  1 
ATOM   5912 C C   . THR C 1 83  ? -19.929 60.206 13.440  1.00 24.42 ? 401 THR C C   1 
ATOM   5913 O O   . THR C 1 83  ? -18.879 60.726 13.101  1.00 22.53 ? 401 THR C O   1 
ATOM   5914 C CB  . THR C 1 83  ? -21.697 61.923 12.917  1.00 24.28 ? 401 THR C CB  1 
ATOM   5915 O OG1 . THR C 1 83  ? -20.755 62.912 12.486  1.00 28.67 ? 401 THR C OG1 1 
ATOM   5916 C CG2 . THR C 1 83  ? -22.984 62.608 13.383  1.00 17.42 ? 401 THR C CG2 1 
ATOM   5917 N N   . GLN C 1 84  ? -20.185 58.909 13.279  1.00 26.28 ? 402 GLN C N   1 
ATOM   5918 C CA  . GLN C 1 84  ? -19.212 57.975 12.710  1.00 28.53 ? 402 GLN C CA  1 
ATOM   5919 C C   . GLN C 1 84  ? -19.008 58.148 11.217  1.00 29.38 ? 402 GLN C C   1 
ATOM   5920 O O   . GLN C 1 84  ? -19.979 58.252 10.458  1.00 31.59 ? 402 GLN C O   1 
ATOM   5921 C CB  . GLN C 1 84  ? -19.679 56.548 12.906  1.00 28.68 ? 402 GLN C CB  1 
ATOM   5922 C CG  . GLN C 1 84  ? -19.455 55.944 14.256  1.00 30.99 ? 402 GLN C CG  1 
ATOM   5923 C CD  . GLN C 1 84  ? -19.701 54.449 14.198  1.00 33.04 ? 402 GLN C CD  1 
ATOM   5924 O OE1 . GLN C 1 84  ? -18.756 53.665 14.217  1.00 28.39 ? 402 GLN C OE1 1 
ATOM   5925 N NE2 . GLN C 1 84  ? -20.974 54.050 14.070  1.00 29.51 ? 402 GLN C NE2 1 
ATOM   5926 N N   . LEU C 1 85  ? -17.746 58.132 10.801  1.00 28.44 ? 403 LEU C N   1 
ATOM   5927 C CA  . LEU C 1 85  ? -17.390 58.138 9.391   1.00 27.22 ? 403 LEU C CA  1 
ATOM   5928 C C   . LEU C 1 85  ? -17.218 56.701 8.957   1.00 27.75 ? 403 LEU C C   1 
ATOM   5929 O O   . LEU C 1 85  ? -16.370 55.993 9.497   1.00 27.45 ? 403 LEU C O   1 
ATOM   5930 C CB  . LEU C 1 85  ? -16.060 58.874 9.195   1.00 26.24 ? 403 LEU C CB  1 
ATOM   5931 C CG  . LEU C 1 85  ? -15.310 58.716 7.864   1.00 25.84 ? 403 LEU C CG  1 
ATOM   5932 C CD1 . LEU C 1 85  ? -16.207 59.090 6.706   1.00 24.83 ? 403 LEU C CD1 1 
ATOM   5933 C CD2 . LEU C 1 85  ? -14.035 59.576 7.834   1.00 23.31 ? 403 LEU C CD2 1 
ATOM   5934 N N   . HIS C 1 86  ? -17.991 56.236 7.989   1.00 27.74 ? 404 HIS C N   1 
ATOM   5935 C CA  . HIS C 1 86  ? -17.660 54.914 7.496   1.00 30.01 ? 404 HIS C CA  1 
ATOM   5936 C C   . HIS C 1 86  ? -16.425 55.002 6.634   1.00 30.75 ? 404 HIS C C   1 
ATOM   5937 O O   . HIS C 1 86  ? -15.402 54.397 6.925   1.00 30.75 ? 404 HIS C O   1 
ATOM   5938 C CB  . HIS C 1 86  ? -18.758 54.283 6.673   1.00 31.13 ? 404 HIS C CB  1 
ATOM   5939 C CG  . HIS C 1 86  ? -18.295 53.076 5.916   1.00 36.65 ? 404 HIS C CG  1 
ATOM   5940 N ND1 . HIS C 1 86  ? -18.291 51.810 6.466   1.00 38.80 ? 404 HIS C ND1 1 
ATOM   5941 C CD2 . HIS C 1 86  ? -17.781 52.949 4.667   1.00 37.45 ? 404 HIS C CD2 1 
ATOM   5942 C CE1 . HIS C 1 86  ? -17.826 50.952 5.573   1.00 41.27 ? 404 HIS C CE1 1 
ATOM   5943 N NE2 . HIS C 1 86  ? -17.504 51.617 4.476   1.00 36.96 ? 404 HIS C NE2 1 
ATOM   5944 N N   . SER C 1 87  ? -16.525 55.741 5.540   1.00 31.55 ? 405 SER C N   1 
ATOM   5945 C CA  . SER C 1 87  ? -15.347 55.934 4.727   1.00 30.71 ? 405 SER C CA  1 
ATOM   5946 C C   . SER C 1 87  ? -15.445 57.206 3.902   1.00 30.05 ? 405 SER C C   1 
ATOM   5947 O O   . SER C 1 87  ? -16.533 57.778 3.748   1.00 29.11 ? 405 SER C O   1 
ATOM   5948 C CB  . SER C 1 87  ? -15.059 54.698 3.853   1.00 30.18 ? 405 SER C CB  1 
ATOM   5949 O OG  . SER C 1 87  ? -15.937 54.605 2.747   1.00 29.22 ? 405 SER C OG  1 
ATOM   5950 N N   . CYS C 1 88  ? -14.270 57.643 3.442   1.00 29.23 ? 406 CYS C N   1 
ATOM   5951 C CA  . CYS C 1 88  ? -14.087 58.670 2.429   1.00 28.96 ? 406 CYS C CA  1 
ATOM   5952 C C   . CYS C 1 88  ? -13.602 58.115 1.079   1.00 28.86 ? 406 CYS C C   1 
ATOM   5953 O O   . CYS C 1 88  ? -12.882 57.102 1.014   1.00 29.21 ? 406 CYS C O   1 
ATOM   5954 C CB  . CYS C 1 88  ? -13.035 59.635 2.907   1.00 27.41 ? 406 CYS C CB  1 
ATOM   5955 S SG  . CYS C 1 88  ? -13.717 60.666 4.061   1.00 34.21 ? 406 CYS C SG  1 
ATOM   5956 N N   . PHE C 1 89  ? -13.962 58.802 0.004   1.00 26.43 ? 407 PHE C N   1 
ATOM   5957 C CA  . PHE C 1 89  ? -13.357 58.508 -1.264  1.00 24.89 ? 407 PHE C CA  1 
ATOM   5958 C C   . PHE C 1 89  ? -13.761 59.587 -2.247  1.00 26.53 ? 407 PHE C C   1 
ATOM   5959 O O   . PHE C 1 89  ? -14.801 60.236 -2.076  1.00 27.59 ? 407 PHE C O   1 
ATOM   5960 C CB  . PHE C 1 89  ? -13.781 57.127 -1.740  1.00 22.15 ? 407 PHE C CB  1 
ATOM   5961 C CG  . PHE C 1 89  ? -15.212 57.037 -2.092  1.00 21.57 ? 407 PHE C CG  1 
ATOM   5962 C CD1 . PHE C 1 89  ? -15.620 57.125 -3.413  1.00 25.20 ? 407 PHE C CD1 1 
ATOM   5963 C CD2 . PHE C 1 89  ? -16.173 56.874 -1.108  1.00 27.81 ? 407 PHE C CD2 1 
ATOM   5964 C CE1 . PHE C 1 89  ? -16.970 57.041 -3.756  1.00 24.62 ? 407 PHE C CE1 1 
ATOM   5965 C CE2 . PHE C 1 89  ? -17.536 56.795 -1.434  1.00 26.14 ? 407 PHE C CE2 1 
ATOM   5966 C CZ  . PHE C 1 89  ? -17.931 56.878 -2.761  1.00 25.27 ? 407 PHE C CZ  1 
ATOM   5967 N N   . GLN C 1 90  ? -12.945 59.781 -3.277  1.00 25.56 ? 408 GLN C N   1 
ATOM   5968 C CA  . GLN C 1 90  ? -13.261 60.775 -4.274  1.00 24.82 ? 408 GLN C CA  1 
ATOM   5969 C C   . GLN C 1 90  ? -13.407 60.161 -5.649  1.00 25.57 ? 408 GLN C C   1 
ATOM   5970 O O   . GLN C 1 90  ? -12.724 59.197 -5.986  1.00 25.67 ? 408 GLN C O   1 
ATOM   5971 C CB  . GLN C 1 90  ? -12.149 61.811 -4.322  1.00 24.37 ? 408 GLN C CB  1 
ATOM   5972 C CG  . GLN C 1 90  ? -10.772 61.205 -4.547  1.00 21.44 ? 408 GLN C CG  1 
ATOM   5973 C CD  . GLN C 1 90  ? -9.688  62.263 -4.637  1.00 18.55 ? 408 GLN C CD  1 
ATOM   5974 O OE1 . GLN C 1 90  ? -9.793  63.210 -5.412  1.00 18.44 ? 408 GLN C OE1 1 
ATOM   5975 N NE2 . GLN C 1 90  ? -8.651  62.117 -3.829  1.00 16.49 ? 408 GLN C NE2 1 
ATOM   5976 N N   . THR C 1 91  ? -14.292 60.739 -6.448  1.00 25.21 ? 409 THR C N   1 
ATOM   5977 C CA  . THR C 1 91  ? -14.308 60.486 -7.878  1.00 25.24 ? 409 THR C CA  1 
ATOM   5978 C C   . THR C 1 91  ? -13.502 61.592 -8.557  1.00 25.29 ? 409 THR C C   1 
ATOM   5979 O O   . THR C 1 91  ? -12.921 62.436 -7.891  1.00 25.35 ? 409 THR C O   1 
ATOM   5980 C CB  . THR C 1 91  ? -15.715 60.558 -8.425  1.00 26.11 ? 409 THR C CB  1 
ATOM   5981 O OG1 . THR C 1 91  ? -16.243 61.866 -8.157  1.00 29.88 ? 409 THR C OG1 1 
ATOM   5982 C CG2 . THR C 1 91  ? -16.608 59.484 -7.785  1.00 21.36 ? 409 THR C CG2 1 
ATOM   5983 N N   . VAL C 1 92  ? -13.469 61.596 -9.884  1.00 25.15 ? 410 VAL C N   1 
ATOM   5984 C CA  . VAL C 1 92  ? -12.623 62.542 -10.602 1.00 23.08 ? 410 VAL C CA  1 
ATOM   5985 C C   . VAL C 1 92  ? -13.108 63.960 -10.361 1.00 24.82 ? 410 VAL C C   1 
ATOM   5986 O O   . VAL C 1 92  ? -12.334 64.902 -10.467 1.00 25.22 ? 410 VAL C O   1 
ATOM   5987 C CB  . VAL C 1 92  ? -12.525 62.218 -12.151 1.00 23.57 ? 410 VAL C CB  1 
ATOM   5988 C CG1 . VAL C 1 92  ? -13.875 62.329 -12.844 1.00 16.48 ? 410 VAL C CG1 1 
ATOM   5989 C CG2 . VAL C 1 92  ? -11.484 63.100 -12.849 1.00 18.16 ? 410 VAL C CG2 1 
ATOM   5990 N N   . ASP C 1 93  ? -14.383 64.096 -9.987  1.00 26.74 ? 411 ASP C N   1 
ATOM   5991 C CA  . ASP C 1 93  ? -15.090 65.410 -9.928  1.00 26.18 ? 411 ASP C CA  1 
ATOM   5992 C C   . ASP C 1 93  ? -15.818 65.715 -8.604  1.00 24.41 ? 411 ASP C C   1 
ATOM   5993 O O   . ASP C 1 93  ? -16.131 66.877 -8.327  1.00 24.47 ? 411 ASP C O   1 
ATOM   5994 C CB  . ASP C 1 93  ? -16.125 65.481 -11.057 1.00 25.03 ? 411 ASP C CB  1 
ATOM   5995 C CG  . ASP C 1 93  ? -17.087 64.323 -11.011 1.00 28.83 ? 411 ASP C CG  1 
ATOM   5996 O OD1 . ASP C 1 93  ? -16.701 63.239 -10.524 1.00 37.07 ? 411 ASP C OD1 1 
ATOM   5997 O OD2 . ASP C 1 93  ? -18.238 64.479 -11.439 1.00 36.91 ? 411 ASP C OD2 1 
ATOM   5998 N N   . ARG C 1 94  ? -16.112 64.685 -7.810  1.00 22.51 ? 412 ARG C N   1 
ATOM   5999 C CA  . ARG C 1 94  ? -16.868 64.874 -6.575  1.00 22.37 ? 412 ARG C CA  1 
ATOM   6000 C C   . ARG C 1 94  ? -16.116 64.277 -5.410  1.00 21.04 ? 412 ARG C C   1 
ATOM   6001 O O   . ARG C 1 94  ? -15.207 63.513 -5.615  1.00 22.75 ? 412 ARG C O   1 
ATOM   6002 C CB  . ARG C 1 94  ? -18.262 64.253 -6.691  1.00 23.31 ? 412 ARG C CB  1 
ATOM   6003 C CG  . ARG C 1 94  ? -19.248 65.049 -7.553  1.00 22.36 ? 412 ARG C CG  1 
ATOM   6004 C CD  . ARG C 1 94  ? -20.601 64.324 -7.698  1.00 23.86 ? 412 ARG C CD  1 
ATOM   6005 N NE  . ARG C 1 94  ? -21.687 65.246 -8.028  1.00 27.94 ? 412 ARG C NE  1 
ATOM   6006 C CZ  . ARG C 1 94  ? -22.091 65.535 -9.269  1.00 32.37 ? 412 ARG C CZ  1 
ATOM   6007 N NH1 . ARG C 1 94  ? -21.531 64.952 -10.320 1.00 24.76 ? 412 ARG C NH1 1 
ATOM   6008 N NH2 . ARG C 1 94  ? -23.082 66.403 -9.466  1.00 37.17 ? 412 ARG C NH2 1 
ATOM   6009 N N   . LEU C 1 95  ? -16.477 64.652 -4.190  1.00 21.05 ? 413 LEU C N   1 
ATOM   6010 C CA  . LEU C 1 95  ? -15.885 64.076 -2.976  1.00 20.03 ? 413 LEU C CA  1 
ATOM   6011 C C   . LEU C 1 95  ? -17.046 63.505 -2.243  1.00 20.53 ? 413 LEU C C   1 
ATOM   6012 O O   . LEU C 1 95  ? -18.127 64.090 -2.280  1.00 20.37 ? 413 LEU C O   1 
ATOM   6013 C CB  . LEU C 1 95  ? -15.314 65.154 -2.071  1.00 18.71 ? 413 LEU C CB  1 
ATOM   6014 C CG  . LEU C 1 95  ? -14.154 65.955 -2.594  1.00 17.89 ? 413 LEU C CG  1 
ATOM   6015 C CD1 . LEU C 1 95  ? -13.762 66.950 -1.564  1.00 16.16 ? 413 LEU C CD1 1 
ATOM   6016 C CD2 . LEU C 1 95  ? -13.004 64.994 -2.869  1.00 27.30 ? 413 LEU C CD2 1 
ATOM   6017 N N   . TYR C 1 96  ? -16.829 62.405 -1.536  1.00 21.76 ? 414 TYR C N   1 
ATOM   6018 C CA  . TYR C 1 96  ? -17.906 61.739 -0.805  1.00 23.55 ? 414 TYR C CA  1 
ATOM   6019 C C   . TYR C 1 96  ? -17.473 61.370 0.583   1.00 24.73 ? 414 TYR C C   1 
ATOM   6020 O O   . TYR C 1 96  ? -16.419 60.736 0.748   1.00 26.67 ? 414 TYR C O   1 
ATOM   6021 C CB  . TYR C 1 96  ? -18.311 60.437 -1.506  1.00 23.61 ? 414 TYR C CB  1 
ATOM   6022 C CG  . TYR C 1 96  ? -18.832 60.627 -2.902  1.00 24.07 ? 414 TYR C CG  1 
ATOM   6023 C CD1 . TYR C 1 96  ? -20.196 60.737 -3.158  1.00 26.39 ? 414 TYR C CD1 1 
ATOM   6024 C CD2 . TYR C 1 96  ? -17.966 60.725 -3.958  1.00 26.30 ? 414 TYR C CD2 1 
ATOM   6025 C CE1 . TYR C 1 96  ? -20.670 60.925 -4.442  1.00 26.12 ? 414 TYR C CE1 1 
ATOM   6026 C CE2 . TYR C 1 96  ? -18.421 60.912 -5.232  1.00 30.35 ? 414 TYR C CE2 1 
ATOM   6027 C CZ  . TYR C 1 96  ? -19.766 60.999 -5.476  1.00 30.34 ? 414 TYR C CZ  1 
ATOM   6028 O OH  . TYR C 1 96  ? -20.169 61.167 -6.777  1.00 32.52 ? 414 TYR C OH  1 
ATOM   6029 N N   . PHE C 1 97  ? -18.286 61.721 1.580   1.00 25.33 ? 415 PHE C N   1 
ATOM   6030 C CA  . PHE C 1 97  ? -18.095 61.180 2.939   1.00 24.83 ? 415 PHE C CA  1 
ATOM   6031 C C   . PHE C 1 97  ? -19.218 60.225 3.219   1.00 25.08 ? 415 PHE C C   1 
ATOM   6032 O O   . PHE C 1 97  ? -20.381 60.640 3.195   1.00 25.64 ? 415 PHE C O   1 
ATOM   6033 C CB  . PHE C 1 97  ? -18.141 62.263 4.005   1.00 23.18 ? 415 PHE C CB  1 
ATOM   6034 C CG  . PHE C 1 97  ? -17.130 63.325 3.816   1.00 26.05 ? 415 PHE C CG  1 
ATOM   6035 C CD1 . PHE C 1 97  ? -17.300 64.294 2.824   1.00 19.97 ? 415 PHE C CD1 1 
ATOM   6036 C CD2 . PHE C 1 97  ? -15.990 63.362 4.621   1.00 28.14 ? 415 PHE C CD2 1 
ATOM   6037 C CE1 . PHE C 1 97  ? -16.363 65.272 2.642   1.00 22.38 ? 415 PHE C CE1 1 
ATOM   6038 C CE2 . PHE C 1 97  ? -15.035 64.351 4.448   1.00 26.87 ? 415 PHE C CE2 1 
ATOM   6039 C CZ  . PHE C 1 97  ? -15.219 65.313 3.463   1.00 26.31 ? 415 PHE C CZ  1 
ATOM   6040 N N   . VAL C 1 98  ? -18.888 58.961 3.495   1.00 24.42 ? 416 VAL C N   1 
ATOM   6041 C CA  . VAL C 1 98  ? -19.916 58.003 3.866   1.00 23.83 ? 416 VAL C CA  1 
ATOM   6042 C C   . VAL C 1 98  ? -19.976 57.910 5.378   1.00 24.32 ? 416 VAL C C   1 
ATOM   6043 O O   . VAL C 1 98  ? -18.994 57.503 6.016   1.00 25.40 ? 416 VAL C O   1 
ATOM   6044 C CB  . VAL C 1 98  ? -19.695 56.609 3.236   1.00 23.85 ? 416 VAL C CB  1 
ATOM   6045 C CG1 . VAL C 1 98  ? -20.920 55.737 3.454   1.00 21.59 ? 416 VAL C CG1 1 
ATOM   6046 C CG2 . VAL C 1 98  ? -19.412 56.723 1.754   1.00 22.24 ? 416 VAL C CG2 1 
ATOM   6047 N N   . MET C 1 99  ? -21.138 58.282 5.923   1.00 23.92 ? 417 MET C N   1 
ATOM   6048 C CA  . MET C 1 99  ? -21.371 58.438 7.365   1.00 25.64 ? 417 MET C CA  1 
ATOM   6049 C C   . MET C 1 99  ? -22.461 57.513 7.924   1.00 26.78 ? 417 MET C C   1 
ATOM   6050 O O   . MET C 1 99  ? -23.259 56.946 7.166   1.00 26.99 ? 417 MET C O   1 
ATOM   6051 C CB  . MET C 1 99  ? -21.813 59.870 7.651   1.00 26.18 ? 417 MET C CB  1 
ATOM   6052 C CG  . MET C 1 99  ? -21.052 60.920 6.898   1.00 26.31 ? 417 MET C CG  1 
ATOM   6053 S SD  . MET C 1 99  ? -19.405 61.056 7.553   1.00 32.76 ? 417 MET C SD  1 
ATOM   6054 C CE  . MET C 1 99  ? -19.786 61.291 9.291   1.00 33.21 ? 417 MET C CE  1 
ATOM   6055 N N   . GLU C 1 100 ? -22.521 57.387 9.251   1.00 27.18 ? 418 GLU C N   1 
ATOM   6056 C CA  . GLU C 1 100 ? -23.641 56.665 9.863   1.00 28.05 ? 418 GLU C CA  1 
ATOM   6057 C C   . GLU C 1 100 ? -24.922 57.438 9.610   1.00 28.30 ? 418 GLU C C   1 
ATOM   6058 O O   . GLU C 1 100 ? -24.886 58.655 9.389   1.00 28.71 ? 418 GLU C O   1 
ATOM   6059 C CB  . GLU C 1 100 ? -23.447 56.415 11.367  1.00 27.95 ? 418 GLU C CB  1 
ATOM   6060 C CG  . GLU C 1 100 ? -23.060 57.625 12.204  1.00 27.11 ? 418 GLU C CG  1 
ATOM   6061 C CD  . GLU C 1 100 ? -23.011 57.312 13.696  1.00 28.93 ? 418 GLU C CD  1 
ATOM   6062 O OE1 . GLU C 1 100 ? -23.548 56.272 14.101  1.00 31.82 ? 418 GLU C OE1 1 
ATOM   6063 O OE2 . GLU C 1 100 ? -22.442 58.100 14.476  1.00 30.67 ? 418 GLU C OE2 1 
ATOM   6064 N N   . TYR C 1 101 ? -26.045 56.727 9.607   1.00 27.53 ? 419 TYR C N   1 
ATOM   6065 C CA  . TYR C 1 101 ? -27.327 57.373 9.469   1.00 27.43 ? 419 TYR C CA  1 
ATOM   6066 C C   . TYR C 1 101 ? -27.872 57.604 10.878  1.00 29.06 ? 419 TYR C C   1 
ATOM   6067 O O   . TYR C 1 101 ? -28.094 56.647 11.627  1.00 28.31 ? 419 TYR C O   1 
ATOM   6068 C CB  . TYR C 1 101 ? -28.270 56.515 8.642   1.00 27.02 ? 419 TYR C CB  1 
ATOM   6069 C CG  . TYR C 1 101 ? -29.655 57.101 8.497   1.00 28.19 ? 419 TYR C CG  1 
ATOM   6070 C CD1 . TYR C 1 101 ? -29.832 58.458 8.262   1.00 34.86 ? 419 TYR C CD1 1 
ATOM   6071 C CD2 . TYR C 1 101 ? -30.788 56.305 8.570   1.00 28.32 ? 419 TYR C CD2 1 
ATOM   6072 C CE1 . TYR C 1 101 ? -31.108 59.016 8.113   1.00 33.50 ? 419 TYR C CE1 1 
ATOM   6073 C CE2 . TYR C 1 101 ? -32.073 56.854 8.411   1.00 30.22 ? 419 TYR C CE2 1 
ATOM   6074 C CZ  . TYR C 1 101 ? -32.221 58.210 8.194   1.00 29.97 ? 419 TYR C CZ  1 
ATOM   6075 O OH  . TYR C 1 101 ? -33.469 58.773 8.048   1.00 24.34 ? 419 TYR C OH  1 
ATOM   6076 N N   . VAL C 1 102 ? -28.040 58.878 11.243  1.00 30.32 ? 420 VAL C N   1 
ATOM   6077 C CA  . VAL C 1 102 ? -28.477 59.274 12.579  1.00 30.09 ? 420 VAL C CA  1 
ATOM   6078 C C   . VAL C 1 102 ? -29.901 59.729 12.404  1.00 32.42 ? 420 VAL C C   1 
ATOM   6079 O O   . VAL C 1 102 ? -30.157 60.791 11.815  1.00 35.06 ? 420 VAL C O   1 
ATOM   6080 C CB  . VAL C 1 102 ? -27.657 60.457 13.099  1.00 29.59 ? 420 VAL C CB  1 
ATOM   6081 C CG1 . VAL C 1 102 ? -28.325 61.059 14.309  1.00 28.59 ? 420 VAL C CG1 1 
ATOM   6082 C CG2 . VAL C 1 102 ? -26.228 60.035 13.407  1.00 27.98 ? 420 VAL C CG2 1 
ATOM   6083 N N   . ASN C 1 103 ? -30.837 58.929 12.889  1.00 32.65 ? 421 ASN C N   1 
ATOM   6084 C CA  . ASN C 1 103 ? -32.226 59.068 12.450  1.00 34.48 ? 421 ASN C CA  1 
ATOM   6085 C C   . ASN C 1 103 ? -33.234 59.526 13.507  1.00 34.82 ? 421 ASN C C   1 
ATOM   6086 O O   . ASN C 1 103 ? -34.429 59.597 13.237  1.00 35.55 ? 421 ASN C O   1 
ATOM   6087 C CB  . ASN C 1 103 ? -32.701 57.762 11.801  1.00 33.69 ? 421 ASN C CB  1 
ATOM   6088 C CG  . ASN C 1 103 ? -32.739 56.592 12.781  1.00 38.35 ? 421 ASN C CG  1 
ATOM   6089 O OD1 . ASN C 1 103 ? -31.894 56.450 13.674  1.00 39.31 ? 421 ASN C OD1 1 
ATOM   6090 N ND2 . ASN C 1 103 ? -33.722 55.731 12.598  1.00 47.62 ? 421 ASN C ND2 1 
ATOM   6091 N N   . GLY C 1 104 ? -32.757 59.853 14.698  1.00 34.71 ? 422 GLY C N   1 
ATOM   6092 C CA  . GLY C 1 104 ? -33.651 60.188 15.788  1.00 35.18 ? 422 GLY C CA  1 
ATOM   6093 C C   . GLY C 1 104 ? -33.930 61.667 15.948  1.00 36.21 ? 422 GLY C C   1 
ATOM   6094 O O   . GLY C 1 104 ? -34.242 62.117 17.049  1.00 36.46 ? 422 GLY C O   1 
ATOM   6095 N N   . GLY C 1 105 ? -33.813 62.426 14.861  1.00 36.48 ? 423 GLY C N   1 
ATOM   6096 C CA  . GLY C 1 105 ? -34.193 63.838 14.871  1.00 36.92 ? 423 GLY C CA  1 
ATOM   6097 C C   . GLY C 1 105 ? -33.180 64.699 15.593  1.00 38.56 ? 423 GLY C C   1 
ATOM   6098 O O   . GLY C 1 105 ? -32.367 64.179 16.378  1.00 39.65 ? 423 GLY C O   1 
ATOM   6099 N N   . ASP C 1 106 ? -33.216 66.012 15.334  1.00 37.79 ? 424 ASP C N   1 
ATOM   6100 C CA  . ASP C 1 106 ? -32.198 66.910 15.872  1.00 36.46 ? 424 ASP C CA  1 
ATOM   6101 C C   . ASP C 1 106 ? -32.697 67.658 17.080  1.00 34.82 ? 424 ASP C C   1 
ATOM   6102 O O   . ASP C 1 106 ? -33.890 67.788 17.294  1.00 34.88 ? 424 ASP C O   1 
ATOM   6103 C CB  . ASP C 1 106 ? -31.634 67.858 14.796  1.00 39.00 ? 424 ASP C CB  1 
ATOM   6104 C CG  . ASP C 1 106 ? -32.614 68.943 14.363  1.00 44.14 ? 424 ASP C CG  1 
ATOM   6105 O OD1 . ASP C 1 106 ? -32.992 69.771 15.228  1.00 50.74 ? 424 ASP C OD1 1 
ATOM   6106 O OD2 . ASP C 1 106 ? -32.963 69.002 13.147  1.00 47.73 ? 424 ASP C OD2 1 
ATOM   6107 N N   . LEU C 1 107 ? -31.780 68.167 17.876  1.00 32.84 ? 425 LEU C N   1 
ATOM   6108 C CA  . LEU C 1 107 ? -32.171 68.626 19.184  1.00 31.42 ? 425 LEU C CA  1 
ATOM   6109 C C   . LEU C 1 107 ? -33.112 69.804 19.134  1.00 31.61 ? 425 LEU C C   1 
ATOM   6110 O O   . LEU C 1 107 ? -34.035 69.894 19.933  1.00 34.16 ? 425 LEU C O   1 
ATOM   6111 C CB  . LEU C 1 107 ? -30.945 68.982 19.992  1.00 31.12 ? 425 LEU C CB  1 
ATOM   6112 C CG  . LEU C 1 107 ? -31.028 68.443 21.397  1.00 28.56 ? 425 LEU C CG  1 
ATOM   6113 C CD1 . LEU C 1 107 ? -31.351 66.954 21.354  1.00 22.15 ? 425 LEU C CD1 1 
ATOM   6114 C CD2 . LEU C 1 107 ? -29.689 68.720 22.027  1.00 29.36 ? 425 LEU C CD2 1 
ATOM   6115 N N   . MET C 1 108 ? -32.865 70.725 18.213  1.00 31.62 ? 426 MET C N   1 
ATOM   6116 C CA  . MET C 1 108 ? -33.736 71.869 18.021  1.00 30.97 ? 426 MET C CA  1 
ATOM   6117 C C   . MET C 1 108 ? -35.188 71.382 18.029  1.00 31.70 ? 426 MET C C   1 
ATOM   6118 O O   . MET C 1 108 ? -36.006 71.791 18.876  1.00 30.88 ? 426 MET C O   1 
ATOM   6119 C CB  . MET C 1 108 ? -33.381 72.545 16.699  1.00 32.07 ? 426 MET C CB  1 
ATOM   6120 C CG  . MET C 1 108 ? -34.297 73.673 16.278  1.00 34.12 ? 426 MET C CG  1 
ATOM   6121 S SD  . MET C 1 108 ? -34.382 75.035 17.443  1.00 32.14 ? 426 MET C SD  1 
ATOM   6122 C CE  . MET C 1 108 ? -34.735 76.373 16.320  1.00 32.20 ? 426 MET C CE  1 
ATOM   6123 N N   . TYR C 1 109 ? -35.486 70.460 17.111  1.00 31.32 ? 427 TYR C N   1 
ATOM   6124 C CA  . TYR C 1 109 ? -36.811 69.864 17.018  1.00 30.54 ? 427 TYR C CA  1 
ATOM   6125 C C   . TYR C 1 109 ? -37.305 69.370 18.373  1.00 31.17 ? 427 TYR C C   1 
ATOM   6126 O O   . TYR C 1 109 ? -38.296 69.879 18.909  1.00 32.14 ? 427 TYR C O   1 
ATOM   6127 C CB  . TYR C 1 109 ? -36.784 68.722 16.026  1.00 29.84 ? 427 TYR C CB  1 
ATOM   6128 C CG  . TYR C 1 109 ? -38.052 67.927 16.001  1.00 33.95 ? 427 TYR C CG  1 
ATOM   6129 C CD1 . TYR C 1 109 ? -39.151 68.370 15.266  1.00 37.48 ? 427 TYR C CD1 1 
ATOM   6130 C CD2 . TYR C 1 109 ? -38.160 66.724 16.701  1.00 36.14 ? 427 TYR C CD2 1 
ATOM   6131 C CE1 . TYR C 1 109 ? -40.335 67.651 15.233  1.00 39.09 ? 427 TYR C CE1 1 
ATOM   6132 C CE2 . TYR C 1 109 ? -39.340 65.989 16.675  1.00 40.18 ? 427 TYR C CE2 1 
ATOM   6133 C CZ  . TYR C 1 109 ? -40.425 66.463 15.937  1.00 42.49 ? 427 TYR C CZ  1 
ATOM   6134 O OH  . TYR C 1 109 ? -41.601 65.754 15.896  1.00 40.56 ? 427 TYR C OH  1 
ATOM   6135 N N   . HIS C 1 110 ? -36.599 68.390 18.931  1.00 30.88 ? 428 HIS C N   1 
ATOM   6136 C CA  . HIS C 1 110 ? -36.987 67.798 20.197  1.00 30.95 ? 428 HIS C CA  1 
ATOM   6137 C C   . HIS C 1 110 ? -37.175 68.799 21.286  1.00 31.76 ? 428 HIS C C   1 
ATOM   6138 O O   . HIS C 1 110 ? -38.031 68.583 22.154  1.00 31.50 ? 428 HIS C O   1 
ATOM   6139 C CB  . HIS C 1 110 ? -35.994 66.747 20.650  1.00 31.61 ? 428 HIS C CB  1 
ATOM   6140 C CG  . HIS C 1 110 ? -36.006 65.534 19.786  1.00 32.63 ? 428 HIS C CG  1 
ATOM   6141 N ND1 . HIS C 1 110 ? -34.900 65.103 19.094  1.00 32.63 ? 428 HIS C ND1 1 
ATOM   6142 C CD2 . HIS C 1 110 ? -37.013 64.699 19.448  1.00 33.46 ? 428 HIS C CD2 1 
ATOM   6143 C CE1 . HIS C 1 110 ? -35.219 64.042 18.378  1.00 32.17 ? 428 HIS C CE1 1 
ATOM   6144 N NE2 . HIS C 1 110 ? -36.493 63.771 18.583  1.00 32.91 ? 428 HIS C NE2 1 
ATOM   6145 N N   . ILE C 1 111 ? -36.401 69.889 21.257  1.00 31.56 ? 429 ILE C N   1 
ATOM   6146 C CA  . ILE C 1 111 ? -36.656 70.971 22.211  1.00 32.15 ? 429 ILE C CA  1 
ATOM   6147 C C   . ILE C 1 111 ? -38.021 71.546 21.910  1.00 32.31 ? 429 ILE C C   1 
ATOM   6148 O O   . ILE C 1 111 ? -38.844 71.709 22.815  1.00 31.96 ? 429 ILE C O   1 
ATOM   6149 C CB  . ILE C 1 111 ? -35.629 72.122 22.170  1.00 32.71 ? 429 ILE C CB  1 
ATOM   6150 C CG1 . ILE C 1 111 ? -34.303 71.704 22.782  1.00 31.86 ? 429 ILE C CG1 1 
ATOM   6151 C CG2 . ILE C 1 111 ? -36.114 73.315 22.996  1.00 29.17 ? 429 ILE C CG2 1 
ATOM   6152 C CD1 . ILE C 1 111 ? -33.360 72.870 22.948  1.00 27.51 ? 429 ILE C CD1 1 
ATOM   6153 N N   . GLN C 1 112 ? -38.268 71.835 20.635  1.00 32.51 ? 430 GLN C N   1 
ATOM   6154 C CA  . GLN C 1 112 ? -39.511 72.488 20.249  1.00 33.37 ? 430 GLN C CA  1 
ATOM   6155 C C   . GLN C 1 112 ? -40.711 71.712 20.741  1.00 35.20 ? 430 GLN C C   1 
ATOM   6156 O O   . GLN C 1 112 ? -41.702 72.296 21.180  1.00 35.17 ? 430 GLN C O   1 
ATOM   6157 C CB  . GLN C 1 112 ? -39.583 72.680 18.751  1.00 31.89 ? 430 GLN C CB  1 
ATOM   6158 C CG  . GLN C 1 112 ? -38.960 73.985 18.332  1.00 34.87 ? 430 GLN C CG  1 
ATOM   6159 C CD  . GLN C 1 112 ? -38.531 73.998 16.876  1.00 39.06 ? 430 GLN C CD  1 
ATOM   6160 O OE1 . GLN C 1 112 ? -38.387 75.066 16.266  1.00 37.61 ? 430 GLN C OE1 1 
ATOM   6161 N NE2 . GLN C 1 112 ? -38.331 72.809 16.305  1.00 39.13 ? 430 GLN C NE2 1 
ATOM   6162 N N   . GLN C 1 113 ? -40.603 70.391 20.710  1.00 36.25 ? 431 GLN C N   1 
ATOM   6163 C CA  . GLN C 1 113 ? -41.714 69.545 21.100  1.00 37.08 ? 431 GLN C CA  1 
ATOM   6164 C C   . GLN C 1 113 ? -42.082 69.649 22.576  1.00 37.57 ? 431 GLN C C   1 
ATOM   6165 O O   . GLN C 1 113 ? -43.195 69.311 22.961  1.00 39.63 ? 431 GLN C O   1 
ATOM   6166 C CB  . GLN C 1 113 ? -41.423 68.092 20.735  1.00 38.19 ? 431 GLN C CB  1 
ATOM   6167 C CG  . GLN C 1 113 ? -41.063 67.880 19.260  1.00 41.23 ? 431 GLN C CG  1 
ATOM   6168 C CD  . GLN C 1 113 ? -42.048 68.546 18.306  1.00 40.76 ? 431 GLN C CD  1 
ATOM   6169 O OE1 . GLN C 1 113 ? -41.714 69.518 17.622  1.00 44.78 ? 431 GLN C OE1 1 
ATOM   6170 N NE2 . GLN C 1 113 ? -43.263 68.028 18.261  1.00 38.69 ? 431 GLN C NE2 1 
ATOM   6171 N N   . VAL C 1 114 ? -41.169 70.110 23.420  1.00 37.66 ? 432 VAL C N   1 
ATOM   6172 C CA  . VAL C 1 114 ? -41.479 70.160 24.857  1.00 36.74 ? 432 VAL C CA  1 
ATOM   6173 C C   . VAL C 1 114 ? -41.280 71.550 25.463  1.00 36.14 ? 432 VAL C C   1 
ATOM   6174 O O   . VAL C 1 114 ? -41.387 71.718 26.677  1.00 35.06 ? 432 VAL C O   1 
ATOM   6175 C CB  . VAL C 1 114 ? -40.723 69.044 25.705  1.00 37.34 ? 432 VAL C CB  1 
ATOM   6176 C CG1 . VAL C 1 114 ? -41.245 67.661 25.394  1.00 34.83 ? 432 VAL C CG1 1 
ATOM   6177 C CG2 . VAL C 1 114 ? -39.203 69.077 25.500  1.00 37.80 ? 432 VAL C CG2 1 
ATOM   6178 N N   . GLY C 1 115 ? -41.004 72.541 24.611  1.00 35.69 ? 433 GLY C N   1 
ATOM   6179 C CA  . GLY C 1 115 ? -40.751 73.922 25.053  1.00 33.67 ? 433 GLY C CA  1 
ATOM   6180 C C   . GLY C 1 115 ? -39.331 74.101 25.574  1.00 32.88 ? 433 GLY C C   1 
ATOM   6181 O O   . GLY C 1 115 ? -38.573 74.930 25.065  1.00 32.40 ? 433 GLY C O   1 
ATOM   6182 N N   . LYS C 1 116 ? -38.997 73.317 26.599  1.00 31.88 ? 434 LYS C N   1 
ATOM   6183 C CA  . LYS C 1 116 ? -37.643 73.190 27.152  1.00 31.77 ? 434 LYS C CA  1 
ATOM   6184 C C   . LYS C 1 116 ? -37.535 71.803 27.801  1.00 32.63 ? 434 LYS C C   1 
ATOM   6185 O O   . LYS C 1 116 ? -38.534 71.131 27.984  1.00 33.22 ? 434 LYS C O   1 
ATOM   6186 C CB  . LYS C 1 116 ? -37.394 74.252 28.215  1.00 31.39 ? 434 LYS C CB  1 
ATOM   6187 C CG  . LYS C 1 116 ? -38.291 74.105 29.436  1.00 23.99 ? 434 LYS C CG  1 
ATOM   6188 C CD  . LYS C 1 116 ? -38.509 75.454 30.037  1.00 22.39 ? 434 LYS C CD  1 
ATOM   6189 C CE  . LYS C 1 116 ? -39.603 75.436 31.059  1.00 28.12 ? 434 LYS C CE  1 
ATOM   6190 N NZ  . LYS C 1 116 ? -39.214 74.609 32.253  1.00 34.42 ? 434 LYS C NZ  1 
ATOM   6191 N N   . PHE C 1 117 ? -36.337 71.375 28.155  1.00 33.20 ? 435 PHE C N   1 
ATOM   6192 C CA  . PHE C 1 117 ? -36.165 70.078 28.792  1.00 35.09 ? 435 PHE C CA  1 
ATOM   6193 C C   . PHE C 1 117 ? -36.243 70.121 30.339  1.00 36.89 ? 435 PHE C C   1 
ATOM   6194 O O   . PHE C 1 117 ? -35.978 71.155 30.965  1.00 37.90 ? 435 PHE C O   1 
ATOM   6195 C CB  . PHE C 1 117 ? -34.816 69.508 28.370  1.00 35.31 ? 435 PHE C CB  1 
ATOM   6196 C CG  . PHE C 1 117 ? -34.726 69.185 26.914  1.00 35.50 ? 435 PHE C CG  1 
ATOM   6197 C CD1 . PHE C 1 117 ? -35.780 68.575 26.262  1.00 33.49 ? 435 PHE C CD1 1 
ATOM   6198 C CD2 . PHE C 1 117 ? -33.567 69.443 26.207  1.00 38.00 ? 435 PHE C CD2 1 
ATOM   6199 C CE1 . PHE C 1 117 ? -35.695 68.260 24.937  1.00 33.98 ? 435 PHE C CE1 1 
ATOM   6200 C CE2 . PHE C 1 117 ? -33.475 69.124 24.867  1.00 39.00 ? 435 PHE C CE2 1 
ATOM   6201 C CZ  . PHE C 1 117 ? -34.547 68.544 24.227  1.00 35.88 ? 435 PHE C CZ  1 
ATOM   6202 N N   . LYS C 1 118 ? -36.587 69.000 30.965  1.00 37.80 ? 436 LYS C N   1 
ATOM   6203 C CA  . LYS C 1 118 ? -36.451 68.906 32.426  1.00 39.40 ? 436 LYS C CA  1 
ATOM   6204 C C   . LYS C 1 118 ? -34.952 68.896 32.717  1.00 37.67 ? 436 LYS C C   1 
ATOM   6205 O O   . LYS C 1 118 ? -34.201 68.287 31.965  1.00 37.90 ? 436 LYS C O   1 
ATOM   6206 C CB  . LYS C 1 118 ? -37.109 67.618 32.964  1.00 39.73 ? 436 LYS C CB  1 
ATOM   6207 C CG  . LYS C 1 118 ? -36.287 66.342 32.695  1.00 45.01 ? 436 LYS C CG  1 
ATOM   6208 C CD  . LYS C 1 118 ? -37.022 65.042 33.067  1.00 49.05 ? 436 LYS C CD  1 
ATOM   6209 C CE  . LYS C 1 118 ? -36.057 63.852 33.249  1.00 46.47 ? 436 LYS C CE  1 
ATOM   6210 N NZ  . LYS C 1 118 ? -35.432 63.371 31.982  1.00 47.96 ? 436 LYS C NZ  1 
ATOM   6211 N N   . GLU C 1 119 ? -34.504 69.544 33.787  1.00 37.17 ? 437 GLU C N   1 
ATOM   6212 C CA  . GLU C 1 119 ? -33.064 69.523 34.113  1.00 37.03 ? 437 GLU C CA  1 
ATOM   6213 C C   . GLU C 1 119 ? -32.432 68.125 33.916  1.00 37.16 ? 437 GLU C C   1 
ATOM   6214 O O   . GLU C 1 119 ? -31.408 67.978 33.226  1.00 36.15 ? 437 GLU C O   1 
ATOM   6215 C CB  . GLU C 1 119 ? -32.770 70.087 35.517  1.00 36.29 ? 437 GLU C CB  1 
ATOM   6216 C CG  . GLU C 1 119 ? -31.403 69.669 36.072  1.00 39.26 ? 437 GLU C CG  1 
ATOM   6217 C CD  . GLU C 1 119 ? -30.877 70.569 37.192  1.00 44.45 ? 437 GLU C CD  1 
ATOM   6218 O OE1 . GLU C 1 119 ? -31.396 71.709 37.316  1.00 45.45 ? 437 GLU C OE1 1 
ATOM   6219 O OE2 . GLU C 1 119 ? -29.933 70.135 37.926  1.00 40.90 ? 437 GLU C OE2 1 
ATOM   6220 N N   . PRO C 1 120 ? -33.044 67.085 34.507  1.00 37.26 ? 438 PRO C N   1 
ATOM   6221 C CA  . PRO C 1 120 ? -32.466 65.756 34.267  1.00 36.44 ? 438 PRO C CA  1 
ATOM   6222 C C   . PRO C 1 120 ? -32.100 65.448 32.802  1.00 34.93 ? 438 PRO C C   1 
ATOM   6223 O O   . PRO C 1 120 ? -30.993 64.977 32.568  1.00 35.20 ? 438 PRO C O   1 
ATOM   6224 C CB  . PRO C 1 120 ? -33.536 64.809 34.807  1.00 35.63 ? 438 PRO C CB  1 
ATOM   6225 C CG  . PRO C 1 120 ? -34.145 65.602 35.950  1.00 37.31 ? 438 PRO C CG  1 
ATOM   6226 C CD  . PRO C 1 120 ? -34.089 67.057 35.552  1.00 36.68 ? 438 PRO C CD  1 
ATOM   6227 N N   . GLN C 1 121 ? -32.977 65.698 31.827  1.00 32.64 ? 439 GLN C N   1 
ATOM   6228 C CA  . GLN C 1 121 ? -32.559 65.395 30.452  1.00 32.20 ? 439 GLN C CA  1 
ATOM   6229 C C   . GLN C 1 121 ? -31.540 66.382 29.874  1.00 32.16 ? 439 GLN C C   1 
ATOM   6230 O O   . GLN C 1 121 ? -30.558 65.963 29.264  1.00 31.79 ? 439 GLN C O   1 
ATOM   6231 C CB  . GLN C 1 121 ? -33.713 65.075 29.476  1.00 31.52 ? 439 GLN C CB  1 
ATOM   6232 C CG  . GLN C 1 121 ? -34.837 66.078 29.306  1.00 32.82 ? 439 GLN C CG  1 
ATOM   6233 C CD  . GLN C 1 121 ? -35.743 65.729 28.109  1.00 34.24 ? 439 GLN C CD  1 
ATOM   6234 O OE1 . GLN C 1 121 ? -35.412 64.863 27.302  1.00 34.86 ? 439 GLN C OE1 1 
ATOM   6235 N NE2 . GLN C 1 121 ? -36.887 66.408 27.996  1.00 37.84 ? 439 GLN C NE2 1 
ATOM   6236 N N   . ALA C 1 122 ? -31.756 67.680 30.087  1.00 31.57 ? 440 ALA C N   1 
ATOM   6237 C CA  . ALA C 1 122 ? -30.763 68.677 29.734  1.00 31.48 ? 440 ALA C CA  1 
ATOM   6238 C C   . ALA C 1 122 ? -29.407 68.225 30.246  1.00 32.19 ? 440 ALA C C   1 
ATOM   6239 O O   . ALA C 1 122 ? -28.414 68.245 29.529  1.00 31.92 ? 440 ALA C O   1 
ATOM   6240 C CB  . ALA C 1 122 ? -31.123 70.000 30.330  1.00 30.78 ? 440 ALA C CB  1 
ATOM   6241 N N   . VAL C 1 123 ? -29.380 67.795 31.498  1.00 33.58 ? 441 VAL C N   1 
ATOM   6242 C CA  . VAL C 1 123 ? -28.142 67.354 32.119  1.00 34.60 ? 441 VAL C CA  1 
ATOM   6243 C C   . VAL C 1 123 ? -27.494 66.237 31.326  1.00 34.85 ? 441 VAL C C   1 
ATOM   6244 O O   . VAL C 1 123 ? -26.334 66.343 30.928  1.00 36.99 ? 441 VAL C O   1 
ATOM   6245 C CB  . VAL C 1 123 ? -28.372 66.886 33.559  1.00 34.63 ? 441 VAL C CB  1 
ATOM   6246 C CG1 . VAL C 1 123 ? -27.046 66.546 34.233  1.00 32.90 ? 441 VAL C CG1 1 
ATOM   6247 C CG2 . VAL C 1 123 ? -29.087 67.964 34.321  1.00 33.68 ? 441 VAL C CG2 1 
ATOM   6248 N N   . PHE C 1 124 ? -28.246 65.169 31.112  1.00 34.02 ? 442 PHE C N   1 
ATOM   6249 C CA  . PHE C 1 124 ? -27.819 64.061 30.267  1.00 34.06 ? 442 PHE C CA  1 
ATOM   6250 C C   . PHE C 1 124 ? -27.269 64.508 28.895  1.00 34.06 ? 442 PHE C C   1 
ATOM   6251 O O   . PHE C 1 124 ? -26.203 64.063 28.461  1.00 36.33 ? 442 PHE C O   1 
ATOM   6252 C CB  . PHE C 1 124 ? -28.998 63.119 30.056  1.00 34.12 ? 442 PHE C CB  1 
ATOM   6253 C CG  . PHE C 1 124 ? -28.680 61.927 29.205  1.00 35.05 ? 442 PHE C CG  1 
ATOM   6254 C CD1 . PHE C 1 124 ? -28.082 60.804 29.761  1.00 30.41 ? 442 PHE C CD1 1 
ATOM   6255 C CD2 . PHE C 1 124 ? -28.998 61.923 27.849  1.00 33.96 ? 442 PHE C CD2 1 
ATOM   6256 C CE1 . PHE C 1 124 ? -27.796 59.710 28.990  1.00 30.65 ? 442 PHE C CE1 1 
ATOM   6257 C CE2 . PHE C 1 124 ? -28.717 60.829 27.068  1.00 34.28 ? 442 PHE C CE2 1 
ATOM   6258 C CZ  . PHE C 1 124 ? -28.114 59.716 27.641  1.00 34.47 ? 442 PHE C CZ  1 
ATOM   6259 N N   . TYR C 1 125 ? -27.992 65.369 28.199  1.00 32.04 ? 443 TYR C N   1 
ATOM   6260 C CA  . TYR C 1 125 ? -27.493 65.867 26.932  1.00 29.81 ? 443 TYR C CA  1 
ATOM   6261 C C   . TYR C 1 125 ? -26.227 66.660 27.170  1.00 28.65 ? 443 TYR C C   1 
ATOM   6262 O O   . TYR C 1 125 ? -25.184 66.383 26.580  1.00 27.52 ? 443 TYR C O   1 
ATOM   6263 C CB  . TYR C 1 125 ? -28.544 66.728 26.231  1.00 29.98 ? 443 TYR C CB  1 
ATOM   6264 C CG  . TYR C 1 125 ? -29.786 65.953 25.843  1.00 28.18 ? 443 TYR C CG  1 
ATOM   6265 C CD1 . TYR C 1 125 ? -29.714 64.595 25.544  1.00 28.03 ? 443 TYR C CD1 1 
ATOM   6266 C CD2 . TYR C 1 125 ? -31.020 66.576 25.751  1.00 25.78 ? 443 TYR C CD2 1 
ATOM   6267 C CE1 . TYR C 1 125 ? -30.833 63.876 25.190  1.00 24.95 ? 443 TYR C CE1 1 
ATOM   6268 C CE2 . TYR C 1 125 ? -32.147 65.858 25.401  1.00 23.94 ? 443 TYR C CE2 1 
ATOM   6269 C CZ  . TYR C 1 125 ? -32.047 64.511 25.119  1.00 23.81 ? 443 TYR C CZ  1 
ATOM   6270 O OH  . TYR C 1 125 ? -33.170 63.792 24.760  1.00 26.78 ? 443 TYR C OH  1 
ATOM   6271 N N   . ALA C 1 126 ? -26.301 67.638 28.055  1.00 28.79 ? 444 ALA C N   1 
ATOM   6272 C CA  . ALA C 1 126 ? -25.103 68.431 28.345  1.00 30.42 ? 444 ALA C CA  1 
ATOM   6273 C C   . ALA C 1 126 ? -23.916 67.497 28.523  1.00 30.12 ? 444 ALA C C   1 
ATOM   6274 O O   . ALA C 1 126 ? -22.800 67.819 28.147  1.00 29.83 ? 444 ALA C O   1 
ATOM   6275 C CB  . ALA C 1 126 ? -25.298 69.305 29.591  1.00 29.55 ? 444 ALA C CB  1 
ATOM   6276 N N   . ALA C 1 127 ? -24.185 66.325 29.080  1.00 31.37 ? 445 ALA C N   1 
ATOM   6277 C CA  . ALA C 1 127 ? -23.136 65.404 29.483  1.00 32.88 ? 445 ALA C CA  1 
ATOM   6278 C C   . ALA C 1 127 ? -22.534 64.613 28.325  1.00 33.20 ? 445 ALA C C   1 
ATOM   6279 O O   . ALA C 1 127 ? -21.317 64.625 28.130  1.00 33.19 ? 445 ALA C O   1 
ATOM   6280 C CB  . ALA C 1 127 ? -23.663 64.478 30.522  1.00 34.25 ? 445 ALA C CB  1 
ATOM   6281 N N   . GLU C 1 128 ? -23.379 63.927 27.558  1.00 33.66 ? 446 GLU C N   1 
ATOM   6282 C CA  . GLU C 1 128 ? -22.908 63.213 26.351  1.00 34.13 ? 446 GLU C CA  1 
ATOM   6283 C C   . GLU C 1 128 ? -22.179 64.137 25.362  1.00 32.63 ? 446 GLU C C   1 
ATOM   6284 O O   . GLU C 1 128 ? -21.259 63.707 24.667  1.00 33.00 ? 446 GLU C O   1 
ATOM   6285 C CB  . GLU C 1 128 ? -24.056 62.458 25.653  1.00 33.85 ? 446 GLU C CB  1 
ATOM   6286 C CG  . GLU C 1 128 ? -24.754 61.427 26.544  1.00 37.00 ? 446 GLU C CG  1 
ATOM   6287 C CD  . GLU C 1 128 ? -25.383 60.284 25.762  1.00 40.23 ? 446 GLU C CD  1 
ATOM   6288 O OE1 . GLU C 1 128 ? -25.777 60.507 24.600  1.00 44.49 ? 446 GLU C OE1 1 
ATOM   6289 O OE2 . GLU C 1 128 ? -25.478 59.158 26.307  1.00 43.07 ? 446 GLU C OE2 1 
ATOM   6290 N N   . ILE C 1 129 ? -22.604 65.399 25.307  1.00 31.19 ? 447 ILE C N   1 
ATOM   6291 C CA  . ILE C 1 129 ? -21.968 66.410 24.469  1.00 29.85 ? 447 ILE C CA  1 
ATOM   6292 C C   . ILE C 1 129 ? -20.567 66.776 24.962  1.00 30.24 ? 447 ILE C C   1 
ATOM   6293 O O   . ILE C 1 129 ? -19.610 66.733 24.202  1.00 29.74 ? 447 ILE C O   1 
ATOM   6294 C CB  . ILE C 1 129 ? -22.821 67.689 24.410  1.00 29.55 ? 447 ILE C CB  1 
ATOM   6295 C CG1 . ILE C 1 129 ? -24.058 67.443 23.537  1.00 28.75 ? 447 ILE C CG1 1 
ATOM   6296 C CG2 . ILE C 1 129 ? -21.991 68.868 23.893  1.00 27.02 ? 447 ILE C CG2 1 
ATOM   6297 C CD1 . ILE C 1 129 ? -25.124 68.494 23.640  1.00 19.75 ? 447 ILE C CD1 1 
ATOM   6298 N N   . SER C 1 130 ? -20.442 67.143 26.233  1.00 30.28 ? 448 SER C N   1 
ATOM   6299 C CA  . SER C 1 130 ? -19.140 67.506 26.756  1.00 29.86 ? 448 SER C CA  1 
ATOM   6300 C C   . SER C 1 130 ? -18.138 66.479 26.280  1.00 29.48 ? 448 SER C C   1 
ATOM   6301 O O   . SER C 1 130 ? -17.034 66.838 25.862  1.00 29.78 ? 448 SER C O   1 
ATOM   6302 C CB  . SER C 1 130 ? -19.147 67.587 28.279  1.00 29.49 ? 448 SER C CB  1 
ATOM   6303 O OG  . SER C 1 130 ? -19.262 66.294 28.852  1.00 35.08 ? 448 SER C OG  1 
ATOM   6304 N N   . ILE C 1 131 ? -18.531 65.206 26.314  1.00 29.62 ? 449 ILE C N   1 
ATOM   6305 C CA  . ILE C 1 131 ? -17.596 64.121 25.989  1.00 29.72 ? 449 ILE C CA  1 
ATOM   6306 C C   . ILE C 1 131 ? -16.999 64.336 24.622  1.00 30.20 ? 449 ILE C C   1 
ATOM   6307 O O   . ILE C 1 131 ? -15.799 64.182 24.455  1.00 32.78 ? 449 ILE C O   1 
ATOM   6308 C CB  . ILE C 1 131 ? -18.240 62.719 26.011  1.00 30.46 ? 449 ILE C CB  1 
ATOM   6309 C CG1 . ILE C 1 131 ? -18.586 62.273 27.443  1.00 29.30 ? 449 ILE C CG1 1 
ATOM   6310 C CG2 . ILE C 1 131 ? -17.349 61.705 25.290  1.00 25.32 ? 449 ILE C CG2 1 
ATOM   6311 C CD1 . ILE C 1 131 ? -17.511 62.498 28.452  1.00 28.98 ? 449 ILE C CD1 1 
ATOM   6312 N N   . GLY C 1 132 ? -17.830 64.686 23.641  1.00 29.30 ? 450 GLY C N   1 
ATOM   6313 C CA  . GLY C 1 132 ? -17.328 65.111 22.319  1.00 28.12 ? 450 GLY C CA  1 
ATOM   6314 C C   . GLY C 1 132 ? -16.307 66.237 22.441  1.00 27.36 ? 450 GLY C C   1 
ATOM   6315 O O   . GLY C 1 132 ? -15.206 66.151 21.907  1.00 28.00 ? 450 GLY C O   1 
ATOM   6316 N N   . LEU C 1 133 ? -16.650 67.291 23.173  1.00 26.31 ? 451 LEU C N   1 
ATOM   6317 C CA  . LEU C 1 133 ? -15.770 68.437 23.264  1.00 25.30 ? 451 LEU C CA  1 
ATOM   6318 C C   . LEU C 1 133 ? -14.450 68.049 23.928  1.00 27.54 ? 451 LEU C C   1 
ATOM   6319 O O   . LEU C 1 133 ? -13.365 68.397 23.444  1.00 27.83 ? 451 LEU C O   1 
ATOM   6320 C CB  . LEU C 1 133 ? -16.461 69.591 23.988  1.00 24.13 ? 451 LEU C CB  1 
ATOM   6321 C CG  . LEU C 1 133 ? -17.538 70.334 23.164  1.00 19.05 ? 451 LEU C CG  1 
ATOM   6322 C CD1 . LEU C 1 133 ? -18.163 71.493 23.893  1.00 10.43 ? 451 LEU C CD1 1 
ATOM   6323 C CD2 . LEU C 1 133 ? -16.973 70.852 21.890  1.00 15.79 ? 451 LEU C CD2 1 
ATOM   6324 N N   . PHE C 1 134 ? -14.537 67.301 25.020  1.00 28.00 ? 452 PHE C N   1 
ATOM   6325 C CA  . PHE C 1 134 ? -13.333 66.849 25.705  1.00 28.24 ? 452 PHE C CA  1 
ATOM   6326 C C   . PHE C 1 134 ? -12.406 66.173 24.723  1.00 28.18 ? 452 PHE C C   1 
ATOM   6327 O O   . PHE C 1 134 ? -11.216 66.451 24.673  1.00 30.11 ? 452 PHE C O   1 
ATOM   6328 C CB  . PHE C 1 134 ? -13.686 65.850 26.806  1.00 28.59 ? 452 PHE C CB  1 
ATOM   6329 C CG  . PHE C 1 134 ? -14.481 66.438 27.927  1.00 28.37 ? 452 PHE C CG  1 
ATOM   6330 C CD1 . PHE C 1 134 ? -14.304 67.763 28.303  1.00 26.45 ? 452 PHE C CD1 1 
ATOM   6331 C CD2 . PHE C 1 134 ? -15.384 65.658 28.629  1.00 28.04 ? 452 PHE C CD2 1 
ATOM   6332 C CE1 . PHE C 1 134 ? -15.025 68.299 29.354  1.00 30.74 ? 452 PHE C CE1 1 
ATOM   6333 C CE2 . PHE C 1 134 ? -16.113 66.186 29.687  1.00 28.55 ? 452 PHE C CE2 1 
ATOM   6334 C CZ  . PHE C 1 134 ? -15.935 67.507 30.054  1.00 28.29 ? 452 PHE C CZ  1 
ATOM   6335 N N   . PHE C 1 135 ? -12.971 65.270 23.939  1.00 28.16 ? 453 PHE C N   1 
ATOM   6336 C CA  . PHE C 1 135 ? -12.185 64.435 23.061  1.00 28.33 ? 453 PHE C CA  1 
ATOM   6337 C C   . PHE C 1 135 ? -11.546 65.314 22.025  1.00 28.94 ? 453 PHE C C   1 
ATOM   6338 O O   . PHE C 1 135 ? -10.331 65.313 21.866  1.00 30.64 ? 453 PHE C O   1 
ATOM   6339 C CB  . PHE C 1 135 ? -13.073 63.394 22.388  1.00 28.46 ? 453 PHE C CB  1 
ATOM   6340 C CG  . PHE C 1 135 ? -12.426 62.708 21.218  1.00 29.83 ? 453 PHE C CG  1 
ATOM   6341 C CD1 . PHE C 1 135 ? -11.527 61.673 21.414  1.00 31.41 ? 453 PHE C CD1 1 
ATOM   6342 C CD2 . PHE C 1 135 ? -12.722 63.094 19.919  1.00 29.77 ? 453 PHE C CD2 1 
ATOM   6343 C CE1 . PHE C 1 135 ? -10.939 61.044 20.343  1.00 32.48 ? 453 PHE C CE1 1 
ATOM   6344 C CE2 . PHE C 1 135 ? -12.136 62.461 18.838  1.00 25.92 ? 453 PHE C CE2 1 
ATOM   6345 C CZ  . PHE C 1 135 ? -11.256 61.440 19.047  1.00 29.81 ? 453 PHE C CZ  1 
ATOM   6346 N N   . LEU C 1 136 ? -12.368 66.088 21.331  1.00 28.15 ? 454 LEU C N   1 
ATOM   6347 C CA  . LEU C 1 136 ? -11.846 66.977 20.315  1.00 27.65 ? 454 LEU C CA  1 
ATOM   6348 C C   . LEU C 1 136 ? -10.755 67.914 20.853  1.00 28.32 ? 454 LEU C C   1 
ATOM   6349 O O   . LEU C 1 136 ? -9.698  68.054 20.244  1.00 28.96 ? 454 LEU C O   1 
ATOM   6350 C CB  . LEU C 1 136 ? -12.981 67.744 19.642  1.00 26.30 ? 454 LEU C CB  1 
ATOM   6351 C CG  . LEU C 1 136 ? -13.754 66.919 18.607  1.00 22.85 ? 454 LEU C CG  1 
ATOM   6352 C CD1 . LEU C 1 136 ? -14.994 67.683 18.072  1.00 14.34 ? 454 LEU C CD1 1 
ATOM   6353 C CD2 . LEU C 1 136 ? -12.816 66.507 17.501  1.00 8.90  ? 454 LEU C CD2 1 
ATOM   6354 N N   . HIS C 1 137 ? -10.997 68.539 21.999  1.00 28.42 ? 455 HIS C N   1 
ATOM   6355 C CA  . HIS C 1 137 ? -10.038 69.493 22.511  1.00 27.82 ? 455 HIS C CA  1 
ATOM   6356 C C   . HIS C 1 137 ? -8.749  68.799 22.838  1.00 29.06 ? 455 HIS C C   1 
ATOM   6357 O O   . HIS C 1 137 ? -7.682  69.323 22.504  1.00 27.90 ? 455 HIS C O   1 
ATOM   6358 C CB  . HIS C 1 137 ? -10.551 70.183 23.755  1.00 27.64 ? 455 HIS C CB  1 
ATOM   6359 C CG  . HIS C 1 137 ? -11.736 71.045 23.510  1.00 27.02 ? 455 HIS C CG  1 
ATOM   6360 N ND1 . HIS C 1 137 ? -12.595 71.425 24.518  1.00 30.97 ? 455 HIS C ND1 1 
ATOM   6361 C CD2 . HIS C 1 137 ? -12.217 71.590 22.369  1.00 24.60 ? 455 HIS C CD2 1 
ATOM   6362 C CE1 . HIS C 1 137 ? -13.548 72.185 24.007  1.00 31.02 ? 455 HIS C CE1 1 
ATOM   6363 N NE2 . HIS C 1 137 ? -13.341 72.302 22.705  1.00 25.15 ? 455 HIS C NE2 1 
ATOM   6364 N N   . LYS C 1 138 ? -8.848  67.633 23.499  1.00 30.07 ? 456 LYS C N   1 
ATOM   6365 C CA  . LYS C 1 138 ? -7.660  66.805 23.831  1.00 31.52 ? 456 LYS C CA  1 
ATOM   6366 C C   . LYS C 1 138 ? -6.759  66.634 22.626  1.00 31.07 ? 456 LYS C C   1 
ATOM   6367 O O   . LYS C 1 138 ? -5.555  66.708 22.730  1.00 31.37 ? 456 LYS C O   1 
ATOM   6368 C CB  . LYS C 1 138 ? -8.062  65.418 24.344  1.00 32.92 ? 456 LYS C CB  1 
ATOM   6369 C CG  . LYS C 1 138 ? -7.144  64.856 25.441  1.00 33.93 ? 456 LYS C CG  1 
ATOM   6370 C CD  . LYS C 1 138 ? -7.781  63.689 26.210  1.00 37.23 ? 456 LYS C CD  1 
ATOM   6371 C CE  . LYS C 1 138 ? -9.006  64.123 27.041  1.00 39.18 ? 456 LYS C CE  1 
ATOM   6372 N NZ  . LYS C 1 138 ? -9.741  62.983 27.714  1.00 37.60 ? 456 LYS C NZ  1 
ATOM   6373 N N   . ARG C 1 139 ? -7.373  66.421 21.474  1.00 33.70 ? 457 ARG C N   1 
ATOM   6374 C CA  . ARG C 1 139 ? -6.674  66.285 20.207  1.00 34.83 ? 457 ARG C CA  1 
ATOM   6375 C C   . ARG C 1 139 ? -6.278  67.627 19.557  1.00 34.80 ? 457 ARG C C   1 
ATOM   6376 O O   . ARG C 1 139 ? -5.886  67.653 18.390  1.00 35.43 ? 457 ARG C O   1 
ATOM   6377 C CB  . ARG C 1 139 ? -7.552  65.499 19.236  1.00 35.34 ? 457 ARG C CB  1 
ATOM   6378 C CG  . ARG C 1 139 ? -7.923  64.117 19.702  1.00 39.75 ? 457 ARG C CG  1 
ATOM   6379 C CD  . ARG C 1 139 ? -6.705  63.225 19.809  1.00 51.17 ? 457 ARG C CD  1 
ATOM   6380 N NE  . ARG C 1 139 ? -7.095  61.889 20.262  1.00 63.86 ? 457 ARG C NE  1 
ATOM   6381 C CZ  . ARG C 1 139 ? -7.306  60.842 19.460  1.00 67.06 ? 457 ARG C CZ  1 
ATOM   6382 N NH1 . ARG C 1 139 ? -7.154  60.945 18.139  1.00 66.45 ? 457 ARG C NH1 1 
ATOM   6383 N NH2 . ARG C 1 139 ? -7.667  59.681 19.989  1.00 67.88 ? 457 ARG C NH2 1 
ATOM   6384 N N   . GLY C 1 140 ? -6.384  68.732 20.296  1.00 33.46 ? 458 GLY C N   1 
ATOM   6385 C CA  . GLY C 1 140 ? -6.036  70.051 19.759  1.00 30.25 ? 458 GLY C CA  1 
ATOM   6386 C C   . GLY C 1 140 ? -6.963  70.563 18.660  1.00 28.27 ? 458 GLY C C   1 
ATOM   6387 O O   . GLY C 1 140 ? -6.535  71.280 17.754  1.00 27.70 ? 458 GLY C O   1 
ATOM   6388 N N   . ILE C 1 141 ? -8.239  70.204 18.734  1.00 27.73 ? 459 ILE C N   1 
ATOM   6389 C CA  . ILE C 1 141 ? -9.219  70.691 17.764  1.00 27.58 ? 459 ILE C CA  1 
ATOM   6390 C C   . ILE C 1 141 ? -10.205 71.662 18.384  1.00 28.92 ? 459 ILE C C   1 
ATOM   6391 O O   . ILE C 1 141 ? -10.577 71.512 19.542  1.00 30.54 ? 459 ILE C O   1 
ATOM   6392 C CB  . ILE C 1 141 ? -10.023 69.552 17.175  1.00 25.79 ? 459 ILE C CB  1 
ATOM   6393 C CG1 . ILE C 1 141 ? -9.110  68.658 16.354  1.00 25.25 ? 459 ILE C CG1 1 
ATOM   6394 C CG2 . ILE C 1 141 ? -11.108 70.091 16.280  1.00 25.38 ? 459 ILE C CG2 1 
ATOM   6395 C CD1 . ILE C 1 141 ? -9.860  67.739 15.454  1.00 25.61 ? 459 ILE C CD1 1 
ATOM   6396 N N   . ILE C 1 142 ? -10.630 72.659 17.620  1.00 29.36 ? 460 ILE C N   1 
ATOM   6397 C CA  . ILE C 1 142 ? -11.706 73.531 18.067  1.00 30.58 ? 460 ILE C CA  1 
ATOM   6398 C C   . ILE C 1 142 ? -12.912 73.375 17.125  1.00 30.93 ? 460 ILE C C   1 
ATOM   6399 O O   . ILE C 1 142 ? -12.771 73.458 15.910  1.00 33.01 ? 460 ILE C O   1 
ATOM   6400 C CB  . ILE C 1 142 ? -11.259 74.989 18.102  1.00 31.51 ? 460 ILE C CB  1 
ATOM   6401 C CG1 . ILE C 1 142 ? -9.856  75.100 18.673  1.00 30.87 ? 460 ILE C CG1 1 
ATOM   6402 C CG2 . ILE C 1 142 ? -12.213 75.838 18.930  1.00 33.04 ? 460 ILE C CG2 1 
ATOM   6403 C CD1 . ILE C 1 142 ? -9.278  76.465 18.425  1.00 33.13 ? 460 ILE C CD1 1 
ATOM   6404 N N   . TYR C 1 143 ? -14.098 73.156 17.684  1.00 29.81 ? 461 TYR C N   1 
ATOM   6405 C CA  . TYR C 1 143 ? -15.260 72.805 16.879  1.00 28.08 ? 461 TYR C CA  1 
ATOM   6406 C C   . TYR C 1 143 ? -15.774 74.001 16.136  1.00 25.69 ? 461 TYR C C   1 
ATOM   6407 O O   . TYR C 1 143 ? -15.924 73.985 14.917  1.00 24.69 ? 461 TYR C O   1 
ATOM   6408 C CB  . TYR C 1 143 ? -16.353 72.266 17.783  1.00 29.27 ? 461 TYR C CB  1 
ATOM   6409 C CG  . TYR C 1 143 ? -17.565 71.756 17.048  1.00 31.45 ? 461 TYR C CG  1 
ATOM   6410 C CD1 . TYR C 1 143 ? -17.453 71.126 15.823  1.00 34.07 ? 461 TYR C CD1 1 
ATOM   6411 C CD2 . TYR C 1 143 ? -18.825 71.891 17.597  1.00 32.13 ? 461 TYR C CD2 1 
ATOM   6412 C CE1 . TYR C 1 143 ? -18.579 70.655 15.166  1.00 38.28 ? 461 TYR C CE1 1 
ATOM   6413 C CE2 . TYR C 1 143 ? -19.940 71.426 16.956  1.00 32.11 ? 461 TYR C CE2 1 
ATOM   6414 C CZ  . TYR C 1 143 ? -19.824 70.812 15.750  1.00 33.17 ? 461 TYR C CZ  1 
ATOM   6415 O OH  . TYR C 1 143 ? -20.967 70.361 15.132  1.00 35.54 ? 461 TYR C OH  1 
ATOM   6416 N N   . ARG C 1 144 ? -16.037 75.039 16.911  1.00 24.14 ? 462 ARG C N   1 
ATOM   6417 C CA  . ARG C 1 144 ? -16.456 76.336 16.403  1.00 23.51 ? 462 ARG C CA  1 
ATOM   6418 C C   . ARG C 1 144 ? -17.858 76.325 15.793  1.00 22.66 ? 462 ARG C C   1 
ATOM   6419 O O   . ARG C 1 144 ? -18.298 77.307 15.233  1.00 22.62 ? 462 ARG C O   1 
ATOM   6420 C CB  . ARG C 1 144 ? -15.396 76.953 15.469  1.00 20.95 ? 462 ARG C CB  1 
ATOM   6421 C CG  . ARG C 1 144 ? -14.128 77.385 16.217  1.00 23.52 ? 462 ARG C CG  1 
ATOM   6422 C CD  . ARG C 1 144 ? -13.161 78.255 15.391  1.00 22.49 ? 462 ARG C CD  1 
ATOM   6423 N NE  . ARG C 1 144 ? -12.852 77.606 14.125  1.00 27.49 ? 462 ARG C NE  1 
ATOM   6424 C CZ  . ARG C 1 144 ? -12.428 78.237 13.040  1.00 28.47 ? 462 ARG C CZ  1 
ATOM   6425 N NH1 . ARG C 1 144 ? -12.229 79.542 13.060  1.00 35.21 ? 462 ARG C NH1 1 
ATOM   6426 N NH2 . ARG C 1 144 ? -12.206 77.566 11.931  1.00 27.10 ? 462 ARG C NH2 1 
ATOM   6427 N N   . ASP C 1 145 ? -18.576 75.223 15.923  1.00 23.75 ? 463 ASP C N   1 
ATOM   6428 C CA  . ASP C 1 145 ? -19.912 75.171 15.339  1.00 23.94 ? 463 ASP C CA  1 
ATOM   6429 C C   . ASP C 1 145 ? -20.870 74.422 16.241  1.00 24.15 ? 463 ASP C C   1 
ATOM   6430 O O   . ASP C 1 145 ? -21.825 73.788 15.798  1.00 24.08 ? 463 ASP C O   1 
ATOM   6431 C CB  . ASP C 1 145 ? -19.890 74.548 13.947  1.00 24.00 ? 463 ASP C CB  1 
ATOM   6432 C CG  . ASP C 1 145 ? -20.853 75.223 13.021  1.00 24.45 ? 463 ASP C CG  1 
ATOM   6433 O OD1 . ASP C 1 145 ? -21.326 76.308 13.413  1.00 31.05 ? 463 ASP C OD1 1 
ATOM   6434 O OD2 . ASP C 1 145 ? -21.151 74.693 11.933  1.00 23.73 ? 463 ASP C OD2 1 
ATOM   6435 N N   . LEU C 1 146 ? -20.602 74.492 17.529  1.00 23.81 ? 464 LEU C N   1 
ATOM   6436 C CA  . LEU C 1 146 ? -21.515 73.915 18.469  1.00 23.57 ? 464 LEU C CA  1 
ATOM   6437 C C   . LEU C 1 146 ? -22.779 74.726 18.454  1.00 23.37 ? 464 LEU C C   1 
ATOM   6438 O O   . LEU C 1 146 ? -22.767 75.901 18.845  1.00 21.57 ? 464 LEU C O   1 
ATOM   6439 C CB  . LEU C 1 146 ? -20.919 74.003 19.847  1.00 25.16 ? 464 LEU C CB  1 
ATOM   6440 C CG  . LEU C 1 146 ? -21.719 73.253 20.894  1.00 22.75 ? 464 LEU C CG  1 
ATOM   6441 C CD1 . LEU C 1 146 ? -22.062 71.865 20.382  1.00 17.30 ? 464 LEU C CD1 1 
ATOM   6442 C CD2 . LEU C 1 146 ? -20.856 73.229 22.152  1.00 25.99 ? 464 LEU C CD2 1 
ATOM   6443 N N   . LYS C 1 147 ? -23.859 74.107 17.986  1.00 22.76 ? 465 LYS C N   1 
ATOM   6444 C CA  . LYS C 1 147 ? -25.162 74.755 17.966  1.00 21.40 ? 465 LYS C CA  1 
ATOM   6445 C C   . LYS C 1 147 ? -26.229 73.706 17.863  1.00 22.81 ? 465 LYS C C   1 
ATOM   6446 O O   . LYS C 1 147 ? -25.964 72.586 17.439  1.00 23.53 ? 465 LYS C O   1 
ATOM   6447 C CB  . LYS C 1 147 ? -25.271 75.646 16.757  1.00 21.06 ? 465 LYS C CB  1 
ATOM   6448 C CG  . LYS C 1 147 ? -25.295 74.885 15.474  1.00 18.37 ? 465 LYS C CG  1 
ATOM   6449 C CD  . LYS C 1 147 ? -25.009 75.833 14.342  1.00 16.81 ? 465 LYS C CD  1 
ATOM   6450 C CE  . LYS C 1 147 ? -25.049 75.165 13.007  1.00 13.62 ? 465 LYS C CE  1 
ATOM   6451 N NZ  . LYS C 1 147 ? -24.648 76.206 12.034  1.00 24.83 ? 465 LYS C NZ  1 
ATOM   6452 N N   . LEU C 1 148 ? -27.452 74.059 18.231  1.00 24.11 ? 466 LEU C N   1 
ATOM   6453 C CA  . LEU C 1 148 ? -28.535 73.082 18.223  1.00 24.54 ? 466 LEU C CA  1 
ATOM   6454 C C   . LEU C 1 148 ? -28.649 72.275 16.917  1.00 26.01 ? 466 LEU C C   1 
ATOM   6455 O O   . LEU C 1 148 ? -28.881 71.069 16.935  1.00 26.19 ? 466 LEU C O   1 
ATOM   6456 C CB  . LEU C 1 148 ? -29.838 73.764 18.584  1.00 22.67 ? 466 LEU C CB  1 
ATOM   6457 C CG  . LEU C 1 148 ? -29.911 73.966 20.098  1.00 25.92 ? 466 LEU C CG  1 
ATOM   6458 C CD1 . LEU C 1 148 ? -31.070 74.885 20.557  1.00 17.51 ? 466 LEU C CD1 1 
ATOM   6459 C CD2 . LEU C 1 148 ? -29.954 72.588 20.803  1.00 21.99 ? 466 LEU C CD2 1 
ATOM   6460 N N   . ASP C 1 149 ? -28.427 72.940 15.794  1.00 28.18 ? 467 ASP C N   1 
ATOM   6461 C CA  . ASP C 1 149 ? -28.654 72.342 14.488  1.00 30.70 ? 467 ASP C CA  1 
ATOM   6462 C C   . ASP C 1 149 ? -27.660 71.276 14.095  1.00 29.84 ? 467 ASP C C   1 
ATOM   6463 O O   . ASP C 1 149 ? -27.898 70.537 13.141  1.00 30.73 ? 467 ASP C O   1 
ATOM   6464 C CB  . ASP C 1 149 ? -28.597 73.406 13.414  1.00 32.93 ? 467 ASP C CB  1 
ATOM   6465 C CG  . ASP C 1 149 ? -29.715 73.278 12.462  1.00 39.68 ? 467 ASP C CG  1 
ATOM   6466 O OD1 . ASP C 1 149 ? -30.843 73.467 12.959  1.00 50.78 ? 467 ASP C OD1 1 
ATOM   6467 O OD2 . ASP C 1 149 ? -29.491 72.988 11.256  1.00 48.36 ? 467 ASP C OD2 1 
ATOM   6468 N N   . ASN C 1 150 ? -26.531 71.241 14.799  1.00 28.36 ? 468 ASN C N   1 
ATOM   6469 C CA  . ASN C 1 150 ? -25.469 70.261 14.557  1.00 26.29 ? 468 ASN C CA  1 
ATOM   6470 C C   . ASN C 1 150 ? -25.562 69.065 15.490  1.00 26.09 ? 468 ASN C C   1 
ATOM   6471 O O   . ASN C 1 150 ? -24.747 68.140 15.397  1.00 25.34 ? 468 ASN C O   1 
ATOM   6472 C CB  . ASN C 1 150 ? -24.098 70.904 14.708  1.00 23.96 ? 468 ASN C CB  1 
ATOM   6473 C CG  . ASN C 1 150 ? -23.708 71.699 13.500  1.00 25.11 ? 468 ASN C CG  1 
ATOM   6474 O OD1 . ASN C 1 150 ? -24.112 71.383 12.377  1.00 30.67 ? 468 ASN C OD1 1 
ATOM   6475 N ND2 . ASN C 1 150 ? -22.907 72.728 13.707  1.00 23.40 ? 468 ASN C ND2 1 
ATOM   6476 N N   . VAL C 1 151 ? -26.555 69.094 16.386  1.00 26.45 ? 469 VAL C N   1 
ATOM   6477 C CA  . VAL C 1 151 ? -26.732 68.033 17.381  1.00 26.51 ? 469 VAL C CA  1 
ATOM   6478 C C   . VAL C 1 151 ? -28.024 67.255 17.158  1.00 26.72 ? 469 VAL C C   1 
ATOM   6479 O O   . VAL C 1 151 ? -29.107 67.822 17.014  1.00 28.06 ? 469 VAL C O   1 
ATOM   6480 C CB  . VAL C 1 151 ? -26.656 68.561 18.825  1.00 25.01 ? 469 VAL C CB  1 
ATOM   6481 C CG1 . VAL C 1 151 ? -26.452 67.426 19.769  1.00 24.82 ? 469 VAL C CG1 1 
ATOM   6482 C CG2 . VAL C 1 151 ? -25.510 69.508 18.959  1.00 24.39 ? 469 VAL C CG2 1 
ATOM   6483 N N   . MET C 1 152 ? -27.889 65.944 17.136  1.00 26.13 ? 470 MET C N   1 
ATOM   6484 C CA  . MET C 1 152 ? -28.954 65.091 16.687  1.00 28.54 ? 470 MET C CA  1 
ATOM   6485 C C   . MET C 1 152 ? -29.140 64.025 17.737  1.00 29.15 ? 470 MET C C   1 
ATOM   6486 O O   . MET C 1 152 ? -28.229 63.769 18.513  1.00 29.90 ? 470 MET C O   1 
ATOM   6487 C CB  . MET C 1 152 ? -28.566 64.431 15.358  1.00 28.07 ? 470 MET C CB  1 
ATOM   6488 C CG  . MET C 1 152 ? -28.992 65.188 14.117  1.00 31.46 ? 470 MET C CG  1 
ATOM   6489 S SD  . MET C 1 152 ? -28.712 64.283 12.565  1.00 37.26 ? 470 MET C SD  1 
ATOM   6490 C CE  . MET C 1 152 ? -26.910 64.195 12.555  1.00 34.56 ? 470 MET C CE  1 
ATOM   6491 N N   . LEU C 1 153 ? -30.310 63.406 17.768  1.00 29.68 ? 471 LEU C N   1 
ATOM   6492 C CA  . LEU C 1 153 ? -30.483 62.224 18.579  1.00 32.40 ? 471 LEU C CA  1 
ATOM   6493 C C   . LEU C 1 153 ? -30.469 60.967 17.690  1.00 32.83 ? 471 LEU C C   1 
ATOM   6494 O O   . LEU C 1 153 ? -31.111 60.950 16.655  1.00 34.71 ? 471 LEU C O   1 
ATOM   6495 C CB  . LEU C 1 153 ? -31.805 62.323 19.331  1.00 33.49 ? 471 LEU C CB  1 
ATOM   6496 C CG  . LEU C 1 153 ? -31.901 63.115 20.632  1.00 33.23 ? 471 LEU C CG  1 
ATOM   6497 C CD1 . LEU C 1 153 ? -33.301 62.963 21.166  1.00 35.47 ? 471 LEU C CD1 1 
ATOM   6498 C CD2 . LEU C 1 153 ? -30.933 62.561 21.638  1.00 35.30 ? 471 LEU C CD2 1 
ATOM   6499 N N   . ASP C 1 154 ? -29.741 59.919 18.060  1.00 32.36 ? 472 ASP C N   1 
ATOM   6500 C CA  . ASP C 1 154 ? -29.874 58.669 17.307  1.00 31.47 ? 472 ASP C CA  1 
ATOM   6501 C C   . ASP C 1 154 ? -31.160 57.973 17.764  1.00 33.10 ? 472 ASP C C   1 
ATOM   6502 O O   . ASP C 1 154 ? -31.887 58.478 18.631  1.00 32.36 ? 472 ASP C O   1 
ATOM   6503 C CB  . ASP C 1 154 ? -28.640 57.749 17.442  1.00 30.47 ? 472 ASP C CB  1 
ATOM   6504 C CG  . ASP C 1 154 ? -28.373 57.292 18.881  1.00 29.16 ? 472 ASP C CG  1 
ATOM   6505 O OD1 . ASP C 1 154 ? -29.252 57.443 19.756  1.00 25.51 ? 472 ASP C OD1 1 
ATOM   6506 O OD2 . ASP C 1 154 ? -27.270 56.765 19.143  1.00 30.21 ? 472 ASP C OD2 1 
ATOM   6507 N N   . SER C 1 155 ? -31.443 56.809 17.193  1.00 33.37 ? 473 SER C N   1 
ATOM   6508 C CA  . SER C 1 155 ? -32.698 56.141 17.472  1.00 32.53 ? 473 SER C CA  1 
ATOM   6509 C C   . SER C 1 155 ? -32.826 55.650 18.912  1.00 33.31 ? 473 SER C C   1 
ATOM   6510 O O   . SER C 1 155 ? -33.928 55.484 19.410  1.00 35.52 ? 473 SER C O   1 
ATOM   6511 C CB  . SER C 1 155 ? -32.897 55.006 16.495  1.00 31.40 ? 473 SER C CB  1 
ATOM   6512 O OG  . SER C 1 155 ? -31.789 54.153 16.553  1.00 30.92 ? 473 SER C OG  1 
ATOM   6513 N N   . GLU C 1 156 ? -31.711 55.428 19.588  1.00 33.53 ? 474 GLU C N   1 
ATOM   6514 C CA  . GLU C 1 156 ? -31.758 55.069 20.999  1.00 33.67 ? 474 GLU C CA  1 
ATOM   6515 C C   . GLU C 1 156 ? -31.879 56.294 21.890  1.00 34.05 ? 474 GLU C C   1 
ATOM   6516 O O   . GLU C 1 156 ? -32.122 56.168 23.092  1.00 35.01 ? 474 GLU C O   1 
ATOM   6517 C CB  . GLU C 1 156 ? -30.521 54.279 21.396  1.00 33.41 ? 474 GLU C CB  1 
ATOM   6518 C CG  . GLU C 1 156 ? -30.583 52.841 20.976  1.00 37.12 ? 474 GLU C CG  1 
ATOM   6519 C CD  . GLU C 1 156 ? -29.210 52.249 20.756  1.00 45.60 ? 474 GLU C CD  1 
ATOM   6520 O OE1 . GLU C 1 156 ? -28.995 51.083 21.171  1.00 49.56 ? 474 GLU C OE1 1 
ATOM   6521 O OE2 . GLU C 1 156 ? -28.345 52.956 20.176  1.00 47.48 ? 474 GLU C OE2 1 
ATOM   6522 N N   . GLY C 1 157 ? -31.701 57.477 21.308  1.00 34.03 ? 475 GLY C N   1 
ATOM   6523 C CA  . GLY C 1 157 ? -31.873 58.732 22.047  1.00 32.59 ? 475 GLY C CA  1 
ATOM   6524 C C   . GLY C 1 157 ? -30.581 59.268 22.630  1.00 31.61 ? 475 GLY C C   1 
ATOM   6525 O O   . GLY C 1 157 ? -30.589 60.177 23.452  1.00 31.53 ? 475 GLY C O   1 
ATOM   6526 N N   . HIS C 1 158 ? -29.466 58.686 22.215  1.00 31.63 ? 476 HIS C N   1 
ATOM   6527 C CA  . HIS C 1 158 ? -28.163 59.240 22.524  1.00 31.59 ? 476 HIS C CA  1 
ATOM   6528 C C   . HIS C 1 158 ? -27.834 60.415 21.609  1.00 30.62 ? 476 HIS C C   1 
ATOM   6529 O O   . HIS C 1 158 ? -28.460 60.627 20.562  1.00 28.24 ? 476 HIS C O   1 
ATOM   6530 C CB  . HIS C 1 158 ? -27.081 58.162 22.407  1.00 32.99 ? 476 HIS C CB  1 
ATOM   6531 C CG  . HIS C 1 158 ? -27.140 57.143 23.504  1.00 38.97 ? 476 HIS C CG  1 
ATOM   6532 N ND1 . HIS C 1 158 ? -26.537 57.333 24.729  1.00 39.60 ? 476 HIS C ND1 1 
ATOM   6533 C CD2 . HIS C 1 158 ? -27.758 55.938 23.571  1.00 39.83 ? 476 HIS C CD2 1 
ATOM   6534 C CE1 . HIS C 1 158 ? -26.771 56.284 25.498  1.00 39.60 ? 476 HIS C CE1 1 
ATOM   6535 N NE2 . HIS C 1 158 ? -27.507 55.423 24.819  1.00 39.10 ? 476 HIS C NE2 1 
ATOM   6536 N N   . ILE C 1 159 ? -26.833 61.180 22.017  1.00 30.62 ? 477 ILE C N   1 
ATOM   6537 C CA  . ILE C 1 159 ? -26.359 62.285 21.208  1.00 30.66 ? 477 ILE C CA  1 
ATOM   6538 C C   . ILE C 1 159 ? -25.387 61.903 20.073  1.00 29.96 ? 477 ILE C C   1 
ATOM   6539 O O   . ILE C 1 159 ? -24.536 61.009 20.219  1.00 30.77 ? 477 ILE C O   1 
ATOM   6540 C CB  . ILE C 1 159 ? -25.802 63.407 22.076  1.00 30.64 ? 477 ILE C CB  1 
ATOM   6541 C CG1 . ILE C 1 159 ? -26.896 64.473 22.232  1.00 32.69 ? 477 ILE C CG1 1 
ATOM   6542 C CG2 . ILE C 1 159 ? -24.550 63.978 21.441  1.00 26.73 ? 477 ILE C CG2 1 
ATOM   6543 C CD1 . ILE C 1 159 ? -26.780 65.299 23.473  1.00 35.30 ? 477 ILE C CD1 1 
ATOM   6544 N N   . LYS C 1 160 ? -25.587 62.557 18.928  1.00 27.25 ? 478 LYS C N   1 
ATOM   6545 C CA  . LYS C 1 160 ? -24.672 62.495 17.809  1.00 25.49 ? 478 LYS C CA  1 
ATOM   6546 C C   . LYS C 1 160 ? -24.386 63.937 17.426  1.00 26.68 ? 478 LYS C C   1 
ATOM   6547 O O   . LYS C 1 160 ? -25.291 64.669 17.067  1.00 28.24 ? 478 LYS C O   1 
ATOM   6548 C CB  . LYS C 1 160 ? -25.306 61.772 16.635  1.00 23.36 ? 478 LYS C CB  1 
ATOM   6549 C CG  . LYS C 1 160 ? -25.474 60.288 16.832  1.00 20.87 ? 478 LYS C CG  1 
ATOM   6550 C CD  . LYS C 1 160 ? -24.158 59.633 17.249  1.00 19.44 ? 478 LYS C CD  1 
ATOM   6551 C CE  . LYS C 1 160 ? -24.085 58.170 16.788  1.00 15.64 ? 478 LYS C CE  1 
ATOM   6552 N NZ  . LYS C 1 160 ? -22.828 57.548 17.217  1.00 14.66 ? 478 LYS C NZ  1 
ATOM   6553 N N   . ILE C 1 161 ? -23.143 64.379 17.560  1.00 27.01 ? 479 ILE C N   1 
ATOM   6554 C CA  . ILE C 1 161 ? -22.799 65.688 17.062  1.00 26.40 ? 479 ILE C CA  1 
ATOM   6555 C C   . ILE C 1 161 ? -22.316 65.459 15.654  1.00 27.16 ? 479 ILE C C   1 
ATOM   6556 O O   . ILE C 1 161 ? -21.659 64.433 15.378  1.00 25.76 ? 479 ILE C O   1 
ATOM   6557 C CB  . ILE C 1 161 ? -21.666 66.334 17.835  1.00 26.47 ? 479 ILE C CB  1 
ATOM   6558 C CG1 . ILE C 1 161 ? -22.010 66.422 19.318  1.00 25.15 ? 479 ILE C CG1 1 
ATOM   6559 C CG2 . ILE C 1 161 ? -21.366 67.716 17.245  1.00 22.74 ? 479 ILE C CG2 1 
ATOM   6560 C CD1 . ILE C 1 161 ? -20.847 66.922 20.175  1.00 20.58 ? 479 ILE C CD1 1 
ATOM   6561 N N   . ALA C 1 162 ? -22.626 66.402 14.767  1.00 26.09 ? 480 ALA C N   1 
ATOM   6562 C CA  . ALA C 1 162 ? -22.242 66.230 13.383  1.00 27.29 ? 480 ALA C CA  1 
ATOM   6563 C C   . ALA C 1 162 ? -21.801 67.526 12.748  1.00 28.21 ? 480 ALA C C   1 
ATOM   6564 O O   . ALA C 1 162 ? -21.754 68.568 13.399  1.00 25.39 ? 480 ALA C O   1 
ATOM   6565 C CB  . ALA C 1 162 ? -23.362 65.607 12.597  1.00 26.70 ? 480 ALA C CB  1 
ATOM   6566 N N   . ASP C 1 163 ? -21.466 67.428 11.462  1.00 31.00 ? 481 ASP C N   1 
ATOM   6567 C CA  . ASP C 1 163 ? -21.016 68.566 10.669  1.00 30.94 ? 481 ASP C CA  1 
ATOM   6568 C C   . ASP C 1 163 ? -19.769 69.198 11.297  1.00 30.89 ? 481 ASP C C   1 
ATOM   6569 O O   . ASP C 1 163 ? -19.887 70.034 12.184  1.00 30.89 ? 481 ASP C O   1 
ATOM   6570 C CB  . ASP C 1 163 ? -22.168 69.556 10.528  1.00 31.33 ? 481 ASP C CB  1 
ATOM   6571 C CG  . ASP C 1 163 ? -21.765 70.843 9.860   1.00 34.27 ? 481 ASP C CG  1 
ATOM   6572 O OD1 . ASP C 1 163 ? -20.598 70.931 9.398   1.00 33.07 ? 481 ASP C OD1 1 
ATOM   6573 O OD2 . ASP C 1 163 ? -22.630 71.761 9.806   1.00 30.55 ? 481 ASP C OD2 1 
ATOM   6574 N N   . PHE C 1 164 ? -18.580 68.770 10.854  1.00 31.11 ? 482 PHE C N   1 
ATOM   6575 C CA  . PHE C 1 164 ? -17.309 69.325 11.364  1.00 32.72 ? 482 PHE C CA  1 
ATOM   6576 C C   . PHE C 1 164 ? -16.585 70.208 10.350  1.00 34.35 ? 482 PHE C C   1 
ATOM   6577 O O   . PHE C 1 164 ? -15.357 70.306 10.375  1.00 34.81 ? 482 PHE C O   1 
ATOM   6578 C CB  . PHE C 1 164 ? -16.358 68.216 11.855  1.00 33.12 ? 482 PHE C CB  1 
ATOM   6579 C CG  . PHE C 1 164 ? -16.965 67.347 12.913  1.00 34.28 ? 482 PHE C CG  1 
ATOM   6580 C CD1 . PHE C 1 164 ? -17.667 66.204 12.569  1.00 30.55 ? 482 PHE C CD1 1 
ATOM   6581 C CD2 . PHE C 1 164 ? -16.906 67.712 14.239  1.00 32.91 ? 482 PHE C CD2 1 
ATOM   6582 C CE1 . PHE C 1 164 ? -18.269 65.435 13.519  1.00 26.59 ? 482 PHE C CE1 1 
ATOM   6583 C CE2 . PHE C 1 164 ? -17.514 66.937 15.192  1.00 31.12 ? 482 PHE C CE2 1 
ATOM   6584 C CZ  . PHE C 1 164 ? -18.186 65.790 14.825  1.00 29.72 ? 482 PHE C CZ  1 
ATOM   6585 N N   . GLY C 1 165 ? -17.343 70.872 9.478   1.00 34.51 ? 483 GLY C N   1 
ATOM   6586 C CA  . GLY C 1 165 ? -16.749 71.735 8.470   1.00 35.47 ? 483 GLY C CA  1 
ATOM   6587 C C   . GLY C 1 165 ? -16.213 73.085 8.937   1.00 36.45 ? 483 GLY C C   1 
ATOM   6588 O O   . GLY C 1 165 ? -16.067 73.994 8.126   1.00 37.92 ? 483 GLY C O   1 
ATOM   6589 N N   . MET C 1 166 ? -15.925 73.248 10.225  1.00 36.09 ? 484 MET C N   1 
ATOM   6590 C CA  . MET C 1 166 ? -15.445 74.548 10.691  1.00 35.20 ? 484 MET C CA  1 
ATOM   6591 C C   . MET C 1 166 ? -14.316 74.463 11.677  1.00 36.10 ? 484 MET C C   1 
ATOM   6592 O O   . MET C 1 166 ? -13.898 75.481 12.211  1.00 36.64 ? 484 MET C O   1 
ATOM   6593 C CB  . MET C 1 166 ? -16.563 75.356 11.317  1.00 33.81 ? 484 MET C CB  1 
ATOM   6594 C CG  . MET C 1 166 ? -16.902 76.579 10.514  1.00 36.52 ? 484 MET C CG  1 
ATOM   6595 S SD  . MET C 1 166 ? -17.889 77.803 11.413  1.00 41.39 ? 484 MET C SD  1 
ATOM   6596 C CE  . MET C 1 166 ? -19.538 77.213 11.036  1.00 38.48 ? 484 MET C CE  1 
ATOM   6597 N N   . CYS C 1 167 ? -13.835 73.249 11.923  1.00 36.47 ? 485 CYS C N   1 
ATOM   6598 C CA  . CYS C 1 167 ? -12.821 73.011 12.939  1.00 35.97 ? 485 CYS C CA  1 
ATOM   6599 C C   . CYS C 1 167 ? -11.524 73.711 12.638  1.00 36.43 ? 485 CYS C C   1 
ATOM   6600 O O   . CYS C 1 167 ? -11.164 73.888 11.469  1.00 37.99 ? 485 CYS C O   1 
ATOM   6601 C CB  . CYS C 1 167 ? -12.546 71.517 13.076  1.00 35.96 ? 485 CYS C CB  1 
ATOM   6602 S SG  . CYS C 1 167 ? -13.976 70.601 13.616  1.00 33.09 ? 485 CYS C SG  1 
ATOM   6603 N N   . LYS C 1 168 ? -10.836 74.123 13.696  1.00 34.96 ? 486 LYS C N   1 
ATOM   6604 C CA  . LYS C 1 168 ? -9.494  74.614 13.564  1.00 35.12 ? 486 LYS C CA  1 
ATOM   6605 C C   . LYS C 1 168 ? -8.631  73.522 14.162  1.00 34.99 ? 486 LYS C C   1 
ATOM   6606 O O   . LYS C 1 168 ? -8.998  72.930 15.174  1.00 36.23 ? 486 LYS C O   1 
ATOM   6607 C CB  . LYS C 1 168 ? -9.310  75.922 14.319  1.00 35.78 ? 486 LYS C CB  1 
ATOM   6608 C CG  . LYS C 1 168 ? -8.057  76.674 13.902  1.00 36.37 ? 486 LYS C CG  1 
ATOM   6609 C CD  . LYS C 1 168 ? -8.422  77.807 12.976  1.00 36.31 ? 486 LYS C CD  1 
ATOM   6610 C CE  . LYS C 1 168 ? -7.274  78.230 12.053  1.00 35.77 ? 486 LYS C CE  1 
ATOM   6611 N NZ  . LYS C 1 168 ? -7.766  79.339 11.166  1.00 34.78 ? 486 LYS C NZ  1 
ATOM   6612 N N   . GLU C 1 169 ? -7.503  73.240 13.520  1.00 33.78 ? 487 GLU C N   1 
ATOM   6613 C CA  . GLU C 1 169 ? -6.629  72.152 13.914  1.00 32.29 ? 487 GLU C CA  1 
ATOM   6614 C C   . GLU C 1 169 ? -5.435  72.671 14.691  1.00 33.94 ? 487 GLU C C   1 
ATOM   6615 O O   . GLU C 1 169 ? -5.369  73.853 15.022  1.00 33.32 ? 487 GLU C O   1 
ATOM   6616 C CB  . GLU C 1 169 ? -6.104  71.443 12.682  1.00 30.37 ? 487 GLU C CB  1 
ATOM   6617 C CG  . GLU C 1 169 ? -6.859  70.232 12.270  1.00 31.56 ? 487 GLU C CG  1 
ATOM   6618 C CD  . GLU C 1 169 ? -6.350  69.661 10.952  1.00 37.52 ? 487 GLU C CD  1 
ATOM   6619 O OE1 . GLU C 1 169 ? -6.119  70.439 9.984   1.00 39.70 ? 487 GLU C OE1 1 
ATOM   6620 O OE2 . GLU C 1 169 ? -6.179  68.424 10.881  1.00 37.61 ? 487 GLU C OE2 1 
ATOM   6621 N N   . HIS C 1 170 ? -4.488  71.759 14.934  1.00 36.16 ? 488 HIS C N   1 
ATOM   6622 C CA  . HIS C 1 170 ? -3.240  71.979 15.685  1.00 37.14 ? 488 HIS C CA  1 
ATOM   6623 C C   . HIS C 1 170 ? -3.376  73.051 16.724  1.00 36.61 ? 488 HIS C C   1 
ATOM   6624 O O   . HIS C 1 170 ? -2.492  73.878 16.877  1.00 37.40 ? 488 HIS C O   1 
ATOM   6625 C CB  . HIS C 1 170 ? -2.065  72.280 14.752  1.00 37.00 ? 488 HIS C CB  1 
ATOM   6626 C CG  . HIS C 1 170 ? -2.046  71.420 13.529  1.00 42.16 ? 488 HIS C CG  1 
ATOM   6627 N ND1 . HIS C 1 170 ? -2.164  70.047 13.584  1.00 48.77 ? 488 HIS C ND1 1 
ATOM   6628 C CD2 . HIS C 1 170 ? -1.947  71.735 12.214  1.00 45.47 ? 488 HIS C CD2 1 
ATOM   6629 C CE1 . HIS C 1 170 ? -2.137  69.551 12.357  1.00 49.10 ? 488 HIS C CE1 1 
ATOM   6630 N NE2 . HIS C 1 170 ? -2.005  70.555 11.507  1.00 49.10 ? 488 HIS C NE2 1 
ATOM   6631 N N   . MET C 1 171 ? -4.493  73.031 17.430  1.00 35.70 ? 489 MET C N   1 
ATOM   6632 C CA  . MET C 1 171 ? -4.759  74.041 18.420  1.00 37.19 ? 489 MET C CA  1 
ATOM   6633 C C   . MET C 1 171 ? -4.333  73.534 19.777  1.00 37.70 ? 489 MET C C   1 
ATOM   6634 O O   . MET C 1 171 ? -5.151  73.130 20.591  1.00 36.43 ? 489 MET C O   1 
ATOM   6635 C CB  . MET C 1 171 ? -6.236  74.396 18.410  1.00 37.53 ? 489 MET C CB  1 
ATOM   6636 C CG  . MET C 1 171 ? -6.658  75.119 17.156  1.00 40.89 ? 489 MET C CG  1 
ATOM   6637 S SD  . MET C 1 171 ? -5.838  76.725 17.028  1.00 41.70 ? 489 MET C SD  1 
ATOM   6638 C CE  . MET C 1 171 ? -4.432  76.361 15.983  1.00 45.14 ? 489 MET C CE  1 
ATOM   6639 N N   . MET C 1 172 ? -3.030  73.536 20.005  1.00 39.64 ? 490 MET C N   1 
ATOM   6640 C CA  . MET C 1 172 ? -2.493  73.063 21.260  1.00 40.87 ? 490 MET C CA  1 
ATOM   6641 C C   . MET C 1 172 ? -2.404  74.174 22.292  1.00 41.35 ? 490 MET C C   1 
ATOM   6642 O O   . MET C 1 172 ? -2.636  75.343 22.000  1.00 41.62 ? 490 MET C O   1 
ATOM   6643 C CB  . MET C 1 172 ? -1.114  72.465 21.040  1.00 41.59 ? 490 MET C CB  1 
ATOM   6644 C CG  . MET C 1 172 ? -1.046  71.471 19.915  1.00 42.49 ? 490 MET C CG  1 
ATOM   6645 S SD  . MET C 1 172 ? -2.260  70.171 20.081  1.00 50.82 ? 490 MET C SD  1 
ATOM   6646 C CE  . MET C 1 172 ? -2.412  69.921 21.872  1.00 46.81 ? 490 MET C CE  1 
ATOM   6647 N N   . ASP C 1 173 ? -2.061  73.786 23.509  1.00 42.00 ? 491 ASP C N   1 
ATOM   6648 C CA  . ASP C 1 173 ? -1.894  74.716 24.606  1.00 42.61 ? 491 ASP C CA  1 
ATOM   6649 C C   . ASP C 1 173 ? -1.504  76.139 24.145  1.00 42.81 ? 491 ASP C C   1 
ATOM   6650 O O   . ASP C 1 173 ? -0.322  76.429 23.916  1.00 42.76 ? 491 ASP C O   1 
ATOM   6651 C CB  . ASP C 1 173 ? -0.858  74.150 25.588  1.00 42.49 ? 491 ASP C CB  1 
ATOM   6652 C CG  . ASP C 1 173 ? -1.110  74.587 27.013  1.00 45.16 ? 491 ASP C CG  1 
ATOM   6653 O OD1 . ASP C 1 173 ? -2.296  74.756 27.376  1.00 49.54 ? 491 ASP C OD1 1 
ATOM   6654 O OD2 . ASP C 1 173 ? -0.130  74.755 27.775  1.00 45.22 ? 491 ASP C OD2 1 
ATOM   6655 N N   . GLY C 1 174 ? -2.501  77.014 24.001  1.00 42.41 ? 492 GLY C N   1 
ATOM   6656 C CA  . GLY C 1 174 ? -2.249  78.441 23.807  1.00 42.60 ? 492 GLY C CA  1 
ATOM   6657 C C   . GLY C 1 174 ? -1.887  78.869 22.393  1.00 43.46 ? 492 GLY C C   1 
ATOM   6658 O O   . GLY C 1 174 ? -1.392  79.979 22.178  1.00 43.54 ? 492 GLY C O   1 
ATOM   6659 N N   . VAL C 1 175 ? -2.109  77.983 21.425  1.00 42.70 ? 493 VAL C N   1 
ATOM   6660 C CA  . VAL C 1 175 ? -2.141  78.381 20.030  1.00 40.80 ? 493 VAL C CA  1 
ATOM   6661 C C   . VAL C 1 175 ? -3.457  79.126 19.926  1.00 39.94 ? 493 VAL C C   1 
ATOM   6662 O O   . VAL C 1 175 ? -4.314  78.990 20.793  1.00 39.54 ? 493 VAL C O   1 
ATOM   6663 C CB  . VAL C 1 175 ? -2.116  77.159 19.085  1.00 41.19 ? 493 VAL C CB  1 
ATOM   6664 C CG1 . VAL C 1 175 ? -2.260  77.593 17.634  1.00 40.54 ? 493 VAL C CG1 1 
ATOM   6665 C CG2 . VAL C 1 175 ? -0.835  76.370 19.286  1.00 37.31 ? 493 VAL C CG2 1 
ATOM   6666 N N   . THR C 1 176 ? -3.625  79.927 18.890  1.00 40.09 ? 494 THR C N   1 
ATOM   6667 C CA  . THR C 1 176 ? -4.665  80.938 18.931  1.00 41.13 ? 494 THR C CA  1 
ATOM   6668 C C   . THR C 1 176 ? -4.993  81.411 17.514  1.00 42.05 ? 494 THR C C   1 
ATOM   6669 O O   . THR C 1 176 ? -4.108  81.454 16.662  1.00 43.99 ? 494 THR C O   1 
ATOM   6670 C CB  . THR C 1 176 ? -4.195  82.126 19.839  1.00 41.10 ? 494 THR C CB  1 
ATOM   6671 O OG1 . THR C 1 176 ? -5.320  82.840 20.356  1.00 42.00 ? 494 THR C OG1 1 
ATOM   6672 C CG2 . THR C 1 176 ? -3.266  83.073 19.101  1.00 38.48 ? 494 THR C CG2 1 
ATOM   6673 N N   . THR C 1 177 ? -6.261  81.728 17.247  1.00 41.36 ? 495 THR C N   1 
ATOM   6674 C CA  . THR C 1 177 ? -6.651  82.323 15.960  1.00 39.14 ? 495 THR C CA  1 
ATOM   6675 C C   . THR C 1 177 ? -7.531  83.543 16.158  1.00 38.71 ? 495 THR C C   1 
ATOM   6676 O O   . THR C 1 177 ? -8.121  83.743 17.216  1.00 37.77 ? 495 THR C O   1 
ATOM   6677 C CB  . THR C 1 177 ? -7.402  81.338 15.072  1.00 38.73 ? 495 THR C CB  1 
ATOM   6678 O OG1 . THR C 1 177 ? -8.082  80.391 15.905  1.00 36.97 ? 495 THR C OG1 1 
ATOM   6679 C CG2 . THR C 1 177 ? -6.441  80.620 14.159  1.00 38.49 ? 495 THR C CG2 1 
ATOM   6680 N N   . ARG C 1 178 ? -7.616  84.365 15.129  1.00 38.84 ? 496 ARG C N   1 
ATOM   6681 C CA  . ARG C 1 178 ? -8.411  85.568 15.238  1.00 40.32 ? 496 ARG C CA  1 
ATOM   6682 C C   . ARG C 1 178 ? -9.589  85.483 14.293  1.00 40.51 ? 496 ARG C C   1 
ATOM   6683 O O   . ARG C 1 178 ? -10.482 86.335 14.329  1.00 43.36 ? 496 ARG C O   1 
ATOM   6684 C CB  . ARG C 1 178 ? -7.567  86.817 14.957  1.00 39.36 ? 496 ARG C CB  1 
ATOM   6685 C CG  . ARG C 1 178 ? -6.439  86.985 15.961  1.00 42.59 ? 496 ARG C CG  1 
ATOM   6686 C CD  . ARG C 1 178 ? -5.867  88.376 15.928  1.00 43.61 ? 496 ARG C CD  1 
ATOM   6687 N NE  . ARG C 1 178 ? -6.933  89.358 15.847  1.00 42.00 ? 496 ARG C NE  1 
ATOM   6688 C CZ  . ARG C 1 178 ? -6.837  90.494 15.173  1.00 39.54 ? 496 ARG C CZ  1 
ATOM   6689 N NH1 . ARG C 1 178 ? -5.719  90.786 14.520  1.00 29.32 ? 496 ARG C NH1 1 
ATOM   6690 N NH2 . ARG C 1 178 ? -7.869  91.328 15.143  1.00 42.02 ? 496 ARG C NH2 1 
ATOM   6691 N N   . GLU C 1 179 ? -9.598  84.445 13.462  1.00 38.71 ? 497 GLU C N   1 
ATOM   6692 C CA  . GLU C 1 179 ? -10.646 84.280 12.458  1.00 36.69 ? 497 GLU C CA  1 
ATOM   6693 C C   . GLU C 1 179 ? -12.074 84.156 12.996  1.00 35.54 ? 497 GLU C C   1 
ATOM   6694 O O   . GLU C 1 179 ? -12.397 83.251 13.781  1.00 35.72 ? 497 GLU C O   1 
ATOM   6695 C CB  . GLU C 1 179 ? -10.354 83.083 11.579  1.00 37.81 ? 497 GLU C CB  1 
ATOM   6696 C CG  . GLU C 1 179 ? -11.490 82.782 10.641  1.00 37.56 ? 497 GLU C CG  1 
ATOM   6697 C CD  . GLU C 1 179 ? -11.309 81.474 9.946   1.00 40.73 ? 497 GLU C CD  1 
ATOM   6698 O OE1 . GLU C 1 179 ? -10.617 80.583 10.504  1.00 45.90 ? 497 GLU C OE1 1 
ATOM   6699 O OE2 . GLU C 1 179 ? -11.855 81.336 8.841   1.00 38.89 ? 497 GLU C OE2 1 
ATOM   6700 N N   . PHE C 1 180 ? -12.913 85.073 12.525  1.00 33.09 ? 498 PHE C N   1 
ATOM   6701 C CA  . PHE C 1 180 ? -14.316 85.211 12.883  1.00 30.22 ? 498 PHE C CA  1 
ATOM   6702 C C   . PHE C 1 180 ? -15.173 84.160 12.175  1.00 29.75 ? 498 PHE C C   1 
ATOM   6703 O O   . PHE C 1 180 ? -14.993 83.916 10.998  1.00 28.89 ? 498 PHE C O   1 
ATOM   6704 C CB  . PHE C 1 180 ? -14.734 86.609 12.446  1.00 29.36 ? 498 PHE C CB  1 
ATOM   6705 C CG  . PHE C 1 180 ? -16.191 86.869 12.514  1.00 31.63 ? 498 PHE C CG  1 
ATOM   6706 C CD1 . PHE C 1 180 ? -16.754 87.478 13.647  1.00 33.89 ? 498 PHE C CD1 1 
ATOM   6707 C CD2 . PHE C 1 180 ? -17.011 86.551 11.447  1.00 32.40 ? 498 PHE C CD2 1 
ATOM   6708 C CE1 . PHE C 1 180 ? -18.112 87.751 13.717  1.00 32.19 ? 498 PHE C CE1 1 
ATOM   6709 C CE2 . PHE C 1 180 ? -18.381 86.813 11.509  1.00 36.95 ? 498 PHE C CE2 1 
ATOM   6710 C CZ  . PHE C 1 180 ? -18.932 87.411 12.647  1.00 35.90 ? 498 PHE C CZ  1 
ATOM   6711 N N   . CYS C 1 181 ? -16.091 83.523 12.903  1.00 30.80 ? 499 CYS C N   1 
ATOM   6712 C CA  . CYS C 1 181 ? -17.056 82.583 12.324  1.00 30.92 ? 499 CYS C CA  1 
ATOM   6713 C C   . CYS C 1 181 ? -18.147 82.242 13.314  1.00 31.38 ? 499 CYS C C   1 
ATOM   6714 O O   . CYS C 1 181 ? -18.074 82.681 14.454  1.00 32.61 ? 499 CYS C O   1 
ATOM   6715 C CB  . CYS C 1 181 ? -16.368 81.299 11.885  1.00 31.15 ? 499 CYS C CB  1 
ATOM   6716 S SG  . CYS C 1 181 ? -15.032 80.779 12.953  1.00 31.44 ? 499 CYS C SG  1 
ATOM   6717 N N   . GLY C 1 182 ? -19.152 81.468 12.873  1.00 31.46 ? 500 GLY C N   1 
ATOM   6718 C CA  . GLY C 1 182 ? -20.161 80.866 13.770  1.00 29.07 ? 500 GLY C CA  1 
ATOM   6719 C C   . GLY C 1 182 ? -21.521 81.517 13.687  1.00 28.59 ? 500 GLY C C   1 
ATOM   6720 O O   . GLY C 1 182 ? -21.638 82.577 13.082  1.00 29.66 ? 500 GLY C O   1 
ATOM   6721 N N   . THR C 1 183 ? -22.549 80.882 14.275  1.00 28.14 ? 501 THR C N   1 
ATOM   6722 C CA  . THR C 1 183 ? -23.928 81.444 14.313  1.00 26.50 ? 501 THR C CA  1 
ATOM   6723 C C   . THR C 1 183 ? -24.059 82.521 15.394  1.00 25.01 ? 501 THR C C   1 
ATOM   6724 O O   . THR C 1 183 ? -23.768 82.285 16.565  1.00 25.81 ? 501 THR C O   1 
ATOM   6725 C CB  . THR C 1 183 ? -25.012 80.361 14.490  1.00 26.13 ? 501 THR C CB  1 
ATOM   6726 O OG1 . THR C 1 183 ? -24.819 79.335 13.513  1.00 31.98 ? 501 THR C OG1 1 
ATOM   6727 C CG2 . THR C 1 183 ? -26.390 80.939 14.240  1.00 25.82 ? 501 THR C CG2 1 
ATOM   6728 N N   . PRO C 1 184 ? -24.434 83.734 14.996  1.00 23.07 ? 502 PRO C N   1 
ATOM   6729 C CA  . PRO C 1 184 ? -24.305 84.849 15.928  1.00 23.33 ? 502 PRO C CA  1 
ATOM   6730 C C   . PRO C 1 184 ? -24.761 84.604 17.364  1.00 23.42 ? 502 PRO C C   1 
ATOM   6731 O O   . PRO C 1 184 ? -24.035 84.959 18.272  1.00 25.40 ? 502 PRO C O   1 
ATOM   6732 C CB  . PRO C 1 184 ? -25.097 85.955 15.262  1.00 22.07 ? 502 PRO C CB  1 
ATOM   6733 C CG  . PRO C 1 184 ? -25.010 85.612 13.761  1.00 23.78 ? 502 PRO C CG  1 
ATOM   6734 C CD  . PRO C 1 184 ? -24.531 84.197 13.611  1.00 22.35 ? 502 PRO C CD  1 
ATOM   6735 N N   . ASP C 1 185 ? -25.909 83.982 17.590  1.00 23.81 ? 503 ASP C N   1 
ATOM   6736 C CA  . ASP C 1 185 ? -26.333 83.703 18.968  1.00 25.91 ? 503 ASP C CA  1 
ATOM   6737 C C   . ASP C 1 185 ? -25.324 82.893 19.827  1.00 27.21 ? 503 ASP C C   1 
ATOM   6738 O O   . ASP C 1 185 ? -25.367 82.970 21.054  1.00 29.78 ? 503 ASP C O   1 
ATOM   6739 C CB  . ASP C 1 185 ? -27.707 83.031 18.986  1.00 26.23 ? 503 ASP C CB  1 
ATOM   6740 C CG  . ASP C 1 185 ? -28.840 84.009 18.708  1.00 30.31 ? 503 ASP C CG  1 
ATOM   6741 O OD1 . ASP C 1 185 ? -29.211 84.183 17.526  1.00 29.98 ? 503 ASP C OD1 1 
ATOM   6742 O OD2 . ASP C 1 185 ? -29.369 84.606 19.674  1.00 36.66 ? 503 ASP C OD2 1 
ATOM   6743 N N   . TYR C 1 186 ? -24.413 82.149 19.183  1.00 26.11 ? 504 TYR C N   1 
ATOM   6744 C CA  . TYR C 1 186 ? -23.517 81.198 19.852  1.00 23.84 ? 504 TYR C CA  1 
ATOM   6745 C C   . TYR C 1 186 ? -22.061 81.686 19.948  1.00 25.11 ? 504 TYR C C   1 
ATOM   6746 O O   . TYR C 1 186 ? -21.179 80.972 20.461  1.00 22.53 ? 504 TYR C O   1 
ATOM   6747 C CB  . TYR C 1 186 ? -23.509 79.874 19.099  1.00 22.15 ? 504 TYR C CB  1 
ATOM   6748 C CG  . TYR C 1 186 ? -24.813 79.088 19.115  1.00 22.37 ? 504 TYR C CG  1 
ATOM   6749 C CD1 . TYR C 1 186 ? -25.805 79.320 18.189  1.00 20.02 ? 504 TYR C CD1 1 
ATOM   6750 C CD2 . TYR C 1 186 ? -25.023 78.070 20.033  1.00 24.66 ? 504 TYR C CD2 1 
ATOM   6751 C CE1 . TYR C 1 186 ? -26.979 78.584 18.198  1.00 17.65 ? 504 TYR C CE1 1 
ATOM   6752 C CE2 . TYR C 1 186 ? -26.193 77.328 20.040  1.00 17.01 ? 504 TYR C CE2 1 
ATOM   6753 C CZ  . TYR C 1 186 ? -27.167 77.597 19.130  1.00 14.56 ? 504 TYR C CZ  1 
ATOM   6754 O OH  . TYR C 1 186 ? -28.331 76.850 19.144  1.00 15.53 ? 504 TYR C OH  1 
ATOM   6755 N N   . ILE C 1 187 ? -21.819 82.897 19.441  1.00 26.52 ? 505 ILE C N   1 
ATOM   6756 C CA  . ILE C 1 187 ? -20.471 83.443 19.281  1.00 25.76 ? 505 ILE C CA  1 
ATOM   6757 C C   . ILE C 1 187 ? -20.017 84.081 20.588  1.00 27.34 ? 505 ILE C C   1 
ATOM   6758 O O   . ILE C 1 187 ? -20.665 84.989 21.117  1.00 27.29 ? 505 ILE C O   1 
ATOM   6759 C CB  . ILE C 1 187 ? -20.435 84.458 18.097  1.00 26.01 ? 505 ILE C CB  1 
ATOM   6760 C CG1 . ILE C 1 187 ? -20.618 83.728 16.772  1.00 28.80 ? 505 ILE C CG1 1 
ATOM   6761 C CG2 . ILE C 1 187 ? -19.141 85.229 18.012  1.00 22.36 ? 505 ILE C CG2 1 
ATOM   6762 C CD1 . ILE C 1 187 ? -20.579 84.657 15.607  1.00 30.71 ? 505 ILE C CD1 1 
ATOM   6763 N N   . ALA C 1 188 ? -18.904 83.576 21.115  1.00 27.92 ? 506 ALA C N   1 
ATOM   6764 C CA  . ALA C 1 188 ? -18.265 84.143 22.294  1.00 27.05 ? 506 ALA C CA  1 
ATOM   6765 C C   . ALA C 1 188 ? -17.944 85.651 22.168  1.00 27.62 ? 506 ALA C C   1 
ATOM   6766 O O   . ALA C 1 188 ? -17.885 86.220 21.063  1.00 27.07 ? 506 ALA C O   1 
ATOM   6767 C CB  . ALA C 1 188 ? -17.006 83.350 22.629  1.00 25.58 ? 506 ALA C CB  1 
ATOM   6768 N N   . PRO C 1 189 ? -17.766 86.307 23.322  1.00 26.67 ? 507 PRO C N   1 
ATOM   6769 C CA  . PRO C 1 189 ? -17.257 87.659 23.448  1.00 25.39 ? 507 PRO C CA  1 
ATOM   6770 C C   . PRO C 1 189 ? -15.919 87.813 22.748  1.00 24.01 ? 507 PRO C C   1 
ATOM   6771 O O   . PRO C 1 189 ? -15.700 88.777 22.017  1.00 24.13 ? 507 PRO C O   1 
ATOM   6772 C CB  . PRO C 1 189 ? -17.043 87.799 24.944  1.00 25.20 ? 507 PRO C CB  1 
ATOM   6773 C CG  . PRO C 1 189 ? -18.024 86.884 25.550  1.00 27.17 ? 507 PRO C CG  1 
ATOM   6774 C CD  . PRO C 1 189 ? -18.283 85.782 24.595  1.00 26.37 ? 507 PRO C CD  1 
ATOM   6775 N N   . GLU C 1 190 ? -15.019 86.872 22.967  1.00 22.60 ? 508 GLU C N   1 
ATOM   6776 C CA  . GLU C 1 190 ? -13.706 87.022 22.386  1.00 23.69 ? 508 GLU C CA  1 
ATOM   6777 C C   . GLU C 1 190 ? -13.683 86.999 20.826  1.00 24.56 ? 508 GLU C C   1 
ATOM   6778 O O   . GLU C 1 190 ? -12.886 87.714 20.187  1.00 24.23 ? 508 GLU C O   1 
ATOM   6779 C CB  . GLU C 1 190 ? -12.701 86.068 23.028  1.00 22.87 ? 508 GLU C CB  1 
ATOM   6780 C CG  . GLU C 1 190 ? -12.996 84.609 22.866  1.00 27.43 ? 508 GLU C CG  1 
ATOM   6781 C CD  . GLU C 1 190 ? -13.902 84.050 23.932  1.00 25.39 ? 508 GLU C CD  1 
ATOM   6782 O OE1 . GLU C 1 190 ? -14.713 84.806 24.509  1.00 27.76 ? 508 GLU C OE1 1 
ATOM   6783 O OE2 . GLU C 1 190 ? -13.812 82.831 24.164  1.00 25.88 ? 508 GLU C OE2 1 
ATOM   6784 N N   . ILE C 1 191 ? -14.568 86.224 20.206  1.00 24.13 ? 509 ILE C N   1 
ATOM   6785 C CA  . ILE C 1 191 ? -14.643 86.260 18.755  1.00 23.11 ? 509 ILE C CA  1 
ATOM   6786 C C   . ILE C 1 191 ? -15.118 87.614 18.255  1.00 24.80 ? 509 ILE C C   1 
ATOM   6787 O O   . ILE C 1 191 ? -14.578 88.115 17.262  1.00 26.45 ? 509 ILE C O   1 
ATOM   6788 C CB  . ILE C 1 191 ? -15.557 85.199 18.202  1.00 22.56 ? 509 ILE C CB  1 
ATOM   6789 C CG1 . ILE C 1 191 ? -14.997 83.824 18.535  1.00 21.85 ? 509 ILE C CG1 1 
ATOM   6790 C CG2 . ILE C 1 191 ? -15.713 85.382 16.695  1.00 22.27 ? 509 ILE C CG2 1 
ATOM   6791 C CD1 . ILE C 1 191 ? -15.791 82.693 17.974  1.00 14.12 ? 509 ILE C CD1 1 
ATOM   6792 N N   . ILE C 1 192 ? -16.108 88.205 18.935  1.00 24.49 ? 510 ILE C N   1 
ATOM   6793 C CA  . ILE C 1 192 ? -16.653 89.505 18.526  1.00 25.02 ? 510 ILE C CA  1 
ATOM   6794 C C   . ILE C 1 192 ? -15.599 90.591 18.696  1.00 27.20 ? 510 ILE C C   1 
ATOM   6795 O O   . ILE C 1 192 ? -15.487 91.516 17.876  1.00 28.43 ? 510 ILE C O   1 
ATOM   6796 C CB  . ILE C 1 192 ? -17.933 89.875 19.309  1.00 26.16 ? 510 ILE C CB  1 
ATOM   6797 C CG1 . ILE C 1 192 ? -19.025 88.810 19.086  1.00 26.49 ? 510 ILE C CG1 1 
ATOM   6798 C CG2 . ILE C 1 192 ? -18.450 91.268 18.922  1.00 18.41 ? 510 ILE C CG2 1 
ATOM   6799 C CD1 . ILE C 1 192 ? -20.070 88.761 20.202  1.00 27.26 ? 510 ILE C CD1 1 
ATOM   6800 N N   . ALA C 1 193 ? -14.790 90.473 19.739  1.00 28.09 ? 511 ALA C N   1 
ATOM   6801 C CA  . ALA C 1 193 ? -13.681 91.411 19.908  1.00 29.21 ? 511 ALA C CA  1 
ATOM   6802 C C   . ALA C 1 193 ? -12.463 91.115 19.005  1.00 31.11 ? 511 ALA C C   1 
ATOM   6803 O O   . ALA C 1 193 ? -11.378 91.659 19.221  1.00 31.85 ? 511 ALA C O   1 
ATOM   6804 C CB  . ALA C 1 193 ? -13.265 91.439 21.340  1.00 28.28 ? 511 ALA C CB  1 
ATOM   6805 N N   . TYR C 1 194 ? -12.623 90.255 18.001  1.00 31.25 ? 512 TYR C N   1 
ATOM   6806 C CA  . TYR C 1 194 ? -11.474 89.849 17.187  1.00 32.12 ? 512 TYR C CA  1 
ATOM   6807 C C   . TYR C 1 194 ? -10.243 89.632 18.051  1.00 31.51 ? 512 TYR C C   1 
ATOM   6808 O O   . TYR C 1 194 ? -9.146  89.949 17.633  1.00 31.85 ? 512 TYR C O   1 
ATOM   6809 C CB  . TYR C 1 194 ? -11.164 90.848 16.034  1.00 32.65 ? 512 TYR C CB  1 
ATOM   6810 C CG  . TYR C 1 194 ? -12.124 90.733 14.852  1.00 34.96 ? 512 TYR C CG  1 
ATOM   6811 C CD1 . TYR C 1 194 ? -11.873 89.848 13.786  1.00 41.38 ? 512 TYR C CD1 1 
ATOM   6812 C CD2 . TYR C 1 194 ? -13.302 91.472 14.818  1.00 34.14 ? 512 TYR C CD2 1 
ATOM   6813 C CE1 . TYR C 1 194 ? -12.780 89.728 12.706  1.00 39.37 ? 512 TYR C CE1 1 
ATOM   6814 C CE2 . TYR C 1 194 ? -14.203 91.357 13.768  1.00 35.24 ? 512 TYR C CE2 1 
ATOM   6815 C CZ  . TYR C 1 194 ? -13.944 90.494 12.719  1.00 38.72 ? 512 TYR C CZ  1 
ATOM   6816 O OH  . TYR C 1 194 ? -14.864 90.409 11.704  1.00 35.67 ? 512 TYR C OH  1 
ATOM   6817 N N   . GLN C 1 195 ? -10.439 89.105 19.257  1.00 32.58 ? 513 GLN C N   1 
ATOM   6818 C CA  . GLN C 1 195 ? -9.339  88.604 20.094  1.00 32.91 ? 513 GLN C CA  1 
ATOM   6819 C C   . GLN C 1 195 ? -8.843  87.268 19.570  1.00 32.62 ? 513 GLN C C   1 
ATOM   6820 O O   . GLN C 1 195 ? -9.607  86.516 18.949  1.00 32.21 ? 513 GLN C O   1 
ATOM   6821 C CB  . GLN C 1 195 ? -9.803  88.369 21.527  1.00 33.76 ? 513 GLN C CB  1 
ATOM   6822 C CG  . GLN C 1 195 ? -10.429 89.570 22.222  1.00 40.98 ? 513 GLN C CG  1 
ATOM   6823 C CD  . GLN C 1 195 ? -9.396  90.580 22.699  1.00 44.71 ? 513 GLN C CD  1 
ATOM   6824 O OE1 . GLN C 1 195 ? -8.575  91.060 21.916  1.00 46.54 ? 513 GLN C OE1 1 
ATOM   6825 N NE2 . GLN C 1 195 ? -9.442  90.912 23.985  1.00 44.21 ? 513 GLN C NE2 1 
ATOM   6826 N N   . PRO C 1 196 ? -7.554  86.966 19.806  1.00 32.93 ? 514 PRO C N   1 
ATOM   6827 C CA  . PRO C 1 196 ? -7.055  85.634 19.522  1.00 31.59 ? 514 PRO C CA  1 
ATOM   6828 C C   . PRO C 1 196 ? -7.703  84.725 20.535  1.00 29.79 ? 514 PRO C C   1 
ATOM   6829 O O   . PRO C 1 196 ? -7.691  85.020 21.725  1.00 28.09 ? 514 PRO C O   1 
ATOM   6830 C CB  . PRO C 1 196 ? -5.545  85.743 19.800  1.00 31.87 ? 514 PRO C CB  1 
ATOM   6831 C CG  . PRO C 1 196 ? -5.231  87.170 19.780  1.00 30.95 ? 514 PRO C CG  1 
ATOM   6832 C CD  . PRO C 1 196 ? -6.476  87.865 20.254  1.00 34.36 ? 514 PRO C CD  1 
ATOM   6833 N N   . TYR C 1 197 ? -8.298  83.647 20.061  1.00 28.83 ? 515 TYR C N   1 
ATOM   6834 C CA  . TYR C 1 197 ? -9.015  82.756 20.940  1.00 28.54 ? 515 TYR C CA  1 
ATOM   6835 C C   . TYR C 1 197 ? -8.599  81.320 20.614  1.00 29.34 ? 515 TYR C C   1 
ATOM   6836 O O   . TYR C 1 197 ? -7.922  81.053 19.609  1.00 29.08 ? 515 TYR C O   1 
ATOM   6837 C CB  . TYR C 1 197 ? -10.521 82.948 20.741  1.00 26.82 ? 515 TYR C CB  1 
ATOM   6838 C CG  . TYR C 1 197 ? -10.950 82.600 19.339  1.00 21.25 ? 515 TYR C CG  1 
ATOM   6839 C CD1 . TYR C 1 197 ? -11.103 81.279 18.953  1.00 19.15 ? 515 TYR C CD1 1 
ATOM   6840 C CD2 . TYR C 1 197 ? -11.175 83.582 18.398  1.00 24.10 ? 515 TYR C CD2 1 
ATOM   6841 C CE1 . TYR C 1 197 ? -11.492 80.932 17.654  1.00 23.72 ? 515 TYR C CE1 1 
ATOM   6842 C CE2 . TYR C 1 197 ? -11.567 83.259 17.074  1.00 26.41 ? 515 TYR C CE2 1 
ATOM   6843 C CZ  . TYR C 1 197 ? -11.722 81.924 16.710  1.00 27.41 ? 515 TYR C CZ  1 
ATOM   6844 O OH  . TYR C 1 197 ? -12.088 81.577 15.416  1.00 23.42 ? 515 TYR C OH  1 
ATOM   6845 N N   . GLY C 1 198 ? -9.002  80.398 21.471  1.00 29.84 ? 516 GLY C N   1 
ATOM   6846 C CA  . GLY C 1 198 ? -8.784  78.992 21.220  1.00 30.38 ? 516 GLY C CA  1 
ATOM   6847 C C   . GLY C 1 198 ? -10.044 78.214 21.537  1.00 32.33 ? 516 GLY C C   1 
ATOM   6848 O O   . GLY C 1 198 ? -11.158 78.586 21.121  1.00 33.99 ? 516 GLY C O   1 
ATOM   6849 N N   . LYS C 1 199 ? -9.875  77.150 22.314  1.00 31.67 ? 517 LYS C N   1 
ATOM   6850 C CA  . LYS C 1 199 ? -10.942 76.211 22.570  1.00 30.38 ? 517 LYS C CA  1 
ATOM   6851 C C   . LYS C 1 199 ? -12.040 76.823 23.450  1.00 28.51 ? 517 LYS C C   1 
ATOM   6852 O O   . LYS C 1 199 ? -13.170 76.350 23.473  1.00 28.45 ? 517 LYS C O   1 
ATOM   6853 C CB  . LYS C 1 199 ? -10.361 74.922 23.153  1.00 30.22 ? 517 LYS C CB  1 
ATOM   6854 C CG  . LYS C 1 199 ? -10.040 75.017 24.624  1.00 39.86 ? 517 LYS C CG  1 
ATOM   6855 C CD  . LYS C 1 199 ? -9.732  73.636 25.218  1.00 48.73 ? 517 LYS C CD  1 
ATOM   6856 C CE  . LYS C 1 199 ? -10.294 73.488 26.632  1.00 47.75 ? 517 LYS C CE  1 
ATOM   6857 N NZ  . LYS C 1 199 ? -9.407  72.639 27.465  1.00 51.67 ? 517 LYS C NZ  1 
ATOM   6858 N N   . SER C 1 200 ? -11.720 77.902 24.143  1.00 27.32 ? 518 SER C N   1 
ATOM   6859 C CA  . SER C 1 200 ? -12.696 78.547 25.000  1.00 26.68 ? 518 SER C CA  1 
ATOM   6860 C C   . SER C 1 200 ? -14.035 78.806 24.309  1.00 27.55 ? 518 SER C C   1 
ATOM   6861 O O   . SER C 1 200 ? -15.110 78.642 24.900  1.00 28.17 ? 518 SER C O   1 
ATOM   6862 C CB  . SER C 1 200 ? -12.137 79.870 25.503  1.00 26.93 ? 518 SER C CB  1 
ATOM   6863 O OG  . SER C 1 200 ? -11.781 80.711 24.427  1.00 29.66 ? 518 SER C OG  1 
ATOM   6864 N N   . VAL C 1 201 ? -13.996 79.230 23.056  1.00 27.25 ? 519 VAL C N   1 
ATOM   6865 C CA  . VAL C 1 201 ? -15.247 79.605 22.412  1.00 25.81 ? 519 VAL C CA  1 
ATOM   6866 C C   . VAL C 1 201 ? -16.240 78.435 22.309  1.00 26.08 ? 519 VAL C C   1 
ATOM   6867 O O   . VAL C 1 201 ? -17.442 78.634 22.097  1.00 26.39 ? 519 VAL C O   1 
ATOM   6868 C CB  . VAL C 1 201 ? -15.009 80.271 21.038  1.00 26.53 ? 519 VAL C CB  1 
ATOM   6869 C CG1 . VAL C 1 201 ? -14.176 81.544 21.222  1.00 25.13 ? 519 VAL C CG1 1 
ATOM   6870 C CG2 . VAL C 1 201 ? -14.364 79.287 20.044  1.00 18.70 ? 519 VAL C CG2 1 
ATOM   6871 N N   . ASP C 1 202 ? -15.747 77.215 22.470  1.00 25.55 ? 520 ASP C N   1 
ATOM   6872 C CA  . ASP C 1 202 ? -16.622 76.064 22.429  1.00 25.75 ? 520 ASP C CA  1 
ATOM   6873 C C   . ASP C 1 202 ? -17.446 76.005 23.700  1.00 25.73 ? 520 ASP C C   1 
ATOM   6874 O O   . ASP C 1 202 ? -18.576 75.510 23.711  1.00 24.90 ? 520 ASP C O   1 
ATOM   6875 C CB  . ASP C 1 202 ? -15.804 74.788 22.299  1.00 27.00 ? 520 ASP C CB  1 
ATOM   6876 C CG  . ASP C 1 202 ? -15.420 74.479 20.853  1.00 32.95 ? 520 ASP C CG  1 
ATOM   6877 O OD1 . ASP C 1 202 ? -15.978 75.104 19.916  1.00 36.97 ? 520 ASP C OD1 1 
ATOM   6878 O OD2 . ASP C 1 202 ? -14.557 73.600 20.655  1.00 33.71 ? 520 ASP C OD2 1 
ATOM   6879 N N   . TRP C 1 203 ? -16.881 76.498 24.789  1.00 25.80 ? 521 TRP C N   1 
ATOM   6880 C CA  . TRP C 1 203 ? -17.532 76.291 26.060  1.00 26.16 ? 521 TRP C CA  1 
ATOM   6881 C C   . TRP C 1 203 ? -18.564 77.360 26.282  1.00 26.89 ? 521 TRP C C   1 
ATOM   6882 O O   . TRP C 1 203 ? -19.451 77.202 27.111  1.00 28.55 ? 521 TRP C O   1 
ATOM   6883 C CB  . TRP C 1 203 ? -16.530 76.236 27.203  1.00 25.85 ? 521 TRP C CB  1 
ATOM   6884 C CG  . TRP C 1 203 ? -15.708 74.994 27.197  1.00 24.38 ? 521 TRP C CG  1 
ATOM   6885 C CD1 . TRP C 1 203 ? -14.354 74.904 27.038  1.00 22.28 ? 521 TRP C CD1 1 
ATOM   6886 C CD2 . TRP C 1 203 ? -16.182 73.647 27.372  1.00 27.82 ? 521 TRP C CD2 1 
ATOM   6887 N NE1 . TRP C 1 203 ? -13.953 73.580 27.094  1.00 23.05 ? 521 TRP C NE1 1 
ATOM   6888 C CE2 . TRP C 1 203 ? -15.053 72.791 27.299  1.00 23.00 ? 521 TRP C CE2 1 
ATOM   6889 C CE3 . TRP C 1 203 ? -17.453 73.077 27.587  1.00 22.72 ? 521 TRP C CE3 1 
ATOM   6890 C CZ2 . TRP C 1 203 ? -15.158 71.409 27.435  1.00 23.14 ? 521 TRP C CZ2 1 
ATOM   6891 C CZ3 . TRP C 1 203 ? -17.554 71.694 27.714  1.00 15.71 ? 521 TRP C CZ3 1 
ATOM   6892 C CH2 . TRP C 1 203 ? -16.419 70.881 27.638  1.00 22.77 ? 521 TRP C CH2 1 
ATOM   6893 N N   . TRP C 1 204 ? -18.461 78.443 25.519  1.00 26.61 ? 522 TRP C N   1 
ATOM   6894 C CA  . TRP C 1 204 ? -19.490 79.490 25.523  1.00 25.03 ? 522 TRP C CA  1 
ATOM   6895 C C   . TRP C 1 204 ? -20.699 78.947 24.782  1.00 24.54 ? 522 TRP C C   1 
ATOM   6896 O O   . TRP C 1 204 ? -21.757 78.710 25.379  1.00 24.56 ? 522 TRP C O   1 
ATOM   6897 C CB  . TRP C 1 204 ? -18.938 80.744 24.858  1.00 24.05 ? 522 TRP C CB  1 
ATOM   6898 C CG  . TRP C 1 204 ? -19.889 81.867 24.655  1.00 23.92 ? 522 TRP C CG  1 
ATOM   6899 C CD1 . TRP C 1 204 ? -20.627 82.120 23.546  1.00 24.48 ? 522 TRP C CD1 1 
ATOM   6900 C CD2 . TRP C 1 204 ? -20.138 82.943 25.556  1.00 24.38 ? 522 TRP C CD2 1 
ATOM   6901 N NE1 . TRP C 1 204 ? -21.340 83.283 23.702  1.00 23.36 ? 522 TRP C NE1 1 
ATOM   6902 C CE2 . TRP C 1 204 ? -21.064 83.800 24.935  1.00 21.73 ? 522 TRP C CE2 1 
ATOM   6903 C CE3 . TRP C 1 204 ? -19.684 83.252 26.845  1.00 25.96 ? 522 TRP C CE3 1 
ATOM   6904 C CZ2 . TRP C 1 204 ? -21.556 84.933 25.555  1.00 22.53 ? 522 TRP C CZ2 1 
ATOM   6905 C CZ3 . TRP C 1 204 ? -20.157 84.378 27.457  1.00 23.78 ? 522 TRP C CZ3 1 
ATOM   6906 C CH2 . TRP C 1 204 ? -21.092 85.209 26.814  1.00 29.65 ? 522 TRP C CH2 1 
ATOM   6907 N N   . ALA C 1 205 ? -20.522 78.716 23.484  1.00 23.17 ? 523 ALA C N   1 
ATOM   6908 C CA  . ALA C 1 205 ? -21.509 78.002 22.690  1.00 22.04 ? 523 ALA C CA  1 
ATOM   6909 C C   . ALA C 1 205 ? -22.153 76.893 23.505  1.00 23.44 ? 523 ALA C C   1 
ATOM   6910 O O   . ALA C 1 205 ? -23.361 76.748 23.482  1.00 25.13 ? 523 ALA C O   1 
ATOM   6911 C CB  . ALA C 1 205 ? -20.862 77.425 21.471  1.00 21.32 ? 523 ALA C CB  1 
ATOM   6912 N N   . TYR C 1 206 ? -21.345 76.108 24.218  1.00 24.46 ? 524 TYR C N   1 
ATOM   6913 C CA  . TYR C 1 206 ? -21.830 75.038 25.087  1.00 24.12 ? 524 TYR C CA  1 
ATOM   6914 C C   . TYR C 1 206 ? -22.818 75.536 26.134  1.00 25.88 ? 524 TYR C C   1 
ATOM   6915 O O   . TYR C 1 206 ? -23.843 74.887 26.401  1.00 27.87 ? 524 TYR C O   1 
ATOM   6916 C CB  . TYR C 1 206 ? -20.657 74.402 25.797  1.00 24.74 ? 524 TYR C CB  1 
ATOM   6917 C CG  . TYR C 1 206 ? -21.001 73.165 26.607  1.00 25.49 ? 524 TYR C CG  1 
ATOM   6918 C CD1 . TYR C 1 206 ? -21.393 71.991 25.992  1.00 23.67 ? 524 TYR C CD1 1 
ATOM   6919 C CD2 . TYR C 1 206 ? -20.888 73.166 27.988  1.00 21.84 ? 524 TYR C CD2 1 
ATOM   6920 C CE1 . TYR C 1 206 ? -21.675 70.864 26.740  1.00 23.50 ? 524 TYR C CE1 1 
ATOM   6921 C CE2 . TYR C 1 206 ? -21.157 72.059 28.721  1.00 16.39 ? 524 TYR C CE2 1 
ATOM   6922 C CZ  . TYR C 1 206 ? -21.557 70.915 28.101  1.00 22.66 ? 524 TYR C CZ  1 
ATOM   6923 O OH  . TYR C 1 206 ? -21.849 69.808 28.862  1.00 33.15 ? 524 TYR C OH  1 
ATOM   6924 N N   . GLY C 1 207 ? -22.516 76.680 26.740  1.00 25.17 ? 525 GLY C N   1 
ATOM   6925 C CA  . GLY C 1 207 ? -23.458 77.308 27.658  1.00 24.14 ? 525 GLY C CA  1 
ATOM   6926 C C   . GLY C 1 207 ? -24.688 77.806 26.910  1.00 24.58 ? 525 GLY C C   1 
ATOM   6927 O O   . GLY C 1 207 ? -25.834 77.614 27.351  1.00 25.55 ? 525 GLY C O   1 
ATOM   6928 N N   . VAL C 1 208 ? -24.472 78.458 25.776  1.00 22.71 ? 526 VAL C N   1 
ATOM   6929 C CA  . VAL C 1 208 ? -25.611 78.956 25.010  1.00 23.43 ? 526 VAL C CA  1 
ATOM   6930 C C   . VAL C 1 208 ? -26.548 77.773 24.729  1.00 23.44 ? 526 VAL C C   1 
ATOM   6931 O O   . VAL C 1 208 ? -27.762 77.876 24.837  1.00 22.58 ? 526 VAL C O   1 
ATOM   6932 C CB  . VAL C 1 208 ? -25.160 79.648 23.678  1.00 23.37 ? 526 VAL C CB  1 
ATOM   6933 C CG1 . VAL C 1 208 ? -26.326 79.895 22.780  1.00 16.84 ? 526 VAL C CG1 1 
ATOM   6934 C CG2 . VAL C 1 208 ? -24.410 80.952 23.965  1.00 24.45 ? 526 VAL C CG2 1 
ATOM   6935 N N   . LEU C 1 209 ? -25.951 76.635 24.397  1.00 24.04 ? 527 LEU C N   1 
ATOM   6936 C CA  . LEU C 1 209 ? -26.714 75.459 24.079  1.00 24.57 ? 527 LEU C CA  1 
ATOM   6937 C C   . LEU C 1 209 ? -27.363 74.953 25.346  1.00 24.79 ? 527 LEU C C   1 
ATOM   6938 O O   . LEU C 1 209 ? -28.588 74.945 25.438  1.00 25.56 ? 527 LEU C O   1 
ATOM   6939 C CB  . LEU C 1 209 ? -25.862 74.387 23.397  1.00 24.97 ? 527 LEU C CB  1 
ATOM   6940 C CG  . LEU C 1 209 ? -26.786 73.368 22.720  1.00 27.44 ? 527 LEU C CG  1 
ATOM   6941 C CD1 . LEU C 1 209 ? -26.223 72.872 21.399  1.00 29.11 ? 527 LEU C CD1 1 
ATOM   6942 C CD2 . LEU C 1 209 ? -27.114 72.212 23.648  1.00 27.13 ? 527 LEU C CD2 1 
ATOM   6943 N N   . LEU C 1 210 ? -26.583 74.561 26.346  1.00 23.77 ? 528 LEU C N   1 
ATOM   6944 C CA  . LEU C 1 210 ? -27.243 74.235 27.605  1.00 23.88 ? 528 LEU C CA  1 
ATOM   6945 C C   . LEU C 1 210 ? -28.431 75.141 27.867  1.00 23.14 ? 528 LEU C C   1 
ATOM   6946 O O   . LEU C 1 210 ? -29.574 74.658 27.997  1.00 22.36 ? 528 LEU C O   1 
ATOM   6947 C CB  . LEU C 1 210 ? -26.308 74.327 28.782  1.00 24.92 ? 528 LEU C CB  1 
ATOM   6948 C CG  . LEU C 1 210 ? -25.937 72.946 29.293  1.00 27.46 ? 528 LEU C CG  1 
ATOM   6949 C CD1 . LEU C 1 210 ? -25.107 72.237 28.238  1.00 34.14 ? 528 LEU C CD1 1 
ATOM   6950 C CD2 . LEU C 1 210 ? -25.157 73.109 30.566  1.00 31.02 ? 528 LEU C CD2 1 
ATOM   6951 N N   . TYR C 1 211 ? -28.160 76.451 27.931  1.00 21.78 ? 529 TYR C N   1 
ATOM   6952 C CA  . TYR C 1 211 ? -29.181 77.435 28.296  1.00 20.58 ? 529 TYR C CA  1 
ATOM   6953 C C   . TYR C 1 211 ? -30.437 77.291 27.454  1.00 21.65 ? 529 TYR C C   1 
ATOM   6954 O O   . TYR C 1 211 ? -31.559 77.255 27.971  1.00 21.61 ? 529 TYR C O   1 
ATOM   6955 C CB  . TYR C 1 211 ? -28.652 78.843 28.143  1.00 20.57 ? 529 TYR C CB  1 
ATOM   6956 C CG  . TYR C 1 211 ? -29.652 79.903 28.546  1.00 19.00 ? 529 TYR C CG  1 
ATOM   6957 C CD1 . TYR C 1 211 ? -30.555 80.446 27.631  1.00 22.56 ? 529 TYR C CD1 1 
ATOM   6958 C CD2 . TYR C 1 211 ? -29.694 80.358 29.835  1.00 16.49 ? 529 TYR C CD2 1 
ATOM   6959 C CE1 . TYR C 1 211 ? -31.465 81.400 28.020  1.00 17.30 ? 529 TYR C CE1 1 
ATOM   6960 C CE2 . TYR C 1 211 ? -30.579 81.298 30.219  1.00 18.20 ? 529 TYR C CE2 1 
ATOM   6961 C CZ  . TYR C 1 211 ? -31.454 81.820 29.325  1.00 18.17 ? 529 TYR C CZ  1 
ATOM   6962 O OH  . TYR C 1 211 ? -32.308 82.772 29.792  1.00 21.34 ? 529 TYR C OH  1 
ATOM   6963 N N   . GLU C 1 212 ? -30.256 77.218 26.146  1.00 22.54 ? 530 GLU C N   1 
ATOM   6964 C CA  . GLU C 1 212 ? -31.383 76.937 25.289  1.00 23.90 ? 530 GLU C CA  1 
ATOM   6965 C C   . GLU C 1 212 ? -32.181 75.743 25.792  1.00 25.46 ? 530 GLU C C   1 
ATOM   6966 O O   . GLU C 1 212 ? -33.370 75.874 26.056  1.00 27.54 ? 530 GLU C O   1 
ATOM   6967 C CB  . GLU C 1 212 ? -30.941 76.772 23.855  1.00 22.68 ? 530 GLU C CB  1 
ATOM   6968 C CG  . GLU C 1 212 ? -30.419 78.085 23.305  1.00 22.90 ? 530 GLU C CG  1 
ATOM   6969 C CD  . GLU C 1 212 ? -30.171 78.006 21.838  1.00 22.67 ? 530 GLU C CD  1 
ATOM   6970 O OE1 . GLU C 1 212 ? -29.172 77.378 21.447  1.00 26.05 ? 530 GLU C OE1 1 
ATOM   6971 O OE2 . GLU C 1 212 ? -30.991 78.537 21.068  1.00 21.10 ? 530 GLU C OE2 1 
ATOM   6972 N N   . MET C 1 213 ? -31.538 74.603 25.986  1.00 25.93 ? 531 MET C N   1 
ATOM   6973 C CA  . MET C 1 213 ? -32.241 73.446 26.533  1.00 26.51 ? 531 MET C CA  1 
ATOM   6974 C C   . MET C 1 213 ? -33.025 73.716 27.832  1.00 28.13 ? 531 MET C C   1 
ATOM   6975 O O   . MET C 1 213 ? -34.152 73.228 28.014  1.00 28.91 ? 531 MET C O   1 
ATOM   6976 C CB  . MET C 1 213 ? -31.262 72.310 26.779  1.00 26.37 ? 531 MET C CB  1 
ATOM   6977 C CG  . MET C 1 213 ? -30.555 71.815 25.551  1.00 24.82 ? 531 MET C CG  1 
ATOM   6978 S SD  . MET C 1 213 ? -29.709 70.274 25.906  1.00 30.21 ? 531 MET C SD  1 
ATOM   6979 C CE  . MET C 1 213 ? -28.291 70.820 26.869  1.00 30.20 ? 531 MET C CE  1 
ATOM   6980 N N   . LEU C 1 214 ? -32.436 74.470 28.753  1.00 28.64 ? 532 LEU C N   1 
ATOM   6981 C CA  . LEU C 1 214 ? -33.065 74.603 30.075  1.00 28.91 ? 532 LEU C CA  1 
ATOM   6982 C C   . LEU C 1 214 ? -34.142 75.652 30.070  1.00 29.67 ? 532 LEU C C   1 
ATOM   6983 O O   . LEU C 1 214 ? -35.155 75.513 30.740  1.00 31.15 ? 532 LEU C O   1 
ATOM   6984 C CB  . LEU C 1 214 ? -32.042 74.923 31.180  1.00 27.21 ? 532 LEU C CB  1 
ATOM   6985 C CG  . LEU C 1 214 ? -31.002 73.845 31.530  1.00 26.23 ? 532 LEU C CG  1 
ATOM   6986 C CD1 . LEU C 1 214 ? -29.996 74.345 32.552  1.00 23.91 ? 532 LEU C CD1 1 
ATOM   6987 C CD2 . LEU C 1 214 ? -31.653 72.518 31.995  1.00 19.59 ? 532 LEU C CD2 1 
ATOM   6988 N N   . ALA C 1 215 ? -33.920 76.712 29.312  1.00 29.87 ? 533 ALA C N   1 
ATOM   6989 C CA  . ALA C 1 215 ? -34.786 77.865 29.401  1.00 29.33 ? 533 ALA C CA  1 
ATOM   6990 C C   . ALA C 1 215 ? -35.661 77.976 28.184  1.00 27.88 ? 533 ALA C C   1 
ATOM   6991 O O   . ALA C 1 215 ? -36.657 78.657 28.208  1.00 27.33 ? 533 ALA C O   1 
ATOM   6992 C CB  . ALA C 1 215 ? -33.952 79.112 29.565  1.00 32.18 ? 533 ALA C CB  1 
ATOM   6993 N N   . GLY C 1 216 ? -35.262 77.314 27.107  1.00 28.30 ? 534 GLY C N   1 
ATOM   6994 C CA  . GLY C 1 216 ? -36.044 77.281 25.884  1.00 27.39 ? 534 GLY C CA  1 
ATOM   6995 C C   . GLY C 1 216 ? -35.975 78.548 25.074  1.00 27.38 ? 534 GLY C C   1 
ATOM   6996 O O   . GLY C 1 216 ? -36.653 78.676 24.064  1.00 27.96 ? 534 GLY C O   1 
ATOM   6997 N N   . GLN C 1 217 ? -35.166 79.493 25.523  1.00 28.62 ? 535 GLN C N   1 
ATOM   6998 C CA  . GLN C 1 217 ? -34.923 80.730 24.783  1.00 30.57 ? 535 GLN C CA  1 
ATOM   6999 C C   . GLN C 1 217 ? -33.419 80.867 24.614  1.00 31.13 ? 535 GLN C C   1 
ATOM   7000 O O   . GLN C 1 217 ? -32.660 80.173 25.299  1.00 31.34 ? 535 GLN C O   1 
ATOM   7001 C CB  . GLN C 1 217 ? -35.459 81.935 25.566  1.00 31.60 ? 535 GLN C CB  1 
ATOM   7002 C CG  . GLN C 1 217 ? -36.967 81.990 25.708  1.00 32.48 ? 535 GLN C CG  1 
ATOM   7003 C CD  . GLN C 1 217 ? -37.666 82.104 24.357  1.00 36.98 ? 535 GLN C CD  1 
ATOM   7004 O OE1 . GLN C 1 217 ? -37.625 81.185 23.524  1.00 37.42 ? 535 GLN C OE1 1 
ATOM   7005 N NE2 . GLN C 1 217 ? -38.308 83.241 24.130  1.00 37.64 ? 535 GLN C NE2 1 
ATOM   7006 N N   . PRO C 1 218 ? -32.974 81.736 23.687  1.00 31.25 ? 536 PRO C N   1 
ATOM   7007 C CA  . PRO C 1 218 ? -31.559 82.072 23.578  1.00 30.15 ? 536 PRO C CA  1 
ATOM   7008 C C   . PRO C 1 218 ? -31.185 83.002 24.734  1.00 30.56 ? 536 PRO C C   1 
ATOM   7009 O O   . PRO C 1 218 ? -32.061 83.688 25.264  1.00 30.76 ? 536 PRO C O   1 
ATOM   7010 C CB  . PRO C 1 218 ? -31.484 82.808 22.239  1.00 28.79 ? 536 PRO C CB  1 
ATOM   7011 C CG  . PRO C 1 218 ? -32.799 83.383 22.051  1.00 28.46 ? 536 PRO C CG  1 
ATOM   7012 C CD  . PRO C 1 218 ? -33.761 82.373 22.624  1.00 31.66 ? 536 PRO C CD  1 
ATOM   7013 N N   . PRO C 1 219 ? -29.906 83.003 25.147  1.00 29.96 ? 537 PRO C N   1 
ATOM   7014 C CA  . PRO C 1 219 ? -29.471 83.776 26.310  1.00 28.58 ? 537 PRO C CA  1 
ATOM   7015 C C   . PRO C 1 219 ? -29.380 85.264 26.054  1.00 27.66 ? 537 PRO C C   1 
ATOM   7016 O O   . PRO C 1 219 ? -29.576 86.049 26.971  1.00 26.05 ? 537 PRO C O   1 
ATOM   7017 C CB  . PRO C 1 219 ? -28.086 83.213 26.618  1.00 27.60 ? 537 PRO C CB  1 
ATOM   7018 C CG  . PRO C 1 219 ? -27.610 82.613 25.354  1.00 30.71 ? 537 PRO C CG  1 
ATOM   7019 C CD  . PRO C 1 219 ? -28.823 82.177 24.586  1.00 30.99 ? 537 PRO C CD  1 
ATOM   7020 N N   . PHE C 1 220 ? -29.082 85.645 24.818  1.00 29.18 ? 538 PHE C N   1 
ATOM   7021 C CA  . PHE C 1 220 ? -28.944 87.063 24.461  1.00 30.44 ? 538 PHE C CA  1 
ATOM   7022 C C   . PHE C 1 220 ? -29.926 87.393 23.362  1.00 31.66 ? 538 PHE C C   1 
ATOM   7023 O O   . PHE C 1 220 ? -30.518 86.478 22.762  1.00 32.48 ? 538 PHE C O   1 
ATOM   7024 C CB  . PHE C 1 220 ? -27.522 87.367 23.996  1.00 29.70 ? 538 PHE C CB  1 
ATOM   7025 C CG  . PHE C 1 220 ? -26.470 86.830 24.916  1.00 30.31 ? 538 PHE C CG  1 
ATOM   7026 C CD1 . PHE C 1 220 ? -26.109 87.527 26.061  1.00 29.27 ? 538 PHE C CD1 1 
ATOM   7027 C CD2 . PHE C 1 220 ? -25.871 85.606 24.665  1.00 29.71 ? 538 PHE C CD2 1 
ATOM   7028 C CE1 . PHE C 1 220 ? -25.145 87.019 26.926  1.00 27.31 ? 538 PHE C CE1 1 
ATOM   7029 C CE2 . PHE C 1 220 ? -24.919 85.087 25.526  1.00 28.19 ? 538 PHE C CE2 1 
ATOM   7030 C CZ  . PHE C 1 220 ? -24.548 85.794 26.651  1.00 27.76 ? 538 PHE C CZ  1 
ATOM   7031 N N   . ASP C 1 221 ? -30.108 88.683 23.088  1.00 31.58 ? 539 ASP C N   1 
ATOM   7032 C CA  . ASP C 1 221 ? -30.987 89.069 21.982  1.00 33.85 ? 539 ASP C CA  1 
ATOM   7033 C C   . ASP C 1 221 ? -30.680 90.401 21.288  1.00 32.61 ? 539 ASP C C   1 
ATOM   7034 O O   . ASP C 1 221 ? -29.991 91.266 21.833  1.00 31.72 ? 539 ASP C O   1 
ATOM   7035 C CB  . ASP C 1 221 ? -32.434 89.015 22.442  1.00 35.85 ? 539 ASP C CB  1 
ATOM   7036 C CG  . ASP C 1 221 ? -32.574 89.384 23.894  1.00 44.32 ? 539 ASP C CG  1 
ATOM   7037 O OD1 . ASP C 1 221 ? -32.310 90.565 24.214  1.00 50.37 ? 539 ASP C OD1 1 
ATOM   7038 O OD2 . ASP C 1 221 ? -32.930 88.496 24.713  1.00 51.72 ? 539 ASP C OD2 1 
ATOM   7039 N N   . GLY C 1 222 ? -31.188 90.544 20.066  1.00 31.94 ? 540 GLY C N   1 
ATOM   7040 C CA  . GLY C 1 222 ? -30.991 91.757 19.285  1.00 31.02 ? 540 GLY C CA  1 
ATOM   7041 C C   . GLY C 1 222 ? -31.867 91.774 18.056  1.00 31.57 ? 540 GLY C C   1 
ATOM   7042 O O   . GLY C 1 222 ? -32.228 90.731 17.528  1.00 30.95 ? 540 GLY C O   1 
ATOM   7043 N N   . GLU C 1 223 ? -32.209 92.973 17.601  1.00 33.27 ? 541 GLU C N   1 
ATOM   7044 C CA  . GLU C 1 223 ? -33.032 93.154 16.407  1.00 34.65 ? 541 GLU C CA  1 
ATOM   7045 C C   . GLU C 1 223 ? -32.314 92.717 15.130  1.00 34.28 ? 541 GLU C C   1 
ATOM   7046 O O   . GLU C 1 223 ? -32.945 92.249 14.162  1.00 34.74 ? 541 GLU C O   1 
ATOM   7047 C CB  . GLU C 1 223 ? -33.442 94.617 16.299  1.00 35.97 ? 541 GLU C CB  1 
ATOM   7048 C CG  . GLU C 1 223 ? -34.482 95.029 17.322  1.00 41.72 ? 541 GLU C CG  1 
ATOM   7049 C CD  . GLU C 1 223 ? -35.884 94.708 16.847  1.00 51.41 ? 541 GLU C CD  1 
ATOM   7050 O OE1 . GLU C 1 223 ? -36.303 93.529 16.956  1.00 51.75 ? 541 GLU C OE1 1 
ATOM   7051 O OE2 . GLU C 1 223 ? -36.561 95.642 16.348  1.00 55.41 ? 541 GLU C OE2 1 
ATOM   7052 N N   . ASP C 1 224 ? -30.997 92.907 15.135  1.00 32.91 ? 542 ASP C N   1 
ATOM   7053 C CA  . ASP C 1 224 ? -30.103 92.406 14.097  1.00 32.50 ? 542 ASP C CA  1 
ATOM   7054 C C   . ASP C 1 224 ? -28.773 91.942 14.713  1.00 31.67 ? 542 ASP C C   1 
ATOM   7055 O O   . ASP C 1 224 ? -28.637 91.797 15.929  1.00 29.48 ? 542 ASP C O   1 
ATOM   7056 C CB  . ASP C 1 224 ? -29.819 93.507 13.088  1.00 32.30 ? 542 ASP C CB  1 
ATOM   7057 C CG  . ASP C 1 224 ? -29.208 94.743 13.736  1.00 35.45 ? 542 ASP C CG  1 
ATOM   7058 O OD1 . ASP C 1 224 ? -28.453 94.603 14.727  1.00 36.40 ? 542 ASP C OD1 1 
ATOM   7059 O OD2 . ASP C 1 224 ? -29.487 95.865 13.258  1.00 39.13 ? 542 ASP C OD2 1 
ATOM   7060 N N   . GLU C 1 225 ? -27.772 91.765 13.869  1.00 31.52 ? 543 GLU C N   1 
ATOM   7061 C CA  . GLU C 1 225 ? -26.528 91.172 14.309  1.00 32.07 ? 543 GLU C CA  1 
ATOM   7062 C C   . GLU C 1 225 ? -25.677 92.091 15.179  1.00 33.71 ? 543 GLU C C   1 
ATOM   7063 O O   . GLU C 1 225 ? -24.980 91.636 16.089  1.00 34.05 ? 543 GLU C O   1 
ATOM   7064 C CB  . GLU C 1 225 ? -25.723 90.738 13.100  1.00 31.98 ? 543 GLU C CB  1 
ATOM   7065 C CG  . GLU C 1 225 ? -24.418 90.091 13.437  1.00 27.55 ? 543 GLU C CG  1 
ATOM   7066 C CD  . GLU C 1 225 ? -23.893 89.323 12.278  1.00 27.29 ? 543 GLU C CD  1 
ATOM   7067 O OE1 . GLU C 1 225 ? -23.931 89.860 11.149  1.00 37.67 ? 543 GLU C OE1 1 
ATOM   7068 O OE2 . GLU C 1 225 ? -23.456 88.185 12.479  1.00 26.42 ? 543 GLU C OE2 1 
ATOM   7069 N N   . ASP C 1 226 ? -25.712 93.382 14.888  1.00 34.89 ? 544 ASP C N   1 
ATOM   7070 C CA  . ASP C 1 226 ? -24.958 94.333 15.678  1.00 36.01 ? 544 ASP C CA  1 
ATOM   7071 C C   . ASP C 1 226 ? -25.520 94.448 17.084  1.00 35.25 ? 544 ASP C C   1 
ATOM   7072 O O   . ASP C 1 226 ? -24.800 94.665 18.059  1.00 34.97 ? 544 ASP C O   1 
ATOM   7073 C CB  . ASP C 1 226 ? -24.991 95.697 15.012  1.00 37.48 ? 544 ASP C CB  1 
ATOM   7074 C CG  . ASP C 1 226 ? -23.656 96.090 14.461  1.00 42.77 ? 544 ASP C CG  1 
ATOM   7075 O OD1 . ASP C 1 226 ? -22.954 96.884 15.137  1.00 49.72 ? 544 ASP C OD1 1 
ATOM   7076 O OD2 . ASP C 1 226 ? -23.298 95.585 13.375  1.00 45.44 ? 544 ASP C OD2 1 
ATOM   7077 N N   . GLU C 1 227 ? -26.829 94.319 17.169  1.00 35.02 ? 545 GLU C N   1 
ATOM   7078 C CA  . GLU C 1 227 ? -27.501 94.469 18.417  1.00 35.10 ? 545 GLU C CA  1 
ATOM   7079 C C   . GLU C 1 227 ? -27.313 93.199 19.240  1.00 33.21 ? 545 GLU C C   1 
ATOM   7080 O O   . GLU C 1 227 ? -27.194 93.242 20.452  1.00 33.83 ? 545 GLU C O   1 
ATOM   7081 C CB  . GLU C 1 227 ? -28.967 94.757 18.158  1.00 36.20 ? 545 GLU C CB  1 
ATOM   7082 C CG  . GLU C 1 227 ? -29.543 95.782 19.115  1.00 45.83 ? 545 GLU C CG  1 
ATOM   7083 C CD  . GLU C 1 227 ? -31.010 96.071 18.858  1.00 51.89 ? 545 GLU C CD  1 
ATOM   7084 O OE1 . GLU C 1 227 ? -31.358 96.405 17.699  1.00 54.85 ? 545 GLU C OE1 1 
ATOM   7085 O OE2 . GLU C 1 227 ? -31.805 95.975 19.825  1.00 53.62 ? 545 GLU C OE2 1 
ATOM   7086 N N   . LEU C 1 228 ? -27.265 92.061 18.575  1.00 31.61 ? 546 LEU C N   1 
ATOM   7087 C CA  . LEU C 1 228 ? -26.979 90.825 19.265  1.00 30.42 ? 546 LEU C CA  1 
ATOM   7088 C C   . LEU C 1 228 ? -25.586 90.865 19.879  1.00 32.28 ? 546 LEU C C   1 
ATOM   7089 O O   . LEU C 1 228 ? -25.368 90.443 21.032  1.00 31.62 ? 546 LEU C O   1 
ATOM   7090 C CB  . LEU C 1 228 ? -27.059 89.655 18.295  1.00 28.43 ? 546 LEU C CB  1 
ATOM   7091 C CG  . LEU C 1 228 ? -26.882 88.279 18.931  1.00 26.46 ? 546 LEU C CG  1 
ATOM   7092 C CD1 . LEU C 1 228 ? -27.862 88.080 20.101  1.00 16.75 ? 546 LEU C CD1 1 
ATOM   7093 C CD2 . LEU C 1 228 ? -27.065 87.206 17.868  1.00 27.17 ? 546 LEU C CD2 1 
ATOM   7094 N N   . PHE C 1 229 ? -24.633 91.343 19.084  1.00 33.79 ? 547 PHE C N   1 
ATOM   7095 C CA  . PHE C 1 229 ? -23.249 91.367 19.496  1.00 34.38 ? 547 PHE C CA  1 
ATOM   7096 C C   . PHE C 1 229 ? -23.145 92.223 20.732  1.00 36.85 ? 547 PHE C C   1 
ATOM   7097 O O   . PHE C 1 229 ? -22.494 91.852 21.721  1.00 37.64 ? 547 PHE C O   1 
ATOM   7098 C CB  . PHE C 1 229 ? -22.390 91.942 18.388  1.00 34.27 ? 547 PHE C CB  1 
ATOM   7099 C CG  . PHE C 1 229 ? -22.050 90.953 17.311  1.00 33.43 ? 547 PHE C CG  1 
ATOM   7100 C CD1 . PHE C 1 229 ? -22.325 89.594 17.481  1.00 31.43 ? 547 PHE C CD1 1 
ATOM   7101 C CD2 . PHE C 1 229 ? -21.408 91.370 16.149  1.00 29.44 ? 547 PHE C CD2 1 
ATOM   7102 C CE1 . PHE C 1 229 ? -21.984 88.666 16.499  1.00 31.52 ? 547 PHE C CE1 1 
ATOM   7103 C CE2 . PHE C 1 229 ? -21.052 90.446 15.157  1.00 33.61 ? 547 PHE C CE2 1 
ATOM   7104 C CZ  . PHE C 1 229 ? -21.342 89.089 15.331  1.00 31.63 ? 547 PHE C CZ  1 
ATOM   7105 N N   . GLN C 1 230 ? -23.821 93.364 20.694  1.00 38.22 ? 548 GLN C N   1 
ATOM   7106 C CA  . GLN C 1 230 ? -23.772 94.259 21.827  1.00 39.87 ? 548 GLN C CA  1 
ATOM   7107 C C   . GLN C 1 230 ? -24.346 93.634 23.082  1.00 39.01 ? 548 GLN C C   1 
ATOM   7108 O O   . GLN C 1 230 ? -23.812 93.801 24.166  1.00 39.36 ? 548 GLN C O   1 
ATOM   7109 C CB  . GLN C 1 230 ? -24.451 95.565 21.503  1.00 40.79 ? 548 GLN C CB  1 
ATOM   7110 C CG  . GLN C 1 230 ? -23.510 96.549 20.851  1.00 48.92 ? 548 GLN C CG  1 
ATOM   7111 C CD  . GLN C 1 230 ? -23.656 97.909 21.472  1.00 58.44 ? 548 GLN C CD  1 
ATOM   7112 O OE1 . GLN C 1 230 ? -24.749 98.280 21.901  1.00 63.32 ? 548 GLN C OE1 1 
ATOM   7113 N NE2 . GLN C 1 230 ? -22.559 98.656 21.554  1.00 62.21 ? 548 GLN C NE2 1 
ATOM   7114 N N   . SER C 1 231 ? -25.421 92.884 22.929  1.00 39.01 ? 549 SER C N   1 
ATOM   7115 C CA  . SER C 1 231 ? -26.009 92.181 24.060  1.00 39.18 ? 549 SER C CA  1 
ATOM   7116 C C   . SER C 1 231 ? -25.080 91.092 24.594  1.00 38.62 ? 549 SER C C   1 
ATOM   7117 O O   . SER C 1 231 ? -25.023 90.856 25.797  1.00 37.73 ? 549 SER C O   1 
ATOM   7118 C CB  . SER C 1 231 ? -27.346 91.576 23.663  1.00 38.54 ? 549 SER C CB  1 
ATOM   7119 O OG  . SER C 1 231 ? -28.311 91.851 24.655  1.00 44.09 ? 549 SER C OG  1 
ATOM   7120 N N   . ILE C 1 232 ? -24.351 90.439 23.691  1.00 38.50 ? 550 ILE C N   1 
ATOM   7121 C CA  . ILE C 1 232 ? -23.411 89.390 24.076  1.00 36.93 ? 550 ILE C CA  1 
ATOM   7122 C C   . ILE C 1 232 ? -22.220 90.001 24.773  1.00 37.24 ? 550 ILE C C   1 
ATOM   7123 O O   . ILE C 1 232 ? -21.741 89.469 25.753  1.00 38.40 ? 550 ILE C O   1 
ATOM   7124 C CB  . ILE C 1 232 ? -22.901 88.567 22.865  1.00 36.17 ? 550 ILE C CB  1 
ATOM   7125 C CG1 . ILE C 1 232 ? -23.960 87.572 22.392  1.00 33.47 ? 550 ILE C CG1 1 
ATOM   7126 C CG2 . ILE C 1 232 ? -21.637 87.830 23.236  1.00 33.60 ? 550 ILE C CG2 1 
ATOM   7127 C CD1 . ILE C 1 232 ? -23.708 87.003 21.009  1.00 25.72 ? 550 ILE C CD1 1 
ATOM   7128 N N   . MET C 1 233 ? -21.727 91.118 24.258  1.00 38.47 ? 551 MET C N   1 
ATOM   7129 C CA  . MET C 1 233 ? -20.573 91.758 24.870  1.00 38.58 ? 551 MET C CA  1 
ATOM   7130 C C   . MET C 1 233 ? -20.912 92.331 26.241  1.00 39.10 ? 551 MET C C   1 
ATOM   7131 O O   . MET C 1 233 ? -20.039 92.408 27.092  1.00 39.79 ? 551 MET C O   1 
ATOM   7132 C CB  . MET C 1 233 ? -20.042 92.873 23.978  1.00 38.42 ? 551 MET C CB  1 
ATOM   7133 C CG  . MET C 1 233 ? -19.431 92.426 22.667  1.00 42.23 ? 551 MET C CG  1 
ATOM   7134 S SD  . MET C 1 233 ? -17.961 91.381 22.841  1.00 52.02 ? 551 MET C SD  1 
ATOM   7135 C CE  . MET C 1 233 ? -17.081 92.253 24.137  1.00 48.66 ? 551 MET C CE  1 
ATOM   7136 N N   . GLU C 1 234 ? -22.185 92.686 26.458  1.00 39.94 ? 552 GLU C N   1 
ATOM   7137 C CA  . GLU C 1 234 ? -22.595 93.596 27.545  1.00 40.64 ? 552 GLU C CA  1 
ATOM   7138 C C   . GLU C 1 234 ? -23.633 93.088 28.537  1.00 40.76 ? 552 GLU C C   1 
ATOM   7139 O O   . GLU C 1 234 ? -23.667 93.532 29.682  1.00 38.92 ? 552 GLU C O   1 
ATOM   7140 C CB  . GLU C 1 234 ? -23.167 94.888 26.953  1.00 40.37 ? 552 GLU C CB  1 
ATOM   7141 C CG  . GLU C 1 234 ? -22.258 95.604 25.992  1.00 44.30 ? 552 GLU C CG  1 
ATOM   7142 C CD  . GLU C 1 234 ? -20.980 96.114 26.647  1.00 47.91 ? 552 GLU C CD  1 
ATOM   7143 O OE1 . GLU C 1 234 ? -20.904 96.149 27.897  1.00 44.91 ? 552 GLU C OE1 1 
ATOM   7144 O OE2 . GLU C 1 234 ? -20.046 96.477 25.901  1.00 47.74 ? 552 GLU C OE2 1 
ATOM   7145 N N   . HIS C 1 235 ? -24.503 92.195 28.088  1.00 42.50 ? 553 HIS C N   1 
ATOM   7146 C CA  . HIS C 1 235 ? -25.696 91.863 28.856  1.00 44.53 ? 553 HIS C CA  1 
ATOM   7147 C C   . HIS C 1 235 ? -25.456 90.753 29.877  1.00 42.65 ? 553 HIS C C   1 
ATOM   7148 O O   . HIS C 1 235 ? -24.517 89.971 29.749  1.00 41.17 ? 553 HIS C O   1 
ATOM   7149 C CB  . HIS C 1 235 ? -26.841 91.478 27.908  1.00 47.31 ? 553 HIS C CB  1 
ATOM   7150 C CG  . HIS C 1 235 ? -28.208 91.811 28.430  1.00 57.10 ? 553 HIS C CG  1 
ATOM   7151 N ND1 . HIS C 1 235 ? -29.015 90.881 29.058  1.00 61.78 ? 553 HIS C ND1 1 
ATOM   7152 C CD2 . HIS C 1 235 ? -28.914 92.970 28.409  1.00 61.70 ? 553 HIS C CD2 1 
ATOM   7153 C CE1 . HIS C 1 235 ? -30.153 91.457 29.411  1.00 64.43 ? 553 HIS C CE1 1 
ATOM   7154 N NE2 . HIS C 1 235 ? -30.115 92.725 29.033  1.00 64.64 ? 553 HIS C NE2 1 
ATOM   7155 N N   . ASN C 1 236 ? -26.306 90.723 30.900  1.00 41.76 ? 554 ASN C N   1 
ATOM   7156 C CA  . ASN C 1 236 ? -26.359 89.638 31.870  1.00 41.21 ? 554 ASN C CA  1 
ATOM   7157 C C   . ASN C 1 236 ? -27.408 88.615 31.449  1.00 41.74 ? 554 ASN C C   1 
ATOM   7158 O O   . ASN C 1 236 ? -28.536 88.974 31.103  1.00 43.24 ? 554 ASN C O   1 
ATOM   7159 C CB  . ASN C 1 236 ? -26.755 90.179 33.239  1.00 41.07 ? 554 ASN C CB  1 
ATOM   7160 C CG  . ASN C 1 236 ? -25.566 90.596 34.074  1.00 43.08 ? 554 ASN C CG  1 
ATOM   7161 O OD1 . ASN C 1 236 ? -24.668 91.294 33.603  1.00 43.33 ? 554 ASN C OD1 1 
ATOM   7162 N ND2 . ASN C 1 236 ? -25.565 90.184 35.338  1.00 43.78 ? 554 ASN C ND2 1 
ATOM   7163 N N   . VAL C 1 237 ? -27.060 87.338 31.460  1.00 41.09 ? 555 VAL C N   1 
ATOM   7164 C CA  . VAL C 1 237 ? -28.072 86.350 31.190  1.00 40.29 ? 555 VAL C CA  1 
ATOM   7165 C C   . VAL C 1 237 ? -29.040 86.400 32.351  1.00 40.80 ? 555 VAL C C   1 
ATOM   7166 O O   . VAL C 1 237 ? -28.650 86.138 33.490  1.00 41.80 ? 555 VAL C O   1 
ATOM   7167 C CB  . VAL C 1 237 ? -27.498 84.943 31.107  1.00 40.24 ? 555 VAL C CB  1 
ATOM   7168 C CG1 . VAL C 1 237 ? -28.609 83.956 30.885  1.00 38.76 ? 555 VAL C CG1 1 
ATOM   7169 C CG2 . VAL C 1 237 ? -26.483 84.841 29.976  1.00 40.24 ? 555 VAL C CG2 1 
ATOM   7170 N N   . SER C 1 238 ? -30.289 86.761 32.085  1.00 40.03 ? 556 SER C N   1 
ATOM   7171 C CA  . SER C 1 238 ? -31.276 86.677 33.138  1.00 40.93 ? 556 SER C CA  1 
ATOM   7172 C C   . SER C 1 238 ? -31.824 85.261 33.086  1.00 41.26 ? 556 SER C C   1 
ATOM   7173 O O   . SER C 1 238 ? -32.070 84.739 32.006  1.00 39.35 ? 556 SER C O   1 
ATOM   7174 C CB  . SER C 1 238 ? -32.356 87.768 33.030  1.00 40.60 ? 556 SER C CB  1 
ATOM   7175 O OG  . SER C 1 238 ? -33.343 87.433 32.086  1.00 40.59 ? 556 SER C OG  1 
ATOM   7176 N N   . TYR C 1 239 ? -31.949 84.638 34.262  1.00 42.90 ? 557 TYR C N   1 
ATOM   7177 C CA  . TYR C 1 239 ? -32.252 83.208 34.408  1.00 43.04 ? 557 TYR C CA  1 
ATOM   7178 C C   . TYR C 1 239 ? -33.610 83.075 35.068  1.00 43.29 ? 557 TYR C C   1 
ATOM   7179 O O   . TYR C 1 239 ? -33.763 83.461 36.215  1.00 44.83 ? 557 TYR C O   1 
ATOM   7180 C CB  . TYR C 1 239 ? -31.208 82.535 35.324  1.00 42.40 ? 557 TYR C CB  1 
ATOM   7181 C CG  . TYR C 1 239 ? -29.823 82.443 34.737  1.00 43.87 ? 557 TYR C CG  1 
ATOM   7182 C CD1 . TYR C 1 239 ? -28.835 83.359 35.078  1.00 46.65 ? 557 TYR C CD1 1 
ATOM   7183 C CD2 . TYR C 1 239 ? -29.501 81.446 33.822  1.00 45.84 ? 557 TYR C CD2 1 
ATOM   7184 C CE1 . TYR C 1 239 ? -27.554 83.282 34.524  1.00 48.08 ? 557 TYR C CE1 1 
ATOM   7185 C CE2 . TYR C 1 239 ? -28.232 81.362 33.256  1.00 45.49 ? 557 TYR C CE2 1 
ATOM   7186 C CZ  . TYR C 1 239 ? -27.258 82.280 33.610  1.00 49.64 ? 557 TYR C CZ  1 
ATOM   7187 O OH  . TYR C 1 239 ? -25.989 82.191 33.051  1.00 49.61 ? 557 TYR C OH  1 
ATOM   7188 N N   . PRO C 1 240 ? -34.599 82.498 34.377  1.00 43.20 ? 558 PRO C N   1 
ATOM   7189 C CA  . PRO C 1 240 ? -35.913 82.409 35.023  1.00 43.08 ? 558 PRO C CA  1 
ATOM   7190 C C   . PRO C 1 240 ? -35.879 81.724 36.405  1.00 42.58 ? 558 PRO C C   1 
ATOM   7191 O O   . PRO C 1 240 ? -35.237 80.692 36.579  1.00 41.94 ? 558 PRO C O   1 
ATOM   7192 C CB  . PRO C 1 240 ? -36.752 81.610 34.018  1.00 42.24 ? 558 PRO C CB  1 
ATOM   7193 C CG  . PRO C 1 240 ? -35.768 80.900 33.177  1.00 42.73 ? 558 PRO C CG  1 
ATOM   7194 C CD  . PRO C 1 240 ? -34.568 81.791 33.091  1.00 43.76 ? 558 PRO C CD  1 
ATOM   7195 N N   . LYS C 1 241 ? -36.587 82.314 37.366  1.00 43.54 ? 559 LYS C N   1 
ATOM   7196 C CA  . LYS C 1 241 ? -36.556 81.891 38.777  1.00 43.86 ? 559 LYS C CA  1 
ATOM   7197 C C   . LYS C 1 241 ? -36.693 80.384 38.999  1.00 42.35 ? 559 LYS C C   1 
ATOM   7198 O O   . LYS C 1 241 ? -36.263 79.862 40.027  1.00 42.52 ? 559 LYS C O   1 
ATOM   7199 C CB  . LYS C 1 241 ? -37.635 82.637 39.578  1.00 44.47 ? 559 LYS C CB  1 
ATOM   7200 C CG  . LYS C 1 241 ? -37.946 82.040 40.956  1.00 49.39 ? 559 LYS C CG  1 
ATOM   7201 C CD  . LYS C 1 241 ? -39.335 82.459 41.460  1.00 56.12 ? 559 LYS C CD  1 
ATOM   7202 C CE  . LYS C 1 241 ? -39.879 81.505 42.540  1.00 61.43 ? 559 LYS C CE  1 
ATOM   7203 N NZ  . LYS C 1 241 ? -39.526 81.902 43.938  1.00 62.27 ? 559 LYS C NZ  1 
ATOM   7204 N N   . SER C 1 242 ? -37.290 79.682 38.044  1.00 40.27 ? 560 SER C N   1 
ATOM   7205 C CA  . SER C 1 242 ? -37.531 78.262 38.221  1.00 38.40 ? 560 SER C CA  1 
ATOM   7206 C C   . SER C 1 242 ? -36.271 77.419 38.024  1.00 38.02 ? 560 SER C C   1 
ATOM   7207 O O   . SER C 1 242 ? -36.225 76.266 38.442  1.00 38.25 ? 560 SER C O   1 
ATOM   7208 C CB  . SER C 1 242 ? -38.637 77.781 37.289  1.00 38.53 ? 560 SER C CB  1 
ATOM   7209 O OG  . SER C 1 242 ? -38.119 77.433 36.023  1.00 37.63 ? 560 SER C OG  1 
ATOM   7210 N N   . LEU C 1 243 ? -35.245 77.984 37.394  1.00 37.26 ? 561 LEU C N   1 
ATOM   7211 C CA  . LEU C 1 243 ? -34.007 77.244 37.161  1.00 34.76 ? 561 LEU C CA  1 
ATOM   7212 C C   . LEU C 1 243 ? -33.328 76.801 38.442  1.00 32.83 ? 561 LEU C C   1 
ATOM   7213 O O   . LEU C 1 243 ? -33.176 77.581 39.380  1.00 31.88 ? 561 LEU C O   1 
ATOM   7214 C CB  . LEU C 1 243 ? -33.044 78.084 36.337  1.00 35.85 ? 561 LEU C CB  1 
ATOM   7215 C CG  . LEU C 1 243 ? -32.757 77.640 34.900  1.00 35.18 ? 561 LEU C CG  1 
ATOM   7216 C CD1 . LEU C 1 243 ? -33.925 76.894 34.292  1.00 32.46 ? 561 LEU C CD1 1 
ATOM   7217 C CD2 . LEU C 1 243 ? -32.384 78.856 34.080  1.00 34.01 ? 561 LEU C CD2 1 
ATOM   7218 N N   . SER C 1 244 ? -32.919 75.539 38.464  1.00 31.57 ? 562 SER C N   1 
ATOM   7219 C CA  . SER C 1 244 ? -32.143 74.978 39.568  1.00 31.29 ? 562 SER C CA  1 
ATOM   7220 C C   . SER C 1 244 ? -30.825 75.706 39.780  1.00 32.47 ? 562 SER C C   1 
ATOM   7221 O O   . SER C 1 244 ? -30.230 76.203 38.834  1.00 35.27 ? 562 SER C O   1 
ATOM   7222 C CB  . SER C 1 244 ? -31.840 73.518 39.298  1.00 30.29 ? 562 SER C CB  1 
ATOM   7223 O OG  . SER C 1 244 ? -30.537 73.221 39.734  1.00 30.14 ? 562 SER C OG  1 
ATOM   7224 N N   . LYS C 1 245 ? -30.346 75.740 41.015  1.00 32.98 ? 563 LYS C N   1 
ATOM   7225 C CA  . LYS C 1 245 ? -29.174 76.532 41.328  1.00 32.67 ? 563 LYS C CA  1 
ATOM   7226 C C   . LYS C 1 245 ? -27.934 75.922 40.728  1.00 33.05 ? 563 LYS C C   1 
ATOM   7227 O O   . LYS C 1 245 ? -27.010 76.652 40.405  1.00 34.30 ? 563 LYS C O   1 
ATOM   7228 C CB  . LYS C 1 245 ? -28.995 76.741 42.836  1.00 33.02 ? 563 LYS C CB  1 
ATOM   7229 C CG  . LYS C 1 245 ? -28.476 75.539 43.633  1.00 33.22 ? 563 LYS C CG  1 
ATOM   7230 C CD  . LYS C 1 245 ? -28.017 75.979 45.025  1.00 30.46 ? 563 LYS C CD  1 
ATOM   7231 C CE  . LYS C 1 245 ? -27.095 74.954 45.692  1.00 30.88 ? 563 LYS C CE  1 
ATOM   7232 N NZ  . LYS C 1 245 ? -27.851 73.837 46.323  1.00 33.90 ? 563 LYS C NZ  1 
ATOM   7233 N N   . GLU C 1 246 ? -27.898 74.602 40.560  1.00 33.33 ? 564 GLU C N   1 
ATOM   7234 C CA  . GLU C 1 246 ? -26.742 74.009 39.869  1.00 34.05 ? 564 GLU C CA  1 
ATOM   7235 C C   . GLU C 1 246 ? -26.752 74.405 38.419  1.00 33.96 ? 564 GLU C C   1 
ATOM   7236 O O   . GLU C 1 246 ? -25.694 74.556 37.827  1.00 35.34 ? 564 GLU C O   1 
ATOM   7237 C CB  . GLU C 1 246 ? -26.652 72.486 39.980  1.00 33.87 ? 564 GLU C CB  1 
ATOM   7238 C CG  . GLU C 1 246 ? -26.517 71.986 41.384  1.00 34.47 ? 564 GLU C CG  1 
ATOM   7239 C CD  . GLU C 1 246 ? -27.855 71.915 42.052  1.00 38.73 ? 564 GLU C CD  1 
ATOM   7240 O OE1 . GLU C 1 246 ? -28.880 71.829 41.337  1.00 42.91 ? 564 GLU C OE1 1 
ATOM   7241 O OE2 . GLU C 1 246 ? -27.893 71.945 43.289  1.00 44.65 ? 564 GLU C OE2 1 
ATOM   7242 N N   . ALA C 1 247 ? -27.943 74.572 37.852  1.00 33.83 ? 565 ALA C N   1 
ATOM   7243 C CA  . ALA C 1 247 ? -28.073 75.028 36.468  1.00 33.66 ? 565 ALA C CA  1 
ATOM   7244 C C   . ALA C 1 247 ? -27.590 76.466 36.289  1.00 32.74 ? 565 ALA C C   1 
ATOM   7245 O O   . ALA C 1 247 ? -26.757 76.753 35.427  1.00 31.68 ? 565 ALA C O   1 
ATOM   7246 C CB  . ALA C 1 247 ? -29.501 74.893 36.009  1.00 34.50 ? 565 ALA C CB  1 
ATOM   7247 N N   . VAL C 1 248 ? -28.107 77.378 37.103  1.00 32.24 ? 566 VAL C N   1 
ATOM   7248 C CA  . VAL C 1 248 ? -27.684 78.758 36.980  1.00 31.56 ? 566 VAL C CA  1 
ATOM   7249 C C   . VAL C 1 248 ? -26.169 78.826 37.136  1.00 31.92 ? 566 VAL C C   1 
ATOM   7250 O O   . VAL C 1 248 ? -25.477 79.553 36.400  1.00 32.56 ? 566 VAL C O   1 
ATOM   7251 C CB  . VAL C 1 248 ? -28.377 79.671 37.993  1.00 31.27 ? 566 VAL C CB  1 
ATOM   7252 C CG1 . VAL C 1 248 ? -27.777 81.073 37.925  1.00 28.35 ? 566 VAL C CG1 1 
ATOM   7253 C CG2 . VAL C 1 248 ? -29.865 79.715 37.713  1.00 28.37 ? 566 VAL C CG2 1 
ATOM   7254 N N   . SER C 1 249 ? -25.656 78.033 38.071  1.00 30.65 ? 567 SER C N   1 
ATOM   7255 C CA  . SER C 1 249 ? -24.226 78.009 38.344  1.00 29.91 ? 567 SER C CA  1 
ATOM   7256 C C   . SER C 1 249 ? -23.445 77.671 37.088  1.00 28.66 ? 567 SER C C   1 
ATOM   7257 O O   . SER C 1 249 ? -22.557 78.410 36.683  1.00 29.35 ? 567 SER C O   1 
ATOM   7258 C CB  . SER C 1 249 ? -23.894 77.018 39.462  1.00 29.11 ? 567 SER C CB  1 
ATOM   7259 O OG  . SER C 1 249 ? -22.489 76.921 39.642  1.00 33.75 ? 567 SER C OG  1 
ATOM   7260 N N   . ILE C 1 250 ? -23.789 76.557 36.459  1.00 28.18 ? 568 ILE C N   1 
ATOM   7261 C CA  . ILE C 1 250 ? -23.045 76.110 35.282  1.00 27.96 ? 568 ILE C CA  1 
ATOM   7262 C C   . ILE C 1 250 ? -23.140 77.139 34.155  1.00 27.16 ? 568 ILE C C   1 
ATOM   7263 O O   . ILE C 1 250 ? -22.151 77.435 33.474  1.00 26.15 ? 568 ILE C O   1 
ATOM   7264 C CB  . ILE C 1 250 ? -23.454 74.672 34.809  1.00 27.63 ? 568 ILE C CB  1 
ATOM   7265 C CG1 . ILE C 1 250 ? -22.338 74.059 33.951  1.00 29.96 ? 568 ILE C CG1 1 
ATOM   7266 C CG2 . ILE C 1 250 ? -24.797 74.675 34.086  1.00 25.23 ? 568 ILE C CG2 1 
ATOM   7267 C CD1 . ILE C 1 250 ? -22.199 72.530 34.061  1.00 30.57 ? 568 ILE C CD1 1 
ATOM   7268 N N   . CYS C 1 251 ? -24.319 77.714 33.985  1.00 25.81 ? 569 CYS C N   1 
ATOM   7269 C CA  . CYS C 1 251 ? -24.472 78.675 32.927  1.00 26.38 ? 569 CYS C CA  1 
ATOM   7270 C C   . CYS C 1 251 ? -23.599 79.898 33.097  1.00 26.17 ? 569 CYS C C   1 
ATOM   7271 O O   . CYS C 1 251 ? -23.052 80.423 32.130  1.00 25.47 ? 569 CYS C O   1 
ATOM   7272 C CB  . CYS C 1 251 ? -25.926 79.029 32.741  1.00 25.77 ? 569 CYS C CB  1 
ATOM   7273 S SG  . CYS C 1 251 ? -26.756 77.614 32.000  1.00 32.02 ? 569 CYS C SG  1 
ATOM   7274 N N   . LYS C 1 252 ? -23.435 80.352 34.322  1.00 26.24 ? 570 LYS C N   1 
ATOM   7275 C CA  . LYS C 1 252 ? -22.599 81.503 34.489  1.00 26.96 ? 570 LYS C CA  1 
ATOM   7276 C C   . LYS C 1 252 ? -21.178 81.070 34.261  1.00 26.18 ? 570 LYS C C   1 
ATOM   7277 O O   . LYS C 1 252 ? -20.382 81.831 33.714  1.00 25.02 ? 570 LYS C O   1 
ATOM   7278 C CB  . LYS C 1 252 ? -22.796 82.117 35.861  1.00 28.48 ? 570 LYS C CB  1 
ATOM   7279 C CG  . LYS C 1 252 ? -24.262 82.478 36.101  1.00 34.40 ? 570 LYS C CG  1 
ATOM   7280 C CD  . LYS C 1 252 ? -24.418 83.474 37.228  1.00 36.58 ? 570 LYS C CD  1 
ATOM   7281 C CE  . LYS C 1 252 ? -25.870 83.792 37.463  1.00 37.88 ? 570 LYS C CE  1 
ATOM   7282 N NZ  . LYS C 1 252 ? -26.001 84.438 38.796  1.00 41.64 ? 570 LYS C NZ  1 
ATOM   7283 N N   . GLY C 1 253 ? -20.868 79.834 34.656  1.00 26.91 ? 571 GLY C N   1 
ATOM   7284 C CA  . GLY C 1 253 ? -19.511 79.296 34.492  1.00 27.44 ? 571 GLY C CA  1 
ATOM   7285 C C   . GLY C 1 253 ? -19.113 79.326 33.025  1.00 28.77 ? 571 GLY C C   1 
ATOM   7286 O O   . GLY C 1 253 ? -18.033 79.822 32.634  1.00 29.05 ? 571 GLY C O   1 
ATOM   7287 N N   . LEU C 1 254 ? -20.030 78.816 32.212  1.00 28.27 ? 572 LEU C N   1 
ATOM   7288 C CA  . LEU C 1 254 ? -19.848 78.700 30.787  1.00 26.29 ? 572 LEU C CA  1 
ATOM   7289 C C   . LEU C 1 254 ? -20.002 80.013 30.025  1.00 26.26 ? 572 LEU C C   1 
ATOM   7290 O O   . LEU C 1 254 ? -19.381 80.193 28.984  1.00 26.43 ? 572 LEU C O   1 
ATOM   7291 C CB  . LEU C 1 254 ? -20.845 77.682 30.250  1.00 25.78 ? 572 LEU C CB  1 
ATOM   7292 C CG  . LEU C 1 254 ? -20.618 76.230 30.660  1.00 24.12 ? 572 LEU C CG  1 
ATOM   7293 C CD1 . LEU C 1 254 ? -21.759 75.354 30.171  1.00 24.10 ? 572 LEU C CD1 1 
ATOM   7294 C CD2 . LEU C 1 254 ? -19.316 75.745 30.094  1.00 20.15 ? 572 LEU C CD2 1 
ATOM   7295 N N   . MET C 1 255 ? -20.851 80.915 30.511  1.00 26.45 ? 573 MET C N   1 
ATOM   7296 C CA  . MET C 1 255 ? -21.131 82.155 29.779  1.00 25.56 ? 573 MET C CA  1 
ATOM   7297 C C   . MET C 1 255 ? -20.492 83.349 30.460  1.00 25.76 ? 573 MET C C   1 
ATOM   7298 O O   . MET C 1 255 ? -21.050 84.447 30.488  1.00 25.83 ? 573 MET C O   1 
ATOM   7299 C CB  . MET C 1 255 ? -22.628 82.353 29.599  1.00 24.92 ? 573 MET C CB  1 
ATOM   7300 C CG  . MET C 1 255 ? -23.151 81.754 28.303  1.00 28.99 ? 573 MET C CG  1 
ATOM   7301 S SD  . MET C 1 255 ? -24.950 81.653 28.127  1.00 33.12 ? 573 MET C SD  1 
ATOM   7302 C CE  . MET C 1 255 ? -25.265 80.065 28.874  1.00 34.24 ? 573 MET C CE  1 
ATOM   7303 N N   . THR C 1 256 ? -19.319 83.083 31.023  1.00 24.64 ? 574 THR C N   1 
ATOM   7304 C CA  . THR C 1 256 ? -18.404 84.065 31.545  1.00 24.23 ? 574 THR C CA  1 
ATOM   7305 C C   . THR C 1 256 ? -17.706 84.733 30.360  1.00 25.99 ? 574 THR C C   1 
ATOM   7306 O O   . THR C 1 256 ? -17.041 84.057 29.539  1.00 25.93 ? 574 THR C O   1 
ATOM   7307 C CB  . THR C 1 256 ? -17.375 83.339 32.454  1.00 24.48 ? 574 THR C CB  1 
ATOM   7308 O OG1 . THR C 1 256 ? -18.067 82.813 33.591  1.00 25.58 ? 574 THR C OG1 1 
ATOM   7309 C CG2 . THR C 1 256 ? -16.229 84.247 32.910  1.00 15.65 ? 574 THR C CG2 1 
ATOM   7310 N N   . LYS C 1 257 ? -17.850 86.055 30.277  1.00 25.83 ? 575 LYS C N   1 
ATOM   7311 C CA  . LYS C 1 257 ? -17.318 86.832 29.152  1.00 25.80 ? 575 LYS C CA  1 
ATOM   7312 C C   . LYS C 1 257 ? -15.787 86.803 29.021  1.00 28.70 ? 575 LYS C C   1 
ATOM   7313 O O   . LYS C 1 257 ? -15.241 86.981 27.927  1.00 31.06 ? 575 LYS C O   1 
ATOM   7314 C CB  . LYS C 1 257 ? -17.826 88.275 29.222  1.00 23.58 ? 575 LYS C CB  1 
ATOM   7315 C CG  . LYS C 1 257 ? -19.349 88.379 29.392  1.00 16.68 ? 575 LYS C CG  1 
ATOM   7316 C CD  . LYS C 1 257 ? -19.917 89.568 28.640  1.00 4.92  ? 575 LYS C CD  1 
ATOM   7317 C CE  . LYS C 1 257 ? -21.370 89.761 28.924  1.00 6.96  ? 575 LYS C CE  1 
ATOM   7318 N NZ  . LYS C 1 257 ? -22.187 88.560 28.502  1.00 20.29 ? 575 LYS C NZ  1 
ATOM   7319 N N   . HIS C 1 258 ? -15.084 86.599 30.126  1.00 30.03 ? 576 HIS C N   1 
ATOM   7320 C CA  . HIS C 1 258 ? -13.637 86.531 30.061  1.00 30.74 ? 576 HIS C CA  1 
ATOM   7321 C C   . HIS C 1 258 ? -13.175 85.098 29.877  1.00 31.24 ? 576 HIS C C   1 
ATOM   7322 O O   . HIS C 1 258 ? -13.247 84.301 30.806  1.00 32.07 ? 576 HIS C O   1 
ATOM   7323 C CB  . HIS C 1 258 ? -13.042 87.085 31.336  1.00 31.79 ? 576 HIS C CB  1 
ATOM   7324 C CG  . HIS C 1 258 ? -13.064 88.574 31.409  1.00 35.04 ? 576 HIS C CG  1 
ATOM   7325 N ND1 . HIS C 1 258 ? -14.126 89.273 31.934  1.00 38.31 ? 576 HIS C ND1 1 
ATOM   7326 C CD2 . HIS C 1 258 ? -12.151 89.498 31.026  1.00 36.04 ? 576 HIS C CD2 1 
ATOM   7327 C CE1 . HIS C 1 258 ? -13.861 90.567 31.877  1.00 41.03 ? 576 HIS C CE1 1 
ATOM   7328 N NE2 . HIS C 1 258 ? -12.669 90.731 31.330  1.00 36.38 ? 576 HIS C NE2 1 
ATOM   7329 N N   . PRO C 1 259 ? -12.691 84.760 28.676  1.00 30.80 ? 577 PRO C N   1 
ATOM   7330 C CA  . PRO C 1 259 ? -12.344 83.378 28.387  1.00 30.67 ? 577 PRO C CA  1 
ATOM   7331 C C   . PRO C 1 259 ? -11.562 82.728 29.518  1.00 32.25 ? 577 PRO C C   1 
ATOM   7332 O O   . PRO C 1 259 ? -11.819 81.572 29.859  1.00 31.94 ? 577 PRO C O   1 
ATOM   7333 C CB  . PRO C 1 259 ? -11.459 83.485 27.144  1.00 31.17 ? 577 PRO C CB  1 
ATOM   7334 C CG  . PRO C 1 259 ? -11.764 84.831 26.528  1.00 30.96 ? 577 PRO C CG  1 
ATOM   7335 C CD  . PRO C 1 259 ? -12.608 85.628 27.490  1.00 31.50 ? 577 PRO C CD  1 
ATOM   7336 N N   . ALA C 1 260 ? -10.619 83.472 30.096  1.00 33.15 ? 578 ALA C N   1 
ATOM   7337 C CA  . ALA C 1 260 ? -9.647  82.894 31.018  1.00 33.19 ? 578 ALA C CA  1 
ATOM   7338 C C   . ALA C 1 260 ? -10.316 82.346 32.232  1.00 34.45 ? 578 ALA C C   1 
ATOM   7339 O O   . ALA C 1 260 ? -9.821  81.388 32.815  1.00 36.78 ? 578 ALA C O   1 
ATOM   7340 C CB  . ALA C 1 260 ? -8.636  83.908 31.433  1.00 33.12 ? 578 ALA C CB  1 
ATOM   7341 N N   . LYS C 1 261 ? -11.431 82.965 32.623  1.00 34.92 ? 579 LYS C N   1 
ATOM   7342 C CA  . LYS C 1 261 ? -12.211 82.537 33.805  1.00 34.95 ? 579 LYS C CA  1 
ATOM   7343 C C   . LYS C 1 261 ? -13.362 81.611 33.430  1.00 34.01 ? 579 LYS C C   1 
ATOM   7344 O O   . LYS C 1 261 ? -14.231 81.335 34.243  1.00 35.02 ? 579 LYS C O   1 
ATOM   7345 C CB  . LYS C 1 261 ? -12.837 83.736 34.530  1.00 34.03 ? 579 LYS C CB  1 
ATOM   7346 C CG  . LYS C 1 261 ? -11.894 84.817 34.988  1.00 36.21 ? 579 LYS C CG  1 
ATOM   7347 C CD  . LYS C 1 261 ? -12.651 86.154 35.047  1.00 44.16 ? 579 LYS C CD  1 
ATOM   7348 C CE  . LYS C 1 261 ? -14.121 85.981 35.532  1.00 45.92 ? 579 LYS C CE  1 
ATOM   7349 N NZ  . LYS C 1 261 ? -15.019 87.177 35.305  1.00 40.76 ? 579 LYS C NZ  1 
ATOM   7350 N N   . ARG C 1 262 ? -13.417 81.178 32.186  1.00 33.11 ? 580 ARG C N   1 
ATOM   7351 C CA  . ARG C 1 262 ? -14.606 80.492 31.747  1.00 31.74 ? 580 ARG C CA  1 
ATOM   7352 C C   . ARG C 1 262 ? -14.481 79.056 32.214  1.00 31.34 ? 580 ARG C C   1 
ATOM   7353 O O   . ARG C 1 262 ? -13.373 78.524 32.253  1.00 31.87 ? 580 ARG C O   1 
ATOM   7354 C CB  . ARG C 1 262 ? -14.726 80.601 30.230  1.00 31.27 ? 580 ARG C CB  1 
ATOM   7355 C CG  . ARG C 1 262 ? -16.008 80.030 29.665  1.00 30.26 ? 580 ARG C CG  1 
ATOM   7356 C CD  . ARG C 1 262 ? -16.122 80.339 28.199  1.00 20.63 ? 580 ARG C CD  1 
ATOM   7357 N NE  . ARG C 1 262 ? -16.165 81.775 27.968  1.00 17.75 ? 580 ARG C NE  1 
ATOM   7358 C CZ  . ARG C 1 262 ? -15.692 82.343 26.865  1.00 18.09 ? 580 ARG C CZ  1 
ATOM   7359 N NH1 . ARG C 1 262 ? -15.154 81.567 25.931  1.00 13.04 ? 580 ARG C NH1 1 
ATOM   7360 N NH2 . ARG C 1 262 ? -15.733 83.673 26.704  1.00 14.69 ? 580 ARG C NH2 1 
ATOM   7361 N N   . LEU C 1 263 ? -15.596 78.440 32.607  1.00 30.99 ? 581 LEU C N   1 
ATOM   7362 C CA  . LEU C 1 263 ? -15.585 77.035 33.011  1.00 29.32 ? 581 LEU C CA  1 
ATOM   7363 C C   . LEU C 1 263 ? -15.274 76.276 31.763  1.00 30.55 ? 581 LEU C C   1 
ATOM   7364 O O   . LEU C 1 263 ? -15.873 76.544 30.723  1.00 31.23 ? 581 LEU C O   1 
ATOM   7365 C CB  . LEU C 1 263 ? -16.946 76.599 33.528  1.00 28.97 ? 581 LEU C CB  1 
ATOM   7366 C CG  . LEU C 1 263 ? -17.237 75.120 33.781  1.00 29.23 ? 581 LEU C CG  1 
ATOM   7367 C CD1 . LEU C 1 263 ? -16.347 74.567 34.866  1.00 34.81 ? 581 LEU C CD1 1 
ATOM   7368 C CD2 . LEU C 1 263 ? -18.675 74.948 34.204  1.00 32.99 ? 581 LEU C CD2 1 
ATOM   7369 N N   . GLY C 1 264 ? -14.337 75.339 31.858  1.00 31.22 ? 582 GLY C N   1 
ATOM   7370 C CA  . GLY C 1 264 ? -13.888 74.578 30.706  1.00 31.51 ? 582 GLY C CA  1 
ATOM   7371 C C   . GLY C 1 264 ? -12.520 75.032 30.237  1.00 32.98 ? 582 GLY C C   1 
ATOM   7372 O O   . GLY C 1 264 ? -11.798 74.267 29.568  1.00 31.97 ? 582 GLY C O   1 
ATOM   7373 N N   . CYS C 1 265 ? -12.158 76.267 30.605  1.00 33.33 ? 583 CYS C N   1 
ATOM   7374 C CA  . CYS C 1 265 ? -10.941 76.906 30.103  1.00 35.43 ? 583 CYS C CA  1 
ATOM   7375 C C   . CYS C 1 265 ? -9.822  77.002 31.128  1.00 35.31 ? 583 CYS C C   1 
ATOM   7376 O O   . CYS C 1 265 ? -8.730  77.468 30.822  1.00 34.80 ? 583 CYS C O   1 
ATOM   7377 C CB  . CYS C 1 265 ? -11.261 78.295 29.559  1.00 35.74 ? 583 CYS C CB  1 
ATOM   7378 S SG  . CYS C 1 265 ? -12.607 78.322 28.342  1.00 47.37 ? 583 CYS C SG  1 
ATOM   7379 N N   . GLY C 1 266 ? -10.088 76.567 32.349  1.00 37.02 ? 584 GLY C N   1 
ATOM   7380 C CA  . GLY C 1 266 ? -9.019  76.460 33.343  1.00 38.84 ? 584 GLY C CA  1 
ATOM   7381 C C   . GLY C 1 266 ? -7.967  75.450 32.906  1.00 39.60 ? 584 GLY C C   1 
ATOM   7382 O O   . GLY C 1 266 ? -8.199  74.653 32.000  1.00 39.72 ? 584 GLY C O   1 
ATOM   7383 N N   . PRO C 1 267 ? -6.800  75.463 33.561  1.00 40.14 ? 585 PRO C N   1 
ATOM   7384 C CA  . PRO C 1 267 ? -5.753  74.495 33.212  1.00 39.91 ? 585 PRO C CA  1 
ATOM   7385 C C   . PRO C 1 267 ? -6.249  73.055 33.421  1.00 39.51 ? 585 PRO C C   1 
ATOM   7386 O O   . PRO C 1 267 ? -5.662  72.101 32.896  1.00 38.98 ? 585 PRO C O   1 
ATOM   7387 C CB  . PRO C 1 267 ? -4.627  74.829 34.191  1.00 39.43 ? 585 PRO C CB  1 
ATOM   7388 C CG  . PRO C 1 267 ? -5.343  75.410 35.384  1.00 40.54 ? 585 PRO C CG  1 
ATOM   7389 C CD  . PRO C 1 267 ? -6.511  76.177 34.819  1.00 40.46 ? 585 PRO C CD  1 
ATOM   7390 N N   . GLU C 1 268 ? -7.329  72.915 34.185  1.00 38.95 ? 586 GLU C N   1 
ATOM   7391 C CA  . GLU C 1 268 ? -7.993  71.635 34.343  1.00 38.56 ? 586 GLU C CA  1 
ATOM   7392 C C   . GLU C 1 268 ? -9.479  71.760 34.017  1.00 37.74 ? 586 GLU C C   1 
ATOM   7393 O O   . GLU C 1 268 ? -10.336 71.211 34.733  1.00 37.49 ? 586 GLU C O   1 
ATOM   7394 C CB  . GLU C 1 268 ? -7.792  71.108 35.752  1.00 38.68 ? 586 GLU C CB  1 
ATOM   7395 C CG  . GLU C 1 268 ? -6.345  70.755 36.040  1.00 43.28 ? 586 GLU C CG  1 
ATOM   7396 C CD  . GLU C 1 268 ? -6.101  70.451 37.505  1.00 47.88 ? 586 GLU C CD  1 
ATOM   7397 O OE1 . GLU C 1 268 ? -5.388  71.245 38.172  1.00 48.27 ? 586 GLU C OE1 1 
ATOM   7398 O OE2 . GLU C 1 268 ? -6.644  69.429 37.985  1.00 47.53 ? 586 GLU C OE2 1 
ATOM   7399 N N   . GLY C 1 269 ? -9.768  72.479 32.929  1.00 34.93 ? 587 GLY C N   1 
ATOM   7400 C CA  . GLY C 1 269 ? -11.135 72.699 32.472  1.00 33.41 ? 587 GLY C CA  1 
ATOM   7401 C C   . GLY C 1 269 ? -12.009 71.453 32.385  1.00 32.52 ? 587 GLY C C   1 
ATOM   7402 O O   . GLY C 1 269 ? -13.150 71.460 32.861  1.00 32.29 ? 587 GLY C O   1 
ATOM   7403 N N   . GLU C 1 270 ? -11.487 70.384 31.783  1.00 31.32 ? 588 GLU C N   1 
ATOM   7404 C CA  . GLU C 1 270 ? -12.257 69.160 31.613  1.00 30.98 ? 588 GLU C CA  1 
ATOM   7405 C C   . GLU C 1 270 ? -12.701 68.633 32.957  1.00 32.02 ? 588 GLU C C   1 
ATOM   7406 O O   . GLU C 1 270 ? -13.799 68.066 33.097  1.00 31.35 ? 588 GLU C O   1 
ATOM   7407 C CB  . GLU C 1 270 ? -11.447 68.077 30.896  1.00 32.14 ? 588 GLU C CB  1 
ATOM   7408 C CG  . GLU C 1 270 ? -12.174 66.718 30.815  1.00 28.77 ? 588 GLU C CG  1 
ATOM   7409 C CD  . GLU C 1 270 ? -11.444 65.693 29.963  1.00 30.18 ? 588 GLU C CD  1 
ATOM   7410 O OE1 . GLU C 1 270 ? -10.316 65.997 29.492  1.00 30.14 ? 588 GLU C OE1 1 
ATOM   7411 O OE2 . GLU C 1 270 ? -12.008 64.590 29.754  1.00 25.23 ? 588 GLU C OE2 1 
ATOM   7412 N N   . ARG C 1 271 ? -11.836 68.823 33.951  1.00 33.14 ? 589 ARG C N   1 
ATOM   7413 C CA  . ARG C 1 271 ? -12.151 68.420 35.313  1.00 32.08 ? 589 ARG C CA  1 
ATOM   7414 C C   . ARG C 1 271 ? -13.209 69.318 35.955  1.00 31.88 ? 589 ARG C C   1 
ATOM   7415 O O   . ARG C 1 271 ? -14.138 68.821 36.576  1.00 32.13 ? 589 ARG C O   1 
ATOM   7416 C CB  . ARG C 1 271 ? -10.895 68.357 36.165  1.00 31.53 ? 589 ARG C CB  1 
ATOM   7417 C CG  . ARG C 1 271 ? -11.116 67.621 37.459  1.00 32.00 ? 589 ARG C CG  1 
ATOM   7418 C CD  . ARG C 1 271 ? -9.814  67.258 38.105  1.00 30.36 ? 589 ARG C CD  1 
ATOM   7419 N NE  . ARG C 1 271 ? -10.047 66.813 39.471  1.00 33.91 ? 589 ARG C NE  1 
ATOM   7420 C CZ  . ARG C 1 271 ? -9.083  66.661 40.370  1.00 33.18 ? 589 ARG C CZ  1 
ATOM   7421 N NH1 . ARG C 1 271 ? -7.832  66.918 40.031  1.00 32.79 ? 589 ARG C NH1 1 
ATOM   7422 N NH2 . ARG C 1 271 ? -9.364  66.263 41.603  1.00 34.87 ? 589 ARG C NH2 1 
ATOM   7423 N N   . ASP C 1 272 ? -13.093 70.629 35.788  1.00 31.43 ? 590 ASP C N   1 
ATOM   7424 C CA  . ASP C 1 272 ? -14.046 71.544 36.418  1.00 32.60 ? 590 ASP C CA  1 
ATOM   7425 C C   . ASP C 1 272 ? -15.477 71.302 35.952  1.00 31.77 ? 590 ASP C C   1 
ATOM   7426 O O   . ASP C 1 272 ? -16.428 71.336 36.743  1.00 31.20 ? 590 ASP C O   1 
ATOM   7427 C CB  . ASP C 1 272 ? -13.642 72.991 36.155  1.00 33.51 ? 590 ASP C CB  1 
ATOM   7428 C CG  . ASP C 1 272 ? -12.168 73.197 36.325  1.00 35.84 ? 590 ASP C CG  1 
ATOM   7429 O OD1 . ASP C 1 272 ? -11.463 72.174 36.428  1.00 36.84 ? 590 ASP C OD1 1 
ATOM   7430 O OD2 . ASP C 1 272 ? -11.714 74.359 36.354  1.00 40.01 ? 590 ASP C OD2 1 
ATOM   7431 N N   . VAL C 1 273 ? -15.612 71.052 34.659  1.00 30.73 ? 591 VAL C N   1 
ATOM   7432 C CA  . VAL C 1 273 ? -16.908 70.809 34.070  1.00 29.33 ? 591 VAL C CA  1 
ATOM   7433 C C   . VAL C 1 273 ? -17.372 69.482 34.593  1.00 29.62 ? 591 VAL C C   1 
ATOM   7434 O O   . VAL C 1 273 ? -18.530 69.317 34.991  1.00 29.72 ? 591 VAL C O   1 
ATOM   7435 C CB  . VAL C 1 273 ? -16.790 70.679 32.546  1.00 28.33 ? 591 VAL C CB  1 
ATOM   7436 C CG1 . VAL C 1 273 ? -18.128 70.312 31.934  1.00 23.57 ? 591 VAL C CG1 1 
ATOM   7437 C CG2 . VAL C 1 273 ? -16.235 71.951 31.959  1.00 28.47 ? 591 VAL C CG2 1 
ATOM   7438 N N   . ARG C 1 274 ? -16.443 68.534 34.597  1.00 28.49 ? 592 ARG C N   1 
ATOM   7439 C CA  . ARG C 1 274 ? -16.799 67.168 34.832  1.00 29.39 ? 592 ARG C CA  1 
ATOM   7440 C C   . ARG C 1 274 ? -17.289 67.018 36.256  1.00 30.69 ? 592 ARG C C   1 
ATOM   7441 O O   . ARG C 1 274 ? -18.211 66.261 36.529  1.00 33.11 ? 592 ARG C O   1 
ATOM   7442 C CB  . ARG C 1 274 ? -15.604 66.284 34.570  1.00 30.15 ? 592 ARG C CB  1 
ATOM   7443 C CG  . ARG C 1 274 ? -15.912 65.126 33.682  1.00 33.23 ? 592 ARG C CG  1 
ATOM   7444 C CD  . ARG C 1 274 ? -14.649 64.510 33.119  1.00 40.33 ? 592 ARG C CD  1 
ATOM   7445 N NE  . ARG C 1 274 ? -14.927 63.158 32.644  1.00 51.75 ? 592 ARG C NE  1 
ATOM   7446 C CZ  . ARG C 1 274 ? -14.500 62.646 31.491  1.00 54.57 ? 592 ARG C CZ  1 
ATOM   7447 N NH1 . ARG C 1 274 ? -13.760 63.370 30.658  1.00 58.28 ? 592 ARG C NH1 1 
ATOM   7448 N NH2 . ARG C 1 274 ? -14.824 61.402 31.168  1.00 53.62 ? 592 ARG C NH2 1 
ATOM   7449 N N   . GLU C 1 275 ? -16.703 67.778 37.169  1.00 30.82 ? 593 GLU C N   1 
ATOM   7450 C CA  . GLU C 1 275 ? -17.086 67.686 38.562  1.00 29.40 ? 593 GLU C CA  1 
ATOM   7451 C C   . GLU C 1 275 ? -17.969 68.822 39.001  1.00 28.44 ? 593 GLU C C   1 
ATOM   7452 O O   . GLU C 1 275 ? -18.122 69.029 40.185  1.00 28.86 ? 593 GLU C O   1 
ATOM   7453 C CB  . GLU C 1 275 ? -15.851 67.704 39.456  1.00 29.66 ? 593 GLU C CB  1 
ATOM   7454 C CG  . GLU C 1 275 ? -15.025 66.439 39.481  1.00 31.01 ? 593 GLU C CG  1 
ATOM   7455 C CD  . GLU C 1 275 ? -13.586 66.733 39.891  1.00 35.93 ? 593 GLU C CD  1 
ATOM   7456 O OE1 . GLU C 1 275 ? -13.318 67.902 40.275  1.00 33.54 ? 593 GLU C OE1 1 
ATOM   7457 O OE2 . GLU C 1 275 ? -12.730 65.813 39.808  1.00 33.51 ? 593 GLU C OE2 1 
ATOM   7458 N N   . HIS C 1 276 ? -18.529 69.590 38.084  1.00 27.89 ? 594 HIS C N   1 
ATOM   7459 C CA  . HIS C 1 276 ? -19.436 70.644 38.520  1.00 28.33 ? 594 HIS C CA  1 
ATOM   7460 C C   . HIS C 1 276 ? -20.662 70.020 39.209  1.00 30.55 ? 594 HIS C C   1 
ATOM   7461 O O   . HIS C 1 276 ? -21.046 68.883 38.902  1.00 30.68 ? 594 HIS C O   1 
ATOM   7462 C CB  . HIS C 1 276 ? -19.838 71.514 37.337  1.00 27.55 ? 594 HIS C CB  1 
ATOM   7463 C CG  . HIS C 1 276 ? -20.538 72.783 37.712  1.00 23.04 ? 594 HIS C CG  1 
ATOM   7464 N ND1 . HIS C 1 276 ? -21.864 72.820 38.090  1.00 23.81 ? 594 HIS C ND1 1 
ATOM   7465 C CD2 . HIS C 1 276 ? -20.110 74.067 37.720  1.00 23.07 ? 594 HIS C CD2 1 
ATOM   7466 C CE1 . HIS C 1 276 ? -22.217 74.070 38.333  1.00 24.26 ? 594 HIS C CE1 1 
ATOM   7467 N NE2 . HIS C 1 276 ? -21.171 74.849 38.113  1.00 21.80 ? 594 HIS C NE2 1 
ATOM   7468 N N   . ALA C 1 277 ? -21.261 70.751 40.154  1.00 32.10 ? 595 ALA C N   1 
ATOM   7469 C CA  . ALA C 1 277 ? -22.442 70.248 40.874  1.00 32.86 ? 595 ALA C CA  1 
ATOM   7470 C C   . ALA C 1 277 ? -23.626 69.918 39.949  1.00 33.76 ? 595 ALA C C   1 
ATOM   7471 O O   . ALA C 1 277 ? -24.501 69.126 40.301  1.00 31.96 ? 595 ALA C O   1 
ATOM   7472 C CB  . ALA C 1 277 ? -22.868 71.226 41.928  1.00 32.35 ? 595 ALA C CB  1 
ATOM   7473 N N   . PHE C 1 278 ? -23.644 70.528 38.771  1.00 34.13 ? 596 PHE C N   1 
ATOM   7474 C CA  . PHE C 1 278 ? -24.723 70.322 37.841  1.00 36.17 ? 596 PHE C CA  1 
ATOM   7475 C C   . PHE C 1 278 ? -24.741 68.852 37.395  1.00 38.28 ? 596 PHE C C   1 
ATOM   7476 O O   . PHE C 1 278 ? -25.787 68.317 37.004  1.00 39.30 ? 596 PHE C O   1 
ATOM   7477 C CB  . PHE C 1 278 ? -24.534 71.284 36.668  1.00 36.75 ? 596 PHE C CB  1 
ATOM   7478 C CG  . PHE C 1 278 ? -25.604 71.204 35.603  1.00 38.22 ? 596 PHE C CG  1 
ATOM   7479 C CD1 . PHE C 1 278 ? -26.829 71.830 35.776  1.00 39.45 ? 596 PHE C CD1 1 
ATOM   7480 C CD2 . PHE C 1 278 ? -25.359 70.547 34.400  1.00 35.30 ? 596 PHE C CD2 1 
ATOM   7481 C CE1 . PHE C 1 278 ? -27.807 71.768 34.782  1.00 37.11 ? 596 PHE C CE1 1 
ATOM   7482 C CE2 . PHE C 1 278 ? -26.328 70.484 33.417  1.00 34.95 ? 596 PHE C CE2 1 
ATOM   7483 C CZ  . PHE C 1 278 ? -27.553 71.089 33.610  1.00 35.08 ? 596 PHE C CZ  1 
ATOM   7484 N N   . PHE C 1 279 ? -23.586 68.193 37.486  1.00 39.46 ? 597 PHE C N   1 
ATOM   7485 C CA  . PHE C 1 279 ? -23.439 66.796 37.033  1.00 39.88 ? 597 PHE C CA  1 
ATOM   7486 C C   . PHE C 1 279 ? -23.335 65.792 38.179  1.00 39.32 ? 597 PHE C C   1 
ATOM   7487 O O   . PHE C 1 279 ? -22.947 64.638 37.969  1.00 37.66 ? 597 PHE C O   1 
ATOM   7488 C CB  . PHE C 1 279 ? -22.187 66.641 36.175  1.00 40.13 ? 597 PHE C CB  1 
ATOM   7489 C CG  . PHE C 1 279 ? -22.217 67.433 34.921  1.00 41.65 ? 597 PHE C CG  1 
ATOM   7490 C CD1 . PHE C 1 279 ? -23.144 67.140 33.920  1.00 43.36 ? 597 PHE C CD1 1 
ATOM   7491 C CD2 . PHE C 1 279 ? -21.324 68.469 34.725  1.00 41.37 ? 597 PHE C CD2 1 
ATOM   7492 C CE1 . PHE C 1 279 ? -23.181 67.866 32.744  1.00 33.76 ? 597 PHE C CE1 1 
ATOM   7493 C CE2 . PHE C 1 279 ? -21.360 69.196 33.552  1.00 40.46 ? 597 PHE C CE2 1 
ATOM   7494 C CZ  . PHE C 1 279 ? -22.292 68.885 32.559  1.00 33.96 ? 597 PHE C CZ  1 
ATOM   7495 N N   . ARG C 1 280 ? -23.667 66.241 39.382  1.00 39.30 ? 598 ARG C N   1 
ATOM   7496 C CA  . ARG C 1 280 ? -23.447 65.443 40.579  1.00 39.83 ? 598 ARG C CA  1 
ATOM   7497 C C   . ARG C 1 280 ? -24.091 64.059 40.539  1.00 40.32 ? 598 ARG C C   1 
ATOM   7498 O O   . ARG C 1 280 ? -23.670 63.177 41.275  1.00 41.36 ? 598 ARG C O   1 
ATOM   7499 C CB  . ARG C 1 280 ? -23.899 66.196 41.828  1.00 39.03 ? 598 ARG C CB  1 
ATOM   7500 C CG  . ARG C 1 280 ? -25.393 66.228 42.001  1.00 38.55 ? 598 ARG C CG  1 
ATOM   7501 C CD  . ARG C 1 280 ? -25.791 67.475 42.737  1.00 41.45 ? 598 ARG C CD  1 
ATOM   7502 N NE  . ARG C 1 280 ? -27.197 67.793 42.566  1.00 39.47 ? 598 ARG C NE  1 
ATOM   7503 C CZ  . ARG C 1 280 ? -27.714 68.230 41.431  1.00 43.26 ? 598 ARG C CZ  1 
ATOM   7504 N NH1 . ARG C 1 280 ? -26.932 68.383 40.373  1.00 46.34 ? 598 ARG C NH1 1 
ATOM   7505 N NH2 . ARG C 1 280 ? -29.011 68.507 41.351  1.00 46.46 ? 598 ARG C NH2 1 
ATOM   7506 N N   . ARG C 1 281 ? -25.090 63.848 39.689  1.00 40.98 ? 599 ARG C N   1 
ATOM   7507 C CA  . ARG C 1 281 ? -25.707 62.520 39.604  1.00 41.68 ? 599 ARG C CA  1 
ATOM   7508 C C   . ARG C 1 281 ? -25.279 61.718 38.355  1.00 41.54 ? 599 ARG C C   1 
ATOM   7509 O O   . ARG C 1 281 ? -25.951 60.766 37.957  1.00 41.51 ? 599 ARG C O   1 
ATOM   7510 C CB  . ARG C 1 281 ? -27.235 62.622 39.708  1.00 41.71 ? 599 ARG C CB  1 
ATOM   7511 C CG  . ARG C 1 281 ? -27.701 63.635 40.731  1.00 45.15 ? 599 ARG C CG  1 
ATOM   7512 C CD  . ARG C 1 281 ? -29.197 63.937 40.621  1.00 53.18 ? 599 ARG C CD  1 
ATOM   7513 N NE  . ARG C 1 281 ? -30.020 62.985 41.360  1.00 60.63 ? 599 ARG C NE  1 
ATOM   7514 C CZ  . ARG C 1 281 ? -30.315 63.088 42.658  1.00 64.71 ? 599 ARG C CZ  1 
ATOM   7515 N NH1 . ARG C 1 281 ? -29.846 64.108 43.375  1.00 65.52 ? 599 ARG C NH1 1 
ATOM   7516 N NH2 . ARG C 1 281 ? -31.080 62.168 43.242  1.00 62.43 ? 599 ARG C NH2 1 
ATOM   7517 N N   . ILE C 1 282 ? -24.158 62.097 37.744  1.00 41.61 ? 600 ILE C N   1 
ATOM   7518 C CA  . ILE C 1 282 ? -23.653 61.381 36.566  1.00 41.71 ? 600 ILE C CA  1 
ATOM   7519 C C   . ILE C 1 282 ? -22.507 60.409 36.880  1.00 42.42 ? 600 ILE C C   1 
ATOM   7520 O O   . ILE C 1 282 ? -21.410 60.826 37.294  1.00 41.88 ? 600 ILE C O   1 
ATOM   7521 C CB  . ILE C 1 282 ? -23.156 62.346 35.432  1.00 41.49 ? 600 ILE C CB  1 
ATOM   7522 C CG1 . ILE C 1 282 ? -24.278 63.262 34.933  1.00 41.22 ? 600 ILE C CG1 1 
ATOM   7523 C CG2 . ILE C 1 282 ? -22.537 61.548 34.268  1.00 38.19 ? 600 ILE C CG2 1 
ATOM   7524 C CD1 . ILE C 1 282 ? -25.319 62.557 34.087  1.00 37.34 ? 600 ILE C CD1 1 
ATOM   7525 N N   . ASP C 1 283 ? -22.761 59.118 36.675  1.00 42.16 ? 601 ASP C N   1 
ATOM   7526 C CA  . ASP C 1 283 ? -21.671 58.168 36.557  1.00 41.30 ? 601 ASP C CA  1 
ATOM   7527 C C   . ASP C 1 283 ? -20.974 58.428 35.210  1.00 41.25 ? 601 ASP C C   1 
ATOM   7528 O O   . ASP C 1 283 ? -21.405 57.937 34.168  1.00 40.54 ? 601 ASP C O   1 
ATOM   7529 C CB  . ASP C 1 283 ? -22.196 56.734 36.655  1.00 40.74 ? 601 ASP C CB  1 
ATOM   7530 C CG  . ASP C 1 283 ? -21.084 55.713 36.746  1.00 40.51 ? 601 ASP C CG  1 
ATOM   7531 O OD1 . ASP C 1 283 ? -19.912 56.092 36.587  1.00 45.22 ? 601 ASP C OD1 1 
ATOM   7532 O OD2 . ASP C 1 283 ? -21.370 54.528 36.976  1.00 36.35 ? 601 ASP C OD2 1 
ATOM   7533 N N   . TRP C 1 284 ? -19.911 59.229 35.241  1.00 41.95 ? 602 TRP C N   1 
ATOM   7534 C CA  . TRP C 1 284 ? -19.179 59.606 34.021  1.00 42.25 ? 602 TRP C CA  1 
ATOM   7535 C C   . TRP C 1 284 ? -18.714 58.431 33.185  1.00 42.55 ? 602 TRP C C   1 
ATOM   7536 O O   . TRP C 1 284 ? -18.843 58.458 31.965  1.00 41.66 ? 602 TRP C O   1 
ATOM   7537 C CB  . TRP C 1 284 ? -17.995 60.531 34.330  1.00 41.84 ? 602 TRP C CB  1 
ATOM   7538 C CG  . TRP C 1 284 ? -18.457 61.908 34.583  1.00 40.46 ? 602 TRP C CG  1 
ATOM   7539 C CD1 . TRP C 1 284 ? -18.561 62.536 35.792  1.00 39.95 ? 602 TRP C CD1 1 
ATOM   7540 C CD2 . TRP C 1 284 ? -18.955 62.822 33.613  1.00 37.62 ? 602 TRP C CD2 1 
ATOM   7541 N NE1 . TRP C 1 284 ? -19.075 63.795 35.631  1.00 33.49 ? 602 TRP C NE1 1 
ATOM   7542 C CE2 . TRP C 1 284 ? -19.330 63.999 34.303  1.00 36.57 ? 602 TRP C CE2 1 
ATOM   7543 C CE3 . TRP C 1 284 ? -19.109 62.769 32.223  1.00 36.53 ? 602 TRP C CE3 1 
ATOM   7544 C CZ2 . TRP C 1 284 ? -19.849 65.118 33.651  1.00 36.35 ? 602 TRP C CZ2 1 
ATOM   7545 C CZ3 . TRP C 1 284 ? -19.627 63.884 31.567  1.00 38.36 ? 602 TRP C CZ3 1 
ATOM   7546 C CH2 . TRP C 1 284 ? -19.991 65.041 32.283  1.00 40.40 ? 602 TRP C CH2 1 
ATOM   7547 N N   . GLU C 1 285 ? -18.184 57.402 33.843  1.00 43.70 ? 603 GLU C N   1 
ATOM   7548 C CA  . GLU C 1 285 ? -17.635 56.237 33.137  1.00 44.97 ? 603 GLU C CA  1 
ATOM   7549 C C   . GLU C 1 285 ? -18.724 55.535 32.319  1.00 43.31 ? 603 GLU C C   1 
ATOM   7550 O O   . GLU C 1 285 ? -18.512 55.183 31.157  1.00 41.88 ? 603 GLU C O   1 
ATOM   7551 C CB  . GLU C 1 285 ? -16.982 55.249 34.120  1.00 46.55 ? 603 GLU C CB  1 
ATOM   7552 C CG  . GLU C 1 285 ? -16.557 55.862 35.479  1.00 53.37 ? 603 GLU C CG  1 
ATOM   7553 C CD  . GLU C 1 285 ? -16.214 54.804 36.548  1.00 61.19 ? 603 GLU C CD  1 
ATOM   7554 O OE1 . GLU C 1 285 ? -17.023 54.589 37.484  1.00 61.84 ? 603 GLU C OE1 1 
ATOM   7555 O OE2 . GLU C 1 285 ? -15.132 54.182 36.450  1.00 65.78 ? 603 GLU C OE2 1 
ATOM   7556 N N   . LYS C 1 286 ? -19.892 55.351 32.930  1.00 41.85 ? 604 LYS C N   1 
ATOM   7557 C CA  . LYS C 1 286 ? -20.987 54.676 32.260  1.00 41.24 ? 604 LYS C CA  1 
ATOM   7558 C C   . LYS C 1 286 ? -21.500 55.533 31.124  1.00 40.58 ? 604 LYS C C   1 
ATOM   7559 O O   . LYS C 1 286 ? -21.695 55.051 30.012  1.00 40.24 ? 604 LYS C O   1 
ATOM   7560 C CB  . LYS C 1 286 ? -22.117 54.339 33.236  1.00 41.40 ? 604 LYS C CB  1 
ATOM   7561 C CG  . LYS C 1 286 ? -21.731 53.329 34.281  1.00 43.74 ? 604 LYS C CG  1 
ATOM   7562 C CD  . LYS C 1 286 ? -22.941 52.750 34.991  1.00 51.73 ? 604 LYS C CD  1 
ATOM   7563 C CE  . LYS C 1 286 ? -23.133 51.275 34.641  1.00 56.10 ? 604 LYS C CE  1 
ATOM   7564 N NZ  . LYS C 1 286 ? -24.418 50.721 35.157  1.00 57.60 ? 604 LYS C NZ  1 
ATOM   7565 N N   . LEU C 1 287 ? -21.730 56.807 31.415  1.00 41.05 ? 605 LEU C N   1 
ATOM   7566 C CA  . LEU C 1 287 ? -22.112 57.762 30.388  1.00 40.21 ? 605 LEU C CA  1 
ATOM   7567 C C   . LEU C 1 287 ? -21.203 57.579 29.196  1.00 39.85 ? 605 LEU C C   1 
ATOM   7568 O O   . LEU C 1 287 ? -21.647 57.229 28.110  1.00 38.03 ? 605 LEU C O   1 
ATOM   7569 C CB  . LEU C 1 287 ? -21.937 59.181 30.899  1.00 39.69 ? 605 LEU C CB  1 
ATOM   7570 C CG  . LEU C 1 287 ? -22.568 60.200 29.963  1.00 38.91 ? 605 LEU C CG  1 
ATOM   7571 C CD1 . LEU C 1 287 ? -23.961 60.514 30.457  1.00 37.68 ? 605 LEU C CD1 1 
ATOM   7572 C CD2 . LEU C 1 287 ? -21.736 61.454 29.866  1.00 35.24 ? 605 LEU C CD2 1 
ATOM   7573 N N   . GLU C 1 288 ? -19.915 57.805 29.427  1.00 41.77 ? 606 GLU C N   1 
ATOM   7574 C CA  . GLU C 1 288 ? -18.894 57.671 28.391  1.00 43.95 ? 606 GLU C CA  1 
ATOM   7575 C C   . GLU C 1 288 ? -19.004 56.379 27.601  1.00 45.68 ? 606 GLU C C   1 
ATOM   7576 O O   . GLU C 1 288 ? -18.501 56.283 26.498  1.00 46.06 ? 606 GLU C O   1 
ATOM   7577 C CB  . GLU C 1 288 ? -17.504 57.721 29.000  1.00 43.48 ? 606 GLU C CB  1 
ATOM   7578 C CG  . GLU C 1 288 ? -17.119 59.024 29.625  1.00 45.92 ? 606 GLU C CG  1 
ATOM   7579 C CD  . GLU C 1 288 ? -15.630 59.088 29.904  1.00 49.23 ? 606 GLU C CD  1 
ATOM   7580 O OE1 . GLU C 1 288 ? -15.210 58.770 31.042  1.00 50.84 ? 606 GLU C OE1 1 
ATOM   7581 O OE2 . GLU C 1 288 ? -14.878 59.446 28.973  1.00 52.35 ? 606 GLU C OE2 1 
ATOM   7582 N N   . ASN C 1 289 ? -19.625 55.366 28.178  1.00 48.71 ? 607 ASN C N   1 
ATOM   7583 C CA  . ASN C 1 289 ? -19.741 54.093 27.492  1.00 50.81 ? 607 ASN C CA  1 
ATOM   7584 C C   . ASN C 1 289 ? -21.129 53.944 26.937  1.00 52.18 ? 607 ASN C C   1 
ATOM   7585 O O   . ASN C 1 289 ? -21.434 52.957 26.281  1.00 53.58 ? 607 ASN C O   1 
ATOM   7586 C CB  . ASN C 1 289 ? -19.454 52.925 28.439  1.00 51.15 ? 607 ASN C CB  1 
ATOM   7587 C CG  . ASN C 1 289 ? -17.976 52.729 28.700  1.00 50.58 ? 607 ASN C CG  1 
ATOM   7588 O OD1 . ASN C 1 289 ? -17.348 53.505 29.427  1.00 45.92 ? 607 ASN C OD1 1 
ATOM   7589 N ND2 . ASN C 1 289 ? -17.414 51.671 28.121  1.00 51.69 ? 607 ASN C ND2 1 
ATOM   7590 N N   . ARG C 1 290 ? -21.977 54.926 27.211  1.00 53.48 ? 608 ARG C N   1 
ATOM   7591 C CA  . ARG C 1 290 ? -23.360 54.860 26.771  1.00 54.73 ? 608 ARG C CA  1 
ATOM   7592 C C   . ARG C 1 290 ? -24.075 53.727 27.485  1.00 54.81 ? 608 ARG C C   1 
ATOM   7593 O O   . ARG C 1 290 ? -24.700 52.869 26.847  1.00 55.16 ? 608 ARG C O   1 
ATOM   7594 C CB  . ARG C 1 290 ? -23.445 54.659 25.253  1.00 54.63 ? 608 ARG C CB  1 
ATOM   7595 C CG  . ARG C 1 290 ? -23.323 55.931 24.448  1.00 56.01 ? 608 ARG C CG  1 
ATOM   7596 C CD  . ARG C 1 290 ? -23.250 55.623 22.980  1.00 57.11 ? 608 ARG C CD  1 
ATOM   7597 N NE  . ARG C 1 290 ? -24.398 54.840 22.561  1.00 57.27 ? 608 ARG C NE  1 
ATOM   7598 C CZ  . ARG C 1 290 ? -24.733 54.642 21.299  1.00 57.43 ? 608 ARG C CZ  1 
ATOM   7599 N NH1 . ARG C 1 290 ? -24.001 55.179 20.327  1.00 61.09 ? 608 ARG C NH1 1 
ATOM   7600 N NH2 . ARG C 1 290 ? -25.807 53.919 21.017  1.00 57.63 ? 608 ARG C NH2 1 
ATOM   7601 N N   . GLU C 1 291 ? -23.969 53.711 28.808  1.00 54.40 ? 609 GLU C N   1 
ATOM   7602 C CA  . GLU C 1 291 ? -24.710 52.733 29.593  1.00 53.73 ? 609 GLU C CA  1 
ATOM   7603 C C   . GLU C 1 291 ? -25.879 53.410 30.293  1.00 52.21 ? 609 GLU C C   1 
ATOM   7604 O O   . GLU C 1 291 ? -26.941 52.817 30.424  1.00 53.98 ? 609 GLU C O   1 
ATOM   7605 C CB  . GLU C 1 291 ? -23.800 51.981 30.570  1.00 54.01 ? 609 GLU C CB  1 
ATOM   7606 C CG  . GLU C 1 291 ? -23.033 50.838 29.916  1.00 57.75 ? 609 GLU C CG  1 
ATOM   7607 C CD  . GLU C 1 291 ? -21.734 50.496 30.637  1.00 64.54 ? 609 GLU C CD  1 
ATOM   7608 O OE1 . GLU C 1 291 ? -21.700 50.500 31.891  1.00 68.75 ? 609 GLU C OE1 1 
ATOM   7609 O OE2 . GLU C 1 291 ? -20.737 50.211 29.942  1.00 65.01 ? 609 GLU C OE2 1 
ATOM   7610 N N   . ILE C 1 292 ? -25.707 54.656 30.722  1.00 49.65 ? 610 ILE C N   1 
ATOM   7611 C CA  . ILE C 1 292 ? -26.845 55.401 31.244  1.00 46.55 ? 610 ILE C CA  1 
ATOM   7612 C C   . ILE C 1 292 ? -27.944 55.382 30.187  1.00 44.96 ? 610 ILE C C   1 
ATOM   7613 O O   . ILE C 1 292 ? -27.666 55.244 29.007  1.00 44.20 ? 610 ILE C O   1 
ATOM   7614 C CB  . ILE C 1 292 ? -26.471 56.828 31.640  1.00 46.09 ? 610 ILE C CB  1 
ATOM   7615 C CG1 . ILE C 1 292 ? -25.291 56.789 32.603  1.00 45.47 ? 610 ILE C CG1 1 
ATOM   7616 C CG2 . ILE C 1 292 ? -27.655 57.539 32.280  1.00 44.18 ? 610 ILE C CG2 1 
ATOM   7617 C CD1 . ILE C 1 292 ? -25.397 57.811 33.720  1.00 49.82 ? 610 ILE C CD1 1 
ATOM   7618 N N   . GLN C 1 293 ? -29.191 55.486 30.622  1.00 44.22 ? 611 GLN C N   1 
ATOM   7619 C CA  . GLN C 1 293 ? -30.322 55.329 29.737  1.00 43.58 ? 611 GLN C CA  1 
ATOM   7620 C C   . GLN C 1 293 ? -30.879 56.672 29.336  1.00 42.00 ? 611 GLN C C   1 
ATOM   7621 O O   . GLN C 1 293 ? -31.189 57.503 30.188  1.00 41.41 ? 611 GLN C O   1 
ATOM   7622 C CB  . GLN C 1 293 ? -31.409 54.539 30.433  1.00 44.67 ? 611 GLN C CB  1 
ATOM   7623 C CG  . GLN C 1 293 ? -32.631 54.320 29.585  1.00 49.41 ? 611 GLN C CG  1 
ATOM   7624 C CD  . GLN C 1 293 ? -33.607 53.416 30.276  1.00 53.82 ? 611 GLN C CD  1 
ATOM   7625 O OE1 . GLN C 1 293 ? -33.620 53.330 31.505  1.00 55.16 ? 611 GLN C OE1 1 
ATOM   7626 N NE2 . GLN C 1 293 ? -34.427 52.720 29.498  1.00 56.58 ? 611 GLN C NE2 1 
ATOM   7627 N N   . PRO C 1 294 ? -31.014 56.888 28.027  1.00 41.15 ? 612 PRO C N   1 
ATOM   7628 C CA  . PRO C 1 294 ? -31.462 58.162 27.491  1.00 40.89 ? 612 PRO C CA  1 
ATOM   7629 C C   . PRO C 1 294 ? -32.795 58.541 28.112  1.00 40.80 ? 612 PRO C C   1 
ATOM   7630 O O   . PRO C 1 294 ? -33.601 57.656 28.373  1.00 41.84 ? 612 PRO C O   1 
ATOM   7631 C CB  . PRO C 1 294 ? -31.636 57.864 26.001  1.00 40.31 ? 612 PRO C CB  1 
ATOM   7632 C CG  . PRO C 1 294 ? -30.684 56.771 25.731  1.00 40.32 ? 612 PRO C CG  1 
ATOM   7633 C CD  . PRO C 1 294 ? -30.718 55.915 26.965  1.00 41.18 ? 612 PRO C CD  1 
ATOM   7634 N N   . PRO C 1 295 ? -33.019 59.843 28.363  1.00 40.17 ? 613 PRO C N   1 
ATOM   7635 C CA  . PRO C 1 295 ? -34.263 60.334 28.926  1.00 40.07 ? 613 PRO C CA  1 
ATOM   7636 C C   . PRO C 1 295 ? -35.463 59.864 28.145  1.00 40.40 ? 613 PRO C C   1 
ATOM   7637 O O   . PRO C 1 295 ? -36.518 59.657 28.731  1.00 41.16 ? 613 PRO C O   1 
ATOM   7638 C CB  . PRO C 1 295 ? -34.131 61.856 28.810  1.00 39.66 ? 613 PRO C CB  1 
ATOM   7639 C CG  . PRO C 1 295 ? -32.961 62.093 27.924  1.00 37.98 ? 613 PRO C CG  1 
ATOM   7640 C CD  . PRO C 1 295 ? -32.063 60.941 28.180  1.00 40.11 ? 613 PRO C CD  1 
ATOM   7641 N N   . PHE C 1 296 ? -35.312 59.712 26.833  1.00 41.39 ? 614 PHE C N   1 
ATOM   7642 C CA  . PHE C 1 296 ? -36.378 59.138 26.009  1.00 42.01 ? 614 PHE C CA  1 
ATOM   7643 C C   . PHE C 1 296 ? -35.897 58.600 24.658  1.00 42.69 ? 614 PHE C C   1 
ATOM   7644 O O   . PHE C 1 296 ? -34.920 59.086 24.073  1.00 43.07 ? 614 PHE C O   1 
ATOM   7645 C CB  . PHE C 1 296 ? -37.537 60.124 25.816  1.00 41.73 ? 614 PHE C CB  1 
ATOM   7646 C CG  . PHE C 1 296 ? -37.353 61.049 24.666  1.00 43.74 ? 614 PHE C CG  1 
ATOM   7647 C CD1 . PHE C 1 296 ? -37.742 60.671 23.387  1.00 45.60 ? 614 PHE C CD1 1 
ATOM   7648 C CD2 . PHE C 1 296 ? -36.786 62.291 24.850  1.00 46.75 ? 614 PHE C CD2 1 
ATOM   7649 C CE1 . PHE C 1 296 ? -37.577 61.516 22.299  1.00 44.27 ? 614 PHE C CE1 1 
ATOM   7650 C CE2 . PHE C 1 296 ? -36.613 63.141 23.770  1.00 51.44 ? 614 PHE C CE2 1 
ATOM   7651 C CZ  . PHE C 1 296 ? -37.015 62.745 22.482  1.00 47.11 ? 614 PHE C CZ  1 
ATOM   7652 N N   . LYS C 1 297 ? -36.607 57.586 24.178  1.00 43.43 ? 615 LYS C N   1 
ATOM   7653 C CA  . LYS C 1 297 ? -36.373 56.999 22.873  1.00 43.85 ? 615 LYS C CA  1 
ATOM   7654 C C   . LYS C 1 297 ? -37.204 57.776 21.886  1.00 44.45 ? 615 LYS C C   1 
ATOM   7655 O O   . LYS C 1 297 ? -38.418 57.831 22.018  1.00 44.43 ? 615 LYS C O   1 
ATOM   7656 C CB  . LYS C 1 297 ? -36.832 55.544 22.870  1.00 43.65 ? 615 LYS C CB  1 
ATOM   7657 C CG  . LYS C 1 297 ? -36.173 54.666 21.828  1.00 43.21 ? 615 LYS C CG  1 
ATOM   7658 C CD  . LYS C 1 297 ? -36.201 53.207 22.263  1.00 43.97 ? 615 LYS C CD  1 
ATOM   7659 C CE  . LYS C 1 297 ? -35.247 52.380 21.426  1.00 46.57 ? 615 LYS C CE  1 
ATOM   7660 N NZ  . LYS C 1 297 ? -35.532 52.519 19.964  1.00 44.71 ? 615 LYS C NZ  1 
ATOM   7661 N N   . PRO C 1 298 ? -36.559 58.390 20.891  1.00 45.22 ? 616 PRO C N   1 
ATOM   7662 C CA  . PRO C 1 298 ? -37.351 59.179 19.969  1.00 45.41 ? 616 PRO C CA  1 
ATOM   7663 C C   . PRO C 1 298 ? -38.108 58.250 19.052  1.00 46.80 ? 616 PRO C C   1 
ATOM   7664 O O   . PRO C 1 298 ? -37.713 57.097 18.886  1.00 45.71 ? 616 PRO C O   1 
ATOM   7665 C CB  . PRO C 1 298 ? -36.305 59.962 19.179  1.00 45.27 ? 616 PRO C CB  1 
ATOM   7666 C CG  . PRO C 1 298 ? -34.956 59.463 19.631  1.00 45.82 ? 616 PRO C CG  1 
ATOM   7667 C CD  . PRO C 1 298 ? -35.165 58.242 20.454  1.00 44.72 ? 616 PRO C CD  1 
ATOM   7668 N N   . LYS C 1 299 ? -39.198 58.742 18.479  1.00 49.36 ? 617 LYS C N   1 
ATOM   7669 C CA  . LYS C 1 299 ? -39.912 58.002 17.447  1.00 52.09 ? 617 LYS C CA  1 
ATOM   7670 C C   . LYS C 1 299 ? -39.087 58.163 16.197  1.00 52.85 ? 617 LYS C C   1 
ATOM   7671 O O   . LYS C 1 299 ? -38.582 59.254 15.924  1.00 52.84 ? 617 LYS C O   1 
ATOM   7672 C CB  . LYS C 1 299 ? -41.294 58.604 17.201  1.00 52.98 ? 617 LYS C CB  1 
ATOM   7673 C CG  . LYS C 1 299 ? -41.916 59.288 18.413  1.00 55.94 ? 617 LYS C CG  1 
ATOM   7674 C CD  . LYS C 1 299 ? -43.061 60.204 18.002  1.00 58.30 ? 617 LYS C CD  1 
ATOM   7675 C CE  . LYS C 1 299 ? -44.143 59.437 17.240  1.00 59.93 ? 617 LYS C CE  1 
ATOM   7676 N NZ  . LYS C 1 299 ? -44.698 58.292 18.020  1.00 56.69 ? 617 LYS C NZ  1 
ATOM   7677 N N   . VAL C 1 300 ? -38.946 57.091 15.429  1.00 54.23 ? 618 VAL C N   1 
ATOM   7678 C CA  . VAL C 1 300 ? -38.018 57.117 14.296  1.00 55.55 ? 618 VAL C CA  1 
ATOM   7679 C C   . VAL C 1 300 ? -38.545 57.906 13.084  1.00 55.70 ? 618 VAL C C   1 
ATOM   7680 O O   . VAL C 1 300 ? -39.331 57.394 12.280  1.00 55.79 ? 618 VAL C O   1 
ATOM   7681 C CB  . VAL C 1 300 ? -37.583 55.697 13.886  1.00 56.32 ? 618 VAL C CB  1 
ATOM   7682 C CG1 . VAL C 1 300 ? -38.802 54.853 13.396  1.00 56.30 ? 618 VAL C CG1 1 
ATOM   7683 C CG2 . VAL C 1 300 ? -36.476 55.779 12.851  1.00 53.87 ? 618 VAL C CG2 1 
ATOM   7684 N N   . PHE C 1 308 ? -45.546 55.421 -3.342  1.00 49.40 ? 626 PHE C N   1 
ATOM   7685 C CA  . PHE C 1 308 ? -46.689 55.959 -2.628  1.00 50.17 ? 626 PHE C CA  1 
ATOM   7686 C C   . PHE C 1 308 ? -47.809 56.414 -3.578  1.00 50.07 ? 626 PHE C C   1 
ATOM   7687 O O   . PHE C 1 308 ? -48.830 55.730 -3.677  1.00 51.69 ? 626 PHE C O   1 
ATOM   7688 C CB  . PHE C 1 308 ? -46.265 57.095 -1.680  1.00 50.48 ? 626 PHE C CB  1 
ATOM   7689 N N   . ASP C 1 309 ? -47.591 57.522 -4.302  1.00 47.77 ? 627 ASP C N   1 
ATOM   7690 C CA  . ASP C 1 309 ? -48.670 58.308 -4.971  1.00 45.16 ? 627 ASP C CA  1 
ATOM   7691 C C   . ASP C 1 309 ? -48.740 58.306 -6.551  1.00 43.49 ? 627 ASP C C   1 
ATOM   7692 O O   . ASP C 1 309 ? -47.778 58.632 -7.240  1.00 42.79 ? 627 ASP C O   1 
ATOM   7693 C CB  . ASP C 1 309 ? -48.619 59.732 -4.382  1.00 44.96 ? 627 ASP C CB  1 
ATOM   7694 C CG  . ASP C 1 309 ? -49.302 60.769 -5.248  1.00 43.84 ? 627 ASP C CG  1 
ATOM   7695 O OD1 . ASP C 1 309 ? -49.867 60.402 -6.296  1.00 44.35 ? 627 ASP C OD1 1 
ATOM   7696 O OD2 . ASP C 1 309 ? -49.280 61.960 -4.866  1.00 40.02 ? 627 ASP C OD2 1 
ATOM   7697 N N   . LYS C 1 310 ? -49.895 57.972 -7.122  1.00 41.68 ? 628 LYS C N   1 
ATOM   7698 C CA  . LYS C 1 310 ? -49.988 57.724 -8.581  1.00 40.44 ? 628 LYS C CA  1 
ATOM   7699 C C   . LYS C 1 310 ? -49.789 58.900 -9.568  1.00 39.38 ? 628 LYS C C   1 
ATOM   7700 O O   . LYS C 1 310 ? -49.461 58.692 -10.750 1.00 38.72 ? 628 LYS C O   1 
ATOM   7701 C CB  . LYS C 1 310 ? -51.300 57.011 -8.910  1.00 39.02 ? 628 LYS C CB  1 
ATOM   7702 C CG  . LYS C 1 310 ? -51.157 55.512 -9.003  1.00 41.46 ? 628 LYS C CG  1 
ATOM   7703 C CD  . LYS C 1 310 ? -52.265 54.889 -9.848  1.00 45.53 ? 628 LYS C CD  1 
ATOM   7704 C CE  . LYS C 1 310 ? -53.618 55.092 -9.196  1.00 48.07 ? 628 LYS C CE  1 
ATOM   7705 N NZ  . LYS C 1 310 ? -54.730 54.841 -10.147 1.00 50.43 ? 628 LYS C NZ  1 
ATOM   7706 N N   . PHE C 1 311 ? -50.000 60.122 -9.082  1.00 38.22 ? 629 PHE C N   1 
ATOM   7707 C CA  . PHE C 1 311 ? -50.116 61.316 -9.933  1.00 36.05 ? 629 PHE C CA  1 
ATOM   7708 C C   . PHE C 1 311 ? -48.940 62.281 -9.782  1.00 35.42 ? 629 PHE C C   1 
ATOM   7709 O O   . PHE C 1 311 ? -48.758 63.184 -10.598 1.00 35.64 ? 629 PHE C O   1 
ATOM   7710 C CB  . PHE C 1 311 ? -51.436 62.062 -9.637  1.00 34.68 ? 629 PHE C CB  1 
ATOM   7711 C CG  . PHE C 1 311 ? -52.651 61.188 -9.673  1.00 29.16 ? 629 PHE C CG  1 
ATOM   7712 C CD1 . PHE C 1 311 ? -53.127 60.675 -10.879 1.00 27.07 ? 629 PHE C CD1 1 
ATOM   7713 C CD2 . PHE C 1 311 ? -53.330 60.881 -8.507  1.00 24.58 ? 629 PHE C CD2 1 
ATOM   7714 C CE1 . PHE C 1 311 ? -54.266 59.858 -10.905 1.00 24.31 ? 629 PHE C CE1 1 
ATOM   7715 C CE2 . PHE C 1 311 ? -54.468 60.068 -8.531  1.00 22.04 ? 629 PHE C CE2 1 
ATOM   7716 C CZ  . PHE C 1 311 ? -54.930 59.561 -9.726  1.00 20.47 ? 629 PHE C CZ  1 
ATOM   7717 N N   . PHE C 1 312 ? -48.163 62.089 -8.724  1.00 35.55 ? 630 PHE C N   1 
ATOM   7718 C CA  . PHE C 1 312 ? -46.983 62.892 -8.460  1.00 36.54 ? 630 PHE C CA  1 
ATOM   7719 C C   . PHE C 1 312 ? -45.830 62.045 -7.940  1.00 39.14 ? 630 PHE C C   1 
ATOM   7720 O O   . PHE C 1 312 ? -46.038 61.046 -7.246  1.00 40.37 ? 630 PHE C O   1 
ATOM   7721 C CB  . PHE C 1 312 ? -47.291 63.977 -7.447  1.00 34.96 ? 630 PHE C CB  1 
ATOM   7722 C CG  . PHE C 1 312 ? -46.087 64.712 -6.982  1.00 35.14 ? 630 PHE C CG  1 
ATOM   7723 C CD1 . PHE C 1 312 ? -45.411 65.580 -7.847  1.00 36.78 ? 630 PHE C CD1 1 
ATOM   7724 C CD2 . PHE C 1 312 ? -45.610 64.545 -5.675  1.00 35.49 ? 630 PHE C CD2 1 
ATOM   7725 C CE1 . PHE C 1 312 ? -44.271 66.277 -7.414  1.00 34.14 ? 630 PHE C CE1 1 
ATOM   7726 C CE2 . PHE C 1 312 ? -44.475 65.239 -5.227  1.00 32.68 ? 630 PHE C CE2 1 
ATOM   7727 C CZ  . PHE C 1 312 ? -43.804 66.101 -6.098  1.00 32.85 ? 630 PHE C CZ  1 
ATOM   7728 N N   . THR C 1 313 ? -44.611 62.461 -8.275  1.00 41.61 ? 631 THR C N   1 
ATOM   7729 C CA  . THR C 1 313 ? -43.388 61.811 -7.784  1.00 42.27 ? 631 THR C CA  1 
ATOM   7730 C C   . THR C 1 313 ? -42.245 62.819 -7.619  1.00 43.57 ? 631 THR C C   1 
ATOM   7731 O O   . THR C 1 313 ? -42.134 63.785 -8.379  1.00 44.06 ? 631 THR C O   1 
ATOM   7732 C CB  . THR C 1 313 ? -42.932 60.663 -8.707  1.00 41.59 ? 631 THR C CB  1 
ATOM   7733 O OG1 . THR C 1 313 ? -41.688 60.155 -8.235  1.00 40.76 ? 631 THR C OG1 1 
ATOM   7734 C CG2 . THR C 1 313 ? -42.738 61.149 -10.121 1.00 39.11 ? 631 THR C CG2 1 
ATOM   7735 N N   . ARG C 1 314 ? -41.404 62.601 -6.617  1.00 44.83 ? 632 ARG C N   1 
ATOM   7736 C CA  . ARG C 1 314 ? -40.237 63.455 -6.422  1.00 46.27 ? 632 ARG C CA  1 
ATOM   7737 C C   . ARG C 1 314 ? -39.162 63.184 -7.478  1.00 45.35 ? 632 ARG C C   1 
ATOM   7738 O O   . ARG C 1 314 ? -38.486 64.108 -7.953  1.00 43.32 ? 632 ARG C O   1 
ATOM   7739 C CB  . ARG C 1 314 ? -39.636 63.232 -5.033  1.00 48.16 ? 632 ARG C CB  1 
ATOM   7740 C CG  . ARG C 1 314 ? -40.429 63.820 -3.899  1.00 51.85 ? 632 ARG C CG  1 
ATOM   7741 C CD  . ARG C 1 314 ? -39.486 64.297 -2.811  1.00 59.77 ? 632 ARG C CD  1 
ATOM   7742 N NE  . ARG C 1 314 ? -40.187 65.031 -1.755  1.00 65.83 ? 632 ARG C NE  1 
ATOM   7743 C CZ  . ARG C 1 314 ? -40.791 66.209 -1.918  1.00 67.02 ? 632 ARG C CZ  1 
ATOM   7744 N NH1 . ARG C 1 314 ? -40.808 66.807 -3.105  1.00 68.00 ? 632 ARG C NH1 1 
ATOM   7745 N NH2 . ARG C 1 314 ? -41.393 66.783 -0.884  1.00 66.22 ? 632 ARG C NH2 1 
ATOM   7746 N N   . GLY C 1 315 ? -39.011 61.906 -7.825  1.00 44.53 ? 633 GLY C N   1 
ATOM   7747 C CA  . GLY C 1 315 ? -37.982 61.476 -8.750  1.00 44.46 ? 633 GLY C CA  1 
ATOM   7748 C C   . GLY C 1 315 ? -36.737 60.941 -8.064  1.00 45.23 ? 633 GLY C C   1 
ATOM   7749 O O   . GLY C 1 315 ? -36.373 61.361 -6.961  1.00 44.48 ? 633 GLY C O   1 
ATOM   7750 N N   . GLN C 1 316 ? -36.080 60.000 -8.724  1.00 46.25 ? 634 GLN C N   1 
ATOM   7751 C CA  . GLN C 1 316 ? -34.788 59.521 -8.281  1.00 48.18 ? 634 GLN C CA  1 
ATOM   7752 C C   . GLN C 1 316 ? -33.750 60.666 -8.193  1.00 48.26 ? 634 GLN C C   1 
ATOM   7753 O O   . GLN C 1 316 ? -33.638 61.488 -9.106  1.00 48.25 ? 634 GLN C O   1 
ATOM   7754 C CB  . GLN C 1 316 ? -34.299 58.440 -9.243  1.00 48.66 ? 634 GLN C CB  1 
ATOM   7755 C CG  . GLN C 1 316 ? -32.922 57.861 -8.897  1.00 54.58 ? 634 GLN C CG  1 
ATOM   7756 C CD  . GLN C 1 316 ? -32.957 56.996 -7.648  1.00 57.38 ? 634 GLN C CD  1 
ATOM   7757 O OE1 . GLN C 1 316 ? -33.996 56.880 -6.995  1.00 59.94 ? 634 GLN C OE1 1 
ATOM   7758 N NE2 . GLN C 1 316 ? -31.824 56.388 -7.310  1.00 55.28 ? 634 GLN C NE2 1 
ATOM   7759 N N   . PRO C 1 317 ? -32.988 60.730 -7.084  1.00 48.02 ? 635 PRO C N   1 
ATOM   7760 C CA  . PRO C 1 317 ? -31.862 61.658 -7.122  1.00 46.82 ? 635 PRO C CA  1 
ATOM   7761 C C   . PRO C 1 317 ? -30.746 61.097 -8.012  1.00 46.61 ? 635 PRO C C   1 
ATOM   7762 O O   . PRO C 1 317 ? -30.297 59.967 -7.810  1.00 47.23 ? 635 PRO C O   1 
ATOM   7763 C CB  . PRO C 1 317 ? -31.405 61.733 -5.656  1.00 45.82 ? 635 PRO C CB  1 
ATOM   7764 C CG  . PRO C 1 317 ? -32.298 60.809 -4.874  1.00 47.07 ? 635 PRO C CG  1 
ATOM   7765 C CD  . PRO C 1 317 ? -33.044 59.952 -5.830  1.00 47.43 ? 635 PRO C CD  1 
ATOM   7766 N N   . VAL C 1 318 ? -30.322 61.859 -9.008  1.00 45.82 ? 636 VAL C N   1 
ATOM   7767 C CA  . VAL C 1 318 ? -29.218 61.414 -9.843  1.00 46.64 ? 636 VAL C CA  1 
ATOM   7768 C C   . VAL C 1 318 ? -28.088 62.446 -9.883  1.00 48.35 ? 636 VAL C C   1 
ATOM   7769 O O   . VAL C 1 318 ? -28.230 63.584 -9.393  1.00 47.32 ? 636 VAL C O   1 
ATOM   7770 C CB  . VAL C 1 318 ? -29.653 61.067 -11.290 1.00 45.59 ? 636 VAL C CB  1 
ATOM   7771 C CG1 . VAL C 1 318 ? -30.801 60.079 -11.294 1.00 44.71 ? 636 VAL C CG1 1 
ATOM   7772 C CG2 . VAL C 1 318 ? -30.023 62.316 -12.039 1.00 46.51 ? 636 VAL C CG2 1 
ATOM   7773 N N   . LEU C 1 319 ? -26.963 62.025 -10.464 1.00 49.60 ? 637 LEU C N   1 
ATOM   7774 C CA  . LEU C 1 319 ? -25.791 62.882 -10.612 1.00 50.56 ? 637 LEU C CA  1 
ATOM   7775 C C   . LEU C 1 319 ? -25.605 63.306 -12.074 1.00 50.84 ? 637 LEU C C   1 
ATOM   7776 O O   . LEU C 1 319 ? -25.585 62.467 -12.993 1.00 49.70 ? 637 LEU C O   1 
ATOM   7777 C CB  . LEU C 1 319 ? -24.533 62.173 -10.068 1.00 50.00 ? 637 LEU C CB  1 
ATOM   7778 C CG  . LEU C 1 319 ? -24.155 62.367 -8.586  1.00 51.07 ? 637 LEU C CG  1 
ATOM   7779 C CD1 . LEU C 1 319 ? -25.331 62.737 -7.674  1.00 50.84 ? 637 LEU C CD1 1 
ATOM   7780 C CD2 . LEU C 1 319 ? -23.474 61.148 -8.049  1.00 50.59 ? 637 LEU C CD2 1 
HETATM 7781 N N   . TPO C 1 320 ? -25.481 64.614 -12.283 1.00 51.23 ? 638 TPO C N   1 
HETATM 7782 C CA  . TPO C 1 320 ? -25.096 65.130 -13.593 1.00 52.67 ? 638 TPO C CA  1 
HETATM 7783 C CB  . TPO C 1 320 ? -24.975 66.642 -13.611 1.00 53.40 ? 638 TPO C CB  1 
HETATM 7784 C CG2 . TPO C 1 320 ? -25.050 67.078 -15.064 1.00 52.61 ? 638 TPO C CG2 1 
HETATM 7785 O OG1 . TPO C 1 320 ? -26.072 67.213 -12.913 1.00 61.25 ? 638 TPO C OG1 1 
HETATM 7786 P P   . TPO C 1 320 ? -25.999 67.824 -11.415 1.00 74.64 ? 638 TPO C P   1 
HETATM 7787 O O1P . TPO C 1 320 ? -25.914 66.645 -10.446 1.00 69.36 ? 638 TPO C O1P 1 
HETATM 7788 O O2P . TPO C 1 320 ? -24.730 68.656 -11.406 1.00 75.07 ? 638 TPO C O2P 1 
HETATM 7789 O O3P . TPO C 1 320 ? -27.291 68.634 -11.414 1.00 69.12 ? 638 TPO C O3P 1 
HETATM 7790 C C   . TPO C 1 320 ? -23.764 64.566 -13.982 1.00 51.30 ? 638 TPO C C   1 
HETATM 7791 O O   . TPO C 1 320 ? -22.862 64.492 -13.151 1.00 50.19 ? 638 TPO C O   1 
ATOM   7792 N N   . PRO C 1 321 ? -23.622 64.144 -15.253 1.00 51.01 ? 639 PRO C N   1 
ATOM   7793 C CA  . PRO C 1 321 ? -22.341 63.574 -15.670 1.00 49.42 ? 639 PRO C CA  1 
ATOM   7794 C C   . PRO C 1 321 ? -21.322 64.677 -15.588 1.00 47.04 ? 639 PRO C C   1 
ATOM   7795 O O   . PRO C 1 321 ? -21.711 65.842 -15.579 1.00 45.17 ? 639 PRO C O   1 
ATOM   7796 C CB  . PRO C 1 321 ? -22.577 63.162 -17.133 1.00 49.74 ? 639 PRO C CB  1 
ATOM   7797 C CG  . PRO C 1 321 ? -24.077 63.196 -17.324 1.00 50.74 ? 639 PRO C CG  1 
ATOM   7798 C CD  . PRO C 1 321 ? -24.569 64.260 -16.377 1.00 51.18 ? 639 PRO C CD  1 
ATOM   7799 N N   . PRO C 1 322 ? -20.027 64.321 -15.525 1.00 46.50 ? 640 PRO C N   1 
ATOM   7800 C CA  . PRO C 1 322 ? -19.002 65.340 -15.294 1.00 44.81 ? 640 PRO C CA  1 
ATOM   7801 C C   . PRO C 1 322 ? -18.839 66.241 -16.525 1.00 42.22 ? 640 PRO C C   1 
ATOM   7802 O O   . PRO C 1 322 ? -18.942 65.760 -17.643 1.00 41.56 ? 640 PRO C O   1 
ATOM   7803 C CB  . PRO C 1 322 ? -17.726 64.517 -15.019 1.00 45.87 ? 640 PRO C CB  1 
ATOM   7804 C CG  . PRO C 1 322 ? -17.998 63.094 -15.528 1.00 44.16 ? 640 PRO C CG  1 
ATOM   7805 C CD  . PRO C 1 322 ? -19.454 63.024 -15.951 1.00 47.97 ? 640 PRO C CD  1 
ATOM   7806 N N   . ASP C 1 323 ? -18.632 67.538 -16.312 1.00 39.69 ? 641 ASP C N   1 
ATOM   7807 C CA  . ASP C 1 323 ? -18.347 68.461 -17.400 1.00 37.51 ? 641 ASP C CA  1 
ATOM   7808 C C   . ASP C 1 323 ? -16.842 68.405 -17.730 1.00 36.47 ? 641 ASP C C   1 
ATOM   7809 O O   . ASP C 1 323 ? -15.993 68.901 -16.978 1.00 37.80 ? 641 ASP C O   1 
ATOM   7810 C CB  . ASP C 1 323 ? -18.766 69.861 -17.002 1.00 37.52 ? 641 ASP C CB  1 
ATOM   7811 C CG  . ASP C 1 323 ? -18.328 70.899 -18.004 1.00 45.61 ? 641 ASP C CG  1 
ATOM   7812 O OD1 . ASP C 1 323 ? -17.773 70.507 -19.061 1.00 51.77 ? 641 ASP C OD1 1 
ATOM   7813 O OD2 . ASP C 1 323 ? -18.535 72.110 -17.737 1.00 48.75 ? 641 ASP C OD2 1 
ATOM   7814 N N   . GLN C 1 324 ? -16.522 67.770 -18.846 1.00 33.62 ? 642 GLN C N   1 
ATOM   7815 C CA  . GLN C 1 324 ? -15.148 67.464 -19.209 1.00 31.95 ? 642 GLN C CA  1 
ATOM   7816 C C   . GLN C 1 324 ? -14.183 68.636 -19.123 1.00 28.98 ? 642 GLN C C   1 
ATOM   7817 O O   . GLN C 1 324 ? -13.063 68.489 -18.648 1.00 28.77 ? 642 GLN C O   1 
ATOM   7818 C CB  . GLN C 1 324 ? -15.103 66.881 -20.627 1.00 33.43 ? 642 GLN C CB  1 
ATOM   7819 C CG  . GLN C 1 324 ? -15.740 65.518 -20.744 1.00 37.74 ? 642 GLN C CG  1 
ATOM   7820 C CD  . GLN C 1 324 ? -15.050 64.501 -19.865 1.00 43.05 ? 642 GLN C CD  1 
ATOM   7821 O OE1 . GLN C 1 324 ? -15.648 63.498 -19.465 1.00 45.30 ? 642 GLN C OE1 1 
ATOM   7822 N NE2 . GLN C 1 324 ? -13.778 64.755 -19.552 1.00 46.55 ? 642 GLN C NE2 1 
ATOM   7823 N N   . LEU C 1 325 ? -14.590 69.796 -19.610 1.00 26.75 ? 643 LEU C N   1 
ATOM   7824 C CA  . LEU C 1 325 ? -13.709 70.940 -19.508 1.00 24.72 ? 643 LEU C CA  1 
ATOM   7825 C C   . LEU C 1 325 ? -13.453 71.209 -18.035 1.00 24.08 ? 643 LEU C C   1 
ATOM   7826 O O   . LEU C 1 325 ? -12.332 71.152 -17.601 1.00 23.72 ? 643 LEU C O   1 
ATOM   7827 C CB  . LEU C 1 325 ? -14.292 72.166 -20.190 1.00 24.92 ? 643 LEU C CB  1 
ATOM   7828 C CG  . LEU C 1 325 ? -13.261 73.254 -20.407 1.00 22.90 ? 643 LEU C CG  1 
ATOM   7829 C CD1 . LEU C 1 325 ? -12.339 72.855 -21.525 1.00 24.40 ? 643 LEU C CD1 1 
ATOM   7830 C CD2 . LEU C 1 325 ? -13.965 74.541 -20.746 1.00 30.15 ? 643 LEU C CD2 1 
ATOM   7831 N N   . VAL C 1 326 ? -14.492 71.459 -17.248 1.00 23.03 ? 644 VAL C N   1 
ATOM   7832 C CA  . VAL C 1 326 ? -14.265 71.580 -15.831 1.00 22.19 ? 644 VAL C CA  1 
ATOM   7833 C C   . VAL C 1 326 ? -13.284 70.524 -15.283 1.00 23.65 ? 644 VAL C C   1 
ATOM   7834 O O   . VAL C 1 326 ? -12.293 70.859 -14.612 1.00 24.48 ? 644 VAL C O   1 
ATOM   7835 C CB  . VAL C 1 326 ? -15.573 71.618 -15.057 1.00 22.64 ? 644 VAL C CB  1 
ATOM   7836 C CG1 . VAL C 1 326 ? -15.308 71.565 -13.558 1.00 18.74 ? 644 VAL C CG1 1 
ATOM   7837 C CG2 . VAL C 1 326 ? -16.316 72.904 -15.397 1.00 21.01 ? 644 VAL C CG2 1 
ATOM   7838 N N   . ILE C 1 327 ? -13.525 69.254 -15.579 1.00 23.66 ? 645 ILE C N   1 
ATOM   7839 C CA  . ILE C 1 327 ? -12.685 68.189 -15.013 1.00 23.20 ? 645 ILE C CA  1 
ATOM   7840 C C   . ILE C 1 327 ? -11.196 68.313 -15.330 1.00 20.79 ? 645 ILE C C   1 
ATOM   7841 O O   . ILE C 1 327 ? -10.338 67.889 -14.551 1.00 20.48 ? 645 ILE C O   1 
ATOM   7842 C CB  . ILE C 1 327 ? -13.119 66.795 -15.497 1.00 24.48 ? 645 ILE C CB  1 
ATOM   7843 C CG1 . ILE C 1 327 ? -14.610 66.588 -15.284 1.00 25.95 ? 645 ILE C CG1 1 
ATOM   7844 C CG2 . ILE C 1 327 ? -12.389 65.736 -14.702 1.00 25.23 ? 645 ILE C CG2 1 
ATOM   7845 C CD1 . ILE C 1 327 ? -14.922 66.435 -13.844 1.00 34.14 ? 645 ILE C CD1 1 
ATOM   7846 N N   . ALA C 1 328 ? -10.891 68.851 -16.500 1.00 19.32 ? 646 ALA C N   1 
ATOM   7847 C CA  . ALA C 1 328 ? -9.516  68.888 -17.003 1.00 16.31 ? 646 ALA C CA  1 
ATOM   7848 C C   . ALA C 1 328 ? -8.724  69.980 -16.309 1.00 16.09 ? 646 ALA C C   1 
ATOM   7849 O O   . ALA C 1 328 ? -7.501  70.036 -16.396 1.00 15.01 ? 646 ALA C O   1 
ATOM   7850 C CB  . ALA C 1 328 ? -9.525  69.112 -18.482 1.00 13.06 ? 646 ALA C CB  1 
ATOM   7851 N N   . ASN C 1 329 ? -9.441  70.840 -15.600 1.00 17.13 ? 647 ASN C N   1 
ATOM   7852 C CA  . ASN C 1 329 ? -8.860  72.033 -15.038 1.00 18.75 ? 647 ASN C CA  1 
ATOM   7853 C C   . ASN C 1 329 ? -9.123  72.097 -13.565 1.00 22.08 ? 647 ASN C C   1 
ATOM   7854 O O   . ASN C 1 329 ? -9.134  73.174 -12.972 1.00 24.63 ? 647 ASN C O   1 
ATOM   7855 C CB  . ASN C 1 329 ? -9.429  73.261 -15.721 1.00 18.15 ? 647 ASN C CB  1 
ATOM   7856 C CG  . ASN C 1 329 ? -8.860  73.456 -17.090 1.00 19.21 ? 647 ASN C CG  1 
ATOM   7857 O OD1 . ASN C 1 329 ? -7.732  73.957 -17.235 1.00 18.10 ? 647 ASN C OD1 1 
ATOM   7858 N ND2 . ASN C 1 329 ? -9.608  73.027 -18.117 1.00 12.07 ? 647 ASN C ND2 1 
ATOM   7859 N N   . ILE C 1 330 ? -9.373  70.926 -12.990 1.00 23.92 ? 648 ILE C N   1 
ATOM   7860 C CA  . ILE C 1 330 ? -9.434  70.746 -11.559 1.00 24.61 ? 648 ILE C CA  1 
ATOM   7861 C C   . ILE C 1 330 ? -8.003  70.503 -11.122 1.00 26.72 ? 648 ILE C C   1 
ATOM   7862 O O   . ILE C 1 330 ? -7.334  69.610 -11.646 1.00 28.74 ? 648 ILE C O   1 
ATOM   7863 C CB  . ILE C 1 330 ? -10.268 69.485 -11.207 1.00 23.73 ? 648 ILE C CB  1 
ATOM   7864 C CG1 . ILE C 1 330 ? -11.739 69.672 -11.593 1.00 22.35 ? 648 ILE C CG1 1 
ATOM   7865 C CG2 . ILE C 1 330 ? -10.147 69.147 -9.745  1.00 23.82 ? 648 ILE C CG2 1 
ATOM   7866 C CD1 . ILE C 1 330 ? -12.655 68.679 -10.962 1.00 11.69 ? 648 ILE C CD1 1 
ATOM   7867 N N   . ASP C 1 331 ? -7.513  71.288 -10.173 1.00 27.97 ? 649 ASP C N   1 
ATOM   7868 C CA  . ASP C 1 331 ? -6.246  70.973 -9.505  1.00 27.83 ? 649 ASP C CA  1 
ATOM   7869 C C   . ASP C 1 331 ? -6.443  69.786 -8.536  1.00 27.28 ? 649 ASP C C   1 
ATOM   7870 O O   . ASP C 1 331 ? -6.766  70.003 -7.365  1.00 27.57 ? 649 ASP C O   1 
ATOM   7871 C CB  . ASP C 1 331 ? -5.804  72.215 -8.731  1.00 29.54 ? 649 ASP C CB  1 
ATOM   7872 C CG  . ASP C 1 331 ? -4.469  72.058 -8.059  1.00 29.25 ? 649 ASP C CG  1 
ATOM   7873 O OD1 . ASP C 1 331 ? -3.951  70.919 -8.027  1.00 28.95 ? 649 ASP C OD1 1 
ATOM   7874 O OD2 . ASP C 1 331 ? -3.961  73.096 -7.562  1.00 28.89 ? 649 ASP C OD2 1 
ATOM   7875 N N   . GLN C 1 332 ? -6.260  68.549 -9.010  1.00 25.47 ? 650 GLN C N   1 
ATOM   7876 C CA  . GLN C 1 332 ? -6.551  67.368 -8.179  1.00 23.76 ? 650 GLN C CA  1 
ATOM   7877 C C   . GLN C 1 332 ? -5.657  67.197 -6.934  1.00 24.50 ? 650 GLN C C   1 
ATOM   7878 O O   . GLN C 1 332 ? -5.968  66.406 -6.054  1.00 26.38 ? 650 GLN C O   1 
ATOM   7879 C CB  . GLN C 1 332 ? -6.509  66.082 -8.998  1.00 21.83 ? 650 GLN C CB  1 
ATOM   7880 C CG  . GLN C 1 332 ? -7.488  66.018 -10.137 1.00 20.66 ? 650 GLN C CG  1 
ATOM   7881 C CD  . GLN C 1 332 ? -8.920  65.758 -9.718  1.00 19.12 ? 650 GLN C CD  1 
ATOM   7882 O OE1 . GLN C 1 332 ? -9.232  65.622 -8.535  1.00 19.87 ? 650 GLN C OE1 1 
ATOM   7883 N NE2 . GLN C 1 332 ? -9.810  65.711 -10.700 1.00 14.10 ? 650 GLN C NE2 1 
ATOM   7884 N N   . SER C 1 333 ? -4.562  67.936 -6.842  1.00 23.83 ? 651 SER C N   1 
ATOM   7885 C CA  . SER C 1 333 ? -3.691  67.833 -5.680  1.00 24.34 ? 651 SER C CA  1 
ATOM   7886 C C   . SER C 1 333 ? -4.294  68.420 -4.389  1.00 26.57 ? 651 SER C C   1 
ATOM   7887 O O   . SER C 1 333 ? -3.720  68.258 -3.304  1.00 27.54 ? 651 SER C O   1 
ATOM   7888 C CB  . SER C 1 333 ? -2.376  68.540 -5.962  1.00 23.32 ? 651 SER C CB  1 
ATOM   7889 O OG  . SER C 1 333 ? -2.579  69.928 -5.904  1.00 18.91 ? 651 SER C OG  1 
ATOM   7890 N N   . ASP C 1 334 ? -5.423  69.123 -4.508  1.00 27.70 ? 652 ASP C N   1 
ATOM   7891 C CA  . ASP C 1 334 ? -6.112  69.696 -3.347  1.00 27.22 ? 652 ASP C CA  1 
ATOM   7892 C C   . ASP C 1 334 ? -6.711  68.566 -2.549  1.00 27.65 ? 652 ASP C C   1 
ATOM   7893 O O   . ASP C 1 334 ? -7.063  68.720 -1.388  1.00 28.84 ? 652 ASP C O   1 
ATOM   7894 C CB  . ASP C 1 334 ? -7.248  70.620 -3.779  1.00 26.45 ? 652 ASP C CB  1 
ATOM   7895 C CG  . ASP C 1 334 ? -6.756  71.880 -4.426  1.00 27.55 ? 652 ASP C CG  1 
ATOM   7896 O OD1 . ASP C 1 334 ? -5.531  72.066 -4.480  1.00 34.08 ? 652 ASP C OD1 1 
ATOM   7897 O OD2 . ASP C 1 334 ? -7.585  72.683 -4.897  1.00 28.27 ? 652 ASP C OD2 1 
ATOM   7898 N N   . PHE C 1 335 ? -6.831  67.417 -3.181  1.00 27.22 ? 653 PHE C N   1 
ATOM   7899 C CA  . PHE C 1 335 ? -7.548  66.339 -2.568  1.00 26.10 ? 653 PHE C CA  1 
ATOM   7900 C C   . PHE C 1 335 ? -6.646  65.155 -2.289  1.00 27.35 ? 653 PHE C C   1 
ATOM   7901 O O   . PHE C 1 335 ? -7.110  64.062 -1.966  1.00 27.67 ? 653 PHE C O   1 
ATOM   7902 C CB  . PHE C 1 335 ? -8.686  66.022 -3.480  1.00 24.79 ? 653 PHE C CB  1 
ATOM   7903 C CG  . PHE C 1 335 ? -9.493  67.234 -3.799  1.00 25.79 ? 653 PHE C CG  1 
ATOM   7904 C CD1 . PHE C 1 335 ? -9.679  67.654 -5.098  1.00 26.93 ? 653 PHE C CD1 1 
ATOM   7905 C CD2 . PHE C 1 335 ? -10.016 68.002 -2.779  1.00 20.02 ? 653 PHE C CD2 1 
ATOM   7906 C CE1 . PHE C 1 335 ? -10.427 68.782 -5.369  1.00 20.41 ? 653 PHE C CE1 1 
ATOM   7907 C CE2 . PHE C 1 335 ? -10.748 69.107 -3.045  1.00 14.02 ? 653 PHE C CE2 1 
ATOM   7908 C CZ  . PHE C 1 335 ? -10.955 69.502 -4.337  1.00 18.73 ? 653 PHE C CZ  1 
ATOM   7909 N N   . GLU C 1 336 ? -5.343  65.404 -2.377  1.00 27.07 ? 654 GLU C N   1 
ATOM   7910 C CA  . GLU C 1 336 ? -4.357  64.414 -2.049  1.00 28.19 ? 654 GLU C CA  1 
ATOM   7911 C C   . GLU C 1 336 ? -4.564  63.862 -0.638  1.00 28.56 ? 654 GLU C C   1 
ATOM   7912 O O   . GLU C 1 336 ? -4.687  64.614 0.336   1.00 28.32 ? 654 GLU C O   1 
ATOM   7913 C CB  . GLU C 1 336 ? -2.994  65.036 -2.146  1.00 29.18 ? 654 GLU C CB  1 
ATOM   7914 C CG  . GLU C 1 336 ? -1.858  64.077 -1.878  1.00 33.71 ? 654 GLU C CG  1 
ATOM   7915 C CD  . GLU C 1 336 ? -0.532  64.823 -1.757  1.00 38.29 ? 654 GLU C CD  1 
ATOM   7916 O OE1 . GLU C 1 336 ? -0.567  66.013 -1.349  1.00 30.41 ? 654 GLU C OE1 1 
ATOM   7917 O OE2 . GLU C 1 336 ? 0.528   64.227 -2.076  1.00 41.15 ? 654 GLU C OE2 1 
ATOM   7918 N N   . GLY C 1 337 ? -4.611  62.541 -0.540  1.00 27.33 ? 655 GLY C N   1 
ATOM   7919 C CA  . GLY C 1 337 ? -4.869  61.899 0.728   1.00 27.55 ? 655 GLY C CA  1 
ATOM   7920 C C   . GLY C 1 337 ? -6.284  62.050 1.249   1.00 27.39 ? 655 GLY C C   1 
ATOM   7921 O O   . GLY C 1 337 ? -6.529  61.877 2.437   1.00 27.65 ? 655 GLY C O   1 
ATOM   7922 N N   . PHE C 1 338 ? -7.237  62.351 0.375   1.00 27.02 ? 656 PHE C N   1 
ATOM   7923 C CA  . PHE C 1 338 ? -8.625  62.429 0.831   1.00 25.27 ? 656 PHE C CA  1 
ATOM   7924 C C   . PHE C 1 338 ? -9.182  61.105 1.326   1.00 25.82 ? 656 PHE C C   1 
ATOM   7925 O O   . PHE C 1 338 ? -9.857  61.055 2.332   1.00 25.84 ? 656 PHE C O   1 
ATOM   7926 C CB  . PHE C 1 338 ? -9.533  62.944 -0.262  1.00 23.40 ? 656 PHE C CB  1 
ATOM   7927 C CG  . PHE C 1 338 ? -10.908 63.216 0.203   1.00 18.62 ? 656 PHE C CG  1 
ATOM   7928 C CD1 . PHE C 1 338 ? -11.153 64.249 1.074   1.00 16.04 ? 656 PHE C CD1 1 
ATOM   7929 C CD2 . PHE C 1 338 ? -11.970 62.439 -0.227  1.00 19.74 ? 656 PHE C CD2 1 
ATOM   7930 C CE1 . PHE C 1 338 ? -12.436 64.503 1.510   1.00 16.81 ? 656 PHE C CE1 1 
ATOM   7931 C CE2 . PHE C 1 338 ? -13.254 62.693 0.204   1.00 11.67 ? 656 PHE C CE2 1 
ATOM   7932 C CZ  . PHE C 1 338 ? -13.483 63.721 1.072   1.00 10.95 ? 656 PHE C CZ  1 
HETATM 7933 N N   . SEP C 1 339 ? -8.914  60.032 0.603   1.00 27.12 ? 657 SEP C N   1 
HETATM 7934 C CA  . SEP C 1 339 ? -9.654  58.810 0.835   1.00 28.06 ? 657 SEP C CA  1 
HETATM 7935 C CB  . SEP C 1 339 ? -9.516  57.896 -0.352  1.00 28.42 ? 657 SEP C CB  1 
HETATM 7936 O OG  . SEP C 1 339 ? -9.759  58.642 -1.533  1.00 35.42 ? 657 SEP C OG  1 
HETATM 7937 C C   . SEP C 1 339 ? -9.164  58.130 2.071   1.00 27.92 ? 657 SEP C C   1 
HETATM 7938 O O   . SEP C 1 339 ? -7.994  58.205 2.386   1.00 29.43 ? 657 SEP C O   1 
HETATM 7939 P P   . SEP C 1 339 ? -9.448  57.654 -2.742  1.00 40.01 ? 657 SEP C P   1 
HETATM 7940 O O1P . SEP C 1 339 ? -7.863  57.818 -3.030  1.00 28.95 ? 657 SEP C O1P 1 
HETATM 7941 O O2P . SEP C 1 339 ? -10.379 57.933 -4.035  1.00 41.07 ? 657 SEP C O2P 1 
HETATM 7942 O O3P . SEP C 1 339 ? -9.892  56.197 -2.224  1.00 38.62 ? 657 SEP C O3P 1 
ATOM   7943 N N   . TYR C 1 340 ? -10.091 57.494 2.775   1.00 27.22 ? 658 TYR C N   1 
ATOM   7944 C CA  . TYR C 1 340 ? -9.827  56.811 4.024   1.00 26.40 ? 658 TYR C CA  1 
ATOM   7945 C C   . TYR C 1 340 ? -10.959 55.822 4.322   1.00 27.88 ? 658 TYR C C   1 
ATOM   7946 O O   . TYR C 1 340 ? -12.136 56.095 4.034   1.00 26.68 ? 658 TYR C O   1 
ATOM   7947 C CB  . TYR C 1 340 ? -9.739  57.809 5.161   1.00 25.50 ? 658 TYR C CB  1 
ATOM   7948 C CG  . TYR C 1 340 ? -9.730  57.161 6.526   1.00 25.16 ? 658 TYR C CG  1 
ATOM   7949 C CD1 . TYR C 1 340 ? -8.598  56.467 6.974   1.00 30.07 ? 658 TYR C CD1 1 
ATOM   7950 C CD2 . TYR C 1 340 ? -10.850 57.227 7.366   1.00 18.81 ? 658 TYR C CD2 1 
ATOM   7951 C CE1 . TYR C 1 340 ? -8.565  55.867 8.234   1.00 33.82 ? 658 TYR C CE1 1 
ATOM   7952 C CE2 . TYR C 1 340 ? -10.838 56.635 8.617   1.00 25.80 ? 658 TYR C CE2 1 
ATOM   7953 C CZ  . TYR C 1 340 ? -9.690  55.955 9.050   1.00 34.99 ? 658 TYR C CZ  1 
ATOM   7954 O OH  . TYR C 1 340 ? -9.652  55.353 10.282  1.00 36.04 ? 658 TYR C OH  1 
ATOM   7955 N N   . VAL C 1 341 ? -10.609 54.674 4.897   1.00 28.03 ? 659 VAL C N   1 
ATOM   7956 C CA  . VAL C 1 341 ? -11.624 53.730 5.321   1.00 29.20 ? 659 VAL C CA  1 
ATOM   7957 C C   . VAL C 1 341 ? -11.535 53.471 6.821   1.00 30.15 ? 659 VAL C C   1 
ATOM   7958 O O   . VAL C 1 341 ? -10.506 53.057 7.321   1.00 32.24 ? 659 VAL C O   1 
ATOM   7959 C CB  . VAL C 1 341 ? -11.471 52.409 4.582   1.00 29.72 ? 659 VAL C CB  1 
ATOM   7960 C CG1 . VAL C 1 341 ? -12.625 51.458 4.947   1.00 29.96 ? 659 VAL C CG1 1 
ATOM   7961 C CG2 . VAL C 1 341 ? -11.385 52.653 3.078   1.00 25.70 ? 659 VAL C CG2 1 
ATOM   7962 N N   . ASN C 1 342 ? -12.608 53.732 7.546   1.00 31.68 ? 660 ASN C N   1 
ATOM   7963 C CA  . ASN C 1 342 ? -12.650 53.408 8.966   1.00 34.20 ? 660 ASN C CA  1 
ATOM   7964 C C   . ASN C 1 342 ? -12.560 51.889 9.171   1.00 36.77 ? 660 ASN C C   1 
ATOM   7965 O O   . ASN C 1 342 ? -13.397 51.130 8.674   1.00 38.44 ? 660 ASN C O   1 
ATOM   7966 C CB  . ASN C 1 342 ? -13.938 53.945 9.586   1.00 33.22 ? 660 ASN C CB  1 
ATOM   7967 C CG  . ASN C 1 342 ? -13.861 54.078 11.090  1.00 33.05 ? 660 ASN C CG  1 
ATOM   7968 O OD1 . ASN C 1 342 ? -12.818 53.820 11.710  1.00 30.10 ? 660 ASN C OD1 1 
ATOM   7969 N ND2 . ASN C 1 342 ? -14.977 54.488 11.694  1.00 28.80 ? 660 ASN C ND2 1 
ATOM   7970 N N   . PRO C 1 343 ? -11.524 51.438 9.879   1.00 38.14 ? 661 PRO C N   1 
ATOM   7971 C CA  . PRO C 1 343 ? -11.392 50.011 10.122  1.00 38.78 ? 661 PRO C CA  1 
ATOM   7972 C C   . PRO C 1 343 ? -12.465 49.546 11.103  1.00 39.81 ? 661 PRO C C   1 
ATOM   7973 O O   . PRO C 1 343 ? -13.059 48.455 10.948  1.00 39.86 ? 661 PRO C O   1 
ATOM   7974 C CB  . PRO C 1 343 ? -10.020 49.907 10.788  1.00 38.94 ? 661 PRO C CB  1 
ATOM   7975 C CG  . PRO C 1 343 ? -9.820  51.253 11.463  1.00 39.29 ? 661 PRO C CG  1 
ATOM   7976 C CD  . PRO C 1 343 ? -10.433 52.223 10.490  1.00 38.35 ? 661 PRO C CD  1 
ATOM   7977 N N   . GLN C 1 344 ? -12.699 50.384 12.111  1.00 39.15 ? 662 GLN C N   1 
ATOM   7978 C CA  . GLN C 1 344 ? -13.576 50.026 13.207  1.00 38.57 ? 662 GLN C CA  1 
ATOM   7979 C C   . GLN C 1 344 ? -14.875 50.822 13.219  1.00 36.24 ? 662 GLN C C   1 
ATOM   7980 O O   . GLN C 1 344 ? -15.213 51.479 14.205  1.00 35.59 ? 662 GLN C O   1 
ATOM   7981 C CB  . GLN C 1 344 ? -12.832 50.110 14.543  1.00 39.11 ? 662 GLN C CB  1 
ATOM   7982 C CG  . GLN C 1 344 ? -12.370 48.742 15.003  1.00 41.73 ? 662 GLN C CG  1 
ATOM   7983 C CD  . GLN C 1 344 ? -13.448 47.668 14.797  1.00 46.99 ? 662 GLN C CD  1 
ATOM   7984 O OE1 . GLN C 1 344 ? -13.225 46.699 14.077  1.00 48.39 ? 662 GLN C OE1 1 
ATOM   7985 N NE2 . GLN C 1 344 ? -14.621 47.845 15.427  1.00 46.10 ? 662 GLN C NE2 1 
ATOM   7986 N N   . PHE C 1 345 ? -15.598 50.737 12.111  1.00 33.73 ? 663 PHE C N   1 
ATOM   7987 C CA  . PHE C 1 345 ? -16.890 51.381 12.000  1.00 32.81 ? 663 PHE C CA  1 
ATOM   7988 C C   . PHE C 1 345 ? -18.006 50.556 12.661  1.00 31.80 ? 663 PHE C C   1 
ATOM   7989 O O   . PHE C 1 345 ? -18.502 49.589 12.082  1.00 32.82 ? 663 PHE C O   1 
ATOM   7990 C CB  . PHE C 1 345 ? -17.235 51.673 10.526  1.00 32.46 ? 663 PHE C CB  1 
ATOM   7991 C CG  . PHE C 1 345 ? -18.618 52.218 10.341  1.00 31.87 ? 663 PHE C CG  1 
ATOM   7992 C CD1 . PHE C 1 345 ? -18.917 53.527 10.708  1.00 31.43 ? 663 PHE C CD1 1 
ATOM   7993 C CD2 . PHE C 1 345 ? -19.638 51.415 9.849   1.00 32.95 ? 663 PHE C CD2 1 
ATOM   7994 C CE1 . PHE C 1 345 ? -20.210 54.038 10.568  1.00 29.76 ? 663 PHE C CE1 1 
ATOM   7995 C CE2 . PHE C 1 345 ? -20.939 51.916 9.708   1.00 32.12 ? 663 PHE C CE2 1 
ATOM   7996 C CZ  . PHE C 1 345 ? -21.221 53.234 10.068  1.00 29.99 ? 663 PHE C CZ  1 
ATOM   7997 N N   . VAL C 1 346 ? -18.407 50.950 13.866  1.00 30.41 ? 664 VAL C N   1 
ATOM   7998 C CA  . VAL C 1 346 ? -19.533 50.310 14.570  1.00 28.38 ? 664 VAL C CA  1 
ATOM   7999 C C   . VAL C 1 346 ? -20.812 50.348 13.748  1.00 28.31 ? 664 VAL C C   1 
ATOM   8000 O O   . VAL C 1 346 ? -21.383 51.417 13.552  1.00 27.94 ? 664 VAL C O   1 
ATOM   8001 C CB  . VAL C 1 346 ? -19.880 51.025 15.904  1.00 27.01 ? 664 VAL C CB  1 
ATOM   8002 C CG1 . VAL C 1 346 ? -20.826 50.167 16.714  1.00 25.50 ? 664 VAL C CG1 1 
ATOM   8003 C CG2 . VAL C 1 346 ? -18.652 51.358 16.689  1.00 20.45 ? 664 VAL C CG2 1 
ATOM   8004 N N   . HIS C 1 347 ? -21.283 49.200 13.285  1.00 29.55 ? 665 HIS C N   1 
ATOM   8005 C CA  . HIS C 1 347 ? -22.581 49.168 12.620  1.00 32.73 ? 665 HIS C CA  1 
ATOM   8006 C C   . HIS C 1 347 ? -23.681 49.248 13.673  1.00 35.89 ? 665 HIS C C   1 
ATOM   8007 O O   . HIS C 1 347 ? -23.385 49.231 14.857  1.00 37.25 ? 665 HIS C O   1 
ATOM   8008 C CB  . HIS C 1 347 ? -22.710 47.947 11.723  1.00 31.95 ? 665 HIS C CB  1 
ATOM   8009 C CG  . HIS C 1 347 ? -21.740 47.948 10.583  1.00 32.98 ? 665 HIS C CG  1 
ATOM   8010 N ND1 . HIS C 1 347 ? -22.065 48.412 9.327   1.00 37.17 ? 665 HIS C ND1 1 
ATOM   8011 C CD2 . HIS C 1 347 ? -20.442 47.570 10.517  1.00 35.32 ? 665 HIS C CD2 1 
ATOM   8012 C CE1 . HIS C 1 347 ? -21.014 48.311 8.534   1.00 36.71 ? 665 HIS C CE1 1 
ATOM   8013 N NE2 . HIS C 1 347 ? -20.016 47.796 9.230   1.00 37.02 ? 665 HIS C NE2 1 
ATOM   8014 N N   . PRO C 1 348 ? -24.943 49.415 13.258  1.00 39.22 ? 666 PRO C N   1 
ATOM   8015 C CA  . PRO C 1 348 ? -25.933 49.524 14.313  1.00 41.17 ? 666 PRO C CA  1 
ATOM   8016 C C   . PRO C 1 348 ? -26.050 48.289 15.218  1.00 44.68 ? 666 PRO C C   1 
ATOM   8017 O O   . PRO C 1 348 ? -26.132 47.154 14.737  1.00 44.13 ? 666 PRO C O   1 
ATOM   8018 C CB  . PRO C 1 348 ? -27.226 49.800 13.542  1.00 39.99 ? 666 PRO C CB  1 
ATOM   8019 C CG  . PRO C 1 348 ? -26.774 50.611 12.384  1.00 39.27 ? 666 PRO C CG  1 
ATOM   8020 C CD  . PRO C 1 348 ? -25.447 49.977 11.987  1.00 40.86 ? 666 PRO C CD  1 
ATOM   8021 N N   . ILE C 1 349 ? -26.068 48.568 16.525  1.00 48.41 ? 667 ILE C N   1 
ATOM   8022 C CA  . ILE C 1 349 ? -26.112 47.614 17.631  1.00 52.06 ? 667 ILE C CA  1 
ATOM   8023 C C   . ILE C 1 349 ? -27.495 46.991 17.833  1.00 54.71 ? 667 ILE C C   1 
ATOM   8024 O O   . ILE C 1 349 ? -28.505 47.557 17.410  1.00 55.90 ? 667 ILE C O   1 
ATOM   8025 C CB  . ILE C 1 349 ? -25.805 48.373 18.954  1.00 52.79 ? 667 ILE C CB  1 
ATOM   8026 C CG1 . ILE C 1 349 ? -24.888 49.578 18.702  1.00 52.30 ? 667 ILE C CG1 1 
ATOM   8027 C CG2 . ILE C 1 349 ? -25.241 47.436 20.026  1.00 52.71 ? 667 ILE C CG2 1 
ATOM   8028 C CD1 . ILE C 1 349 ? -23.416 49.266 18.863  1.00 51.71 ? 667 ILE C CD1 1 
ATOM   8029 N N   . LEU C 1 350 ? -27.554 45.845 18.507  1.00 56.29 ? 668 LEU C N   1 
ATOM   8030 C CA  . LEU C 1 350 ? -28.830 45.365 19.012  1.00 57.95 ? 668 LEU C CA  1 
ATOM   8031 C C   . LEU C 1 350 ? -29.185 46.172 20.247  1.00 59.34 ? 668 LEU C C   1 
ATOM   8032 O O   . LEU C 1 350 ? -28.422 46.213 21.210  1.00 59.06 ? 668 LEU C O   1 
ATOM   8033 C CB  . LEU C 1 350 ? -28.753 43.891 19.378  1.00 58.58 ? 668 LEU C CB  1 
ATOM   8034 C CG  . LEU C 1 350 ? -29.031 42.897 18.258  1.00 59.24 ? 668 LEU C CG  1 
ATOM   8035 C CD1 . LEU C 1 350 ? -28.029 43.071 17.118  1.00 60.02 ? 668 LEU C CD1 1 
ATOM   8036 C CD2 . LEU C 1 350 ? -29.012 41.480 18.816  1.00 58.75 ? 668 LEU C CD2 1 
ATOM   8037 N N   . GLN C 1 351 ? -30.346 46.811 20.231  1.00 61.44 ? 669 GLN C N   1 
ATOM   8038 C CA  . GLN C 1 351 ? -30.710 47.695 21.332  1.00 63.65 ? 669 GLN C CA  1 
ATOM   8039 C C   . GLN C 1 351 ? -31.283 46.938 22.532  1.00 63.83 ? 669 GLN C C   1 
ATOM   8040 O O   . GLN C 1 351 ? -31.851 45.859 22.383  1.00 63.69 ? 669 GLN C O   1 
ATOM   8041 C CB  . GLN C 1 351 ? -31.670 48.778 20.846  1.00 63.86 ? 669 GLN C CB  1 
ATOM   8042 C CG  . GLN C 1 351 ? -31.293 49.335 19.477  1.00 68.59 ? 669 GLN C CG  1 
ATOM   8043 C CD  . GLN C 1 351 ? -32.183 50.495 19.032  1.00 74.10 ? 669 GLN C CD  1 
ATOM   8044 O OE1 . GLN C 1 351 ? -33.204 50.793 19.666  1.00 76.51 ? 669 GLN C OE1 1 
ATOM   8045 N NE2 . GLN C 1 351 ? -31.793 51.161 17.941  1.00 71.71 ? 669 GLN C NE2 1 
ATOM   8046 N N   . SER C 1 352 ? -31.111 47.505 23.722  1.00 64.65 ? 670 SER C N   1 
ATOM   8047 C CA  . SER C 1 352 ? -31.629 46.910 24.949  1.00 65.21 ? 670 SER C CA  1 
ATOM   8048 C C   . SER C 1 352 ? -32.558 47.879 25.683  1.00 65.78 ? 670 SER C C   1 
ATOM   8049 O O   . SER C 1 352 ? -32.132 48.944 26.143  1.00 66.08 ? 670 SER C O   1 
ATOM   8050 C CB  . SER C 1 352 ? -30.481 46.486 25.866  1.00 65.20 ? 670 SER C CB  1 
ATOM   8051 O OG  . SER C 1 352 ? -30.981 45.970 27.086  1.00 65.26 ? 670 SER C OG  1 
HETATM 8052 N N1  . LW4 D 2 .   ? 8.580   32.313 52.720  1.00 31.68 ? 901 LW4 A N1  1 
HETATM 8053 C C4  . LW4 D 2 .   ? 6.731   31.588 51.710  1.00 33.13 ? 901 LW4 A C4  1 
HETATM 8054 C C5  . LW4 D 2 .   ? 6.430   32.678 52.707  1.00 32.30 ? 901 LW4 A C5  1 
HETATM 8055 C C6  . LW4 D 2 .   ? 7.605   33.013 53.259  1.00 34.86 ? 901 LW4 A C6  1 
HETATM 8056 C C8  . LW4 D 2 .   ? 5.120   33.238 53.065  1.00 32.50 ? 901 LW4 A C8  1 
HETATM 8057 C C10 . LW4 D 2 .   ? 2.933   33.568 53.522  1.00 27.94 ? 901 LW4 A C10 1 
HETATM 8058 C C13 . LW4 D 2 .   ? 4.848   34.588 53.574  1.00 33.82 ? 901 LW4 A C13 1 
HETATM 8059 C C20 . LW4 D 2 .   ? 2.402   29.570 51.367  1.00 33.56 ? 901 LW4 A C20 1 
HETATM 8060 C C21 . LW4 D 2 .   ? 2.567   30.904 51.733  1.00 31.32 ? 901 LW4 A C21 1 
HETATM 8061 C C22 . LW4 D 2 .   ? 1.640   31.838 51.253  1.00 33.05 ? 901 LW4 A C22 1 
HETATM 8062 C C24 . LW4 D 2 .   ? 0.586   31.454 50.426  1.00 32.59 ? 901 LW4 A C24 1 
HETATM 8063 C C26 . LW4 D 2 .   ? 0.440   30.113 50.063  1.00 35.28 ? 901 LW4 A C26 1 
HETATM 8064 C C28 . LW4 D 2 .   ? 1.350   29.167 50.536  1.00 32.46 ? 901 LW4 A C28 1 
HETATM 8065 C C3  . LW4 D 2 .   ? 8.116   31.456 51.806  1.00 30.56 ? 901 LW4 A C3  1 
HETATM 8066 C C9  . LW4 D 2 .   ? 3.937   32.626 53.041  1.00 31.55 ? 901 LW4 A C9  1 
HETATM 8067 N N11 . LW4 D 2 .   ? 3.538   34.733 53.816  1.00 32.00 ? 901 LW4 A N11 1 
HETATM 8068 O O14 . LW4 D 2 .   ? 5.696   35.442 53.746  1.00 35.97 ? 901 LW4 A O14 1 
HETATM 8069 O O15 . LW4 D 2 .   ? 1.742   33.306 53.620  1.00 28.53 ? 901 LW4 A O15 1 
HETATM 8070 C C16 . LW4 D 2 .   ? 3.644   31.221 52.576  1.00 32.15 ? 901 LW4 A C16 1 
HETATM 8071 N N17 . LW4 D 2 .   ? 4.483   30.257 52.969  1.00 33.90 ? 901 LW4 A N17 1 
HETATM 8072 C C18 . LW4 D 2 .   ? 4.313   28.977 52.602  1.00 36.16 ? 901 LW4 A C18 1 
HETATM 8073 N N19 . LW4 D 2 .   ? 3.279   28.644 51.807  1.00 37.88 ? 901 LW4 A N19 1 
HETATM 8074 N N30 . LW4 D 2 .   ? 5.205   28.048 52.994  1.00 34.33 ? 901 LW4 A N30 1 
HETATM 8075 C C31 . LW4 D 2 .   ? 4.993   26.630 52.731  1.00 30.97 ? 901 LW4 A C31 1 
HETATM 8076 C C34 . LW4 D 2 .   ? 6.304   26.209 52.051  1.00 32.80 ? 901 LW4 A C34 1 
HETATM 8077 N N37 . LW4 D 2 .   ? 7.494   26.618 52.839  1.00 31.95 ? 901 LW4 A N37 1 
HETATM 8078 C C38 . LW4 D 2 .   ? 7.561   28.053 53.176  1.00 28.99 ? 901 LW4 A C38 1 
HETATM 8079 C C41 . LW4 D 2 .   ? 6.272   28.423 53.913  1.00 30.19 ? 901 LW4 A C41 1 
HETATM 8080 C C44 . LW4 D 2 .   ? 8.759   26.117 52.245  1.00 38.15 ? 901 LW4 A C44 1 
HETATM 8081 C C48 . LW4 D 2 .   ? 5.986   30.809 50.817  1.00 32.63 ? 901 LW4 A C48 1 
HETATM 8082 C C50 . LW4 D 2 .   ? 6.703   29.877 50.032  1.00 33.00 ? 901 LW4 A C50 1 
HETATM 8083 C C52 . LW4 D 2 .   ? 8.106   29.754 50.139  1.00 26.86 ? 901 LW4 A C52 1 
HETATM 8084 C C54 . LW4 D 2 .   ? 8.840   30.545 51.038  1.00 26.32 ? 901 LW4 A C54 1 
HETATM 8085 N N1  . LW4 E 2 .   ? -12.980 13.435 29.705  1.00 30.20 ? 901 LW4 B N1  1 
HETATM 8086 C C4  . LW4 E 2 .   ? -14.808 14.294 30.653  1.00 31.99 ? 901 LW4 B C4  1 
HETATM 8087 C C5  . LW4 E 2 .   ? -15.123 13.199 29.675  1.00 26.37 ? 901 LW4 B C5  1 
HETATM 8088 C C6  . LW4 E 2 .   ? -13.971 12.772 29.154  1.00 29.20 ? 901 LW4 B C6  1 
HETATM 8089 C C8  . LW4 E 2 .   ? -16.426 12.715 29.293  1.00 26.51 ? 901 LW4 B C8  1 
HETATM 8090 C C10 . LW4 E 2 .   ? -18.574 12.369 28.730  1.00 30.76 ? 901 LW4 B C10 1 
HETATM 8091 C C13 . LW4 E 2 .   ? -16.639 11.358 28.823  1.00 28.37 ? 901 LW4 B C13 1 
HETATM 8092 C C20 . LW4 E 2 .   ? -19.316 16.466 30.604  1.00 31.04 ? 901 LW4 B C20 1 
HETATM 8093 C C21 . LW4 E 2 .   ? -19.096 15.104 30.336  1.00 31.68 ? 901 LW4 B C21 1 
HETATM 8094 C C22 . LW4 E 2 .   ? -19.989 14.130 30.824  1.00 32.62 ? 901 LW4 B C22 1 
HETATM 8095 C C24 . LW4 E 2 .   ? -21.106 14.497 31.562  1.00 33.60 ? 901 LW4 B C24 1 
HETATM 8096 C C26 . LW4 E 2 .   ? -21.313 15.862 31.819  1.00 39.17 ? 901 LW4 B C26 1 
HETATM 8097 C C28 . LW4 E 2 .   ? -20.428 16.852 31.348  1.00 31.93 ? 901 LW4 B C28 1 
HETATM 8098 C C3  . LW4 E 2 .   ? -13.415 14.341 30.592  1.00 30.91 ? 901 LW4 B C3  1 
HETATM 8099 C C9  . LW4 E 2 .   ? -17.607 13.349 29.223  1.00 30.97 ? 901 LW4 B C9  1 
HETATM 8100 N N11 . LW4 E 2 .   ? -17.942 11.191 28.519  1.00 33.23 ? 901 LW4 B N11 1 
HETATM 8101 O O14 . LW4 E 2 .   ? -15.745 10.533 28.763  1.00 30.40 ? 901 LW4 B O14 1 
HETATM 8102 O O15 . LW4 E 2 .   ? -19.754 12.622 28.550  1.00 33.26 ? 901 LW4 B O15 1 
HETATM 8103 C C16 . LW4 E 2 .   ? -17.966 14.777 29.582  1.00 29.88 ? 901 LW4 B C16 1 
HETATM 8104 N N17 . LW4 E 2 .   ? -17.161 15.765 29.159  1.00 33.18 ? 901 LW4 B N17 1 
HETATM 8105 C C18 . LW4 E 2 .   ? -17.375 17.071 29.432  1.00 31.95 ? 901 LW4 B C18 1 
HETATM 8106 N N19 . LW4 E 2 .   ? -18.455 17.416 30.167  1.00 31.84 ? 901 LW4 B N19 1 
HETATM 8107 N N30 . LW4 E 2 .   ? -16.404 17.964 29.132  1.00 27.03 ? 901 LW4 B N30 1 
HETATM 8108 C C31 . LW4 E 2 .   ? -16.483 19.325 29.641  1.00 29.31 ? 901 LW4 B C31 1 
HETATM 8109 C C34 . LW4 E 2 .   ? -15.142 19.743 30.297  1.00 30.07 ? 901 LW4 B C34 1 
HETATM 8110 N N37 . LW4 E 2 .   ? -14.018 19.289 29.450  1.00 31.98 ? 901 LW4 B N37 1 
HETATM 8111 C C38 . LW4 E 2 .   ? -14.015 17.826 29.231  1.00 25.97 ? 901 LW4 B C38 1 
HETATM 8112 C C41 . LW4 E 2 .   ? -15.241 17.540 28.353  1.00 23.91 ? 901 LW4 B C41 1 
HETATM 8113 C C44 . LW4 E 2 .   ? -12.703 19.942 29.708  1.00 33.29 ? 901 LW4 B C44 1 
HETATM 8114 C C48 . LW4 E 2 .   ? -15.543 15.119 31.506  1.00 29.01 ? 901 LW4 B C48 1 
HETATM 8115 C C50 . LW4 E 2 .   ? -14.782 16.007 32.292  1.00 33.54 ? 901 LW4 B C50 1 
HETATM 8116 C C52 . LW4 E 2 .   ? -13.376 16.060 32.226  1.00 31.18 ? 901 LW4 B C52 1 
HETATM 8117 C C54 . LW4 E 2 .   ? -12.658 15.215 31.368  1.00 30.45 ? 901 LW4 B C54 1 
HETATM 8118 N N1  . LW4 F 2 .   ? -29.969 64.034 9.105   1.00 33.76 ? 901 LW4 C N1  1 
HETATM 8119 C C4  . LW4 F 2 .   ? -28.148 64.958 8.215   1.00 34.05 ? 901 LW4 C C4  1 
HETATM 8120 C C5  . LW4 F 2 .   ? -27.817 63.710 8.976   1.00 26.68 ? 901 LW4 C C5  1 
HETATM 8121 C C6  . LW4 F 2 .   ? -28.977 63.258 9.468   1.00 32.90 ? 901 LW4 C C6  1 
HETATM 8122 C C8  . LW4 F 2 .   ? -26.506 63.090 9.195   1.00 28.40 ? 901 LW4 C C8  1 
HETATM 8123 C C10 . LW4 F 2 .   ? -24.324 62.672 9.570   1.00 31.38 ? 901 LW4 C C10 1 
HETATM 8124 C C13 . LW4 F 2 .   ? -26.216 61.636 9.337   1.00 32.05 ? 901 LW4 C C13 1 
HETATM 8125 C C20 . LW4 F 2 .   ? -23.628 66.985 8.606   1.00 30.45 ? 901 LW4 C C20 1 
HETATM 8126 C C21 . LW4 F 2 .   ? -23.883 65.598 8.574   1.00 27.85 ? 901 LW4 C C21 1 
HETATM 8127 C C22 . LW4 F 2 .   ? -22.995 64.765 7.859   1.00 26.97 ? 901 LW4 C C22 1 
HETATM 8128 C C24 . LW4 F 2 .   ? -21.888 65.307 7.176   1.00 24.49 ? 901 LW4 C C24 1 
HETATM 8129 C C26 . LW4 F 2 .   ? -21.649 66.684 7.205   1.00 20.09 ? 901 LW4 C C26 1 
HETATM 8130 C C28 . LW4 F 2 .   ? -22.519 67.522 7.925   1.00 25.09 ? 901 LW4 C C28 1 
HETATM 8131 C C3  . LW4 F 2 .   ? -29.526 65.055 8.374   1.00 32.34 ? 901 LW4 C C3  1 
HETATM 8132 C C9  . LW4 F 2 .   ? -25.339 63.694 9.338   1.00 24.28 ? 901 LW4 C C9  1 
HETATM 8133 N N11 . LW4 F 2 .   ? -24.908 61.451 9.561   1.00 31.46 ? 901 LW4 C N11 1 
HETATM 8134 O O14 . LW4 F 2 .   ? -27.041 60.728 9.282   1.00 35.35 ? 901 LW4 C O14 1 
HETATM 8135 O O15 . LW4 F 2 .   ? -23.133 62.924 9.738   1.00 33.91 ? 901 LW4 C O15 1 
HETATM 8136 C C16 . LW4 F 2 .   ? -24.996 65.139 9.276   1.00 22.51 ? 901 LW4 C C16 1 
HETATM 8137 N N17 . LW4 F 2 .   ? -25.768 66.010 9.917   1.00 25.18 ? 901 LW4 C N17 1 
HETATM 8138 C C18 . LW4 F 2 .   ? -25.511 67.319 9.937   1.00 23.17 ? 901 LW4 C C18 1 
HETATM 8139 N N19 . LW4 F 2 .   ? -24.453 67.805 9.291   1.00 28.65 ? 901 LW4 C N19 1 
HETATM 8140 N N30 . LW4 F 2 .   ? -26.361 68.142 10.556  1.00 27.31 ? 901 LW4 C N30 1 
HETATM 8141 C C31 . LW4 F 2 .   ? -27.449 67.571 11.347  1.00 25.20 ? 901 LW4 C C31 1 
HETATM 8142 C C34 . LW4 F 2 .   ? -28.738 67.968 10.598  1.00 23.47 ? 901 LW4 C C34 1 
HETATM 8143 N N37 . LW4 F 2 .   ? -28.740 69.442 10.708  1.00 28.71 ? 901 LW4 C N37 1 
HETATM 8144 C C38 . LW4 F 2 .   ? -27.658 70.107 9.936   1.00 26.43 ? 901 LW4 C C38 1 
HETATM 8145 C C41 . LW4 F 2 .   ? -26.274 69.593 10.378  1.00 24.24 ? 901 LW4 C C41 1 
HETATM 8146 C C44 . LW4 F 2 .   ? -30.065 70.105 10.674  1.00 29.71 ? 901 LW4 C C44 1 
HETATM 8147 C C48 . LW4 F 2 .   ? -27.433 65.900 7.474   1.00 36.48 ? 901 LW4 C C48 1 
HETATM 8148 C C50 . LW4 F 2 .   ? -28.186 66.940 6.899   1.00 38.70 ? 901 LW4 C C50 1 
HETATM 8149 C C52 . LW4 F 2 .   ? -29.583 67.027 7.058   1.00 32.35 ? 901 LW4 C C52 1 
HETATM 8150 C C54 . LW4 F 2 .   ? -30.281 66.075 7.808   1.00 30.77 ? 901 LW4 C C54 1 
HETATM 8151 O O   . HOH G 3 .   ? 17.833  28.313 64.209  1.00 42.81 ? 3   HOH A O   1 
HETATM 8152 O O   . HOH G 3 .   ? -9.787  21.032 68.133  1.00 23.42 ? 4   HOH A O   1 
HETATM 8153 O O   . HOH G 3 .   ? 10.241  32.686 56.653  1.00 24.22 ? 12  HOH A O   1 
HETATM 8154 O O   . HOH G 3 .   ? 13.811  23.832 54.794  1.00 29.20 ? 20  HOH A O   1 
HETATM 8155 O O   . HOH G 3 .   ? 4.954   24.660 86.600  1.00 20.38 ? 21  HOH A O   1 
HETATM 8156 O O   . HOH G 3 .   ? 14.454  39.230 63.486  1.00 20.09 ? 22  HOH A O   1 
HETATM 8157 O O   . HOH G 3 .   ? -15.050 34.539 59.237  1.00 26.23 ? 23  HOH A O   1 
HETATM 8158 O O   . HOH G 3 .   ? -1.524  15.359 49.563  1.00 23.88 ? 24  HOH A O   1 
HETATM 8159 O O   . HOH G 3 .   ? 3.759   30.472 80.513  1.00 22.06 ? 26  HOH A O   1 
HETATM 8160 O O   . HOH G 3 .   ? -4.560  39.519 61.564  1.00 47.30 ? 32  HOH A O   1 
HETATM 8161 O O   . HOH G 3 .   ? -5.480  38.013 58.131  1.00 29.80 ? 33  HOH A O   1 
HETATM 8162 O O   . HOH G 3 .   ? 17.620  16.129 63.196  1.00 26.31 ? 34  HOH A O   1 
HETATM 8163 O O   . HOH G 3 .   ? -6.847  48.495 57.274  1.00 41.12 ? 35  HOH A O   1 
HETATM 8164 O O   . HOH G 3 .   ? -5.543  51.857 47.001  1.00 30.01 ? 38  HOH A O   1 
HETATM 8165 O O   . HOH G 3 .   ? 25.065  44.078 38.617  1.00 19.86 ? 41  HOH A O   1 
HETATM 8166 O O   . HOH G 3 .   ? -3.890  13.107 47.072  1.00 42.73 ? 42  HOH A O   1 
HETATM 8167 O O   . HOH G 3 .   ? 10.968  47.238 54.498  1.00 21.03 ? 45  HOH A O   1 
HETATM 8168 O O   . HOH G 3 .   ? -2.267  38.163 33.425  1.00 38.46 ? 46  HOH A O   1 
HETATM 8169 O O   . HOH G 3 .   ? 19.597  14.736 64.624  1.00 35.13 ? 52  HOH A O   1 
HETATM 8170 O O   . HOH H 3 .   ? -19.147 6.567  19.099  1.00 21.74 ? 1   HOH B O   1 
HETATM 8171 O O   . HOH H 3 .   ? -31.338 3.451  35.246  1.00 21.73 ? 2   HOH B O   1 
HETATM 8172 O O   . HOH H 3 .   ? -25.956 -4.764 38.020  1.00 29.34 ? 7   HOH B O   1 
HETATM 8173 O O   . HOH H 3 .   ? -23.047 12.385 51.665  1.00 17.99 ? 16  HOH B O   1 
HETATM 8174 O O   . HOH H 3 .   ? -13.789 15.611 1.671   1.00 19.59 ? 18  HOH B O   1 
HETATM 8175 O O   . HOH H 3 .   ? -26.705 19.901 34.918  1.00 48.00 ? 19  HOH B O   1 
HETATM 8176 O O   . HOH H 3 .   ? -31.024 2.235  37.680  1.00 25.12 ? 40  HOH B O   1 
HETATM 8177 O O   . HOH I 3 .   ? -32.433 79.731 40.503  1.00 13.36 ? 5   HOH C O   1 
HETATM 8178 O O   . HOH I 3 .   ? -10.030 68.119 26.880  1.00 22.10 ? 6   HOH C O   1 
HETATM 8179 O O   . HOH I 3 .   ? -18.090 76.041 18.915  1.00 14.25 ? 8   HOH C O   1 
HETATM 8180 O O   . HOH I 3 .   ? -25.317 53.252 9.482   1.00 17.18 ? 9   HOH C O   1 
HETATM 8181 O O   . HOH I 3 .   ? -21.447 77.727 17.741  1.00 23.66 ? 11  HOH C O   1 
HETATM 8182 O O   . HOH I 3 .   ? -8.501  65.655 -13.372 1.00 23.66 ? 14  HOH C O   1 
HETATM 8183 O O   . HOH I 3 .   ? -7.454  62.688 -14.042 1.00 27.98 ? 15  HOH C O   1 
HETATM 8184 O O   . HOH I 3 .   ? -27.617 82.906 15.547  1.00 20.40 ? 17  HOH C O   1 
HETATM 8185 O O   . HOH I 3 .   ? -28.263 66.629 45.498  1.00 31.46 ? 25  HOH C O   1 
HETATM 8186 O O   . HOH I 3 .   ? -5.712  66.743 12.880  1.00 29.66 ? 27  HOH C O   1 
HETATM 8187 O O   . HOH I 3 .   ? -21.739 84.079 33.580  1.00 27.94 ? 28  HOH C O   1 
HETATM 8188 O O   . HOH I 3 .   ? -33.042 87.098 27.445  1.00 40.40 ? 29  HOH C O   1 
HETATM 8189 O O   . HOH I 3 .   ? -29.635 56.492 14.444  1.00 26.99 ? 31  HOH C O   1 
HETATM 8190 O O   . HOH I 3 .   ? -5.503  78.392 23.533  1.00 39.89 ? 37  HOH C O   1 
HETATM 8191 O O   . HOH I 3 .   ? -11.488 54.086 14.609  1.00 38.37 ? 39  HOH C O   1 
HETATM 8192 O O   . HOH I 3 .   ? -51.182 64.334 -5.920  1.00 26.39 ? 43  HOH C O   1 
HETATM 8193 O O   . HOH I 3 .   ? -18.110 80.798 20.635  1.00 19.03 ? 44  HOH C O   1 
HETATM 8194 O O   . HOH I 3 .   ? -9.864  81.983 24.157  1.00 37.26 ? 50  HOH C O   1 
HETATM 8195 O O   . HOH I 3 .   ? -22.460 91.830 32.388  1.00 25.19 ? 51  HOH C O   1 
HETATM 8196 O O   . HOH I 3 .   ? -16.964 87.715 32.953  1.00 37.75 ? 53  HOH C O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   319 ?   ?   ?   A . n 
A 1 2   PRO 2   320 ?   ?   ?   A . n 
A 1 3   SER 3   321 ?   ?   ?   A . n 
A 1 4   GLU 4   322 ?   ?   ?   A . n 
A 1 5   ASP 5   323 ?   ?   ?   A . n 
A 1 6   ARG 6   324 ?   ?   ?   A . n 
A 1 7   LYS 7   325 ?   ?   ?   A . n 
A 1 8   GLN 8   326 ?   ?   ?   A . n 
A 1 9   PRO 9   327 ?   ?   ?   A . n 
A 1 10  SER 10  328 ?   ?   ?   A . n 
A 1 11  ASN 11  329 ?   ?   ?   A . n 
A 1 12  ASN 12  330 ?   ?   ?   A . n 
A 1 13  LEU 13  331 331 LEU LEU A . n 
A 1 14  ASP 14  332 332 ASP ASP A . n 
A 1 15  ARG 15  333 333 ARG ARG A . n 
A 1 16  VAL 16  334 334 VAL VAL A . n 
A 1 17  LYS 17  335 335 LYS LYS A . n 
A 1 18  LEU 18  336 336 LEU LEU A . n 
A 1 19  THR 19  337 337 THR THR A . n 
A 1 20  ASP 20  338 338 ASP ASP A . n 
A 1 21  PHE 21  339 339 PHE PHE A . n 
A 1 22  ASN 22  340 340 ASN ASN A . n 
A 1 23  PHE 23  341 341 PHE PHE A . n 
A 1 24  LEU 24  342 342 LEU LEU A . n 
A 1 25  MET 25  343 343 MET MET A . n 
A 1 26  VAL 26  344 344 VAL VAL A . n 
A 1 27  LEU 27  345 345 LEU LEU A . n 
A 1 28  GLY 28  346 346 GLY GLY A . n 
A 1 29  LYS 29  347 347 LYS LYS A . n 
A 1 30  GLY 30  348 348 GLY GLY A . n 
A 1 31  SER 31  349 349 SER SER A . n 
A 1 32  PHE 32  350 350 PHE PHE A . n 
A 1 33  GLY 33  351 351 GLY GLY A . n 
A 1 34  LYS 34  352 352 LYS LYS A . n 
A 1 35  VAL 35  353 353 VAL VAL A . n 
A 1 36  MET 36  354 354 MET MET A . n 
A 1 37  LEU 37  355 355 LEU LEU A . n 
A 1 38  ALA 38  356 356 ALA ALA A . n 
A 1 39  ASP 39  357 357 ASP ASP A . n 
A 1 40  ARG 40  358 358 ARG ARG A . n 
A 1 41  LYS 41  359 359 LYS LYS A . n 
A 1 42  GLY 42  360 360 GLY GLY A . n 
A 1 43  THR 43  361 361 THR THR A . n 
A 1 44  GLU 44  362 362 GLU GLU A . n 
A 1 45  GLU 45  363 363 GLU GLU A . n 
A 1 46  LEU 46  364 364 LEU LEU A . n 
A 1 47  TYR 47  365 365 TYR TYR A . n 
A 1 48  ALA 48  366 366 ALA ALA A . n 
A 1 49  ILE 49  367 367 ILE ILE A . n 
A 1 50  LYS 50  368 368 LYS LYS A . n 
A 1 51  ILE 51  369 369 ILE ILE A . n 
A 1 52  LEU 52  370 370 LEU LEU A . n 
A 1 53  LYS 53  371 371 LYS LYS A . n 
A 1 54  LYS 54  372 372 LYS LYS A . n 
A 1 55  ASP 55  373 373 ASP ASP A . n 
A 1 56  VAL 56  374 374 VAL VAL A . n 
A 1 57  VAL 57  375 375 VAL VAL A . n 
A 1 58  ILE 58  376 376 ILE ILE A . n 
A 1 59  GLN 59  377 377 GLN GLN A . n 
A 1 60  ASP 60  378 378 ASP ASP A . n 
A 1 61  ASP 61  379 379 ASP ASP A . n 
A 1 62  ASP 62  380 380 ASP ASP A . n 
A 1 63  VAL 63  381 381 VAL VAL A . n 
A 1 64  GLU 64  382 382 GLU GLU A . n 
A 1 65  CYS 65  383 383 CYS CYS A . n 
A 1 66  THR 66  384 384 THR THR A . n 
A 1 67  MET 67  385 385 MET MET A . n 
A 1 68  VAL 68  386 386 VAL VAL A . n 
A 1 69  GLU 69  387 387 GLU GLU A . n 
A 1 70  LYS 70  388 388 LYS LYS A . n 
A 1 71  ARG 71  389 389 ARG ARG A . n 
A 1 72  VAL 72  390 390 VAL VAL A . n 
A 1 73  LEU 73  391 391 LEU LEU A . n 
A 1 74  ALA 74  392 392 ALA ALA A . n 
A 1 75  LEU 75  393 393 LEU LEU A . n 
A 1 76  LEU 76  394 394 LEU LEU A . n 
A 1 77  ASP 77  395 395 ASP ASP A . n 
A 1 78  LYS 78  396 396 LYS LYS A . n 
A 1 79  PRO 79  397 397 PRO PRO A . n 
A 1 80  PRO 80  398 398 PRO PRO A . n 
A 1 81  PHE 81  399 399 PHE PHE A . n 
A 1 82  LEU 82  400 400 LEU LEU A . n 
A 1 83  THR 83  401 401 THR THR A . n 
A 1 84  GLN 84  402 402 GLN GLN A . n 
A 1 85  LEU 85  403 403 LEU LEU A . n 
A 1 86  HIS 86  404 404 HIS HIS A . n 
A 1 87  SER 87  405 405 SER SER A . n 
A 1 88  CYS 88  406 406 CYS CYS A . n 
A 1 89  PHE 89  407 407 PHE PHE A . n 
A 1 90  GLN 90  408 408 GLN GLN A . n 
A 1 91  THR 91  409 409 THR THR A . n 
A 1 92  VAL 92  410 410 VAL VAL A . n 
A 1 93  ASP 93  411 411 ASP ASP A . n 
A 1 94  ARG 94  412 412 ARG ARG A . n 
A 1 95  LEU 95  413 413 LEU LEU A . n 
A 1 96  TYR 96  414 414 TYR TYR A . n 
A 1 97  PHE 97  415 415 PHE PHE A . n 
A 1 98  VAL 98  416 416 VAL VAL A . n 
A 1 99  MET 99  417 417 MET MET A . n 
A 1 100 GLU 100 418 418 GLU GLU A . n 
A 1 101 TYR 101 419 419 TYR TYR A . n 
A 1 102 VAL 102 420 420 VAL VAL A . n 
A 1 103 ASN 103 421 421 ASN ASN A . n 
A 1 104 GLY 104 422 422 GLY GLY A . n 
A 1 105 GLY 105 423 423 GLY GLY A . n 
A 1 106 ASP 106 424 424 ASP ASP A . n 
A 1 107 LEU 107 425 425 LEU LEU A . n 
A 1 108 MET 108 426 426 MET MET A . n 
A 1 109 TYR 109 427 427 TYR TYR A . n 
A 1 110 HIS 110 428 428 HIS HIS A . n 
A 1 111 ILE 111 429 429 ILE ILE A . n 
A 1 112 GLN 112 430 430 GLN GLN A . n 
A 1 113 GLN 113 431 431 GLN GLN A . n 
A 1 114 VAL 114 432 432 VAL VAL A . n 
A 1 115 GLY 115 433 433 GLY GLY A . n 
A 1 116 LYS 116 434 434 LYS LYS A . n 
A 1 117 PHE 117 435 435 PHE PHE A . n 
A 1 118 LYS 118 436 436 LYS LYS A . n 
A 1 119 GLU 119 437 437 GLU GLU A . n 
A 1 120 PRO 120 438 438 PRO PRO A . n 
A 1 121 GLN 121 439 439 GLN GLN A . n 
A 1 122 ALA 122 440 440 ALA ALA A . n 
A 1 123 VAL 123 441 441 VAL VAL A . n 
A 1 124 PHE 124 442 442 PHE PHE A . n 
A 1 125 TYR 125 443 443 TYR TYR A . n 
A 1 126 ALA 126 444 444 ALA ALA A . n 
A 1 127 ALA 127 445 445 ALA ALA A . n 
A 1 128 GLU 128 446 446 GLU GLU A . n 
A 1 129 ILE 129 447 447 ILE ILE A . n 
A 1 130 SER 130 448 448 SER SER A . n 
A 1 131 ILE 131 449 449 ILE ILE A . n 
A 1 132 GLY 132 450 450 GLY GLY A . n 
A 1 133 LEU 133 451 451 LEU LEU A . n 
A 1 134 PHE 134 452 452 PHE PHE A . n 
A 1 135 PHE 135 453 453 PHE PHE A . n 
A 1 136 LEU 136 454 454 LEU LEU A . n 
A 1 137 HIS 137 455 455 HIS HIS A . n 
A 1 138 LYS 138 456 456 LYS LYS A . n 
A 1 139 ARG 139 457 457 ARG ARG A . n 
A 1 140 GLY 140 458 458 GLY GLY A . n 
A 1 141 ILE 141 459 459 ILE ILE A . n 
A 1 142 ILE 142 460 460 ILE ILE A . n 
A 1 143 TYR 143 461 461 TYR TYR A . n 
A 1 144 ARG 144 462 462 ARG ARG A . n 
A 1 145 ASP 145 463 463 ASP ASP A . n 
A 1 146 LEU 146 464 464 LEU LEU A . n 
A 1 147 LYS 147 465 465 LYS LYS A . n 
A 1 148 LEU 148 466 466 LEU LEU A . n 
A 1 149 ASP 149 467 467 ASP ASP A . n 
A 1 150 ASN 150 468 468 ASN ASN A . n 
A 1 151 VAL 151 469 469 VAL VAL A . n 
A 1 152 MET 152 470 470 MET MET A . n 
A 1 153 LEU 153 471 471 LEU LEU A . n 
A 1 154 ASP 154 472 472 ASP ASP A . n 
A 1 155 SER 155 473 473 SER SER A . n 
A 1 156 GLU 156 474 474 GLU GLU A . n 
A 1 157 GLY 157 475 475 GLY GLY A . n 
A 1 158 HIS 158 476 476 HIS HIS A . n 
A 1 159 ILE 159 477 477 ILE ILE A . n 
A 1 160 LYS 160 478 478 LYS LYS A . n 
A 1 161 ILE 161 479 479 ILE ILE A . n 
A 1 162 ALA 162 480 480 ALA ALA A . n 
A 1 163 ASP 163 481 481 ASP ASP A . n 
A 1 164 PHE 164 482 482 PHE PHE A . n 
A 1 165 GLY 165 483 483 GLY GLY A . n 
A 1 166 MET 166 484 484 MET MET A . n 
A 1 167 CYS 167 485 485 CYS CYS A . n 
A 1 168 LYS 168 486 486 LYS LYS A . n 
A 1 169 GLU 169 487 487 GLU GLU A . n 
A 1 170 HIS 170 488 488 HIS HIS A . n 
A 1 171 MET 171 489 489 MET MET A . n 
A 1 172 MET 172 490 490 MET MET A . n 
A 1 173 ASP 173 491 491 ASP ASP A . n 
A 1 174 GLY 174 492 492 GLY GLY A . n 
A 1 175 VAL 175 493 493 VAL VAL A . n 
A 1 176 THR 176 494 494 THR THR A . n 
A 1 177 THR 177 495 495 THR THR A . n 
A 1 178 ARG 178 496 496 ARG ARG A . n 
A 1 179 GLU 179 497 497 GLU GLU A . n 
A 1 180 PHE 180 498 498 PHE PHE A . n 
A 1 181 CYS 181 499 499 CYS CYS A . n 
A 1 182 GLY 182 500 500 GLY GLY A . n 
A 1 183 THR 183 501 501 THR THR A . n 
A 1 184 PRO 184 502 502 PRO PRO A . n 
A 1 185 ASP 185 503 503 ASP ASP A . n 
A 1 186 TYR 186 504 504 TYR TYR A . n 
A 1 187 ILE 187 505 505 ILE ILE A . n 
A 1 188 ALA 188 506 506 ALA ALA A . n 
A 1 189 PRO 189 507 507 PRO PRO A . n 
A 1 190 GLU 190 508 508 GLU GLU A . n 
A 1 191 ILE 191 509 509 ILE ILE A . n 
A 1 192 ILE 192 510 510 ILE ILE A . n 
A 1 193 ALA 193 511 511 ALA ALA A . n 
A 1 194 TYR 194 512 512 TYR TYR A . n 
A 1 195 GLN 195 513 513 GLN GLN A . n 
A 1 196 PRO 196 514 514 PRO PRO A . n 
A 1 197 TYR 197 515 515 TYR TYR A . n 
A 1 198 GLY 198 516 516 GLY GLY A . n 
A 1 199 LYS 199 517 517 LYS LYS A . n 
A 1 200 SER 200 518 518 SER SER A . n 
A 1 201 VAL 201 519 519 VAL VAL A . n 
A 1 202 ASP 202 520 520 ASP ASP A . n 
A 1 203 TRP 203 521 521 TRP TRP A . n 
A 1 204 TRP 204 522 522 TRP TRP A . n 
A 1 205 ALA 205 523 523 ALA ALA A . n 
A 1 206 TYR 206 524 524 TYR TYR A . n 
A 1 207 GLY 207 525 525 GLY GLY A . n 
A 1 208 VAL 208 526 526 VAL VAL A . n 
A 1 209 LEU 209 527 527 LEU LEU A . n 
A 1 210 LEU 210 528 528 LEU LEU A . n 
A 1 211 TYR 211 529 529 TYR TYR A . n 
A 1 212 GLU 212 530 530 GLU GLU A . n 
A 1 213 MET 213 531 531 MET MET A . n 
A 1 214 LEU 214 532 532 LEU LEU A . n 
A 1 215 ALA 215 533 533 ALA ALA A . n 
A 1 216 GLY 216 534 534 GLY GLY A . n 
A 1 217 GLN 217 535 535 GLN GLN A . n 
A 1 218 PRO 218 536 536 PRO PRO A . n 
A 1 219 PRO 219 537 537 PRO PRO A . n 
A 1 220 PHE 220 538 538 PHE PHE A . n 
A 1 221 ASP 221 539 539 ASP ASP A . n 
A 1 222 GLY 222 540 540 GLY GLY A . n 
A 1 223 GLU 223 541 541 GLU GLU A . n 
A 1 224 ASP 224 542 542 ASP ASP A . n 
A 1 225 GLU 225 543 543 GLU GLU A . n 
A 1 226 ASP 226 544 544 ASP ASP A . n 
A 1 227 GLU 227 545 545 GLU GLU A . n 
A 1 228 LEU 228 546 546 LEU LEU A . n 
A 1 229 PHE 229 547 547 PHE PHE A . n 
A 1 230 GLN 230 548 548 GLN GLN A . n 
A 1 231 SER 231 549 549 SER SER A . n 
A 1 232 ILE 232 550 550 ILE ILE A . n 
A 1 233 MET 233 551 551 MET MET A . n 
A 1 234 GLU 234 552 552 GLU GLU A . n 
A 1 235 HIS 235 553 553 HIS HIS A . n 
A 1 236 ASN 236 554 554 ASN ASN A . n 
A 1 237 VAL 237 555 555 VAL VAL A . n 
A 1 238 SER 238 556 556 SER SER A . n 
A 1 239 TYR 239 557 557 TYR TYR A . n 
A 1 240 PRO 240 558 558 PRO PRO A . n 
A 1 241 LYS 241 559 559 LYS LYS A . n 
A 1 242 SER 242 560 560 SER SER A . n 
A 1 243 LEU 243 561 561 LEU LEU A . n 
A 1 244 SER 244 562 562 SER SER A . n 
A 1 245 LYS 245 563 563 LYS LYS A . n 
A 1 246 GLU 246 564 564 GLU GLU A . n 
A 1 247 ALA 247 565 565 ALA ALA A . n 
A 1 248 VAL 248 566 566 VAL VAL A . n 
A 1 249 SER 249 567 567 SER SER A . n 
A 1 250 ILE 250 568 568 ILE ILE A . n 
A 1 251 CYS 251 569 569 CYS CYS A . n 
A 1 252 LYS 252 570 570 LYS LYS A . n 
A 1 253 GLY 253 571 571 GLY GLY A . n 
A 1 254 LEU 254 572 572 LEU LEU A . n 
A 1 255 MET 255 573 573 MET MET A . n 
A 1 256 THR 256 574 574 THR THR A . n 
A 1 257 LYS 257 575 575 LYS LYS A . n 
A 1 258 HIS 258 576 576 HIS HIS A . n 
A 1 259 PRO 259 577 577 PRO PRO A . n 
A 1 260 ALA 260 578 578 ALA ALA A . n 
A 1 261 LYS 261 579 579 LYS LYS A . n 
A 1 262 ARG 262 580 580 ARG ARG A . n 
A 1 263 LEU 263 581 581 LEU LEU A . n 
A 1 264 GLY 264 582 582 GLY GLY A . n 
A 1 265 CYS 265 583 583 CYS CYS A . n 
A 1 266 GLY 266 584 584 GLY GLY A . n 
A 1 267 PRO 267 585 585 PRO PRO A . n 
A 1 268 GLU 268 586 586 GLU GLU A . n 
A 1 269 GLY 269 587 587 GLY GLY A . n 
A 1 270 GLU 270 588 588 GLU GLU A . n 
A 1 271 ARG 271 589 589 ARG ARG A . n 
A 1 272 ASP 272 590 590 ASP ASP A . n 
A 1 273 VAL 273 591 591 VAL VAL A . n 
A 1 274 ARG 274 592 592 ARG ARG A . n 
A 1 275 GLU 275 593 593 GLU GLU A . n 
A 1 276 HIS 276 594 594 HIS HIS A . n 
A 1 277 ALA 277 595 595 ALA ALA A . n 
A 1 278 PHE 278 596 596 PHE PHE A . n 
A 1 279 PHE 279 597 597 PHE PHE A . n 
A 1 280 ARG 280 598 598 ARG ARG A . n 
A 1 281 ARG 281 599 599 ARG ARG A . n 
A 1 282 ILE 282 600 600 ILE ILE A . n 
A 1 283 ASP 283 601 601 ASP ASP A . n 
A 1 284 TRP 284 602 602 TRP TRP A . n 
A 1 285 GLU 285 603 603 GLU GLU A . n 
A 1 286 LYS 286 604 604 LYS LYS A . n 
A 1 287 LEU 287 605 605 LEU LEU A . n 
A 1 288 GLU 288 606 606 GLU GLU A . n 
A 1 289 ASN 289 607 607 ASN ASN A . n 
A 1 290 ARG 290 608 608 ARG ARG A . n 
A 1 291 GLU 291 609 609 GLU GLU A . n 
A 1 292 ILE 292 610 610 ILE ILE A . n 
A 1 293 GLN 293 611 611 GLN GLN A . n 
A 1 294 PRO 294 612 612 PRO PRO A . n 
A 1 295 PRO 295 613 613 PRO PRO A . n 
A 1 296 PHE 296 614 614 PHE PHE A . n 
A 1 297 LYS 297 615 615 LYS LYS A . n 
A 1 298 PRO 298 616 616 PRO PRO A . n 
A 1 299 LYS 299 617 617 LYS LYS A . n 
A 1 300 VAL 300 618 618 VAL VAL A . n 
A 1 301 CYS 301 619 ?   ?   ?   A . n 
A 1 302 GLY 302 620 ?   ?   ?   A . n 
A 1 303 LYS 303 621 ?   ?   ?   A . n 
A 1 304 GLY 304 622 ?   ?   ?   A . n 
A 1 305 ALA 305 623 ?   ?   ?   A . n 
A 1 306 GLU 306 624 ?   ?   ?   A . n 
A 1 307 ASN 307 625 ?   ?   ?   A . n 
A 1 308 PHE 308 626 626 PHE PHE A . n 
A 1 309 ASP 309 627 627 ASP ASP A . n 
A 1 310 LYS 310 628 628 LYS LYS A . n 
A 1 311 PHE 311 629 629 PHE PHE A . n 
A 1 312 PHE 312 630 630 PHE PHE A . n 
A 1 313 THR 313 631 631 THR THR A . n 
A 1 314 ARG 314 632 632 ARG ARG A . n 
A 1 315 GLY 315 633 633 GLY GLY A . n 
A 1 316 GLN 316 634 634 GLN GLN A . n 
A 1 317 PRO 317 635 635 PRO PRO A . n 
A 1 318 VAL 318 636 636 VAL VAL A . n 
A 1 319 LEU 319 637 637 LEU LEU A . n 
A 1 320 TPO 320 638 638 TPO TPO A . n 
A 1 321 PRO 321 639 639 PRO PRO A . n 
A 1 322 PRO 322 640 640 PRO PRO A . n 
A 1 323 ASP 323 641 641 ASP ASP A . n 
A 1 324 GLN 324 642 642 GLN GLN A . n 
A 1 325 LEU 325 643 643 LEU LEU A . n 
A 1 326 VAL 326 644 644 VAL VAL A . n 
A 1 327 ILE 327 645 645 ILE ILE A . n 
A 1 328 ALA 328 646 646 ALA ALA A . n 
A 1 329 ASN 329 647 647 ASN ASN A . n 
A 1 330 ILE 330 648 648 ILE ILE A . n 
A 1 331 ASP 331 649 649 ASP ASP A . n 
A 1 332 GLN 332 650 650 GLN GLN A . n 
A 1 333 SER 333 651 651 SER SER A . n 
A 1 334 ASP 334 652 652 ASP ASP A . n 
A 1 335 PHE 335 653 653 PHE PHE A . n 
A 1 336 GLU 336 654 654 GLU GLU A . n 
A 1 337 GLY 337 655 655 GLY GLY A . n 
A 1 338 PHE 338 656 656 PHE PHE A . n 
A 1 339 SEP 339 657 657 SEP SEP A . n 
A 1 340 TYR 340 658 658 TYR TYR A . n 
A 1 341 VAL 341 659 659 VAL VAL A . n 
A 1 342 ASN 342 660 660 ASN ASN A . n 
A 1 343 PRO 343 661 661 PRO PRO A . n 
A 1 344 GLN 344 662 662 GLN GLN A . n 
A 1 345 PHE 345 663 663 PHE PHE A . n 
A 1 346 VAL 346 664 664 VAL VAL A . n 
A 1 347 HIS 347 665 665 HIS HIS A . n 
A 1 348 PRO 348 666 666 PRO PRO A . n 
A 1 349 ILE 349 667 667 ILE ILE A . n 
A 1 350 LEU 350 668 668 LEU LEU A . n 
A 1 351 GLN 351 669 669 GLN GLN A . n 
A 1 352 SER 352 670 ?   ?   ?   A . n 
A 1 353 ALA 353 671 ?   ?   ?   A . n 
A 1 354 VAL 354 672 ?   ?   ?   A . n 
A 1 355 HIS 355 673 ?   ?   ?   A . n 
A 1 356 HIS 356 674 ?   ?   ?   A . n 
A 1 357 HIS 357 675 ?   ?   ?   A . n 
A 1 358 HIS 358 676 ?   ?   ?   A . n 
A 1 359 HIS 359 677 ?   ?   ?   A . n 
A 1 360 HIS 360 678 ?   ?   ?   A . n 
B 1 1   MET 1   319 ?   ?   ?   B . n 
B 1 2   PRO 2   320 ?   ?   ?   B . n 
B 1 3   SER 3   321 ?   ?   ?   B . n 
B 1 4   GLU 4   322 ?   ?   ?   B . n 
B 1 5   ASP 5   323 ?   ?   ?   B . n 
B 1 6   ARG 6   324 ?   ?   ?   B . n 
B 1 7   LYS 7   325 ?   ?   ?   B . n 
B 1 8   GLN 8   326 ?   ?   ?   B . n 
B 1 9   PRO 9   327 ?   ?   ?   B . n 
B 1 10  SER 10  328 ?   ?   ?   B . n 
B 1 11  ASN 11  329 ?   ?   ?   B . n 
B 1 12  ASN 12  330 ?   ?   ?   B . n 
B 1 13  LEU 13  331 ?   ?   ?   B . n 
B 1 14  ASP 14  332 332 ASP ASP B . n 
B 1 15  ARG 15  333 333 ARG ARG B . n 
B 1 16  VAL 16  334 334 VAL VAL B . n 
B 1 17  LYS 17  335 335 LYS LYS B . n 
B 1 18  LEU 18  336 336 LEU LEU B . n 
B 1 19  THR 19  337 337 THR THR B . n 
B 1 20  ASP 20  338 338 ASP ASP B . n 
B 1 21  PHE 21  339 339 PHE PHE B . n 
B 1 22  ASN 22  340 340 ASN ASN B . n 
B 1 23  PHE 23  341 341 PHE PHE B . n 
B 1 24  LEU 24  342 342 LEU LEU B . n 
B 1 25  MET 25  343 343 MET MET B . n 
B 1 26  VAL 26  344 344 VAL VAL B . n 
B 1 27  LEU 27  345 345 LEU LEU B . n 
B 1 28  GLY 28  346 346 GLY GLY B . n 
B 1 29  LYS 29  347 347 LYS LYS B . n 
B 1 30  GLY 30  348 348 GLY GLY B . n 
B 1 31  SER 31  349 349 SER SER B . n 
B 1 32  PHE 32  350 350 PHE PHE B . n 
B 1 33  GLY 33  351 351 GLY GLY B . n 
B 1 34  LYS 34  352 352 LYS LYS B . n 
B 1 35  VAL 35  353 353 VAL VAL B . n 
B 1 36  MET 36  354 354 MET MET B . n 
B 1 37  LEU 37  355 355 LEU LEU B . n 
B 1 38  ALA 38  356 356 ALA ALA B . n 
B 1 39  ASP 39  357 357 ASP ASP B . n 
B 1 40  ARG 40  358 358 ARG ARG B . n 
B 1 41  LYS 41  359 359 LYS LYS B . n 
B 1 42  GLY 42  360 360 GLY GLY B . n 
B 1 43  THR 43  361 361 THR THR B . n 
B 1 44  GLU 44  362 362 GLU GLU B . n 
B 1 45  GLU 45  363 363 GLU GLU B . n 
B 1 46  LEU 46  364 364 LEU LEU B . n 
B 1 47  TYR 47  365 365 TYR TYR B . n 
B 1 48  ALA 48  366 366 ALA ALA B . n 
B 1 49  ILE 49  367 367 ILE ILE B . n 
B 1 50  LYS 50  368 368 LYS LYS B . n 
B 1 51  ILE 51  369 369 ILE ILE B . n 
B 1 52  LEU 52  370 370 LEU LEU B . n 
B 1 53  LYS 53  371 371 LYS LYS B . n 
B 1 54  LYS 54  372 372 LYS LYS B . n 
B 1 55  ASP 55  373 373 ASP ASP B . n 
B 1 56  VAL 56  374 374 VAL VAL B . n 
B 1 57  VAL 57  375 375 VAL VAL B . n 
B 1 58  ILE 58  376 376 ILE ILE B . n 
B 1 59  GLN 59  377 377 GLN GLN B . n 
B 1 60  ASP 60  378 378 ASP ASP B . n 
B 1 61  ASP 61  379 379 ASP ASP B . n 
B 1 62  ASP 62  380 380 ASP ASP B . n 
B 1 63  VAL 63  381 381 VAL VAL B . n 
B 1 64  GLU 64  382 382 GLU GLU B . n 
B 1 65  CYS 65  383 383 CYS CYS B . n 
B 1 66  THR 66  384 384 THR THR B . n 
B 1 67  MET 67  385 385 MET MET B . n 
B 1 68  VAL 68  386 386 VAL VAL B . n 
B 1 69  GLU 69  387 387 GLU GLU B . n 
B 1 70  LYS 70  388 388 LYS LYS B . n 
B 1 71  ARG 71  389 389 ARG ARG B . n 
B 1 72  VAL 72  390 390 VAL VAL B . n 
B 1 73  LEU 73  391 391 LEU LEU B . n 
B 1 74  ALA 74  392 392 ALA ALA B . n 
B 1 75  LEU 75  393 393 LEU LEU B . n 
B 1 76  LEU 76  394 394 LEU LEU B . n 
B 1 77  ASP 77  395 395 ASP ASP B . n 
B 1 78  LYS 78  396 396 LYS LYS B . n 
B 1 79  PRO 79  397 397 PRO PRO B . n 
B 1 80  PRO 80  398 398 PRO PRO B . n 
B 1 81  PHE 81  399 399 PHE PHE B . n 
B 1 82  LEU 82  400 400 LEU LEU B . n 
B 1 83  THR 83  401 401 THR THR B . n 
B 1 84  GLN 84  402 402 GLN GLN B . n 
B 1 85  LEU 85  403 403 LEU LEU B . n 
B 1 86  HIS 86  404 404 HIS HIS B . n 
B 1 87  SER 87  405 405 SER SER B . n 
B 1 88  CYS 88  406 406 CYS CYS B . n 
B 1 89  PHE 89  407 407 PHE PHE B . n 
B 1 90  GLN 90  408 408 GLN GLN B . n 
B 1 91  THR 91  409 409 THR THR B . n 
B 1 92  VAL 92  410 410 VAL VAL B . n 
B 1 93  ASP 93  411 411 ASP ASP B . n 
B 1 94  ARG 94  412 412 ARG ARG B . n 
B 1 95  LEU 95  413 413 LEU LEU B . n 
B 1 96  TYR 96  414 414 TYR TYR B . n 
B 1 97  PHE 97  415 415 PHE PHE B . n 
B 1 98  VAL 98  416 416 VAL VAL B . n 
B 1 99  MET 99  417 417 MET MET B . n 
B 1 100 GLU 100 418 418 GLU GLU B . n 
B 1 101 TYR 101 419 419 TYR TYR B . n 
B 1 102 VAL 102 420 420 VAL VAL B . n 
B 1 103 ASN 103 421 421 ASN ASN B . n 
B 1 104 GLY 104 422 422 GLY GLY B . n 
B 1 105 GLY 105 423 423 GLY GLY B . n 
B 1 106 ASP 106 424 424 ASP ASP B . n 
B 1 107 LEU 107 425 425 LEU LEU B . n 
B 1 108 MET 108 426 426 MET MET B . n 
B 1 109 TYR 109 427 427 TYR TYR B . n 
B 1 110 HIS 110 428 428 HIS HIS B . n 
B 1 111 ILE 111 429 429 ILE ILE B . n 
B 1 112 GLN 112 430 430 GLN GLN B . n 
B 1 113 GLN 113 431 431 GLN GLN B . n 
B 1 114 VAL 114 432 432 VAL VAL B . n 
B 1 115 GLY 115 433 433 GLY GLY B . n 
B 1 116 LYS 116 434 434 LYS LYS B . n 
B 1 117 PHE 117 435 435 PHE PHE B . n 
B 1 118 LYS 118 436 436 LYS LYS B . n 
B 1 119 GLU 119 437 437 GLU GLU B . n 
B 1 120 PRO 120 438 438 PRO PRO B . n 
B 1 121 GLN 121 439 439 GLN GLN B . n 
B 1 122 ALA 122 440 440 ALA ALA B . n 
B 1 123 VAL 123 441 441 VAL VAL B . n 
B 1 124 PHE 124 442 442 PHE PHE B . n 
B 1 125 TYR 125 443 443 TYR TYR B . n 
B 1 126 ALA 126 444 444 ALA ALA B . n 
B 1 127 ALA 127 445 445 ALA ALA B . n 
B 1 128 GLU 128 446 446 GLU GLU B . n 
B 1 129 ILE 129 447 447 ILE ILE B . n 
B 1 130 SER 130 448 448 SER SER B . n 
B 1 131 ILE 131 449 449 ILE ILE B . n 
B 1 132 GLY 132 450 450 GLY GLY B . n 
B 1 133 LEU 133 451 451 LEU LEU B . n 
B 1 134 PHE 134 452 452 PHE PHE B . n 
B 1 135 PHE 135 453 453 PHE PHE B . n 
B 1 136 LEU 136 454 454 LEU LEU B . n 
B 1 137 HIS 137 455 455 HIS HIS B . n 
B 1 138 LYS 138 456 456 LYS LYS B . n 
B 1 139 ARG 139 457 457 ARG ARG B . n 
B 1 140 GLY 140 458 458 GLY GLY B . n 
B 1 141 ILE 141 459 459 ILE ILE B . n 
B 1 142 ILE 142 460 460 ILE ILE B . n 
B 1 143 TYR 143 461 461 TYR TYR B . n 
B 1 144 ARG 144 462 462 ARG ARG B . n 
B 1 145 ASP 145 463 463 ASP ASP B . n 
B 1 146 LEU 146 464 464 LEU LEU B . n 
B 1 147 LYS 147 465 465 LYS LYS B . n 
B 1 148 LEU 148 466 466 LEU LEU B . n 
B 1 149 ASP 149 467 467 ASP ASP B . n 
B 1 150 ASN 150 468 468 ASN ASN B . n 
B 1 151 VAL 151 469 469 VAL VAL B . n 
B 1 152 MET 152 470 470 MET MET B . n 
B 1 153 LEU 153 471 471 LEU LEU B . n 
B 1 154 ASP 154 472 472 ASP ASP B . n 
B 1 155 SER 155 473 473 SER SER B . n 
B 1 156 GLU 156 474 474 GLU GLU B . n 
B 1 157 GLY 157 475 475 GLY GLY B . n 
B 1 158 HIS 158 476 476 HIS HIS B . n 
B 1 159 ILE 159 477 477 ILE ILE B . n 
B 1 160 LYS 160 478 478 LYS LYS B . n 
B 1 161 ILE 161 479 479 ILE ILE B . n 
B 1 162 ALA 162 480 480 ALA ALA B . n 
B 1 163 ASP 163 481 481 ASP ASP B . n 
B 1 164 PHE 164 482 482 PHE PHE B . n 
B 1 165 GLY 165 483 483 GLY GLY B . n 
B 1 166 MET 166 484 484 MET MET B . n 
B 1 167 CYS 167 485 485 CYS CYS B . n 
B 1 168 LYS 168 486 486 LYS LYS B . n 
B 1 169 GLU 169 487 487 GLU GLU B . n 
B 1 170 HIS 170 488 488 HIS HIS B . n 
B 1 171 MET 171 489 489 MET MET B . n 
B 1 172 MET 172 490 490 MET MET B . n 
B 1 173 ASP 173 491 ?   ?   ?   B . n 
B 1 174 GLY 174 492 492 GLY GLY B . n 
B 1 175 VAL 175 493 493 VAL VAL B . n 
B 1 176 THR 176 494 494 THR THR B . n 
B 1 177 THR 177 495 495 THR THR B . n 
B 1 178 ARG 178 496 496 ARG ARG B . n 
B 1 179 GLU 179 497 497 GLU GLU B . n 
B 1 180 PHE 180 498 498 PHE PHE B . n 
B 1 181 CYS 181 499 499 CYS CYS B . n 
B 1 182 GLY 182 500 500 GLY GLY B . n 
B 1 183 THR 183 501 501 THR THR B . n 
B 1 184 PRO 184 502 502 PRO PRO B . n 
B 1 185 ASP 185 503 503 ASP ASP B . n 
B 1 186 TYR 186 504 504 TYR TYR B . n 
B 1 187 ILE 187 505 505 ILE ILE B . n 
B 1 188 ALA 188 506 506 ALA ALA B . n 
B 1 189 PRO 189 507 507 PRO PRO B . n 
B 1 190 GLU 190 508 508 GLU GLU B . n 
B 1 191 ILE 191 509 509 ILE ILE B . n 
B 1 192 ILE 192 510 510 ILE ILE B . n 
B 1 193 ALA 193 511 511 ALA ALA B . n 
B 1 194 TYR 194 512 512 TYR TYR B . n 
B 1 195 GLN 195 513 513 GLN GLN B . n 
B 1 196 PRO 196 514 514 PRO PRO B . n 
B 1 197 TYR 197 515 515 TYR TYR B . n 
B 1 198 GLY 198 516 516 GLY GLY B . n 
B 1 199 LYS 199 517 517 LYS LYS B . n 
B 1 200 SER 200 518 518 SER SER B . n 
B 1 201 VAL 201 519 519 VAL VAL B . n 
B 1 202 ASP 202 520 520 ASP ASP B . n 
B 1 203 TRP 203 521 521 TRP TRP B . n 
B 1 204 TRP 204 522 522 TRP TRP B . n 
B 1 205 ALA 205 523 523 ALA ALA B . n 
B 1 206 TYR 206 524 524 TYR TYR B . n 
B 1 207 GLY 207 525 525 GLY GLY B . n 
B 1 208 VAL 208 526 526 VAL VAL B . n 
B 1 209 LEU 209 527 527 LEU LEU B . n 
B 1 210 LEU 210 528 528 LEU LEU B . n 
B 1 211 TYR 211 529 529 TYR TYR B . n 
B 1 212 GLU 212 530 530 GLU GLU B . n 
B 1 213 MET 213 531 531 MET MET B . n 
B 1 214 LEU 214 532 532 LEU LEU B . n 
B 1 215 ALA 215 533 533 ALA ALA B . n 
B 1 216 GLY 216 534 534 GLY GLY B . n 
B 1 217 GLN 217 535 535 GLN GLN B . n 
B 1 218 PRO 218 536 536 PRO PRO B . n 
B 1 219 PRO 219 537 537 PRO PRO B . n 
B 1 220 PHE 220 538 538 PHE PHE B . n 
B 1 221 ASP 221 539 539 ASP ASP B . n 
B 1 222 GLY 222 540 540 GLY GLY B . n 
B 1 223 GLU 223 541 541 GLU GLU B . n 
B 1 224 ASP 224 542 542 ASP ASP B . n 
B 1 225 GLU 225 543 543 GLU GLU B . n 
B 1 226 ASP 226 544 544 ASP ASP B . n 
B 1 227 GLU 227 545 545 GLU GLU B . n 
B 1 228 LEU 228 546 546 LEU LEU B . n 
B 1 229 PHE 229 547 547 PHE PHE B . n 
B 1 230 GLN 230 548 548 GLN GLN B . n 
B 1 231 SER 231 549 549 SER SER B . n 
B 1 232 ILE 232 550 550 ILE ILE B . n 
B 1 233 MET 233 551 551 MET MET B . n 
B 1 234 GLU 234 552 552 GLU GLU B . n 
B 1 235 HIS 235 553 553 HIS HIS B . n 
B 1 236 ASN 236 554 554 ASN ASN B . n 
B 1 237 VAL 237 555 555 VAL VAL B . n 
B 1 238 SER 238 556 556 SER SER B . n 
B 1 239 TYR 239 557 557 TYR TYR B . n 
B 1 240 PRO 240 558 558 PRO PRO B . n 
B 1 241 LYS 241 559 559 LYS LYS B . n 
B 1 242 SER 242 560 560 SER SER B . n 
B 1 243 LEU 243 561 561 LEU LEU B . n 
B 1 244 SER 244 562 562 SER SER B . n 
B 1 245 LYS 245 563 563 LYS LYS B . n 
B 1 246 GLU 246 564 564 GLU GLU B . n 
B 1 247 ALA 247 565 565 ALA ALA B . n 
B 1 248 VAL 248 566 566 VAL VAL B . n 
B 1 249 SER 249 567 567 SER SER B . n 
B 1 250 ILE 250 568 568 ILE ILE B . n 
B 1 251 CYS 251 569 569 CYS CYS B . n 
B 1 252 LYS 252 570 570 LYS LYS B . n 
B 1 253 GLY 253 571 571 GLY GLY B . n 
B 1 254 LEU 254 572 572 LEU LEU B . n 
B 1 255 MET 255 573 573 MET MET B . n 
B 1 256 THR 256 574 574 THR THR B . n 
B 1 257 LYS 257 575 575 LYS LYS B . n 
B 1 258 HIS 258 576 576 HIS HIS B . n 
B 1 259 PRO 259 577 577 PRO PRO B . n 
B 1 260 ALA 260 578 578 ALA ALA B . n 
B 1 261 LYS 261 579 579 LYS LYS B . n 
B 1 262 ARG 262 580 580 ARG ARG B . n 
B 1 263 LEU 263 581 581 LEU LEU B . n 
B 1 264 GLY 264 582 582 GLY GLY B . n 
B 1 265 CYS 265 583 583 CYS CYS B . n 
B 1 266 GLY 266 584 584 GLY GLY B . n 
B 1 267 PRO 267 585 585 PRO PRO B . n 
B 1 268 GLU 268 586 586 GLU GLU B . n 
B 1 269 GLY 269 587 587 GLY GLY B . n 
B 1 270 GLU 270 588 588 GLU GLU B . n 
B 1 271 ARG 271 589 589 ARG ARG B . n 
B 1 272 ASP 272 590 590 ASP ASP B . n 
B 1 273 VAL 273 591 591 VAL VAL B . n 
B 1 274 ARG 274 592 592 ARG ARG B . n 
B 1 275 GLU 275 593 593 GLU GLU B . n 
B 1 276 HIS 276 594 594 HIS HIS B . n 
B 1 277 ALA 277 595 595 ALA ALA B . n 
B 1 278 PHE 278 596 596 PHE PHE B . n 
B 1 279 PHE 279 597 597 PHE PHE B . n 
B 1 280 ARG 280 598 598 ARG ARG B . n 
B 1 281 ARG 281 599 599 ARG ARG B . n 
B 1 282 ILE 282 600 600 ILE ILE B . n 
B 1 283 ASP 283 601 601 ASP ASP B . n 
B 1 284 TRP 284 602 602 TRP TRP B . n 
B 1 285 GLU 285 603 603 GLU GLU B . n 
B 1 286 LYS 286 604 604 LYS LYS B . n 
B 1 287 LEU 287 605 605 LEU LEU B . n 
B 1 288 GLU 288 606 606 GLU GLU B . n 
B 1 289 ASN 289 607 607 ASN ASN B . n 
B 1 290 ARG 290 608 608 ARG ARG B . n 
B 1 291 GLU 291 609 609 GLU GLU B . n 
B 1 292 ILE 292 610 610 ILE ILE B . n 
B 1 293 GLN 293 611 611 GLN GLN B . n 
B 1 294 PRO 294 612 612 PRO PRO B . n 
B 1 295 PRO 295 613 613 PRO PRO B . n 
B 1 296 PHE 296 614 614 PHE PHE B . n 
B 1 297 LYS 297 615 615 LYS LYS B . n 
B 1 298 PRO 298 616 616 PRO PRO B . n 
B 1 299 LYS 299 617 617 LYS LYS B . n 
B 1 300 VAL 300 618 618 VAL VAL B . n 
B 1 301 CYS 301 619 ?   ?   ?   B . n 
B 1 302 GLY 302 620 ?   ?   ?   B . n 
B 1 303 LYS 303 621 ?   ?   ?   B . n 
B 1 304 GLY 304 622 ?   ?   ?   B . n 
B 1 305 ALA 305 623 ?   ?   ?   B . n 
B 1 306 GLU 306 624 ?   ?   ?   B . n 
B 1 307 ASN 307 625 ?   ?   ?   B . n 
B 1 308 PHE 308 626 626 PHE PHE B . n 
B 1 309 ASP 309 627 627 ASP ASP B . n 
B 1 310 LYS 310 628 628 LYS LYS B . n 
B 1 311 PHE 311 629 629 PHE PHE B . n 
B 1 312 PHE 312 630 630 PHE PHE B . n 
B 1 313 THR 313 631 631 THR THR B . n 
B 1 314 ARG 314 632 632 ARG ARG B . n 
B 1 315 GLY 315 633 633 GLY GLY B . n 
B 1 316 GLN 316 634 634 GLN GLN B . n 
B 1 317 PRO 317 635 635 PRO PRO B . n 
B 1 318 VAL 318 636 636 VAL VAL B . n 
B 1 319 LEU 319 637 637 LEU LEU B . n 
B 1 320 TPO 320 638 638 TPO TPO B . n 
B 1 321 PRO 321 639 639 PRO PRO B . n 
B 1 322 PRO 322 640 640 PRO PRO B . n 
B 1 323 ASP 323 641 641 ASP ASP B . n 
B 1 324 GLN 324 642 642 GLN GLN B . n 
B 1 325 LEU 325 643 643 LEU LEU B . n 
B 1 326 VAL 326 644 644 VAL VAL B . n 
B 1 327 ILE 327 645 645 ILE ILE B . n 
B 1 328 ALA 328 646 646 ALA ALA B . n 
B 1 329 ASN 329 647 647 ASN ASN B . n 
B 1 330 ILE 330 648 648 ILE ILE B . n 
B 1 331 ASP 331 649 649 ASP ASP B . n 
B 1 332 GLN 332 650 650 GLN GLN B . n 
B 1 333 SER 333 651 651 SER SER B . n 
B 1 334 ASP 334 652 652 ASP ASP B . n 
B 1 335 PHE 335 653 653 PHE PHE B . n 
B 1 336 GLU 336 654 654 GLU GLU B . n 
B 1 337 GLY 337 655 655 GLY GLY B . n 
B 1 338 PHE 338 656 656 PHE PHE B . n 
B 1 339 SEP 339 657 657 SEP SEP B . n 
B 1 340 TYR 340 658 658 TYR TYR B . n 
B 1 341 VAL 341 659 659 VAL VAL B . n 
B 1 342 ASN 342 660 660 ASN ASN B . n 
B 1 343 PRO 343 661 661 PRO PRO B . n 
B 1 344 GLN 344 662 662 GLN GLN B . n 
B 1 345 PHE 345 663 663 PHE PHE B . n 
B 1 346 VAL 346 664 664 VAL VAL B . n 
B 1 347 HIS 347 665 665 HIS HIS B . n 
B 1 348 PRO 348 666 666 PRO PRO B . n 
B 1 349 ILE 349 667 ?   ?   ?   B . n 
B 1 350 LEU 350 668 ?   ?   ?   B . n 
B 1 351 GLN 351 669 ?   ?   ?   B . n 
B 1 352 SER 352 670 ?   ?   ?   B . n 
B 1 353 ALA 353 671 ?   ?   ?   B . n 
B 1 354 VAL 354 672 ?   ?   ?   B . n 
B 1 355 HIS 355 673 ?   ?   ?   B . n 
B 1 356 HIS 356 674 ?   ?   ?   B . n 
B 1 357 HIS 357 675 ?   ?   ?   B . n 
B 1 358 HIS 358 676 ?   ?   ?   B . n 
B 1 359 HIS 359 677 ?   ?   ?   B . n 
B 1 360 HIS 360 678 ?   ?   ?   B . n 
C 1 1   MET 1   319 ?   ?   ?   C . n 
C 1 2   PRO 2   320 ?   ?   ?   C . n 
C 1 3   SER 3   321 ?   ?   ?   C . n 
C 1 4   GLU 4   322 ?   ?   ?   C . n 
C 1 5   ASP 5   323 ?   ?   ?   C . n 
C 1 6   ARG 6   324 ?   ?   ?   C . n 
C 1 7   LYS 7   325 ?   ?   ?   C . n 
C 1 8   GLN 8   326 ?   ?   ?   C . n 
C 1 9   PRO 9   327 ?   ?   ?   C . n 
C 1 10  SER 10  328 ?   ?   ?   C . n 
C 1 11  ASN 11  329 ?   ?   ?   C . n 
C 1 12  ASN 12  330 330 ASN ASN C . n 
C 1 13  LEU 13  331 331 LEU LEU C . n 
C 1 14  ASP 14  332 332 ASP ASP C . n 
C 1 15  ARG 15  333 333 ARG ARG C . n 
C 1 16  VAL 16  334 334 VAL VAL C . n 
C 1 17  LYS 17  335 335 LYS LYS C . n 
C 1 18  LEU 18  336 336 LEU LEU C . n 
C 1 19  THR 19  337 337 THR THR C . n 
C 1 20  ASP 20  338 338 ASP ASP C . n 
C 1 21  PHE 21  339 339 PHE PHE C . n 
C 1 22  ASN 22  340 340 ASN ASN C . n 
C 1 23  PHE 23  341 341 PHE PHE C . n 
C 1 24  LEU 24  342 342 LEU LEU C . n 
C 1 25  MET 25  343 343 MET MET C . n 
C 1 26  VAL 26  344 344 VAL VAL C . n 
C 1 27  LEU 27  345 345 LEU LEU C . n 
C 1 28  GLY 28  346 346 GLY GLY C . n 
C 1 29  LYS 29  347 347 LYS LYS C . n 
C 1 30  GLY 30  348 348 GLY GLY C . n 
C 1 31  SER 31  349 349 SER SER C . n 
C 1 32  PHE 32  350 350 PHE PHE C . n 
C 1 33  GLY 33  351 351 GLY GLY C . n 
C 1 34  LYS 34  352 352 LYS LYS C . n 
C 1 35  VAL 35  353 353 VAL VAL C . n 
C 1 36  MET 36  354 354 MET MET C . n 
C 1 37  LEU 37  355 355 LEU LEU C . n 
C 1 38  ALA 38  356 356 ALA ALA C . n 
C 1 39  ASP 39  357 357 ASP ASP C . n 
C 1 40  ARG 40  358 358 ARG ARG C . n 
C 1 41  LYS 41  359 359 LYS LYS C . n 
C 1 42  GLY 42  360 360 GLY GLY C . n 
C 1 43  THR 43  361 361 THR THR C . n 
C 1 44  GLU 44  362 362 GLU GLU C . n 
C 1 45  GLU 45  363 363 GLU GLU C . n 
C 1 46  LEU 46  364 364 LEU LEU C . n 
C 1 47  TYR 47  365 365 TYR TYR C . n 
C 1 48  ALA 48  366 366 ALA ALA C . n 
C 1 49  ILE 49  367 367 ILE ILE C . n 
C 1 50  LYS 50  368 368 LYS LYS C . n 
C 1 51  ILE 51  369 369 ILE ILE C . n 
C 1 52  LEU 52  370 370 LEU LEU C . n 
C 1 53  LYS 53  371 371 LYS LYS C . n 
C 1 54  LYS 54  372 372 LYS LYS C . n 
C 1 55  ASP 55  373 373 ASP ASP C . n 
C 1 56  VAL 56  374 374 VAL VAL C . n 
C 1 57  VAL 57  375 375 VAL VAL C . n 
C 1 58  ILE 58  376 376 ILE ILE C . n 
C 1 59  GLN 59  377 377 GLN GLN C . n 
C 1 60  ASP 60  378 378 ASP ASP C . n 
C 1 61  ASP 61  379 379 ASP ASP C . n 
C 1 62  ASP 62  380 380 ASP ASP C . n 
C 1 63  VAL 63  381 381 VAL VAL C . n 
C 1 64  GLU 64  382 382 GLU GLU C . n 
C 1 65  CYS 65  383 383 CYS CYS C . n 
C 1 66  THR 66  384 384 THR THR C . n 
C 1 67  MET 67  385 385 MET MET C . n 
C 1 68  VAL 68  386 386 VAL VAL C . n 
C 1 69  GLU 69  387 387 GLU GLU C . n 
C 1 70  LYS 70  388 388 LYS LYS C . n 
C 1 71  ARG 71  389 389 ARG ARG C . n 
C 1 72  VAL 72  390 390 VAL VAL C . n 
C 1 73  LEU 73  391 391 LEU LEU C . n 
C 1 74  ALA 74  392 392 ALA ALA C . n 
C 1 75  LEU 75  393 393 LEU LEU C . n 
C 1 76  LEU 76  394 394 LEU LEU C . n 
C 1 77  ASP 77  395 395 ASP ASP C . n 
C 1 78  LYS 78  396 396 LYS LYS C . n 
C 1 79  PRO 79  397 397 PRO PRO C . n 
C 1 80  PRO 80  398 398 PRO PRO C . n 
C 1 81  PHE 81  399 399 PHE PHE C . n 
C 1 82  LEU 82  400 400 LEU LEU C . n 
C 1 83  THR 83  401 401 THR THR C . n 
C 1 84  GLN 84  402 402 GLN GLN C . n 
C 1 85  LEU 85  403 403 LEU LEU C . n 
C 1 86  HIS 86  404 404 HIS HIS C . n 
C 1 87  SER 87  405 405 SER SER C . n 
C 1 88  CYS 88  406 406 CYS CYS C . n 
C 1 89  PHE 89  407 407 PHE PHE C . n 
C 1 90  GLN 90  408 408 GLN GLN C . n 
C 1 91  THR 91  409 409 THR THR C . n 
C 1 92  VAL 92  410 410 VAL VAL C . n 
C 1 93  ASP 93  411 411 ASP ASP C . n 
C 1 94  ARG 94  412 412 ARG ARG C . n 
C 1 95  LEU 95  413 413 LEU LEU C . n 
C 1 96  TYR 96  414 414 TYR TYR C . n 
C 1 97  PHE 97  415 415 PHE PHE C . n 
C 1 98  VAL 98  416 416 VAL VAL C . n 
C 1 99  MET 99  417 417 MET MET C . n 
C 1 100 GLU 100 418 418 GLU GLU C . n 
C 1 101 TYR 101 419 419 TYR TYR C . n 
C 1 102 VAL 102 420 420 VAL VAL C . n 
C 1 103 ASN 103 421 421 ASN ASN C . n 
C 1 104 GLY 104 422 422 GLY GLY C . n 
C 1 105 GLY 105 423 423 GLY GLY C . n 
C 1 106 ASP 106 424 424 ASP ASP C . n 
C 1 107 LEU 107 425 425 LEU LEU C . n 
C 1 108 MET 108 426 426 MET MET C . n 
C 1 109 TYR 109 427 427 TYR TYR C . n 
C 1 110 HIS 110 428 428 HIS HIS C . n 
C 1 111 ILE 111 429 429 ILE ILE C . n 
C 1 112 GLN 112 430 430 GLN GLN C . n 
C 1 113 GLN 113 431 431 GLN GLN C . n 
C 1 114 VAL 114 432 432 VAL VAL C . n 
C 1 115 GLY 115 433 433 GLY GLY C . n 
C 1 116 LYS 116 434 434 LYS LYS C . n 
C 1 117 PHE 117 435 435 PHE PHE C . n 
C 1 118 LYS 118 436 436 LYS LYS C . n 
C 1 119 GLU 119 437 437 GLU GLU C . n 
C 1 120 PRO 120 438 438 PRO PRO C . n 
C 1 121 GLN 121 439 439 GLN GLN C . n 
C 1 122 ALA 122 440 440 ALA ALA C . n 
C 1 123 VAL 123 441 441 VAL VAL C . n 
C 1 124 PHE 124 442 442 PHE PHE C . n 
C 1 125 TYR 125 443 443 TYR TYR C . n 
C 1 126 ALA 126 444 444 ALA ALA C . n 
C 1 127 ALA 127 445 445 ALA ALA C . n 
C 1 128 GLU 128 446 446 GLU GLU C . n 
C 1 129 ILE 129 447 447 ILE ILE C . n 
C 1 130 SER 130 448 448 SER SER C . n 
C 1 131 ILE 131 449 449 ILE ILE C . n 
C 1 132 GLY 132 450 450 GLY GLY C . n 
C 1 133 LEU 133 451 451 LEU LEU C . n 
C 1 134 PHE 134 452 452 PHE PHE C . n 
C 1 135 PHE 135 453 453 PHE PHE C . n 
C 1 136 LEU 136 454 454 LEU LEU C . n 
C 1 137 HIS 137 455 455 HIS HIS C . n 
C 1 138 LYS 138 456 456 LYS LYS C . n 
C 1 139 ARG 139 457 457 ARG ARG C . n 
C 1 140 GLY 140 458 458 GLY GLY C . n 
C 1 141 ILE 141 459 459 ILE ILE C . n 
C 1 142 ILE 142 460 460 ILE ILE C . n 
C 1 143 TYR 143 461 461 TYR TYR C . n 
C 1 144 ARG 144 462 462 ARG ARG C . n 
C 1 145 ASP 145 463 463 ASP ASP C . n 
C 1 146 LEU 146 464 464 LEU LEU C . n 
C 1 147 LYS 147 465 465 LYS LYS C . n 
C 1 148 LEU 148 466 466 LEU LEU C . n 
C 1 149 ASP 149 467 467 ASP ASP C . n 
C 1 150 ASN 150 468 468 ASN ASN C . n 
C 1 151 VAL 151 469 469 VAL VAL C . n 
C 1 152 MET 152 470 470 MET MET C . n 
C 1 153 LEU 153 471 471 LEU LEU C . n 
C 1 154 ASP 154 472 472 ASP ASP C . n 
C 1 155 SER 155 473 473 SER SER C . n 
C 1 156 GLU 156 474 474 GLU GLU C . n 
C 1 157 GLY 157 475 475 GLY GLY C . n 
C 1 158 HIS 158 476 476 HIS HIS C . n 
C 1 159 ILE 159 477 477 ILE ILE C . n 
C 1 160 LYS 160 478 478 LYS LYS C . n 
C 1 161 ILE 161 479 479 ILE ILE C . n 
C 1 162 ALA 162 480 480 ALA ALA C . n 
C 1 163 ASP 163 481 481 ASP ASP C . n 
C 1 164 PHE 164 482 482 PHE PHE C . n 
C 1 165 GLY 165 483 483 GLY GLY C . n 
C 1 166 MET 166 484 484 MET MET C . n 
C 1 167 CYS 167 485 485 CYS CYS C . n 
C 1 168 LYS 168 486 486 LYS LYS C . n 
C 1 169 GLU 169 487 487 GLU GLU C . n 
C 1 170 HIS 170 488 488 HIS HIS C . n 
C 1 171 MET 171 489 489 MET MET C . n 
C 1 172 MET 172 490 490 MET MET C . n 
C 1 173 ASP 173 491 491 ASP ASP C . n 
C 1 174 GLY 174 492 492 GLY GLY C . n 
C 1 175 VAL 175 493 493 VAL VAL C . n 
C 1 176 THR 176 494 494 THR THR C . n 
C 1 177 THR 177 495 495 THR THR C . n 
C 1 178 ARG 178 496 496 ARG ARG C . n 
C 1 179 GLU 179 497 497 GLU GLU C . n 
C 1 180 PHE 180 498 498 PHE PHE C . n 
C 1 181 CYS 181 499 499 CYS CYS C . n 
C 1 182 GLY 182 500 500 GLY GLY C . n 
C 1 183 THR 183 501 501 THR THR C . n 
C 1 184 PRO 184 502 502 PRO PRO C . n 
C 1 185 ASP 185 503 503 ASP ASP C . n 
C 1 186 TYR 186 504 504 TYR TYR C . n 
C 1 187 ILE 187 505 505 ILE ILE C . n 
C 1 188 ALA 188 506 506 ALA ALA C . n 
C 1 189 PRO 189 507 507 PRO PRO C . n 
C 1 190 GLU 190 508 508 GLU GLU C . n 
C 1 191 ILE 191 509 509 ILE ILE C . n 
C 1 192 ILE 192 510 510 ILE ILE C . n 
C 1 193 ALA 193 511 511 ALA ALA C . n 
C 1 194 TYR 194 512 512 TYR TYR C . n 
C 1 195 GLN 195 513 513 GLN GLN C . n 
C 1 196 PRO 196 514 514 PRO PRO C . n 
C 1 197 TYR 197 515 515 TYR TYR C . n 
C 1 198 GLY 198 516 516 GLY GLY C . n 
C 1 199 LYS 199 517 517 LYS LYS C . n 
C 1 200 SER 200 518 518 SER SER C . n 
C 1 201 VAL 201 519 519 VAL VAL C . n 
C 1 202 ASP 202 520 520 ASP ASP C . n 
C 1 203 TRP 203 521 521 TRP TRP C . n 
C 1 204 TRP 204 522 522 TRP TRP C . n 
C 1 205 ALA 205 523 523 ALA ALA C . n 
C 1 206 TYR 206 524 524 TYR TYR C . n 
C 1 207 GLY 207 525 525 GLY GLY C . n 
C 1 208 VAL 208 526 526 VAL VAL C . n 
C 1 209 LEU 209 527 527 LEU LEU C . n 
C 1 210 LEU 210 528 528 LEU LEU C . n 
C 1 211 TYR 211 529 529 TYR TYR C . n 
C 1 212 GLU 212 530 530 GLU GLU C . n 
C 1 213 MET 213 531 531 MET MET C . n 
C 1 214 LEU 214 532 532 LEU LEU C . n 
C 1 215 ALA 215 533 533 ALA ALA C . n 
C 1 216 GLY 216 534 534 GLY GLY C . n 
C 1 217 GLN 217 535 535 GLN GLN C . n 
C 1 218 PRO 218 536 536 PRO PRO C . n 
C 1 219 PRO 219 537 537 PRO PRO C . n 
C 1 220 PHE 220 538 538 PHE PHE C . n 
C 1 221 ASP 221 539 539 ASP ASP C . n 
C 1 222 GLY 222 540 540 GLY GLY C . n 
C 1 223 GLU 223 541 541 GLU GLU C . n 
C 1 224 ASP 224 542 542 ASP ASP C . n 
C 1 225 GLU 225 543 543 GLU GLU C . n 
C 1 226 ASP 226 544 544 ASP ASP C . n 
C 1 227 GLU 227 545 545 GLU GLU C . n 
C 1 228 LEU 228 546 546 LEU LEU C . n 
C 1 229 PHE 229 547 547 PHE PHE C . n 
C 1 230 GLN 230 548 548 GLN GLN C . n 
C 1 231 SER 231 549 549 SER SER C . n 
C 1 232 ILE 232 550 550 ILE ILE C . n 
C 1 233 MET 233 551 551 MET MET C . n 
C 1 234 GLU 234 552 552 GLU GLU C . n 
C 1 235 HIS 235 553 553 HIS HIS C . n 
C 1 236 ASN 236 554 554 ASN ASN C . n 
C 1 237 VAL 237 555 555 VAL VAL C . n 
C 1 238 SER 238 556 556 SER SER C . n 
C 1 239 TYR 239 557 557 TYR TYR C . n 
C 1 240 PRO 240 558 558 PRO PRO C . n 
C 1 241 LYS 241 559 559 LYS LYS C . n 
C 1 242 SER 242 560 560 SER SER C . n 
C 1 243 LEU 243 561 561 LEU LEU C . n 
C 1 244 SER 244 562 562 SER SER C . n 
C 1 245 LYS 245 563 563 LYS LYS C . n 
C 1 246 GLU 246 564 564 GLU GLU C . n 
C 1 247 ALA 247 565 565 ALA ALA C . n 
C 1 248 VAL 248 566 566 VAL VAL C . n 
C 1 249 SER 249 567 567 SER SER C . n 
C 1 250 ILE 250 568 568 ILE ILE C . n 
C 1 251 CYS 251 569 569 CYS CYS C . n 
C 1 252 LYS 252 570 570 LYS LYS C . n 
C 1 253 GLY 253 571 571 GLY GLY C . n 
C 1 254 LEU 254 572 572 LEU LEU C . n 
C 1 255 MET 255 573 573 MET MET C . n 
C 1 256 THR 256 574 574 THR THR C . n 
C 1 257 LYS 257 575 575 LYS LYS C . n 
C 1 258 HIS 258 576 576 HIS HIS C . n 
C 1 259 PRO 259 577 577 PRO PRO C . n 
C 1 260 ALA 260 578 578 ALA ALA C . n 
C 1 261 LYS 261 579 579 LYS LYS C . n 
C 1 262 ARG 262 580 580 ARG ARG C . n 
C 1 263 LEU 263 581 581 LEU LEU C . n 
C 1 264 GLY 264 582 582 GLY GLY C . n 
C 1 265 CYS 265 583 583 CYS CYS C . n 
C 1 266 GLY 266 584 584 GLY GLY C . n 
C 1 267 PRO 267 585 585 PRO PRO C . n 
C 1 268 GLU 268 586 586 GLU GLU C . n 
C 1 269 GLY 269 587 587 GLY GLY C . n 
C 1 270 GLU 270 588 588 GLU GLU C . n 
C 1 271 ARG 271 589 589 ARG ARG C . n 
C 1 272 ASP 272 590 590 ASP ASP C . n 
C 1 273 VAL 273 591 591 VAL VAL C . n 
C 1 274 ARG 274 592 592 ARG ARG C . n 
C 1 275 GLU 275 593 593 GLU GLU C . n 
C 1 276 HIS 276 594 594 HIS HIS C . n 
C 1 277 ALA 277 595 595 ALA ALA C . n 
C 1 278 PHE 278 596 596 PHE PHE C . n 
C 1 279 PHE 279 597 597 PHE PHE C . n 
C 1 280 ARG 280 598 598 ARG ARG C . n 
C 1 281 ARG 281 599 599 ARG ARG C . n 
C 1 282 ILE 282 600 600 ILE ILE C . n 
C 1 283 ASP 283 601 601 ASP ASP C . n 
C 1 284 TRP 284 602 602 TRP TRP C . n 
C 1 285 GLU 285 603 603 GLU GLU C . n 
C 1 286 LYS 286 604 604 LYS LYS C . n 
C 1 287 LEU 287 605 605 LEU LEU C . n 
C 1 288 GLU 288 606 606 GLU GLU C . n 
C 1 289 ASN 289 607 607 ASN ASN C . n 
C 1 290 ARG 290 608 608 ARG ARG C . n 
C 1 291 GLU 291 609 609 GLU GLU C . n 
C 1 292 ILE 292 610 610 ILE ILE C . n 
C 1 293 GLN 293 611 611 GLN GLN C . n 
C 1 294 PRO 294 612 612 PRO PRO C . n 
C 1 295 PRO 295 613 613 PRO PRO C . n 
C 1 296 PHE 296 614 614 PHE PHE C . n 
C 1 297 LYS 297 615 615 LYS LYS C . n 
C 1 298 PRO 298 616 616 PRO PRO C . n 
C 1 299 LYS 299 617 617 LYS LYS C . n 
C 1 300 VAL 300 618 618 VAL VAL C . n 
C 1 301 CYS 301 619 ?   ?   ?   C . n 
C 1 302 GLY 302 620 ?   ?   ?   C . n 
C 1 303 LYS 303 621 ?   ?   ?   C . n 
C 1 304 GLY 304 622 ?   ?   ?   C . n 
C 1 305 ALA 305 623 ?   ?   ?   C . n 
C 1 306 GLU 306 624 ?   ?   ?   C . n 
C 1 307 ASN 307 625 ?   ?   ?   C . n 
C 1 308 PHE 308 626 626 PHE PHE C . n 
C 1 309 ASP 309 627 627 ASP ASP C . n 
C 1 310 LYS 310 628 628 LYS LYS C . n 
C 1 311 PHE 311 629 629 PHE PHE C . n 
C 1 312 PHE 312 630 630 PHE PHE C . n 
C 1 313 THR 313 631 631 THR THR C . n 
C 1 314 ARG 314 632 632 ARG ARG C . n 
C 1 315 GLY 315 633 633 GLY GLY C . n 
C 1 316 GLN 316 634 634 GLN GLN C . n 
C 1 317 PRO 317 635 635 PRO PRO C . n 
C 1 318 VAL 318 636 636 VAL VAL C . n 
C 1 319 LEU 319 637 637 LEU LEU C . n 
C 1 320 TPO 320 638 638 TPO TPO C . n 
C 1 321 PRO 321 639 639 PRO PRO C . n 
C 1 322 PRO 322 640 640 PRO PRO C . n 
C 1 323 ASP 323 641 641 ASP ASP C . n 
C 1 324 GLN 324 642 642 GLN GLN C . n 
C 1 325 LEU 325 643 643 LEU LEU C . n 
C 1 326 VAL 326 644 644 VAL VAL C . n 
C 1 327 ILE 327 645 645 ILE ILE C . n 
C 1 328 ALA 328 646 646 ALA ALA C . n 
C 1 329 ASN 329 647 647 ASN ASN C . n 
C 1 330 ILE 330 648 648 ILE ILE C . n 
C 1 331 ASP 331 649 649 ASP ASP C . n 
C 1 332 GLN 332 650 650 GLN GLN C . n 
C 1 333 SER 333 651 651 SER SER C . n 
C 1 334 ASP 334 652 652 ASP ASP C . n 
C 1 335 PHE 335 653 653 PHE PHE C . n 
C 1 336 GLU 336 654 654 GLU GLU C . n 
C 1 337 GLY 337 655 655 GLY GLY C . n 
C 1 338 PHE 338 656 656 PHE PHE C . n 
C 1 339 SEP 339 657 657 SEP SEP C . n 
C 1 340 TYR 340 658 658 TYR TYR C . n 
C 1 341 VAL 341 659 659 VAL VAL C . n 
C 1 342 ASN 342 660 660 ASN ASN C . n 
C 1 343 PRO 343 661 661 PRO PRO C . n 
C 1 344 GLN 344 662 662 GLN GLN C . n 
C 1 345 PHE 345 663 663 PHE PHE C . n 
C 1 346 VAL 346 664 664 VAL VAL C . n 
C 1 347 HIS 347 665 665 HIS HIS C . n 
C 1 348 PRO 348 666 666 PRO PRO C . n 
C 1 349 ILE 349 667 667 ILE ILE C . n 
C 1 350 LEU 350 668 668 LEU LEU C . n 
C 1 351 GLN 351 669 669 GLN GLN C . n 
C 1 352 SER 352 670 670 SER SER C . n 
C 1 353 ALA 353 671 ?   ?   ?   C . n 
C 1 354 VAL 354 672 ?   ?   ?   C . n 
C 1 355 HIS 355 673 ?   ?   ?   C . n 
C 1 356 HIS 356 674 ?   ?   ?   C . n 
C 1 357 HIS 357 675 ?   ?   ?   C . n 
C 1 358 HIS 358 676 ?   ?   ?   C . n 
C 1 359 HIS 359 677 ?   ?   ?   C . n 
C 1 360 HIS 360 678 ?   ?   ?   C . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
D 2 LW4 1  901 901 LW4 LIG A . 
E 2 LW4 1  901 901 LW4 LIG B . 
F 2 LW4 1  901 901 LW4 LIG C . 
G 3 HOH 1  3   3   HOH HOH A . 
G 3 HOH 2  4   4   HOH HOH A . 
G 3 HOH 3  12  12  HOH HOH A . 
G 3 HOH 4  20  20  HOH HOH A . 
G 3 HOH 5  21  21  HOH HOH A . 
G 3 HOH 6  22  22  HOH HOH A . 
G 3 HOH 7  23  23  HOH HOH A . 
G 3 HOH 8  24  24  HOH HOH A . 
G 3 HOH 9  26  26  HOH HOH A . 
G 3 HOH 10 32  32  HOH HOH A . 
G 3 HOH 11 33  33  HOH HOH A . 
G 3 HOH 12 34  34  HOH HOH A . 
G 3 HOH 13 35  35  HOH HOH A . 
G 3 HOH 14 38  38  HOH HOH A . 
G 3 HOH 15 41  41  HOH HOH A . 
G 3 HOH 16 42  42  HOH HOH A . 
G 3 HOH 17 45  45  HOH HOH A . 
G 3 HOH 18 46  46  HOH HOH A . 
G 3 HOH 19 52  52  HOH HOH A . 
H 3 HOH 1  1   1   HOH HOH B . 
H 3 HOH 2  2   2   HOH HOH B . 
H 3 HOH 3  7   7   HOH HOH B . 
H 3 HOH 4  16  16  HOH HOH B . 
H 3 HOH 5  18  18  HOH HOH B . 
H 3 HOH 6  19  19  HOH HOH B . 
H 3 HOH 7  40  40  HOH HOH B . 
I 3 HOH 1  5   5   HOH HOH C . 
I 3 HOH 2  6   6   HOH HOH C . 
I 3 HOH 3  8   8   HOH HOH C . 
I 3 HOH 4  9   9   HOH HOH C . 
I 3 HOH 5  11  11  HOH HOH C . 
I 3 HOH 6  14  14  HOH HOH C . 
I 3 HOH 7  15  15  HOH HOH C . 
I 3 HOH 8  17  17  HOH HOH C . 
I 3 HOH 9  25  25  HOH HOH C . 
I 3 HOH 10 27  27  HOH HOH C . 
I 3 HOH 11 28  28  HOH HOH C . 
I 3 HOH 12 29  29  HOH HOH C . 
I 3 HOH 13 31  31  HOH HOH C . 
I 3 HOH 14 37  37  HOH HOH C . 
I 3 HOH 15 39  39  HOH HOH C . 
I 3 HOH 16 43  43  HOH HOH C . 
I 3 HOH 17 44  44  HOH HOH C . 
I 3 HOH 18 50  50  HOH HOH C . 
I 3 HOH 19 51  51  HOH HOH C . 
I 3 HOH 20 53  53  HOH HOH C . 
# 
loop_
_pdbx_struct_mod_residue.id 
_pdbx_struct_mod_residue.label_asym_id 
_pdbx_struct_mod_residue.label_comp_id 
_pdbx_struct_mod_residue.label_seq_id 
_pdbx_struct_mod_residue.auth_asym_id 
_pdbx_struct_mod_residue.auth_comp_id 
_pdbx_struct_mod_residue.auth_seq_id 
_pdbx_struct_mod_residue.PDB_ins_code 
_pdbx_struct_mod_residue.parent_comp_id 
_pdbx_struct_mod_residue.details 
1 A TPO 320 A TPO 638 ? THR PHOSPHOTHREONINE 
2 A SEP 339 A SEP 657 ? SER PHOSPHOSERINE    
3 B TPO 320 B TPO 638 ? THR PHOSPHOTHREONINE 
4 B SEP 339 B SEP 657 ? SER PHOSPHOSERINE    
5 C TPO 320 C TPO 638 ? THR PHOSPHOTHREONINE 
6 C SEP 339 C SEP 657 ? SER PHOSPHOSERINE    
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA monomeric 1 
2 author_and_software_defined_assembly PISA monomeric 1 
3 author_and_software_defined_assembly PISA monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,D,G 
2 1 B,E,H 
3 1 C,F,I 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-11-03 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2017-11-01 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' Advisory                    
2 2 'Structure model' 'Refinement description'    
3 2 'Structure model' 'Version format compliance' 
4 3 'Structure model' 'Refinement description'    
# 
_pdbx_audit_revision_category.ordinal             1 
_pdbx_audit_revision_category.revision_ordinal    3 
_pdbx_audit_revision_category.data_content_type   'Structure model' 
_pdbx_audit_revision_category.category            software 
# 
_pdbx_audit_revision_item.ordinal             1 
_pdbx_audit_revision_item.revision_ordinal    3 
_pdbx_audit_revision_item.data_content_type   'Structure model' 
_pdbx_audit_revision_item.item                '_software.name' 
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
'X-RAY DIFFRACTION' 1 ? refined 0.3760   26.1100 57.1840 0.0204 0.0501 0.1269 0.0009 0.0063 -0.0547 1.1844 0.4806 0.5645 -0.1669 
0.3323 0.0297  -0.0035 -0.0781 0.0816 -0.1544 0.3527  0.0170  0.0425  0.0502 -0.0386 
'X-RAY DIFFRACTION' 2 ? refined -20.8270 19.7510 24.7700 0.1494 0.0656 0.0578 0.0562 0.0397 0.0365  0.5189 2.1733 0.6534 0.0972  
0.0268 -0.6817 0.0732  -0.1225 0.0493 0.0853  0.0845  0.0093  -0.4984 0.1775 -0.0025 
'X-RAY DIFFRACTION' 3 ? refined -21.6180 68.5730 15.2070 0.0362 0.0782 0.0531 0.0044 0.0138 0.0622  0.7428 0.4013 1.0277 0.0250  
0.1195 0.2702  -0.0014 -0.0286 0.0299 -0.1128 -0.0953 -0.0233 0.0431  0.0648 0.0193  
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1 1 A 331 A 669 ? . . . . ? 
'X-RAY DIFFRACTION' 2 2 B 332 B 666 ? . . . . ? 
'X-RAY DIFFRACTION' 3 3 C 330 C 670 ? . . . . ? 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 XSCALE      .     ?               package 'Wolfgang Kabsch'    ?                     'data scaling'    
http://www.mpimf-heidelberg.mpg.de/~kabsch/xds/html_doc/xscale_program.html ?          ? 
2 REFMAC      .     ?               program 'Garib N. Murshudov' garib@ysbl.york.ac.uk refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html                                Fortran_77 ? 
3 PDB_EXTRACT 3.005 'June 11, 2008' package PDB                  help@deposit.rcsb.org 'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/                                   C++        ? 
4 MAR345      .     ?               ?       ?                    ?                     'data collection' ? ?          ? 
5 XDS         .     ?               ?       ?                    ?                     'data reduction'  ? ?          ? 
6 REFMAC      .     ?               ?       ?                    ?                     phasing           ? ?          ? 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   NH1 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   ARG 
_pdbx_validate_close_contact.auth_seq_id_1    599 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    21 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.18 
# 
loop_
_pdbx_validate_rmsd_bond.id 
_pdbx_validate_rmsd_bond.PDB_model_num 
_pdbx_validate_rmsd_bond.auth_atom_id_1 
_pdbx_validate_rmsd_bond.auth_asym_id_1 
_pdbx_validate_rmsd_bond.auth_comp_id_1 
_pdbx_validate_rmsd_bond.auth_seq_id_1 
_pdbx_validate_rmsd_bond.PDB_ins_code_1 
_pdbx_validate_rmsd_bond.label_alt_id_1 
_pdbx_validate_rmsd_bond.auth_atom_id_2 
_pdbx_validate_rmsd_bond.auth_asym_id_2 
_pdbx_validate_rmsd_bond.auth_comp_id_2 
_pdbx_validate_rmsd_bond.auth_seq_id_2 
_pdbx_validate_rmsd_bond.PDB_ins_code_2 
_pdbx_validate_rmsd_bond.label_alt_id_2 
_pdbx_validate_rmsd_bond.bond_value 
_pdbx_validate_rmsd_bond.bond_target_value 
_pdbx_validate_rmsd_bond.bond_deviation 
_pdbx_validate_rmsd_bond.bond_standard_deviation 
_pdbx_validate_rmsd_bond.linker_flag 
1 1 CB A CYS 406 ? ? SG A CYS 406 ? ? 1.681 1.812 -0.131 0.016 N 
2 1 CB C CYS 406 ? ? SG C CYS 406 ? ? 1.691 1.812 -0.121 0.016 N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASP A 332 ? ? -91.51  39.15   
2  1 LYS A 335 ? ? -117.45 -166.08 
3  1 LEU A 342 ? ? -73.44  -84.85  
4  1 PHE A 350 ? ? -69.50  6.10    
5  1 PRO A 397 ? ? -48.73  160.29  
6  1 SER A 405 ? ? 175.97  166.79  
7  1 ARG A 462 ? ? 57.81   14.63   
8  1 ASP A 463 ? ? -150.22 27.92   
9  1 ASP A 481 ? ? 59.08   89.37   
10 1 MET A 484 ? ? -152.28 24.52   
11 1 MET A 489 ? ? -103.00 74.18   
12 1 MET A 573 ? ? -98.37  49.66   
13 1 GLU A 586 ? ? -98.68  37.92   
14 1 ARG A 598 ? ? -48.98  -71.18  
15 1 GLU A 606 ? ? -66.29  4.37    
16 1 LYS A 617 ? ? -37.84  140.82  
17 1 PRO A 635 ? ? -52.54  109.03  
18 1 TPO A 638 ? ? -39.11  137.86  
19 1 ALA A 646 ? ? -38.93  -31.90  
20 1 ASP A 649 ? ? -59.35  95.18   
21 1 ASP A 652 ? ? -45.67  -16.79  
22 1 THR B 361 ? ? -166.13 117.17  
23 1 GLU B 362 ? ? -43.82  -5.52   
24 1 SER B 405 ? ? 179.56  161.50  
25 1 ILE B 429 ? ? -29.35  -48.28  
26 1 ASP B 463 ? ? -155.79 29.95   
27 1 ASP B 481 ? ? 60.88   102.14  
28 1 MET B 489 ? ? -103.88 70.03   
29 1 LYS B 517 ? ? -54.05  -5.05   
30 1 LYS B 559 ? ? -58.47  13.04   
31 1 ALA B 565 ? ? -56.65  -70.57  
32 1 MET B 573 ? ? -94.62  32.67   
33 1 ALA B 578 ? ? -33.17  -38.99  
34 1 LEU B 581 ? ? -49.94  106.03  
35 1 PRO B 585 ? ? -59.31  -70.19  
36 1 GLU B 588 ? ? -37.92  -71.59  
37 1 ASP B 590 ? ? -20.38  -62.33  
38 1 GLU B 593 ? ? -63.03  -79.39  
39 1 HIS B 594 ? ? -6.16   138.20  
40 1 LEU B 605 ? ? -67.60  -71.99  
41 1 GLU B 606 ? ? -59.21  17.13   
42 1 ILE B 610 ? ? -59.64  106.25  
43 1 PRO B 613 ? ? -13.30  -67.21  
44 1 ASP C 332 ? ? -83.42  47.23   
45 1 LYS C 359 ? ? -28.97  129.99  
46 1 LEU C 393 ? ? -47.65  155.61  
47 1 ASP C 463 ? ? -141.74 29.74   
48 1 ASP C 481 ? ? 58.36   93.10   
49 1 HIS C 488 ? ? 28.87   42.46   
50 1 ASP C 491 ? ? -26.72  95.36   
51 1 GLN C 662 ? ? -110.85 57.00   
# 
_pdbx_validate_peptide_omega.id               1 
_pdbx_validate_peptide_omega.PDB_model_num    1 
_pdbx_validate_peptide_omega.auth_comp_id_1   VAL 
_pdbx_validate_peptide_omega.auth_asym_id_1   A 
_pdbx_validate_peptide_omega.auth_seq_id_1    420 
_pdbx_validate_peptide_omega.PDB_ins_code_1   ? 
_pdbx_validate_peptide_omega.label_alt_id_1   ? 
_pdbx_validate_peptide_omega.auth_comp_id_2   ASN 
_pdbx_validate_peptide_omega.auth_asym_id_2   A 
_pdbx_validate_peptide_omega.auth_seq_id_2    421 
_pdbx_validate_peptide_omega.PDB_ins_code_2   ? 
_pdbx_validate_peptide_omega.label_alt_id_2   ? 
_pdbx_validate_peptide_omega.omega            -148.35 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LEU 331 ? CG  ? A LEU 13  CG  
2  1 Y 1 A LEU 331 ? CD1 ? A LEU 13  CD1 
3  1 Y 1 A LEU 331 ? CD2 ? A LEU 13  CD2 
4  1 Y 1 A PHE 626 ? CG  ? A PHE 308 CG  
5  1 Y 1 A PHE 626 ? CD1 ? A PHE 308 CD1 
6  1 Y 1 A PHE 626 ? CD2 ? A PHE 308 CD2 
7  1 Y 1 A PHE 626 ? CE1 ? A PHE 308 CE1 
8  1 Y 1 A PHE 626 ? CE2 ? A PHE 308 CE2 
9  1 Y 1 A PHE 626 ? CZ  ? A PHE 308 CZ  
10 1 Y 1 A GLN 669 ? CG  ? A GLN 351 CG  
11 1 Y 1 A GLN 669 ? CD  ? A GLN 351 CD  
12 1 Y 1 A GLN 669 ? OE1 ? A GLN 351 OE1 
13 1 Y 1 A GLN 669 ? NE2 ? A GLN 351 NE2 
14 1 Y 1 C PHE 626 ? CG  ? C PHE 308 CG  
15 1 Y 1 C PHE 626 ? CD1 ? C PHE 308 CD1 
16 1 Y 1 C PHE 626 ? CD2 ? C PHE 308 CD2 
17 1 Y 1 C PHE 626 ? CE1 ? C PHE 308 CE1 
18 1 Y 1 C PHE 626 ? CE2 ? C PHE 308 CE2 
19 1 Y 1 C PHE 626 ? CZ  ? C PHE 308 CZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 319 ? A MET 1   
2  1 Y 1 A PRO 320 ? A PRO 2   
3  1 Y 1 A SER 321 ? A SER 3   
4  1 Y 1 A GLU 322 ? A GLU 4   
5  1 Y 1 A ASP 323 ? A ASP 5   
6  1 Y 1 A ARG 324 ? A ARG 6   
7  1 Y 1 A LYS 325 ? A LYS 7   
8  1 Y 1 A GLN 326 ? A GLN 8   
9  1 Y 1 A PRO 327 ? A PRO 9   
10 1 Y 1 A SER 328 ? A SER 10  
11 1 Y 1 A ASN 329 ? A ASN 11  
12 1 Y 1 A ASN 330 ? A ASN 12  
13 1 Y 1 A CYS 619 ? A CYS 301 
14 1 Y 1 A GLY 620 ? A GLY 302 
15 1 Y 1 A LYS 621 ? A LYS 303 
16 1 Y 1 A GLY 622 ? A GLY 304 
17 1 Y 1 A ALA 623 ? A ALA 305 
18 1 Y 1 A GLU 624 ? A GLU 306 
19 1 Y 1 A ASN 625 ? A ASN 307 
20 1 Y 1 A SER 670 ? A SER 352 
21 1 Y 1 A ALA 671 ? A ALA 353 
22 1 Y 1 A VAL 672 ? A VAL 354 
23 1 Y 1 A HIS 673 ? A HIS 355 
24 1 Y 1 A HIS 674 ? A HIS 356 
25 1 Y 1 A HIS 675 ? A HIS 357 
26 1 Y 1 A HIS 676 ? A HIS 358 
27 1 Y 1 A HIS 677 ? A HIS 359 
28 1 Y 1 A HIS 678 ? A HIS 360 
29 1 Y 1 B MET 319 ? B MET 1   
30 1 Y 1 B PRO 320 ? B PRO 2   
31 1 Y 1 B SER 321 ? B SER 3   
32 1 Y 1 B GLU 322 ? B GLU 4   
33 1 Y 1 B ASP 323 ? B ASP 5   
34 1 Y 1 B ARG 324 ? B ARG 6   
35 1 Y 1 B LYS 325 ? B LYS 7   
36 1 Y 1 B GLN 326 ? B GLN 8   
37 1 Y 1 B PRO 327 ? B PRO 9   
38 1 Y 1 B SER 328 ? B SER 10  
39 1 Y 1 B ASN 329 ? B ASN 11  
40 1 Y 1 B ASN 330 ? B ASN 12  
41 1 Y 1 B LEU 331 ? B LEU 13  
42 1 Y 1 B ASP 491 ? B ASP 173 
43 1 Y 1 B CYS 619 ? B CYS 301 
44 1 Y 1 B GLY 620 ? B GLY 302 
45 1 Y 1 B LYS 621 ? B LYS 303 
46 1 Y 1 B GLY 622 ? B GLY 304 
47 1 Y 1 B ALA 623 ? B ALA 305 
48 1 Y 1 B GLU 624 ? B GLU 306 
49 1 Y 1 B ASN 625 ? B ASN 307 
50 1 Y 1 B ILE 667 ? B ILE 349 
51 1 Y 1 B LEU 668 ? B LEU 350 
52 1 Y 1 B GLN 669 ? B GLN 351 
53 1 Y 1 B SER 670 ? B SER 352 
54 1 Y 1 B ALA 671 ? B ALA 353 
55 1 Y 1 B VAL 672 ? B VAL 354 
56 1 Y 1 B HIS 673 ? B HIS 355 
57 1 Y 1 B HIS 674 ? B HIS 356 
58 1 Y 1 B HIS 675 ? B HIS 357 
59 1 Y 1 B HIS 676 ? B HIS 358 
60 1 Y 1 B HIS 677 ? B HIS 359 
61 1 Y 1 B HIS 678 ? B HIS 360 
62 1 Y 1 C MET 319 ? C MET 1   
63 1 Y 1 C PRO 320 ? C PRO 2   
64 1 Y 1 C SER 321 ? C SER 3   
65 1 Y 1 C GLU 322 ? C GLU 4   
66 1 Y 1 C ASP 323 ? C ASP 5   
67 1 Y 1 C ARG 324 ? C ARG 6   
68 1 Y 1 C LYS 325 ? C LYS 7   
69 1 Y 1 C GLN 326 ? C GLN 8   
70 1 Y 1 C PRO 327 ? C PRO 9   
71 1 Y 1 C SER 328 ? C SER 10  
72 1 Y 1 C ASN 329 ? C ASN 11  
73 1 Y 1 C CYS 619 ? C CYS 301 
74 1 Y 1 C GLY 620 ? C GLY 302 
75 1 Y 1 C LYS 621 ? C LYS 303 
76 1 Y 1 C GLY 622 ? C GLY 304 
77 1 Y 1 C ALA 623 ? C ALA 305 
78 1 Y 1 C GLU 624 ? C GLU 306 
79 1 Y 1 C ASN 625 ? C ASN 307 
80 1 Y 1 C ALA 671 ? C ALA 353 
81 1 Y 1 C VAL 672 ? C VAL 354 
82 1 Y 1 C HIS 673 ? C HIS 355 
83 1 Y 1 C HIS 674 ? C HIS 356 
84 1 Y 1 C HIS 675 ? C HIS 357 
85 1 Y 1 C HIS 676 ? C HIS 358 
86 1 Y 1 C HIS 677 ? C HIS 359 
87 1 Y 1 C HIS 678 ? C HIS 360 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '3-(1H-indol-3-yl)-4-[2-(4-methylpiperazin-1-yl)quinazolin-4-yl]-1H-pyrrole-2,5-dione' LW4 
3 water                                                                                  HOH 
#