data_3J9X
# 
_entry.id   3J9X 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.296 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
RCSB  RCSB160435   
PDB   3J9X         
WWPDB D_1000160435 
# 
_pdbx_database_related.db_name        EMDB 
_pdbx_database_related.db_id          EMD-6310 
_pdbx_database_related.content_type   'associated EM volume' 
_pdbx_database_related.details        . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3J9X 
_pdbx_database_status.recvd_initial_deposition_date   2015-03-21 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'DiMaio, F.'       1 
'Yu, X.'           2 
'Rensen, E.'       3 
'Krupovic, M.'     4 
'Prangishvili, D.' 5 
'Egelman, E.'      6 
# 
_citation.id                        primary 
_citation.title                     'A virus that infects a hyperthermophile encapsidates A-form DNA.' 
_citation.journal_abbrev            Science 
_citation.journal_volume            348 
_citation.page_first                914 
_citation.page_last                 917 
_citation.year                      2015 
_citation.journal_id_ASTM           SCIEAS 
_citation.country                   US 
_citation.journal_id_ISSN           0036-8075 
_citation.journal_id_CSD            0038 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   25999507 
_citation.pdbx_database_id_DOI      10.1126/science.aaa4181 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'DiMaio, F.'       1 
primary 'Yu, X.'           2 
primary 'Rensen, E.'       3 
primary 'Krupovic, M.'     4 
primary 'Prangishvili, D.' 5 
primary 'Egelman, E.H.'    6 
# 
_cell.entry_id           3J9X 
_cell.length_a           1 
_cell.length_b           1 
_cell.length_c           1 
_cell.angle_alpha        90 
_cell.angle_beta         90 
_cell.angle_gamma        90 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3J9X 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer nat 'coat protein' 13760.465  58 ? ? ? ? 
2 polymer nat DNA            107382.531 2  ? ? ? ? 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'        no no 
;SRSYSQRYAKWQAKFNAFSNPTVASTILSNVSPVAQQNFQTNVPKFTSVNENVSAVLTQYGITGPNRAIYQGFGLKVARA
LNRIGSGPALVNMINGLKGYYISAFNANPQVLDAVVNIITGSPTGYVS
;
;SRSYSQRYAKWQAKFNAFSNPTVASTILSNVSPVAQQNFQTNVPKFTSVNENVSAVLTQYGITGPNRAIYQGFGLKVARA
LNRIGSGPALVNMINGLKGYYISAFNANPQVLDAVVNIITGSPTGYVS
;
A,B,C,D,E,F,G,H,I,J,K,L,M,N,O,P,Q,R,S,T,U,V,W,X,Y,Z,a,b,c,d,e,f,g,h,i,j,k,l,m,n,o,p,q,r,s,t,u,v,w,x,y,z,1,2,3,4,5,6 ? 
2 polydeoxyribonucleotide no no 
;(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)
(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)
(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)
(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)
(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)
(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)
(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)
(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)
(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)
(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)
(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)
(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)
(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)
(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)
(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)
(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)
(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)
(DA)(DT)(DA)(DT)(DA)(DT)(DA)(DT)
;
;ATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATAT
ATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATAT
ATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATAT
ATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATAT
ATATATATATATATATATATATATATAT
;
7,8                                                                                                                 ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   SER n 
1 2   ARG n 
1 3   SER n 
1 4   TYR n 
1 5   SER n 
1 6   GLN n 
1 7   ARG n 
1 8   TYR n 
1 9   ALA n 
1 10  LYS n 
1 11  TRP n 
1 12  GLN n 
1 13  ALA n 
1 14  LYS n 
1 15  PHE n 
1 16  ASN n 
1 17  ALA n 
1 18  PHE n 
1 19  SER n 
1 20  ASN n 
1 21  PRO n 
1 22  THR n 
1 23  VAL n 
1 24  ALA n 
1 25  SER n 
1 26  THR n 
1 27  ILE n 
1 28  LEU n 
1 29  SER n 
1 30  ASN n 
1 31  VAL n 
1 32  SER n 
1 33  PRO n 
1 34  VAL n 
1 35  ALA n 
1 36  GLN n 
1 37  GLN n 
1 38  ASN n 
1 39  PHE n 
1 40  GLN n 
1 41  THR n 
1 42  ASN n 
1 43  VAL n 
1 44  PRO n 
1 45  LYS n 
1 46  PHE n 
1 47  THR n 
1 48  SER n 
1 49  VAL n 
1 50  ASN n 
1 51  GLU n 
1 52  ASN n 
1 53  VAL n 
1 54  SER n 
1 55  ALA n 
1 56  VAL n 
1 57  LEU n 
1 58  THR n 
1 59  GLN n 
1 60  TYR n 
1 61  GLY n 
1 62  ILE n 
1 63  THR n 
1 64  GLY n 
1 65  PRO n 
1 66  ASN n 
1 67  ARG n 
1 68  ALA n 
1 69  ILE n 
1 70  TYR n 
1 71  GLN n 
1 72  GLY n 
1 73  PHE n 
1 74  GLY n 
1 75  LEU n 
1 76  LYS n 
1 77  VAL n 
1 78  ALA n 
1 79  ARG n 
1 80  ALA n 
1 81  LEU n 
1 82  ASN n 
1 83  ARG n 
1 84  ILE n 
1 85  GLY n 
1 86  SER n 
1 87  GLY n 
1 88  PRO n 
1 89  ALA n 
1 90  LEU n 
1 91  VAL n 
1 92  ASN n 
1 93  MET n 
1 94  ILE n 
1 95  ASN n 
1 96  GLY n 
1 97  LEU n 
1 98  LYS n 
1 99  GLY n 
1 100 TYR n 
1 101 TYR n 
1 102 ILE n 
1 103 SER n 
1 104 ALA n 
1 105 PHE n 
1 106 ASN n 
1 107 ALA n 
1 108 ASN n 
1 109 PRO n 
1 110 GLN n 
1 111 VAL n 
1 112 LEU n 
1 113 ASP n 
1 114 ALA n 
1 115 VAL n 
1 116 VAL n 
1 117 ASN n 
1 118 ILE n 
1 119 ILE n 
1 120 THR n 
1 121 GLY n 
1 122 SER n 
1 123 PRO n 
1 124 THR n 
1 125 GLY n 
1 126 TYR n 
1 127 VAL n 
1 128 SER n 
2 1   DA  n 
2 2   DT  n 
2 3   DA  n 
2 4   DT  n 
2 5   DA  n 
2 6   DT  n 
2 7   DA  n 
2 8   DT  n 
2 9   DA  n 
2 10  DT  n 
2 11  DA  n 
2 12  DT  n 
2 13  DA  n 
2 14  DT  n 
2 15  DA  n 
2 16  DT  n 
2 17  DA  n 
2 18  DT  n 
2 19  DA  n 
2 20  DT  n 
2 21  DA  n 
2 22  DT  n 
2 23  DA  n 
2 24  DT  n 
2 25  DA  n 
2 26  DT  n 
2 27  DA  n 
2 28  DT  n 
2 29  DA  n 
2 30  DT  n 
2 31  DA  n 
2 32  DT  n 
2 33  DA  n 
2 34  DT  n 
2 35  DA  n 
2 36  DT  n 
2 37  DA  n 
2 38  DT  n 
2 39  DA  n 
2 40  DT  n 
2 41  DA  n 
2 42  DT  n 
2 43  DA  n 
2 44  DT  n 
2 45  DA  n 
2 46  DT  n 
2 47  DA  n 
2 48  DT  n 
2 49  DA  n 
2 50  DT  n 
2 51  DA  n 
2 52  DT  n 
2 53  DA  n 
2 54  DT  n 
2 55  DA  n 
2 56  DT  n 
2 57  DA  n 
2 58  DT  n 
2 59  DA  n 
2 60  DT  n 
2 61  DA  n 
2 62  DT  n 
2 63  DA  n 
2 64  DT  n 
2 65  DA  n 
2 66  DT  n 
2 67  DA  n 
2 68  DT  n 
2 69  DA  n 
2 70  DT  n 
2 71  DA  n 
2 72  DT  n 
2 73  DA  n 
2 74  DT  n 
2 75  DA  n 
2 76  DT  n 
2 77  DA  n 
2 78  DT  n 
2 79  DA  n 
2 80  DT  n 
2 81  DA  n 
2 82  DT  n 
2 83  DA  n 
2 84  DT  n 
2 85  DA  n 
2 86  DT  n 
2 87  DA  n 
2 88  DT  n 
2 89  DA  n 
2 90  DT  n 
2 91  DA  n 
2 92  DT  n 
2 93  DA  n 
2 94  DT  n 
2 95  DA  n 
2 96  DT  n 
2 97  DA  n 
2 98  DT  n 
2 99  DA  n 
2 100 DT  n 
2 101 DA  n 
2 102 DT  n 
2 103 DA  n 
2 104 DT  n 
2 105 DA  n 
2 106 DT  n 
2 107 DA  n 
2 108 DT  n 
2 109 DA  n 
2 110 DT  n 
2 111 DA  n 
2 112 DT  n 
2 113 DA  n 
2 114 DT  n 
2 115 DA  n 
2 116 DT  n 
2 117 DA  n 
2 118 DT  n 
2 119 DA  n 
2 120 DT  n 
2 121 DA  n 
2 122 DT  n 
2 123 DA  n 
2 124 DT  n 
2 125 DA  n 
2 126 DT  n 
2 127 DA  n 
2 128 DT  n 
2 129 DA  n 
2 130 DT  n 
2 131 DA  n 
2 132 DT  n 
2 133 DA  n 
2 134 DT  n 
2 135 DA  n 
2 136 DT  n 
2 137 DA  n 
2 138 DT  n 
2 139 DA  n 
2 140 DT  n 
2 141 DA  n 
2 142 DT  n 
2 143 DA  n 
2 144 DT  n 
2 145 DA  n 
2 146 DT  n 
2 147 DA  n 
2 148 DT  n 
2 149 DA  n 
2 150 DT  n 
2 151 DA  n 
2 152 DT  n 
2 153 DA  n 
2 154 DT  n 
2 155 DA  n 
2 156 DT  n 
2 157 DA  n 
2 158 DT  n 
2 159 DA  n 
2 160 DT  n 
2 161 DA  n 
2 162 DT  n 
2 163 DA  n 
2 164 DT  n 
2 165 DA  n 
2 166 DT  n 
2 167 DA  n 
2 168 DT  n 
2 169 DA  n 
2 170 DT  n 
2 171 DA  n 
2 172 DT  n 
2 173 DA  n 
2 174 DT  n 
2 175 DA  n 
2 176 DT  n 
2 177 DA  n 
2 178 DT  n 
2 179 DA  n 
2 180 DT  n 
2 181 DA  n 
2 182 DT  n 
2 183 DA  n 
2 184 DT  n 
2 185 DA  n 
2 186 DT  n 
2 187 DA  n 
2 188 DT  n 
2 189 DA  n 
2 190 DT  n 
2 191 DA  n 
2 192 DT  n 
2 193 DA  n 
2 194 DT  n 
2 195 DA  n 
2 196 DT  n 
2 197 DA  n 
2 198 DT  n 
2 199 DA  n 
2 200 DT  n 
2 201 DA  n 
2 202 DT  n 
2 203 DA  n 
2 204 DT  n 
2 205 DA  n 
2 206 DT  n 
2 207 DA  n 
2 208 DT  n 
2 209 DA  n 
2 210 DT  n 
2 211 DA  n 
2 212 DT  n 
2 213 DA  n 
2 214 DT  n 
2 215 DA  n 
2 216 DT  n 
2 217 DA  n 
2 218 DT  n 
2 219 DA  n 
2 220 DT  n 
2 221 DA  n 
2 222 DT  n 
2 223 DA  n 
2 224 DT  n 
2 225 DA  n 
2 226 DT  n 
2 227 DA  n 
2 228 DT  n 
2 229 DA  n 
2 230 DT  n 
2 231 DA  n 
2 232 DT  n 
2 233 DA  n 
2 234 DT  n 
2 235 DA  n 
2 236 DT  n 
2 237 DA  n 
2 238 DT  n 
2 239 DA  n 
2 240 DT  n 
2 241 DA  n 
2 242 DT  n 
2 243 DA  n 
2 244 DT  n 
2 245 DA  n 
2 246 DT  n 
2 247 DA  n 
2 248 DT  n 
2 249 DA  n 
2 250 DT  n 
2 251 DA  n 
2 252 DT  n 
2 253 DA  n 
2 254 DT  n 
2 255 DA  n 
2 256 DT  n 
2 257 DA  n 
2 258 DT  n 
2 259 DA  n 
2 260 DT  n 
2 261 DA  n 
2 262 DT  n 
2 263 DA  n 
2 264 DT  n 
2 265 DA  n 
2 266 DT  n 
2 267 DA  n 
2 268 DT  n 
2 269 DA  n 
2 270 DT  n 
2 271 DA  n 
2 272 DT  n 
2 273 DA  n 
2 274 DT  n 
2 275 DA  n 
2 276 DT  n 
2 277 DA  n 
2 278 DT  n 
2 279 DA  n 
2 280 DT  n 
2 281 DA  n 
2 282 DT  n 
2 283 DA  n 
2 284 DT  n 
2 285 DA  n 
2 286 DT  n 
2 287 DA  n 
2 288 DT  n 
2 289 DA  n 
2 290 DT  n 
2 291 DA  n 
2 292 DT  n 
2 293 DA  n 
2 294 DT  n 
2 295 DA  n 
2 296 DT  n 
2 297 DA  n 
2 298 DT  n 
2 299 DA  n 
2 300 DT  n 
2 301 DA  n 
2 302 DT  n 
2 303 DA  n 
2 304 DT  n 
2 305 DA  n 
2 306 DT  n 
2 307 DA  n 
2 308 DT  n 
2 309 DA  n 
2 310 DT  n 
2 311 DA  n 
2 312 DT  n 
2 313 DA  n 
2 314 DT  n 
2 315 DA  n 
2 316 DT  n 
2 317 DA  n 
2 318 DT  n 
2 319 DA  n 
2 320 DT  n 
2 321 DA  n 
2 322 DT  n 
2 323 DA  n 
2 324 DT  n 
2 325 DA  n 
2 326 DT  n 
2 327 DA  n 
2 328 DT  n 
2 329 DA  n 
2 330 DT  n 
2 331 DA  n 
2 332 DT  n 
2 333 DA  n 
2 334 DT  n 
2 335 DA  n 
2 336 DT  n 
2 337 DA  n 
2 338 DT  n 
2 339 DA  n 
2 340 DT  n 
2 341 DA  n 
2 342 DT  n 
2 343 DA  n 
2 344 DT  n 
2 345 DA  n 
2 346 DT  n 
2 347 DA  n 
2 348 DT  n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1 1 sample ? ? ? 'Sulfolobus islandicus rod-shaped virus 2' 157899 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2 1 sample ? ? ? 'Sulfolobus islandicus rod-shaped virus 2' 157899 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP Q8V9P2_9VIRU Q8V9P2 1 
;SRSYSQRYAKWQAKFNAFSNPTVASTILSNVSPVAQQNFQTNVPKFTSVNENVSAVLTQYGITGPNRAIYQGFGLKVARA
LNRIGSGPALVNMINGLKGYYISAFNANPQVLDAVVNIITGSPTGYVS
;
7 ? 
2 PDB 3J9X         3J9X   2 
;ATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATAT
ATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATAT
ATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATAT
ATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATATAT
ATATATATATATATATATATATATATAT
;
1 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1 3J9X A 1 ? 128 ? Q8V9P2 7 ? 134 ? 7 134 
2  1 3J9X B 1 ? 128 ? Q8V9P2 7 ? 134 ? 7 134 
3  1 3J9X C 1 ? 128 ? Q8V9P2 7 ? 134 ? 7 134 
4  1 3J9X D 1 ? 128 ? Q8V9P2 7 ? 134 ? 7 134 
5  1 3J9X E 1 ? 128 ? Q8V9P2 7 ? 134 ? 7 134 
6  1 3J9X F 1 ? 128 ? Q8V9P2 7 ? 134 ? 7 134 
7  1 3J9X G 1 ? 128 ? Q8V9P2 7 ? 134 ? 7 134 
8  1 3J9X H 1 ? 128 ? Q8V9P2 7 ? 134 ? 7 134 
9  1 3J9X I 1 ? 128 ? Q8V9P2 7 ? 134 ? 7 134 
10 1 3J9X J 1 ? 128 ? Q8V9P2 7 ? 134 ? 7 134 
11 1 3J9X K 1 ? 128 ? Q8V9P2 7 ? 134 ? 7 134 
12 1 3J9X L 1 ? 128 ? Q8V9P2 7 ? 134 ? 7 134 
13 1 3J9X M 1 ? 128 ? Q8V9P2 7 ? 134 ? 7 134 
14 1 3J9X N 1 ? 128 ? Q8V9P2 7 ? 134 ? 7 134 
15 1 3J9X O 1 ? 128 ? Q8V9P2 7 ? 134 ? 7 134 
16 1 3J9X P 1 ? 128 ? Q8V9P2 7 ? 134 ? 7 134 
17 1 3J9X Q 1 ? 128 ? Q8V9P2 7 ? 134 ? 7 134 
18 1 3J9X R 1 ? 128 ? Q8V9P2 7 ? 134 ? 7 134 
19 1 3J9X S 1 ? 128 ? Q8V9P2 7 ? 134 ? 7 134 
20 1 3J9X T 1 ? 128 ? Q8V9P2 7 ? 134 ? 7 134 
21 1 3J9X U 1 ? 128 ? Q8V9P2 7 ? 134 ? 7 134 
22 1 3J9X V 1 ? 128 ? Q8V9P2 7 ? 134 ? 7 134 
23 1 3J9X W 1 ? 128 ? Q8V9P2 7 ? 134 ? 7 134 
24 1 3J9X X 1 ? 128 ? Q8V9P2 7 ? 134 ? 7 134 
25 1 3J9X Y 1 ? 128 ? Q8V9P2 7 ? 134 ? 7 134 
26 1 3J9X Z 1 ? 128 ? Q8V9P2 7 ? 134 ? 7 134 
27 1 3J9X a 1 ? 128 ? Q8V9P2 7 ? 134 ? 7 134 
28 1 3J9X b 1 ? 128 ? Q8V9P2 7 ? 134 ? 7 134 
29 1 3J9X c 1 ? 128 ? Q8V9P2 7 ? 134 ? 7 134 
30 1 3J9X d 1 ? 128 ? Q8V9P2 7 ? 134 ? 7 134 
31 1 3J9X e 1 ? 128 ? Q8V9P2 7 ? 134 ? 7 134 
32 1 3J9X f 1 ? 128 ? Q8V9P2 7 ? 134 ? 7 134 
33 1 3J9X g 1 ? 128 ? Q8V9P2 7 ? 134 ? 7 134 
34 1 3J9X h 1 ? 128 ? Q8V9P2 7 ? 134 ? 7 134 
35 1 3J9X i 1 ? 128 ? Q8V9P2 7 ? 134 ? 7 134 
36 1 3J9X j 1 ? 128 ? Q8V9P2 7 ? 134 ? 7 134 
37 1 3J9X k 1 ? 128 ? Q8V9P2 7 ? 134 ? 7 134 
38 1 3J9X l 1 ? 128 ? Q8V9P2 7 ? 134 ? 7 134 
39 1 3J9X m 1 ? 128 ? Q8V9P2 7 ? 134 ? 7 134 
40 1 3J9X n 1 ? 128 ? Q8V9P2 7 ? 134 ? 7 134 
41 1 3J9X o 1 ? 128 ? Q8V9P2 7 ? 134 ? 7 134 
42 1 3J9X p 1 ? 128 ? Q8V9P2 7 ? 134 ? 7 134 
43 1 3J9X q 1 ? 128 ? Q8V9P2 7 ? 134 ? 7 134 
44 1 3J9X r 1 ? 128 ? Q8V9P2 7 ? 134 ? 7 134 
45 1 3J9X s 1 ? 128 ? Q8V9P2 7 ? 134 ? 7 134 
46 1 3J9X t 1 ? 128 ? Q8V9P2 7 ? 134 ? 7 134 
47 1 3J9X u 1 ? 128 ? Q8V9P2 7 ? 134 ? 7 134 
48 1 3J9X v 1 ? 128 ? Q8V9P2 7 ? 134 ? 7 134 
49 1 3J9X w 1 ? 128 ? Q8V9P2 7 ? 134 ? 7 134 
50 1 3J9X x 1 ? 128 ? Q8V9P2 7 ? 134 ? 7 134 
51 1 3J9X y 1 ? 128 ? Q8V9P2 7 ? 134 ? 7 134 
52 1 3J9X z 1 ? 128 ? Q8V9P2 7 ? 134 ? 7 134 
53 1 3J9X 1 1 ? 128 ? Q8V9P2 7 ? 134 ? 7 134 
54 1 3J9X 2 1 ? 128 ? Q8V9P2 7 ? 134 ? 7 134 
55 1 3J9X 3 1 ? 128 ? Q8V9P2 7 ? 134 ? 7 134 
56 1 3J9X 4 1 ? 128 ? Q8V9P2 7 ? 134 ? 7 134 
57 1 3J9X 5 1 ? 128 ? Q8V9P2 7 ? 134 ? 7 134 
58 1 3J9X 6 1 ? 128 ? Q8V9P2 7 ? 134 ? 7 134 
59 2 3J9X 7 1 ? 348 ? 3J9X   1 ? 348 ? 1 348 
60 2 3J9X 8 1 ? 348 ? 3J9X   1 ? 348 ? 1 348 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE                              ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                             ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                           ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                      ? 'C4 H7 N O4'      133.103 
DA  'DNA linking'       y "2'-DEOXYADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O6 P' 331.222 
DT  'DNA linking'       y "THYMIDINE-5'-MONOPHOSPHATE"         ? 'C10 H15 N2 O8 P' 322.208 
GLN 'L-peptide linking' y GLUTAMINE                            ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                      ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                              ? 'C2 H5 N O2'      75.067  
ILE 'L-peptide linking' y ISOLEUCINE                           ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                              ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                               ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                           ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                        ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                              ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                               ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                            ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                           ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                             ? 'C9 H11 N O3'     181.189 
VAL 'L-peptide linking' y VALINE                               ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          3J9X 
_exptl.method            'ELECTRON MICROSCOPY' 
_exptl.crystals_number   ? 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      ? 
_exptl_crystal.density_percent_sol   ? 
_exptl_crystal.description           ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           ? 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_refine_hist.pdbx_refine_id                   'ELECTRON MICROSCOPY' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        56434 
_refine_hist.pdbx_number_atoms_nucleic_acid   14268 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               70702 
_refine_hist.d_res_high                       . 
_refine_hist.d_res_low                        . 
# 
_struct.entry_id                  3J9X 
_struct.title                     'A Virus that Infects a Hyperthermophile Encapsidates A-Form DNA' 
_struct.pdbx_descriptor           'coat protein' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3J9X 
_struct_keywords.pdbx_keywords   VIRUS 
_struct_keywords.text            'archaeal virus, helical symmetry, VIRUS' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1 ? 
B  N N 1 ? 
C  N N 1 ? 
D  N N 1 ? 
E  N N 1 ? 
F  N N 1 ? 
G  N N 1 ? 
H  N N 1 ? 
I  N N 1 ? 
J  N N 1 ? 
K  N N 1 ? 
L  N N 1 ? 
M  N N 1 ? 
N  N N 1 ? 
O  N N 1 ? 
P  N N 1 ? 
Q  N N 1 ? 
R  N N 1 ? 
S  N N 1 ? 
T  N N 1 ? 
U  N N 1 ? 
V  N N 1 ? 
W  N N 1 ? 
X  N N 1 ? 
Y  N N 1 ? 
Z  N N 1 ? 
AA N N 1 ? 
BA N N 1 ? 
CA N N 1 ? 
DA N N 1 ? 
EA N N 1 ? 
FA N N 1 ? 
GA N N 1 ? 
HA N N 1 ? 
IA N N 1 ? 
JA N N 1 ? 
KA N N 1 ? 
LA N N 1 ? 
MA N N 1 ? 
NA N N 1 ? 
OA N N 1 ? 
PA N N 1 ? 
QA N N 1 ? 
RA N N 1 ? 
SA N N 1 ? 
TA N N 1 ? 
UA N N 1 ? 
VA N N 1 ? 
WA N N 1 ? 
XA N N 1 ? 
YA N N 1 ? 
ZA N N 1 ? 
AB N N 1 ? 
BB N N 1 ? 
CB N N 1 ? 
DB N N 1 ? 
EB N N 1 ? 
FB N N 1 ? 
GB N N 2 ? 
HB N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   'The helical parameters generate the capsid filament from chains A and B.' 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1   1   SER A  3   ? ASN A  20  ? SER A 9   ASN A 26  1 ? 18 
HELX_P HELX_P2   2   ASN A  20  ? VAL A  31  ? ASN A 26  VAL A 37  1 ? 12 
HELX_P HELX_P3   3   VAL A  31  ? TYR A  60  ? VAL A 37  TYR A 66  1 ? 30 
HELX_P HELX_P4   4   GLY A  64  ? GLY A  85  ? GLY A 70  GLY A 91  1 ? 22 
HELX_P HELX_P5   5   GLY A  87  ? PHE A  105 ? GLY A 93  PHE A 111 1 ? 19 
HELX_P HELX_P6   6   ASN A  108 ? THR A  120 ? ASN A 114 THR A 126 1 ? 13 
HELX_P HELX_P7   7   SER B  3   ? ASN B  20  ? SER B 9   ASN B 26  1 ? 18 
HELX_P HELX_P8   8   ASN B  20  ? VAL B  43  ? ASN B 26  VAL B 49  1 ? 24 
HELX_P HELX_P9   9   VAL B  43  ? TYR B  60  ? VAL B 49  TYR B 66  1 ? 18 
HELX_P HELX_P10  10  GLY B  64  ? GLY B  85  ? GLY B 70  GLY B 91  1 ? 22 
HELX_P HELX_P11  11  GLY B  87  ? PHE B  105 ? GLY B 93  PHE B 111 1 ? 19 
HELX_P HELX_P12  12  ASN B  108 ? THR B  120 ? ASN B 114 THR B 126 1 ? 13 
HELX_P HELX_P13  13  SER C  3   ? ASN C  20  ? SER C 9   ASN C 26  1 ? 18 
HELX_P HELX_P14  14  ASN C  20  ? VAL C  31  ? ASN C 26  VAL C 37  1 ? 12 
HELX_P HELX_P15  15  VAL C  31  ? TYR C  60  ? VAL C 37  TYR C 66  1 ? 30 
HELX_P HELX_P16  16  GLY C  64  ? GLY C  85  ? GLY C 70  GLY C 91  1 ? 22 
HELX_P HELX_P17  17  GLY C  87  ? PHE C  105 ? GLY C 93  PHE C 111 1 ? 19 
HELX_P HELX_P18  18  ASN C  108 ? THR C  120 ? ASN C 114 THR C 126 1 ? 13 
HELX_P HELX_P19  19  SER D  3   ? ASN D  20  ? SER D 9   ASN D 26  1 ? 18 
HELX_P HELX_P20  20  ASN D  20  ? VAL D  43  ? ASN D 26  VAL D 49  1 ? 24 
HELX_P HELX_P21  21  VAL D  43  ? TYR D  60  ? VAL D 49  TYR D 66  1 ? 18 
HELX_P HELX_P22  22  GLY D  64  ? GLY D  85  ? GLY D 70  GLY D 91  1 ? 22 
HELX_P HELX_P23  23  GLY D  87  ? PHE D  105 ? GLY D 93  PHE D 111 1 ? 19 
HELX_P HELX_P24  24  ASN D  108 ? THR D  120 ? ASN D 114 THR D 126 1 ? 13 
HELX_P HELX_P25  25  SER E  3   ? ASN E  20  ? SER E 9   ASN E 26  1 ? 18 
HELX_P HELX_P26  26  ASN E  20  ? VAL E  31  ? ASN E 26  VAL E 37  1 ? 12 
HELX_P HELX_P27  27  VAL E  31  ? TYR E  60  ? VAL E 37  TYR E 66  1 ? 30 
HELX_P HELX_P28  28  GLY E  64  ? GLY E  85  ? GLY E 70  GLY E 91  1 ? 22 
HELX_P HELX_P29  29  GLY E  87  ? PHE E  105 ? GLY E 93  PHE E 111 1 ? 19 
HELX_P HELX_P30  30  ASN E  108 ? THR E  120 ? ASN E 114 THR E 126 1 ? 13 
HELX_P HELX_P31  31  SER F  3   ? ASN F  20  ? SER F 9   ASN F 26  1 ? 18 
HELX_P HELX_P32  32  ASN F  20  ? VAL F  43  ? ASN F 26  VAL F 49  1 ? 24 
HELX_P HELX_P33  33  VAL F  43  ? TYR F  60  ? VAL F 49  TYR F 66  1 ? 18 
HELX_P HELX_P34  34  GLY F  64  ? GLY F  85  ? GLY F 70  GLY F 91  1 ? 22 
HELX_P HELX_P35  35  GLY F  87  ? PHE F  105 ? GLY F 93  PHE F 111 1 ? 19 
HELX_P HELX_P36  36  ASN F  108 ? THR F  120 ? ASN F 114 THR F 126 1 ? 13 
HELX_P HELX_P37  37  SER G  3   ? ASN G  20  ? SER G 9   ASN G 26  1 ? 18 
HELX_P HELX_P38  38  ASN G  20  ? VAL G  31  ? ASN G 26  VAL G 37  1 ? 12 
HELX_P HELX_P39  39  VAL G  31  ? TYR G  60  ? VAL G 37  TYR G 66  1 ? 30 
HELX_P HELX_P40  40  GLY G  64  ? GLY G  85  ? GLY G 70  GLY G 91  1 ? 22 
HELX_P HELX_P41  41  GLY G  87  ? PHE G  105 ? GLY G 93  PHE G 111 1 ? 19 
HELX_P HELX_P42  42  ASN G  108 ? THR G  120 ? ASN G 114 THR G 126 1 ? 13 
HELX_P HELX_P43  43  SER H  3   ? ASN H  20  ? SER H 9   ASN H 26  1 ? 18 
HELX_P HELX_P44  44  ASN H  20  ? VAL H  43  ? ASN H 26  VAL H 49  1 ? 24 
HELX_P HELX_P45  45  VAL H  43  ? TYR H  60  ? VAL H 49  TYR H 66  1 ? 18 
HELX_P HELX_P46  46  GLY H  64  ? GLY H  85  ? GLY H 70  GLY H 91  1 ? 22 
HELX_P HELX_P47  47  GLY H  87  ? PHE H  105 ? GLY H 93  PHE H 111 1 ? 19 
HELX_P HELX_P48  48  ASN H  108 ? THR H  120 ? ASN H 114 THR H 126 1 ? 13 
HELX_P HELX_P49  49  SER I  3   ? ASN I  20  ? SER I 9   ASN I 26  1 ? 18 
HELX_P HELX_P50  50  ASN I  20  ? VAL I  31  ? ASN I 26  VAL I 37  1 ? 12 
HELX_P HELX_P51  51  VAL I  31  ? TYR I  60  ? VAL I 37  TYR I 66  1 ? 30 
HELX_P HELX_P52  52  GLY I  64  ? GLY I  85  ? GLY I 70  GLY I 91  1 ? 22 
HELX_P HELX_P53  53  GLY I  87  ? PHE I  105 ? GLY I 93  PHE I 111 1 ? 19 
HELX_P HELX_P54  54  ASN I  108 ? THR I  120 ? ASN I 114 THR I 126 1 ? 13 
HELX_P HELX_P55  55  SER J  3   ? ASN J  20  ? SER J 9   ASN J 26  1 ? 18 
HELX_P HELX_P56  56  ASN J  20  ? VAL J  43  ? ASN J 26  VAL J 49  1 ? 24 
HELX_P HELX_P57  57  VAL J  43  ? TYR J  60  ? VAL J 49  TYR J 66  1 ? 18 
HELX_P HELX_P58  58  GLY J  64  ? GLY J  85  ? GLY J 70  GLY J 91  1 ? 22 
HELX_P HELX_P59  59  GLY J  87  ? PHE J  105 ? GLY J 93  PHE J 111 1 ? 19 
HELX_P HELX_P60  60  ASN J  108 ? THR J  120 ? ASN J 114 THR J 126 1 ? 13 
HELX_P HELX_P61  61  SER K  3   ? ASN K  20  ? SER K 9   ASN K 26  1 ? 18 
HELX_P HELX_P62  62  ASN K  20  ? VAL K  31  ? ASN K 26  VAL K 37  1 ? 12 
HELX_P HELX_P63  63  VAL K  31  ? TYR K  60  ? VAL K 37  TYR K 66  1 ? 30 
HELX_P HELX_P64  64  GLY K  64  ? GLY K  85  ? GLY K 70  GLY K 91  1 ? 22 
HELX_P HELX_P65  65  GLY K  87  ? PHE K  105 ? GLY K 93  PHE K 111 1 ? 19 
HELX_P HELX_P66  66  ASN K  108 ? THR K  120 ? ASN K 114 THR K 126 1 ? 13 
HELX_P HELX_P67  67  SER L  3   ? ASN L  20  ? SER L 9   ASN L 26  1 ? 18 
HELX_P HELX_P68  68  ASN L  20  ? VAL L  43  ? ASN L 26  VAL L 49  1 ? 24 
HELX_P HELX_P69  69  VAL L  43  ? TYR L  60  ? VAL L 49  TYR L 66  1 ? 18 
HELX_P HELX_P70  70  GLY L  64  ? GLY L  85  ? GLY L 70  GLY L 91  1 ? 22 
HELX_P HELX_P71  71  GLY L  87  ? PHE L  105 ? GLY L 93  PHE L 111 1 ? 19 
HELX_P HELX_P72  72  ASN L  108 ? THR L  120 ? ASN L 114 THR L 126 1 ? 13 
HELX_P HELX_P73  73  SER M  3   ? ASN M  20  ? SER M 9   ASN M 26  1 ? 18 
HELX_P HELX_P74  74  ASN M  20  ? VAL M  31  ? ASN M 26  VAL M 37  1 ? 12 
HELX_P HELX_P75  75  VAL M  31  ? TYR M  60  ? VAL M 37  TYR M 66  1 ? 30 
HELX_P HELX_P76  76  GLY M  64  ? GLY M  85  ? GLY M 70  GLY M 91  1 ? 22 
HELX_P HELX_P77  77  GLY M  87  ? PHE M  105 ? GLY M 93  PHE M 111 1 ? 19 
HELX_P HELX_P78  78  ASN M  108 ? THR M  120 ? ASN M 114 THR M 126 1 ? 13 
HELX_P HELX_P79  79  SER N  3   ? ASN N  20  ? SER N 9   ASN N 26  1 ? 18 
HELX_P HELX_P80  80  ASN N  20  ? VAL N  43  ? ASN N 26  VAL N 49  1 ? 24 
HELX_P HELX_P81  81  VAL N  43  ? TYR N  60  ? VAL N 49  TYR N 66  1 ? 18 
HELX_P HELX_P82  82  GLY N  64  ? GLY N  85  ? GLY N 70  GLY N 91  1 ? 22 
HELX_P HELX_P83  83  GLY N  87  ? PHE N  105 ? GLY N 93  PHE N 111 1 ? 19 
HELX_P HELX_P84  84  ASN N  108 ? THR N  120 ? ASN N 114 THR N 126 1 ? 13 
HELX_P HELX_P85  85  SER O  3   ? ASN O  20  ? SER O 9   ASN O 26  1 ? 18 
HELX_P HELX_P86  86  ASN O  20  ? VAL O  31  ? ASN O 26  VAL O 37  1 ? 12 
HELX_P HELX_P87  87  VAL O  31  ? TYR O  60  ? VAL O 37  TYR O 66  1 ? 30 
HELX_P HELX_P88  88  GLY O  64  ? GLY O  85  ? GLY O 70  GLY O 91  1 ? 22 
HELX_P HELX_P89  89  GLY O  87  ? PHE O  105 ? GLY O 93  PHE O 111 1 ? 19 
HELX_P HELX_P90  90  ASN O  108 ? THR O  120 ? ASN O 114 THR O 126 1 ? 13 
HELX_P HELX_P91  91  SER P  3   ? ASN P  20  ? SER P 9   ASN P 26  1 ? 18 
HELX_P HELX_P92  92  ASN P  20  ? VAL P  43  ? ASN P 26  VAL P 49  1 ? 24 
HELX_P HELX_P93  93  VAL P  43  ? TYR P  60  ? VAL P 49  TYR P 66  1 ? 18 
HELX_P HELX_P94  94  GLY P  64  ? GLY P  85  ? GLY P 70  GLY P 91  1 ? 22 
HELX_P HELX_P95  95  GLY P  87  ? PHE P  105 ? GLY P 93  PHE P 111 1 ? 19 
HELX_P HELX_P96  96  ASN P  108 ? THR P  120 ? ASN P 114 THR P 126 1 ? 13 
HELX_P HELX_P97  97  SER Q  3   ? ASN Q  20  ? SER Q 9   ASN Q 26  1 ? 18 
HELX_P HELX_P98  98  ASN Q  20  ? VAL Q  31  ? ASN Q 26  VAL Q 37  1 ? 12 
HELX_P HELX_P99  99  VAL Q  31  ? TYR Q  60  ? VAL Q 37  TYR Q 66  1 ? 30 
HELX_P HELX_P100 100 GLY Q  64  ? GLY Q  85  ? GLY Q 70  GLY Q 91  1 ? 22 
HELX_P HELX_P101 101 GLY Q  87  ? PHE Q  105 ? GLY Q 93  PHE Q 111 1 ? 19 
HELX_P HELX_P102 102 ASN Q  108 ? THR Q  120 ? ASN Q 114 THR Q 126 1 ? 13 
HELX_P HELX_P103 103 SER R  3   ? ASN R  20  ? SER R 9   ASN R 26  1 ? 18 
HELX_P HELX_P104 104 ASN R  20  ? VAL R  43  ? ASN R 26  VAL R 49  1 ? 24 
HELX_P HELX_P105 105 VAL R  43  ? TYR R  60  ? VAL R 49  TYR R 66  1 ? 18 
HELX_P HELX_P106 106 GLY R  64  ? GLY R  85  ? GLY R 70  GLY R 91  1 ? 22 
HELX_P HELX_P107 107 GLY R  87  ? PHE R  105 ? GLY R 93  PHE R 111 1 ? 19 
HELX_P HELX_P108 108 ASN R  108 ? THR R  120 ? ASN R 114 THR R 126 1 ? 13 
HELX_P HELX_P109 109 SER S  3   ? ASN S  20  ? SER S 9   ASN S 26  1 ? 18 
HELX_P HELX_P110 110 ASN S  20  ? VAL S  31  ? ASN S 26  VAL S 37  1 ? 12 
HELX_P HELX_P111 111 VAL S  31  ? TYR S  60  ? VAL S 37  TYR S 66  1 ? 30 
HELX_P HELX_P112 112 GLY S  64  ? GLY S  85  ? GLY S 70  GLY S 91  1 ? 22 
HELX_P HELX_P113 113 GLY S  87  ? PHE S  105 ? GLY S 93  PHE S 111 1 ? 19 
HELX_P HELX_P114 114 ASN S  108 ? THR S  120 ? ASN S 114 THR S 126 1 ? 13 
HELX_P HELX_P115 115 SER T  3   ? ASN T  20  ? SER T 9   ASN T 26  1 ? 18 
HELX_P HELX_P116 116 ASN T  20  ? VAL T  43  ? ASN T 26  VAL T 49  1 ? 24 
HELX_P HELX_P117 117 VAL T  43  ? TYR T  60  ? VAL T 49  TYR T 66  1 ? 18 
HELX_P HELX_P118 118 GLY T  64  ? GLY T  85  ? GLY T 70  GLY T 91  1 ? 22 
HELX_P HELX_P119 119 GLY T  87  ? PHE T  105 ? GLY T 93  PHE T 111 1 ? 19 
HELX_P HELX_P120 120 ASN T  108 ? THR T  120 ? ASN T 114 THR T 126 1 ? 13 
HELX_P HELX_P121 121 SER U  3   ? ASN U  20  ? SER U 9   ASN U 26  1 ? 18 
HELX_P HELX_P122 122 ASN U  20  ? VAL U  31  ? ASN U 26  VAL U 37  1 ? 12 
HELX_P HELX_P123 123 VAL U  31  ? TYR U  60  ? VAL U 37  TYR U 66  1 ? 30 
HELX_P HELX_P124 124 GLY U  64  ? GLY U  85  ? GLY U 70  GLY U 91  1 ? 22 
HELX_P HELX_P125 125 GLY U  87  ? PHE U  105 ? GLY U 93  PHE U 111 1 ? 19 
HELX_P HELX_P126 126 ASN U  108 ? THR U  120 ? ASN U 114 THR U 126 1 ? 13 
HELX_P HELX_P127 127 SER V  3   ? ASN V  20  ? SER V 9   ASN V 26  1 ? 18 
HELX_P HELX_P128 128 ASN V  20  ? VAL V  43  ? ASN V 26  VAL V 49  1 ? 24 
HELX_P HELX_P129 129 VAL V  43  ? TYR V  60  ? VAL V 49  TYR V 66  1 ? 18 
HELX_P HELX_P130 130 GLY V  64  ? GLY V  85  ? GLY V 70  GLY V 91  1 ? 22 
HELX_P HELX_P131 131 GLY V  87  ? PHE V  105 ? GLY V 93  PHE V 111 1 ? 19 
HELX_P HELX_P132 132 ASN V  108 ? THR V  120 ? ASN V 114 THR V 126 1 ? 13 
HELX_P HELX_P133 133 SER W  3   ? ASN W  20  ? SER W 9   ASN W 26  1 ? 18 
HELX_P HELX_P134 134 ASN W  20  ? VAL W  31  ? ASN W 26  VAL W 37  1 ? 12 
HELX_P HELX_P135 135 VAL W  31  ? TYR W  60  ? VAL W 37  TYR W 66  1 ? 30 
HELX_P HELX_P136 136 GLY W  64  ? GLY W  85  ? GLY W 70  GLY W 91  1 ? 22 
HELX_P HELX_P137 137 GLY W  87  ? PHE W  105 ? GLY W 93  PHE W 111 1 ? 19 
HELX_P HELX_P138 138 ASN W  108 ? THR W  120 ? ASN W 114 THR W 126 1 ? 13 
HELX_P HELX_P139 139 SER X  3   ? ASN X  20  ? SER X 9   ASN X 26  1 ? 18 
HELX_P HELX_P140 140 ASN X  20  ? VAL X  43  ? ASN X 26  VAL X 49  1 ? 24 
HELX_P HELX_P141 141 VAL X  43  ? TYR X  60  ? VAL X 49  TYR X 66  1 ? 18 
HELX_P HELX_P142 142 GLY X  64  ? GLY X  85  ? GLY X 70  GLY X 91  1 ? 22 
HELX_P HELX_P143 143 GLY X  87  ? PHE X  105 ? GLY X 93  PHE X 111 1 ? 19 
HELX_P HELX_P144 144 ASN X  108 ? THR X  120 ? ASN X 114 THR X 126 1 ? 13 
HELX_P HELX_P145 145 SER Y  3   ? ASN Y  20  ? SER Y 9   ASN Y 26  1 ? 18 
HELX_P HELX_P146 146 ASN Y  20  ? VAL Y  31  ? ASN Y 26  VAL Y 37  1 ? 12 
HELX_P HELX_P147 147 VAL Y  31  ? TYR Y  60  ? VAL Y 37  TYR Y 66  1 ? 30 
HELX_P HELX_P148 148 GLY Y  64  ? GLY Y  85  ? GLY Y 70  GLY Y 91  1 ? 22 
HELX_P HELX_P149 149 GLY Y  87  ? PHE Y  105 ? GLY Y 93  PHE Y 111 1 ? 19 
HELX_P HELX_P150 150 ASN Y  108 ? THR Y  120 ? ASN Y 114 THR Y 126 1 ? 13 
HELX_P HELX_P151 151 SER Z  3   ? ASN Z  20  ? SER Z 9   ASN Z 26  1 ? 18 
HELX_P HELX_P152 152 ASN Z  20  ? VAL Z  43  ? ASN Z 26  VAL Z 49  1 ? 24 
HELX_P HELX_P153 153 VAL Z  43  ? TYR Z  60  ? VAL Z 49  TYR Z 66  1 ? 18 
HELX_P HELX_P154 154 GLY Z  64  ? GLY Z  85  ? GLY Z 70  GLY Z 91  1 ? 22 
HELX_P HELX_P155 155 GLY Z  87  ? PHE Z  105 ? GLY Z 93  PHE Z 111 1 ? 19 
HELX_P HELX_P156 156 ASN Z  108 ? THR Z  120 ? ASN Z 114 THR Z 126 1 ? 13 
HELX_P HELX_P157 157 SER AA 3   ? ASN AA 20  ? SER a 9   ASN a 26  1 ? 18 
HELX_P HELX_P158 158 ASN AA 20  ? VAL AA 31  ? ASN a 26  VAL a 37  1 ? 12 
HELX_P HELX_P159 159 VAL AA 31  ? TYR AA 60  ? VAL a 37  TYR a 66  1 ? 30 
HELX_P HELX_P160 160 GLY AA 64  ? GLY AA 85  ? GLY a 70  GLY a 91  1 ? 22 
HELX_P HELX_P161 161 GLY AA 87  ? PHE AA 105 ? GLY a 93  PHE a 111 1 ? 19 
HELX_P HELX_P162 162 ASN AA 108 ? THR AA 120 ? ASN a 114 THR a 126 1 ? 13 
HELX_P HELX_P163 163 SER BA 3   ? ASN BA 20  ? SER b 9   ASN b 26  1 ? 18 
HELX_P HELX_P164 164 ASN BA 20  ? VAL BA 43  ? ASN b 26  VAL b 49  1 ? 24 
HELX_P HELX_P165 165 VAL BA 43  ? TYR BA 60  ? VAL b 49  TYR b 66  1 ? 18 
HELX_P HELX_P166 166 GLY BA 64  ? GLY BA 85  ? GLY b 70  GLY b 91  1 ? 22 
HELX_P HELX_P167 167 GLY BA 87  ? PHE BA 105 ? GLY b 93  PHE b 111 1 ? 19 
HELX_P HELX_P168 168 ASN BA 108 ? THR BA 120 ? ASN b 114 THR b 126 1 ? 13 
HELX_P HELX_P169 169 SER CA 3   ? ASN CA 20  ? SER c 9   ASN c 26  1 ? 18 
HELX_P HELX_P170 170 ASN CA 20  ? VAL CA 31  ? ASN c 26  VAL c 37  1 ? 12 
HELX_P HELX_P171 171 VAL CA 31  ? TYR CA 60  ? VAL c 37  TYR c 66  1 ? 30 
HELX_P HELX_P172 172 GLY CA 64  ? GLY CA 85  ? GLY c 70  GLY c 91  1 ? 22 
HELX_P HELX_P173 173 GLY CA 87  ? PHE CA 105 ? GLY c 93  PHE c 111 1 ? 19 
HELX_P HELX_P174 174 ASN CA 108 ? THR CA 120 ? ASN c 114 THR c 126 1 ? 13 
HELX_P HELX_P175 175 SER DA 3   ? ASN DA 20  ? SER d 9   ASN d 26  1 ? 18 
HELX_P HELX_P176 176 ASN DA 20  ? VAL DA 43  ? ASN d 26  VAL d 49  1 ? 24 
HELX_P HELX_P177 177 VAL DA 43  ? TYR DA 60  ? VAL d 49  TYR d 66  1 ? 18 
HELX_P HELX_P178 178 GLY DA 64  ? GLY DA 85  ? GLY d 70  GLY d 91  1 ? 22 
HELX_P HELX_P179 179 GLY DA 87  ? PHE DA 105 ? GLY d 93  PHE d 111 1 ? 19 
HELX_P HELX_P180 180 ASN DA 108 ? THR DA 120 ? ASN d 114 THR d 126 1 ? 13 
HELX_P HELX_P181 181 SER EA 3   ? ASN EA 20  ? SER e 9   ASN e 26  1 ? 18 
HELX_P HELX_P182 182 ASN EA 20  ? VAL EA 31  ? ASN e 26  VAL e 37  1 ? 12 
HELX_P HELX_P183 183 VAL EA 31  ? TYR EA 60  ? VAL e 37  TYR e 66  1 ? 30 
HELX_P HELX_P184 184 GLY EA 64  ? GLY EA 85  ? GLY e 70  GLY e 91  1 ? 22 
HELX_P HELX_P185 185 GLY EA 87  ? PHE EA 105 ? GLY e 93  PHE e 111 1 ? 19 
HELX_P HELX_P186 186 ASN EA 108 ? THR EA 120 ? ASN e 114 THR e 126 1 ? 13 
HELX_P HELX_P187 187 SER FA 3   ? ASN FA 20  ? SER f 9   ASN f 26  1 ? 18 
HELX_P HELX_P188 188 ASN FA 20  ? VAL FA 43  ? ASN f 26  VAL f 49  1 ? 24 
HELX_P HELX_P189 189 VAL FA 43  ? TYR FA 60  ? VAL f 49  TYR f 66  1 ? 18 
HELX_P HELX_P190 190 GLY FA 64  ? GLY FA 85  ? GLY f 70  GLY f 91  1 ? 22 
HELX_P HELX_P191 191 GLY FA 87  ? PHE FA 105 ? GLY f 93  PHE f 111 1 ? 19 
HELX_P HELX_P192 192 ASN FA 108 ? THR FA 120 ? ASN f 114 THR f 126 1 ? 13 
HELX_P HELX_P193 193 SER GA 3   ? ASN GA 20  ? SER g 9   ASN g 26  1 ? 18 
HELX_P HELX_P194 194 ASN GA 20  ? VAL GA 31  ? ASN g 26  VAL g 37  1 ? 12 
HELX_P HELX_P195 195 VAL GA 31  ? TYR GA 60  ? VAL g 37  TYR g 66  1 ? 30 
HELX_P HELX_P196 196 GLY GA 64  ? GLY GA 85  ? GLY g 70  GLY g 91  1 ? 22 
HELX_P HELX_P197 197 GLY GA 87  ? PHE GA 105 ? GLY g 93  PHE g 111 1 ? 19 
HELX_P HELX_P198 198 ASN GA 108 ? THR GA 120 ? ASN g 114 THR g 126 1 ? 13 
HELX_P HELX_P199 199 SER HA 3   ? ASN HA 20  ? SER h 9   ASN h 26  1 ? 18 
HELX_P HELX_P200 200 ASN HA 20  ? VAL HA 43  ? ASN h 26  VAL h 49  1 ? 24 
HELX_P HELX_P201 201 VAL HA 43  ? TYR HA 60  ? VAL h 49  TYR h 66  1 ? 18 
HELX_P HELX_P202 202 GLY HA 64  ? GLY HA 85  ? GLY h 70  GLY h 91  1 ? 22 
HELX_P HELX_P203 203 GLY HA 87  ? PHE HA 105 ? GLY h 93  PHE h 111 1 ? 19 
HELX_P HELX_P204 204 ASN HA 108 ? THR HA 120 ? ASN h 114 THR h 126 1 ? 13 
HELX_P HELX_P205 205 SER IA 3   ? ASN IA 20  ? SER i 9   ASN i 26  1 ? 18 
HELX_P HELX_P206 206 ASN IA 20  ? VAL IA 31  ? ASN i 26  VAL i 37  1 ? 12 
HELX_P HELX_P207 207 VAL IA 31  ? TYR IA 60  ? VAL i 37  TYR i 66  1 ? 30 
HELX_P HELX_P208 208 GLY IA 64  ? GLY IA 85  ? GLY i 70  GLY i 91  1 ? 22 
HELX_P HELX_P209 209 GLY IA 87  ? PHE IA 105 ? GLY i 93  PHE i 111 1 ? 19 
HELX_P HELX_P210 210 ASN IA 108 ? THR IA 120 ? ASN i 114 THR i 126 1 ? 13 
HELX_P HELX_P211 211 SER JA 3   ? ASN JA 20  ? SER j 9   ASN j 26  1 ? 18 
HELX_P HELX_P212 212 ASN JA 20  ? VAL JA 43  ? ASN j 26  VAL j 49  1 ? 24 
HELX_P HELX_P213 213 VAL JA 43  ? TYR JA 60  ? VAL j 49  TYR j 66  1 ? 18 
HELX_P HELX_P214 214 GLY JA 64  ? GLY JA 85  ? GLY j 70  GLY j 91  1 ? 22 
HELX_P HELX_P215 215 GLY JA 87  ? PHE JA 105 ? GLY j 93  PHE j 111 1 ? 19 
HELX_P HELX_P216 216 ASN JA 108 ? THR JA 120 ? ASN j 114 THR j 126 1 ? 13 
HELX_P HELX_P217 217 SER KA 3   ? ASN KA 20  ? SER k 9   ASN k 26  1 ? 18 
HELX_P HELX_P218 218 ASN KA 20  ? VAL KA 31  ? ASN k 26  VAL k 37  1 ? 12 
HELX_P HELX_P219 219 VAL KA 31  ? TYR KA 60  ? VAL k 37  TYR k 66  1 ? 30 
HELX_P HELX_P220 220 GLY KA 64  ? GLY KA 85  ? GLY k 70  GLY k 91  1 ? 22 
HELX_P HELX_P221 221 GLY KA 87  ? PHE KA 105 ? GLY k 93  PHE k 111 1 ? 19 
HELX_P HELX_P222 222 ASN KA 108 ? THR KA 120 ? ASN k 114 THR k 126 1 ? 13 
HELX_P HELX_P223 223 SER LA 3   ? ASN LA 20  ? SER l 9   ASN l 26  1 ? 18 
HELX_P HELX_P224 224 ASN LA 20  ? VAL LA 43  ? ASN l 26  VAL l 49  1 ? 24 
HELX_P HELX_P225 225 VAL LA 43  ? TYR LA 60  ? VAL l 49  TYR l 66  1 ? 18 
HELX_P HELX_P226 226 GLY LA 64  ? GLY LA 85  ? GLY l 70  GLY l 91  1 ? 22 
HELX_P HELX_P227 227 GLY LA 87  ? PHE LA 105 ? GLY l 93  PHE l 111 1 ? 19 
HELX_P HELX_P228 228 ASN LA 108 ? THR LA 120 ? ASN l 114 THR l 126 1 ? 13 
HELX_P HELX_P229 229 SER MA 3   ? ASN MA 20  ? SER m 9   ASN m 26  1 ? 18 
HELX_P HELX_P230 230 ASN MA 20  ? VAL MA 31  ? ASN m 26  VAL m 37  1 ? 12 
HELX_P HELX_P231 231 VAL MA 31  ? TYR MA 60  ? VAL m 37  TYR m 66  1 ? 30 
HELX_P HELX_P232 232 GLY MA 64  ? GLY MA 85  ? GLY m 70  GLY m 91  1 ? 22 
HELX_P HELX_P233 233 GLY MA 87  ? PHE MA 105 ? GLY m 93  PHE m 111 1 ? 19 
HELX_P HELX_P234 234 ASN MA 108 ? THR MA 120 ? ASN m 114 THR m 126 1 ? 13 
HELX_P HELX_P235 235 SER NA 3   ? ASN NA 20  ? SER n 9   ASN n 26  1 ? 18 
HELX_P HELX_P236 236 ASN NA 20  ? VAL NA 43  ? ASN n 26  VAL n 49  1 ? 24 
HELX_P HELX_P237 237 VAL NA 43  ? TYR NA 60  ? VAL n 49  TYR n 66  1 ? 18 
HELX_P HELX_P238 238 GLY NA 64  ? GLY NA 85  ? GLY n 70  GLY n 91  1 ? 22 
HELX_P HELX_P239 239 GLY NA 87  ? PHE NA 105 ? GLY n 93  PHE n 111 1 ? 19 
HELX_P HELX_P240 240 ASN NA 108 ? THR NA 120 ? ASN n 114 THR n 126 1 ? 13 
HELX_P HELX_P241 241 SER OA 3   ? ASN OA 20  ? SER o 9   ASN o 26  1 ? 18 
HELX_P HELX_P242 242 ASN OA 20  ? VAL OA 31  ? ASN o 26  VAL o 37  1 ? 12 
HELX_P HELX_P243 243 VAL OA 31  ? TYR OA 60  ? VAL o 37  TYR o 66  1 ? 30 
HELX_P HELX_P244 244 GLY OA 64  ? GLY OA 85  ? GLY o 70  GLY o 91  1 ? 22 
HELX_P HELX_P245 245 GLY OA 87  ? PHE OA 105 ? GLY o 93  PHE o 111 1 ? 19 
HELX_P HELX_P246 246 ASN OA 108 ? THR OA 120 ? ASN o 114 THR o 126 1 ? 13 
HELX_P HELX_P247 247 SER PA 3   ? ASN PA 20  ? SER p 9   ASN p 26  1 ? 18 
HELX_P HELX_P248 248 ASN PA 20  ? VAL PA 43  ? ASN p 26  VAL p 49  1 ? 24 
HELX_P HELX_P249 249 VAL PA 43  ? TYR PA 60  ? VAL p 49  TYR p 66  1 ? 18 
HELX_P HELX_P250 250 GLY PA 64  ? GLY PA 85  ? GLY p 70  GLY p 91  1 ? 22 
HELX_P HELX_P251 251 GLY PA 87  ? PHE PA 105 ? GLY p 93  PHE p 111 1 ? 19 
HELX_P HELX_P252 252 ASN PA 108 ? THR PA 120 ? ASN p 114 THR p 126 1 ? 13 
HELX_P HELX_P253 253 SER QA 3   ? ASN QA 20  ? SER q 9   ASN q 26  1 ? 18 
HELX_P HELX_P254 254 ASN QA 20  ? VAL QA 31  ? ASN q 26  VAL q 37  1 ? 12 
HELX_P HELX_P255 255 VAL QA 31  ? TYR QA 60  ? VAL q 37  TYR q 66  1 ? 30 
HELX_P HELX_P256 256 GLY QA 64  ? GLY QA 85  ? GLY q 70  GLY q 91  1 ? 22 
HELX_P HELX_P257 257 GLY QA 87  ? PHE QA 105 ? GLY q 93  PHE q 111 1 ? 19 
HELX_P HELX_P258 258 ASN QA 108 ? THR QA 120 ? ASN q 114 THR q 126 1 ? 13 
HELX_P HELX_P259 259 SER RA 3   ? ASN RA 20  ? SER r 9   ASN r 26  1 ? 18 
HELX_P HELX_P260 260 ASN RA 20  ? VAL RA 43  ? ASN r 26  VAL r 49  1 ? 24 
HELX_P HELX_P261 261 VAL RA 43  ? TYR RA 60  ? VAL r 49  TYR r 66  1 ? 18 
HELX_P HELX_P262 262 GLY RA 64  ? GLY RA 85  ? GLY r 70  GLY r 91  1 ? 22 
HELX_P HELX_P263 263 GLY RA 87  ? PHE RA 105 ? GLY r 93  PHE r 111 1 ? 19 
HELX_P HELX_P264 264 ASN RA 108 ? THR RA 120 ? ASN r 114 THR r 126 1 ? 13 
HELX_P HELX_P265 265 SER SA 3   ? ASN SA 20  ? SER s 9   ASN s 26  1 ? 18 
HELX_P HELX_P266 266 ASN SA 20  ? VAL SA 31  ? ASN s 26  VAL s 37  1 ? 12 
HELX_P HELX_P267 267 VAL SA 31  ? TYR SA 60  ? VAL s 37  TYR s 66  1 ? 30 
HELX_P HELX_P268 268 GLY SA 64  ? GLY SA 85  ? GLY s 70  GLY s 91  1 ? 22 
HELX_P HELX_P269 269 GLY SA 87  ? PHE SA 105 ? GLY s 93  PHE s 111 1 ? 19 
HELX_P HELX_P270 270 ASN SA 108 ? THR SA 120 ? ASN s 114 THR s 126 1 ? 13 
HELX_P HELX_P271 271 SER TA 3   ? ASN TA 20  ? SER t 9   ASN t 26  1 ? 18 
HELX_P HELX_P272 272 ASN TA 20  ? VAL TA 43  ? ASN t 26  VAL t 49  1 ? 24 
HELX_P HELX_P273 273 VAL TA 43  ? TYR TA 60  ? VAL t 49  TYR t 66  1 ? 18 
HELX_P HELX_P274 274 GLY TA 64  ? GLY TA 85  ? GLY t 70  GLY t 91  1 ? 22 
HELX_P HELX_P275 275 GLY TA 87  ? PHE TA 105 ? GLY t 93  PHE t 111 1 ? 19 
HELX_P HELX_P276 276 ASN TA 108 ? THR TA 120 ? ASN t 114 THR t 126 1 ? 13 
HELX_P HELX_P277 277 SER UA 3   ? ASN UA 20  ? SER u 9   ASN u 26  1 ? 18 
HELX_P HELX_P278 278 ASN UA 20  ? VAL UA 31  ? ASN u 26  VAL u 37  1 ? 12 
HELX_P HELX_P279 279 VAL UA 31  ? TYR UA 60  ? VAL u 37  TYR u 66  1 ? 30 
HELX_P HELX_P280 280 GLY UA 64  ? GLY UA 85  ? GLY u 70  GLY u 91  1 ? 22 
HELX_P HELX_P281 281 GLY UA 87  ? PHE UA 105 ? GLY u 93  PHE u 111 1 ? 19 
HELX_P HELX_P282 282 ASN UA 108 ? THR UA 120 ? ASN u 114 THR u 126 1 ? 13 
HELX_P HELX_P283 283 SER VA 3   ? ASN VA 20  ? SER v 9   ASN v 26  1 ? 18 
HELX_P HELX_P284 284 ASN VA 20  ? VAL VA 43  ? ASN v 26  VAL v 49  1 ? 24 
HELX_P HELX_P285 285 VAL VA 43  ? TYR VA 60  ? VAL v 49  TYR v 66  1 ? 18 
HELX_P HELX_P286 286 GLY VA 64  ? GLY VA 85  ? GLY v 70  GLY v 91  1 ? 22 
HELX_P HELX_P287 287 GLY VA 87  ? PHE VA 105 ? GLY v 93  PHE v 111 1 ? 19 
HELX_P HELX_P288 288 ASN VA 108 ? THR VA 120 ? ASN v 114 THR v 126 1 ? 13 
HELX_P HELX_P289 289 SER WA 3   ? ASN WA 20  ? SER w 9   ASN w 26  1 ? 18 
HELX_P HELX_P290 290 ASN WA 20  ? VAL WA 31  ? ASN w 26  VAL w 37  1 ? 12 
HELX_P HELX_P291 291 VAL WA 31  ? TYR WA 60  ? VAL w 37  TYR w 66  1 ? 30 
HELX_P HELX_P292 292 GLY WA 64  ? GLY WA 85  ? GLY w 70  GLY w 91  1 ? 22 
HELX_P HELX_P293 293 GLY WA 87  ? PHE WA 105 ? GLY w 93  PHE w 111 1 ? 19 
HELX_P HELX_P294 294 ASN WA 108 ? THR WA 120 ? ASN w 114 THR w 126 1 ? 13 
HELX_P HELX_P295 295 SER XA 3   ? ASN XA 20  ? SER x 9   ASN x 26  1 ? 18 
HELX_P HELX_P296 296 ASN XA 20  ? VAL XA 43  ? ASN x 26  VAL x 49  1 ? 24 
HELX_P HELX_P297 297 VAL XA 43  ? TYR XA 60  ? VAL x 49  TYR x 66  1 ? 18 
HELX_P HELX_P298 298 GLY XA 64  ? GLY XA 85  ? GLY x 70  GLY x 91  1 ? 22 
HELX_P HELX_P299 299 GLY XA 87  ? PHE XA 105 ? GLY x 93  PHE x 111 1 ? 19 
HELX_P HELX_P300 300 ASN XA 108 ? THR XA 120 ? ASN x 114 THR x 126 1 ? 13 
HELX_P HELX_P301 301 SER YA 3   ? ASN YA 20  ? SER y 9   ASN y 26  1 ? 18 
HELX_P HELX_P302 302 ASN YA 20  ? VAL YA 31  ? ASN y 26  VAL y 37  1 ? 12 
HELX_P HELX_P303 303 VAL YA 31  ? TYR YA 60  ? VAL y 37  TYR y 66  1 ? 30 
HELX_P HELX_P304 304 GLY YA 64  ? GLY YA 85  ? GLY y 70  GLY y 91  1 ? 22 
HELX_P HELX_P305 305 GLY YA 87  ? PHE YA 105 ? GLY y 93  PHE y 111 1 ? 19 
HELX_P HELX_P306 306 ASN YA 108 ? THR YA 120 ? ASN y 114 THR y 126 1 ? 13 
HELX_P HELX_P307 307 SER ZA 3   ? ASN ZA 20  ? SER z 9   ASN z 26  1 ? 18 
HELX_P HELX_P308 308 ASN ZA 20  ? VAL ZA 43  ? ASN z 26  VAL z 49  1 ? 24 
HELX_P HELX_P309 309 VAL ZA 43  ? TYR ZA 60  ? VAL z 49  TYR z 66  1 ? 18 
HELX_P HELX_P310 310 GLY ZA 64  ? GLY ZA 85  ? GLY z 70  GLY z 91  1 ? 22 
HELX_P HELX_P311 311 GLY ZA 87  ? PHE ZA 105 ? GLY z 93  PHE z 111 1 ? 19 
HELX_P HELX_P312 312 ASN ZA 108 ? THR ZA 120 ? ASN z 114 THR z 126 1 ? 13 
HELX_P HELX_P313 313 SER AB 3   ? ASN AB 20  ? SER 1 9   ASN 1 26  1 ? 18 
HELX_P HELX_P314 314 ASN AB 20  ? VAL AB 31  ? ASN 1 26  VAL 1 37  1 ? 12 
HELX_P HELX_P315 315 VAL AB 31  ? TYR AB 60  ? VAL 1 37  TYR 1 66  1 ? 30 
HELX_P HELX_P316 316 GLY AB 64  ? GLY AB 85  ? GLY 1 70  GLY 1 91  1 ? 22 
HELX_P HELX_P317 317 GLY AB 87  ? PHE AB 105 ? GLY 1 93  PHE 1 111 1 ? 19 
HELX_P HELX_P318 318 ASN AB 108 ? THR AB 120 ? ASN 1 114 THR 1 126 1 ? 13 
HELX_P HELX_P319 319 SER BB 3   ? ASN BB 20  ? SER 2 9   ASN 2 26  1 ? 18 
HELX_P HELX_P320 320 ASN BB 20  ? VAL BB 43  ? ASN 2 26  VAL 2 49  1 ? 24 
HELX_P HELX_P321 321 VAL BB 43  ? TYR BB 60  ? VAL 2 49  TYR 2 66  1 ? 18 
HELX_P HELX_P322 322 GLY BB 64  ? GLY BB 85  ? GLY 2 70  GLY 2 91  1 ? 22 
HELX_P HELX_P323 323 GLY BB 87  ? PHE BB 105 ? GLY 2 93  PHE 2 111 1 ? 19 
HELX_P HELX_P324 324 ASN BB 108 ? THR BB 120 ? ASN 2 114 THR 2 126 1 ? 13 
HELX_P HELX_P325 325 SER CB 3   ? ASN CB 20  ? SER 3 9   ASN 3 26  1 ? 18 
HELX_P HELX_P326 326 ASN CB 20  ? VAL CB 31  ? ASN 3 26  VAL 3 37  1 ? 12 
HELX_P HELX_P327 327 VAL CB 31  ? TYR CB 60  ? VAL 3 37  TYR 3 66  1 ? 30 
HELX_P HELX_P328 328 GLY CB 64  ? GLY CB 85  ? GLY 3 70  GLY 3 91  1 ? 22 
HELX_P HELX_P329 329 GLY CB 87  ? PHE CB 105 ? GLY 3 93  PHE 3 111 1 ? 19 
HELX_P HELX_P330 330 ASN CB 108 ? THR CB 120 ? ASN 3 114 THR 3 126 1 ? 13 
HELX_P HELX_P331 331 SER DB 3   ? ASN DB 20  ? SER 4 9   ASN 4 26  1 ? 18 
HELX_P HELX_P332 332 ASN DB 20  ? VAL DB 43  ? ASN 4 26  VAL 4 49  1 ? 24 
HELX_P HELX_P333 333 VAL DB 43  ? TYR DB 60  ? VAL 4 49  TYR 4 66  1 ? 18 
HELX_P HELX_P334 334 GLY DB 64  ? GLY DB 85  ? GLY 4 70  GLY 4 91  1 ? 22 
HELX_P HELX_P335 335 GLY DB 87  ? PHE DB 105 ? GLY 4 93  PHE 4 111 1 ? 19 
HELX_P HELX_P336 336 ASN DB 108 ? THR DB 120 ? ASN 4 114 THR 4 126 1 ? 13 
HELX_P HELX_P337 337 SER EB 3   ? ASN EB 20  ? SER 5 9   ASN 5 26  1 ? 18 
HELX_P HELX_P338 338 ASN EB 20  ? VAL EB 31  ? ASN 5 26  VAL 5 37  1 ? 12 
HELX_P HELX_P339 339 VAL EB 31  ? TYR EB 60  ? VAL 5 37  TYR 5 66  1 ? 30 
HELX_P HELX_P340 340 GLY EB 64  ? GLY EB 85  ? GLY 5 70  GLY 5 91  1 ? 22 
HELX_P HELX_P341 341 GLY EB 87  ? PHE EB 105 ? GLY 5 93  PHE 5 111 1 ? 19 
HELX_P HELX_P342 342 ASN EB 108 ? THR EB 120 ? ASN 5 114 THR 5 126 1 ? 13 
HELX_P HELX_P343 343 SER FB 3   ? ASN FB 20  ? SER 6 9   ASN 6 26  1 ? 18 
HELX_P HELX_P344 344 ASN FB 20  ? VAL FB 43  ? ASN 6 26  VAL 6 49  1 ? 24 
HELX_P HELX_P345 345 VAL FB 43  ? TYR FB 60  ? VAL 6 49  TYR 6 66  1 ? 18 
HELX_P HELX_P346 346 GLY FB 64  ? GLY FB 85  ? GLY 6 70  GLY 6 91  1 ? 22 
HELX_P HELX_P347 347 GLY FB 87  ? PHE FB 105 ? GLY 6 93  PHE 6 111 1 ? 19 
HELX_P HELX_P348 348 ASN FB 108 ? THR FB 120 ? ASN 6 114 THR 6 126 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
hydrog1   hydrog ? ? GB DA 1   N1 ? ? ? 1_555 HB DT 348 N3 ? ? 7 DA 1   8 DT 348 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog2   hydrog ? ? GB DA 1   N6 ? ? ? 1_555 HB DT 348 O4 ? ? 7 DA 1   8 DT 348 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog3   hydrog ? ? GB DT 2   N3 ? ? ? 1_555 HB DA 347 N1 ? ? 7 DT 2   8 DA 347 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog4   hydrog ? ? GB DT 2   O4 ? ? ? 1_555 HB DA 347 N6 ? ? 7 DT 2   8 DA 347 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog5   hydrog ? ? GB DA 3   N1 ? ? ? 1_555 HB DT 346 N3 ? ? 7 DA 3   8 DT 346 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog6   hydrog ? ? GB DA 3   N6 ? ? ? 1_555 HB DT 346 O4 ? ? 7 DA 3   8 DT 346 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog7   hydrog ? ? GB DT 4   N3 ? ? ? 1_555 HB DA 345 N1 ? ? 7 DT 4   8 DA 345 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog8   hydrog ? ? GB DT 4   O4 ? ? ? 1_555 HB DA 345 N6 ? ? 7 DT 4   8 DA 345 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog9   hydrog ? ? GB DA 5   N1 ? ? ? 1_555 HB DT 344 N3 ? ? 7 DA 5   8 DT 344 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog10  hydrog ? ? GB DA 5   N6 ? ? ? 1_555 HB DT 344 O4 ? ? 7 DA 5   8 DT 344 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog11  hydrog ? ? GB DT 6   N3 ? ? ? 1_555 HB DA 343 N1 ? ? 7 DT 6   8 DA 343 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog12  hydrog ? ? GB DT 6   O4 ? ? ? 1_555 HB DA 343 N6 ? ? 7 DT 6   8 DA 343 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog13  hydrog ? ? GB DA 7   N1 ? ? ? 1_555 HB DT 342 N3 ? ? 7 DA 7   8 DT 342 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog14  hydrog ? ? GB DA 7   N6 ? ? ? 1_555 HB DT 342 O4 ? ? 7 DA 7   8 DT 342 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog15  hydrog ? ? GB DT 8   N3 ? ? ? 1_555 HB DA 341 N1 ? ? 7 DT 8   8 DA 341 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog16  hydrog ? ? GB DT 8   O4 ? ? ? 1_555 HB DA 341 N6 ? ? 7 DT 8   8 DA 341 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog17  hydrog ? ? GB DA 9   N1 ? ? ? 1_555 HB DT 340 N3 ? ? 7 DA 9   8 DT 340 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog18  hydrog ? ? GB DA 9   N6 ? ? ? 1_555 HB DT 340 O4 ? ? 7 DA 9   8 DT 340 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog19  hydrog ? ? GB DT 10  N3 ? ? ? 1_555 HB DA 339 N1 ? ? 7 DT 10  8 DA 339 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog20  hydrog ? ? GB DT 10  O4 ? ? ? 1_555 HB DA 339 N6 ? ? 7 DT 10  8 DA 339 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog21  hydrog ? ? GB DA 11  N1 ? ? ? 1_555 HB DT 338 N3 ? ? 7 DA 11  8 DT 338 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog22  hydrog ? ? GB DA 11  N6 ? ? ? 1_555 HB DT 338 O4 ? ? 7 DA 11  8 DT 338 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog23  hydrog ? ? GB DT 12  N3 ? ? ? 1_555 HB DA 337 N1 ? ? 7 DT 12  8 DA 337 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog24  hydrog ? ? GB DT 12  O4 ? ? ? 1_555 HB DA 337 N6 ? ? 7 DT 12  8 DA 337 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog25  hydrog ? ? GB DA 13  N1 ? ? ? 1_555 HB DT 336 N3 ? ? 7 DA 13  8 DT 336 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog26  hydrog ? ? GB DA 13  N6 ? ? ? 1_555 HB DT 336 O4 ? ? 7 DA 13  8 DT 336 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog27  hydrog ? ? GB DT 14  N3 ? ? ? 1_555 HB DA 335 N1 ? ? 7 DT 14  8 DA 335 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog28  hydrog ? ? GB DT 14  O4 ? ? ? 1_555 HB DA 335 N6 ? ? 7 DT 14  8 DA 335 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog29  hydrog ? ? GB DA 15  N1 ? ? ? 1_555 HB DT 334 N3 ? ? 7 DA 15  8 DT 334 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog30  hydrog ? ? GB DA 15  N6 ? ? ? 1_555 HB DT 334 O4 ? ? 7 DA 15  8 DT 334 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog31  hydrog ? ? GB DT 16  N3 ? ? ? 1_555 HB DA 333 N1 ? ? 7 DT 16  8 DA 333 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog32  hydrog ? ? GB DT 16  O4 ? ? ? 1_555 HB DA 333 N6 ? ? 7 DT 16  8 DA 333 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog33  hydrog ? ? GB DA 17  N1 ? ? ? 1_555 HB DT 332 N3 ? ? 7 DA 17  8 DT 332 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog34  hydrog ? ? GB DA 17  N6 ? ? ? 1_555 HB DT 332 O4 ? ? 7 DA 17  8 DT 332 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog35  hydrog ? ? GB DT 18  N3 ? ? ? 1_555 HB DA 331 N1 ? ? 7 DT 18  8 DA 331 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog36  hydrog ? ? GB DT 18  O4 ? ? ? 1_555 HB DA 331 N6 ? ? 7 DT 18  8 DA 331 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog37  hydrog ? ? GB DA 19  N1 ? ? ? 1_555 HB DT 330 N3 ? ? 7 DA 19  8 DT 330 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog38  hydrog ? ? GB DA 19  N6 ? ? ? 1_555 HB DT 330 O4 ? ? 7 DA 19  8 DT 330 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog39  hydrog ? ? GB DT 20  N3 ? ? ? 1_555 HB DA 329 N1 ? ? 7 DT 20  8 DA 329 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog40  hydrog ? ? GB DT 20  O4 ? ? ? 1_555 HB DA 329 N6 ? ? 7 DT 20  8 DA 329 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog41  hydrog ? ? GB DA 21  N1 ? ? ? 1_555 HB DT 328 N3 ? ? 7 DA 21  8 DT 328 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog42  hydrog ? ? GB DA 21  N6 ? ? ? 1_555 HB DT 328 O4 ? ? 7 DA 21  8 DT 328 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog43  hydrog ? ? GB DT 22  N3 ? ? ? 1_555 HB DA 327 N1 ? ? 7 DT 22  8 DA 327 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog44  hydrog ? ? GB DT 22  O4 ? ? ? 1_555 HB DA 327 N6 ? ? 7 DT 22  8 DA 327 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog45  hydrog ? ? GB DA 23  N1 ? ? ? 1_555 HB DT 326 N3 ? ? 7 DA 23  8 DT 326 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog46  hydrog ? ? GB DA 23  N6 ? ? ? 1_555 HB DT 326 O4 ? ? 7 DA 23  8 DT 326 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog47  hydrog ? ? GB DT 24  N3 ? ? ? 1_555 HB DA 325 N1 ? ? 7 DT 24  8 DA 325 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog48  hydrog ? ? GB DT 24  O4 ? ? ? 1_555 HB DA 325 N6 ? ? 7 DT 24  8 DA 325 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog49  hydrog ? ? GB DA 25  N1 ? ? ? 1_555 HB DT 324 N3 ? ? 7 DA 25  8 DT 324 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog50  hydrog ? ? GB DA 25  N6 ? ? ? 1_555 HB DT 324 O4 ? ? 7 DA 25  8 DT 324 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog51  hydrog ? ? GB DT 26  N3 ? ? ? 1_555 HB DA 323 N1 ? ? 7 DT 26  8 DA 323 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog52  hydrog ? ? GB DT 26  O4 ? ? ? 1_555 HB DA 323 N6 ? ? 7 DT 26  8 DA 323 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog53  hydrog ? ? GB DA 27  N1 ? ? ? 1_555 HB DT 322 N3 ? ? 7 DA 27  8 DT 322 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog54  hydrog ? ? GB DA 27  N6 ? ? ? 1_555 HB DT 322 O4 ? ? 7 DA 27  8 DT 322 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog55  hydrog ? ? GB DT 28  N3 ? ? ? 1_555 HB DA 321 N1 ? ? 7 DT 28  8 DA 321 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog56  hydrog ? ? GB DT 28  O4 ? ? ? 1_555 HB DA 321 N6 ? ? 7 DT 28  8 DA 321 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog57  hydrog ? ? GB DA 29  N1 ? ? ? 1_555 HB DT 320 N3 ? ? 7 DA 29  8 DT 320 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog58  hydrog ? ? GB DA 29  N6 ? ? ? 1_555 HB DT 320 O4 ? ? 7 DA 29  8 DT 320 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog59  hydrog ? ? GB DT 30  N3 ? ? ? 1_555 HB DA 319 N1 ? ? 7 DT 30  8 DA 319 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog60  hydrog ? ? GB DT 30  O4 ? ? ? 1_555 HB DA 319 N6 ? ? 7 DT 30  8 DA 319 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog61  hydrog ? ? GB DA 31  N1 ? ? ? 1_555 HB DT 318 N3 ? ? 7 DA 31  8 DT 318 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog62  hydrog ? ? GB DA 31  N6 ? ? ? 1_555 HB DT 318 O4 ? ? 7 DA 31  8 DT 318 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog63  hydrog ? ? GB DT 32  N3 ? ? ? 1_555 HB DA 317 N1 ? ? 7 DT 32  8 DA 317 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog64  hydrog ? ? GB DT 32  O4 ? ? ? 1_555 HB DA 317 N6 ? ? 7 DT 32  8 DA 317 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog65  hydrog ? ? GB DA 33  N1 ? ? ? 1_555 HB DT 316 N3 ? ? 7 DA 33  8 DT 316 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog66  hydrog ? ? GB DA 33  N6 ? ? ? 1_555 HB DT 316 O4 ? ? 7 DA 33  8 DT 316 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog67  hydrog ? ? GB DT 34  N3 ? ? ? 1_555 HB DA 315 N1 ? ? 7 DT 34  8 DA 315 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog68  hydrog ? ? GB DT 34  O4 ? ? ? 1_555 HB DA 315 N6 ? ? 7 DT 34  8 DA 315 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog69  hydrog ? ? GB DA 35  N1 ? ? ? 1_555 HB DT 314 N3 ? ? 7 DA 35  8 DT 314 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog70  hydrog ? ? GB DA 35  N6 ? ? ? 1_555 HB DT 314 O4 ? ? 7 DA 35  8 DT 314 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog71  hydrog ? ? GB DT 36  N3 ? ? ? 1_555 HB DA 313 N1 ? ? 7 DT 36  8 DA 313 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog72  hydrog ? ? GB DT 36  O4 ? ? ? 1_555 HB DA 313 N6 ? ? 7 DT 36  8 DA 313 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog73  hydrog ? ? GB DA 37  N1 ? ? ? 1_555 HB DT 312 N3 ? ? 7 DA 37  8 DT 312 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog74  hydrog ? ? GB DA 37  N6 ? ? ? 1_555 HB DT 312 O4 ? ? 7 DA 37  8 DT 312 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog75  hydrog ? ? GB DT 38  N3 ? ? ? 1_555 HB DA 311 N1 ? ? 7 DT 38  8 DA 311 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog76  hydrog ? ? GB DT 38  O4 ? ? ? 1_555 HB DA 311 N6 ? ? 7 DT 38  8 DA 311 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog77  hydrog ? ? GB DA 39  N1 ? ? ? 1_555 HB DT 310 N3 ? ? 7 DA 39  8 DT 310 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog78  hydrog ? ? GB DA 39  N6 ? ? ? 1_555 HB DT 310 O4 ? ? 7 DA 39  8 DT 310 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog79  hydrog ? ? GB DT 40  N3 ? ? ? 1_555 HB DA 309 N1 ? ? 7 DT 40  8 DA 309 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog80  hydrog ? ? GB DT 40  O4 ? ? ? 1_555 HB DA 309 N6 ? ? 7 DT 40  8 DA 309 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog81  hydrog ? ? GB DA 41  N1 ? ? ? 1_555 HB DT 308 N3 ? ? 7 DA 41  8 DT 308 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog82  hydrog ? ? GB DA 41  N6 ? ? ? 1_555 HB DT 308 O4 ? ? 7 DA 41  8 DT 308 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog83  hydrog ? ? GB DT 42  N3 ? ? ? 1_555 HB DA 307 N1 ? ? 7 DT 42  8 DA 307 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog84  hydrog ? ? GB DT 42  O4 ? ? ? 1_555 HB DA 307 N6 ? ? 7 DT 42  8 DA 307 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog85  hydrog ? ? GB DA 43  N1 ? ? ? 1_555 HB DT 306 N3 ? ? 7 DA 43  8 DT 306 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog86  hydrog ? ? GB DA 43  N6 ? ? ? 1_555 HB DT 306 O4 ? ? 7 DA 43  8 DT 306 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog87  hydrog ? ? GB DT 44  N3 ? ? ? 1_555 HB DA 305 N1 ? ? 7 DT 44  8 DA 305 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog88  hydrog ? ? GB DT 44  O4 ? ? ? 1_555 HB DA 305 N6 ? ? 7 DT 44  8 DA 305 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog89  hydrog ? ? GB DA 45  N1 ? ? ? 1_555 HB DT 304 N3 ? ? 7 DA 45  8 DT 304 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog90  hydrog ? ? GB DA 45  N6 ? ? ? 1_555 HB DT 304 O4 ? ? 7 DA 45  8 DT 304 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog91  hydrog ? ? GB DT 46  N3 ? ? ? 1_555 HB DA 303 N1 ? ? 7 DT 46  8 DA 303 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog92  hydrog ? ? GB DT 46  O4 ? ? ? 1_555 HB DA 303 N6 ? ? 7 DT 46  8 DA 303 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog93  hydrog ? ? GB DA 47  N1 ? ? ? 1_555 HB DT 302 N3 ? ? 7 DA 47  8 DT 302 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog94  hydrog ? ? GB DA 47  N6 ? ? ? 1_555 HB DT 302 O4 ? ? 7 DA 47  8 DT 302 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog95  hydrog ? ? GB DT 48  N3 ? ? ? 1_555 HB DA 301 N1 ? ? 7 DT 48  8 DA 301 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog96  hydrog ? ? GB DT 48  O4 ? ? ? 1_555 HB DA 301 N6 ? ? 7 DT 48  8 DA 301 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog97  hydrog ? ? GB DA 49  N1 ? ? ? 1_555 HB DT 300 N3 ? ? 7 DA 49  8 DT 300 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog98  hydrog ? ? GB DA 49  N6 ? ? ? 1_555 HB DT 300 O4 ? ? 7 DA 49  8 DT 300 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog99  hydrog ? ? GB DT 50  N3 ? ? ? 1_555 HB DA 299 N1 ? ? 7 DT 50  8 DA 299 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog100 hydrog ? ? GB DT 50  O4 ? ? ? 1_555 HB DA 299 N6 ? ? 7 DT 50  8 DA 299 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog101 hydrog ? ? GB DA 51  N1 ? ? ? 1_555 HB DT 298 N3 ? ? 7 DA 51  8 DT 298 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog102 hydrog ? ? GB DA 51  N6 ? ? ? 1_555 HB DT 298 O4 ? ? 7 DA 51  8 DT 298 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog103 hydrog ? ? GB DT 52  N3 ? ? ? 1_555 HB DA 297 N1 ? ? 7 DT 52  8 DA 297 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog104 hydrog ? ? GB DT 52  O4 ? ? ? 1_555 HB DA 297 N6 ? ? 7 DT 52  8 DA 297 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog105 hydrog ? ? GB DA 53  N1 ? ? ? 1_555 HB DT 296 N3 ? ? 7 DA 53  8 DT 296 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog106 hydrog ? ? GB DA 53  N6 ? ? ? 1_555 HB DT 296 O4 ? ? 7 DA 53  8 DT 296 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog107 hydrog ? ? GB DT 54  N3 ? ? ? 1_555 HB DA 295 N1 ? ? 7 DT 54  8 DA 295 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog108 hydrog ? ? GB DT 54  O4 ? ? ? 1_555 HB DA 295 N6 ? ? 7 DT 54  8 DA 295 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog109 hydrog ? ? GB DA 55  N1 ? ? ? 1_555 HB DT 294 N3 ? ? 7 DA 55  8 DT 294 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog110 hydrog ? ? GB DA 55  N6 ? ? ? 1_555 HB DT 294 O4 ? ? 7 DA 55  8 DT 294 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog111 hydrog ? ? GB DT 56  N3 ? ? ? 1_555 HB DA 293 N1 ? ? 7 DT 56  8 DA 293 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog112 hydrog ? ? GB DT 56  O4 ? ? ? 1_555 HB DA 293 N6 ? ? 7 DT 56  8 DA 293 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog113 hydrog ? ? GB DA 57  N1 ? ? ? 1_555 HB DT 292 N3 ? ? 7 DA 57  8 DT 292 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog114 hydrog ? ? GB DA 57  N6 ? ? ? 1_555 HB DT 292 O4 ? ? 7 DA 57  8 DT 292 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog115 hydrog ? ? GB DT 58  N3 ? ? ? 1_555 HB DA 291 N1 ? ? 7 DT 58  8 DA 291 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog116 hydrog ? ? GB DT 58  O4 ? ? ? 1_555 HB DA 291 N6 ? ? 7 DT 58  8 DA 291 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog117 hydrog ? ? GB DA 59  N1 ? ? ? 1_555 HB DT 290 N3 ? ? 7 DA 59  8 DT 290 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog118 hydrog ? ? GB DA 59  N6 ? ? ? 1_555 HB DT 290 O4 ? ? 7 DA 59  8 DT 290 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog119 hydrog ? ? GB DT 60  N3 ? ? ? 1_555 HB DA 289 N1 ? ? 7 DT 60  8 DA 289 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog120 hydrog ? ? GB DT 60  O4 ? ? ? 1_555 HB DA 289 N6 ? ? 7 DT 60  8 DA 289 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog121 hydrog ? ? GB DA 61  N1 ? ? ? 1_555 HB DT 288 N3 ? ? 7 DA 61  8 DT 288 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog122 hydrog ? ? GB DA 61  N6 ? ? ? 1_555 HB DT 288 O4 ? ? 7 DA 61  8 DT 288 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog123 hydrog ? ? GB DT 62  N3 ? ? ? 1_555 HB DA 287 N1 ? ? 7 DT 62  8 DA 287 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog124 hydrog ? ? GB DT 62  O4 ? ? ? 1_555 HB DA 287 N6 ? ? 7 DT 62  8 DA 287 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog125 hydrog ? ? GB DA 63  N1 ? ? ? 1_555 HB DT 286 N3 ? ? 7 DA 63  8 DT 286 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog126 hydrog ? ? GB DA 63  N6 ? ? ? 1_555 HB DT 286 O4 ? ? 7 DA 63  8 DT 286 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog127 hydrog ? ? GB DT 64  N3 ? ? ? 1_555 HB DA 285 N1 ? ? 7 DT 64  8 DA 285 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog128 hydrog ? ? GB DT 64  O4 ? ? ? 1_555 HB DA 285 N6 ? ? 7 DT 64  8 DA 285 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog129 hydrog ? ? GB DA 65  N1 ? ? ? 1_555 HB DT 284 N3 ? ? 7 DA 65  8 DT 284 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog130 hydrog ? ? GB DA 65  N6 ? ? ? 1_555 HB DT 284 O4 ? ? 7 DA 65  8 DT 284 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog131 hydrog ? ? GB DT 66  N3 ? ? ? 1_555 HB DA 283 N1 ? ? 7 DT 66  8 DA 283 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog132 hydrog ? ? GB DT 66  O4 ? ? ? 1_555 HB DA 283 N6 ? ? 7 DT 66  8 DA 283 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog133 hydrog ? ? GB DA 67  N1 ? ? ? 1_555 HB DT 282 N3 ? ? 7 DA 67  8 DT 282 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog134 hydrog ? ? GB DA 67  N6 ? ? ? 1_555 HB DT 282 O4 ? ? 7 DA 67  8 DT 282 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog135 hydrog ? ? GB DT 68  N3 ? ? ? 1_555 HB DA 281 N1 ? ? 7 DT 68  8 DA 281 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog136 hydrog ? ? GB DT 68  O4 ? ? ? 1_555 HB DA 281 N6 ? ? 7 DT 68  8 DA 281 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog137 hydrog ? ? GB DA 69  N1 ? ? ? 1_555 HB DT 280 N3 ? ? 7 DA 69  8 DT 280 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog138 hydrog ? ? GB DA 69  N6 ? ? ? 1_555 HB DT 280 O4 ? ? 7 DA 69  8 DT 280 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog139 hydrog ? ? GB DT 70  N3 ? ? ? 1_555 HB DA 279 N1 ? ? 7 DT 70  8 DA 279 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog140 hydrog ? ? GB DT 70  O4 ? ? ? 1_555 HB DA 279 N6 ? ? 7 DT 70  8 DA 279 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog141 hydrog ? ? GB DA 71  N1 ? ? ? 1_555 HB DT 278 N3 ? ? 7 DA 71  8 DT 278 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog142 hydrog ? ? GB DA 71  N6 ? ? ? 1_555 HB DT 278 O4 ? ? 7 DA 71  8 DT 278 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog143 hydrog ? ? GB DT 72  N3 ? ? ? 1_555 HB DA 277 N1 ? ? 7 DT 72  8 DA 277 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog144 hydrog ? ? GB DT 72  O4 ? ? ? 1_555 HB DA 277 N6 ? ? 7 DT 72  8 DA 277 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog145 hydrog ? ? GB DA 73  N1 ? ? ? 1_555 HB DT 276 N3 ? ? 7 DA 73  8 DT 276 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog146 hydrog ? ? GB DA 73  N6 ? ? ? 1_555 HB DT 276 O4 ? ? 7 DA 73  8 DT 276 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog147 hydrog ? ? GB DT 74  N3 ? ? ? 1_555 HB DA 275 N1 ? ? 7 DT 74  8 DA 275 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog148 hydrog ? ? GB DT 74  O4 ? ? ? 1_555 HB DA 275 N6 ? ? 7 DT 74  8 DA 275 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog149 hydrog ? ? GB DA 75  N1 ? ? ? 1_555 HB DT 274 N3 ? ? 7 DA 75  8 DT 274 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog150 hydrog ? ? GB DA 75  N6 ? ? ? 1_555 HB DT 274 O4 ? ? 7 DA 75  8 DT 274 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog151 hydrog ? ? GB DT 76  N3 ? ? ? 1_555 HB DA 273 N1 ? ? 7 DT 76  8 DA 273 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog152 hydrog ? ? GB DT 76  O4 ? ? ? 1_555 HB DA 273 N6 ? ? 7 DT 76  8 DA 273 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog153 hydrog ? ? GB DA 77  N1 ? ? ? 1_555 HB DT 272 N3 ? ? 7 DA 77  8 DT 272 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog154 hydrog ? ? GB DA 77  N6 ? ? ? 1_555 HB DT 272 O4 ? ? 7 DA 77  8 DT 272 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog155 hydrog ? ? GB DT 78  N3 ? ? ? 1_555 HB DA 271 N1 ? ? 7 DT 78  8 DA 271 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog156 hydrog ? ? GB DT 78  O4 ? ? ? 1_555 HB DA 271 N6 ? ? 7 DT 78  8 DA 271 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog157 hydrog ? ? GB DA 79  N1 ? ? ? 1_555 HB DT 270 N3 ? ? 7 DA 79  8 DT 270 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog158 hydrog ? ? GB DA 79  N6 ? ? ? 1_555 HB DT 270 O4 ? ? 7 DA 79  8 DT 270 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog159 hydrog ? ? GB DT 80  N3 ? ? ? 1_555 HB DA 269 N1 ? ? 7 DT 80  8 DA 269 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog160 hydrog ? ? GB DT 80  O4 ? ? ? 1_555 HB DA 269 N6 ? ? 7 DT 80  8 DA 269 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog161 hydrog ? ? GB DA 81  N1 ? ? ? 1_555 HB DT 268 N3 ? ? 7 DA 81  8 DT 268 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog162 hydrog ? ? GB DA 81  N6 ? ? ? 1_555 HB DT 268 O4 ? ? 7 DA 81  8 DT 268 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog163 hydrog ? ? GB DT 82  N3 ? ? ? 1_555 HB DA 267 N1 ? ? 7 DT 82  8 DA 267 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog164 hydrog ? ? GB DT 82  O4 ? ? ? 1_555 HB DA 267 N6 ? ? 7 DT 82  8 DA 267 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog165 hydrog ? ? GB DA 83  N1 ? ? ? 1_555 HB DT 266 N3 ? ? 7 DA 83  8 DT 266 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog166 hydrog ? ? GB DA 83  N6 ? ? ? 1_555 HB DT 266 O4 ? ? 7 DA 83  8 DT 266 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog167 hydrog ? ? GB DT 84  N3 ? ? ? 1_555 HB DA 265 N1 ? ? 7 DT 84  8 DA 265 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog168 hydrog ? ? GB DT 84  O4 ? ? ? 1_555 HB DA 265 N6 ? ? 7 DT 84  8 DA 265 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog169 hydrog ? ? GB DA 85  N1 ? ? ? 1_555 HB DT 264 N3 ? ? 7 DA 85  8 DT 264 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog170 hydrog ? ? GB DA 85  N6 ? ? ? 1_555 HB DT 264 O4 ? ? 7 DA 85  8 DT 264 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog171 hydrog ? ? GB DT 86  N3 ? ? ? 1_555 HB DA 263 N1 ? ? 7 DT 86  8 DA 263 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog172 hydrog ? ? GB DT 86  O4 ? ? ? 1_555 HB DA 263 N6 ? ? 7 DT 86  8 DA 263 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog173 hydrog ? ? GB DA 87  N1 ? ? ? 1_555 HB DT 262 N3 ? ? 7 DA 87  8 DT 262 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog174 hydrog ? ? GB DA 87  N6 ? ? ? 1_555 HB DT 262 O4 ? ? 7 DA 87  8 DT 262 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog175 hydrog ? ? GB DT 88  N3 ? ? ? 1_555 HB DA 261 N1 ? ? 7 DT 88  8 DA 261 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog176 hydrog ? ? GB DT 88  O4 ? ? ? 1_555 HB DA 261 N6 ? ? 7 DT 88  8 DA 261 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog177 hydrog ? ? GB DA 89  N1 ? ? ? 1_555 HB DT 260 N3 ? ? 7 DA 89  8 DT 260 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog178 hydrog ? ? GB DA 89  N6 ? ? ? 1_555 HB DT 260 O4 ? ? 7 DA 89  8 DT 260 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog179 hydrog ? ? GB DT 90  N3 ? ? ? 1_555 HB DA 259 N1 ? ? 7 DT 90  8 DA 259 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog180 hydrog ? ? GB DT 90  O4 ? ? ? 1_555 HB DA 259 N6 ? ? 7 DT 90  8 DA 259 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog181 hydrog ? ? GB DA 91  N1 ? ? ? 1_555 HB DT 258 N3 ? ? 7 DA 91  8 DT 258 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog182 hydrog ? ? GB DA 91  N6 ? ? ? 1_555 HB DT 258 O4 ? ? 7 DA 91  8 DT 258 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog183 hydrog ? ? GB DT 92  N3 ? ? ? 1_555 HB DA 257 N1 ? ? 7 DT 92  8 DA 257 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog184 hydrog ? ? GB DT 92  O4 ? ? ? 1_555 HB DA 257 N6 ? ? 7 DT 92  8 DA 257 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog185 hydrog ? ? GB DA 93  N1 ? ? ? 1_555 HB DT 256 N3 ? ? 7 DA 93  8 DT 256 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog186 hydrog ? ? GB DA 93  N6 ? ? ? 1_555 HB DT 256 O4 ? ? 7 DA 93  8 DT 256 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog187 hydrog ? ? GB DT 94  N3 ? ? ? 1_555 HB DA 255 N1 ? ? 7 DT 94  8 DA 255 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog188 hydrog ? ? GB DT 94  O4 ? ? ? 1_555 HB DA 255 N6 ? ? 7 DT 94  8 DA 255 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog189 hydrog ? ? GB DA 95  N1 ? ? ? 1_555 HB DT 254 N3 ? ? 7 DA 95  8 DT 254 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog190 hydrog ? ? GB DA 95  N6 ? ? ? 1_555 HB DT 254 O4 ? ? 7 DA 95  8 DT 254 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog191 hydrog ? ? GB DT 96  N3 ? ? ? 1_555 HB DA 253 N1 ? ? 7 DT 96  8 DA 253 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog192 hydrog ? ? GB DT 96  O4 ? ? ? 1_555 HB DA 253 N6 ? ? 7 DT 96  8 DA 253 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog193 hydrog ? ? GB DA 97  N1 ? ? ? 1_555 HB DT 252 N3 ? ? 7 DA 97  8 DT 252 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog194 hydrog ? ? GB DA 97  N6 ? ? ? 1_555 HB DT 252 O4 ? ? 7 DA 97  8 DT 252 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog195 hydrog ? ? GB DT 98  N3 ? ? ? 1_555 HB DA 251 N1 ? ? 7 DT 98  8 DA 251 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog196 hydrog ? ? GB DT 98  O4 ? ? ? 1_555 HB DA 251 N6 ? ? 7 DT 98  8 DA 251 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog197 hydrog ? ? GB DA 99  N1 ? ? ? 1_555 HB DT 250 N3 ? ? 7 DA 99  8 DT 250 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog198 hydrog ? ? GB DA 99  N6 ? ? ? 1_555 HB DT 250 O4 ? ? 7 DA 99  8 DT 250 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog199 hydrog ? ? GB DT 100 N3 ? ? ? 1_555 HB DA 249 N1 ? ? 7 DT 100 8 DA 249 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog200 hydrog ? ? GB DT 100 O4 ? ? ? 1_555 HB DA 249 N6 ? ? 7 DT 100 8 DA 249 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog201 hydrog ? ? GB DA 101 N1 ? ? ? 1_555 HB DT 248 N3 ? ? 7 DA 101 8 DT 248 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog202 hydrog ? ? GB DA 101 N6 ? ? ? 1_555 HB DT 248 O4 ? ? 7 DA 101 8 DT 248 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog203 hydrog ? ? GB DT 102 N3 ? ? ? 1_555 HB DA 247 N1 ? ? 7 DT 102 8 DA 247 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog204 hydrog ? ? GB DT 102 O4 ? ? ? 1_555 HB DA 247 N6 ? ? 7 DT 102 8 DA 247 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog205 hydrog ? ? GB DA 103 N1 ? ? ? 1_555 HB DT 246 N3 ? ? 7 DA 103 8 DT 246 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog206 hydrog ? ? GB DA 103 N6 ? ? ? 1_555 HB DT 246 O4 ? ? 7 DA 103 8 DT 246 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog207 hydrog ? ? GB DT 104 N3 ? ? ? 1_555 HB DA 245 N1 ? ? 7 DT 104 8 DA 245 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog208 hydrog ? ? GB DT 104 O4 ? ? ? 1_555 HB DA 245 N6 ? ? 7 DT 104 8 DA 245 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog209 hydrog ? ? GB DA 105 N1 ? ? ? 1_555 HB DT 244 N3 ? ? 7 DA 105 8 DT 244 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog210 hydrog ? ? GB DA 105 N6 ? ? ? 1_555 HB DT 244 O4 ? ? 7 DA 105 8 DT 244 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog211 hydrog ? ? GB DT 106 N3 ? ? ? 1_555 HB DA 243 N1 ? ? 7 DT 106 8 DA 243 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog212 hydrog ? ? GB DT 106 O4 ? ? ? 1_555 HB DA 243 N6 ? ? 7 DT 106 8 DA 243 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog213 hydrog ? ? GB DA 107 N1 ? ? ? 1_555 HB DT 242 N3 ? ? 7 DA 107 8 DT 242 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog214 hydrog ? ? GB DA 107 N6 ? ? ? 1_555 HB DT 242 O4 ? ? 7 DA 107 8 DT 242 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog215 hydrog ? ? GB DT 108 N3 ? ? ? 1_555 HB DA 241 N1 ? ? 7 DT 108 8 DA 241 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog216 hydrog ? ? GB DT 108 O4 ? ? ? 1_555 HB DA 241 N6 ? ? 7 DT 108 8 DA 241 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog217 hydrog ? ? GB DA 109 N1 ? ? ? 1_555 HB DT 240 N3 ? ? 7 DA 109 8 DT 240 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog218 hydrog ? ? GB DA 109 N6 ? ? ? 1_555 HB DT 240 O4 ? ? 7 DA 109 8 DT 240 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog219 hydrog ? ? GB DT 110 N3 ? ? ? 1_555 HB DA 239 N1 ? ? 7 DT 110 8 DA 239 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog220 hydrog ? ? GB DT 110 O4 ? ? ? 1_555 HB DA 239 N6 ? ? 7 DT 110 8 DA 239 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog221 hydrog ? ? GB DA 111 N1 ? ? ? 1_555 HB DT 238 N3 ? ? 7 DA 111 8 DT 238 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog222 hydrog ? ? GB DA 111 N6 ? ? ? 1_555 HB DT 238 O4 ? ? 7 DA 111 8 DT 238 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog223 hydrog ? ? GB DT 112 N3 ? ? ? 1_555 HB DA 237 N1 ? ? 7 DT 112 8 DA 237 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog224 hydrog ? ? GB DT 112 O4 ? ? ? 1_555 HB DA 237 N6 ? ? 7 DT 112 8 DA 237 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog225 hydrog ? ? GB DA 113 N1 ? ? ? 1_555 HB DT 236 N3 ? ? 7 DA 113 8 DT 236 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog226 hydrog ? ? GB DA 113 N6 ? ? ? 1_555 HB DT 236 O4 ? ? 7 DA 113 8 DT 236 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog227 hydrog ? ? GB DT 114 N3 ? ? ? 1_555 HB DA 235 N1 ? ? 7 DT 114 8 DA 235 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog228 hydrog ? ? GB DT 114 O4 ? ? ? 1_555 HB DA 235 N6 ? ? 7 DT 114 8 DA 235 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog229 hydrog ? ? GB DA 115 N1 ? ? ? 1_555 HB DT 234 N3 ? ? 7 DA 115 8 DT 234 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog230 hydrog ? ? GB DA 115 N6 ? ? ? 1_555 HB DT 234 O4 ? ? 7 DA 115 8 DT 234 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog231 hydrog ? ? GB DT 116 N3 ? ? ? 1_555 HB DA 233 N1 ? ? 7 DT 116 8 DA 233 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog232 hydrog ? ? GB DT 116 O4 ? ? ? 1_555 HB DA 233 N6 ? ? 7 DT 116 8 DA 233 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog233 hydrog ? ? GB DA 117 N1 ? ? ? 1_555 HB DT 232 N3 ? ? 7 DA 117 8 DT 232 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog234 hydrog ? ? GB DA 117 N6 ? ? ? 1_555 HB DT 232 O4 ? ? 7 DA 117 8 DT 232 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog235 hydrog ? ? GB DT 118 N3 ? ? ? 1_555 HB DA 231 N1 ? ? 7 DT 118 8 DA 231 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog236 hydrog ? ? GB DT 118 O4 ? ? ? 1_555 HB DA 231 N6 ? ? 7 DT 118 8 DA 231 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog237 hydrog ? ? GB DA 119 N1 ? ? ? 1_555 HB DT 230 N3 ? ? 7 DA 119 8 DT 230 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog238 hydrog ? ? GB DA 119 N6 ? ? ? 1_555 HB DT 230 O4 ? ? 7 DA 119 8 DT 230 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog239 hydrog ? ? GB DT 120 N3 ? ? ? 1_555 HB DA 229 N1 ? ? 7 DT 120 8 DA 229 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog240 hydrog ? ? GB DT 120 O4 ? ? ? 1_555 HB DA 229 N6 ? ? 7 DT 120 8 DA 229 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog241 hydrog ? ? GB DA 121 N1 ? ? ? 1_555 HB DT 228 N3 ? ? 7 DA 121 8 DT 228 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog242 hydrog ? ? GB DA 121 N6 ? ? ? 1_555 HB DT 228 O4 ? ? 7 DA 121 8 DT 228 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog243 hydrog ? ? GB DT 122 N3 ? ? ? 1_555 HB DA 227 N1 ? ? 7 DT 122 8 DA 227 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog244 hydrog ? ? GB DT 122 O4 ? ? ? 1_555 HB DA 227 N6 ? ? 7 DT 122 8 DA 227 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog245 hydrog ? ? GB DA 123 N1 ? ? ? 1_555 HB DT 226 N3 ? ? 7 DA 123 8 DT 226 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog246 hydrog ? ? GB DA 123 N6 ? ? ? 1_555 HB DT 226 O4 ? ? 7 DA 123 8 DT 226 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog247 hydrog ? ? GB DT 124 N3 ? ? ? 1_555 HB DA 225 N1 ? ? 7 DT 124 8 DA 225 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog248 hydrog ? ? GB DT 124 O4 ? ? ? 1_555 HB DA 225 N6 ? ? 7 DT 124 8 DA 225 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog249 hydrog ? ? GB DA 125 N1 ? ? ? 1_555 HB DT 224 N3 ? ? 7 DA 125 8 DT 224 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog250 hydrog ? ? GB DA 125 N6 ? ? ? 1_555 HB DT 224 O4 ? ? 7 DA 125 8 DT 224 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog251 hydrog ? ? GB DT 126 N3 ? ? ? 1_555 HB DA 223 N1 ? ? 7 DT 126 8 DA 223 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog252 hydrog ? ? GB DT 126 O4 ? ? ? 1_555 HB DA 223 N6 ? ? 7 DT 126 8 DA 223 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog253 hydrog ? ? GB DA 127 N1 ? ? ? 1_555 HB DT 222 N3 ? ? 7 DA 127 8 DT 222 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog254 hydrog ? ? GB DA 127 N6 ? ? ? 1_555 HB DT 222 O4 ? ? 7 DA 127 8 DT 222 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog255 hydrog ? ? GB DT 128 N3 ? ? ? 1_555 HB DA 221 N1 ? ? 7 DT 128 8 DA 221 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog256 hydrog ? ? GB DT 128 O4 ? ? ? 1_555 HB DA 221 N6 ? ? 7 DT 128 8 DA 221 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog257 hydrog ? ? GB DA 129 N1 ? ? ? 1_555 HB DT 220 N3 ? ? 7 DA 129 8 DT 220 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog258 hydrog ? ? GB DA 129 N6 ? ? ? 1_555 HB DT 220 O4 ? ? 7 DA 129 8 DT 220 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog259 hydrog ? ? GB DT 130 N3 ? ? ? 1_555 HB DA 219 N1 ? ? 7 DT 130 8 DA 219 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog260 hydrog ? ? GB DT 130 O4 ? ? ? 1_555 HB DA 219 N6 ? ? 7 DT 130 8 DA 219 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog261 hydrog ? ? GB DA 131 N1 ? ? ? 1_555 HB DT 218 N3 ? ? 7 DA 131 8 DT 218 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog262 hydrog ? ? GB DA 131 N6 ? ? ? 1_555 HB DT 218 O4 ? ? 7 DA 131 8 DT 218 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog263 hydrog ? ? GB DT 132 N3 ? ? ? 1_555 HB DA 217 N1 ? ? 7 DT 132 8 DA 217 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog264 hydrog ? ? GB DT 132 O4 ? ? ? 1_555 HB DA 217 N6 ? ? 7 DT 132 8 DA 217 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog265 hydrog ? ? GB DA 133 N1 ? ? ? 1_555 HB DT 216 N3 ? ? 7 DA 133 8 DT 216 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog266 hydrog ? ? GB DA 133 N6 ? ? ? 1_555 HB DT 216 O4 ? ? 7 DA 133 8 DT 216 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog267 hydrog ? ? GB DT 134 N3 ? ? ? 1_555 HB DA 215 N1 ? ? 7 DT 134 8 DA 215 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog268 hydrog ? ? GB DT 134 O4 ? ? ? 1_555 HB DA 215 N6 ? ? 7 DT 134 8 DA 215 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog269 hydrog ? ? GB DA 135 N1 ? ? ? 1_555 HB DT 214 N3 ? ? 7 DA 135 8 DT 214 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog270 hydrog ? ? GB DA 135 N6 ? ? ? 1_555 HB DT 214 O4 ? ? 7 DA 135 8 DT 214 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog271 hydrog ? ? GB DT 136 N3 ? ? ? 1_555 HB DA 213 N1 ? ? 7 DT 136 8 DA 213 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog272 hydrog ? ? GB DT 136 O4 ? ? ? 1_555 HB DA 213 N6 ? ? 7 DT 136 8 DA 213 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog273 hydrog ? ? GB DA 137 N1 ? ? ? 1_555 HB DT 212 N3 ? ? 7 DA 137 8 DT 212 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog274 hydrog ? ? GB DA 137 N6 ? ? ? 1_555 HB DT 212 O4 ? ? 7 DA 137 8 DT 212 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog275 hydrog ? ? GB DT 138 N3 ? ? ? 1_555 HB DA 211 N1 ? ? 7 DT 138 8 DA 211 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog276 hydrog ? ? GB DT 138 O4 ? ? ? 1_555 HB DA 211 N6 ? ? 7 DT 138 8 DA 211 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog277 hydrog ? ? GB DA 139 N1 ? ? ? 1_555 HB DT 210 N3 ? ? 7 DA 139 8 DT 210 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog278 hydrog ? ? GB DA 139 N6 ? ? ? 1_555 HB DT 210 O4 ? ? 7 DA 139 8 DT 210 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog279 hydrog ? ? GB DT 140 N3 ? ? ? 1_555 HB DA 209 N1 ? ? 7 DT 140 8 DA 209 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog280 hydrog ? ? GB DT 140 O4 ? ? ? 1_555 HB DA 209 N6 ? ? 7 DT 140 8 DA 209 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog281 hydrog ? ? GB DA 141 N1 ? ? ? 1_555 HB DT 208 N3 ? ? 7 DA 141 8 DT 208 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog282 hydrog ? ? GB DA 141 N6 ? ? ? 1_555 HB DT 208 O4 ? ? 7 DA 141 8 DT 208 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog283 hydrog ? ? GB DT 142 N3 ? ? ? 1_555 HB DA 207 N1 ? ? 7 DT 142 8 DA 207 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog284 hydrog ? ? GB DT 142 O4 ? ? ? 1_555 HB DA 207 N6 ? ? 7 DT 142 8 DA 207 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog285 hydrog ? ? GB DA 143 N1 ? ? ? 1_555 HB DT 206 N3 ? ? 7 DA 143 8 DT 206 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog286 hydrog ? ? GB DA 143 N6 ? ? ? 1_555 HB DT 206 O4 ? ? 7 DA 143 8 DT 206 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog287 hydrog ? ? GB DT 144 N3 ? ? ? 1_555 HB DA 205 N1 ? ? 7 DT 144 8 DA 205 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog288 hydrog ? ? GB DT 144 O4 ? ? ? 1_555 HB DA 205 N6 ? ? 7 DT 144 8 DA 205 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog289 hydrog ? ? GB DA 145 N1 ? ? ? 1_555 HB DT 204 N3 ? ? 7 DA 145 8 DT 204 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog290 hydrog ? ? GB DA 145 N6 ? ? ? 1_555 HB DT 204 O4 ? ? 7 DA 145 8 DT 204 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog291 hydrog ? ? GB DT 146 N3 ? ? ? 1_555 HB DA 203 N1 ? ? 7 DT 146 8 DA 203 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog292 hydrog ? ? GB DT 146 O4 ? ? ? 1_555 HB DA 203 N6 ? ? 7 DT 146 8 DA 203 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog293 hydrog ? ? GB DA 147 N1 ? ? ? 1_555 HB DT 202 N3 ? ? 7 DA 147 8 DT 202 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog294 hydrog ? ? GB DA 147 N6 ? ? ? 1_555 HB DT 202 O4 ? ? 7 DA 147 8 DT 202 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog295 hydrog ? ? GB DT 148 N3 ? ? ? 1_555 HB DA 201 N1 ? ? 7 DT 148 8 DA 201 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog296 hydrog ? ? GB DT 148 O4 ? ? ? 1_555 HB DA 201 N6 ? ? 7 DT 148 8 DA 201 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog297 hydrog ? ? GB DA 149 N1 ? ? ? 1_555 HB DT 200 N3 ? ? 7 DA 149 8 DT 200 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog298 hydrog ? ? GB DA 149 N6 ? ? ? 1_555 HB DT 200 O4 ? ? 7 DA 149 8 DT 200 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog299 hydrog ? ? GB DT 150 N3 ? ? ? 1_555 HB DA 199 N1 ? ? 7 DT 150 8 DA 199 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog300 hydrog ? ? GB DT 150 O4 ? ? ? 1_555 HB DA 199 N6 ? ? 7 DT 150 8 DA 199 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog301 hydrog ? ? GB DA 151 N1 ? ? ? 1_555 HB DT 198 N3 ? ? 7 DA 151 8 DT 198 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog302 hydrog ? ? GB DA 151 N6 ? ? ? 1_555 HB DT 198 O4 ? ? 7 DA 151 8 DT 198 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog303 hydrog ? ? GB DT 152 N3 ? ? ? 1_555 HB DA 197 N1 ? ? 7 DT 152 8 DA 197 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog304 hydrog ? ? GB DT 152 O4 ? ? ? 1_555 HB DA 197 N6 ? ? 7 DT 152 8 DA 197 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog305 hydrog ? ? GB DA 153 N1 ? ? ? 1_555 HB DT 196 N3 ? ? 7 DA 153 8 DT 196 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog306 hydrog ? ? GB DA 153 N6 ? ? ? 1_555 HB DT 196 O4 ? ? 7 DA 153 8 DT 196 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog307 hydrog ? ? GB DT 154 N3 ? ? ? 1_555 HB DA 195 N1 ? ? 7 DT 154 8 DA 195 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog308 hydrog ? ? GB DT 154 O4 ? ? ? 1_555 HB DA 195 N6 ? ? 7 DT 154 8 DA 195 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog309 hydrog ? ? GB DA 155 N1 ? ? ? 1_555 HB DT 194 N3 ? ? 7 DA 155 8 DT 194 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog310 hydrog ? ? GB DA 155 N6 ? ? ? 1_555 HB DT 194 O4 ? ? 7 DA 155 8 DT 194 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog311 hydrog ? ? GB DT 156 N3 ? ? ? 1_555 HB DA 193 N1 ? ? 7 DT 156 8 DA 193 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog312 hydrog ? ? GB DT 156 O4 ? ? ? 1_555 HB DA 193 N6 ? ? 7 DT 156 8 DA 193 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog313 hydrog ? ? GB DA 157 N1 ? ? ? 1_555 HB DT 192 N3 ? ? 7 DA 157 8 DT 192 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog314 hydrog ? ? GB DA 157 N6 ? ? ? 1_555 HB DT 192 O4 ? ? 7 DA 157 8 DT 192 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog315 hydrog ? ? GB DT 158 N3 ? ? ? 1_555 HB DA 191 N1 ? ? 7 DT 158 8 DA 191 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog316 hydrog ? ? GB DT 158 O4 ? ? ? 1_555 HB DA 191 N6 ? ? 7 DT 158 8 DA 191 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog317 hydrog ? ? GB DA 159 N1 ? ? ? 1_555 HB DT 190 N3 ? ? 7 DA 159 8 DT 190 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog318 hydrog ? ? GB DA 159 N6 ? ? ? 1_555 HB DT 190 O4 ? ? 7 DA 159 8 DT 190 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog319 hydrog ? ? GB DT 160 N3 ? ? ? 1_555 HB DA 189 N1 ? ? 7 DT 160 8 DA 189 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog320 hydrog ? ? GB DT 160 O4 ? ? ? 1_555 HB DA 189 N6 ? ? 7 DT 160 8 DA 189 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog321 hydrog ? ? GB DA 161 N1 ? ? ? 1_555 HB DT 188 N3 ? ? 7 DA 161 8 DT 188 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog322 hydrog ? ? GB DA 161 N6 ? ? ? 1_555 HB DT 188 O4 ? ? 7 DA 161 8 DT 188 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog323 hydrog ? ? GB DT 162 N3 ? ? ? 1_555 HB DA 187 N1 ? ? 7 DT 162 8 DA 187 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog324 hydrog ? ? GB DT 162 O4 ? ? ? 1_555 HB DA 187 N6 ? ? 7 DT 162 8 DA 187 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog325 hydrog ? ? GB DA 163 N1 ? ? ? 1_555 HB DT 186 N3 ? ? 7 DA 163 8 DT 186 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog326 hydrog ? ? GB DA 163 N6 ? ? ? 1_555 HB DT 186 O4 ? ? 7 DA 163 8 DT 186 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog327 hydrog ? ? GB DT 164 N3 ? ? ? 1_555 HB DA 185 N1 ? ? 7 DT 164 8 DA 185 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog328 hydrog ? ? GB DT 164 O4 ? ? ? 1_555 HB DA 185 N6 ? ? 7 DT 164 8 DA 185 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog329 hydrog ? ? GB DA 165 N1 ? ? ? 1_555 HB DT 184 N3 ? ? 7 DA 165 8 DT 184 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog330 hydrog ? ? GB DA 165 N6 ? ? ? 1_555 HB DT 184 O4 ? ? 7 DA 165 8 DT 184 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog331 hydrog ? ? GB DT 166 N3 ? ? ? 1_555 HB DA 183 N1 ? ? 7 DT 166 8 DA 183 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog332 hydrog ? ? GB DT 166 O4 ? ? ? 1_555 HB DA 183 N6 ? ? 7 DT 166 8 DA 183 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog333 hydrog ? ? GB DA 167 N1 ? ? ? 1_555 HB DT 182 N3 ? ? 7 DA 167 8 DT 182 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog334 hydrog ? ? GB DA 167 N6 ? ? ? 1_555 HB DT 182 O4 ? ? 7 DA 167 8 DT 182 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog335 hydrog ? ? GB DT 168 N3 ? ? ? 1_555 HB DA 181 N1 ? ? 7 DT 168 8 DA 181 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog336 hydrog ? ? GB DT 168 O4 ? ? ? 1_555 HB DA 181 N6 ? ? 7 DT 168 8 DA 181 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog337 hydrog ? ? GB DA 169 N1 ? ? ? 1_555 HB DT 180 N3 ? ? 7 DA 169 8 DT 180 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog338 hydrog ? ? GB DA 169 N6 ? ? ? 1_555 HB DT 180 O4 ? ? 7 DA 169 8 DT 180 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog339 hydrog ? ? GB DT 170 N3 ? ? ? 1_555 HB DA 179 N1 ? ? 7 DT 170 8 DA 179 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog340 hydrog ? ? GB DT 170 O4 ? ? ? 1_555 HB DA 179 N6 ? ? 7 DT 170 8 DA 179 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog341 hydrog ? ? GB DA 171 N1 ? ? ? 1_555 HB DT 178 N3 ? ? 7 DA 171 8 DT 178 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog342 hydrog ? ? GB DA 171 N6 ? ? ? 1_555 HB DT 178 O4 ? ? 7 DA 171 8 DT 178 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog343 hydrog ? ? GB DT 172 N3 ? ? ? 1_555 HB DA 177 N1 ? ? 7 DT 172 8 DA 177 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog344 hydrog ? ? GB DT 172 O4 ? ? ? 1_555 HB DA 177 N6 ? ? 7 DT 172 8 DA 177 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog345 hydrog ? ? GB DA 173 N1 ? ? ? 1_555 HB DT 176 N3 ? ? 7 DA 173 8 DT 176 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog346 hydrog ? ? GB DA 173 N6 ? ? ? 1_555 HB DT 176 O4 ? ? 7 DA 173 8 DT 176 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog347 hydrog ? ? GB DT 174 N3 ? ? ? 1_555 HB DA 175 N1 ? ? 7 DT 174 8 DA 175 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog348 hydrog ? ? GB DT 174 O4 ? ? ? 1_555 HB DA 175 N6 ? ? 7 DT 174 8 DA 175 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog349 hydrog ? ? GB DA 175 N1 ? ? ? 1_555 HB DT 174 N3 ? ? 7 DA 175 8 DT 174 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog350 hydrog ? ? GB DA 175 N6 ? ? ? 1_555 HB DT 174 O4 ? ? 7 DA 175 8 DT 174 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog351 hydrog ? ? GB DT 176 N3 ? ? ? 1_555 HB DA 173 N1 ? ? 7 DT 176 8 DA 173 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog352 hydrog ? ? GB DT 176 O4 ? ? ? 1_555 HB DA 173 N6 ? ? 7 DT 176 8 DA 173 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog353 hydrog ? ? GB DA 177 N1 ? ? ? 1_555 HB DT 172 N3 ? ? 7 DA 177 8 DT 172 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog354 hydrog ? ? GB DA 177 N6 ? ? ? 1_555 HB DT 172 O4 ? ? 7 DA 177 8 DT 172 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog355 hydrog ? ? GB DT 178 N3 ? ? ? 1_555 HB DA 171 N1 ? ? 7 DT 178 8 DA 171 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog356 hydrog ? ? GB DT 178 O4 ? ? ? 1_555 HB DA 171 N6 ? ? 7 DT 178 8 DA 171 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog357 hydrog ? ? GB DA 179 N1 ? ? ? 1_555 HB DT 170 N3 ? ? 7 DA 179 8 DT 170 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog358 hydrog ? ? GB DA 179 N6 ? ? ? 1_555 HB DT 170 O4 ? ? 7 DA 179 8 DT 170 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog359 hydrog ? ? GB DT 180 N3 ? ? ? 1_555 HB DA 169 N1 ? ? 7 DT 180 8 DA 169 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog360 hydrog ? ? GB DT 180 O4 ? ? ? 1_555 HB DA 169 N6 ? ? 7 DT 180 8 DA 169 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog361 hydrog ? ? GB DA 181 N1 ? ? ? 1_555 HB DT 168 N3 ? ? 7 DA 181 8 DT 168 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog362 hydrog ? ? GB DA 181 N6 ? ? ? 1_555 HB DT 168 O4 ? ? 7 DA 181 8 DT 168 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog363 hydrog ? ? GB DT 182 N3 ? ? ? 1_555 HB DA 167 N1 ? ? 7 DT 182 8 DA 167 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog364 hydrog ? ? GB DT 182 O4 ? ? ? 1_555 HB DA 167 N6 ? ? 7 DT 182 8 DA 167 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog365 hydrog ? ? GB DA 183 N1 ? ? ? 1_555 HB DT 166 N3 ? ? 7 DA 183 8 DT 166 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog366 hydrog ? ? GB DA 183 N6 ? ? ? 1_555 HB DT 166 O4 ? ? 7 DA 183 8 DT 166 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog367 hydrog ? ? GB DT 184 N3 ? ? ? 1_555 HB DA 165 N1 ? ? 7 DT 184 8 DA 165 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog368 hydrog ? ? GB DT 184 O4 ? ? ? 1_555 HB DA 165 N6 ? ? 7 DT 184 8 DA 165 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog369 hydrog ? ? GB DA 185 N1 ? ? ? 1_555 HB DT 164 N3 ? ? 7 DA 185 8 DT 164 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog370 hydrog ? ? GB DA 185 N6 ? ? ? 1_555 HB DT 164 O4 ? ? 7 DA 185 8 DT 164 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog371 hydrog ? ? GB DT 186 N3 ? ? ? 1_555 HB DA 163 N1 ? ? 7 DT 186 8 DA 163 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog372 hydrog ? ? GB DT 186 O4 ? ? ? 1_555 HB DA 163 N6 ? ? 7 DT 186 8 DA 163 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog373 hydrog ? ? GB DA 187 N1 ? ? ? 1_555 HB DT 162 N3 ? ? 7 DA 187 8 DT 162 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog374 hydrog ? ? GB DA 187 N6 ? ? ? 1_555 HB DT 162 O4 ? ? 7 DA 187 8 DT 162 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog375 hydrog ? ? GB DT 188 N3 ? ? ? 1_555 HB DA 161 N1 ? ? 7 DT 188 8 DA 161 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog376 hydrog ? ? GB DT 188 O4 ? ? ? 1_555 HB DA 161 N6 ? ? 7 DT 188 8 DA 161 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog377 hydrog ? ? GB DA 189 N1 ? ? ? 1_555 HB DT 160 N3 ? ? 7 DA 189 8 DT 160 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog378 hydrog ? ? GB DA 189 N6 ? ? ? 1_555 HB DT 160 O4 ? ? 7 DA 189 8 DT 160 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog379 hydrog ? ? GB DT 190 N3 ? ? ? 1_555 HB DA 159 N1 ? ? 7 DT 190 8 DA 159 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog380 hydrog ? ? GB DT 190 O4 ? ? ? 1_555 HB DA 159 N6 ? ? 7 DT 190 8 DA 159 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog381 hydrog ? ? GB DA 191 N1 ? ? ? 1_555 HB DT 158 N3 ? ? 7 DA 191 8 DT 158 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog382 hydrog ? ? GB DA 191 N6 ? ? ? 1_555 HB DT 158 O4 ? ? 7 DA 191 8 DT 158 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog383 hydrog ? ? GB DT 192 N3 ? ? ? 1_555 HB DA 157 N1 ? ? 7 DT 192 8 DA 157 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog384 hydrog ? ? GB DT 192 O4 ? ? ? 1_555 HB DA 157 N6 ? ? 7 DT 192 8 DA 157 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog385 hydrog ? ? GB DA 193 N1 ? ? ? 1_555 HB DT 156 N3 ? ? 7 DA 193 8 DT 156 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog386 hydrog ? ? GB DA 193 N6 ? ? ? 1_555 HB DT 156 O4 ? ? 7 DA 193 8 DT 156 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog387 hydrog ? ? GB DT 194 N3 ? ? ? 1_555 HB DA 155 N1 ? ? 7 DT 194 8 DA 155 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog388 hydrog ? ? GB DT 194 O4 ? ? ? 1_555 HB DA 155 N6 ? ? 7 DT 194 8 DA 155 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog389 hydrog ? ? GB DA 195 N1 ? ? ? 1_555 HB DT 154 N3 ? ? 7 DA 195 8 DT 154 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog390 hydrog ? ? GB DA 195 N6 ? ? ? 1_555 HB DT 154 O4 ? ? 7 DA 195 8 DT 154 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog391 hydrog ? ? GB DT 196 N3 ? ? ? 1_555 HB DA 153 N1 ? ? 7 DT 196 8 DA 153 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog392 hydrog ? ? GB DT 196 O4 ? ? ? 1_555 HB DA 153 N6 ? ? 7 DT 196 8 DA 153 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog393 hydrog ? ? GB DA 197 N1 ? ? ? 1_555 HB DT 152 N3 ? ? 7 DA 197 8 DT 152 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog394 hydrog ? ? GB DA 197 N6 ? ? ? 1_555 HB DT 152 O4 ? ? 7 DA 197 8 DT 152 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog395 hydrog ? ? GB DT 198 N3 ? ? ? 1_555 HB DA 151 N1 ? ? 7 DT 198 8 DA 151 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog396 hydrog ? ? GB DT 198 O4 ? ? ? 1_555 HB DA 151 N6 ? ? 7 DT 198 8 DA 151 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog397 hydrog ? ? GB DA 199 N1 ? ? ? 1_555 HB DT 150 N3 ? ? 7 DA 199 8 DT 150 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog398 hydrog ? ? GB DA 199 N6 ? ? ? 1_555 HB DT 150 O4 ? ? 7 DA 199 8 DT 150 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog399 hydrog ? ? GB DT 200 N3 ? ? ? 1_555 HB DA 149 N1 ? ? 7 DT 200 8 DA 149 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog400 hydrog ? ? GB DT 200 O4 ? ? ? 1_555 HB DA 149 N6 ? ? 7 DT 200 8 DA 149 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog401 hydrog ? ? GB DA 201 N1 ? ? ? 1_555 HB DT 148 N3 ? ? 7 DA 201 8 DT 148 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog402 hydrog ? ? GB DA 201 N6 ? ? ? 1_555 HB DT 148 O4 ? ? 7 DA 201 8 DT 148 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog403 hydrog ? ? GB DT 202 N3 ? ? ? 1_555 HB DA 147 N1 ? ? 7 DT 202 8 DA 147 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog404 hydrog ? ? GB DT 202 O4 ? ? ? 1_555 HB DA 147 N6 ? ? 7 DT 202 8 DA 147 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog405 hydrog ? ? GB DA 203 N1 ? ? ? 1_555 HB DT 146 N3 ? ? 7 DA 203 8 DT 146 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog406 hydrog ? ? GB DA 203 N6 ? ? ? 1_555 HB DT 146 O4 ? ? 7 DA 203 8 DT 146 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog407 hydrog ? ? GB DT 204 N3 ? ? ? 1_555 HB DA 145 N1 ? ? 7 DT 204 8 DA 145 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog408 hydrog ? ? GB DT 204 O4 ? ? ? 1_555 HB DA 145 N6 ? ? 7 DT 204 8 DA 145 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog409 hydrog ? ? GB DA 205 N1 ? ? ? 1_555 HB DT 144 N3 ? ? 7 DA 205 8 DT 144 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog410 hydrog ? ? GB DA 205 N6 ? ? ? 1_555 HB DT 144 O4 ? ? 7 DA 205 8 DT 144 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog411 hydrog ? ? GB DT 206 N3 ? ? ? 1_555 HB DA 143 N1 ? ? 7 DT 206 8 DA 143 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog412 hydrog ? ? GB DT 206 O4 ? ? ? 1_555 HB DA 143 N6 ? ? 7 DT 206 8 DA 143 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog413 hydrog ? ? GB DA 207 N1 ? ? ? 1_555 HB DT 142 N3 ? ? 7 DA 207 8 DT 142 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog414 hydrog ? ? GB DA 207 N6 ? ? ? 1_555 HB DT 142 O4 ? ? 7 DA 207 8 DT 142 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog415 hydrog ? ? GB DT 208 N3 ? ? ? 1_555 HB DA 141 N1 ? ? 7 DT 208 8 DA 141 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog416 hydrog ? ? GB DT 208 O4 ? ? ? 1_555 HB DA 141 N6 ? ? 7 DT 208 8 DA 141 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog417 hydrog ? ? GB DA 209 N1 ? ? ? 1_555 HB DT 140 N3 ? ? 7 DA 209 8 DT 140 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog418 hydrog ? ? GB DA 209 N6 ? ? ? 1_555 HB DT 140 O4 ? ? 7 DA 209 8 DT 140 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog419 hydrog ? ? GB DT 210 N3 ? ? ? 1_555 HB DA 139 N1 ? ? 7 DT 210 8 DA 139 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog420 hydrog ? ? GB DT 210 O4 ? ? ? 1_555 HB DA 139 N6 ? ? 7 DT 210 8 DA 139 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog421 hydrog ? ? GB DA 211 N1 ? ? ? 1_555 HB DT 138 N3 ? ? 7 DA 211 8 DT 138 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog422 hydrog ? ? GB DA 211 N6 ? ? ? 1_555 HB DT 138 O4 ? ? 7 DA 211 8 DT 138 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog423 hydrog ? ? GB DT 212 N3 ? ? ? 1_555 HB DA 137 N1 ? ? 7 DT 212 8 DA 137 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog424 hydrog ? ? GB DT 212 O4 ? ? ? 1_555 HB DA 137 N6 ? ? 7 DT 212 8 DA 137 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog425 hydrog ? ? GB DA 213 N1 ? ? ? 1_555 HB DT 136 N3 ? ? 7 DA 213 8 DT 136 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog426 hydrog ? ? GB DA 213 N6 ? ? ? 1_555 HB DT 136 O4 ? ? 7 DA 213 8 DT 136 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog427 hydrog ? ? GB DT 214 N3 ? ? ? 1_555 HB DA 135 N1 ? ? 7 DT 214 8 DA 135 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog428 hydrog ? ? GB DT 214 O4 ? ? ? 1_555 HB DA 135 N6 ? ? 7 DT 214 8 DA 135 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog429 hydrog ? ? GB DA 215 N1 ? ? ? 1_555 HB DT 134 N3 ? ? 7 DA 215 8 DT 134 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog430 hydrog ? ? GB DA 215 N6 ? ? ? 1_555 HB DT 134 O4 ? ? 7 DA 215 8 DT 134 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog431 hydrog ? ? GB DT 216 N3 ? ? ? 1_555 HB DA 133 N1 ? ? 7 DT 216 8 DA 133 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog432 hydrog ? ? GB DT 216 O4 ? ? ? 1_555 HB DA 133 N6 ? ? 7 DT 216 8 DA 133 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog433 hydrog ? ? GB DA 217 N1 ? ? ? 1_555 HB DT 132 N3 ? ? 7 DA 217 8 DT 132 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog434 hydrog ? ? GB DA 217 N6 ? ? ? 1_555 HB DT 132 O4 ? ? 7 DA 217 8 DT 132 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog435 hydrog ? ? GB DT 218 N3 ? ? ? 1_555 HB DA 131 N1 ? ? 7 DT 218 8 DA 131 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog436 hydrog ? ? GB DT 218 O4 ? ? ? 1_555 HB DA 131 N6 ? ? 7 DT 218 8 DA 131 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog437 hydrog ? ? GB DA 219 N1 ? ? ? 1_555 HB DT 130 N3 ? ? 7 DA 219 8 DT 130 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog438 hydrog ? ? GB DA 219 N6 ? ? ? 1_555 HB DT 130 O4 ? ? 7 DA 219 8 DT 130 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog439 hydrog ? ? GB DT 220 N3 ? ? ? 1_555 HB DA 129 N1 ? ? 7 DT 220 8 DA 129 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog440 hydrog ? ? GB DT 220 O4 ? ? ? 1_555 HB DA 129 N6 ? ? 7 DT 220 8 DA 129 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog441 hydrog ? ? GB DA 221 N1 ? ? ? 1_555 HB DT 128 N3 ? ? 7 DA 221 8 DT 128 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog442 hydrog ? ? GB DA 221 N6 ? ? ? 1_555 HB DT 128 O4 ? ? 7 DA 221 8 DT 128 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog443 hydrog ? ? GB DT 222 N3 ? ? ? 1_555 HB DA 127 N1 ? ? 7 DT 222 8 DA 127 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog444 hydrog ? ? GB DT 222 O4 ? ? ? 1_555 HB DA 127 N6 ? ? 7 DT 222 8 DA 127 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog445 hydrog ? ? GB DA 223 N1 ? ? ? 1_555 HB DT 126 N3 ? ? 7 DA 223 8 DT 126 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog446 hydrog ? ? GB DA 223 N6 ? ? ? 1_555 HB DT 126 O4 ? ? 7 DA 223 8 DT 126 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog447 hydrog ? ? GB DT 224 N3 ? ? ? 1_555 HB DA 125 N1 ? ? 7 DT 224 8 DA 125 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog448 hydrog ? ? GB DT 224 O4 ? ? ? 1_555 HB DA 125 N6 ? ? 7 DT 224 8 DA 125 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog449 hydrog ? ? GB DA 225 N1 ? ? ? 1_555 HB DT 124 N3 ? ? 7 DA 225 8 DT 124 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog450 hydrog ? ? GB DA 225 N6 ? ? ? 1_555 HB DT 124 O4 ? ? 7 DA 225 8 DT 124 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog451 hydrog ? ? GB DT 226 N3 ? ? ? 1_555 HB DA 123 N1 ? ? 7 DT 226 8 DA 123 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog452 hydrog ? ? GB DT 226 O4 ? ? ? 1_555 HB DA 123 N6 ? ? 7 DT 226 8 DA 123 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog453 hydrog ? ? GB DA 227 N1 ? ? ? 1_555 HB DT 122 N3 ? ? 7 DA 227 8 DT 122 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog454 hydrog ? ? GB DA 227 N6 ? ? ? 1_555 HB DT 122 O4 ? ? 7 DA 227 8 DT 122 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog455 hydrog ? ? GB DT 228 N3 ? ? ? 1_555 HB DA 121 N1 ? ? 7 DT 228 8 DA 121 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog456 hydrog ? ? GB DT 228 O4 ? ? ? 1_555 HB DA 121 N6 ? ? 7 DT 228 8 DA 121 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog457 hydrog ? ? GB DA 229 N1 ? ? ? 1_555 HB DT 120 N3 ? ? 7 DA 229 8 DT 120 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog458 hydrog ? ? GB DA 229 N6 ? ? ? 1_555 HB DT 120 O4 ? ? 7 DA 229 8 DT 120 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog459 hydrog ? ? GB DT 230 N3 ? ? ? 1_555 HB DA 119 N1 ? ? 7 DT 230 8 DA 119 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog460 hydrog ? ? GB DT 230 O4 ? ? ? 1_555 HB DA 119 N6 ? ? 7 DT 230 8 DA 119 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog461 hydrog ? ? GB DA 231 N1 ? ? ? 1_555 HB DT 118 N3 ? ? 7 DA 231 8 DT 118 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog462 hydrog ? ? GB DA 231 N6 ? ? ? 1_555 HB DT 118 O4 ? ? 7 DA 231 8 DT 118 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog463 hydrog ? ? GB DT 232 N3 ? ? ? 1_555 HB DA 117 N1 ? ? 7 DT 232 8 DA 117 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog464 hydrog ? ? GB DT 232 O4 ? ? ? 1_555 HB DA 117 N6 ? ? 7 DT 232 8 DA 117 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog465 hydrog ? ? GB DA 233 N1 ? ? ? 1_555 HB DT 116 N3 ? ? 7 DA 233 8 DT 116 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog466 hydrog ? ? GB DA 233 N6 ? ? ? 1_555 HB DT 116 O4 ? ? 7 DA 233 8 DT 116 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog467 hydrog ? ? GB DT 234 N3 ? ? ? 1_555 HB DA 115 N1 ? ? 7 DT 234 8 DA 115 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog468 hydrog ? ? GB DT 234 O4 ? ? ? 1_555 HB DA 115 N6 ? ? 7 DT 234 8 DA 115 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog469 hydrog ? ? GB DA 235 N1 ? ? ? 1_555 HB DT 114 N3 ? ? 7 DA 235 8 DT 114 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog470 hydrog ? ? GB DA 235 N6 ? ? ? 1_555 HB DT 114 O4 ? ? 7 DA 235 8 DT 114 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog471 hydrog ? ? GB DT 236 N3 ? ? ? 1_555 HB DA 113 N1 ? ? 7 DT 236 8 DA 113 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog472 hydrog ? ? GB DT 236 O4 ? ? ? 1_555 HB DA 113 N6 ? ? 7 DT 236 8 DA 113 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog473 hydrog ? ? GB DA 237 N1 ? ? ? 1_555 HB DT 112 N3 ? ? 7 DA 237 8 DT 112 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog474 hydrog ? ? GB DA 237 N6 ? ? ? 1_555 HB DT 112 O4 ? ? 7 DA 237 8 DT 112 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog475 hydrog ? ? GB DT 238 N3 ? ? ? 1_555 HB DA 111 N1 ? ? 7 DT 238 8 DA 111 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog476 hydrog ? ? GB DT 238 O4 ? ? ? 1_555 HB DA 111 N6 ? ? 7 DT 238 8 DA 111 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog477 hydrog ? ? GB DA 239 N1 ? ? ? 1_555 HB DT 110 N3 ? ? 7 DA 239 8 DT 110 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog478 hydrog ? ? GB DA 239 N6 ? ? ? 1_555 HB DT 110 O4 ? ? 7 DA 239 8 DT 110 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog479 hydrog ? ? GB DT 240 N3 ? ? ? 1_555 HB DA 109 N1 ? ? 7 DT 240 8 DA 109 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog480 hydrog ? ? GB DT 240 O4 ? ? ? 1_555 HB DA 109 N6 ? ? 7 DT 240 8 DA 109 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog481 hydrog ? ? GB DA 241 N1 ? ? ? 1_555 HB DT 108 N3 ? ? 7 DA 241 8 DT 108 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog482 hydrog ? ? GB DA 241 N6 ? ? ? 1_555 HB DT 108 O4 ? ? 7 DA 241 8 DT 108 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog483 hydrog ? ? GB DT 242 N3 ? ? ? 1_555 HB DA 107 N1 ? ? 7 DT 242 8 DA 107 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog484 hydrog ? ? GB DT 242 O4 ? ? ? 1_555 HB DA 107 N6 ? ? 7 DT 242 8 DA 107 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog485 hydrog ? ? GB DA 243 N1 ? ? ? 1_555 HB DT 106 N3 ? ? 7 DA 243 8 DT 106 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog486 hydrog ? ? GB DA 243 N6 ? ? ? 1_555 HB DT 106 O4 ? ? 7 DA 243 8 DT 106 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog487 hydrog ? ? GB DT 244 N3 ? ? ? 1_555 HB DA 105 N1 ? ? 7 DT 244 8 DA 105 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog488 hydrog ? ? GB DT 244 O4 ? ? ? 1_555 HB DA 105 N6 ? ? 7 DT 244 8 DA 105 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog489 hydrog ? ? GB DA 245 N1 ? ? ? 1_555 HB DT 104 N3 ? ? 7 DA 245 8 DT 104 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog490 hydrog ? ? GB DA 245 N6 ? ? ? 1_555 HB DT 104 O4 ? ? 7 DA 245 8 DT 104 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog491 hydrog ? ? GB DT 246 N3 ? ? ? 1_555 HB DA 103 N1 ? ? 7 DT 246 8 DA 103 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog492 hydrog ? ? GB DT 246 O4 ? ? ? 1_555 HB DA 103 N6 ? ? 7 DT 246 8 DA 103 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog493 hydrog ? ? GB DA 247 N1 ? ? ? 1_555 HB DT 102 N3 ? ? 7 DA 247 8 DT 102 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog494 hydrog ? ? GB DA 247 N6 ? ? ? 1_555 HB DT 102 O4 ? ? 7 DA 247 8 DT 102 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog495 hydrog ? ? GB DT 248 N3 ? ? ? 1_555 HB DA 101 N1 ? ? 7 DT 248 8 DA 101 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog496 hydrog ? ? GB DT 248 O4 ? ? ? 1_555 HB DA 101 N6 ? ? 7 DT 248 8 DA 101 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog497 hydrog ? ? GB DA 249 N1 ? ? ? 1_555 HB DT 100 N3 ? ? 7 DA 249 8 DT 100 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog498 hydrog ? ? GB DA 249 N6 ? ? ? 1_555 HB DT 100 O4 ? ? 7 DA 249 8 DT 100 1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog499 hydrog ? ? GB DT 250 N3 ? ? ? 1_555 HB DA 99  N1 ? ? 7 DT 250 8 DA 99  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog500 hydrog ? ? GB DT 250 O4 ? ? ? 1_555 HB DA 99  N6 ? ? 7 DT 250 8 DA 99  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog501 hydrog ? ? GB DA 251 N1 ? ? ? 1_555 HB DT 98  N3 ? ? 7 DA 251 8 DT 98  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog502 hydrog ? ? GB DA 251 N6 ? ? ? 1_555 HB DT 98  O4 ? ? 7 DA 251 8 DT 98  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog503 hydrog ? ? GB DT 252 N3 ? ? ? 1_555 HB DA 97  N1 ? ? 7 DT 252 8 DA 97  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog504 hydrog ? ? GB DT 252 O4 ? ? ? 1_555 HB DA 97  N6 ? ? 7 DT 252 8 DA 97  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog505 hydrog ? ? GB DA 253 N1 ? ? ? 1_555 HB DT 96  N3 ? ? 7 DA 253 8 DT 96  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog506 hydrog ? ? GB DA 253 N6 ? ? ? 1_555 HB DT 96  O4 ? ? 7 DA 253 8 DT 96  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog507 hydrog ? ? GB DT 254 N3 ? ? ? 1_555 HB DA 95  N1 ? ? 7 DT 254 8 DA 95  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog508 hydrog ? ? GB DT 254 O4 ? ? ? 1_555 HB DA 95  N6 ? ? 7 DT 254 8 DA 95  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog509 hydrog ? ? GB DA 255 N1 ? ? ? 1_555 HB DT 94  N3 ? ? 7 DA 255 8 DT 94  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog510 hydrog ? ? GB DA 255 N6 ? ? ? 1_555 HB DT 94  O4 ? ? 7 DA 255 8 DT 94  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog511 hydrog ? ? GB DT 256 N3 ? ? ? 1_555 HB DA 93  N1 ? ? 7 DT 256 8 DA 93  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog512 hydrog ? ? GB DT 256 O4 ? ? ? 1_555 HB DA 93  N6 ? ? 7 DT 256 8 DA 93  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog513 hydrog ? ? GB DA 257 N1 ? ? ? 1_555 HB DT 92  N3 ? ? 7 DA 257 8 DT 92  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog514 hydrog ? ? GB DA 257 N6 ? ? ? 1_555 HB DT 92  O4 ? ? 7 DA 257 8 DT 92  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog515 hydrog ? ? GB DT 258 N3 ? ? ? 1_555 HB DA 91  N1 ? ? 7 DT 258 8 DA 91  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog516 hydrog ? ? GB DT 258 O4 ? ? ? 1_555 HB DA 91  N6 ? ? 7 DT 258 8 DA 91  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog517 hydrog ? ? GB DA 259 N1 ? ? ? 1_555 HB DT 90  N3 ? ? 7 DA 259 8 DT 90  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog518 hydrog ? ? GB DA 259 N6 ? ? ? 1_555 HB DT 90  O4 ? ? 7 DA 259 8 DT 90  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog519 hydrog ? ? GB DT 260 N3 ? ? ? 1_555 HB DA 89  N1 ? ? 7 DT 260 8 DA 89  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog520 hydrog ? ? GB DT 260 O4 ? ? ? 1_555 HB DA 89  N6 ? ? 7 DT 260 8 DA 89  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog521 hydrog ? ? GB DA 261 N1 ? ? ? 1_555 HB DT 88  N3 ? ? 7 DA 261 8 DT 88  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog522 hydrog ? ? GB DA 261 N6 ? ? ? 1_555 HB DT 88  O4 ? ? 7 DA 261 8 DT 88  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog523 hydrog ? ? GB DT 262 N3 ? ? ? 1_555 HB DA 87  N1 ? ? 7 DT 262 8 DA 87  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog524 hydrog ? ? GB DT 262 O4 ? ? ? 1_555 HB DA 87  N6 ? ? 7 DT 262 8 DA 87  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog525 hydrog ? ? GB DA 263 N1 ? ? ? 1_555 HB DT 86  N3 ? ? 7 DA 263 8 DT 86  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog526 hydrog ? ? GB DA 263 N6 ? ? ? 1_555 HB DT 86  O4 ? ? 7 DA 263 8 DT 86  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog527 hydrog ? ? GB DT 264 N3 ? ? ? 1_555 HB DA 85  N1 ? ? 7 DT 264 8 DA 85  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog528 hydrog ? ? GB DT 264 O4 ? ? ? 1_555 HB DA 85  N6 ? ? 7 DT 264 8 DA 85  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog529 hydrog ? ? GB DA 265 N1 ? ? ? 1_555 HB DT 84  N3 ? ? 7 DA 265 8 DT 84  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog530 hydrog ? ? GB DA 265 N6 ? ? ? 1_555 HB DT 84  O4 ? ? 7 DA 265 8 DT 84  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog531 hydrog ? ? GB DT 266 N3 ? ? ? 1_555 HB DA 83  N1 ? ? 7 DT 266 8 DA 83  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog532 hydrog ? ? GB DT 266 O4 ? ? ? 1_555 HB DA 83  N6 ? ? 7 DT 266 8 DA 83  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog533 hydrog ? ? GB DA 267 N1 ? ? ? 1_555 HB DT 82  N3 ? ? 7 DA 267 8 DT 82  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog534 hydrog ? ? GB DA 267 N6 ? ? ? 1_555 HB DT 82  O4 ? ? 7 DA 267 8 DT 82  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog535 hydrog ? ? GB DT 268 N3 ? ? ? 1_555 HB DA 81  N1 ? ? 7 DT 268 8 DA 81  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog536 hydrog ? ? GB DT 268 O4 ? ? ? 1_555 HB DA 81  N6 ? ? 7 DT 268 8 DA 81  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog537 hydrog ? ? GB DA 269 N1 ? ? ? 1_555 HB DT 80  N3 ? ? 7 DA 269 8 DT 80  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog538 hydrog ? ? GB DA 269 N6 ? ? ? 1_555 HB DT 80  O4 ? ? 7 DA 269 8 DT 80  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog539 hydrog ? ? GB DT 270 N3 ? ? ? 1_555 HB DA 79  N1 ? ? 7 DT 270 8 DA 79  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog540 hydrog ? ? GB DT 270 O4 ? ? ? 1_555 HB DA 79  N6 ? ? 7 DT 270 8 DA 79  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog541 hydrog ? ? GB DA 271 N1 ? ? ? 1_555 HB DT 78  N3 ? ? 7 DA 271 8 DT 78  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog542 hydrog ? ? GB DA 271 N6 ? ? ? 1_555 HB DT 78  O4 ? ? 7 DA 271 8 DT 78  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog543 hydrog ? ? GB DT 272 N3 ? ? ? 1_555 HB DA 77  N1 ? ? 7 DT 272 8 DA 77  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog544 hydrog ? ? GB DT 272 O4 ? ? ? 1_555 HB DA 77  N6 ? ? 7 DT 272 8 DA 77  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog545 hydrog ? ? GB DA 273 N1 ? ? ? 1_555 HB DT 76  N3 ? ? 7 DA 273 8 DT 76  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog546 hydrog ? ? GB DA 273 N6 ? ? ? 1_555 HB DT 76  O4 ? ? 7 DA 273 8 DT 76  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog547 hydrog ? ? GB DT 274 N3 ? ? ? 1_555 HB DA 75  N1 ? ? 7 DT 274 8 DA 75  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog548 hydrog ? ? GB DT 274 O4 ? ? ? 1_555 HB DA 75  N6 ? ? 7 DT 274 8 DA 75  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog549 hydrog ? ? GB DA 275 N1 ? ? ? 1_555 HB DT 74  N3 ? ? 7 DA 275 8 DT 74  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog550 hydrog ? ? GB DA 275 N6 ? ? ? 1_555 HB DT 74  O4 ? ? 7 DA 275 8 DT 74  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog551 hydrog ? ? GB DT 276 N3 ? ? ? 1_555 HB DA 73  N1 ? ? 7 DT 276 8 DA 73  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog552 hydrog ? ? GB DT 276 O4 ? ? ? 1_555 HB DA 73  N6 ? ? 7 DT 276 8 DA 73  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog553 hydrog ? ? GB DA 277 N1 ? ? ? 1_555 HB DT 72  N3 ? ? 7 DA 277 8 DT 72  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog554 hydrog ? ? GB DA 277 N6 ? ? ? 1_555 HB DT 72  O4 ? ? 7 DA 277 8 DT 72  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog555 hydrog ? ? GB DT 278 N3 ? ? ? 1_555 HB DA 71  N1 ? ? 7 DT 278 8 DA 71  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog556 hydrog ? ? GB DT 278 O4 ? ? ? 1_555 HB DA 71  N6 ? ? 7 DT 278 8 DA 71  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog557 hydrog ? ? GB DA 279 N1 ? ? ? 1_555 HB DT 70  N3 ? ? 7 DA 279 8 DT 70  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog558 hydrog ? ? GB DA 279 N6 ? ? ? 1_555 HB DT 70  O4 ? ? 7 DA 279 8 DT 70  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog559 hydrog ? ? GB DT 280 N3 ? ? ? 1_555 HB DA 69  N1 ? ? 7 DT 280 8 DA 69  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog560 hydrog ? ? GB DT 280 O4 ? ? ? 1_555 HB DA 69  N6 ? ? 7 DT 280 8 DA 69  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog561 hydrog ? ? GB DA 281 N1 ? ? ? 1_555 HB DT 68  N3 ? ? 7 DA 281 8 DT 68  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog562 hydrog ? ? GB DA 281 N6 ? ? ? 1_555 HB DT 68  O4 ? ? 7 DA 281 8 DT 68  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog563 hydrog ? ? GB DT 282 N3 ? ? ? 1_555 HB DA 67  N1 ? ? 7 DT 282 8 DA 67  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog564 hydrog ? ? GB DT 282 O4 ? ? ? 1_555 HB DA 67  N6 ? ? 7 DT 282 8 DA 67  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog565 hydrog ? ? GB DA 283 N1 ? ? ? 1_555 HB DT 66  N3 ? ? 7 DA 283 8 DT 66  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog566 hydrog ? ? GB DA 283 N6 ? ? ? 1_555 HB DT 66  O4 ? ? 7 DA 283 8 DT 66  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog567 hydrog ? ? GB DT 284 N3 ? ? ? 1_555 HB DA 65  N1 ? ? 7 DT 284 8 DA 65  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog568 hydrog ? ? GB DT 284 O4 ? ? ? 1_555 HB DA 65  N6 ? ? 7 DT 284 8 DA 65  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog569 hydrog ? ? GB DA 285 N1 ? ? ? 1_555 HB DT 64  N3 ? ? 7 DA 285 8 DT 64  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog570 hydrog ? ? GB DA 285 N6 ? ? ? 1_555 HB DT 64  O4 ? ? 7 DA 285 8 DT 64  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog571 hydrog ? ? GB DT 286 N3 ? ? ? 1_555 HB DA 63  N1 ? ? 7 DT 286 8 DA 63  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog572 hydrog ? ? GB DT 286 O4 ? ? ? 1_555 HB DA 63  N6 ? ? 7 DT 286 8 DA 63  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog573 hydrog ? ? GB DA 287 N1 ? ? ? 1_555 HB DT 62  N3 ? ? 7 DA 287 8 DT 62  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog574 hydrog ? ? GB DA 287 N6 ? ? ? 1_555 HB DT 62  O4 ? ? 7 DA 287 8 DT 62  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog575 hydrog ? ? GB DT 288 N3 ? ? ? 1_555 HB DA 61  N1 ? ? 7 DT 288 8 DA 61  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog576 hydrog ? ? GB DT 288 O4 ? ? ? 1_555 HB DA 61  N6 ? ? 7 DT 288 8 DA 61  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog577 hydrog ? ? GB DA 289 N1 ? ? ? 1_555 HB DT 60  N3 ? ? 7 DA 289 8 DT 60  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog578 hydrog ? ? GB DA 289 N6 ? ? ? 1_555 HB DT 60  O4 ? ? 7 DA 289 8 DT 60  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog579 hydrog ? ? GB DT 290 N3 ? ? ? 1_555 HB DA 59  N1 ? ? 7 DT 290 8 DA 59  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog580 hydrog ? ? GB DT 290 O4 ? ? ? 1_555 HB DA 59  N6 ? ? 7 DT 290 8 DA 59  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog581 hydrog ? ? GB DA 291 N1 ? ? ? 1_555 HB DT 58  N3 ? ? 7 DA 291 8 DT 58  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog582 hydrog ? ? GB DA 291 N6 ? ? ? 1_555 HB DT 58  O4 ? ? 7 DA 291 8 DT 58  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog583 hydrog ? ? GB DT 292 N3 ? ? ? 1_555 HB DA 57  N1 ? ? 7 DT 292 8 DA 57  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog584 hydrog ? ? GB DT 292 O4 ? ? ? 1_555 HB DA 57  N6 ? ? 7 DT 292 8 DA 57  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog585 hydrog ? ? GB DA 293 N1 ? ? ? 1_555 HB DT 56  N3 ? ? 7 DA 293 8 DT 56  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog586 hydrog ? ? GB DA 293 N6 ? ? ? 1_555 HB DT 56  O4 ? ? 7 DA 293 8 DT 56  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog587 hydrog ? ? GB DT 294 N3 ? ? ? 1_555 HB DA 55  N1 ? ? 7 DT 294 8 DA 55  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog588 hydrog ? ? GB DT 294 O4 ? ? ? 1_555 HB DA 55  N6 ? ? 7 DT 294 8 DA 55  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog589 hydrog ? ? GB DA 295 N1 ? ? ? 1_555 HB DT 54  N3 ? ? 7 DA 295 8 DT 54  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog590 hydrog ? ? GB DA 295 N6 ? ? ? 1_555 HB DT 54  O4 ? ? 7 DA 295 8 DT 54  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog591 hydrog ? ? GB DT 296 N3 ? ? ? 1_555 HB DA 53  N1 ? ? 7 DT 296 8 DA 53  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog592 hydrog ? ? GB DT 296 O4 ? ? ? 1_555 HB DA 53  N6 ? ? 7 DT 296 8 DA 53  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog593 hydrog ? ? GB DA 297 N1 ? ? ? 1_555 HB DT 52  N3 ? ? 7 DA 297 8 DT 52  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog594 hydrog ? ? GB DA 297 N6 ? ? ? 1_555 HB DT 52  O4 ? ? 7 DA 297 8 DT 52  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog595 hydrog ? ? GB DT 298 N3 ? ? ? 1_555 HB DA 51  N1 ? ? 7 DT 298 8 DA 51  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog596 hydrog ? ? GB DT 298 O4 ? ? ? 1_555 HB DA 51  N6 ? ? 7 DT 298 8 DA 51  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog597 hydrog ? ? GB DA 299 N1 ? ? ? 1_555 HB DT 50  N3 ? ? 7 DA 299 8 DT 50  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog598 hydrog ? ? GB DA 299 N6 ? ? ? 1_555 HB DT 50  O4 ? ? 7 DA 299 8 DT 50  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog599 hydrog ? ? GB DT 300 N3 ? ? ? 1_555 HB DA 49  N1 ? ? 7 DT 300 8 DA 49  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog600 hydrog ? ? GB DT 300 O4 ? ? ? 1_555 HB DA 49  N6 ? ? 7 DT 300 8 DA 49  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog601 hydrog ? ? GB DA 301 N1 ? ? ? 1_555 HB DT 48  N3 ? ? 7 DA 301 8 DT 48  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog602 hydrog ? ? GB DA 301 N6 ? ? ? 1_555 HB DT 48  O4 ? ? 7 DA 301 8 DT 48  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog603 hydrog ? ? GB DT 302 N3 ? ? ? 1_555 HB DA 47  N1 ? ? 7 DT 302 8 DA 47  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog604 hydrog ? ? GB DT 302 O4 ? ? ? 1_555 HB DA 47  N6 ? ? 7 DT 302 8 DA 47  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog605 hydrog ? ? GB DA 303 N1 ? ? ? 1_555 HB DT 46  N3 ? ? 7 DA 303 8 DT 46  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog606 hydrog ? ? GB DA 303 N6 ? ? ? 1_555 HB DT 46  O4 ? ? 7 DA 303 8 DT 46  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog607 hydrog ? ? GB DT 304 N3 ? ? ? 1_555 HB DA 45  N1 ? ? 7 DT 304 8 DA 45  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog608 hydrog ? ? GB DT 304 O4 ? ? ? 1_555 HB DA 45  N6 ? ? 7 DT 304 8 DA 45  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog609 hydrog ? ? GB DA 305 N1 ? ? ? 1_555 HB DT 44  N3 ? ? 7 DA 305 8 DT 44  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog610 hydrog ? ? GB DA 305 N6 ? ? ? 1_555 HB DT 44  O4 ? ? 7 DA 305 8 DT 44  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog611 hydrog ? ? GB DT 306 N3 ? ? ? 1_555 HB DA 43  N1 ? ? 7 DT 306 8 DA 43  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog612 hydrog ? ? GB DT 306 O4 ? ? ? 1_555 HB DA 43  N6 ? ? 7 DT 306 8 DA 43  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog613 hydrog ? ? GB DA 307 N1 ? ? ? 1_555 HB DT 42  N3 ? ? 7 DA 307 8 DT 42  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog614 hydrog ? ? GB DA 307 N6 ? ? ? 1_555 HB DT 42  O4 ? ? 7 DA 307 8 DT 42  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog615 hydrog ? ? GB DT 308 N3 ? ? ? 1_555 HB DA 41  N1 ? ? 7 DT 308 8 DA 41  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog616 hydrog ? ? GB DT 308 O4 ? ? ? 1_555 HB DA 41  N6 ? ? 7 DT 308 8 DA 41  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog617 hydrog ? ? GB DA 309 N1 ? ? ? 1_555 HB DT 40  N3 ? ? 7 DA 309 8 DT 40  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog618 hydrog ? ? GB DA 309 N6 ? ? ? 1_555 HB DT 40  O4 ? ? 7 DA 309 8 DT 40  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog619 hydrog ? ? GB DT 310 N3 ? ? ? 1_555 HB DA 39  N1 ? ? 7 DT 310 8 DA 39  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog620 hydrog ? ? GB DT 310 O4 ? ? ? 1_555 HB DA 39  N6 ? ? 7 DT 310 8 DA 39  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog621 hydrog ? ? GB DA 311 N1 ? ? ? 1_555 HB DT 38  N3 ? ? 7 DA 311 8 DT 38  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog622 hydrog ? ? GB DA 311 N6 ? ? ? 1_555 HB DT 38  O4 ? ? 7 DA 311 8 DT 38  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog623 hydrog ? ? GB DT 312 N3 ? ? ? 1_555 HB DA 37  N1 ? ? 7 DT 312 8 DA 37  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog624 hydrog ? ? GB DT 312 O4 ? ? ? 1_555 HB DA 37  N6 ? ? 7 DT 312 8 DA 37  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog625 hydrog ? ? GB DA 313 N1 ? ? ? 1_555 HB DT 36  N3 ? ? 7 DA 313 8 DT 36  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog626 hydrog ? ? GB DA 313 N6 ? ? ? 1_555 HB DT 36  O4 ? ? 7 DA 313 8 DT 36  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog627 hydrog ? ? GB DT 314 N3 ? ? ? 1_555 HB DA 35  N1 ? ? 7 DT 314 8 DA 35  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog628 hydrog ? ? GB DT 314 O4 ? ? ? 1_555 HB DA 35  N6 ? ? 7 DT 314 8 DA 35  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog629 hydrog ? ? GB DA 315 N1 ? ? ? 1_555 HB DT 34  N3 ? ? 7 DA 315 8 DT 34  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog630 hydrog ? ? GB DA 315 N6 ? ? ? 1_555 HB DT 34  O4 ? ? 7 DA 315 8 DT 34  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog631 hydrog ? ? GB DT 316 N3 ? ? ? 1_555 HB DA 33  N1 ? ? 7 DT 316 8 DA 33  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog632 hydrog ? ? GB DT 316 O4 ? ? ? 1_555 HB DA 33  N6 ? ? 7 DT 316 8 DA 33  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog633 hydrog ? ? GB DA 317 N1 ? ? ? 1_555 HB DT 32  N3 ? ? 7 DA 317 8 DT 32  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog634 hydrog ? ? GB DA 317 N6 ? ? ? 1_555 HB DT 32  O4 ? ? 7 DA 317 8 DT 32  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog635 hydrog ? ? GB DT 318 N3 ? ? ? 1_555 HB DA 31  N1 ? ? 7 DT 318 8 DA 31  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog636 hydrog ? ? GB DT 318 O4 ? ? ? 1_555 HB DA 31  N6 ? ? 7 DT 318 8 DA 31  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog637 hydrog ? ? GB DA 319 N1 ? ? ? 1_555 HB DT 30  N3 ? ? 7 DA 319 8 DT 30  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog638 hydrog ? ? GB DA 319 N6 ? ? ? 1_555 HB DT 30  O4 ? ? 7 DA 319 8 DT 30  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog639 hydrog ? ? GB DT 320 N3 ? ? ? 1_555 HB DA 29  N1 ? ? 7 DT 320 8 DA 29  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog640 hydrog ? ? GB DT 320 O4 ? ? ? 1_555 HB DA 29  N6 ? ? 7 DT 320 8 DA 29  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog641 hydrog ? ? GB DA 321 N1 ? ? ? 1_555 HB DT 28  N3 ? ? 7 DA 321 8 DT 28  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog642 hydrog ? ? GB DA 321 N6 ? ? ? 1_555 HB DT 28  O4 ? ? 7 DA 321 8 DT 28  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog643 hydrog ? ? GB DT 322 N3 ? ? ? 1_555 HB DA 27  N1 ? ? 7 DT 322 8 DA 27  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog644 hydrog ? ? GB DT 322 O4 ? ? ? 1_555 HB DA 27  N6 ? ? 7 DT 322 8 DA 27  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog645 hydrog ? ? GB DA 323 N1 ? ? ? 1_555 HB DT 26  N3 ? ? 7 DA 323 8 DT 26  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog646 hydrog ? ? GB DA 323 N6 ? ? ? 1_555 HB DT 26  O4 ? ? 7 DA 323 8 DT 26  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog647 hydrog ? ? GB DT 324 N3 ? ? ? 1_555 HB DA 25  N1 ? ? 7 DT 324 8 DA 25  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog648 hydrog ? ? GB DT 324 O4 ? ? ? 1_555 HB DA 25  N6 ? ? 7 DT 324 8 DA 25  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog649 hydrog ? ? GB DA 325 N1 ? ? ? 1_555 HB DT 24  N3 ? ? 7 DA 325 8 DT 24  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog650 hydrog ? ? GB DA 325 N6 ? ? ? 1_555 HB DT 24  O4 ? ? 7 DA 325 8 DT 24  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog651 hydrog ? ? GB DT 326 N3 ? ? ? 1_555 HB DA 23  N1 ? ? 7 DT 326 8 DA 23  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog652 hydrog ? ? GB DT 326 O4 ? ? ? 1_555 HB DA 23  N6 ? ? 7 DT 326 8 DA 23  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog653 hydrog ? ? GB DA 327 N1 ? ? ? 1_555 HB DT 22  N3 ? ? 7 DA 327 8 DT 22  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog654 hydrog ? ? GB DA 327 N6 ? ? ? 1_555 HB DT 22  O4 ? ? 7 DA 327 8 DT 22  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog655 hydrog ? ? GB DT 328 N3 ? ? ? 1_555 HB DA 21  N1 ? ? 7 DT 328 8 DA 21  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog656 hydrog ? ? GB DT 328 O4 ? ? ? 1_555 HB DA 21  N6 ? ? 7 DT 328 8 DA 21  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog657 hydrog ? ? GB DA 329 N1 ? ? ? 1_555 HB DT 20  N3 ? ? 7 DA 329 8 DT 20  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog658 hydrog ? ? GB DA 329 N6 ? ? ? 1_555 HB DT 20  O4 ? ? 7 DA 329 8 DT 20  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog659 hydrog ? ? GB DT 330 N3 ? ? ? 1_555 HB DA 19  N1 ? ? 7 DT 330 8 DA 19  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog660 hydrog ? ? GB DT 330 O4 ? ? ? 1_555 HB DA 19  N6 ? ? 7 DT 330 8 DA 19  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog661 hydrog ? ? GB DA 331 N1 ? ? ? 1_555 HB DT 18  N3 ? ? 7 DA 331 8 DT 18  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog662 hydrog ? ? GB DA 331 N6 ? ? ? 1_555 HB DT 18  O4 ? ? 7 DA 331 8 DT 18  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog663 hydrog ? ? GB DT 332 N3 ? ? ? 1_555 HB DA 17  N1 ? ? 7 DT 332 8 DA 17  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog664 hydrog ? ? GB DT 332 O4 ? ? ? 1_555 HB DA 17  N6 ? ? 7 DT 332 8 DA 17  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog665 hydrog ? ? GB DA 333 N1 ? ? ? 1_555 HB DT 16  N3 ? ? 7 DA 333 8 DT 16  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog666 hydrog ? ? GB DA 333 N6 ? ? ? 1_555 HB DT 16  O4 ? ? 7 DA 333 8 DT 16  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog667 hydrog ? ? GB DT 334 N3 ? ? ? 1_555 HB DA 15  N1 ? ? 7 DT 334 8 DA 15  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog668 hydrog ? ? GB DT 334 O4 ? ? ? 1_555 HB DA 15  N6 ? ? 7 DT 334 8 DA 15  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog669 hydrog ? ? GB DA 335 N1 ? ? ? 1_555 HB DT 14  N3 ? ? 7 DA 335 8 DT 14  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog670 hydrog ? ? GB DA 335 N6 ? ? ? 1_555 HB DT 14  O4 ? ? 7 DA 335 8 DT 14  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog671 hydrog ? ? GB DT 336 N3 ? ? ? 1_555 HB DA 13  N1 ? ? 7 DT 336 8 DA 13  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog672 hydrog ? ? GB DT 336 O4 ? ? ? 1_555 HB DA 13  N6 ? ? 7 DT 336 8 DA 13  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog673 hydrog ? ? GB DA 337 N1 ? ? ? 1_555 HB DT 12  N3 ? ? 7 DA 337 8 DT 12  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog674 hydrog ? ? GB DA 337 N6 ? ? ? 1_555 HB DT 12  O4 ? ? 7 DA 337 8 DT 12  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog675 hydrog ? ? GB DT 338 N3 ? ? ? 1_555 HB DA 11  N1 ? ? 7 DT 338 8 DA 11  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog676 hydrog ? ? GB DT 338 O4 ? ? ? 1_555 HB DA 11  N6 ? ? 7 DT 338 8 DA 11  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog677 hydrog ? ? GB DA 339 N1 ? ? ? 1_555 HB DT 10  N3 ? ? 7 DA 339 8 DT 10  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog678 hydrog ? ? GB DA 339 N6 ? ? ? 1_555 HB DT 10  O4 ? ? 7 DA 339 8 DT 10  1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog679 hydrog ? ? GB DT 340 N3 ? ? ? 1_555 HB DA 9   N1 ? ? 7 DT 340 8 DA 9   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog680 hydrog ? ? GB DT 340 O4 ? ? ? 1_555 HB DA 9   N6 ? ? 7 DT 340 8 DA 9   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog681 hydrog ? ? GB DA 341 N1 ? ? ? 1_555 HB DT 8   N3 ? ? 7 DA 341 8 DT 8   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog682 hydrog ? ? GB DA 341 N6 ? ? ? 1_555 HB DT 8   O4 ? ? 7 DA 341 8 DT 8   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog683 hydrog ? ? GB DT 342 N3 ? ? ? 1_555 HB DA 7   N1 ? ? 7 DT 342 8 DA 7   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog684 hydrog ? ? GB DT 342 O4 ? ? ? 1_555 HB DA 7   N6 ? ? 7 DT 342 8 DA 7   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog685 hydrog ? ? GB DA 343 N1 ? ? ? 1_555 HB DT 6   N3 ? ? 7 DA 343 8 DT 6   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog686 hydrog ? ? GB DA 343 N6 ? ? ? 1_555 HB DT 6   O4 ? ? 7 DA 343 8 DT 6   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog687 hydrog ? ? GB DT 344 N3 ? ? ? 1_555 HB DA 5   N1 ? ? 7 DT 344 8 DA 5   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog688 hydrog ? ? GB DT 344 O4 ? ? ? 1_555 HB DA 5   N6 ? ? 7 DT 344 8 DA 5   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog689 hydrog ? ? GB DA 345 N1 ? ? ? 1_555 HB DT 4   N3 ? ? 7 DA 345 8 DT 4   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog690 hydrog ? ? GB DA 345 N6 ? ? ? 1_555 HB DT 4   O4 ? ? 7 DA 345 8 DT 4   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog691 hydrog ? ? GB DT 346 N3 ? ? ? 1_555 HB DA 3   N1 ? ? 7 DT 346 8 DA 3   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog692 hydrog ? ? GB DT 346 O4 ? ? ? 1_555 HB DA 3   N6 ? ? 7 DT 346 8 DA 3   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog693 hydrog ? ? GB DA 347 N1 ? ? ? 1_555 HB DT 2   N3 ? ? 7 DA 347 8 DT 2   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog694 hydrog ? ? GB DA 347 N6 ? ? ? 1_555 HB DT 2   O4 ? ? 7 DA 347 8 DT 2   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog695 hydrog ? ? GB DT 348 N3 ? ? ? 1_555 HB DA 1   N1 ? ? 7 DT 348 8 DA 1   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
hydrog696 hydrog ? ? GB DT 348 O4 ? ? ? 1_555 HB DA 1   N6 ? ? 7 DT 348 8 DA 1   1_555 ? ? ? ? ? ? WATSON-CRICK ? ? 
# 
_struct_conn_type.id          hydrog 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_database_PDB_matrix.entry_id          3J9X 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3J9X 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
P 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1     N N     . SER A  1 1   ? 45.385  -44.583 46.796  1.00 0.00 ? 7   SER A N     1 
ATOM 2     C CA    . SER A  1 1   ? 44.484  -45.629 47.256  1.00 0.00 ? 7   SER A CA    1 
ATOM 3     C C     . SER A  1 1   ? 43.252  -45.050 47.931  1.00 0.00 ? 7   SER A C     1 
ATOM 4     O O     . SER A  1 1   ? 43.283  -43.934 48.450  1.00 0.00 ? 7   SER A O     1 
ATOM 5     C CB    . SER A  1 1   ? 45.176  -46.559 48.190  1.00 0.00 ? 7   SER A CB    1 
ATOM 6     O OG    . SER A  1 1   ? 44.276  -47.516 48.663  1.00 0.00 ? 7   SER A OG    1 
ATOM 7     N N     . ARG A  1 2   ? 42.149  -45.793 47.879  1.00 0.00 ? 8   ARG A N     1 
ATOM 8     C CA    . ARG A  1 2   ? 40.879  -45.314 48.417  1.00 0.00 ? 8   ARG A CA    1 
ATOM 9     C C     . ARG A  1 2   ? 40.148  -46.360 49.236  1.00 0.00 ? 8   ARG A C     1 
ATOM 10    O O     . ARG A  1 2   ? 39.914  -47.474 48.774  1.00 0.00 ? 8   ARG A O     1 
ATOM 11    C CB    . ARG A  1 2   ? 39.980  -44.902 47.297  1.00 0.00 ? 8   ARG A CB    1 
ATOM 12    C CG    . ARG A  1 2   ? 40.462  -43.734 46.469  1.00 0.00 ? 8   ARG A CG    1 
ATOM 13    C CD    . ARG A  1 2   ? 40.360  -42.466 47.192  1.00 0.00 ? 8   ARG A CD    1 
ATOM 14    N NE    . ARG A  1 2   ? 40.737  -41.356 46.355  1.00 0.00 ? 8   ARG A NE    1 
ATOM 15    C CZ    . ARG A  1 2   ? 41.984  -40.894 46.221  1.00 0.00 ? 8   ARG A CZ    1 
ATOM 16    N NH1   . ARG A  1 2   ? 42.973  -41.444 46.883  1.00 0.00 ? 8   ARG A NH1   1 
ATOM 17    N NH2   . ARG A  1 2   ? 42.241  -39.869 45.430  1.00 0.00 ? 8   ARG A NH2   1 
ATOM 18    N N     . SER A  1 3   ? 39.747  -45.974 50.438  1.00 0.00 ? 9   SER A N     1 
ATOM 19    C CA    . SER A  1 3   ? 38.945  -46.817 51.317  1.00 0.00 ? 9   SER A CA    1 
ATOM 20    C C     . SER A  1 3   ? 37.507  -46.788 50.888  1.00 0.00 ? 9   SER A C     1 
ATOM 21    O O     . SER A  1 3   ? 37.120  -45.928 50.112  1.00 0.00 ? 9   SER A O     1 
ATOM 22    C CB    . SER A  1 3   ? 39.033  -46.307 52.725  1.00 0.00 ? 9   SER A CB    1 
ATOM 23    O OG    . SER A  1 3   ? 38.434  -45.038 52.822  1.00 0.00 ? 9   SER A OG    1 
ATOM 24    N N     . TYR A  1 4   ? 36.694  -47.676 51.439  1.00 0.00 ? 10  TYR A N     1 
ATOM 25    C CA    . TYR A  1 4   ? 35.276  -47.676 51.120  1.00 0.00 ? 10  TYR A CA    1 
ATOM 26    C C     . TYR A  1 4   ? 34.648  -46.341 51.352  1.00 0.00 ? 10  TYR A C     1 
ATOM 27    O O     . TYR A  1 4   ? 33.882  -45.864 50.522  1.00 0.00 ? 10  TYR A O     1 
ATOM 28    C CB    . TYR A  1 4   ? 34.511  -48.702 51.912  1.00 0.00 ? 10  TYR A CB    1 
ATOM 29    C CG    . TYR A  1 4   ? 33.033  -48.500 51.748  1.00 0.00 ? 10  TYR A CG    1 
ATOM 30    C CD1   . TYR A  1 4   ? 32.401  -48.866 50.575  1.00 0.00 ? 10  TYR A CD1   1 
ATOM 31    C CD2   . TYR A  1 4   ? 32.317  -47.899 52.757  1.00 0.00 ? 10  TYR A CD2   1 
ATOM 32    C CE1   . TYR A  1 4   ? 31.052  -48.630 50.419  1.00 0.00 ? 10  TYR A CE1   1 
ATOM 33    C CE2   . TYR A  1 4   ? 30.976  -47.662 52.603  1.00 0.00 ? 10  TYR A CE2   1 
ATOM 34    C CZ    . TYR A  1 4   ? 30.344  -48.023 51.442  1.00 0.00 ? 10  TYR A CZ    1 
ATOM 35    O OH    . TYR A  1 4   ? 29.004  -47.773 51.295  1.00 0.00 ? 10  TYR A OH    1 
ATOM 36    N N     . SER A  1 5   ? 34.925  -45.747 52.507  1.00 0.00 ? 11  SER A N     1 
ATOM 37    C CA    . SER A  1 5   ? 34.375  -44.445 52.823  1.00 0.00 ? 11  SER A CA    1 
ATOM 38    C C     . SER A  1 5   ? 34.634  -43.479 51.689  1.00 0.00 ? 11  SER A C     1 
ATOM 39    O O     . SER A  1 5   ? 33.733  -42.760 51.261  1.00 0.00 ? 11  SER A O     1 
ATOM 40    C CB    . SER A  1 5   ? 34.982  -43.901 54.113  1.00 0.00 ? 11  SER A CB    1 
ATOM 41    O OG    . SER A  1 5   ? 34.591  -44.663 55.222  1.00 0.00 ? 11  SER A OG    1 
ATOM 42    N N     . GLN A  1 6   ? 35.859  -43.486 51.187  1.00 0.00 ? 12  GLN A N     1 
ATOM 43    C CA    . GLN A  1 6   ? 36.240  -42.620 50.095  1.00 0.00 ? 12  GLN A CA    1 
ATOM 44    C C     . GLN A  1 6   ? 35.587  -43.015 48.787  1.00 0.00 ? 12  GLN A C     1 
ATOM 45    O O     . GLN A  1 6   ? 35.149  -42.153 48.029  1.00 0.00 ? 12  GLN A O     1 
ATOM 46    C CB    . GLN A  1 6   ? 37.731  -42.627 49.948  1.00 0.00 ? 12  GLN A CB    1 
ATOM 47    C CG    . GLN A  1 6   ? 38.446  -41.937 51.077  1.00 0.00 ? 12  GLN A CG    1 
ATOM 48    C CD    . GLN A  1 6   ? 39.920  -42.214 51.071  1.00 0.00 ? 12  GLN A CD    1 
ATOM 49    O OE1   . GLN A  1 6   ? 40.332  -43.344 51.350  1.00 0.00 ? 12  GLN A OE1   1 
ATOM 50    N NE2   . GLN A  1 6   ? 40.725  -41.207 50.752  1.00 0.00 ? 12  GLN A NE2   1 
ATOM 51    N N     . ARG A  1 7   ? 35.503  -44.317 48.527  1.00 0.00 ? 13  ARG A N     1 
ATOM 52    C CA    . ARG A  1 7   ? 34.909  -44.803 47.290  1.00 0.00 ? 13  ARG A CA    1 
ATOM 53    C C     . ARG A  1 7   ? 33.512  -44.303 47.157  1.00 0.00 ? 13  ARG A C     1 
ATOM 54    O O     . ARG A  1 7   ? 33.135  -43.724 46.139  1.00 0.00 ? 13  ARG A O     1 
ATOM 55    C CB    . ARG A  1 7   ? 34.859  -46.326 47.262  1.00 0.00 ? 13  ARG A CB    1 
ATOM 56    C CG    . ARG A  1 7   ? 36.188  -47.026 47.174  1.00 0.00 ? 13  ARG A CG    1 
ATOM 57    C CD    . ARG A  1 7   ? 36.025  -48.476 46.954  1.00 0.00 ? 13  ARG A CD    1 
ATOM 58    N NE    . ARG A  1 7   ? 35.508  -48.756 45.624  1.00 0.00 ? 13  ARG A NE    1 
ATOM 59    C CZ    . ARG A  1 7   ? 35.059  -49.954 45.212  1.00 0.00 ? 13  ARG A CZ    1 
ATOM 60    N NH1   . ARG A  1 7   ? 35.054  -50.975 46.041  1.00 0.00 ? 13  ARG A NH1   1 
ATOM 61    N NH2   . ARG A  1 7   ? 34.618  -50.114 43.972  1.00 0.00 ? 13  ARG A NH2   1 
ATOM 62    N N     . TYR A  1 8   ? 32.742  -44.527 48.196  1.00 0.00 ? 14  TYR A N     1 
ATOM 63    C CA    . TYR A  1 8   ? 31.368  -44.146 48.226  1.00 0.00 ? 14  TYR A CA    1 
ATOM 64    C C     . TYR A  1 8   ? 31.192  -42.667 48.211  1.00 0.00 ? 14  TYR A C     1 
ATOM 65    O O     . TYR A  1 8   ? 30.357  -42.161 47.476  1.00 0.00 ? 14  TYR A O     1 
ATOM 66    C CB    . TYR A  1 8   ? 30.687  -44.736 49.426  1.00 0.00 ? 14  TYR A CB    1 
ATOM 67    C CG    . TYR A  1 8   ? 29.294  -44.250 49.571  1.00 0.00 ? 14  TYR A CG    1 
ATOM 68    C CD1   . TYR A  1 8   ? 28.454  -44.262 48.486  1.00 0.00 ? 14  TYR A CD1   1 
ATOM 69    C CD2   . TYR A  1 8   ? 28.850  -43.792 50.789  1.00 0.00 ? 14  TYR A CD2   1 
ATOM 70    C CE1   . TYR A  1 8   ? 27.174  -43.803 48.611  1.00 0.00 ? 14  TYR A CE1   1 
ATOM 71    C CE2   . TYR A  1 8   ? 27.566  -43.331 50.919  1.00 0.00 ? 14  TYR A CE2   1 
ATOM 72    C CZ    . TYR A  1 8   ? 26.733  -43.331 49.830  1.00 0.00 ? 14  TYR A CZ    1 
ATOM 73    O OH    . TYR A  1 8   ? 25.456  -42.854 49.944  1.00 0.00 ? 14  TYR A OH    1 
ATOM 74    N N     . ALA A  1 9   ? 31.948  -41.964 49.041  1.00 0.00 ? 15  ALA A N     1 
ATOM 75    C CA    . ALA A  1 9   ? 31.817  -40.521 49.132  1.00 0.00 ? 15  ALA A CA    1 
ATOM 76    C C     . ALA A  1 9   ? 31.857  -39.870 47.767  1.00 0.00 ? 15  ALA A C     1 
ATOM 77    O O     . ALA A  1 9   ? 30.959  -39.099 47.414  1.00 0.00 ? 15  ALA A O     1 
ATOM 78    C CB    . ALA A  1 9   ? 32.921  -39.950 50.000  1.00 0.00 ? 15  ALA A CB    1 
ATOM 79    N N     . LYS A  1 10  ? 32.887  -40.174 46.994  1.00 0.00 ? 16  LYS A N     1 
ATOM 80    C CA    . LYS A  1 10  ? 33.027  -39.554 45.704  1.00 0.00 ? 16  LYS A CA    1 
ATOM 81    C C     . LYS A  1 10  ? 31.982  -40.039 44.739  1.00 0.00 ? 16  LYS A C     1 
ATOM 82    O O     . LYS A  1 10  ? 31.461  -39.260 43.947  1.00 0.00 ? 16  LYS A O     1 
ATOM 83    C CB    . LYS A  1 10  ? 34.389  -39.777 45.130  1.00 0.00 ? 16  LYS A CB    1 
ATOM 84    C CG    . LYS A  1 10  ? 34.627  -38.977 43.878  1.00 0.00 ? 16  LYS A CG    1 
ATOM 85    C CD    . LYS A  1 10  ? 36.042  -39.109 43.393  1.00 0.00 ? 16  LYS A CD    1 
ATOM 86    C CE    . LYS A  1 10  ? 36.277  -38.200 42.208  1.00 0.00 ? 16  LYS A CE    1 
ATOM 87    N NZ    . LYS A  1 10  ? 37.638  -38.354 41.639  1.00 0.00 ? 16  LYS A NZ    1 
ATOM 88    N N     . TRP A  1 11  ? 31.648  -41.328 44.806  1.00 0.00 ? 17  TRP A N     1 
ATOM 89    C CA    . TRP A  1 11  ? 30.608  -41.869 43.952  1.00 0.00 ? 17  TRP A CA    1 
ATOM 90    C C     . TRP A  1 11  ? 29.330  -41.124 44.137  1.00 0.00 ? 17  TRP A C     1 
ATOM 91    O O     . TRP A  1 11  ? 28.624  -40.845 43.172  1.00 0.00 ? 17  TRP A O     1 
ATOM 92    C CB    . TRP A  1 11  ? 30.355  -43.329 44.249  1.00 0.00 ? 17  TRP A CB    1 
ATOM 93    C CG    . TRP A  1 11  ? 29.236  -43.893 43.438  1.00 0.00 ? 17  TRP A CG    1 
ATOM 94    C CD1   . TRP A  1 11  ? 29.330  -44.443 42.201  1.00 0.00 ? 17  TRP A CD1   1 
ATOM 95    C CD2   . TRP A  1 11  ? 27.839  -43.967 43.803  1.00 0.00 ? 17  TRP A CD2   1 
ATOM 96    N NE1   . TRP A  1 11  ? 28.096  -44.861 41.777  1.00 0.00 ? 17  TRP A NE1   1 
ATOM 97    C CE2   . TRP A  1 11  ? 27.173  -44.576 42.742  1.00 0.00 ? 17  TRP A CE2   1 
ATOM 98    C CE3   . TRP A  1 11  ? 27.115  -43.584 44.927  1.00 0.00 ? 17  TRP A CE3   1 
ATOM 99    C CZ2   . TRP A  1 11  ? 25.810  -44.810 42.768  1.00 0.00 ? 17  TRP A CZ2   1 
ATOM 100   C CZ3   . TRP A  1 11  ? 25.749  -43.820 44.956  1.00 0.00 ? 17  TRP A CZ3   1 
ATOM 101   C CH2   . TRP A  1 11  ? 25.113  -44.418 43.905  1.00 0.00 ? 17  TRP A CH2   1 
ATOM 102   N N     . GLN A  1 12  ? 29.012  -40.821 45.378  1.00 0.00 ? 18  GLN A N     1 
ATOM 103   C CA    . GLN A  1 12  ? 27.800  -40.133 45.690  1.00 0.00 ? 18  GLN A CA    1 
ATOM 104   C C     . GLN A  1 12  ? 27.798  -38.756 45.115  1.00 0.00 ? 18  GLN A C     1 
ATOM 105   O O     . GLN A  1 12  ? 26.809  -38.325 44.530  1.00 0.00 ? 18  GLN A O     1 
ATOM 106   C CB    . GLN A  1 12  ? 27.623  -40.039 47.182  1.00 0.00 ? 18  GLN A CB    1 
ATOM 107   C CG    . GLN A  1 12  ? 26.302  -39.467 47.577  1.00 0.00 ? 18  GLN A CG    1 
ATOM 108   C CD    . GLN A  1 12  ? 25.203  -40.384 47.187  1.00 0.00 ? 18  GLN A CD    1 
ATOM 109   O OE1   . GLN A  1 12  ? 25.189  -41.530 47.632  1.00 0.00 ? 18  GLN A OE1   1 
ATOM 110   N NE2   . GLN A  1 12  ? 24.276  -39.923 46.358  1.00 0.00 ? 18  GLN A NE2   1 
ATOM 111   N N     . ALA A  1 13  ? 28.912  -38.061 45.255  1.00 0.00 ? 19  ALA A N     1 
ATOM 112   C CA    . ALA A  1 13  ? 29.021  -36.705 44.760  1.00 0.00 ? 19  ALA A CA    1 
ATOM 113   C C     . ALA A  1 13  ? 28.814  -36.645 43.267  1.00 0.00 ? 19  ALA A C     1 
ATOM 114   O O     . ALA A  1 13  ? 28.121  -35.760 42.767  1.00 0.00 ? 19  ALA A O     1 
ATOM 115   C CB    . ALA A  1 13  ? 30.369  -36.130 45.122  1.00 0.00 ? 19  ALA A CB    1 
ATOM 116   N N     . LYS A  1 14  ? 29.389  -37.599 42.554  1.00 0.00 ? 20  LYS A N     1 
ATOM 117   C CA    . LYS A  1 14  ? 29.281  -37.611 41.117  1.00 0.00 ? 20  LYS A CA    1 
ATOM 118   C C     . LYS A  1 14  ? 27.931  -38.048 40.667  1.00 0.00 ? 20  LYS A C     1 
ATOM 119   O O     . LYS A  1 14  ? 27.412  -37.528 39.682  1.00 0.00 ? 20  LYS A O     1 
ATOM 120   C CB    . LYS A  1 14  ? 30.341  -38.506 40.522  1.00 0.00 ? 20  LYS A CB    1 
ATOM 121   C CG    . LYS A  1 14  ? 31.740  -37.990 40.735  1.00 0.00 ? 20  LYS A CG    1 
ATOM 122   C CD    . LYS A  1 14  ? 31.939  -36.684 39.995  1.00 0.00 ? 20  LYS A CD    1 
ATOM 123   C CE    . LYS A  1 14  ? 32.208  -36.908 38.517  1.00 0.00 ? 20  LYS A CE    1 
ATOM 124   N NZ    . LYS A  1 14  ? 33.620  -37.293 38.279  1.00 0.00 ? 20  LYS A NZ    1 
ATOM 125   N N     . PHE A  1 15  ? 27.324  -38.968 41.399  1.00 0.00 ? 21  PHE A N     1 
ATOM 126   C CA    . PHE A  1 15  ? 25.989  -39.400 41.069  1.00 0.00 ? 21  PHE A CA    1 
ATOM 127   C C     . PHE A  1 15  ? 25.031  -38.237 41.186  1.00 0.00 ? 21  PHE A C     1 
ATOM 128   O O     . PHE A  1 15  ? 24.207  -38.008 40.300  1.00 0.00 ? 21  PHE A O     1 
ATOM 129   C CB    . PHE A  1 15  ? 25.534  -40.523 41.971  1.00 0.00 ? 21  PHE A CB    1 
ATOM 130   C CG    . PHE A  1 15  ? 24.197  -41.037 41.579  1.00 0.00 ? 21  PHE A CG    1 
ATOM 131   C CD1   . PHE A  1 15  ? 24.081  -42.036 40.627  1.00 0.00 ? 21  PHE A CD1   1 
ATOM 132   C CD2   . PHE A  1 15  ? 23.050  -40.496 42.113  1.00 0.00 ? 21  PHE A CD2   1 
ATOM 133   C CE1   . PHE A  1 15  ? 22.841  -42.491 40.229  1.00 0.00 ? 21  PHE A CE1   1 
ATOM 134   C CE2   . PHE A  1 15  ? 21.810  -40.945 41.712  1.00 0.00 ? 21  PHE A CE2   1 
ATOM 135   C CZ    . PHE A  1 15  ? 21.704  -41.945 40.770  1.00 0.00 ? 21  PHE A CZ    1 
ATOM 136   N N     . ASN A  1 16  ? 25.146  -37.501 42.287  1.00 0.00 ? 22  ASN A N     1 
ATOM 137   C CA    . ASN A  1 16  ? 24.304  -36.355 42.531  1.00 0.00 ? 22  ASN A CA    1 
ATOM 138   C C     . ASN A  1 16  ? 24.440  -35.348 41.424  1.00 0.00 ? 22  ASN A C     1 
ATOM 139   O O     . ASN A  1 16  ? 23.446  -34.863 40.887  1.00 0.00 ? 22  ASN A O     1 
ATOM 140   C CB    . ASN A  1 16  ? 24.672  -35.701 43.837  1.00 0.00 ? 22  ASN A CB    1 
ATOM 141   C CG    . ASN A  1 16  ? 24.322  -36.532 45.019  1.00 0.00 ? 22  ASN A CG    1 
ATOM 142   O OD1   . ASN A  1 16  ? 23.597  -37.522 44.912  1.00 0.00 ? 22  ASN A OD1   1 
ATOM 143   N ND2   . ASN A  1 16  ? 24.824  -36.149 46.161  1.00 0.00 ? 22  ASN A ND2   1 
ATOM 144   N N     . ALA A  1 17  ? 25.684  -35.059 41.048  1.00 0.00 ? 23  ALA A N     1 
ATOM 145   C CA    . ALA A  1 17  ? 25.953  -34.102 39.999  1.00 0.00 ? 23  ALA A CA    1 
ATOM 146   C C     . ALA A  1 17  ? 25.262  -34.492 38.722  1.00 0.00 ? 23  ALA A C     1 
ATOM 147   O O     . ALA A  1 17  ? 24.543  -33.691 38.128  1.00 0.00 ? 23  ALA A O     1 
ATOM 148   C CB    . ALA A  1 17  ? 27.444  -33.990 39.764  1.00 0.00 ? 23  ALA A CB    1 
ATOM 149   N N     . PHE A  1 18  ? 25.448  -35.735 38.312  1.00 0.00 ? 24  PHE A N     1 
ATOM 150   C CA    . PHE A  1 18  ? 24.868  -36.223 37.084  1.00 0.00 ? 24  PHE A CA    1 
ATOM 151   C C     . PHE A  1 18  ? 23.369  -36.116 37.061  1.00 0.00 ? 24  PHE A C     1 
ATOM 152   O O     . PHE A  1 18  ? 22.792  -35.798 36.030  1.00 0.00 ? 24  PHE A O     1 
ATOM 153   C CB    . PHE A  1 18  ? 25.284  -37.642 36.816  1.00 0.00 ? 24  PHE A CB    1 
ATOM 154   C CG    . PHE A  1 18  ? 24.703  -38.182 35.547  1.00 0.00 ? 24  PHE A CG    1 
ATOM 155   C CD1   . PHE A  1 18  ? 24.975  -37.575 34.334  1.00 0.00 ? 24  PHE A CD1   1 
ATOM 156   C CD2   . PHE A  1 18  ? 23.912  -39.318 35.556  1.00 0.00 ? 24  PHE A CD2   1 
ATOM 157   C CE1   . PHE A  1 18  ? 24.456  -38.086 33.160  1.00 0.00 ? 24  PHE A CE1   1 
ATOM 158   C CE2   . PHE A  1 18  ? 23.401  -39.832 34.384  1.00 0.00 ? 24  PHE A CE2   1 
ATOM 159   C CZ    . PHE A  1 18  ? 23.671  -39.215 33.187  1.00 0.00 ? 24  PHE A CZ    1 
ATOM 160   N N     . SER A  1 19  ? 22.719  -36.366 38.196  1.00 0.00 ? 25  SER A N     1 
ATOM 161   C CA    . SER A  1 19  ? 21.258  -36.361 38.246  1.00 0.00 ? 25  SER A CA    1 
ATOM 162   C C     . SER A  1 19  ? 20.647  -34.992 37.923  1.00 0.00 ? 25  SER A C     1 
ATOM 163   O O     . SER A  1 19  ? 19.455  -34.897 37.647  1.00 0.00 ? 25  SER A O     1 
ATOM 164   C CB    . SER A  1 19  ? 20.781  -36.784 39.606  1.00 0.00 ? 25  SER A CB    1 
ATOM 165   O OG    . SER A  1 19  ? 21.005  -35.774 40.554  1.00 0.00 ? 25  SER A OG    1 
ATOM 166   N N     . ASN A  1 20  ? 21.457  -33.936 37.977  1.00 0.00 ? 26  ASN A N     1 
ATOM 167   C CA    . ASN A  1 20  ? 20.996  -32.589 37.666  1.00 0.00 ? 26  ASN A CA    1 
ATOM 168   C C     . ASN A  1 20  ? 20.564  -32.467 36.204  1.00 0.00 ? 26  ASN A C     1 
ATOM 169   O O     . ASN A  1 20  ? 21.387  -32.642 35.314  1.00 0.00 ? 26  ASN A O     1 
ATOM 170   C CB    . ASN A  1 20  ? 22.092  -31.596 37.968  1.00 0.00 ? 26  ASN A CB    1 
ATOM 171   C CG    . ASN A  1 20  ? 21.707  -30.182 37.683  1.00 0.00 ? 26  ASN A CG    1 
ATOM 172   O OD1   . ASN A  1 20  ? 21.219  -29.863 36.588  1.00 0.00 ? 26  ASN A OD1   1 
ATOM 173   N ND2   . ASN A  1 20  ? 21.915  -29.322 38.644  1.00 0.00 ? 26  ASN A ND2   1 
ATOM 174   N N     . PRO A  1 21  ? 19.268  -32.186 35.947  1.00 0.00 ? 27  PRO A N     1 
ATOM 175   C CA    . PRO A  1 21  ? 18.648  -32.018 34.615  1.00 0.00 ? 27  PRO A CA    1 
ATOM 176   C C     . PRO A  1 21  ? 19.598  -31.500 33.552  1.00 0.00 ? 27  PRO A C     1 
ATOM 177   O O     . PRO A  1 21  ? 19.652  -32.033 32.438  1.00 0.00 ? 27  PRO A O     1 
ATOM 178   C CB    . PRO A  1 21  ? 17.574  -30.951 34.857  1.00 0.00 ? 27  PRO A CB    1 
ATOM 179   C CG    . PRO A  1 21  ? 17.221  -31.089 36.273  1.00 0.00 ? 27  PRO A CG    1 
ATOM 180   C CD    . PRO A  1 21  ? 18.524  -31.379 36.946  1.00 0.00 ? 27  PRO A CD    1 
ATOM 181   N N     . THR A  1 22  ? 20.318  -30.438 33.878  1.00 0.00 ? 28  THR A N     1 
ATOM 182   C CA    . THR A  1 22  ? 21.134  -29.766 32.902  1.00 0.00 ? 28  THR A CA    1 
ATOM 183   C C     . THR A  1 22  ? 22.435  -30.456 32.703  1.00 0.00 ? 28  THR A C     1 
ATOM 184   O O     . THR A  1 22  ? 23.006  -30.403 31.624  1.00 0.00 ? 28  THR A O     1 
ATOM 185   C CB    . THR A  1 22  ? 21.406  -28.347 33.331  1.00 0.00 ? 28  THR A CB    1 
ATOM 186   O OG1   . THR A  1 22  ? 22.139  -28.369 34.558  1.00 0.00 ? 28  THR A OG1   1 
ATOM 187   C CG2   . THR A  1 22  ? 20.105  -27.601 33.535  1.00 0.00 ? 28  THR A CG2   1 
ATOM 188   N N     . VAL A  1 23  ? 22.906  -31.124 33.725  1.00 0.00 ? 29  VAL A N     1 
ATOM 189   C CA    . VAL A  1 23  ? 24.150  -31.822 33.629  1.00 0.00 ? 29  VAL A CA    1 
ATOM 190   C C     . VAL A  1 23  ? 23.972  -33.072 32.844  1.00 0.00 ? 29  VAL A C     1 
ATOM 191   O O     . VAL A  1 23  ? 24.766  -33.377 31.953  1.00 0.00 ? 29  VAL A O     1 
ATOM 192   C CB    . VAL A  1 23  ? 24.683  -32.143 35.004  1.00 0.00 ? 29  VAL A CB    1 
ATOM 193   C CG1   . VAL A  1 23  ? 25.923  -32.999 34.898  1.00 0.00 ? 29  VAL A CG1   1 
ATOM 194   C CG2   . VAL A  1 23  ? 24.981  -30.860 35.721  1.00 0.00 ? 29  VAL A CG2   1 
ATOM 195   N N     . ALA A  1 24  ? 22.922  -33.802 33.157  1.00 0.00 ? 30  ALA A N     1 
ATOM 196   C CA    . ALA A  1 24  ? 22.629  -35.018 32.454  1.00 0.00 ? 30  ALA A CA    1 
ATOM 197   C C     . ALA A  1 24  ? 22.408  -34.747 30.993  1.00 0.00 ? 30  ALA A C     1 
ATOM 198   O O     . ALA A  1 24  ? 22.987  -35.410 30.143  1.00 0.00 ? 30  ALA A O     1 
ATOM 199   C CB    . ALA A  1 24  ? 21.404  -35.689 33.039  1.00 0.00 ? 30  ALA A CB    1 
ATOM 200   N N     . SER A  1 25  ? 21.589  -33.751 30.693  1.00 0.00 ? 31  SER A N     1 
ATOM 201   C CA    . SER A  1 25  ? 21.272  -33.462 29.322  1.00 0.00 ? 31  SER A CA    1 
ATOM 202   C C     . SER A  1 25  ? 22.424  -32.873 28.571  1.00 0.00 ? 31  SER A C     1 
ATOM 203   O O     . SER A  1 25  ? 22.606  -33.163 27.395  1.00 0.00 ? 31  SER A O     1 
ATOM 204   C CB    . SER A  1 25  ? 20.127  -32.534 29.266  1.00 0.00 ? 31  SER A CB    1 
ATOM 205   O OG    . SER A  1 25  ? 20.443  -31.331 29.898  1.00 0.00 ? 31  SER A OG    1 
ATOM 206   N N     . THR A  1 26  ? 23.254  -32.093 29.248  1.00 0.00 ? 32  THR A N     1 
ATOM 207   C CA    . THR A  1 26  ? 24.427  -31.548 28.599  1.00 0.00 ? 32  THR A CA    1 
ATOM 208   C C     . THR A  1 26  ? 25.324  -32.644 28.137  1.00 0.00 ? 32  THR A C     1 
ATOM 209   O O     . THR A  1 26  ? 25.692  -32.706 26.967  1.00 0.00 ? 32  THR A O     1 
ATOM 210   C CB    . THR A  1 26  ? 25.211  -30.628 29.525  1.00 0.00 ? 32  THR A CB    1 
ATOM 211   O OG1   . THR A  1 26  ? 24.414  -29.493 29.858  1.00 0.00 ? 32  THR A OG1   1 
ATOM 212   C CG2   . THR A  1 26  ? 26.474  -30.174 28.851  1.00 0.00 ? 32  THR A CG2   1 
ATOM 213   N N     . ILE A  1 27  ? 25.666  -33.526 29.045  1.00 0.00 ? 33  ILE A N     1 
ATOM 214   C CA    . ILE A  1 27  ? 26.566  -34.592 28.732  1.00 0.00 ? 33  ILE A CA    1 
ATOM 215   C C     . ILE A  1 27  ? 25.989  -35.526 27.707  1.00 0.00 ? 33  ILE A C     1 
ATOM 216   O O     . ILE A  1 27  ? 26.630  -35.822 26.703  1.00 0.00 ? 33  ILE A O     1 
ATOM 217   C CB    . ILE A  1 27  ? 26.905  -35.378 29.977  1.00 0.00 ? 33  ILE A CB    1 
ATOM 218   C CG1   . ILE A  1 27  ? 27.709  -34.522 30.929  1.00 0.00 ? 33  ILE A CG1   1 
ATOM 219   C CG2   . ILE A  1 27  ? 27.671  -36.619 29.601  1.00 0.00 ? 33  ILE A CG2   1 
ATOM 220   C CD1   . ILE A  1 27  ? 27.842  -35.122 32.297  1.00 0.00 ? 33  ILE A CD1   1 
ATOM 221   N N     . LEU A  1 28  ? 24.781  -35.994 27.959  1.00 0.00 ? 34  LEU A N     1 
ATOM 222   C CA    . LEU A  1 28  ? 24.169  -36.999 27.128  1.00 0.00 ? 34  LEU A CA    1 
ATOM 223   C C     . LEU A  1 28  ? 23.878  -36.505 25.735  1.00 0.00 ? 34  LEU A C     1 
ATOM 224   O O     . LEU A  1 28  ? 24.052  -37.246 24.768  1.00 0.00 ? 34  LEU A O     1 
ATOM 225   C CB    . LEU A  1 28  ? 22.891  -37.476 27.782  1.00 0.00 ? 34  LEU A CB    1 
ATOM 226   C CG    . LEU A  1 28  ? 23.088  -38.263 29.075  1.00 0.00 ? 34  LEU A CG    1 
ATOM 227   C CD1   . LEU A  1 28  ? 21.742  -38.494 29.730  1.00 0.00 ? 34  LEU A CD1   1 
ATOM 228   C CD2   . LEU A  1 28  ? 23.774  -39.577 28.760  1.00 0.00 ? 34  LEU A CD2   1 
ATOM 229   N N     . SER A  1 29  ? 23.463  -35.255 25.609  1.00 0.00 ? 35  SER A N     1 
ATOM 230   C CA    . SER A  1 29  ? 23.195  -34.716 24.297  1.00 0.00 ? 35  SER A CA    1 
ATOM 231   C C     . SER A  1 29  ? 24.478  -34.464 23.535  1.00 0.00 ? 35  SER A C     1 
ATOM 232   O O     . SER A  1 29  ? 24.503  -34.568 22.310  1.00 0.00 ? 35  SER A O     1 
ATOM 233   C CB    . SER A  1 29  ? 22.413  -33.443 24.399  1.00 0.00 ? 35  SER A CB    1 
ATOM 234   O OG    . SER A  1 29  ? 23.176  -32.438 24.998  1.00 0.00 ? 35  SER A OG    1 
ATOM 235   N N     . ASN A  1 30  ? 25.566  -34.184 24.254  1.00 0.00 ? 36  ASN A N     1 
ATOM 236   C CA    . ASN A  1 30  ? 26.839  -33.978 23.597  1.00 0.00 ? 36  ASN A CA    1 
ATOM 237   C C     . ASN A  1 30  ? 27.435  -35.267 23.097  1.00 0.00 ? 36  ASN A C     1 
ATOM 238   O O     . ASN A  1 30  ? 28.037  -35.297 22.030  1.00 0.00 ? 36  ASN A O     1 
ATOM 239   C CB    . ASN A  1 30  ? 27.805  -33.269 24.501  1.00 0.00 ? 36  ASN A CB    1 
ATOM 240   C CG    . ASN A  1 30  ? 27.462  -31.823 24.648  1.00 0.00 ? 36  ASN A CG    1 
ATOM 241   O OD1   . ASN A  1 30  ? 26.602  -31.308 23.926  1.00 0.00 ? 36  ASN A OD1   1 
ATOM 242   N ND2   . ASN A  1 30  ? 28.127  -31.147 25.544  1.00 0.00 ? 36  ASN A ND2   1 
ATOM 243   N N     . VAL A  1 31  ? 27.243  -36.353 23.842  1.00 0.00 ? 37  VAL A N     1 
ATOM 244   C CA    . VAL A  1 31  ? 27.818  -37.629 23.438  1.00 0.00 ? 37  VAL A CA    1 
ATOM 245   C C     . VAL A  1 31  ? 26.849  -38.466 22.666  1.00 0.00 ? 37  VAL A C     1 
ATOM 246   O O     . VAL A  1 31  ? 27.163  -39.600 22.327  1.00 0.00 ? 37  VAL A O     1 
ATOM 247   C CB    . VAL A  1 31  ? 28.280  -38.440 24.640  1.00 0.00 ? 37  VAL A CB    1 
ATOM 248   C CG1   . VAL A  1 31  ? 29.286  -37.658 25.449  1.00 0.00 ? 37  VAL A CG1   1 
ATOM 249   C CG2   . VAL A  1 31  ? 27.085  -38.842 25.471  1.00 0.00 ? 37  VAL A CG2   1 
ATOM 250   N N     . SER A  1 32  ? 25.663  -37.926 22.399  1.00 0.00 ? 38  SER A N     1 
ATOM 251   C CA    . SER A  1 32  ? 24.666  -38.635 21.621  1.00 0.00 ? 38  SER A CA    1 
ATOM 252   C C     . SER A  1 32  ? 25.241  -39.230 20.330  1.00 0.00 ? 38  SER A C     1 
ATOM 253   O O     . SER A  1 32  ? 25.449  -40.440 20.265  1.00 0.00 ? 38  SER A O     1 
ATOM 254   C CB    . SER A  1 32  ? 23.467  -37.745 21.334  1.00 0.00 ? 38  SER A CB    1 
ATOM 255   O OG    . SER A  1 32  ? 22.740  -37.493 22.504  1.00 0.00 ? 38  SER A OG    1 
ATOM 256   N N     . PRO A  1 33  ? 25.463  -38.410 19.278  1.00 0.00 ? 39  PRO A N     1 
ATOM 257   C CA    . PRO A  1 33  ? 25.931  -38.880 17.973  1.00 0.00 ? 39  PRO A CA    1 
ATOM 258   C C     . PRO A  1 33  ? 27.209  -39.735 18.070  1.00 0.00 ? 39  PRO A C     1 
ATOM 259   O O     . PRO A  1 33  ? 27.447  -40.598 17.225  1.00 0.00 ? 39  PRO A O     1 
ATOM 260   C CB    . PRO A  1 33  ? 26.235  -37.596 17.237  1.00 0.00 ? 39  PRO A CB    1 
ATOM 261   C CG    . PRO A  1 33  ? 26.743  -36.681 18.289  1.00 0.00 ? 39  PRO A CG    1 
ATOM 262   C CD    . PRO A  1 33  ? 26.030  -37.065 19.548  1.00 0.00 ? 39  PRO A CD    1 
ATOM 263   N N     . VAL A  1 34  ? 28.006  -39.514 19.112  1.00 0.00 ? 40  VAL A N     1 
ATOM 264   C CA    . VAL A  1 34  ? 29.214  -40.266 19.308  1.00 0.00 ? 40  VAL A CA    1 
ATOM 265   C C     . VAL A  1 34  ? 28.876  -41.674 19.703  1.00 0.00 ? 40  VAL A C     1 
ATOM 266   O O     . VAL A  1 34  ? 29.373  -42.635 19.114  1.00 0.00 ? 40  VAL A O     1 
ATOM 267   C CB    . VAL A  1 34  ? 30.066  -39.625 20.400  1.00 0.00 ? 40  VAL A CB    1 
ATOM 268   C CG1   . VAL A  1 34  ? 31.267  -40.496 20.702  1.00 0.00 ? 40  VAL A CG1   1 
ATOM 269   C CG2   . VAL A  1 34  ? 30.488  -38.234 19.971  1.00 0.00 ? 40  VAL A CG2   1 
ATOM 270   N N     . ALA A  1 35  ? 27.999  -41.797 20.688  1.00 0.00 ? 41  ALA A N     1 
ATOM 271   C CA    . ALA A  1 35  ? 27.547  -43.081 21.150  1.00 0.00 ? 41  ALA A CA    1 
ATOM 272   C C     . ALA A  1 35  ? 26.870  -43.830 20.045  1.00 0.00 ? 41  ALA A C     1 
ATOM 273   O O     . ALA A  1 35  ? 27.042  -45.037 19.911  1.00 0.00 ? 41  ALA A O     1 
ATOM 274   C CB    . ALA A  1 35  ? 26.600  -42.916 22.323  1.00 0.00 ? 41  ALA A CB    1 
ATOM 275   N N     . GLN A  1 36  ? 26.116  -43.107 19.227  1.00 0.00 ? 42  GLN A N     1 
ATOM 276   C CA    . GLN A  1 36  ? 25.400  -43.705 18.125  1.00 0.00 ? 42  GLN A CA    1 
ATOM 277   C C     . GLN A  1 36  ? 26.344  -44.379 17.198  1.00 0.00 ? 42  GLN A C     1 
ATOM 278   O O     . GLN A  1 36  ? 26.116  -45.510 16.783  1.00 0.00 ? 42  GLN A O     1 
ATOM 279   C CB    . GLN A  1 36  ? 24.624  -42.654 17.374  1.00 0.00 ? 42  GLN A CB    1 
ATOM 280   C CG    . GLN A  1 36  ? 23.496  -42.060 18.166  1.00 0.00 ? 42  GLN A CG    1 
ATOM 281   C CD    . GLN A  1 36  ? 22.763  -40.990 17.408  1.00 0.00 ? 42  GLN A CD    1 
ATOM 282   O OE1   . GLN A  1 36  ? 22.573  -41.092 16.193  1.00 0.00 ? 42  GLN A OE1   1 
ATOM 283   N NE2   . GLN A  1 36  ? 22.346  -39.951 18.114  1.00 0.00 ? 42  GLN A NE2   1 
ATOM 284   N N     . GLN A  1 37  ? 27.438  -43.702 16.895  1.00 0.00 ? 43  GLN A N     1 
ATOM 285   C CA    . GLN A  1 37  ? 28.456  -44.263 16.047  1.00 0.00 ? 43  GLN A CA    1 
ATOM 286   C C     . GLN A  1 37  ? 29.002  -45.538 16.614  1.00 0.00 ? 43  GLN A C     1 
ATOM 287   O O     . GLN A  1 37  ? 29.132  -46.534 15.904  1.00 0.00 ? 43  GLN A O     1 
ATOM 288   C CB    . GLN A  1 37  ? 29.593  -43.277 15.866  1.00 0.00 ? 43  GLN A CB    1 
ATOM 289   C CG    . GLN A  1 37  ? 30.698  -43.790 14.988  1.00 0.00 ? 43  GLN A CG    1 
ATOM 290   C CD    . GLN A  1 37  ? 30.255  -43.960 13.565  1.00 0.00 ? 43  GLN A CD    1 
ATOM 291   O OE1   . GLN A  1 37  ? 29.736  -43.022 12.958  1.00 0.00 ? 43  GLN A OE1   1 
ATOM 292   N NE2   . GLN A  1 37  ? 30.449  -45.152 13.015  1.00 0.00 ? 43  GLN A NE2   1 
ATOM 293   N N     . ASN A  1 38  ? 29.320  -45.514 17.896  1.00 0.00 ? 44  ASN A N     1 
ATOM 294   C CA    . ASN A  1 38  ? 29.925  -46.652 18.545  1.00 0.00 ? 44  ASN A CA    1 
ATOM 295   C C     . ASN A  1 38  ? 28.990  -47.833 18.606  1.00 0.00 ? 44  ASN A C     1 
ATOM 296   O O     . ASN A  1 38  ? 29.404  -48.972 18.387  1.00 0.00 ? 44  ASN A O     1 
ATOM 297   C CB    . ASN A  1 38  ? 30.389  -46.258 19.912  1.00 0.00 ? 44  ASN A CB    1 
ATOM 298   C CG    . ASN A  1 38  ? 31.585  -45.366 19.839  1.00 0.00 ? 44  ASN A CG    1 
ATOM 299   O OD1   . ASN A  1 38  ? 32.309  -45.384 18.836  1.00 0.00 ? 44  ASN A OD1   1 
ATOM 300   N ND2   . ASN A  1 38  ? 31.804  -44.576 20.858  1.00 0.00 ? 44  ASN A ND2   1 
ATOM 301   N N     . PHE A  1 39  ? 27.724  -47.564 18.877  1.00 0.00 ? 45  PHE A N     1 
ATOM 302   C CA    . PHE A  1 39  ? 26.728  -48.606 18.943  1.00 0.00 ? 45  PHE A CA    1 
ATOM 303   C C     . PHE A  1 39  ? 26.567  -49.251 17.594  1.00 0.00 ? 45  PHE A C     1 
ATOM 304   O O     . PHE A  1 39  ? 26.594  -50.469 17.467  1.00 0.00 ? 45  PHE A O     1 
ATOM 305   C CB    . PHE A  1 39  ? 25.398  -48.046 19.374  1.00 0.00 ? 45  PHE A CB    1 
ATOM 306   C CG    . PHE A  1 39  ? 24.371  -49.096 19.603  1.00 0.00 ? 45  PHE A CG    1 
ATOM 307   C CD1   . PHE A  1 39  ? 24.050  -49.488 20.888  1.00 0.00 ? 45  PHE A CD1   1 
ATOM 308   C CD2   . PHE A  1 39  ? 23.751  -49.727 18.546  1.00 0.00 ? 45  PHE A CD2   1 
ATOM 309   C CE1   . PHE A  1 39  ? 23.097  -50.461 21.115  1.00 0.00 ? 45  PHE A CE1   1 
ATOM 310   C CE2   . PHE A  1 39  ? 22.802  -50.709 18.770  1.00 0.00 ? 45  PHE A CE2   1 
ATOM 311   C CZ    . PHE A  1 39  ? 22.468  -51.069 20.056  1.00 0.00 ? 45  PHE A CZ    1 
ATOM 312   N N     . GLN A  1 40  ? 26.419  -48.429 16.571  1.00 0.00 ? 46  GLN A N     1 
ATOM 313   C CA    . GLN A  1 40  ? 26.254  -48.919 15.222  1.00 0.00 ? 46  GLN A CA    1 
ATOM 314   C C     . GLN A  1 40  ? 27.468  -49.660 14.737  1.00 0.00 ? 46  GLN A C     1 
ATOM 315   O O     . GLN A  1 40  ? 27.354  -50.630 13.995  1.00 0.00 ? 46  GLN A O     1 
ATOM 316   C CB    . GLN A  1 40  ? 25.971  -47.776 14.279  1.00 0.00 ? 46  GLN A CB    1 
ATOM 317   C CG    . GLN A  1 40  ? 24.613  -47.158 14.443  1.00 0.00 ? 46  GLN A CG    1 
ATOM 318   C CD    . GLN A  1 40  ? 24.467  -45.934 13.591  1.00 0.00 ? 46  GLN A CD    1 
ATOM 319   O OE1   . GLN A  1 40  ? 25.343  -45.065 13.587  1.00 0.00 ? 46  GLN A OE1   1 
ATOM 320   N NE2   . GLN A  1 40  ? 23.371  -45.857 12.849  1.00 0.00 ? 46  GLN A NE2   1 
ATOM 321   N N     . THR A  1 41  ? 28.637  -49.192 15.122  1.00 0.00 ? 47  THR A N     1 
ATOM 322   C CA    . THR A  1 41  ? 29.863  -49.790 14.660  1.00 0.00 ? 47  THR A CA    1 
ATOM 323   C C     . THR A  1 41  ? 30.073  -51.200 15.183  1.00 0.00 ? 47  THR A C     1 
ATOM 324   O O     . THR A  1 41  ? 30.446  -52.088 14.424  1.00 0.00 ? 47  THR A O     1 
ATOM 325   C CB    . THR A  1 41  ? 31.062  -48.930 15.053  1.00 0.00 ? 47  THR A CB    1 
ATOM 326   O OG1   . THR A  1 41  ? 30.942  -47.639 14.444  1.00 0.00 ? 47  THR A OG1   1 
ATOM 327   C CG2   . THR A  1 41  ? 32.350  -49.585 14.597  1.00 0.00 ? 47  THR A CG2   1 
ATOM 328   N N     . ASN A  1 42  ? 29.873  -51.408 16.475  1.00 0.00 ? 48  ASN A N     1 
ATOM 329   C CA    . ASN A  1 42  ? 30.190  -52.702 17.049  1.00 0.00 ? 48  ASN A CA    1 
ATOM 330   C C     . ASN A  1 42  ? 29.018  -53.652 17.231  1.00 0.00 ? 48  ASN A C     1 
ATOM 331   O O     . ASN A  1 42  ? 29.195  -54.855 17.123  1.00 0.00 ? 48  ASN A O     1 
ATOM 332   C CB    . ASN A  1 42  ? 30.920  -52.525 18.355  1.00 0.00 ? 48  ASN A CB    1 
ATOM 333   C CG    . ASN A  1 42  ? 32.326  -52.021 18.160  1.00 0.00 ? 48  ASN A CG    1 
ATOM 334   O OD1   . ASN A  1 42  ? 32.943  -52.264 17.111  1.00 0.00 ? 48  ASN A OD1   1 
ATOM 335   N ND2   . ASN A  1 42  ? 32.856  -51.343 19.147  1.00 0.00 ? 48  ASN A ND2   1 
ATOM 336   N N     . VAL A  1 43  ? 27.826  -53.144 17.500  1.00 0.00 ? 49  VAL A N     1 
ATOM 337   C CA    . VAL A  1 43  ? 26.720  -54.044 17.848  1.00 0.00 ? 49  VAL A CA    1 
ATOM 338   C C     . VAL A  1 43  ? 26.349  -55.101 16.792  1.00 0.00 ? 49  VAL A C     1 
ATOM 339   O O     . VAL A  1 43  ? 26.162  -56.263 17.154  1.00 0.00 ? 49  VAL A O     1 
ATOM 340   C CB    . VAL A  1 43  ? 25.487  -53.256 18.247  1.00 0.00 ? 49  VAL A CB    1 
ATOM 341   C CG1   . VAL A  1 43  ? 24.287  -54.175 18.354  1.00 0.00 ? 49  VAL A CG1   1 
ATOM 342   C CG2   . VAL A  1 43  ? 25.768  -52.619 19.571  1.00 0.00 ? 49  VAL A CG2   1 
ATOM 343   N N     . PRO A  1 44  ? 26.245  -54.745 15.500  1.00 0.00 ? 50  PRO A N     1 
ATOM 344   C CA    . PRO A  1 44  ? 25.939  -55.610 14.374  1.00 0.00 ? 50  PRO A CA    1 
ATOM 345   C C     . PRO A  1 44  ? 26.871  -56.811 14.334  1.00 0.00 ? 50  PRO A C     1 
ATOM 346   O O     . PRO A  1 44  ? 26.491  -57.883 13.860  1.00 0.00 ? 50  PRO A O     1 
ATOM 347   C CB    . PRO A  1 44  ? 26.146  -54.707 13.172  1.00 0.00 ? 50  PRO A CB    1 
ATOM 348   C CG    . PRO A  1 44  ? 25.863  -53.349 13.682  1.00 0.00 ? 50  PRO A CG    1 
ATOM 349   C CD    . PRO A  1 44  ? 26.424  -53.348 15.066  1.00 0.00 ? 50  PRO A CD    1 
ATOM 350   N N     . LYS A  1 45  ? 28.093  -56.627 14.832  1.00 0.00 ? 51  LYS A N     1 
ATOM 351   C CA    . LYS A  1 45  ? 29.092  -57.675 14.837  1.00 0.00 ? 51  LYS A CA    1 
ATOM 352   C C     . LYS A  1 45  ? 28.675  -58.803 15.746  1.00 0.00 ? 51  LYS A C     1 
ATOM 353   O O     . LYS A  1 45  ? 28.979  -59.963 15.486  1.00 0.00 ? 51  LYS A O     1 
ATOM 354   C CB    . LYS A  1 45  ? 30.423  -57.121 15.312  1.00 0.00 ? 51  LYS A CB    1 
ATOM 355   C CG    . LYS A  1 45  ? 31.060  -56.114 14.376  1.00 0.00 ? 51  LYS A CG    1 
ATOM 356   C CD    . LYS A  1 45  ? 32.296  -55.496 15.008  1.00 0.00 ? 51  LYS A CD    1 
ATOM 357   C CE    . LYS A  1 45  ? 32.918  -54.447 14.102  1.00 0.00 ? 51  LYS A CE    1 
ATOM 358   N NZ    . LYS A  1 45  ? 34.017  -53.712 14.778  1.00 0.00 ? 51  LYS A NZ    1 
ATOM 359   N N     . PHE A  1 46  ? 27.983  -58.458 16.822  1.00 0.00 ? 52  PHE A N     1 
ATOM 360   C CA    . PHE A  1 46  ? 27.558  -59.430 17.796  1.00 0.00 ? 52  PHE A CA    1 
ATOM 361   C C     . PHE A  1 46  ? 26.187  -59.956 17.489  1.00 0.00 ? 52  PHE A C     1 
ATOM 362   O O     . PHE A  1 46  ? 25.855  -61.078 17.854  1.00 0.00 ? 52  PHE A O     1 
ATOM 363   C CB    . PHE A  1 46  ? 27.596  -58.822 19.173  1.00 0.00 ? 52  PHE A CB    1 
ATOM 364   C CG    . PHE A  1 46  ? 28.984  -58.562 19.626  1.00 0.00 ? 52  PHE A CG    1 
ATOM 365   C CD1   . PHE A  1 46  ? 29.600  -57.369 19.324  1.00 0.00 ? 52  PHE A CD1   1 
ATOM 366   C CD2   . PHE A  1 46  ? 29.683  -59.510 20.348  1.00 0.00 ? 52  PHE A CD2   1 
ATOM 367   C CE1   . PHE A  1 46  ? 30.891  -57.127 19.729  1.00 0.00 ? 52  PHE A CE1   1 
ATOM 368   C CE2   . PHE A  1 46  ? 30.969  -59.268 20.763  1.00 0.00 ? 52  PHE A CE2   1 
ATOM 369   C CZ    . PHE A  1 46  ? 31.577  -58.077 20.452  1.00 0.00 ? 52  PHE A CZ    1 
ATOM 370   N N     . THR A  1 47  ? 25.390  -59.167 16.787  1.00 0.00 ? 53  THR A N     1 
ATOM 371   C CA    . THR A  1 47  ? 24.095  -59.646 16.371  1.00 0.00 ? 53  THR A CA    1 
ATOM 372   C C     . THR A  1 47  ? 24.244  -60.807 15.429  1.00 0.00 ? 53  THR A C     1 
ATOM 373   O O     . THR A  1 47  ? 23.533  -61.800 15.547  1.00 0.00 ? 53  THR A O     1 
ATOM 374   C CB    . THR A  1 47  ? 23.275  -58.568 15.704  1.00 0.00 ? 53  THR A CB    1 
ATOM 375   O OG1   . THR A  1 47  ? 23.024  -57.509 16.633  1.00 0.00 ? 53  THR A OG1   1 
ATOM 376   C CG2   . THR A  1 47  ? 21.964  -59.155 15.229  1.00 0.00 ? 53  THR A CG2   1 
ATOM 377   N N     . SER A  1 48  ? 25.188  -60.696 14.499  1.00 0.00 ? 54  SER A N     1 
ATOM 378   C CA    . SER A  1 48  ? 25.432  -61.776 13.562  1.00 0.00 ? 54  SER A CA    1 
ATOM 379   C C     . SER A  1 48  ? 25.884  -63.037 14.283  1.00 0.00 ? 54  SER A C     1 
ATOM 380   O O     . SER A  1 48  ? 25.571  -64.146 13.856  1.00 0.00 ? 54  SER A O     1 
ATOM 381   C CB    . SER A  1 48  ? 26.481  -61.364 12.563  1.00 0.00 ? 54  SER A CB    1 
ATOM 382   O OG    . SER A  1 48  ? 27.730  -61.222 13.179  1.00 0.00 ? 54  SER A OG    1 
ATOM 383   N N     . VAL A  1 49  ? 26.568  -62.862 15.410  1.00 0.00 ? 55  VAL A N     1 
ATOM 384   C CA    . VAL A  1 49  ? 26.984  -63.984 16.228  1.00 0.00 ? 55  VAL A CA    1 
ATOM 385   C C     . VAL A  1 49  ? 25.794  -64.638 16.852  1.00 0.00 ? 55  VAL A C     1 
ATOM 386   O O     . VAL A  1 49  ? 25.647  -65.852 16.792  1.00 0.00 ? 55  VAL A O     1 
ATOM 387   C CB    . VAL A  1 49  ? 27.943  -63.532 17.330  1.00 0.00 ? 55  VAL A CB    1 
ATOM 388   C CG1   . VAL A  1 49  ? 28.206  -64.670 18.293  1.00 0.00 ? 55  VAL A CG1   1 
ATOM 389   C CG2   . VAL A  1 49  ? 29.232  -63.060 16.713  1.00 0.00 ? 55  VAL A CG2   1 
ATOM 390   N N     . ASN A  1 50  ? 24.910  -63.833 17.415  1.00 0.00 ? 56  ASN A N     1 
ATOM 391   C CA    . ASN A  1 50  ? 23.712  -64.349 18.034  1.00 0.00 ? 56  ASN A CA    1 
ATOM 392   C C     . ASN A  1 50  ? 22.912  -65.146 17.056  1.00 0.00 ? 56  ASN A C     1 
ATOM 393   O O     . ASN A  1 50  ? 22.370  -66.189 17.399  1.00 0.00 ? 56  ASN A O     1 
ATOM 394   C CB    . ASN A  1 50  ? 22.877  -63.227 18.580  1.00 0.00 ? 56  ASN A CB    1 
ATOM 395   C CG    . ASN A  1 50  ? 23.466  -62.636 19.801  1.00 0.00 ? 56  ASN A CG    1 
ATOM 396   O OD1   . ASN A  1 50  ? 24.266  -63.284 20.477  1.00 0.00 ? 56  ASN A OD1   1 
ATOM 397   N ND2   . ASN A  1 50  ? 23.093  -61.422 20.105  1.00 0.00 ? 56  ASN A ND2   1 
ATOM 398   N N     . GLU A  1 51  ? 22.860  -64.674 15.825  1.00 0.00 ? 57  GLU A N     1 
ATOM 399   C CA    . GLU A  1 51  ? 22.119  -65.343 14.787  1.00 0.00 ? 57  GLU A CA    1 
ATOM 400   C C     . GLU A  1 51  ? 22.717  -66.671 14.409  1.00 0.00 ? 57  GLU A C     1 
ATOM 401   O O     . GLU A  1 51  ? 22.021  -67.684 14.377  1.00 0.00 ? 57  GLU A O     1 
ATOM 402   C CB    . GLU A  1 51  ? 22.053  -64.475 13.553  1.00 0.00 ? 57  GLU A CB    1 
ATOM 403   C CG    . GLU A  1 51  ? 21.332  -65.128 12.405  1.00 0.00 ? 57  GLU A CG    1 
ATOM 404   C CD    . GLU A  1 51  ? 19.896  -65.354 12.709  1.00 0.00 ? 57  GLU A CD    1 
ATOM 405   O OE1   . GLU A  1 51  ? 19.360  -64.616 13.499  1.00 0.00 ? 57  GLU A OE1   1 
ATOM 406   O OE2   . GLU A  1 51  ? 19.331  -66.276 12.172  1.00 0.00 ? 57  GLU A OE2   1 
ATOM 407   N N     . ASN A  1 52  ? 23.998  -66.668 14.095  1.00 0.00 ? 58  ASN A N     1 
ATOM 408   C CA    . ASN A  1 52  ? 24.640  -67.868 13.634  1.00 0.00 ? 58  ASN A CA    1 
ATOM 409   C C     . ASN A  1 52  ? 24.733  -68.904 14.729  1.00 0.00 ? 58  ASN A C     1 
ATOM 410   O O     . ASN A  1 52  ? 24.517  -70.089 14.485  1.00 0.00 ? 58  ASN A O     1 
ATOM 411   C CB    . ASN A  1 52  ? 25.987  -67.550 13.077  1.00 0.00 ? 58  ASN A CB    1 
ATOM 412   C CG    . ASN A  1 52  ? 25.900  -66.812 11.776  1.00 0.00 ? 58  ASN A CG    1 
ATOM 413   O OD1   . ASN A  1 52  ? 24.851  -66.798 11.124  1.00 0.00 ? 58  ASN A OD1   1 
ATOM 414   N ND2   . ASN A  1 52  ? 26.986  -66.202 11.379  1.00 0.00 ? 58  ASN A ND2   1 
ATOM 415   N N     . VAL A  1 53  ? 25.009  -68.460 15.946  1.00 0.00 ? 59  VAL A N     1 
ATOM 416   C CA    . VAL A  1 53  ? 25.061  -69.359 17.075  1.00 0.00 ? 59  VAL A CA    1 
ATOM 417   C C     . VAL A  1 53  ? 23.700  -69.935 17.347  1.00 0.00 ? 59  VAL A C     1 
ATOM 418   O O     . VAL A  1 53  ? 23.575  -71.114 17.657  1.00 0.00 ? 59  VAL A O     1 
ATOM 419   C CB    . VAL A  1 53  ? 25.588  -68.650 18.321  1.00 0.00 ? 59  VAL A CB    1 
ATOM 420   C CG1   . VAL A  1 53  ? 25.433  -69.549 19.535  1.00 0.00 ? 59  VAL A CG1   1 
ATOM 421   C CG2   . VAL A  1 53  ? 27.049  -68.292 18.119  1.00 0.00 ? 59  VAL A CG2   1 
ATOM 422   N N     . SER A  1 54  ? 22.670  -69.112 17.222  1.00 0.00 ? 60  SER A N     1 
ATOM 423   C CA    . SER A  1 54  ? 21.323  -69.586 17.397  1.00 0.00 ? 60  SER A CA    1 
ATOM 424   C C     . SER A  1 54  ? 21.028  -70.706 16.439  1.00 0.00 ? 60  SER A C     1 
ATOM 425   O O     . SER A  1 54  ? 20.468  -71.728 16.831  1.00 0.00 ? 60  SER A O     1 
ATOM 426   C CB    . SER A  1 54  ? 20.341  -68.468 17.189  1.00 0.00 ? 60  SER A CB    1 
ATOM 427   O OG    . SER A  1 54  ? 19.030  -68.921 17.357  1.00 0.00 ? 60  SER A OG    1 
ATOM 428   N N     . ALA A  1 55  ? 21.416  -70.530 15.177  1.00 0.00 ? 61  ALA A N     1 
ATOM 429   C CA    . ALA A  1 55  ? 21.198  -71.559 14.175  1.00 0.00 ? 61  ALA A CA    1 
ATOM 430   C C     . ALA A  1 55  ? 21.808  -72.866 14.617  1.00 0.00 ? 61  ALA A C     1 
ATOM 431   O O     . ALA A  1 55  ? 21.162  -73.912 14.552  1.00 0.00 ? 61  ALA A O     1 
ATOM 432   C CB    . ALA A  1 55  ? 21.783  -71.133 12.846  1.00 0.00 ? 61  ALA A CB    1 
ATOM 433   N N     . VAL A  1 56  ? 23.034  -72.799 15.108  1.00 0.00 ? 62  VAL A N     1 
ATOM 434   C CA    . VAL A  1 56  ? 23.724  -73.967 15.611  1.00 0.00 ? 62  VAL A CA    1 
ATOM 435   C C     . VAL A  1 56  ? 22.964  -74.633 16.718  1.00 0.00 ? 62  VAL A C     1 
ATOM 436   O O     . VAL A  1 56  ? 22.759  -75.843 16.702  1.00 0.00 ? 62  VAL A O     1 
ATOM 437   C CB    . VAL A  1 56  ? 25.103  -73.571 16.132  1.00 0.00 ? 62  VAL A CB    1 
ATOM 438   C CG1   . VAL A  1 56  ? 25.739  -74.713 16.879  1.00 0.00 ? 62  VAL A CG1   1 
ATOM 439   C CG2   . VAL A  1 56  ? 25.963  -73.167 14.980  1.00 0.00 ? 62  VAL A CG2   1 
ATOM 440   N N     . LEU A  1 57  ? 22.529  -73.843 17.674  1.00 0.00 ? 63  LEU A N     1 
ATOM 441   C CA    . LEU A  1 57  ? 21.861  -74.362 18.836  1.00 0.00 ? 63  LEU A CA    1 
ATOM 442   C C     . LEU A  1 57  ? 20.574  -75.058 18.479  1.00 0.00 ? 63  LEU A C     1 
ATOM 443   O O     . LEU A  1 57  ? 20.229  -76.077 19.073  1.00 0.00 ? 63  LEU A O     1 
ATOM 444   C CB    . LEU A  1 57  ? 21.620  -73.235 19.805  1.00 0.00 ? 63  LEU A CB    1 
ATOM 445   C CG    . LEU A  1 57  ? 22.897  -72.677 20.414  1.00 0.00 ? 63  LEU A CG    1 
ATOM 446   C CD1   . LEU A  1 57  ? 22.577  -71.458 21.247  1.00 0.00 ? 63  LEU A CD1   1 
ATOM 447   C CD2   . LEU A  1 57  ? 23.559  -73.757 21.235  1.00 0.00 ? 63  LEU A CD2   1 
ATOM 448   N N     . THR A  1 58  ? 19.887  -74.555 17.470  1.00 0.00 ? 64  THR A N     1 
ATOM 449   C CA    . THR A  1 58  ? 18.690  -75.212 16.997  1.00 0.00 ? 64  THR A CA    1 
ATOM 450   C C     . THR A  1 58  ? 19.025  -76.565 16.392  1.00 0.00 ? 64  THR A C     1 
ATOM 451   O O     . THR A  1 58  ? 18.328  -77.549 16.634  1.00 0.00 ? 64  THR A O     1 
ATOM 452   C CB    . THR A  1 58  ? 17.933  -74.333 16.015  1.00 0.00 ? 64  THR A CB    1 
ATOM 453   O OG1   . THR A  1 58  ? 17.524  -73.134 16.696  1.00 0.00 ? 64  THR A OG1   1 
ATOM 454   C CG2   . THR A  1 58  ? 16.707  -75.062 15.488  1.00 0.00 ? 64  THR A CG2   1 
ATOM 455   N N     . GLN A  1 59  ? 20.129  -76.635 15.650  1.00 0.00 ? 65  GLN A N     1 
ATOM 456   C CA    . GLN A  1 59  ? 20.587  -77.911 15.094  1.00 0.00 ? 65  GLN A CA    1 
ATOM 457   C C     . GLN A  1 59  ? 20.954  -78.915 16.194  1.00 0.00 ? 65  GLN A C     1 
ATOM 458   O O     . GLN A  1 59  ? 20.787  -80.120 16.020  1.00 0.00 ? 65  GLN A O     1 
ATOM 459   C CB    . GLN A  1 59  ? 21.789  -77.710 14.180  1.00 0.00 ? 65  GLN A CB    1 
ATOM 460   C CG    . GLN A  1 59  ? 21.479  -76.996 12.887  1.00 0.00 ? 65  GLN A CG    1 
ATOM 461   C CD    . GLN A  1 59  ? 22.714  -76.811 12.023  1.00 0.00 ? 65  GLN A CD    1 
ATOM 462   O OE1   . GLN A  1 59  ? 23.807  -77.277 12.361  1.00 0.00 ? 65  GLN A OE1   1 
ATOM 463   N NE2   . GLN A  1 59  ? 22.547  -76.127 10.897  1.00 0.00 ? 65  GLN A NE2   1 
ATOM 464   N N     . TYR A  1 60  ? 21.452  -78.418 17.325  1.00 0.00 ? 66  TYR A N     1 
ATOM 465   C CA    . TYR A  1 60  ? 21.788  -79.291 18.447  1.00 0.00 ? 66  TYR A CA    1 
ATOM 466   C C     . TYR A  1 60  ? 20.642  -79.534 19.411  1.00 0.00 ? 66  TYR A C     1 
ATOM 467   O O     . TYR A  1 60  ? 20.823  -80.204 20.423  1.00 0.00 ? 66  TYR A O     1 
ATOM 468   C CB    . TYR A  1 60  ? 22.980  -78.751 19.204  1.00 0.00 ? 66  TYR A CB    1 
ATOM 469   C CG    . TYR A  1 60  ? 24.272  -79.034 18.519  1.00 0.00 ? 66  TYR A CG    1 
ATOM 470   C CD1   . TYR A  1 60  ? 24.873  -78.077 17.747  1.00 0.00 ? 66  TYR A CD1   1 
ATOM 471   C CD2   . TYR A  1 60  ? 24.857  -80.275 18.665  1.00 0.00 ? 66  TYR A CD2   1 
ATOM 472   C CE1   . TYR A  1 60  ? 26.056  -78.354 17.107  1.00 0.00 ? 66  TYR A CE1   1 
ATOM 473   C CE2   . TYR A  1 60  ? 26.044  -80.552 18.033  1.00 0.00 ? 66  TYR A CE2   1 
ATOM 474   C CZ    . TYR A  1 60  ? 26.642  -79.594 17.255  1.00 0.00 ? 66  TYR A CZ    1 
ATOM 475   O OH    . TYR A  1 60  ? 27.827  -79.866 16.621  1.00 0.00 ? 66  TYR A OH    1 
ATOM 476   N N     . GLY A  1 61  ? 19.469  -78.994 19.124  1.00 0.00 ? 67  GLY A N     1 
ATOM 477   C CA    . GLY A  1 61  ? 18.314  -79.266 19.962  1.00 0.00 ? 67  GLY A CA    1 
ATOM 478   C C     . GLY A  1 61  ? 18.339  -78.512 21.284  1.00 0.00 ? 67  GLY A C     1 
ATOM 479   O O     . GLY A  1 61  ? 17.648  -78.892 22.231  1.00 0.00 ? 67  GLY A O     1 
ATOM 480   N N     . ILE A  1 62  ? 19.113  -77.440 21.348  1.00 0.00 ? 68  ILE A N     1 
ATOM 481   C CA    . ILE A  1 62  ? 19.266  -76.690 22.578  1.00 0.00 ? 68  ILE A CA    1 
ATOM 482   C C     . ILE A  1 62  ? 18.133  -75.702 22.741  1.00 0.00 ? 68  ILE A C     1 
ATOM 483   O O     . ILE A  1 62  ? 17.849  -74.922 21.834  1.00 0.00 ? 68  ILE A O     1 
ATOM 484   C CB    . ILE A  1 62  ? 20.596  -75.944 22.589  1.00 0.00 ? 68  ILE A CB    1 
ATOM 485   C CG1   . ILE A  1 62  ? 21.749  -76.916 22.358  1.00 0.00 ? 68  ILE A CG1   1 
ATOM 486   C CG2   . ILE A  1 62  ? 20.776  -75.233 23.900  1.00 0.00 ? 68  ILE A CG2   1 
ATOM 487   C CD1   . ILE A  1 62  ? 21.839  -78.006 23.392  1.00 0.00 ? 68  ILE A CD1   1 
ATOM 488   N N     . THR A  1 63  ? 17.465  -75.748 23.888  1.00 0.00 ? 69  THR A N     1 
ATOM 489   C CA    . THR A  1 63  ? 16.322  -74.869 24.140  1.00 0.00 ? 69  THR A CA    1 
ATOM 490   C C     . THR A  1 63  ? 16.449  -74.112 25.448  1.00 0.00 ? 69  THR A C     1 
ATOM 491   O O     . THR A  1 63  ? 17.216  -74.493 26.332  1.00 0.00 ? 69  THR A O     1 
ATOM 492   C CB    . THR A  1 63  ? 15.037  -75.665 24.201  1.00 0.00 ? 69  THR A CB    1 
ATOM 493   O OG1   . THR A  1 63  ? 15.123  -76.546 25.314  1.00 0.00 ? 69  THR A OG1   1 
ATOM 494   C CG2   . THR A  1 63  ? 14.817  -76.469 22.931  1.00 0.00 ? 69  THR A CG2   1 
ATOM 495   N N     . GLY A  1 64  ? 15.643  -73.077 25.586  1.00 0.00 ? 70  GLY A N     1 
ATOM 496   C CA    . GLY A  1 64  ? 15.574  -72.317 26.813  1.00 0.00 ? 70  GLY A CA    1 
ATOM 497   C C     . GLY A  1 64  ? 16.896  -71.667 27.157  1.00 0.00 ? 70  GLY A C     1 
ATOM 498   O O     . GLY A  1 64  ? 17.690  -71.331 26.277  1.00 0.00 ? 70  GLY A O     1 
ATOM 499   N N     . PRO A  1 65  ? 17.152  -71.519 28.445  1.00 0.00 ? 71  PRO A N     1 
ATOM 500   C CA    . PRO A  1 65  ? 18.319  -70.923 29.049  1.00 0.00 ? 71  PRO A CA    1 
ATOM 501   C C     . PRO A  1 65  ? 19.580  -71.638 28.652  1.00 0.00 ? 71  PRO A C     1 
ATOM 502   O O     . PRO A  1 65  ? 20.666  -71.082 28.758  1.00 0.00 ? 71  PRO A O     1 
ATOM 503   C CB    . PRO A  1 65  ? 18.028  -71.012 30.530  1.00 0.00 ? 71  PRO A CB    1 
ATOM 504   C CG    . PRO A  1 65  ? 16.539  -70.889 30.616  1.00 0.00 ? 71  PRO A CG    1 
ATOM 505   C CD    . PRO A  1 65  ? 16.019  -71.563 29.383  1.00 0.00 ? 71  PRO A CD    1 
ATOM 506   N N     . ASN A  1 66  ? 19.454  -72.867 28.177  1.00 0.00 ? 72  ASN A N     1 
ATOM 507   C CA    . ASN A  1 66  ? 20.613  -73.585 27.745  1.00 0.00 ? 72  ASN A CA    1 
ATOM 508   C C     . ASN A  1 66  ? 21.187  -72.938 26.514  1.00 0.00 ? 72  ASN A C     1 
ATOM 509   O O     . ASN A  1 66  ? 22.400  -72.952 26.308  1.00 0.00 ? 72  ASN A O     1 
ATOM 510   C CB    . ASN A  1 66  ? 20.276  -75.017 27.507  1.00 0.00 ? 72  ASN A CB    1 
ATOM 511   C CG    . ASN A  1 66  ? 20.034  -75.736 28.786  1.00 0.00 ? 72  ASN A CG    1 
ATOM 512   O OD1   . ASN A  1 66  ? 20.679  -75.448 29.798  1.00 0.00 ? 72  ASN A OD1   1 
ATOM 513   N ND2   . ASN A  1 66  ? 19.099  -76.645 28.779  1.00 0.00 ? 72  ASN A ND2   1 
ATOM 514   N N     . ARG A  1 67  ? 20.321  -72.330 25.708  1.00 0.00 ? 73  ARG A N     1 
ATOM 515   C CA    . ARG A  1 67  ? 20.781  -71.623 24.544  1.00 0.00 ? 73  ARG A CA    1 
ATOM 516   C C     . ARG A  1 67  ? 21.536  -70.429 24.997  1.00 0.00 ? 73  ARG A C     1 
ATOM 517   O O     . ARG A  1 67  ? 22.608  -70.132 24.481  1.00 0.00 ? 73  ARG A O     1 
ATOM 518   C CB    . ARG A  1 67  ? 19.628  -71.170 23.674  1.00 0.00 ? 73  ARG A CB    1 
ATOM 519   C CG    . ARG A  1 67  ? 18.847  -72.280 23.029  1.00 0.00 ? 73  ARG A CG    1 
ATOM 520   C CD    . ARG A  1 67  ? 17.700  -71.766 22.267  1.00 0.00 ? 73  ARG A CD    1 
ATOM 521   N NE    . ARG A  1 67  ? 18.093  -71.145 21.016  1.00 0.00 ? 73  ARG A NE    1 
ATOM 522   C CZ    . ARG A  1 67  ? 18.129  -71.787 19.830  1.00 0.00 ? 73  ARG A CZ    1 
ATOM 523   N NH1   . ARG A  1 67  ? 17.834  -73.058 19.743  1.00 0.00 ? 73  ARG A NH1   1 
ATOM 524   N NH2   . ARG A  1 67  ? 18.441  -71.152 18.722  1.00 0.00 ? 73  ARG A NH2   1 
ATOM 525   N N     . ALA A  1 68  ? 21.001  -69.773 26.025  1.00 0.00 ? 74  ALA A N     1 
ATOM 526   C CA    . ALA A  1 68  ? 21.619  -68.582 26.589  1.00 0.00 ? 74  ALA A CA    1 
ATOM 527   C C     . ALA A  1 68  ? 23.029  -68.861 27.083  1.00 0.00 ? 74  ALA A C     1 
ATOM 528   O O     . ALA A  1 68  ? 23.910  -68.017 26.942  1.00 0.00 ? 74  ALA A O     1 
ATOM 529   C CB    . ALA A  1 68  ? 20.770  -68.030 27.718  1.00 0.00 ? 74  ALA A CB    1 
ATOM 530   N N     . ILE A  1 69  ? 23.255  -70.056 27.623  1.00 0.00 ? 75  ILE A N     1 
ATOM 531   C CA    . ILE A  1 69  ? 24.592  -70.432 28.065  1.00 0.00 ? 75  ILE A CA    1 
ATOM 532   C C     . ILE A  1 69  ? 25.570  -70.371 26.928  1.00 0.00 ? 75  ILE A C     1 
ATOM 533   O O     . ILE A  1 69  ? 26.636  -69.757 27.036  1.00 0.00 ? 75  ILE A O     1 
ATOM 534   C CB    . ILE A  1 69  ? 24.621  -71.855 28.632  1.00 0.00 ? 75  ILE A CB    1 
ATOM 535   C CG1   . ILE A  1 69  ? 23.849  -71.925 29.927  1.00 0.00 ? 75  ILE A CG1   1 
ATOM 536   C CG2   . ILE A  1 69  ? 26.056  -72.307 28.833  1.00 0.00 ? 75  ILE A CG2   1 
ATOM 537   C CD1   . ILE A  1 69  ? 23.596  -73.327 30.410  1.00 0.00 ? 75  ILE A CD1   1 
ATOM 538   N N     . TYR A  1 70  ? 25.211  -71.006 25.829  1.00 0.00 ? 76  TYR A N     1 
ATOM 539   C CA    . TYR A  1 70  ? 26.094  -71.078 24.695  1.00 0.00 ? 76  TYR A CA    1 
ATOM 540   C C     . TYR A  1 70  ? 26.208  -69.748 23.986  1.00 0.00 ? 76  TYR A C     1 
ATOM 541   O O     . TYR A  1 70  ? 27.267  -69.410 23.464  1.00 0.00 ? 76  TYR A O     1 
ATOM 542   C CB    . TYR A  1 70  ? 25.620  -72.150 23.758  1.00 0.00 ? 76  TYR A CB    1 
ATOM 543   C CG    . TYR A  1 70  ? 25.736  -73.515 24.365  1.00 0.00 ? 76  TYR A CG    1 
ATOM 544   C CD1   . TYR A  1 70  ? 24.600  -74.247 24.630  1.00 0.00 ? 76  TYR A CD1   1 
ATOM 545   C CD2   . TYR A  1 70  ? 26.975  -74.016 24.689  1.00 0.00 ? 76  TYR A CD2   1 
ATOM 546   C CE1   . TYR A  1 70  ? 24.704  -75.481 25.223  1.00 0.00 ? 76  TYR A CE1   1 
ATOM 547   C CE2   . TYR A  1 70  ? 27.085  -75.251 25.283  1.00 0.00 ? 76  TYR A CE2   1 
ATOM 548   C CZ    . TYR A  1 70  ? 25.952  -75.981 25.554  1.00 0.00 ? 76  TYR A CZ    1 
ATOM 549   O OH    . TYR A  1 70  ? 26.050  -77.206 26.161  1.00 0.00 ? 76  TYR A OH    1 
ATOM 550   N N     . GLN A  1 71  ? 25.134  -68.969 24.004  1.00 0.00 ? 77  GLN A N     1 
ATOM 551   C CA    . GLN A  1 71  ? 25.159  -67.655 23.410  1.00 0.00 ? 77  GLN A CA    1 
ATOM 552   C C     . GLN A  1 71  ? 26.143  -66.774 24.132  1.00 0.00 ? 77  GLN A C     1 
ATOM 553   O O     . GLN A  1 71  ? 26.916  -66.063 23.499  1.00 0.00 ? 77  GLN A O     1 
ATOM 554   C CB    . GLN A  1 71  ? 23.773  -67.030 23.446  1.00 0.00 ? 77  GLN A CB    1 
ATOM 555   C CG    . GLN A  1 71  ? 22.784  -67.664 22.490  1.00 0.00 ? 77  GLN A CG    1 
ATOM 556   C CD    . GLN A  1 71  ? 23.075  -67.305 21.067  1.00 0.00 ? 77  GLN A CD    1 
ATOM 557   O OE1   . GLN A  1 71  ? 24.162  -66.816 20.761  1.00 0.00 ? 77  GLN A OE1   1 
ATOM 558   N NE2   . GLN A  1 71  ? 22.106  -67.519 20.183  1.00 0.00 ? 77  GLN A NE2   1 
ATOM 559   N N     . GLY A  1 72  ? 26.154  -66.861 25.460  1.00 0.00 ? 78  GLY A N     1 
ATOM 560   C CA    . GLY A  1 72  ? 27.089  -66.087 26.266  1.00 0.00 ? 78  GLY A CA    1 
ATOM 561   C C     . GLY A  1 72  ? 28.513  -66.446 25.915  1.00 0.00 ? 78  GLY A C     1 
ATOM 562   O O     . GLY A  1 72  ? 29.357  -65.569 25.729  1.00 0.00 ? 78  GLY A O     1 
ATOM 563   N N     . PHE A  1 73  ? 28.771  -67.736 25.802  1.00 0.00 ? 79  PHE A N     1 
ATOM 564   C CA    . PHE A  1 73  ? 30.072  -68.220 25.411  1.00 0.00 ? 79  PHE A CA    1 
ATOM 565   C C     . PHE A  1 73  ? 30.495  -67.648 24.072  1.00 0.00 ? 79  PHE A C     1 
ATOM 566   O O     . PHE A  1 73  ? 31.602  -67.132 23.939  1.00 0.00 ? 79  PHE A O     1 
ATOM 567   C CB    . PHE A  1 73  ? 30.054  -69.728 25.351  1.00 0.00 ? 79  PHE A CB    1 
ATOM 568   C CG    . PHE A  1 73  ? 31.274  -70.329 24.757  1.00 0.00 ? 79  PHE A CG    1 
ATOM 569   C CD1   . PHE A  1 73  ? 32.429  -70.494 25.492  1.00 0.00 ? 79  PHE A CD1   1 
ATOM 570   C CD2   . PHE A  1 73  ? 31.258  -70.760 23.450  1.00 0.00 ? 79  PHE A CD2   1 
ATOM 571   C CE1   . PHE A  1 73  ? 33.542  -71.081 24.928  1.00 0.00 ? 79  PHE A CE1   1 
ATOM 572   C CE2   . PHE A  1 73  ? 32.361  -71.339 22.881  1.00 0.00 ? 79  PHE A CE2   1 
ATOM 573   C CZ    . PHE A  1 73  ? 33.507  -71.502 23.621  1.00 0.00 ? 79  PHE A CZ    1 
ATOM 574   N N     . GLY A  1 74  ? 29.617  -67.747 23.080  1.00 0.00 ? 80  GLY A N     1 
ATOM 575   C CA    . GLY A  1 74  ? 29.905  -67.249 21.745  1.00 0.00 ? 80  GLY A CA    1 
ATOM 576   C C     . GLY A  1 74  ? 30.207  -65.762 21.755  1.00 0.00 ? 80  GLY A C     1 
ATOM 577   O O     . GLY A  1 74  ? 31.171  -65.313 21.140  1.00 0.00 ? 80  GLY A O     1 
ATOM 578   N N     . LEU A  1 75  ? 29.402  -65.011 22.472  1.00 0.00 ? 81  LEU A N     1 
ATOM 579   C CA    . LEU A  1 75  ? 29.584  -63.583 22.560  1.00 0.00 ? 81  LEU A CA    1 
ATOM 580   C C     . LEU A  1 75  ? 30.927  -63.231 23.156  1.00 0.00 ? 81  LEU A C     1 
ATOM 581   O O     . LEU A  1 75  ? 31.590  -62.302 22.697  1.00 0.00 ? 81  LEU A O     1 
ATOM 582   C CB    . LEU A  1 75  ? 28.471  -62.989 23.392  1.00 0.00 ? 81  LEU A CB    1 
ATOM 583   C CG    . LEU A  1 75  ? 27.102  -62.999 22.737  1.00 0.00 ? 81  LEU A CG    1 
ATOM 584   C CD1   . LEU A  1 75  ? 26.053  -62.597 23.756  1.00 0.00 ? 81  LEU A CD1   1 
ATOM 585   C CD2   . LEU A  1 75  ? 27.120  -62.042 21.563  1.00 0.00 ? 81  LEU A CD2   1 
ATOM 586   N N     . LYS A  1 76  ? 31.349  -63.998 24.148  1.00 0.00 ? 82  LYS A N     1 
ATOM 587   C CA    . LYS A  1 76  ? 32.638  -63.796 24.765  1.00 0.00 ? 82  LYS A CA    1 
ATOM 588   C C     . LYS A  1 76  ? 33.764  -64.029 23.794  1.00 0.00 ? 82  LYS A C     1 
ATOM 589   O O     . LYS A  1 76  ? 34.732  -63.271 23.770  1.00 0.00 ? 82  LYS A O     1 
ATOM 590   C CB    . LYS A  1 76  ? 32.790  -64.701 25.958  1.00 0.00 ? 82  LYS A CB    1 
ATOM 591   C CG    . LYS A  1 76  ? 34.142  -64.631 26.620  1.00 0.00 ? 82  LYS A CG    1 
ATOM 592   C CD    . LYS A  1 76  ? 34.401  -63.288 27.202  1.00 0.00 ? 82  LYS A CD    1 
ATOM 593   C CE    . LYS A  1 76  ? 35.665  -63.284 28.028  1.00 0.00 ? 82  LYS A CE    1 
ATOM 594   N NZ    . LYS A  1 76  ? 35.475  -64.021 29.300  1.00 0.00 ? 82  LYS A NZ    1 
ATOM 595   N N     . VAL A  1 77  ? 33.634  -65.064 22.970  1.00 0.00 ? 83  VAL A N     1 
ATOM 596   C CA    . VAL A  1 77  ? 34.643  -65.346 21.966  1.00 0.00 ? 83  VAL A CA    1 
ATOM 597   C C     . VAL A  1 77  ? 34.804  -64.164 21.039  1.00 0.00 ? 83  VAL A C     1 
ATOM 598   O O     . VAL A  1 77  ? 35.921  -63.733 20.754  1.00 0.00 ? 83  VAL A O     1 
ATOM 599   C CB    . VAL A  1 77  ? 34.264  -66.592 21.139  1.00 0.00 ? 83  VAL A CB    1 
ATOM 600   C CG1   . VAL A  1 77  ? 35.208  -66.744 19.964  1.00 0.00 ? 83  VAL A CG1   1 
ATOM 601   C CG2   . VAL A  1 77  ? 34.311  -67.832 22.014  1.00 0.00 ? 83  VAL A CG2   1 
ATOM 602   N N     . ALA A  1 78  ? 33.678  -63.636 20.579  1.00 0.00 ? 84  ALA A N     1 
ATOM 603   C CA    . ALA A  1 78  ? 33.671  -62.498 19.683  1.00 0.00 ? 84  ALA A CA    1 
ATOM 604   C C     . ALA A  1 78  ? 34.259  -61.261 20.344  1.00 0.00 ? 84  ALA A C     1 
ATOM 605   O O     . ALA A  1 78  ? 34.972  -60.495 19.701  1.00 0.00 ? 84  ALA A O     1 
ATOM 606   C CB    . ALA A  1 78  ? 32.262  -62.225 19.214  1.00 0.00 ? 84  ALA A CB    1 
ATOM 607   N N     . ARG A  1 79  ? 33.966  -61.068 21.625  1.00 0.00 ? 85  ARG A N     1 
ATOM 608   C CA    . ARG A  1 79  ? 34.495  -59.928 22.357  1.00 0.00 ? 85  ARG A CA    1 
ATOM 609   C C     . ARG A  1 79  ? 35.991  -59.915 22.341  1.00 0.00 ? 85  ARG A C     1 
ATOM 610   O O     . ARG A  1 79  ? 36.609  -58.900 22.014  1.00 0.00 ? 85  ARG A O     1 
ATOM 611   C CB    . ARG A  1 79  ? 34.032  -59.950 23.785  1.00 0.00 ? 85  ARG A CB    1 
ATOM 612   C CG    . ARG A  1 79  ? 34.538  -58.799 24.637  1.00 0.00 ? 85  ARG A CG    1 
ATOM 613   C CD    . ARG A  1 79  ? 33.978  -58.866 26.001  1.00 0.00 ? 85  ARG A CD    1 
ATOM 614   N NE    . ARG A  1 79  ? 34.119  -57.628 26.738  1.00 0.00 ? 85  ARG A NE    1 
ATOM 615   C CZ    . ARG A  1 79  ? 35.195  -57.277 27.467  1.00 0.00 ? 85  ARG A CZ    1 
ATOM 616   N NH1   . ARG A  1 79  ? 36.235  -58.077 27.524  1.00 0.00 ? 85  ARG A NH1   1 
ATOM 617   N NH2   . ARG A  1 79  ? 35.198  -56.128 28.125  1.00 0.00 ? 85  ARG A NH2   1 
ATOM 618   N N     . ALA A  1 80  ? 36.578  -61.044 22.689  1.00 0.00 ? 86  ALA A N     1 
ATOM 619   C CA    . ALA A  1 80  ? 38.013  -61.178 22.702  1.00 0.00 ? 86  ALA A CA    1 
ATOM 620   C C     . ALA A  1 80  ? 38.576  -60.940 21.325  1.00 0.00 ? 86  ALA A C     1 
ATOM 621   O O     . ALA A  1 80  ? 39.586  -60.263 21.167  1.00 0.00 ? 86  ALA A O     1 
ATOM 622   C CB    . ALA A  1 80  ? 38.400  -62.547 23.196  1.00 0.00 ? 86  ALA A CB    1 
ATOM 623   N N     . LEU A  1 81  ? 37.902  -61.463 20.321  1.00 0.00 ? 87  LEU A N     1 
ATOM 624   C CA    . LEU A  1 81  ? 38.335  -61.263 18.970  1.00 0.00 ? 87  LEU A CA    1 
ATOM 625   C C     . LEU A  1 81  ? 38.435  -59.787 18.656  1.00 0.00 ? 87  LEU A C     1 
ATOM 626   O O     . LEU A  1 81  ? 39.446  -59.331 18.139  1.00 0.00 ? 87  LEU A O     1 
ATOM 627   C CB    . LEU A  1 81  ? 37.383  -61.944 18.008  1.00 0.00 ? 87  LEU A CB    1 
ATOM 628   C CG    . LEU A  1 81  ? 37.725  -61.794 16.540  1.00 0.00 ? 87  LEU A CG    1 
ATOM 629   C CD1   . LEU A  1 81  ? 39.081  -62.417 16.280  1.00 0.00 ? 87  LEU A CD1   1 
ATOM 630   C CD2   . LEU A  1 81  ? 36.646  -62.462 15.706  1.00 0.00 ? 87  LEU A CD2   1 
ATOM 631   N N     . ASN A  1 82  ? 37.415  -59.024 19.008  1.00 0.00 ? 88  ASN A N     1 
ATOM 632   C CA    . ASN A  1 82  ? 37.439  -57.589 18.741  1.00 0.00 ? 88  ASN A CA    1 
ATOM 633   C C     . ASN A  1 82  ? 38.530  -56.843 19.508  1.00 0.00 ? 88  ASN A C     1 
ATOM 634   O O     . ASN A  1 82  ? 39.149  -55.926 18.972  1.00 0.00 ? 88  ASN A O     1 
ATOM 635   C CB    . ASN A  1 82  ? 36.100  -56.962 19.038  1.00 0.00 ? 88  ASN A CB    1 
ATOM 636   C CG    . ASN A  1 82  ? 35.083  -57.266 17.996  1.00 0.00 ? 88  ASN A CG    1 
ATOM 637   O OD1   . ASN A  1 82  ? 35.403  -57.796 16.931  1.00 0.00 ? 88  ASN A OD1   1 
ATOM 638   N ND2   . ASN A  1 82  ? 33.861  -56.914 18.265  1.00 0.00 ? 88  ASN A ND2   1 
ATOM 639   N N     . ARG A  1 83  ? 38.761  -57.223 20.759  1.00 0.00 ? 89  ARG A N     1 
ATOM 640   C CA    . ARG A  1 83  ? 39.706  -56.486 21.596  1.00 0.00 ? 89  ARG A CA    1 
ATOM 641   C C     . ARG A  1 83  ? 41.135  -57.039 21.532  1.00 0.00 ? 89  ARG A C     1 
ATOM 642   O O     . ARG A  1 83  ? 42.074  -56.373 21.957  1.00 0.00 ? 89  ARG A O     1 
ATOM 643   C CB    . ARG A  1 83  ? 39.223  -56.482 23.040  1.00 0.00 ? 89  ARG A CB    1 
ATOM 644   C CG    . ARG A  1 83  ? 37.941  -55.677 23.282  1.00 0.00 ? 89  ARG A CG    1 
ATOM 645   C CD    . ARG A  1 83  ? 37.468  -55.791 24.691  1.00 0.00 ? 89  ARG A CD    1 
ATOM 646   N NE    . ARG A  1 83  ? 36.179  -55.125 24.907  1.00 0.00 ? 89  ARG A NE    1 
ATOM 647   C CZ    . ARG A  1 83  ? 36.019  -53.851 25.310  1.00 0.00 ? 89  ARG A CZ    1 
ATOM 648   N NH1   . ARG A  1 83  ? 37.061  -53.092 25.548  1.00 0.00 ? 89  ARG A NH1   1 
ATOM 649   N NH2   . ARG A  1 83  ? 34.806  -53.368 25.475  1.00 0.00 ? 89  ARG A NH2   1 
ATOM 650   N N     . ILE A  1 84  ? 41.295  -58.239 20.989  1.00 0.00 ? 90  ILE A N     1 
ATOM 651   C CA    . ILE A  1 84  ? 42.614  -58.860 20.855  1.00 0.00 ? 90  ILE A CA    1 
ATOM 652   C C     . ILE A  1 84  ? 42.996  -59.092 19.407  1.00 0.00 ? 90  ILE A C     1 
ATOM 653   O O     . ILE A  1 84  ? 44.127  -58.824 18.993  1.00 0.00 ? 90  ILE A O     1 
ATOM 654   C CB    . ILE A  1 84  ? 42.676  -60.212 21.586  1.00 0.00 ? 90  ILE A CB    1 
ATOM 655   C CG1   . ILE A  1 84  ? 42.500  -60.033 23.086  1.00 0.00 ? 90  ILE A CG1   1 
ATOM 656   C CG2   . ILE A  1 84  ? 43.972  -60.906 21.283  1.00 0.00 ? 90  ILE A CG2   1 
ATOM 657   C CD1   . ILE A  1 84  ? 42.375  -61.341 23.830  1.00 0.00 ? 90  ILE A CD1   1 
ATOM 658   N N     . GLY A  1 85  ? 42.075  -59.656 18.652  1.00 0.00 ? 91  GLY A N     1 
ATOM 659   C CA    . GLY A  1 85  ? 42.347  -60.022 17.272  1.00 0.00 ? 91  GLY A CA    1 
ATOM 660   C C     . GLY A  1 85  ? 42.689  -61.491 17.201  1.00 0.00 ? 91  GLY A C     1 
ATOM 661   O O     . GLY A  1 85  ? 43.002  -62.105 18.216  1.00 0.00 ? 91  GLY A O     1 
ATOM 662   N N     . SER A  1 86  ? 42.616  -62.065 16.008  1.00 0.00 ? 92  SER A N     1 
ATOM 663   C CA    . SER A  1 86  ? 42.873  -63.489 15.845  1.00 0.00 ? 92  SER A CA    1 
ATOM 664   C C     . SER A  1 86  ? 44.337  -63.810 16.027  1.00 0.00 ? 92  SER A C     1 
ATOM 665   O O     . SER A  1 86  ? 45.190  -62.928 15.931  1.00 0.00 ? 92  SER A O     1 
ATOM 666   C CB    . SER A  1 86  ? 42.435  -63.949 14.482  1.00 0.00 ? 92  SER A CB    1 
ATOM 667   O OG    . SER A  1 86  ? 43.260  -63.411 13.489  1.00 0.00 ? 92  SER A OG    1 
ATOM 668   N N     . GLY A  1 87  ? 44.631  -65.083 16.256  1.00 0.00 ? 93  GLY A N     1 
ATOM 669   C CA    . GLY A  1 87  ? 46.000  -65.524 16.446  1.00 0.00 ? 93  GLY A CA    1 
ATOM 670   C C     . GLY A  1 87  ? 46.225  -66.025 17.865  1.00 0.00 ? 93  GLY A C     1 
ATOM 671   O O     . GLY A  1 87  ? 45.285  -66.110 18.651  1.00 0.00 ? 93  GLY A O     1 
ATOM 672   N N     . PRO A  1 88  ? 47.471  -66.378 18.167  1.00 0.00 ? 94  PRO A N     1 
ATOM 673   C CA    . PRO A  1 88  ? 47.987  -66.903 19.447  1.00 0.00 ? 94  PRO A CA    1 
ATOM 674   C C     . PRO A  1 88  ? 47.175  -66.471 20.663  1.00 0.00 ? 94  PRO A C     1 
ATOM 675   O O     . PRO A  1 88  ? 46.648  -67.307 21.390  1.00 0.00 ? 94  PRO A O     1 
ATOM 676   C CB    . PRO A  1 88  ? 49.398  -66.322 19.520  1.00 0.00 ? 94  PRO A CB    1 
ATOM 677   C CG    . PRO A  1 88  ? 49.774  -66.120 18.113  1.00 0.00 ? 94  PRO A CG    1 
ATOM 678   C CD    . PRO A  1 88  ? 48.524  -65.607 17.491  1.00 0.00 ? 94  PRO A CD    1 
ATOM 679   N N     . ALA A  1 89  ? 47.112  -65.169 20.908  1.00 0.00 ? 95  ALA A N     1 
ATOM 680   C CA    . ALA A  1 89  ? 46.437  -64.658 22.090  1.00 0.00 ? 95  ALA A CA    1 
ATOM 681   C C     . ALA A  1 89  ? 44.984  -65.089 22.151  1.00 0.00 ? 95  ALA A C     1 
ATOM 682   O O     . ALA A  1 89  ? 44.471  -65.386 23.229  1.00 0.00 ? 95  ALA A O     1 
ATOM 683   C CB    . ALA A  1 89  ? 46.545  -63.156 22.129  1.00 0.00 ? 95  ALA A CB    1 
ATOM 684   N N     . LEU A  1 90  ? 44.317  -65.128 21.003  1.00 0.00 ? 96  LEU A N     1 
ATOM 685   C CA    . LEU A  1 90  ? 42.932  -65.546 20.967  1.00 0.00 ? 96  LEU A CA    1 
ATOM 686   C C     . LEU A  1 90  ? 42.833  -66.986 21.341  1.00 0.00 ? 96  LEU A C     1 
ATOM 687   O O     . LEU A  1 90  ? 41.936  -67.383 22.078  1.00 0.00 ? 96  LEU A O     1 
ATOM 688   C CB    . LEU A  1 90  ? 42.322  -65.345 19.599  1.00 0.00 ? 96  LEU A CB    1 
ATOM 689   C CG    . LEU A  1 90  ? 40.841  -65.707 19.510  1.00 0.00 ? 96  LEU A CG    1 
ATOM 690   C CD1   . LEU A  1 90  ? 40.054  -64.825 20.469  1.00 0.00 ? 96  LEU A CD1   1 
ATOM 691   C CD2   . LEU A  1 90  ? 40.357  -65.534 18.089  1.00 0.00 ? 96  LEU A CD2   1 
ATOM 692   N N     . VAL A  1 91  ? 43.753  -67.782 20.823  1.00 0.00 ? 97  VAL A N     1 
ATOM 693   C CA    . VAL A  1 91  ? 43.795  -69.195 21.141  1.00 0.00 ? 97  VAL A CA    1 
ATOM 694   C C     . VAL A  1 91  ? 43.913  -69.401 22.633  1.00 0.00 ? 97  VAL A C     1 
ATOM 695   O O     . VAL A  1 91  ? 43.187  -70.209 23.216  1.00 0.00 ? 97  VAL A O     1 
ATOM 696   C CB    . VAL A  1 91  ? 44.977  -69.871 20.437  1.00 0.00 ? 97  VAL A CB    1 
ATOM 697   C CG1   . VAL A  1 91  ? 45.152  -71.284 20.951  1.00 0.00 ? 97  VAL A CG1   1 
ATOM 698   C CG2   . VAL A  1 91  ? 44.747  -69.862 18.938  1.00 0.00 ? 97  VAL A CG2   1 
ATOM 699   N N     . ASN A  1 92  ? 44.813  -68.649 23.257  1.00 0.00 ? 98  ASN A N     1 
ATOM 700   C CA    . ASN A  1 92  ? 45.011  -68.729 24.687  1.00 0.00 ? 98  ASN A CA    1 
ATOM 701   C C     . ASN A  1 92  ? 43.728  -68.396 25.416  1.00 0.00 ? 98  ASN A C     1 
ATOM 702   O O     . ASN A  1 92  ? 43.340  -69.090 26.361  1.00 0.00 ? 98  ASN A O     1 
ATOM 703   C CB    . ASN A  1 92  ? 46.126  -67.799 25.112  1.00 0.00 ? 98  ASN A CB    1 
ATOM 704   C CG    . ASN A  1 92  ? 47.455  -68.302 24.668  1.00 0.00 ? 98  ASN A CG    1 
ATOM 705   O OD1   . ASN A  1 92  ? 47.576  -69.483 24.322  1.00 0.00 ? 98  ASN A OD1   1 
ATOM 706   N ND2   . ASN A  1 92  ? 48.459  -67.456 24.665  1.00 0.00 ? 98  ASN A ND2   1 
ATOM 707   N N     . MET A  1 93  ? 43.046  -67.367 24.938  1.00 0.00 ? 99  MET A N     1 
ATOM 708   C CA    . MET A  1 93  ? 41.802  -66.944 25.517  1.00 0.00 ? 99  MET A CA    1 
ATOM 709   C C     . MET A  1 93  ? 40.740  -68.003 25.446  1.00 0.00 ? 99  MET A C     1 
ATOM 710   O O     . MET A  1 93  ? 40.096  -68.304 26.451  1.00 0.00 ? 99  MET A O     1 
ATOM 711   C CB    . MET A  1 93  ? 41.308  -65.700 24.827  1.00 0.00 ? 99  MET A CB    1 
ATOM 712   C CG    . MET A  1 93  ? 39.990  -65.214 25.352  1.00 0.00 ? 99  MET A CG    1 
ATOM 713   S SD    . MET A  1 93  ? 40.102  -64.651 27.033  1.00 0.00 ? 99  MET A SD    1 
ATOM 714   C CE    . MET A  1 93  ? 40.855  -63.051 26.768  1.00 0.00 ? 99  MET A CE    1 
ATOM 715   N N     . ILE A  1 94  ? 40.533  -68.554 24.258  1.00 0.00 ? 100 ILE A N     1 
ATOM 716   C CA    . ILE A  1 94  ? 39.463  -69.503 24.050  1.00 0.00 ? 100 ILE A CA    1 
ATOM 717   C C     . ILE A  1 94  ? 39.649  -70.735 24.879  1.00 0.00 ? 100 ILE A C     1 
ATOM 718   O O     . ILE A  1 94  ? 38.684  -71.266 25.417  1.00 0.00 ? 100 ILE A O     1 
ATOM 719   C CB    . ILE A  1 94  ? 39.323  -69.890 22.591  1.00 0.00 ? 100 ILE A CB    1 
ATOM 720   C CG1   . ILE A  1 94  ? 38.858  -68.689 21.775  1.00 0.00 ? 100 ILE A CG1   1 
ATOM 721   C CG2   . ILE A  1 94  ? 38.312  -71.017 22.470  1.00 0.00 ? 100 ILE A CG2   1 
ATOM 722   C CD1   . ILE A  1 94  ? 38.945  -68.902 20.286  1.00 0.00 ? 100 ILE A CD1   1 
ATOM 723   N N     . ASN A  1 95  ? 40.885  -71.209 24.982  1.00 0.00 ? 101 ASN A N     1 
ATOM 724   C CA    . ASN A  1 95  ? 41.163  -72.379 25.797  1.00 0.00 ? 101 ASN A CA    1 
ATOM 725   C C     . ASN A  1 95  ? 40.690  -72.177 27.220  1.00 0.00 ? 101 ASN A C     1 
ATOM 726   O O     . ASN A  1 95  ? 40.006  -73.037 27.782  1.00 0.00 ? 101 ASN A O     1 
ATOM 727   C CB    . ASN A  1 95  ? 42.638  -72.694 25.791  1.00 0.00 ? 101 ASN A CB    1 
ATOM 728   C CG    . ASN A  1 95  ? 43.089  -73.312 24.520  1.00 0.00 ? 101 ASN A CG    1 
ATOM 729   O OD1   . ASN A  1 95  ? 42.290  -73.899 23.785  1.00 0.00 ? 101 ASN A OD1   1 
ATOM 730   N ND2   . ASN A  1 95  ? 44.361  -73.200 24.240  1.00 0.00 ? 101 ASN A ND2   1 
ATOM 731   N N     . GLY A  1 96  ? 41.033  -71.027 27.798  1.00 0.00 ? 102 GLY A N     1 
ATOM 732   C CA    . GLY A  1 96  ? 40.625  -70.728 29.155  1.00 0.00 ? 102 GLY A CA    1 
ATOM 733   C C     . GLY A  1 96  ? 39.134  -70.552 29.246  1.00 0.00 ? 102 GLY A C     1 
ATOM 734   O O     . GLY A  1 96  ? 38.505  -71.033 30.189  1.00 0.00 ? 102 GLY A O     1 
ATOM 735   N N     . LEU A  1 97  ? 38.565  -69.877 28.257  1.00 0.00 ? 103 LEU A N     1 
ATOM 736   C CA    . LEU A  1 97  ? 37.144  -69.635 28.210  1.00 0.00 ? 103 LEU A CA    1 
ATOM 737   C C     . LEU A  1 97  ? 36.346  -70.910 28.203  1.00 0.00 ? 103 LEU A C     1 
ATOM 738   O O     . LEU A  1 97  ? 35.337  -71.022 28.894  1.00 0.00 ? 103 LEU A O     1 
ATOM 739   C CB    . LEU A  1 97  ? 36.794  -68.834 26.995  1.00 0.00 ? 103 LEU A CB    1 
ATOM 740   C CG    . LEU A  1 97  ? 35.325  -68.574 26.841  1.00 0.00 ? 103 LEU A CG    1 
ATOM 741   C CD1   . LEU A  1 97  ? 34.840  -67.824 28.057  1.00 0.00 ? 103 LEU A CD1   1 
ATOM 742   C CD2   . LEU A  1 97  ? 35.086  -67.799 25.565  1.00 0.00 ? 103 LEU A CD2   1 
ATOM 743   N N     . LYS A  1 98  ? 36.759  -71.858 27.387  1.00 0.00 ? 104 LYS A N     1 
ATOM 744   C CA    . LYS A  1 98  ? 36.100  -73.128 27.353  1.00 0.00 ? 104 LYS A CA    1 
ATOM 745   C C     . LYS A  1 98  ? 36.156  -73.790 28.704  1.00 0.00 ? 104 LYS A C     1 
ATOM 746   O O     . LYS A  1 98  ? 35.148  -74.276 29.196  1.00 0.00 ? 104 LYS A O     1 
ATOM 747   C CB    . LYS A  1 98  ? 36.710  -74.022 26.304  1.00 0.00 ? 104 LYS A CB    1 
ATOM 748   C CG    . LYS A  1 98  ? 36.311  -73.684 24.884  1.00 0.00 ? 104 LYS A CG    1 
ATOM 749   C CD    . LYS A  1 98  ? 37.073  -74.537 23.894  1.00 0.00 ? 104 LYS A CD    1 
ATOM 750   C CE    . LYS A  1 98  ? 36.909  -76.012 24.220  1.00 0.00 ? 104 LYS A CE    1 
ATOM 751   N NZ    . LYS A  1 98  ? 37.539  -76.879 23.198  1.00 0.00 ? 104 LYS A NZ    1 
ATOM 752   N N     . GLY A  1 99  ? 37.323  -73.757 29.336  1.00 0.00 ? 105 GLY A N     1 
ATOM 753   C CA    . GLY A  1 99  ? 37.462  -74.328 30.666  1.00 0.00 ? 105 GLY A CA    1 
ATOM 754   C C     . GLY A  1 99  ? 36.467  -73.691 31.625  1.00 0.00 ? 105 GLY A C     1 
ATOM 755   O O     . GLY A  1 99  ? 35.822  -74.381 32.417  1.00 0.00 ? 105 GLY A O     1 
ATOM 756   N N     . TYR A  1 100 ? 36.328  -72.376 31.521  1.00 0.00 ? 106 TYR A N     1 
ATOM 757   C CA    . TYR A  1 100 ? 35.404  -71.624 32.342  1.00 0.00 ? 106 TYR A CA    1 
ATOM 758   C C     . TYR A  1 100 ? 34.000  -72.157 32.209  1.00 0.00 ? 106 TYR A C     1 
ATOM 759   O O     . TYR A  1 100 ? 33.396  -72.550 33.190  1.00 0.00 ? 106 TYR A O     1 
ATOM 760   C CB    . TYR A  1 100 ? 35.454  -70.150 31.942  1.00 0.00 ? 106 TYR A CB    1 
ATOM 761   C CG    . TYR A  1 100 ? 34.546  -69.227 32.696  1.00 0.00 ? 106 TYR A CG    1 
ATOM 762   C CD1   . TYR A  1 100 ? 34.683  -69.054 34.060  1.00 0.00 ? 106 TYR A CD1   1 
ATOM 763   C CD2   . TYR A  1 100 ? 33.617  -68.490 31.996  1.00 0.00 ? 106 TYR A CD2   1 
ATOM 764   C CE1   . TYR A  1 100 ? 33.861  -68.158 34.723  1.00 0.00 ? 106 TYR A CE1   1 
ATOM 765   C CE2   . TYR A  1 100 ? 32.809  -67.592 32.649  1.00 0.00 ? 106 TYR A CE2   1 
ATOM 766   C CZ    . TYR A  1 100 ? 32.922  -67.425 34.007  1.00 0.00 ? 106 TYR A CZ    1 
ATOM 767   O OH    . TYR A  1 100 ? 32.100  -66.525 34.656  1.00 0.00 ? 106 TYR A OH    1 
ATOM 768   N N     . TYR A  1 101 ? 33.489  -72.207 30.995  1.00 0.00 ? 107 TYR A N     1 
ATOM 769   C CA    . TYR A  1 101 ? 32.120  -72.655 30.790  1.00 0.00 ? 107 TYR A CA    1 
ATOM 770   C C     . TYR A  1 101 ? 31.898  -74.126 31.025  1.00 0.00 ? 107 TYR A C     1 
ATOM 771   O O     . TYR A  1 101 ? 30.889  -74.515 31.616  1.00 0.00 ? 107 TYR A O     1 
ATOM 772   C CB    . TYR A  1 101 ? 31.654  -72.285 29.406  1.00 0.00 ? 107 TYR A CB    1 
ATOM 773   C CG    . TYR A  1 101 ? 31.036  -70.935 29.349  1.00 0.00 ? 107 TYR A CG    1 
ATOM 774   C CD1   . TYR A  1 101 ? 31.806  -69.816 29.123  1.00 0.00 ? 107 TYR A CD1   1 
ATOM 775   C CD2   . TYR A  1 101 ? 29.674  -70.820 29.527  1.00 0.00 ? 107 TYR A CD2   1 
ATOM 776   C CE1   . TYR A  1 101 ? 31.209  -68.575 29.083  1.00 0.00 ? 107 TYR A CE1   1 
ATOM 777   C CE2   . TYR A  1 101 ? 29.078  -69.586 29.486  1.00 0.00 ? 107 TYR A CE2   1 
ATOM 778   C CZ    . TYR A  1 101 ? 29.839  -68.468 29.267  1.00 0.00 ? 107 TYR A CZ    1 
ATOM 779   O OH    . TYR A  1 101 ? 29.239  -67.240 29.227  1.00 0.00 ? 107 TYR A OH    1 
ATOM 780   N N     . ILE A  1 102 ? 32.841  -74.945 30.615  1.00 0.00 ? 108 ILE A N     1 
ATOM 781   C CA    . ILE A  1 102 ? 32.689  -76.368 30.764  1.00 0.00 ? 108 ILE A CA    1 
ATOM 782   C C     . ILE A  1 102 ? 32.577  -76.766 32.201  1.00 0.00 ? 108 ILE A C     1 
ATOM 783   O O     . ILE A  1 102 ? 31.730  -77.573 32.560  1.00 0.00 ? 108 ILE A O     1 
ATOM 784   C CB    . ILE A  1 102 ? 33.857  -77.127 30.143  1.00 0.00 ? 108 ILE A CB    1 
ATOM 785   C CG1   . ILE A  1 102 ? 33.840  -76.977 28.635  1.00 0.00 ? 108 ILE A CG1   1 
ATOM 786   C CG2   . ILE A  1 102 ? 33.776  -78.590 30.528  1.00 0.00 ? 108 ILE A CG2   1 
ATOM 787   C CD1   . ILE A  1 102 ? 35.108  -77.445 27.959  1.00 0.00 ? 108 ILE A CD1   1 
ATOM 788   N N     . SER A  1 103 ? 33.453  -76.241 33.030  1.00 0.00 ? 109 SER A N     1 
ATOM 789   C CA    . SER A  1 103 ? 33.487  -76.662 34.408  1.00 0.00 ? 109 SER A CA    1 
ATOM 790   C C     . SER A  1 103 ? 32.691  -75.780 35.360  1.00 0.00 ? 109 SER A C     1 
ATOM 791   O O     . SER A  1 103 ? 32.221  -76.260 36.387  1.00 0.00 ? 109 SER A O     1 
ATOM 792   C CB    . SER A  1 103 ? 34.912  -76.743 34.858  1.00 0.00 ? 109 SER A CB    1 
ATOM 793   O OG    . SER A  1 103 ? 35.519  -75.493 34.787  1.00 0.00 ? 109 SER A OG    1 
ATOM 794   N N     . ALA A  1 104 ? 32.523  -74.501 35.037  1.00 0.00 ? 110 ALA A N     1 
ATOM 795   C CA    . ALA A  1 104 ? 31.771  -73.635 35.941  1.00 0.00 ? 110 ALA A CA    1 
ATOM 796   C C     . ALA A  1 104 ? 30.298  -73.744 35.709  1.00 0.00 ? 110 ALA A C     1 
ATOM 797   O O     . ALA A  1 104 ? 29.530  -73.663 36.658  1.00 0.00 ? 110 ALA A O     1 
ATOM 798   C CB    . ALA A  1 104 ? 32.185  -72.173 35.810  1.00 0.00 ? 110 ALA A CB    1 
ATOM 799   N N     . PHE A  1 105 ? 29.889  -73.913 34.446  1.00 0.00 ? 111 PHE A N     1 
ATOM 800   C CA    . PHE A  1 105 ? 28.474  -73.948 34.116  1.00 0.00 ? 111 PHE A CA    1 
ATOM 801   C C     . PHE A  1 105 ? 28.045  -75.265 33.531  1.00 0.00 ? 111 PHE A C     1 
ATOM 802   O O     . PHE A  1 105 ? 26.899  -75.414 33.115  1.00 0.00 ? 111 PHE A O     1 
ATOM 803   C CB    . PHE A  1 105 ? 28.142  -72.847 33.137  1.00 0.00 ? 111 PHE A CB    1 
ATOM 804   C CG    . PHE A  1 105 ? 28.446  -71.498 33.671  1.00 0.00 ? 111 PHE A CG    1 
ATOM 805   C CD1   . PHE A  1 105 ? 29.451  -70.738 33.122  1.00 0.00 ? 111 PHE A CD1   1 
ATOM 806   C CD2   . PHE A  1 105 ? 27.746  -70.997 34.743  1.00 0.00 ? 111 PHE A CD2   1 
ATOM 807   C CE1   . PHE A  1 105 ? 29.747  -69.498 33.621  1.00 0.00 ? 111 PHE A CE1   1 
ATOM 808   C CE2   . PHE A  1 105 ? 28.037  -69.755 35.250  1.00 0.00 ? 111 PHE A CE2   1 
ATOM 809   C CZ    . PHE A  1 105 ? 29.041  -69.003 34.686  1.00 0.00 ? 111 PHE A CZ    1 
ATOM 810   N N     . ASN A  1 106 ? 28.961  -76.221 33.487  1.00 0.00 ? 112 ASN A N     1 
ATOM 811   C CA    . ASN A  1 106 ? 28.667  -77.541 32.953  1.00 0.00 ? 112 ASN A CA    1 
ATOM 812   C C     . ASN A  1 106 ? 28.230  -77.482 31.503  1.00 0.00 ? 112 ASN A C     1 
ATOM 813   O O     . ASN A  1 106 ? 27.346  -78.229 31.087  1.00 0.00 ? 112 ASN A O     1 
ATOM 814   C CB    . ASN A  1 106 ? 27.624  -78.236 33.793  1.00 0.00 ? 112 ASN A CB    1 
ATOM 815   C CG    . ASN A  1 106 ? 28.103  -78.471 35.188  1.00 0.00 ? 112 ASN A CG    1 
ATOM 816   O OD1   . ASN A  1 106 ? 29.282  -78.760 35.409  1.00 0.00 ? 112 ASN A OD1   1 
ATOM 817   N ND2   . ASN A  1 106 ? 27.214  -78.357 36.138  1.00 0.00 ? 112 ASN A ND2   1 
ATOM 818   N N     . ALA A  1 107 ? 28.847  -76.598 30.728  1.00 0.00 ? 113 ALA A N     1 
ATOM 819   C CA    . ALA A  1 107 ? 28.534  -76.500 29.315  1.00 0.00 ? 113 ALA A CA    1 
ATOM 820   C C     . ALA A  1 107 ? 29.141  -77.682 28.578  1.00 0.00 ? 113 ALA A C     1 
ATOM 821   O O     . ALA A  1 107 ? 30.190  -78.187 28.971  1.00 0.00 ? 113 ALA A O     1 
ATOM 822   C CB    . ALA A  1 107 ? 29.037  -75.196 28.753  1.00 0.00 ? 113 ALA A CB    1 
ATOM 823   N N     . ASN A  1 108 ? 28.469  -78.136 27.523  1.00 0.00 ? 114 ASN A N     1 
ATOM 824   C CA    . ASN A  1 108 ? 28.913  -79.306 26.773  1.00 0.00 ? 114 ASN A CA    1 
ATOM 825   C C     . ASN A  1 108 ? 30.015  -78.979 25.765  1.00 0.00 ? 114 ASN A C     1 
ATOM 826   O O     . ASN A  1 108 ? 29.720  -78.482 24.680  1.00 0.00 ? 114 ASN A O     1 
ATOM 827   C CB    . ASN A  1 108 ? 27.759  -79.939 26.056  1.00 0.00 ? 114 ASN A CB    1 
ATOM 828   C CG    . ASN A  1 108 ? 28.181  -81.156 25.309  1.00 0.00 ? 114 ASN A CG    1 
ATOM 829   O OD1   . ASN A  1 108 ? 29.333  -81.257 24.870  1.00 0.00 ? 114 ASN A OD1   1 
ATOM 830   N ND2   . ASN A  1 108 ? 27.279  -82.091 25.153  1.00 0.00 ? 114 ASN A ND2   1 
ATOM 831   N N     . PRO A  1 109 ? 31.282  -79.281 26.110  1.00 0.00 ? 115 PRO A N     1 
ATOM 832   C CA    . PRO A  1 109 ? 32.494  -79.106 25.284  1.00 0.00 ? 115 PRO A CA    1 
ATOM 833   C C     . PRO A  1 109 ? 32.240  -79.223 23.789  1.00 0.00 ? 115 PRO A C     1 
ATOM 834   O O     . PRO A  1 109 ? 32.740  -78.416 23.006  1.00 0.00 ? 115 PRO A O     1 
ATOM 835   C CB    . PRO A  1 109 ? 33.393  -80.264 25.725  1.00 0.00 ? 115 PRO A CB    1 
ATOM 836   C CG    . PRO A  1 109 ? 32.968  -80.553 27.097  1.00 0.00 ? 115 PRO A CG    1 
ATOM 837   C CD    . PRO A  1 109 ? 31.485  -80.413 27.040  1.00 0.00 ? 115 PRO A CD    1 
ATOM 838   N N     . GLN A  1 110 ? 31.502  -80.251 23.391  1.00 0.00 ? 116 GLN A N     1 
ATOM 839   C CA    . GLN A  1 110 ? 31.271  -80.514 21.986  1.00 0.00 ? 116 GLN A CA    1 
ATOM 840   C C     . GLN A  1 110 ? 30.469  -79.399 21.336  1.00 0.00 ? 116 GLN A C     1 
ATOM 841   O O     . GLN A  1 110 ? 30.781  -78.959 20.227  1.00 0.00 ? 116 GLN A O     1 
ATOM 842   C CB    . GLN A  1 110 ? 30.552  -81.839 21.811  1.00 0.00 ? 116 GLN A CB    1 
ATOM 843   C CG    . GLN A  1 110 ? 30.500  -82.312 20.384  1.00 0.00 ? 116 GLN A CG    1 
ATOM 844   C CD    . GLN A  1 110 ? 29.397  -81.648 19.611  1.00 0.00 ? 116 GLN A CD    1 
ATOM 845   O OE1   . GLN A  1 110 ? 28.322  -81.371 20.151  1.00 0.00 ? 116 GLN A OE1   1 
ATOM 846   N NE2   . GLN A  1 110 ? 29.654  -81.373 18.338  1.00 0.00 ? 116 GLN A NE2   1 
ATOM 847   N N     . VAL A  1 111 ? 29.445  -78.936 22.024  1.00 0.00 ? 117 VAL A N     1 
ATOM 848   C CA    . VAL A  1 111 ? 28.636  -77.868 21.507  1.00 0.00 ? 117 VAL A CA    1 
ATOM 849   C C     . VAL A  1 111 ? 29.426  -76.591 21.509  1.00 0.00 ? 117 VAL A C     1 
ATOM 850   O O     . VAL A  1 111 ? 29.309  -75.784 20.595  1.00 0.00 ? 117 VAL A O     1 
ATOM 851   C CB    . VAL A  1 111 ? 27.364  -77.695 22.323  1.00 0.00 ? 117 VAL A CB    1 
ATOM 852   C CG1   . VAL A  1 111 ? 26.606  -76.468 21.841  1.00 0.00 ? 117 VAL A CG1   1 
ATOM 853   C CG2   . VAL A  1 111 ? 26.510  -78.941 22.198  1.00 0.00 ? 117 VAL A CG2   1 
ATOM 854   N N     . LEU A  1 112 ? 30.248  -76.412 22.536  1.00 0.00 ? 118 LEU A N     1 
ATOM 855   C CA    . LEU A  1 112 ? 31.076  -75.225 22.640  1.00 0.00 ? 118 LEU A CA    1 
ATOM 856   C C     . LEU A  1 112 ? 32.005  -75.118 21.457  1.00 0.00 ? 118 LEU A C     1 
ATOM 857   O O     . LEU A  1 112 ? 32.204  -74.034 20.912  1.00 0.00 ? 118 LEU A O     1 
ATOM 858   C CB    . LEU A  1 112 ? 31.895  -75.266 23.917  1.00 0.00 ? 118 LEU A CB    1 
ATOM 859   C CG    . LEU A  1 112 ? 31.106  -75.134 25.202  1.00 0.00 ? 118 LEU A CG    1 
ATOM 860   C CD1   . LEU A  1 112 ? 32.017  -75.374 26.361  1.00 0.00 ? 118 LEU A CD1   1 
ATOM 861   C CD2   . LEU A  1 112 ? 30.518  -73.761 25.280  1.00 0.00 ? 118 LEU A CD2   1 
ATOM 862   N N     . ASP A  1 113 ? 32.541  -76.250 21.032  1.00 0.00 ? 119 ASP A N     1 
ATOM 863   C CA    . ASP A  1 113 ? 33.393  -76.282 19.872  1.00 0.00 ? 119 ASP A CA    1 
ATOM 864   C C     . ASP A  1 113 ? 32.627  -75.963 18.622  1.00 0.00 ? 119 ASP A C     1 
ATOM 865   O O     . ASP A  1 113 ? 33.150  -75.305 17.729  1.00 0.00 ? 119 ASP A O     1 
ATOM 866   C CB    . ASP A  1 113 ? 34.068  -77.618 19.760  1.00 0.00 ? 119 ASP A CB    1 
ATOM 867   C CG    . ASP A  1 113 ? 35.160  -77.756 20.787  1.00 0.00 ? 119 ASP A CG    1 
ATOM 868   O OD1   . ASP A  1 113 ? 35.627  -76.741 21.250  1.00 0.00 ? 119 ASP A OD1   1 
ATOM 869   O OD2   . ASP A  1 113 ? 35.518  -78.858 21.120  1.00 0.00 ? 119 ASP A OD2   1 
ATOM 870   N N     . ALA A  1 114 ? 31.366  -76.387 18.569  1.00 0.00 ? 120 ALA A N     1 
ATOM 871   C CA    . ALA A  1 114 ? 30.511  -76.044 17.447  1.00 0.00 ? 120 ALA A CA    1 
ATOM 872   C C     . ALA A  1 114 ? 30.322  -74.534 17.359  1.00 0.00 ? 120 ALA A C     1 
ATOM 873   O O     . ALA A  1 114 ? 30.326  -73.972 16.270  1.00 0.00 ? 120 ALA A O     1 
ATOM 874   C CB    . ALA A  1 114 ? 29.169  -76.735 17.565  1.00 0.00 ? 120 ALA A CB    1 
ATOM 875   N N     . VAL A  1 115 ? 30.196  -73.874 18.508  1.00 0.00 ? 121 VAL A N     1 
ATOM 876   C CA    . VAL A  1 115 ? 30.068  -72.425 18.527  1.00 0.00 ? 121 VAL A CA    1 
ATOM 877   C C     . VAL A  1 115 ? 31.324  -71.766 18.004  1.00 0.00 ? 121 VAL A C     1 
ATOM 878   O O     . VAL A  1 115 ? 31.255  -70.888 17.145  1.00 0.00 ? 121 VAL A O     1 
ATOM 879   C CB    . VAL A  1 115 ? 29.787  -71.911 19.941  1.00 0.00 ? 121 VAL A CB    1 
ATOM 880   C CG1   . VAL A  1 115 ? 29.864  -70.401 19.958  1.00 0.00 ? 121 VAL A CG1   1 
ATOM 881   C CG2   . VAL A  1 115 ? 28.416  -72.378 20.402  1.00 0.00 ? 121 VAL A CG2   1 
ATOM 882   N N     . VAL A  1 116 ? 32.475  -72.220 18.485  1.00 0.00 ? 122 VAL A N     1 
ATOM 883   C CA    . VAL A  1 116 ? 33.756  -71.683 18.041  1.00 0.00 ? 122 VAL A CA    1 
ATOM 884   C C     . VAL A  1 116 ? 33.931  -71.902 16.538  1.00 0.00 ? 122 VAL A C     1 
ATOM 885   O O     . VAL A  1 116 ? 34.367  -71.006 15.809  1.00 0.00 ? 122 VAL A O     1 
ATOM 886   C CB    . VAL A  1 116 ? 34.915  -72.347 18.808  1.00 0.00 ? 122 VAL A CB    1 
ATOM 887   C CG1   . VAL A  1 116 ? 36.237  -71.933 18.224  1.00 0.00 ? 122 VAL A CG1   1 
ATOM 888   C CG2   . VAL A  1 116 ? 34.850  -71.965 20.263  1.00 0.00 ? 122 VAL A CG2   1 
ATOM 889   N N     . ASN A  1 117 ? 33.507  -73.076 16.067  1.00 0.00 ? 123 ASN A N     1 
ATOM 890   C CA    . ASN A  1 117 ? 33.563  -73.432 14.655  1.00 0.00 ? 123 ASN A CA    1 
ATOM 891   C C     . ASN A  1 117 ? 32.817  -72.465 13.744  1.00 0.00 ? 123 ASN A C     1 
ATOM 892   O O     . ASN A  1 117 ? 32.985  -72.508 12.529  1.00 0.00 ? 123 ASN A O     1 
ATOM 893   C CB    . ASN A  1 117 ? 33.036  -74.822 14.431  1.00 0.00 ? 123 ASN A CB    1 
ATOM 894   C CG    . ASN A  1 117 ? 33.238  -75.271 13.014  1.00 0.00 ? 123 ASN A CG    1 
ATOM 895   O OD1   . ASN A  1 117 ? 34.365  -75.532 12.586  1.00 0.00 ? 123 ASN A OD1   1 
ATOM 896   N ND2   . ASN A  1 117 ? 32.166  -75.345 12.266  1.00 0.00 ? 123 ASN A ND2   1 
ATOM 897   N N     . ILE A  1 118 ? 31.967  -71.628 14.308  1.00 0.00 ? 124 ILE A N     1 
ATOM 898   C CA    . ILE A  1 118 ? 31.261  -70.660 13.528  1.00 0.00 ? 124 ILE A CA    1 
ATOM 899   C C     . ILE A  1 118 ? 31.922  -69.326 13.601  1.00 0.00 ? 124 ILE A C     1 
ATOM 900   O O     . ILE A  1 118 ? 32.193  -68.697 12.580  1.00 0.00 ? 124 ILE A O     1 
ATOM 901   C CB    . ILE A  1 118 ? 29.849  -70.522 14.006  1.00 0.00 ? 124 ILE A CB    1 
ATOM 902   C CG1   . ILE A  1 118 ? 29.151  -71.844 13.904  1.00 0.00 ? 124 ILE A CG1   1 
ATOM 903   C CG2   . ILE A  1 118 ? 29.130  -69.468 13.219  1.00 0.00 ? 124 ILE A CG2   1 
ATOM 904   C CD1   . ILE A  1 118 ? 29.141  -72.416 12.512  1.00 0.00 ? 124 ILE A CD1   1 
ATOM 905   N N     . ILE A  1 119 ? 32.171  -68.878 14.812  1.00 0.00 ? 125 ILE A N     1 
ATOM 906   C CA    . ILE A  1 119 ? 32.733  -67.565 15.035  1.00 0.00 ? 125 ILE A CA    1 
ATOM 907   C C     . ILE A  1 119 ? 34.134  -67.454 14.475  1.00 0.00 ? 125 ILE A C     1 
ATOM 908   O O     . ILE A  1 119 ? 34.469  -66.475 13.811  1.00 0.00 ? 125 ILE A O     1 
ATOM 909   C CB    . ILE A  1 119 ? 32.745  -67.242 16.512  1.00 0.00 ? 125 ILE A CB    1 
ATOM 910   C CG1   . ILE A  1 119 ? 31.324  -67.116 17.012  1.00 0.00 ? 125 ILE A CG1   1 
ATOM 911   C CG2   . ILE A  1 119 ? 33.509  -65.958 16.756  1.00 0.00 ? 125 ILE A CG2   1 
ATOM 912   C CD1   . ILE A  1 119 ? 31.229  -67.089 18.500  1.00 0.00 ? 125 ILE A CD1   1 
ATOM 913   N N     . THR A  1 120 ? 34.958  -68.453 14.745  1.00 0.00 ? 126 THR A N     1 
ATOM 914   C CA    . THR A  1 120 ? 36.316  -68.462 14.244  1.00 0.00 ? 126 THR A CA    1 
ATOM 915   C C     . THR A  1 120 ? 36.389  -69.210 12.947  1.00 0.00 ? 126 THR A C     1 
ATOM 916   O O     . THR A  1 120 ? 37.213  -68.909 12.087  1.00 0.00 ? 126 THR A O     1 
ATOM 917   C CB    . THR A  1 120 ? 37.240  -69.150 15.206  1.00 0.00 ? 126 THR A CB    1 
ATOM 918   O OG1   . THR A  1 120 ? 36.837  -70.514 15.299  1.00 0.00 ? 126 THR A OG1   1 
ATOM 919   C CG2   . THR A  1 120 ? 37.162  -68.504 16.579  1.00 0.00 ? 126 THR A CG2   1 
ATOM 920   N N     . GLY A  1 121 ? 35.507  -70.185 12.796  1.00 0.00 ? 127 GLY A N     1 
ATOM 921   C CA    . GLY A  1 121 ? 35.472  -70.996 11.592  1.00 0.00 ? 127 GLY A CA    1 
ATOM 922   C C     . GLY A  1 121 ? 36.010  -72.382 11.866  1.00 0.00 ? 127 GLY A C     1 
ATOM 923   O O     . GLY A  1 121 ? 35.860  -73.287 11.047  1.00 0.00 ? 127 GLY A O     1 
ATOM 924   N N     . SER A  1 122 ? 36.634  -72.549 13.026  1.00 0.00 ? 128 SER A N     1 
ATOM 925   C CA    . SER A  1 122 ? 37.177  -73.828 13.432  1.00 0.00 ? 128 SER A CA    1 
ATOM 926   C C     . SER A  1 122 ? 37.449  -73.808 14.912  1.00 0.00 ? 128 SER A C     1 
ATOM 927   O O     . SER A  1 122 ? 37.621  -72.743 15.492  1.00 0.00 ? 128 SER A O     1 
ATOM 928   C CB    . SER A  1 122 ? 38.469  -74.105 12.699  1.00 0.00 ? 128 SER A CB    1 
ATOM 929   O OG    . SER A  1 122 ? 39.478  -73.241 13.145  1.00 0.00 ? 128 SER A OG    1 
ATOM 930   N N     . PRO A  1 123 ? 37.571  -74.971 15.526  1.00 0.00 ? 129 PRO A N     1 
ATOM 931   C CA    . PRO A  1 123 ? 37.956  -75.158 16.902  1.00 0.00 ? 129 PRO A CA    1 
ATOM 932   C C     . PRO A  1 123 ? 39.331  -74.564 17.092  1.00 0.00 ? 129 PRO A C     1 
ATOM 933   O O     . PRO A  1 123 ? 40.074  -74.388 16.126  1.00 0.00 ? 129 PRO A O     1 
ATOM 934   C CB    . PRO A  1 123 ? 37.886  -76.658 17.092  1.00 0.00 ? 129 PRO A CB    1 
ATOM 935   C CG    . PRO A  1 123 ? 36.776  -77.083 16.179  1.00 0.00 ? 129 PRO A CG    1 
ATOM 936   C CD    . PRO A  1 123 ? 36.802  -76.113 15.025  1.00 0.00 ? 129 PRO A CD    1 
ATOM 937   N N     . THR A  1 124 ? 39.668  -74.218 18.315  1.00 0.00 ? 130 THR A N     1 
ATOM 938   C CA    . THR A  1 124 ? 40.896  -73.495 18.537  1.00 0.00 ? 130 THR A CA    1 
ATOM 939   C C     . THR A  1 124 ? 42.081  -74.415 18.718  1.00 0.00 ? 130 THR A C     1 
ATOM 940   O O     . THR A  1 124 ? 42.173  -75.448 18.062  1.00 0.00 ? 130 THR A O     1 
ATOM 941   C CB    . THR A  1 124 ? 40.755  -72.577 19.756  1.00 0.00 ? 130 THR A CB    1 
ATOM 942   O OG1   . THR A  1 124 ? 41.950  -71.812 19.913  1.00 0.00 ? 130 THR A OG1   1 
ATOM 943   C CG2   . THR A  1 124 ? 40.468  -73.378 21.031  1.00 0.00 ? 130 THR A CG2   1 
ATOM 944   N N     . GLY A  1 125 ? 43.016  -74.031 19.583  1.00 0.00 ? 131 GLY A N     1 
ATOM 945   C CA    . GLY A  1 125 ? 44.238  -74.815 19.778  1.00 0.00 ? 131 GLY A CA    1 
ATOM 946   C C     . GLY A  1 125 ? 45.238  -74.494 18.670  1.00 0.00 ? 131 GLY A C     1 
ATOM 947   O O     . GLY A  1 125 ? 46.315  -73.953 18.919  1.00 0.00 ? 131 GLY A O     1 
ATOM 948   N N     . TYR A  1 126 ? 44.853  -74.816 17.447  1.00 0.00 ? 132 TYR A N     1 
ATOM 949   C CA    . TYR A  1 126 ? 45.636  -74.517 16.285  1.00 0.00 ? 132 TYR A CA    1 
ATOM 950   C C     . TYR A  1 126 ? 45.029  -73.327 15.575  1.00 0.00 ? 132 TYR A C     1 
ATOM 951   O O     . TYR A  1 126 ? 43.812  -73.161 15.562  1.00 0.00 ? 132 TYR A O     1 
ATOM 952   C CB    . TYR A  1 126 ? 45.665  -75.724 15.363  1.00 0.00 ? 132 TYR A CB    1 
ATOM 953   C CG    . TYR A  1 126 ? 46.252  -76.942 16.024  1.00 0.00 ? 132 TYR A CG    1 
ATOM 954   C CD1   . TYR A  1 126 ? 45.423  -77.789 16.743  1.00 0.00 ? 132 TYR A CD1   1 
ATOM 955   C CD2   . TYR A  1 126 ? 47.606  -77.210 15.931  1.00 0.00 ? 132 TYR A CD2   1 
ATOM 956   C CE1   . TYR A  1 126 ? 45.944  -78.900 17.364  1.00 0.00 ? 132 TYR A CE1   1 
ATOM 957   C CE2   . TYR A  1 126 ? 48.128  -78.325 16.553  1.00 0.00 ? 132 TYR A CE2   1 
ATOM 958   C CZ    . TYR A  1 126 ? 47.300  -79.168 17.268  1.00 0.00 ? 132 TYR A CZ    1 
ATOM 959   O OH    . TYR A  1 126 ? 47.817  -80.279 17.886  1.00 0.00 ? 132 TYR A OH    1 
ATOM 960   N N     . VAL A  1 127 ? 45.866  -72.504 14.981  1.00 0.00 ? 133 VAL A N     1 
ATOM 961   C CA    . VAL A  1 127 ? 45.373  -71.353 14.253  1.00 0.00 ? 133 VAL A CA    1 
ATOM 962   C C     . VAL A  1 127 ? 45.086  -71.723 12.810  1.00 0.00 ? 133 VAL A C     1 
ATOM 963   O O     . VAL A  1 127 ? 45.996  -72.066 12.056  1.00 0.00 ? 133 VAL A O     1 
ATOM 964   C CB    . VAL A  1 127 ? 46.394  -70.197 14.303  1.00 0.00 ? 133 VAL A CB    1 
ATOM 965   C CG1   . VAL A  1 127 ? 45.886  -69.012 13.493  1.00 0.00 ? 133 VAL A CG1   1 
ATOM 966   C CG2   . VAL A  1 127 ? 46.637  -69.787 15.747  1.00 0.00 ? 133 VAL A CG2   1 
ATOM 967   N N     . SER A  1 128 ? 43.825  -71.654 12.430  1.00 0.00 ? 134 SER A N     1 
ATOM 968   C CA    . SER A  1 128 ? 43.427  -71.980 11.073  1.00 0.00 ? 134 SER A CA    1 
ATOM 969   C C     . SER A  1 128 ? 41.977  -71.579 10.828  1.00 0.00 ? 134 SER A C     1 
ATOM 970   O O     . SER A  1 128 ? 41.710  -70.545 10.215  1.00 0.00 ? 134 SER A O     1 
ATOM 971   C CB    . SER A  1 128 ? 43.616  -73.471 10.817  1.00 0.00 ? 134 SER A CB    1 
ATOM 972   O OG    . SER A  1 128 ? 43.231  -73.814 9.514   1.00 0.00 ? 134 SER A OG    1 
ATOM 973   O OXT   . SER A  1 128 ? 41.078  -72.200 11.390  1.00 0.00 ? 134 SER A OXT   1 
ATOM 974   N N     . SER B  1 1   ? 13.205  -62.038 19.835  1.00 0.00 ? 7   SER B N     1 
ATOM 975   C CA    . SER B  1 1   ? 13.650  -62.216 18.457  1.00 0.00 ? 7   SER B CA    1 
ATOM 976   C C     . SER B  1 1   ? 13.736  -60.890 17.726  1.00 0.00 ? 7   SER B C     1 
ATOM 977   O O     . SER B  1 1   ? 12.725  -60.365 17.265  1.00 0.00 ? 7   SER B O     1 
ATOM 978   C CB    . SER B  1 1   ? 12.713  -63.128 17.723  1.00 0.00 ? 7   SER B CB    1 
ATOM 979   O OG    . SER B  1 1   ? 13.091  -63.242 16.384  1.00 0.00 ? 7   SER B OG    1 
ATOM 980   N N     . ARG B  1 2   ? 14.948  -60.348 17.625  1.00 0.00 ? 8   ARG B N     1 
ATOM 981   C CA    . ARG B  1 2   ? 15.153  -59.057 16.955  1.00 0.00 ? 8   ARG B CA    1 
ATOM 982   C C     . ARG B  1 2   ? 16.456  -59.012 16.171  1.00 0.00 ? 8   ARG B C     1 
ATOM 983   O O     . ARG B  1 2   ? 17.470  -59.550 16.611  1.00 0.00 ? 8   ARG B O     1 
ATOM 984   C CB    . ARG B  1 2   ? 15.195  -57.929 17.969  1.00 0.00 ? 8   ARG B CB    1 
ATOM 985   C CG    . ARG B  1 2   ? 13.933  -57.709 18.793  1.00 0.00 ? 8   ARG B CG    1 
ATOM 986   C CD    . ARG B  1 2   ? 12.816  -57.157 18.004  1.00 0.00 ? 8   ARG B CD    1 
ATOM 987   N NE    . ARG B  1 2   ? 11.692  -56.829 18.860  1.00 0.00 ? 8   ARG B NE    1 
ATOM 988   C CZ    . ARG B  1 2   ? 10.755  -57.700 19.265  1.00 0.00 ? 8   ARG B CZ    1 
ATOM 989   N NH1   . ARG B  1 2   ? 10.805  -58.950 18.868  1.00 0.00 ? 8   ARG B NH1   1 
ATOM 990   N NH2   . ARG B  1 2   ? 9.777   -57.304 20.068  1.00 0.00 ? 8   ARG B NH2   1 
ATOM 991   N N     . SER B  1 3   ? 16.435  -58.320 15.037  1.00 0.00 ? 9   SER B N     1 
ATOM 992   C CA    . SER B  1 3   ? 17.638  -58.063 14.249  1.00 0.00 ? 9   SER B CA    1 
ATOM 993   C C     . SER B  1 3   ? 18.402  -56.949 14.887  1.00 0.00 ? 9   SER B C     1 
ATOM 994   O O     . SER B  1 3   ? 17.887  -56.288 15.779  1.00 0.00 ? 9   SER B O     1 
ATOM 995   C CB    . SER B  1 3   ? 17.274  -57.666 12.853  1.00 0.00 ? 9   SER B CB    1 
ATOM 996   O OG    . SER B  1 3   ? 16.616  -56.426 12.857  1.00 0.00 ? 9   SER B OG    1 
ATOM 997   N N     . TYR B  1 4   ? 19.610  -56.677 14.412  1.00 0.00 ? 10  TYR B N     1 
ATOM 998   C CA    . TYR B  1 4   ? 20.362  -55.613 15.036  1.00 0.00 ? 10  TYR B CA    1 
ATOM 999   C C     . TYR B  1 4   ? 19.722  -54.304 14.707  1.00 0.00 ? 10  TYR B C     1 
ATOM 1000  O O     . TYR B  1 4   ? 19.843  -53.346 15.457  1.00 0.00 ? 10  TYR B O     1 
ATOM 1001  C CB    . TYR B  1 4   ? 21.806  -55.527 14.570  1.00 0.00 ? 10  TYR B CB    1 
ATOM 1002  C CG    . TYR B  1 4   ? 22.031  -54.316 13.721  1.00 0.00 ? 10  TYR B CG    1 
ATOM 1003  C CD1   . TYR B  1 4   ? 22.190  -53.088 14.353  1.00 0.00 ? 10  TYR B CD1   1 
ATOM 1004  C CD2   . TYR B  1 4   ? 22.051  -54.396 12.347  1.00 0.00 ? 10  TYR B CD2   1 
ATOM 1005  C CE1   . TYR B  1 4   ? 22.348  -51.943 13.610  1.00 0.00 ? 10  TYR B CE1   1 
ATOM 1006  C CE2   . TYR B  1 4   ? 22.214  -53.248 11.599  1.00 0.00 ? 10  TYR B CE2   1 
ATOM 1007  C CZ    . TYR B  1 4   ? 22.355  -52.022 12.227  1.00 0.00 ? 10  TYR B CZ    1 
ATOM 1008  O OH    . TYR B  1 4   ? 22.503  -50.873 11.478  1.00 0.00 ? 10  TYR B OH    1 
ATOM 1009  N N     . SER B  1 5   ? 19.056  -54.238 13.558  1.00 0.00 ? 11  SER B N     1 
ATOM 1010  C CA    . SER B  1 5   ? 18.451  -53.009 13.136  1.00 0.00 ? 11  SER B CA    1 
ATOM 1011  C C     . SER B  1 5   ? 17.338  -52.639 14.060  1.00 0.00 ? 11  SER B C     1 
ATOM 1012  O O     . SER B  1 5   ? 17.132  -51.466 14.360  1.00 0.00 ? 11  SER B O     1 
ATOM 1013  C CB    . SER B  1 5   ? 17.928  -53.149 11.740  1.00 0.00 ? 11  SER B CB    1 
ATOM 1014  O OG    . SER B  1 5   ? 16.835  -54.026 11.703  1.00 0.00 ? 11  SER B OG    1 
ATOM 1015  N N     . GLN B  1 6   ? 16.659  -53.646 14.576  1.00 0.00 ? 12  GLN B N     1 
ATOM 1016  C CA    . GLN B  1 6   ? 15.618  -53.440 15.548  1.00 0.00 ? 12  GLN B CA    1 
ATOM 1017  C C     . GLN B  1 6   ? 16.199  -53.113 16.896  1.00 0.00 ? 12  GLN B C     1 
ATOM 1018  O O     . GLN B  1 6   ? 15.698  -52.235 17.594  1.00 0.00 ? 12  GLN B O     1 
ATOM 1019  C CB    . GLN B  1 6   ? 14.749  -54.658 15.625  1.00 0.00 ? 12  GLN B CB    1 
ATOM 1020  C CG    . GLN B  1 6   ? 13.903  -54.857 14.398  1.00 0.00 ? 12  GLN B CG    1 
ATOM 1021  C CD    . GLN B  1 6   ? 13.315  -56.231 14.327  1.00 0.00 ? 12  GLN B CD    1 
ATOM 1022  O OE1   . GLN B  1 6   ? 14.042  -57.193 14.061  1.00 0.00 ? 12  GLN B OE1   1 
ATOM 1023  N NE2   . GLN B  1 6   ? 12.013  -56.352 14.568  1.00 0.00 ? 12  GLN B NE2   1 
ATOM 1024  N N     . ARG B  1 7   ? 17.285  -53.793 17.247  1.00 0.00 ? 13  ARG B N     1 
ATOM 1025  C CA    . ARG B  1 7   ? 17.952  -53.541 18.507  1.00 0.00 ? 13  ARG B CA    1 
ATOM 1026  C C     . ARG B  1 7   ? 18.393  -52.109 18.578  1.00 0.00 ? 13  ARG B C     1 
ATOM 1027  O O     . ARG B  1 7   ? 18.145  -51.421 19.564  1.00 0.00 ? 13  ARG B O     1 
ATOM 1028  C CB    . ARG B  1 7   ? 19.166  -54.440 18.658  1.00 0.00 ? 13  ARG B CB    1 
ATOM 1029  C CG    . ARG B  1 7   ? 18.847  -55.907 18.849  1.00 0.00 ? 13  ARG B CG    1 
ATOM 1030  C CD    . ARG B  1 7   ? 20.073  -56.748 18.867  1.00 0.00 ? 13  ARG B CD    1 
ATOM 1031  N NE    . ARG B  1 7   ? 20.854  -56.529 20.066  1.00 0.00 ? 13  ARG B NE    1 
ATOM 1032  C CZ    . ARG B  1 7   ? 22.130  -56.917 20.239  1.00 0.00 ? 13  ARG B CZ    1 
ATOM 1033  N NH1   . ARG B  1 7   ? 22.783  -57.528 19.275  1.00 0.00 ? 13  ARG B NH1   1 
ATOM 1034  N NH2   . ARG B  1 7   ? 22.732  -56.681 21.389  1.00 0.00 ? 13  ARG B NH2   1 
ATOM 1035  N N     . TYR B  1 8   ? 19.020  -51.656 17.510  1.00 0.00 ? 14  TYR B N     1 
ATOM 1036  C CA    . TYR B  1 8   ? 19.476  -50.299 17.404  1.00 0.00 ? 14  TYR B CA    1 
ATOM 1037  C C     . TYR B  1 8   ? 18.356  -49.330 17.392  1.00 0.00 ? 14  TYR B C     1 
ATOM 1038  O O     . TYR B  1 8   ? 18.389  -48.351 18.122  1.00 0.00 ? 14  TYR B O     1 
ATOM 1039  C CB    . TYR B  1 8   ? 20.316  -50.108 16.176  1.00 0.00 ? 14  TYR B CB    1 
ATOM 1040  C CG    . TYR B  1 8   ? 20.606  -48.669 15.923  1.00 0.00 ? 14  TYR B CG    1 
ATOM 1041  C CD1   . TYR B  1 8   ? 21.290  -47.929 16.857  1.00 0.00 ? 14  TYR B CD1   1 
ATOM 1042  C CD2   . TYR B  1 8   ? 20.171  -48.083 14.754  1.00 0.00 ? 14  TYR B CD2   1 
ATOM 1043  C CE1   . TYR B  1 8   ? 21.530  -46.599 16.633  1.00 0.00 ? 14  TYR B CE1   1 
ATOM 1044  C CE2   . TYR B  1 8   ? 20.411  -46.752 14.526  1.00 0.00 ? 14  TYR B CE2   1 
ATOM 1045  C CZ    . TYR B  1 8   ? 21.081  -46.009 15.464  1.00 0.00 ? 14  TYR B CZ    1 
ATOM 1046  O OH    . TYR B  1 8   ? 21.293  -44.672 15.253  1.00 0.00 ? 14  TYR B OH    1 
ATOM 1047  N N     . ALA B  1 9   ? 17.368  -49.562 16.546  1.00 0.00 ? 15  ALA B N     1 
ATOM 1048  C CA    . ALA B  1 9   ? 16.256  -48.644 16.422  1.00 0.00 ? 15  ALA B CA    1 
ATOM 1049  C C     . ALA B  1 9   ? 15.680  -48.292 17.771  1.00 0.00 ? 15  ALA B C     1 
ATOM 1050  O O     . ALA B  1 9   ? 15.545  -47.113 18.107  1.00 0.00 ? 15  ALA B O     1 
ATOM 1051  C CB    . ALA B  1 9   ? 15.176  -49.240 15.546  1.00 0.00 ? 15  ALA B CB    1 
ATOM 1052  N N     . LYS B  1 10  ? 15.341  -49.304 18.552  1.00 0.00 ? 16  LYS B N     1 
ATOM 1053  C CA    . LYS B  1 10  ? 14.744  -49.054 19.833  1.00 0.00 ? 16  LYS B CA    1 
ATOM 1054  C C     . LYS B  1 10  ? 15.737  -48.451 20.791  1.00 0.00 ? 16  LYS B C     1 
ATOM 1055  O O     . LYS B  1 10  ? 15.395  -47.549 21.547  1.00 0.00 ? 16  LYS B O     1 
ATOM 1056  C CB    . LYS B  1 10  ? 14.159  -50.301 20.425  1.00 0.00 ? 16  LYS B CB    1 
ATOM 1057  C CG    . LYS B  1 10  ? 13.366  -50.020 21.672  1.00 0.00 ? 16  LYS B CG    1 
ATOM 1058  C CD    . LYS B  1 10  ? 12.698  -51.253 22.212  1.00 0.00 ? 16  LYS B CD    1 
ATOM 1059  C CE    . LYS B  1 10  ? 11.824  -50.886 23.389  1.00 0.00 ? 16  LYS B CE    1 
ATOM 1060  N NZ    . LYS B  1 10  ? 11.277  -52.073 24.089  1.00 0.00 ? 16  LYS B NZ    1 
ATOM 1061  N N     . TRP B  1 11  ? 16.975  -48.933 20.757  1.00 0.00 ? 17  TRP B N     1 
ATOM 1062  C CA    . TRP B  1 11  ? 18.011  -48.381 21.610  1.00 0.00 ? 17  TRP B CA    1 
ATOM 1063  C C     . TRP B  1 11  ? 18.163  -46.912 21.392  1.00 0.00 ? 17  TRP B C     1 
ATOM 1064  O O     . TRP B  1 11  ? 18.351  -46.156 22.338  1.00 0.00 ? 17  TRP B O     1 
ATOM 1065  C CB    . TRP B  1 11  ? 19.343  -49.045 21.362  1.00 0.00 ? 17  TRP B CB    1 
ATOM 1066  C CG    . TRP B  1 11  ? 20.440  -48.409 22.142  1.00 0.00 ? 17  TRP B CG    1 
ATOM 1067  C CD1   . TRP B  1 11  ? 20.797  -48.691 23.420  1.00 0.00 ? 17  TRP B CD1   1 
ATOM 1068  C CD2   . TRP B  1 11  ? 21.336  -47.364 21.699  1.00 0.00 ? 17  TRP B CD2   1 
ATOM 1069  N NE1   . TRP B  1 11  ? 21.848  -47.901 23.804  1.00 0.00 ? 17  TRP B NE1   1 
ATOM 1070  C CE2   . TRP B  1 11  ? 22.192  -47.083 22.762  1.00 0.00 ? 17  TRP B CE2   1 
ATOM 1071  C CE3   . TRP B  1 11  ? 21.482  -46.662 20.502  1.00 0.00 ? 17  TRP B CE3   1 
ATOM 1072  C CZ2   . TRP B  1 11  ? 23.188  -46.126 22.668  1.00 0.00 ? 17  TRP B CZ2   1 
ATOM 1073  C CZ3   . TRP B  1 11  ? 22.482  -45.705 20.407  1.00 0.00 ? 17  TRP B CZ3   1 
ATOM 1074  C CH2   . TRP B  1 11  ? 23.313  -45.443 21.461  1.00 0.00 ? 17  TRP B CH2   1 
ATOM 1075  N N     . GLN B  1 12  ? 18.116  -46.503 20.140  1.00 0.00 ? 18  GLN B N     1 
ATOM 1076  C CA    . GLN B  1 12  ? 18.251  -45.124 19.796  1.00 0.00 ? 18  GLN B CA    1 
ATOM 1077  C C     . GLN B  1 12  ? 17.134  -44.314 20.364  1.00 0.00 ? 18  GLN B C     1 
ATOM 1078  O O     . GLN B  1 12  ? 17.360  -43.259 20.947  1.00 0.00 ? 18  GLN B O     1 
ATOM 1079  C CB    . GLN B  1 12  ? 18.257  -44.958 18.297  1.00 0.00 ? 18  GLN B CB    1 
ATOM 1080  C CG    . GLN B  1 12  ? 18.488  -43.546 17.862  1.00 0.00 ? 18  GLN B CG    1 
ATOM 1081  C CD    . GLN B  1 12  ? 19.864  -43.107 18.202  1.00 0.00 ? 18  GLN B CD    1 
ATOM 1082  O OE1   . GLN B  1 12  ? 20.826  -43.660 17.671  1.00 0.00 ? 18  GLN B OE1   1 
ATOM 1083  N NE2   . GLN B  1 12  ? 19.997  -42.125 19.084  1.00 0.00 ? 18  GLN B NE2   1 
ATOM 1084  N N     . ALA B  1 13  ? 15.920  -44.814 20.219  1.00 0.00 ? 19  ALA B N     1 
ATOM 1085  C CA    . ALA B  1 13  ? 14.755  -44.112 20.711  1.00 0.00 ? 19  ALA B CA    1 
ATOM 1086  C C     . ALA B  1 13  ? 14.820  -43.919 22.203  1.00 0.00 ? 19  ALA B C     1 
ATOM 1087  O O     . ALA B  1 13  ? 14.477  -42.853 22.711  1.00 0.00 ? 19  ALA B O     1 
ATOM 1088  C CB    . ALA B  1 13  ? 13.504  -44.866 20.339  1.00 0.00 ? 19  ALA B CB    1 
ATOM 1089  N N     . LYS B  1 14  ? 15.279  -44.935 22.910  1.00 0.00 ? 20  LYS B N     1 
ATOM 1090  C CA    . LYS B  1 14  ? 15.344  -44.866 24.345  1.00 0.00 ? 20  LYS B CA    1 
ATOM 1091  C C     . LYS B  1 14  ? 16.478  -44.023 24.815  1.00 0.00 ? 20  LYS B C     1 
ATOM 1092  O O     . LYS B  1 14  ? 16.356  -43.331 25.820  1.00 0.00 ? 20  LYS B O     1 
ATOM 1093  C CB    . LYS B  1 14  ? 15.448  -46.245 24.928  1.00 0.00 ? 20  LYS B CB    1 
ATOM 1094  C CG    . LYS B  1 14  ? 14.216  -47.074 24.701  1.00 0.00 ? 20  LYS B CG    1 
ATOM 1095  C CD    . LYS B  1 14  ? 13.027  -46.424 25.363  1.00 0.00 ? 20  LYS B CD    1 
ATOM 1096  C CE    . LYS B  1 14  ? 13.066  -46.585 26.869  1.00 0.00 ? 20  LYS B CE    1 
ATOM 1097  N NZ    . LYS B  1 14  ? 12.567  -47.916 27.289  1.00 0.00 ? 20  LYS B NZ    1 
ATOM 1098  N N     . PHE B  1 15  ? 17.577  -44.038 24.081  1.00 0.00 ? 21  PHE B N     1 
ATOM 1099  C CA    . PHE B  1 15  ? 18.691  -43.193 24.427  1.00 0.00 ? 21  PHE B CA    1 
ATOM 1100  C C     . PHE B  1 15  ? 18.277  -41.747 24.304  1.00 0.00 ? 21  PHE B C     1 
ATOM 1101  O O     . PHE B  1 15  ? 18.555  -40.935 25.185  1.00 0.00 ? 21  PHE B O     1 
ATOM 1102  C CB    . PHE B  1 15  ? 19.887  -43.456 23.542  1.00 0.00 ? 21  PHE B CB    1 
ATOM 1103  C CG    . PHE B  1 15  ? 21.080  -42.682 23.974  1.00 0.00 ? 21  PHE B CG    1 
ATOM 1104  C CD1   . PHE B  1 15  ? 21.931  -43.186 24.942  1.00 0.00 ? 21  PHE B CD1   1 
ATOM 1105  C CD2   . PHE B  1 15  ? 21.332  -41.428 23.464  1.00 0.00 ? 21  PHE B CD2   1 
ATOM 1106  C CE1   . PHE B  1 15  ? 23.019  -42.457 25.378  1.00 0.00 ? 21  PHE B CE1   1 
ATOM 1107  C CE2   . PHE B  1 15  ? 22.417  -40.694 23.904  1.00 0.00 ? 21  PHE B CE2   1 
ATOM 1108  C CZ    . PHE B  1 15  ? 23.262  -41.210 24.860  1.00 0.00 ? 21  PHE B CZ    1 
ATOM 1109  N N     . ASN B  1 16  ? 17.599  -41.430 23.203  1.00 0.00 ? 22  ASN B N     1 
ATOM 1110  C CA    . ASN B  1 16  ? 17.122  -40.090 22.961  1.00 0.00 ? 22  ASN B CA    1 
ATOM 1111  C C     . ASN B  1 16  ? 16.231  -39.637 24.080  1.00 0.00 ? 22  ASN B C     1 
ATOM 1112  O O     . ASN B  1 16  ? 16.408  -38.552 24.629  1.00 0.00 ? 22  ASN B O     1 
ATOM 1113  C CB    . ASN B  1 16  ? 16.350  -40.030 21.670  1.00 0.00 ? 22  ASN B CB    1 
ATOM 1114  C CG    . ASN B  1 16  ? 17.205  -40.230 20.477  1.00 0.00 ? 22  ASN B CG    1 
ATOM 1115  O OD1   . ASN B  1 16  ? 18.435  -40.221 20.565  1.00 0.00 ? 22  ASN B OD1   1 
ATOM 1116  N ND2   . ASN B  1 16  ? 16.583  -40.414 19.346  1.00 0.00 ? 22  ASN B ND2   1 
ATOM 1117  N N     . ALA B  1 17  ? 15.285  -40.494 24.450  1.00 0.00 ? 23  ALA B N     1 
ATOM 1118  C CA    . ALA B  1 17  ? 14.354  -40.181 25.504  1.00 0.00 ? 23  ALA B CA    1 
ATOM 1119  C C     . ALA B  1 17  ? 15.077  -39.840 26.777  1.00 0.00 ? 23  ALA B C     1 
ATOM 1120  O O     . ALA B  1 17  ? 14.838  -38.794 27.372  1.00 0.00 ? 23  ALA B O     1 
ATOM 1121  C CB    . ALA B  1 17  ? 13.417  -41.348 25.736  1.00 0.00 ? 23  ALA B CB    1 
ATOM 1122  N N     . PHE B  1 18  ? 15.988  -40.707 27.185  1.00 0.00 ? 24  PHE B N     1 
ATOM 1123  C CA    . PHE B  1 18  ? 16.712  -40.514 28.416  1.00 0.00 ? 24  PHE B CA    1 
ATOM 1124  C C     . PHE B  1 18  ? 17.492  -39.232 28.442  1.00 0.00 ? 24  PHE B C     1 
ATOM 1125  O O     . PHE B  1 18  ? 17.576  -38.587 29.477  1.00 0.00 ? 24  PHE B O     1 
ATOM 1126  C CB    . PHE B  1 18  ? 17.623  -41.672 28.700  1.00 0.00 ? 24  PHE B CB    1 
ATOM 1127  C CG    . PHE B  1 18  ? 18.354  -41.518 29.996  1.00 0.00 ? 24  PHE B CG    1 
ATOM 1128  C CD1   . PHE B  1 18  ? 17.655  -41.408 31.186  1.00 0.00 ? 24  PHE B CD1   1 
ATOM 1129  C CD2   . PHE B  1 18  ? 19.740  -41.514 30.038  1.00 0.00 ? 24  PHE B CD2   1 
ATOM 1130  C CE1   . PHE B  1 18  ? 18.327  -41.288 32.387  1.00 0.00 ? 24  PHE B CE1   1 
ATOM 1131  C CE2   . PHE B  1 18  ? 20.409  -41.401 31.238  1.00 0.00 ? 24  PHE B CE2   1 
ATOM 1132  C CZ    . PHE B  1 18  ? 19.703  -41.287 32.411  1.00 0.00 ? 24  PHE B CZ    1 
ATOM 1133  N N     . SER B  1 19  ? 18.065  -38.841 27.305  1.00 0.00 ? 25  SER B N     1 
ATOM 1134  C CA    . SER B  1 19  ? 18.898  -37.639 27.253  1.00 0.00 ? 25  SER B CA    1 
ATOM 1135  C C     . SER B  1 19  ? 18.118  -36.348 27.545  1.00 0.00 ? 25  SER B C     1 
ATOM 1136  O O     . SER B  1 19  ? 18.717  -35.307 27.796  1.00 0.00 ? 25  SER B O     1 
ATOM 1137  C CB    . SER B  1 19  ? 19.541  -37.510 25.902  1.00 0.00 ? 25  SER B CB    1 
ATOM 1138  O OG    . SER B  1 19  ? 18.601  -37.132 24.930  1.00 0.00 ? 25  SER B OG    1 
ATOM 1139  N N     . ASN B  1 20  ? 16.788  -36.415 27.490  1.00 0.00 ? 26  ASN B N     1 
ATOM 1140  C CA    . ASN B  1 20  ? 15.946  -35.257 27.754  1.00 0.00 ? 26  ASN B CA    1 
ATOM 1141  C C     . ASN B  1 20  ? 16.042  -34.826 29.213  1.00 0.00 ? 26  ASN B C     1 
ATOM 1142  O O     . ASN B  1 20  ? 15.670  -35.591 30.092  1.00 0.00 ? 26  ASN B O     1 
ATOM 1143  C CB    . ASN B  1 20  ? 14.512  -35.580 27.402  1.00 0.00 ? 26  ASN B CB    1 
ATOM 1144  C CG    . ASN B  1 20  ? 13.578  -34.428 27.595  1.00 0.00 ? 26  ASN B CG    1 
ATOM 1145  O OD1   . ASN B  1 20  ? 13.557  -33.789 28.656  1.00 0.00 ? 26  ASN B OD1   1 
ATOM 1146  N ND2   . ASN B  1 20  ? 12.798  -34.147 26.587  1.00 0.00 ? 26  ASN B ND2   1 
ATOM 1147  N N     . PRO B  1 21  ? 16.561  -33.606 29.483  1.00 0.00 ? 27  PRO B N     1 
ATOM 1148  C CA    . PRO B  1 21  ? 16.726  -32.999 30.823  1.00 0.00 ? 27  PRO B CA    1 
ATOM 1149  C C     . PRO B  1 21  ? 15.703  -33.483 31.831  1.00 0.00 ? 27  PRO B C     1 
ATOM 1150  O O     . PRO B  1 21  ? 16.050  -33.844 32.961  1.00 0.00 ? 27  PRO B O     1 
ATOM 1151  C CB    . PRO B  1 21  ? 16.486  -31.505 30.570  1.00 0.00 ? 27  PRO B CB    1 
ATOM 1152  C CG    . PRO B  1 21  ? 16.863  -31.297 29.167  1.00 0.00 ? 27  PRO B CG    1 
ATOM 1153  C CD    . PRO B  1 21  ? 16.383  -32.534 28.471  1.00 0.00 ? 27  PRO B CD    1 
ATOM 1154  N N     . THR B  1 22  ? 14.437  -33.450 31.437  1.00 0.00 ? 28  THR B N     1 
ATOM 1155  C CA    . THR B  1 22  ? 13.365  -33.803 32.327  1.00 0.00 ? 28  THR B CA    1 
ATOM 1156  C C     . THR B  1 22  ? 13.350  -35.264 32.607  1.00 0.00 ? 28  THR B C     1 
ATOM 1157  O O     . THR B  1 22  ? 13.216  -35.673 33.753  1.00 0.00 ? 28  THR B O     1 
ATOM 1158  C CB    . THR B  1 22  ? 12.023  -33.381 31.759  1.00 0.00 ? 28  THR B CB    1 
ATOM 1159  O OG1   . THR B  1 22  ? 12.002  -31.960 31.588  1.00 0.00 ? 28  THR B OG1   1 
ATOM 1160  C CG2   . THR B  1 22  ? 10.913  -33.788 32.697  1.00 0.00 ? 28  THR B CG2   1 
ATOM 1161  N N     . VAL B  1 23  ? 13.490  -36.063 31.570  1.00 0.00 ? 29  VAL B N     1 
ATOM 1162  C CA    . VAL B  1 23  ? 13.464  -37.494 31.724  1.00 0.00 ? 29  VAL B CA    1 
ATOM 1163  C C     . VAL B  1 23  ? 14.625  -37.977 32.532  1.00 0.00 ? 29  VAL B C     1 
ATOM 1164  O O     . VAL B  1 23  ? 14.468  -38.808 33.425  1.00 0.00 ? 29  VAL B O     1 
ATOM 1165  C CB    . VAL B  1 23  ? 13.486  -38.170 30.369  1.00 0.00 ? 29  VAL B CB    1 
ATOM 1166  C CG1   . VAL B  1 23  ? 13.639  -39.664 30.537  1.00 0.00 ? 29  VAL B CG1   1 
ATOM 1167  C CG2   . VAL B  1 23  ? 12.223  -37.849 29.631  1.00 0.00 ? 29  VAL B CG2   1 
ATOM 1168  N N     . ALA B  1 24  ? 15.795  -37.461 32.227  1.00 0.00 ? 30  ALA B N     1 
ATOM 1169  C CA    . ALA B  1 24  ? 16.988  -37.856 32.927  1.00 0.00 ? 30  ALA B CA    1 
ATOM 1170  C C     . ALA B  1 24  ? 16.871  -37.568 34.396  1.00 0.00 ? 30  ALA B C     1 
ATOM 1171  O O     . ALA B  1 24  ? 17.084  -38.446 35.225  1.00 0.00 ? 30  ALA B O     1 
ATOM 1172  C CB    . ALA B  1 24  ? 18.198  -37.137 32.360  1.00 0.00 ? 30  ALA B CB    1 
ATOM 1173  N N     . SER B  1 25  ? 16.509  -36.340 34.728  1.00 0.00 ? 31  SER B N     1 
ATOM 1174  C CA    . SER B  1 25  ? 16.436  -35.949 36.107  1.00 0.00 ? 31  SER B CA    1 
ATOM 1175  C C     . SER B  1 25  ? 15.291  -36.582 36.832  1.00 0.00 ? 31  SER B C     1 
ATOM 1176  O O     . SER B  1 25  ? 15.403  -36.887 38.012  1.00 0.00 ? 31  SER B O     1 
ATOM 1177  C CB    . SER B  1 25  ? 16.316  -34.480 36.196  1.00 0.00 ? 31  SER B CB    1 
ATOM 1178  O OG    . SER B  1 25  ? 15.147  -34.043 35.568  1.00 0.00 ? 31  SER B OG    1 
ATOM 1179  N N     . THR B  1 26  ? 14.198  -36.833 36.134  1.00 0.00 ? 32  THR B N     1 
ATOM 1180  C CA    . THR B  1 26  ? 13.068  -37.476 36.764  1.00 0.00 ? 32  THR B CA    1 
ATOM 1181  C C     . THR B  1 26  ? 13.441  -38.834 37.240  1.00 0.00 ? 32  THR B C     1 
ATOM 1182  O O     . THR B  1 26  ? 13.247  -39.169 38.406  1.00 0.00 ? 32  THR B O     1 
ATOM 1183  C CB    . THR B  1 26  ? 11.881  -37.585 35.823  1.00 0.00 ? 32  THR B CB    1 
ATOM 1184  O OG1   . THR B  1 26  ? 11.432  -36.280 35.462  1.00 0.00 ? 32  THR B OG1   1 
ATOM 1185  C CG2   . THR B  1 26  ? 10.761  -38.331 36.502  1.00 0.00 ? 32  THR B CG2   1 
ATOM 1186  N N     . ILE B  1 27  ? 13.994  -39.624 36.349  1.00 0.00 ? 33  ILE B N     1 
ATOM 1187  C CA    . ILE B  1 27  ? 14.355  -40.964 36.691  1.00 0.00 ? 33  ILE B CA    1 
ATOM 1188  C C     . ILE B  1 27  ? 15.446  -40.995 37.722  1.00 0.00 ? 33  ILE B C     1 
ATOM 1189  O O     . ILE B  1 27  ? 15.324  -41.675 38.737  1.00 0.00 ? 33  ILE B O     1 
ATOM 1190  C CB    . ILE B  1 27  ? 14.821  -41.720 35.465  1.00 0.00 ? 33  ILE B CB    1 
ATOM 1191  C CG1   . ILE B  1 27  ? 13.670  -41.918 34.503  1.00 0.00 ? 33  ILE B CG1   1 
ATOM 1192  C CG2   . ILE B  1 27  ? 15.397  -43.050 35.878  1.00 0.00 ? 33  ILE B CG2   1 
ATOM 1193  C CD1   . ILE B  1 27  ? 14.105  -42.407 33.153  1.00 0.00 ? 33  ILE B CD1   1 
ATOM 1194  N N     . LEU B  1 28  ? 16.512  -40.262 37.468  1.00 0.00 ? 34  LEU B N     1 
ATOM 1195  C CA    . LEU B  1 28  ? 17.682  -40.308 38.305  1.00 0.00 ? 34  LEU B CA    1 
ATOM 1196  C C     . LEU B  1 28  ? 17.430  -39.779 39.695  1.00 0.00 ? 34  LEU B C     1 
ATOM 1197  O O     . LEU B  1 28  ? 17.941  -40.328 40.668  1.00 0.00 ? 34  LEU B O     1 
ATOM 1198  C CB    . LEU B  1 28  ? 18.793  -39.528 37.651  1.00 0.00 ? 34  LEU B CB    1 
ATOM 1199  C CG    . LEU B  1 28  ? 19.336  -40.144 36.364  1.00 0.00 ? 34  LEU B CG    1 
ATOM 1200  C CD1   . LEU B  1 28  ? 20.285  -39.166 35.705  1.00 0.00 ? 34  LEU B CD1   1 
ATOM 1201  C CD2   . LEU B  1 28  ? 20.032  -41.452 36.688  1.00 0.00 ? 34  LEU B CD2   1 
ATOM 1202  N N     . SER B  1 29  ? 16.627  -38.733 39.806  1.00 0.00 ? 35  SER B N     1 
ATOM 1203  C CA    . SER B  1 29  ? 16.326  -38.194 41.112  1.00 0.00 ? 35  SER B CA    1 
ATOM 1204  C C     . SER B  1 29  ? 15.396  -39.105 41.882  1.00 0.00 ? 35  SER B C     1 
ATOM 1205  O O     . SER B  1 29  ? 15.456  -39.158 43.109  1.00 0.00 ? 35  SER B O     1 
ATOM 1206  C CB    . SER B  1 29  ? 15.713  -36.831 40.994  1.00 0.00 ? 35  SER B CB    1 
ATOM 1207  O OG    . SER B  1 29  ? 14.455  -36.902 40.390  1.00 0.00 ? 35  SER B OG    1 
ATOM 1208  N N     . ASN B  1 30  ? 14.563  -39.866 41.170  1.00 0.00 ? 36  ASN B N     1 
ATOM 1209  C CA    . ASN B  1 30  ? 13.678  -40.797 41.836  1.00 0.00 ? 36  ASN B CA    1 
ATOM 1210  C C     . ASN B  1 30  ? 14.407  -42.013 42.336  1.00 0.00 ? 36  ASN B C     1 
ATOM 1211  O O     . ASN B  1 30  ? 14.092  -42.526 43.404  1.00 0.00 ? 36  ASN B O     1 
ATOM 1212  C CB    . ASN B  1 30  ? 12.540  -41.192 40.942  1.00 0.00 ? 36  ASN B CB    1 
ATOM 1213  C CG    . ASN B  1 30  ? 11.542  -40.090 40.807  1.00 0.00 ? 36  ASN B CG    1 
ATOM 1214  O OD1   . ASN B  1 30  ? 11.597  -39.105 41.551  1.00 0.00 ? 36  ASN B OD1   1 
ATOM 1215  N ND2   . ASN B  1 30  ? 10.620  -40.236 39.898  1.00 0.00 ? 36  ASN B ND2   1 
ATOM 1216  N N     . VAL B  1 31  ? 15.412  -42.467 41.593  1.00 0.00 ? 37  VAL B N     1 
ATOM 1217  C CA    . VAL B  1 31  ? 16.143  -43.661 41.999  1.00 0.00 ? 37  VAL B CA    1 
ATOM 1218  C C     . VAL B  1 31  ? 17.367  -43.328 42.790  1.00 0.00 ? 37  VAL B C     1 
ATOM 1219  O O     . VAL B  1 31  ? 18.121  -44.221 43.146  1.00 0.00 ? 37  VAL B O     1 
ATOM 1220  C CB    . VAL B  1 31  ? 16.575  -44.494 40.794  1.00 0.00 ? 37  VAL B CB    1 
ATOM 1221  C CG1   . VAL B  1 31  ? 15.376  -44.888 39.961  1.00 0.00 ? 37  VAL B CG1   1 
ATOM 1222  C CG2   . VAL B  1 31  ? 17.588  -43.728 39.981  1.00 0.00 ? 37  VAL B CG2   1 
ATOM 1223  N N     . SER B  1 32  ? 17.584  -42.043 43.055  1.00 0.00 ? 38  SER B N     1 
ATOM 1224  C CA    . SER B  1 32  ? 18.722  -41.612 43.844  1.00 0.00 ? 38  SER B CA    1 
ATOM 1225  C C     . SER B  1 32  ? 18.885  -42.415 45.148  1.00 0.00 ? 38  SER B C     1 
ATOM 1226  O O     . SER B  1 32  ? 19.790  -43.240 45.237  1.00 0.00 ? 38  SER B O     1 
ATOM 1227  C CB    . SER B  1 32  ? 18.653  -40.117 44.116  1.00 0.00 ? 38  SER B CB    1 
ATOM 1228  O OG    . SER B  1 32  ? 18.867  -39.384 42.942  1.00 0.00 ? 38  SER B OG    1 
ATOM 1229  N N     . PRO B  1 33  ? 18.065  -42.144 46.189  1.00 0.00 ? 39  PRO B N     1 
ATOM 1230  C CA    . PRO B  1 33  ? 18.175  -42.801 47.492  1.00 0.00 ? 39  PRO B CA    1 
ATOM 1231  C C     . PRO B  1 33  ? 18.156  -44.341 47.386  1.00 0.00 ? 39  PRO B C     1 
ATOM 1232  O O     . PRO B  1 33  ? 18.734  -45.032 48.227  1.00 0.00 ? 39  PRO B O     1 
ATOM 1233  C CB    . PRO B  1 33  ? 16.938  -42.326 48.218  1.00 0.00 ? 39  PRO B CB    1 
ATOM 1234  C CG    . PRO B  1 33  ? 15.906  -42.218 47.153  1.00 0.00 ? 39  PRO B CG    1 
ATOM 1235  C CD    . PRO B  1 33  ? 16.641  -41.845 45.904  1.00 0.00 ? 39  PRO B CD    1 
ATOM 1236  N N     . VAL B  1 34  ? 17.524  -44.867 46.339  1.00 0.00 ? 40  VAL B N     1 
ATOM 1237  C CA    . VAL B  1 34  ? 17.469  -46.288 46.122  1.00 0.00 ? 40  VAL B CA    1 
ATOM 1238  C C     . VAL B  1 34  ? 18.825  -46.791 45.734  1.00 0.00 ? 40  VAL B C     1 
ATOM 1239  O O     . VAL B  1 34  ? 19.327  -47.764 46.298  1.00 0.00 ? 40  VAL B O     1 
ATOM 1240  C CB    . VAL B  1 34  ? 16.470  -46.616 45.020  1.00 0.00 ? 40  VAL B CB    1 
ATOM 1241  C CG1   . VAL B  1 34  ? 16.523  -48.096 44.697  1.00 0.00 ? 40  VAL B CG1   1 
ATOM 1242  C CG2   . VAL B  1 34  ? 15.077  -46.196 45.447  1.00 0.00 ? 40  VAL B CG2   1 
ATOM 1243  N N     . ALA B  1 35  ? 19.435  -46.099 44.784  1.00 0.00 ? 41  ALA B N     1 
ATOM 1244  C CA    . ALA B  1 35  ? 20.762  -46.416 44.324  1.00 0.00 ? 41  ALA B CA    1 
ATOM 1245  C C     . ALA B  1 35  ? 21.737  -46.355 45.449  1.00 0.00 ? 41  ALA B C     1 
ATOM 1246  O O     . ALA B  1 35  ? 22.627  -47.192 45.551  1.00 0.00 ? 41  ALA B O     1 
ATOM 1247  C CB    . ALA B  1 35  ? 21.183  -45.451 43.235  1.00 0.00 ? 41  ALA B CB    1 
ATOM 1248  N N     . GLN B  1 36  ? 21.560  -45.372 46.315  1.00 0.00 ? 42  GLN B N     1 
ATOM 1249  C CA    . GLN B  1 36  ? 22.446  -45.185 47.431  1.00 0.00 ? 42  GLN B CA    1 
ATOM 1250  C C     . GLN B  1 36  ? 22.427  -46.380 48.313  1.00 0.00 ? 42  GLN B C     1 
ATOM 1251  O O     . GLN B  1 36  ? 23.470  -46.863 48.730  1.00 0.00 ? 42  GLN B O     1 
ATOM 1252  C CB    . GLN B  1 36  ? 22.041  -43.964 48.216  1.00 0.00 ? 42  GLN B CB    1 
ATOM 1253  C CG    . GLN B  1 36  ? 22.228  -42.687 47.453  1.00 0.00 ? 42  GLN B CG    1 
ATOM 1254  C CD    . GLN B  1 36  ? 21.820  -41.471 48.239  1.00 0.00 ? 42  GLN B CD    1 
ATOM 1255  O OE1   . GLN B  1 36  ? 22.078  -41.374 49.442  1.00 0.00 ? 42  GLN B OE1   1 
ATOM 1256  N NE2   . GLN B  1 36  ? 21.177  -40.529 47.564  1.00 0.00 ? 42  GLN B NE2   1 
ATOM 1257  N N     . GLN B  1 37  ? 21.240  -46.902 48.566  1.00 0.00 ? 43  GLN B N     1 
ATOM 1258  C CA    . GLN B  1 37  ? 21.109  -48.081 49.381  1.00 0.00 ? 43  GLN B CA    1 
ATOM 1259  C C     . GLN B  1 37  ? 21.800  -49.261 48.766  1.00 0.00 ? 43  GLN B C     1 
ATOM 1260  O O     . GLN B  1 37  ? 22.509  -49.999 49.449  1.00 0.00 ? 43  GLN B O     1 
ATOM 1261  C CB    . GLN B  1 37  ? 19.651  -48.421 49.591  1.00 0.00 ? 43  GLN B CB    1 
ATOM 1262  C CG    . GLN B  1 37  ? 19.441  -49.632 50.457  1.00 0.00 ? 43  GLN B CG    1 
ATOM 1263  C CD    . GLN B  1 37  ? 19.920  -49.406 51.863  1.00 0.00 ? 43  GLN B CD    1 
ATOM 1264  O OE1   . GLN B  1 37  ? 19.508  -48.444 52.516  1.00 0.00 ? 43  GLN B OE1   1 
ATOM 1265  N NE2   . GLN B  1 37  ? 20.795  -50.283 52.347  1.00 0.00 ? 43  GLN B NE2   1 
ATOM 1266  N N     . ASN B  1 38  ? 21.609  -49.437 47.468  1.00 0.00 ? 44  ASN B N     1 
ATOM 1267  C CA    . ASN B  1 38  ? 22.170  -50.573 46.776  1.00 0.00 ? 44  ASN B CA    1 
ATOM 1268  C C     . ASN B  1 38  ? 23.677  -50.507 46.729  1.00 0.00 ? 44  ASN B C     1 
ATOM 1269  O O     . ASN B  1 38  ? 24.355  -51.516 46.924  1.00 0.00 ? 44  ASN B O     1 
ATOM 1270  C CB    . ASN B  1 38  ? 21.582  -50.669 45.399  1.00 0.00 ? 44  ASN B CB    1 
ATOM 1271  C CG    . ASN B  1 38  ? 20.153  -51.116 45.452  1.00 0.00 ? 44  ASN B CG    1 
ATOM 1272  O OD1   . ASN B  1 38  ? 19.722  -51.681 46.463  1.00 0.00 ? 44  ASN B OD1   1 
ATOM 1273  N ND2   . ASN B  1 38  ? 19.409  -50.880 44.401  1.00 0.00 ? 44  ASN B ND2   1 
ATOM 1274  N N     . PHE B  1 39  ? 24.203  -49.315 46.503  1.00 0.00 ? 45  PHE B N     1 
ATOM 1275  C CA    . PHE B  1 39  ? 25.630  -49.105 46.473  1.00 0.00 ? 45  PHE B CA    1 
ATOM 1276  C C     . PHE B  1 39  ? 26.222  -49.378 47.832  1.00 0.00 ? 45  PHE B C     1 
ATOM 1277  O O     . PHE B  1 39  ? 27.195  -50.108 47.961  1.00 0.00 ? 45  PHE B O     1 
ATOM 1278  C CB    . PHE B  1 39  ? 25.958  -47.690 46.080  1.00 0.00 ? 45  PHE B CB    1 
ATOM 1279  C CG    . PHE B  1 39  ? 27.417  -47.463 45.924  1.00 0.00 ? 45  PHE B CG    1 
ATOM 1280  C CD1   . PHE B  1 39  ? 27.987  -47.425 44.668  1.00 0.00 ? 45  PHE B CD1   1 
ATOM 1281  C CD2   . PHE B  1 39  ? 28.238  -47.339 47.025  1.00 0.00 ? 45  PHE B CD2   1 
ATOM 1282  C CE1   . PHE B  1 39  ? 29.345  -47.227 44.511  1.00 0.00 ? 45  PHE B CE1   1 
ATOM 1283  C CE2   . PHE B  1 39  ? 29.598  -47.151 46.874  1.00 0.00 ? 45  PHE B CE2   1 
ATOM 1284  C CZ    . PHE B  1 39  ? 30.151  -47.084 45.616  1.00 0.00 ? 45  PHE B CZ    1 
ATOM 1285  N N     . GLN B  1 40  ? 25.617  -48.804 48.856  1.00 0.00 ? 46  GLN B N     1 
ATOM 1286  C CA    . GLN B  1 40  ? 26.101  -48.978 50.205  1.00 0.00 ? 46  GLN B CA    1 
ATOM 1287  C C     . GLN B  1 40  ? 26.078  -50.417 50.633  1.00 0.00 ? 46  GLN B C     1 
ATOM 1288  O O     . GLN B  1 40  ? 26.948  -50.864 51.374  1.00 0.00 ? 46  GLN B O     1 
ATOM 1289  C CB    . GLN B  1 40  ? 25.266  -48.181 51.181  1.00 0.00 ? 46  GLN B CB    1 
ATOM 1290  C CG    . GLN B  1 40  ? 25.443  -46.687 51.115  1.00 0.00 ? 46  GLN B CG    1 
ATOM 1291  C CD    . GLN B  1 40  ? 24.465  -46.004 52.028  1.00 0.00 ? 46  GLN B CD    1 
ATOM 1292  O OE1   . GLN B  1 40  ? 23.979  -46.620 52.979  1.00 0.00 ? 46  GLN B OE1   1 
ATOM 1293  N NE2   . GLN B  1 40  ? 24.152  -44.744 51.758  1.00 0.00 ? 46  GLN B NE2   1 
ATOM 1294  N N     . THR B  1 41  ? 25.058  -51.137 50.205  1.00 0.00 ? 47  THR B N     1 
ATOM 1295  C CA    . THR B  1 41  ? 24.892  -52.501 50.620  1.00 0.00 ? 47  THR B CA    1 
ATOM 1296  C C     . THR B  1 41  ? 25.935  -53.444 50.031  1.00 0.00 ? 47  THR B C     1 
ATOM 1297  O O     . THR B  1 41  ? 26.552  -54.215 50.756  1.00 0.00 ? 47  THR B O     1 
ATOM 1298  C CB    . THR B  1 41  ? 23.502  -53.002 50.241  1.00 0.00 ? 47  THR B CB    1 
ATOM 1299  O OG1   . THR B  1 41  ? 22.512  -52.190 50.879  1.00 0.00 ? 47  THR B OG1   1 
ATOM 1300  C CG2   . THR B  1 41  ? 23.323  -54.445 50.673  1.00 0.00 ? 47  THR B CG2   1 
ATOM 1301  N N     . ASN B  1 42  ? 26.110  -53.412 48.716  1.00 0.00 ? 48  ASN B N     1 
ATOM 1302  C CA    . ASN B  1 42  ? 26.969  -54.399 48.083  1.00 0.00 ? 48  ASN B CA    1 
ATOM 1303  C C     . ASN B  1 42  ? 28.408  -53.986 47.848  1.00 0.00 ? 48  ASN B C     1 
ATOM 1304  O O     . ASN B  1 42  ? 29.251  -54.844 47.638  1.00 0.00 ? 48  ASN B O     1 
ATOM 1305  C CB    . ASN B  1 42  ? 26.364  -54.866 46.782  1.00 0.00 ? 48  ASN B CB    1 
ATOM 1306  C CG    . ASN B  1 42  ? 25.167  -55.750 46.987  1.00 0.00 ? 48  ASN B CG    1 
ATOM 1307  O OD1   . ASN B  1 42  ? 25.027  -56.398 48.035  1.00 0.00 ? 48  ASN B OD1   1 
ATOM 1308  N ND2   . ASN B  1 42  ? 24.313  -55.818 46.002  1.00 0.00 ? 48  ASN B ND2   1 
ATOM 1309  N N     . VAL B  1 43  ? 28.717  -52.700 47.888  1.00 0.00 ? 49  VAL B N     1 
ATOM 1310  C CA    . VAL B  1 43  ? 30.084  -52.286 47.566  1.00 0.00 ? 49  VAL B CA    1 
ATOM 1311  C C     . VAL B  1 43  ? 31.170  -52.555 48.636  1.00 0.00 ? 49  VAL B C     1 
ATOM 1312  O O     . VAL B  1 43  ? 32.209  -53.126 48.297  1.00 0.00 ? 49  VAL B O     1 
ATOM 1313  C CB    . VAL B  1 43  ? 30.108  -50.836 47.180  1.00 0.00 ? 49  VAL B CB    1 
ATOM 1314  C CG1   . VAL B  1 43  ? 31.536  -50.357 47.036  1.00 0.00 ? 49  VAL B CG1   1 
ATOM 1315  C CG2   . VAL B  1 43  ? 29.376  -50.700 45.866  1.00 0.00 ? 49  VAL B CG2   1 
ATOM 1316  N N     . PRO B  1 44  ? 30.982  -52.134 49.906  1.00 0.00 ? 50  PRO B N     1 
ATOM 1317  C CA    . PRO B  1 44  ? 31.969  -52.313 50.972  1.00 0.00 ? 50  PRO B CA    1 
ATOM 1318  C C     . PRO B  1 44  ? 32.394  -53.781 51.119  1.00 0.00 ? 50  PRO B C     1 
ATOM 1319  O O     . PRO B  1 44  ? 33.494  -54.071 51.594  1.00 0.00 ? 50  PRO B O     1 
ATOM 1320  C CB    . PRO B  1 44  ? 31.227  -51.854 52.210  1.00 0.00 ? 50  PRO B CB    1 
ATOM 1321  C CG    . PRO B  1 44  ? 29.814  -52.224 51.957  1.00 0.00 ? 50  PRO B CG    1 
ATOM 1322  C CD    . PRO B  1 44  ? 29.622  -52.157 50.471  1.00 0.00 ? 50  PRO B CD    1 
ATOM 1323  N N     . LYS B  1 45  ? 31.541  -54.695 50.658  1.00 0.00 ? 51  LYS B N     1 
ATOM 1324  C CA    . LYS B  1 45  ? 31.826  -56.113 50.659  1.00 0.00 ? 51  LYS B CA    1 
ATOM 1325  C C     . LYS B  1 45  ? 33.049  -56.423 49.823  1.00 0.00 ? 51  LYS B C     1 
ATOM 1326  O O     . LYS B  1 45  ? 33.850  -57.284 50.176  1.00 0.00 ? 51  LYS B O     1 
ATOM 1327  C CB    . LYS B  1 45  ? 30.640  -56.868 50.090  1.00 0.00 ? 51  LYS B CB    1 
ATOM 1328  C CG    . LYS B  1 45  ? 29.400  -56.861 50.958  1.00 0.00 ? 51  LYS B CG    1 
ATOM 1329  C CD    . LYS B  1 45  ? 28.243  -57.543 50.245  1.00 0.00 ? 51  LYS B CD    1 
ATOM 1330  C CE    . LYS B  1 45  ? 26.983  -57.537 51.090  1.00 0.00 ? 51  LYS B CE    1 
ATOM 1331  N NZ    . LYS B  1 45  ? 25.816  -58.065 50.340  1.00 0.00 ? 51  LYS B NZ    1 
ATOM 1332  N N     . PHE B  1 46  ? 33.187  -55.722 48.708  1.00 0.00 ? 52  PHE B N     1 
ATOM 1333  C CA    . PHE B  1 46  ? 34.283  -55.943 47.795  1.00 0.00 ? 52  PHE B CA    1 
ATOM 1334  C C     . PHE B  1 46  ? 35.465  -55.087 48.145  1.00 0.00 ? 52  PHE B C     1 
ATOM 1335  O O     . PHE B  1 46  ? 36.603  -55.445 47.854  1.00 0.00 ? 52  PHE B O     1 
ATOM 1336  C CB    . PHE B  1 46  ? 33.837  -55.659 46.384  1.00 0.00 ? 52  PHE B CB    1 
ATOM 1337  C CG    . PHE B  1 46  ? 32.838  -56.642 45.898  1.00 0.00 ? 52  PHE B CG    1 
ATOM 1338  C CD1   . PHE B  1 46  ? 31.506  -56.443 46.153  1.00 0.00 ? 52  PHE B CD1   1 
ATOM 1339  C CD2   . PHE B  1 46  ? 33.221  -57.762 45.189  1.00 0.00 ? 52  PHE B CD2   1 
ATOM 1340  C CE1   . PHE B  1 46  ? 30.562  -57.345 45.722  1.00 0.00 ? 52  PHE B CE1   1 
ATOM 1341  C CE2   . PHE B  1 46  ? 32.283  -58.662 44.745  1.00 0.00 ? 52  PHE B CE2   1 
ATOM 1342  C CZ    . PHE B  1 46  ? 30.952  -58.457 45.015  1.00 0.00 ? 52  PHE B CZ    1 
ATOM 1343  N N     . THR B  1 47  ? 35.213  -53.964 48.795  1.00 0.00 ? 53  THR B N     1 
ATOM 1344  C CA    . THR B  1 47  ? 36.305  -53.124 49.229  1.00 0.00 ? 53  THR B CA    1 
ATOM 1345  C C     . THR B  1 47  ? 37.167  -53.860 50.230  1.00 0.00 ? 53  THR B C     1 
ATOM 1346  O O     . THR B  1 47  ? 38.394  -53.802 50.164  1.00 0.00 ? 53  THR B O     1 
ATOM 1347  C CB    . THR B  1 47  ? 35.820  -51.831 49.845  1.00 0.00 ? 53  THR B CB    1 
ATOM 1348  O OG1   . THR B  1 47  ? 35.072  -51.085 48.881  1.00 0.00 ? 53  THR B OG1   1 
ATOM 1349  C CG2   . THR B  1 47  ? 37.011  -51.020 50.299  1.00 0.00 ? 53  THR B CG2   1 
ATOM 1350  N N     . SER B  1 48  ? 36.524  -54.574 51.154  1.00 0.00 ? 54  SER B N     1 
ATOM 1351  C CA    . SER B  1 48  ? 37.254  -55.348 52.142  1.00 0.00 ? 54  SER B CA    1 
ATOM 1352  C C     . SER B  1 48  ? 38.076  -56.440 51.481  1.00 0.00 ? 54  SER B C     1 
ATOM 1353  O O     . SER B  1 48  ? 39.175  -56.764 51.938  1.00 0.00 ? 54  SER B O     1 
ATOM 1354  C CB    . SER B  1 48  ? 36.296  -55.978 53.117  1.00 0.00 ? 54  SER B CB    1 
ATOM 1355  O OG    . SER B  1 48  ? 35.523  -56.966 52.491  1.00 0.00 ? 54  SER B OG    1 
ATOM 1356  N N     . VAL B  1 49  ? 37.573  -56.959 50.365  1.00 0.00 ? 55  VAL B N     1 
ATOM 1357  C CA    . VAL B  1 49  ? 38.297  -57.952 49.606  1.00 0.00 ? 55  VAL B CA    1 
ATOM 1358  C C     . VAL B  1 49  ? 39.542  -57.356 49.049  1.00 0.00 ? 55  VAL B C     1 
ATOM 1359  O O     . VAL B  1 49  ? 40.613  -57.938 49.148  1.00 0.00 ? 55  VAL B O     1 
ATOM 1360  C CB    . VAL B  1 49  ? 37.439  -58.504 48.454  1.00 0.00 ? 55  VAL B CB    1 
ATOM 1361  C CG1   . VAL B  1 49  ? 38.279  -59.380 47.548  1.00 0.00 ? 55  VAL B CG1   1 
ATOM 1362  C CG2   . VAL B  1 49  ? 36.280  -59.290 49.013  1.00 0.00 ? 55  VAL B CG2   1 
ATOM 1363  N N     . ASN B  1 50  ? 39.416  -56.166 48.488  1.00 0.00 ? 56  ASN B N     1 
ATOM 1364  C CA    . ASN B  1 50  ? 40.540  -55.495 47.895  1.00 0.00 ? 56  ASN B CA    1 
ATOM 1365  C C     . ASN B  1 50  ? 41.648  -55.264 48.887  1.00 0.00 ? 56  ASN B C     1 
ATOM 1366  O O     . ASN B  1 50  ? 42.811  -55.447 48.556  1.00 0.00 ? 56  ASN B O     1 
ATOM 1367  C CB    . ASN B  1 50  ? 40.111  -54.200 47.281  1.00 0.00 ? 56  ASN B CB    1 
ATOM 1368  C CG    . ASN B  1 50  ? 39.342  -54.417 46.032  1.00 0.00 ? 56  ASN B CG    1 
ATOM 1369  O OD1   . ASN B  1 50  ? 39.445  -55.487 45.426  1.00 0.00 ? 56  ASN B OD1   1 
ATOM 1370  N ND2   . ASN B  1 50  ? 38.571  -53.440 45.631  1.00 0.00 ? 56  ASN B ND2   1 
ATOM 1371  N N     . GLU B  1 51  ? 41.302  -54.885 50.117  1.00 0.00 ? 57  GLU B N     1 
ATOM 1372  C CA    . GLU B  1 51  ? 42.336  -54.663 51.126  1.00 0.00 ? 57  GLU B CA    1 
ATOM 1373  C C     . GLU B  1 51  ? 43.099  -55.941 51.422  1.00 0.00 ? 57  GLU B C     1 
ATOM 1374  O O     . GLU B  1 51  ? 44.330  -55.956 51.368  1.00 0.00 ? 57  GLU B O     1 
ATOM 1375  C CB    . GLU B  1 51  ? 41.753  -54.093 52.435  1.00 0.00 ? 57  GLU B CB    1 
ATOM 1376  C CG    . GLU B  1 51  ? 42.829  -53.783 53.501  1.00 0.00 ? 57  GLU B CG    1 
ATOM 1377  C CD    . GLU B  1 51  ? 42.307  -53.128 54.778  1.00 0.00 ? 57  GLU B CD    1 
ATOM 1378  O OE1   . GLU B  1 51  ? 41.117  -53.001 54.931  1.00 0.00 ? 57  GLU B OE1   1 
ATOM 1379  O OE2   . GLU B  1 51  ? 43.120  -52.737 55.585  1.00 0.00 ? 57  GLU B OE2   1 
ATOM 1380  N N     . ASN B  1 52  ? 42.379  -57.012 51.740  1.00 0.00 ? 58  ASN B N     1 
ATOM 1381  C CA    . ASN B  1 52  ? 43.039  -58.256 52.102  1.00 0.00 ? 58  ASN B CA    1 
ATOM 1382  C C     . ASN B  1 52  ? 43.788  -58.877 50.940  1.00 0.00 ? 58  ASN B C     1 
ATOM 1383  O O     . ASN B  1 52  ? 44.922  -59.317 51.101  1.00 0.00 ? 58  ASN B O     1 
ATOM 1384  C CB    . ASN B  1 52  ? 42.060  -59.244 52.676  1.00 0.00 ? 58  ASN B CB    1 
ATOM 1385  C CG    . ASN B  1 52  ? 41.642  -58.912 54.079  1.00 0.00 ? 58  ASN B CG    1 
ATOM 1386  O OD1   . ASN B  1 52  ? 42.258  -58.075 54.742  1.00 0.00 ? 58  ASN B OD1   1 
ATOM 1387  N ND2   . ASN B  1 52  ? 40.618  -59.574 54.551  1.00 0.00 ? 58  ASN B ND2   1 
ATOM 1388  N N     . VAL B  1 53  ? 43.169  -58.894 49.769  1.00 0.00 ? 59  VAL B N     1 
ATOM 1389  C CA    . VAL B  1 53  ? 43.805  -59.463 48.597  1.00 0.00 ? 59  VAL B CA    1 
ATOM 1390  C C     . VAL B  1 53  ? 45.046  -58.710 48.241  1.00 0.00 ? 59  VAL B C     1 
ATOM 1391  O O     . VAL B  1 53  ? 46.065  -59.309 47.911  1.00 0.00 ? 59  VAL B O     1 
ATOM 1392  C CB    . VAL B  1 53  ? 42.851  -59.471 47.400  1.00 0.00 ? 59  VAL B CB    1 
ATOM 1393  C CG1   . VAL B  1 53  ? 43.605  -59.847 46.138  1.00 0.00 ? 59  VAL B CG1   1 
ATOM 1394  C CG2   . VAL B  1 53  ? 41.734  -60.468 47.652  1.00 0.00 ? 59  VAL B CG2   1 
ATOM 1395  N N     . SER B  1 54  ? 44.971  -57.393 48.304  1.00 0.00 ? 60  SER B N     1 
ATOM 1396  C CA    . SER B  1 54  ? 46.108  -56.568 48.002  1.00 0.00 ? 60  SER B CA    1 
ATOM 1397  C C     . SER B  1 54  ? 47.249  -56.893 48.936  1.00 0.00 ? 60  SER B C     1 
ATOM 1398  O O     . SER B  1 54  ? 48.388  -57.031 48.502  1.00 0.00 ? 60  SER B O     1 
ATOM 1399  C CB    . SER B  1 54  ? 45.738  -55.117 48.119  1.00 0.00 ? 60  SER B CB    1 
ATOM 1400  O OG    . SER B  1 54  ? 46.792  -54.291 47.723  1.00 0.00 ? 60  SER B OG    1 
ATOM 1401  N N     . ALA B  1 55  ? 46.943  -57.034 50.222  1.00 0.00 ? 61  ALA B N     1 
ATOM 1402  C CA    . ALA B  1 55  ? 47.959  -57.364 51.206  1.00 0.00 ? 61  ALA B CA    1 
ATOM 1403  C C     . ALA B  1 55  ? 48.671  -58.643 50.836  1.00 0.00 ? 61  ALA B C     1 
ATOM 1404  O O     . ALA B  1 55  ? 49.899  -58.712 50.878  1.00 0.00 ? 61  ALA B O     1 
ATOM 1405  C CB    . ALA B  1 55  ? 47.339  -57.495 52.581  1.00 0.00 ? 61  ALA B CB    1 
ATOM 1406  N N     . VAL B  1 56  ? 47.904  -59.645 50.432  1.00 0.00 ? 62  VAL B N     1 
ATOM 1407  C CA    . VAL B  1 56  ? 48.467  -60.909 50.008  1.00 0.00 ? 62  VAL B CA    1 
ATOM 1408  C C     . VAL B  1 56  ? 49.393  -60.744 48.846  1.00 0.00 ? 62  VAL B C     1 
ATOM 1409  O O     . VAL B  1 56  ? 50.495  -61.286 48.844  1.00 0.00 ? 62  VAL B O     1 
ATOM 1410  C CB    . VAL B  1 56  ? 47.362  -61.874 49.621  1.00 0.00 ? 62  VAL B CB    1 
ATOM 1411  C CG1   . VAL B  1 56  ? 47.940  -63.092 48.947  1.00 0.00 ? 62  VAL B CG1   1 
ATOM 1412  C CG2   . VAL B  1 56  ? 46.610  -62.271 50.855  1.00 0.00 ? 62  VAL B CG2   1 
ATOM 1413  N N     . LEU B  1 57  ? 48.964  -59.980 47.866  1.00 0.00 ? 63  LEU B N     1 
ATOM 1414  C CA    . LEU B  1 57  ? 49.747  -59.777 46.676  1.00 0.00 ? 63  LEU B CA    1 
ATOM 1415  C C     . LEU B  1 57  ? 51.071  -59.125 46.999  1.00 0.00 ? 63  LEU B C     1 
ATOM 1416  O O     . LEU B  1 57  ? 52.092  -59.466 46.409  1.00 0.00 ? 63  LEU B O     1 
ATOM 1417  C CB    . LEU B  1 57  ? 48.953  -58.945 45.698  1.00 0.00 ? 63  LEU B CB    1 
ATOM 1418  C CG    . LEU B  1 57  ? 47.738  -59.663 45.123  1.00 0.00 ? 63  LEU B CG    1 
ATOM 1419  C CD1   . LEU B  1 57  ? 46.917  -58.700 44.294  1.00 0.00 ? 63  LEU B CD1   1 
ATOM 1420  C CD2   . LEU B  1 57  ? 48.209  -60.838 44.302  1.00 0.00 ? 63  LEU B CD2   1 
ATOM 1421  N N     . THR B  1 58  ? 51.074  -58.233 47.977  1.00 0.00 ? 64  THR B N     1 
ATOM 1422  C CA    . THR B  1 58  ? 52.316  -57.633 48.426  1.00 0.00 ? 64  THR B CA    1 
ATOM 1423  C C     . THR B  1 58  ? 53.227  -58.673 49.053  1.00 0.00 ? 64  THR B C     1 
ATOM 1424  O O     . THR B  1 58  ? 54.427  -58.693 48.788  1.00 0.00 ? 64  THR B O     1 
ATOM 1425  C CB    . THR B  1 58  ? 52.057  -56.478 49.385  1.00 0.00 ? 64  THR B CB    1 
ATOM 1426  O OG1   . THR B  1 58  ? 51.341  -55.452 48.680  1.00 0.00 ? 64  THR B OG1   1 
ATOM 1427  C CG2   . THR B  1 58  ? 53.367  -55.917 49.912  1.00 0.00 ? 64  THR B CG2   1 
ATOM 1428  N N     . GLN B  1 59  ? 52.655  -59.575 49.837  1.00 0.00 ? 65  GLN B N     1 
ATOM 1429  C CA    . GLN B  1 59  ? 53.436  -60.661 50.428  1.00 0.00 ? 65  GLN B CA    1 
ATOM 1430  C C     . GLN B  1 59  ? 53.981  -61.628 49.364  1.00 0.00 ? 65  GLN B C     1 
ATOM 1431  O O     . GLN B  1 59  ? 55.037  -62.227 49.548  1.00 0.00 ? 65  GLN B O     1 
ATOM 1432  C CB    . GLN B  1 59  ? 52.609  -61.421 51.446  1.00 0.00 ? 65  GLN B CB    1 
ATOM 1433  C CG    . GLN B  1 59  ? 52.306  -60.637 52.708  1.00 0.00 ? 65  GLN B CG    1 
ATOM 1434  C CD    . GLN B  1 59  ? 53.562  -60.311 53.506  1.00 0.00 ? 65  GLN B CD    1 
ATOM 1435  O OE1   . GLN B  1 59  ? 54.493  -61.117 53.566  1.00 0.00 ? 65  GLN B OE1   1 
ATOM 1436  N NE2   . GLN B  1 59  ? 53.587  -59.139 54.134  1.00 0.00 ? 65  GLN B NE2   1 
ATOM 1437  N N     . TYR B  1 60  ? 53.272  -61.758 48.242  1.00 0.00 ? 66  TYR B N     1 
ATOM 1438  C CA    . TYR B  1 60  ? 53.758  -62.573 47.128  1.00 0.00 ? 66  TYR B CA    1 
ATOM 1439  C C     . TYR B  1 60  ? 54.639  -61.815 46.143  1.00 0.00 ? 66  TYR B C     1 
ATOM 1440  O O     . TYR B  1 60  ? 55.069  -62.380 45.142  1.00 0.00 ? 66  TYR B O     1 
ATOM 1441  C CB    . TYR B  1 60  ? 52.607  -63.208 46.380  1.00 0.00 ? 66  TYR B CB    1 
ATOM 1442  C CG    . TYR B  1 60  ? 52.112  -64.479 46.998  1.00 0.00 ? 66  TYR B CG    1 
ATOM 1443  C CD1   . TYR B  1 60  ? 51.111  -64.462 47.935  1.00 0.00 ? 66  TYR B CD1   1 
ATOM 1444  C CD2   . TYR B  1 60  ? 52.663  -65.681 46.593  1.00 0.00 ? 66  TYR B CD2   1 
ATOM 1445  C CE1   . TYR B  1 60  ? 50.657  -65.646 48.475  1.00 0.00 ? 66  TYR B CE1   1 
ATOM 1446  C CE2   . TYR B  1 60  ? 52.208  -66.865 47.125  1.00 0.00 ? 66  TYR B CE2   1 
ATOM 1447  C CZ    . TYR B  1 60  ? 51.205  -66.851 48.062  1.00 0.00 ? 66  TYR B CZ    1 
ATOM 1448  O OH    . TYR B  1 60  ? 50.744  -68.030 48.593  1.00 0.00 ? 66  TYR B OH    1 
ATOM 1449  N N     . GLY B  1 61  ? 54.902  -60.542 46.402  1.00 0.00 ? 67  GLY B N     1 
ATOM 1450  C CA    . GLY B  1 61  ? 55.803  -59.787 45.545  1.00 0.00 ? 67  GLY B CA    1 
ATOM 1451  C C     . GLY B  1 61  ? 55.172  -59.369 44.219  1.00 0.00 ? 67  GLY B C     1 
ATOM 1452  O O     . GLY B  1 61  ? 55.884  -59.017 43.276  1.00 0.00 ? 67  GLY B O     1 
ATOM 1453  N N     . ILE B  1 62  ? 53.849  -59.382 44.153  1.00 0.00 ? 68  ILE B N     1 
ATOM 1454  C CA    . ILE B  1 62  ? 53.144  -59.078 42.920  1.00 0.00 ? 68  ILE B CA    1 
ATOM 1455  C C     . ILE B  1 62  ? 52.994  -57.582 42.744  1.00 0.00 ? 68  ILE B C     1 
ATOM 1456  O O     . ILE B  1 62  ? 52.532  -56.892 43.650  1.00 0.00 ? 68  ILE B O     1 
ATOM 1457  C CB    . ILE B  1 62  ? 51.758  -59.729 42.916  1.00 0.00 ? 68  ILE B CB    1 
ATOM 1458  C CG1   . ILE B  1 62  ? 51.873  -61.229 43.157  1.00 0.00 ? 68  ILE B CG1   1 
ATOM 1459  C CG2   . ILE B  1 62  ? 51.071  -59.472 41.602  1.00 0.00 ? 68  ILE B CG2   1 
ATOM 1460  C CD1   . ILE B  1 62  ? 52.696  -61.946 42.122  1.00 0.00 ? 68  ILE B CD1   1 
ATOM 1461  N N     . THR B  1 63  ? 53.400  -57.073 41.589  1.00 0.00 ? 69  THR B N     1 
ATOM 1462  C CA    . THR B  1 63  ? 53.338  -55.637 41.331  1.00 0.00 ? 69  THR B CA    1 
ATOM 1463  C C     . THR B  1 63  ? 52.635  -55.304 40.029  1.00 0.00 ? 69  THR B C     1 
ATOM 1464  O O     . THR B  1 63  ? 52.507  -56.145 39.140  1.00 0.00 ? 69  THR B O     1 
ATOM 1465  C CB    . THR B  1 63  ? 54.723  -55.047 41.257  1.00 0.00 ? 69  THR B CB    1 
ATOM 1466  O OG1   . THR B  1 63  ? 55.385  -55.639 40.146  1.00 0.00 ? 69  THR B OG1   1 
ATOM 1467  C CG2   . THR B  1 63  ? 55.514  -55.313 42.524  1.00 0.00 ? 69  THR B CG2   1 
ATOM 1468  N N     . GLY B  1 64  ? 52.244  -54.049 39.900  1.00 0.00 ? 70  GLY B N     1 
ATOM 1469  C CA    . GLY B  1 64  ? 51.657  -53.549 38.676  1.00 0.00 ? 70  GLY B CA    1 
ATOM 1470  C C     . GLY B  1 64  ? 50.366  -54.253 38.331  1.00 0.00 ? 70  GLY B C     1 
ATOM 1471  O O     . GLY B  1 64  ? 49.638  -54.719 39.207  1.00 0.00 ? 70  GLY B O     1 
ATOM 1472  N N     . PRO B  1 65  ? 50.099  -54.366 37.042  1.00 0.00 ? 71  PRO B N     1 
ATOM 1473  C CA    . PRO B  1 65  ? 48.934  -54.973 36.445  1.00 0.00 ? 71  PRO B CA    1 
ATOM 1474  C C     . PRO B  1 65  ? 48.798  -56.416 36.826  1.00 0.00 ? 71  PRO B C     1 
ATOM 1475  O O     . PRO B  1 65  ? 47.716  -56.983 36.721  1.00 0.00 ? 71  PRO B O     1 
ATOM 1476  C CB    . PRO B  1 65  ? 49.150  -54.762 34.968  1.00 0.00 ? 71  PRO B CB    1 
ATOM 1477  C CG    . PRO B  1 65  ? 49.886  -53.457 34.892  1.00 0.00 ? 71  PRO B CG    1 
ATOM 1478  C CD    . PRO B  1 65  ? 50.742  -53.415 36.121  1.00 0.00 ? 71  PRO B CD    1 
ATOM 1479  N N     . ASN B  1 66  ? 49.877  -57.023 37.291  1.00 0.00 ? 72  ASN B N     1 
ATOM 1480  C CA    . ASN B  1 66  ? 49.799  -58.384 37.719  1.00 0.00 ? 72  ASN B CA    1 
ATOM 1481  C C     . ASN B  1 66  ? 48.940  -58.480 38.950  1.00 0.00 ? 72  ASN B C     1 
ATOM 1482  O O     . ASN B  1 66  ? 48.233  -59.466 39.142  1.00 0.00 ? 72  ASN B O     1 
ATOM 1483  C CB    . ASN B  1 66  ? 51.166  -58.934 37.960  1.00 0.00 ? 72  ASN B CB    1 
ATOM 1484  C CG    . ASN B  1 66  ? 51.896  -59.143 36.681  1.00 0.00 ? 72  ASN B CG    1 
ATOM 1485  O OD1   . ASN B  1 66  ? 51.295  -59.510 35.670  1.00 0.00 ? 72  ASN B OD1   1 
ATOM 1486  N ND2   . ASN B  1 66  ? 53.176  -58.891 36.690  1.00 0.00 ? 72  ASN B ND2   1 
ATOM 1487  N N     . ARG B  1 67  ? 48.957  -57.431 39.768  1.00 0.00 ? 73  ARG B N     1 
ATOM 1488  C CA    . ARG B  1 67  ? 48.118  -57.398 40.936  1.00 0.00 ? 73  ARG B CA    1 
ATOM 1489  C C     . ARG B  1 67  ? 46.706  -57.332 40.492  1.00 0.00 ? 73  ARG B C     1 
ATOM 1490  O O     . ARG B  1 67  ? 45.849  -58.041 41.010  1.00 0.00 ? 73  ARG B O     1 
ATOM 1491  C CB    . ARG B  1 67  ? 48.412  -56.192 41.796  1.00 0.00 ? 73  ARG B CB    1 
ATOM 1492  C CG    . ARG B  1 67  ? 49.774  -56.177 42.422  1.00 0.00 ? 73  ARG B CG    1 
ATOM 1493  C CD    . ARG B  1 67  ? 50.006  -54.933 43.167  1.00 0.00 ? 73  ARG B CD    1 
ATOM 1494  N NE    . ARG B  1 67  ? 49.305  -54.906 44.439  1.00 0.00 ? 73  ARG B NE    1 
ATOM 1495  C CZ    . ARG B  1 67  ? 49.857  -55.273 45.611  1.00 0.00 ? 73  ARG B CZ    1 
ATOM 1496  N NH1   . ARG B  1 67  ? 51.084  -55.714 45.670  1.00 0.00 ? 73  ARG B NH1   1 
ATOM 1497  N NH2   . ARG B  1 67  ? 49.185  -55.177 46.734  1.00 0.00 ? 73  ARG B NH2   1 
ATOM 1498  N N     . ALA B  1 68  ? 46.470  -56.507 39.473  1.00 0.00 ? 74  ALA B N     1 
ATOM 1499  C CA    . ALA B  1 68  ? 45.137  -56.319 38.919  1.00 0.00 ? 74  ALA B CA    1 
ATOM 1500  C C     . ALA B  1 68  ? 44.556  -57.613 38.394  1.00 0.00 ? 74  ALA B C     1 
ATOM 1501  O O     . ALA B  1 68  ? 43.354  -57.833 38.502  1.00 0.00 ? 74  ALA B O     1 
ATOM 1502  C CB    . ALA B  1 68  ? 45.163  -55.290 37.826  1.00 0.00 ? 74  ALA B CB    1 
ATOM 1503  N N     . ILE B  1 69  ? 45.401  -58.485 37.854  1.00 0.00 ? 75  ILE B N     1 
ATOM 1504  C CA    . ILE B  1 69  ? 44.926  -59.782 37.405  1.00 0.00 ? 75  ILE B CA    1 
ATOM 1505  C C     . ILE B  1 69  ? 44.292  -60.525 38.542  1.00 0.00 ? 75  ILE B C     1 
ATOM 1506  O O     . ILE B  1 69  ? 43.188  -61.065 38.414  1.00 0.00 ? 75  ILE B O     1 
ATOM 1507  C CB    . ILE B  1 69  ? 46.061  -60.644 36.847  1.00 0.00 ? 75  ILE B CB    1 
ATOM 1508  C CG1   . ILE B  1 69  ? 46.580  -60.061 35.553  1.00 0.00 ? 75  ILE B CG1   1 
ATOM 1509  C CG2   . ILE B  1 69  ? 45.578  -62.067 36.643  1.00 0.00 ? 75  ILE B CG2   1 
ATOM 1510  C CD1   . ILE B  1 69  ? 47.862  -60.686 35.078  1.00 0.00 ? 75  ILE B CD1   1 
ATOM 1511  N N     . TYR B  1 70  ? 44.981  -60.550 39.663  1.00 0.00 ? 76  TYR B N     1 
ATOM 1512  C CA    . TYR B  1 70  ? 44.505  -61.280 40.807  1.00 0.00 ? 76  TYR B CA    1 
ATOM 1513  C C     . TYR B  1 70  ? 43.367  -60.561 41.498  1.00 0.00 ? 76  TYR B C     1 
ATOM 1514  O O     . TYR B  1 70  ? 42.488  -61.198 42.069  1.00 0.00 ? 76  TYR B O     1 
ATOM 1515  C CB    . TYR B  1 70  ? 45.642  -61.528 41.749  1.00 0.00 ? 76  TYR B CB    1 
ATOM 1516  C CG    . TYR B  1 70  ? 46.693  -62.383 41.118  1.00 0.00 ? 76  TYR B CG    1 
ATOM 1517  C CD1   . TYR B  1 70  ? 47.940  -61.861 40.882  1.00 0.00 ? 76  TYR B CD1   1 
ATOM 1518  C CD2   . TYR B  1 70  ? 46.392  -63.668 40.725  1.00 0.00 ? 76  TYR B CD2   1 
ATOM 1519  C CE1   . TYR B  1 70  ? 48.896  -62.620 40.253  1.00 0.00 ? 76  TYR B CE1   1 
ATOM 1520  C CE2   . TYR B  1 70  ? 47.346  -64.435 40.095  1.00 0.00 ? 76  TYR B CE2   1 
ATOM 1521  C CZ    . TYR B  1 70  ? 48.593  -63.907 39.856  1.00 0.00 ? 76  TYR B CZ    1 
ATOM 1522  O OH    . TYR B  1 70  ? 49.546  -64.653 39.211  1.00 0.00 ? 76  TYR B OH    1 
ATOM 1523  N N     . GLN B  1 71  ? 43.348  -59.236 41.406  1.00 0.00 ? 77  GLN B N     1 
ATOM 1524  C CA    . GLN B  1 71  ? 42.250  -58.478 41.962  1.00 0.00 ? 77  GLN B CA    1 
ATOM 1525  C C     . GLN B  1 71  ? 40.982  -58.792 41.221  1.00 0.00 ? 77  GLN B C     1 
ATOM 1526  O O     . GLN B  1 71  ? 39.943  -59.009 41.832  1.00 0.00 ? 77  GLN B O     1 
ATOM 1527  C CB    . GLN B  1 71  ? 42.526  -56.976 41.894  1.00 0.00 ? 77  GLN B CB    1 
ATOM 1528  C CG    . GLN B  1 71  ? 43.608  -56.487 42.835  1.00 0.00 ? 77  GLN B CG    1 
ATOM 1529  C CD    . GLN B  1 71  ? 43.219  -56.674 44.269  1.00 0.00 ? 77  GLN B CD    1 
ATOM 1530  O OE1   . GLN B  1 71  ? 42.219  -57.334 44.554  1.00 0.00 ? 77  GLN B OE1   1 
ATOM 1531  N NE2   . GLN B  1 71  ? 43.981  -56.092 45.187  1.00 0.00 ? 77  GLN B NE2   1 
ATOM 1532  N N     . GLY B  1 72  ? 41.075  -58.873 39.896  1.00 0.00 ? 78  GLY B N     1 
ATOM 1533  C CA    . GLY B  1 72  ? 39.925  -59.214 39.071  1.00 0.00 ? 78  GLY B CA    1 
ATOM 1534  C C     . GLY B  1 72  ? 39.407  -60.585 39.434  1.00 0.00 ? 78  GLY B C     1 
ATOM 1535  O O     . GLY B  1 72  ? 38.205  -60.778 39.612  1.00 0.00 ? 78  GLY B O     1 
ATOM 1536  N N     . PHE B  1 73  ? 40.321  -61.528 39.567  1.00 0.00 ? 79  PHE B N     1 
ATOM 1537  C CA    . PHE B  1 73  ? 39.977  -62.868 39.960  1.00 0.00 ? 79  PHE B CA    1 
ATOM 1538  C C     . PHE B  1 73  ? 39.266  -62.895 41.294  1.00 0.00 ? 79  PHE B C     1 
ATOM 1539  O O     . PHE B  1 73  ? 38.187  -63.467 41.409  1.00 0.00 ? 79  PHE B O     1 
ATOM 1540  C CB    . PHE B  1 73  ? 41.223  -63.717 40.026  1.00 0.00 ? 79  PHE B CB    1 
ATOM 1541  C CG    . PHE B  1 73  ? 41.011  -65.059 40.634  1.00 0.00 ? 79  PHE B CG    1 
ATOM 1542  C CD1   . PHE B  1 73  ? 40.395  -66.075 39.935  1.00 0.00 ? 79  PHE B CD1   1 
ATOM 1543  C CD2   . PHE B  1 73  ? 41.453  -65.310 41.914  1.00 0.00 ? 79  PHE B CD2   1 
ATOM 1544  C CE1   . PHE B  1 73  ? 40.231  -67.317 40.507  1.00 0.00 ? 79  PHE B CE1   1 
ATOM 1545  C CE2   . PHE B  1 73  ? 41.290  -66.543 42.488  1.00 0.00 ? 79  PHE B CE2   1 
ATOM 1546  C CZ    . PHE B  1 73  ? 40.677  -67.551 41.783  1.00 0.00 ? 79  PHE B CZ    1 
ATOM 1547  N N     . GLY B  1 74  ? 39.869  -62.273 42.299  1.00 0.00 ? 80  GLY B N     1 
ATOM 1548  C CA    . GLY B  1 74  ? 39.315  -62.261 43.641  1.00 0.00 ? 80  GLY B CA    1 
ATOM 1549  C C     . GLY B  1 74  ? 37.944  -61.639 43.679  1.00 0.00 ? 80  GLY B C     1 
ATOM 1550  O O     . GLY B  1 74  ? 37.025  -62.179 44.288  1.00 0.00 ? 80  GLY B O     1 
ATOM 1551  N N     . LEU B  1 75  ? 37.793  -60.517 43.015  1.00 0.00 ? 81  LEU B N     1 
ATOM 1552  C CA    . LEU B  1 75  ? 36.528  -59.834 42.985  1.00 0.00 ? 81  LEU B CA    1 
ATOM 1553  C C     . LEU B  1 75  ? 35.453  -60.700 42.364  1.00 0.00 ? 81  LEU B C     1 
ATOM 1554  O O     . LEU B  1 75  ? 34.320  -60.728 42.839  1.00 0.00 ? 81  LEU B O     1 
ATOM 1555  C CB    . LEU B  1 75  ? 36.669  -58.546 42.207  1.00 0.00 ? 81  LEU B CB    1 
ATOM 1556  C CG    . LEU B  1 75  ? 37.493  -57.463 42.880  1.00 0.00 ? 81  LEU B CG    1 
ATOM 1557  C CD1   . LEU B  1 75  ? 37.742  -56.340 41.891  1.00 0.00 ? 81  LEU B CD1   1 
ATOM 1558  C CD2   . LEU B  1 75  ? 36.746  -56.963 44.095  1.00 0.00 ? 81  LEU B CD2   1 
ATOM 1559  N N     . LYS B  1 76  ? 35.816  -61.426 41.320  1.00 0.00 ? 82  LYS B N     1 
ATOM 1560  C CA    . LYS B  1 76  ? 34.885  -62.301 40.648  1.00 0.00 ? 82  LYS B CA    1 
ATOM 1561  C C     . LYS B  1 76  ? 34.491  -63.467 41.539  1.00 0.00 ? 82  LYS B C     1 
ATOM 1562  O O     . LYS B  1 76  ? 33.334  -63.883 41.542  1.00 0.00 ? 82  LYS B O     1 
ATOM 1563  C CB    . LYS B  1 76  ? 35.479  -62.768 39.335  1.00 0.00 ? 82  LYS B CB    1 
ATOM 1564  C CG    . LYS B  1 76  ? 34.545  -63.572 38.463  1.00 0.00 ? 82  LYS B CG    1 
ATOM 1565  C CD    . LYS B  1 76  ? 35.096  -63.668 37.053  1.00 0.00 ? 82  LYS B CD    1 
ATOM 1566  C CE    . LYS B  1 76  ? 34.298  -64.634 36.209  1.00 0.00 ? 82  LYS B CE    1 
ATOM 1567  N NZ    . LYS B  1 76  ? 32.959  -64.119 35.884  1.00 0.00 ? 82  LYS B NZ    1 
ATOM 1568  N N     . VAL B  1 77  ? 35.438  -63.965 42.330  1.00 0.00 ? 83  VAL B N     1 
ATOM 1569  C CA    . VAL B  1 77  ? 35.129  -65.006 43.298  1.00 0.00 ? 83  VAL B CA    1 
ATOM 1570  C C     . VAL B  1 77  ? 34.092  -64.516 44.284  1.00 0.00 ? 83  VAL B C     1 
ATOM 1571  O O     . VAL B  1 77  ? 33.111  -65.203 44.563  1.00 0.00 ? 83  VAL B O     1 
ATOM 1572  C CB    . VAL B  1 77  ? 36.393  -65.445 44.070  1.00 0.00 ? 83  VAL B CB    1 
ATOM 1573  C CG1   . VAL B  1 77  ? 36.009  -66.345 45.225  1.00 0.00 ? 83  VAL B CG1   1 
ATOM 1574  C CG2   . VAL B  1 77  ? 37.347  -66.170 43.144  1.00 0.00 ? 83  VAL B CG2   1 
ATOM 1575  N N     . ALA B  1 78  ? 34.312  -63.314 44.804  1.00 0.00 ? 84  ALA B N     1 
ATOM 1576  C CA    . ALA B  1 78  ? 33.407  -62.715 45.762  1.00 0.00 ? 84  ALA B CA    1 
ATOM 1577  C C     . ALA B  1 78  ? 32.031  -62.484 45.155  1.00 0.00 ? 84  ALA B C     1 
ATOM 1578  O O     . ALA B  1 78  ? 31.018  -62.695 45.814  1.00 0.00 ? 84  ALA B O     1 
ATOM 1579  C CB    . ALA B  1 78  ? 33.986  -61.417 46.275  1.00 0.00 ? 84  ALA B CB    1 
ATOM 1580  N N     . ARG B  1 79  ? 31.996  -62.065 43.893  1.00 0.00 ? 85  ARG B N     1 
ATOM 1581  C CA    . ARG B  1 79  ? 30.736  -61.896 43.194  1.00 0.00 ? 85  ARG B CA    1 
ATOM 1582  C C     . ARG B  1 79  ? 29.903  -63.139 43.238  1.00 0.00 ? 85  ARG B C     1 
ATOM 1583  O O     . ARG B  1 79  ? 28.728  -63.099 43.606  1.00 0.00 ? 85  ARG B O     1 
ATOM 1584  C CB    . ARG B  1 79  ? 30.954  -61.546 41.755  1.00 0.00 ? 85  ARG B CB    1 
ATOM 1585  C CG    . ARG B  1 79  ? 29.675  -61.526 40.950  1.00 0.00 ? 85  ARG B CG    1 
ATOM 1586  C CD    . ARG B  1 79  ? 29.928  -61.337 39.514  1.00 0.00 ? 85  ARG B CD    1 
ATOM 1587  N NE    . ARG B  1 79  ? 28.743  -61.607 38.734  1.00 0.00 ? 85  ARG B NE    1 
ATOM 1588  C CZ    . ARG B  1 79  ? 28.735  -61.856 37.415  1.00 0.00 ? 85  ARG B CZ    1 
ATOM 1589  N NH1   . ARG B  1 79  ? 29.850  -61.847 36.726  1.00 0.00 ? 85  ARG B NH1   1 
ATOM 1590  N NH2   . ARG B  1 79  ? 27.597  -62.120 36.804  1.00 0.00 ? 85  ARG B NH2   1 
ATOM 1591  N N     . ALA B  1 80  ? 30.507  -64.249 42.843  1.00 0.00 ? 86  ALA B N     1 
ATOM 1592  C CA    . ALA B  1 80  ? 29.822  -65.520 42.823  1.00 0.00 ? 86  ALA B CA    1 
ATOM 1593  C C     . ALA B  1 80  ? 29.341  -65.883 44.204  1.00 0.00 ? 86  ALA B C     1 
ATOM 1594  O O     . ALA B  1 80  ? 28.229  -66.372 44.374  1.00 0.00 ? 86  ALA B O     1 
ATOM 1595  C CB    . ALA B  1 80  ? 30.735  -66.591 42.289  1.00 0.00 ? 86  ALA B CB    1 
ATOM 1596  N N     . LEU B  1 81  ? 30.157  -65.608 45.203  1.00 0.00 ? 87  LEU B N     1 
ATOM 1597  C CA    . LEU B  1 81  ? 29.761  -65.867 46.555  1.00 0.00 ? 87  LEU B CA    1 
ATOM 1598  C C     . LEU B  1 81  ? 28.470  -65.145 46.879  1.00 0.00 ? 87  LEU B C     1 
ATOM 1599  O O     . LEU B  1 81  ? 27.543  -65.746 47.404  1.00 0.00 ? 87  LEU B O     1 
ATOM 1600  C CB    . LEU B  1 81  ? 30.857  -65.455 47.521  1.00 0.00 ? 87  LEU B CB    1 
ATOM 1601  C CG    . LEU B  1 81  ? 30.532  -65.630 48.993  1.00 0.00 ? 87  LEU B CG    1 
ATOM 1602  C CD1   . LEU B  1 81  ? 30.252  -67.091 49.275  1.00 0.00 ? 87  LEU B CD1   1 
ATOM 1603  C CD2   . LEU B  1 81  ? 31.703  -65.132 49.821  1.00 0.00 ? 87  LEU B CD2   1 
ATOM 1604  N N     . ASN B  1 82  ? 28.383  -63.871 46.530  1.00 0.00 ? 88  ASN B N     1 
ATOM 1605  C CA    . ASN B  1 82  ? 27.165  -63.113 46.806  1.00 0.00 ? 88  ASN B CA    1 
ATOM 1606  C C     . ASN B  1 82  ? 25.936  -63.639 46.062  1.00 0.00 ? 88  ASN B C     1 
ATOM 1607  O O     . ASN B  1 82  ? 24.855  -63.740 46.639  1.00 0.00 ? 88  ASN B O     1 
ATOM 1608  C CB    . ASN B  1 82  ? 27.348  -61.650 46.475  1.00 0.00 ? 88  ASN B CB    1 
ATOM 1609  C CG    . ASN B  1 82  ? 28.166  -60.923 47.485  1.00 0.00 ? 88  ASN B CG    1 
ATOM 1610  O OD1   . ASN B  1 82  ? 28.442  -61.436 48.571  1.00 0.00 ? 88  ASN B OD1   1 
ATOM 1611  N ND2   . ASN B  1 82  ? 28.539  -59.720 47.161  1.00 0.00 ? 88  ASN B ND2   1 
ATOM 1612  N N     . ARG B  1 83  ? 26.092  -63.945 44.781  1.00 0.00 ? 89  ARG B N     1 
ATOM 1613  C CA    . ARG B  1 83  ? 24.945  -64.329 43.959  1.00 0.00 ? 89  ARG B CA    1 
ATOM 1614  C C     . ARG B  1 83  ? 24.578  -65.813 44.081  1.00 0.00 ? 89  ARG B C     1 
ATOM 1615  O O     . ARG B  1 83  ? 23.431  -66.188 43.855  1.00 0.00 ? 89  ARG B O     1 
ATOM 1616  C CB    . ARG B  1 83  ? 25.205  -63.971 42.504  1.00 0.00 ? 89  ARG B CB    1 
ATOM 1617  C CG    . ARG B  1 83  ? 25.249  -62.461 42.220  1.00 0.00 ? 89  ARG B CG    1 
ATOM 1618  C CD    . ARG B  1 83  ? 25.547  -62.167 40.789  1.00 0.00 ? 89  ARG B CD    1 
ATOM 1619  N NE    . ARG B  1 83  ? 25.744  -60.731 40.533  1.00 0.00 ? 89  ARG B NE    1 
ATOM 1620  C CZ    . ARG B  1 83  ? 24.778  -59.858 40.185  1.00 0.00 ? 89  ARG B CZ    1 
ATOM 1621  N NH1   . ARG B  1 83  ? 23.538  -60.260 40.045  1.00 0.00 ? 89  ARG B NH1   1 
ATOM 1622  N NH2   . ARG B  1 83  ? 25.084  -58.595 39.975  1.00 0.00 ? 89  ARG B NH2   1 
ATOM 1623  N N     . ILE B  1 84  ? 25.543  -66.643 44.446  1.00 0.00 ? 90  ILE B N     1 
ATOM 1624  C CA    . ILE B  1 84  ? 25.313  -68.081 44.617  1.00 0.00 ? 90  ILE B CA    1 
ATOM 1625  C C     . ILE B  1 84  ? 25.259  -68.479 46.083  1.00 0.00 ? 90  ILE B C     1 
ATOM 1626  O O     . ILE B  1 84  ? 24.374  -69.226 46.508  1.00 0.00 ? 90  ILE B O     1 
ATOM 1627  C CB    . ILE B  1 84  ? 26.410  -68.916 43.927  1.00 0.00 ? 90  ILE B CB    1 
ATOM 1628  C CG1   . ILE B  1 84  ? 26.388  -68.705 42.421  1.00 0.00 ? 90  ILE B CG1   1 
ATOM 1629  C CG2   . ILE B  1 84  ? 26.240  -70.375 44.255  1.00 0.00 ? 90  ILE B CG2   1 
ATOM 1630  C CD1   . ILE B  1 84  ? 27.560  -69.343 41.714  1.00 0.00 ? 90  ILE B CD1   1 
ATOM 1631  N N     . GLY B  1 85  ? 26.256  -68.050 46.837  1.00 0.00 ? 91  GLY B N     1 
ATOM 1632  C CA    . GLY B  1 85  ? 26.377  -68.449 48.231  1.00 0.00 ? 91  GLY B CA    1 
ATOM 1633  C C     . GLY B  1 85  ? 27.353  -69.593 48.330  1.00 0.00 ? 91  GLY B C     1 
ATOM 1634  O O     . GLY B  1 85  ? 27.634  -70.251 47.336  1.00 0.00 ? 91  GLY B O     1 
ATOM 1635  N N     . SER B  1 86  ? 27.880  -69.834 49.520  1.00 0.00 ? 92  SER B N     1 
ATOM 1636  C CA    . SER B  1 86  ? 28.876  -70.884 49.687  1.00 0.00 ? 92  SER B CA    1 
ATOM 1637  C C     . SER B  1 86  ? 28.266  -72.252 49.516  1.00 0.00 ? 92  SER B C     1 
ATOM 1638  O O     . SER B  1 86  ? 27.054  -72.425 49.652  1.00 0.00 ? 92  SER B O     1 
ATOM 1639  C CB    . SER B  1 86  ? 29.522  -70.789 51.041  1.00 0.00 ? 92  SER B CB    1 
ATOM 1640  O OG    . SER B  1 86  ? 28.611  -71.121 52.048  1.00 0.00 ? 92  SER B OG    1 
ATOM 1641  N N     . GLY B  1 87  ? 29.114  -73.236 49.247  1.00 0.00 ? 93  GLY B N     1 
ATOM 1642  C CA    . GLY B  1 87  ? 28.660  -74.598 49.045  1.00 0.00 ? 93  GLY B CA    1 
ATOM 1643  C C     . GLY B  1 87  ? 28.973  -75.073 47.634  1.00 0.00 ? 93  GLY B C     1 
ATOM 1644  O O     . GLY B  1 87  ? 29.574  -74.342 46.849  1.00 0.00 ? 93  GLY B O     1 
ATOM 1645  N N     . PRO B  1 88  ? 28.572  -76.303 47.334  1.00 0.00 ? 94  PRO B N     1 
ATOM 1646  C CA    . PRO B  1 88  ? 28.746  -77.032 46.064  1.00 0.00 ? 94  PRO B CA    1 
ATOM 1647  C C     . PRO B  1 88  ? 28.861  -76.123 44.845  1.00 0.00 ? 94  PRO B C     1 
ATOM 1648  O O     . PRO B  1 88  ? 29.883  -76.130 44.161  1.00 0.00 ? 94  PRO B O     1 
ATOM 1649  C CB    . PRO B  1 88  ? 27.473  -77.881 45.972  1.00 0.00 ? 94  PRO B CB    1 
ATOM 1650  C CG    . PRO B  1 88  ? 27.066  -78.067 47.373  1.00 0.00 ? 94  PRO B CG    1 
ATOM 1651  C CD    . PRO B  1 88  ? 27.330  -76.737 47.989  1.00 0.00 ? 94  PRO B CD    1 
ATOM 1652  N N     . ALA B  1 89  ? 27.801  -75.375 44.553  1.00 0.00 ? 95  ALA B N     1 
ATOM 1653  C CA    . ALA B  1 89  ? 27.758  -74.550 43.356  1.00 0.00 ? 95  ALA B CA    1 
ATOM 1654  C C     . ALA B  1 89  ? 28.891  -73.556 43.304  1.00 0.00 ? 95  ALA B C     1 
ATOM 1655  O O     . ALA B  1 89  ? 29.422  -73.282 42.228  1.00 0.00 ? 95  ALA B O     1 
ATOM 1656  C CB    . ALA B  1 89  ? 26.437  -73.831 43.275  1.00 0.00 ? 95  ALA B CB    1 
ATOM 1657  N N     . LEU B  1 90  ? 29.262  -73.004 44.449  1.00 0.00 ? 96  LEU B N     1 
ATOM 1658  C CA    . LEU B  1 90  ? 30.336  -72.041 44.482  1.00 0.00 ? 96  LEU B CA    1 
ATOM 1659  C C     . LEU B  1 90  ? 31.617  -72.703 44.122  1.00 0.00 ? 96  LEU B C     1 
ATOM 1660  O O     . LEU B  1 90  ? 32.416  -72.155 43.375  1.00 0.00 ? 96  LEU B O     1 
ATOM 1661  C CB    . LEU B  1 90  ? 30.479  -71.408 45.839  1.00 0.00 ? 96  LEU B CB    1 
ATOM 1662  C CG    . LEU B  1 90  ? 31.557  -70.341 45.915  1.00 0.00 ? 96  LEU B CG    1 
ATOM 1663  C CD1   . LEU B  1 90  ? 31.212  -69.219 44.948  1.00 0.00 ? 96  LEU B CD1   1 
ATOM 1664  C CD2   . LEU B  1 90  ? 31.671  -69.828 47.327  1.00 0.00 ? 96  LEU B CD2   1 
ATOM 1665  N N     . VAL B  1 91  ? 31.826  -73.888 44.663  1.00 0.00 ? 97  VAL B N     1 
ATOM 1666  C CA    . VAL B  1 91  ? 33.020  -74.644 44.361  1.00 0.00 ? 97  VAL B CA    1 
ATOM 1667  C C     . VAL B  1 91  ? 33.102  -74.932 42.877  1.00 0.00 ? 97  VAL B C     1 
ATOM 1668  O O     . VAL B  1 91  ? 34.158  -74.771 42.267  1.00 0.00 ? 97  VAL B O     1 
ATOM 1669  C CB    . VAL B  1 91  ? 33.051  -75.952 45.156  1.00 0.00 ? 97  VAL B CB    1 
ATOM 1670  C CG1   . VAL B  1 91  ? 34.187  -76.833 44.674  1.00 0.00 ? 97  VAL B CG1   1 
ATOM 1671  C CG2   . VAL B  1 91  ? 33.209  -75.632 46.629  1.00 0.00 ? 97  VAL B CG2   1 
ATOM 1672  N N     . ASN B  1 92  ? 31.972  -75.325 42.287  1.00 0.00 ? 98  ASN B N     1 
ATOM 1673  C CA    . ASN B  1 92  ? 31.913  -75.580 40.859  1.00 0.00 ? 98  ASN B CA    1 
ATOM 1674  C C     . ASN B  1 92  ? 32.340  -74.346 40.091  1.00 0.00 ? 98  ASN B C     1 
ATOM 1675  O O     . ASN B  1 92  ? 33.156  -74.423 39.166  1.00 0.00 ? 98  ASN B O     1 
ATOM 1676  C CB    . ASN B  1 92  ? 30.513  -76.003 40.453  1.00 0.00 ? 98  ASN B CB    1 
ATOM 1677  C CG    . ASN B  1 92  ? 30.193  -77.380 40.923  1.00 0.00 ? 98  ASN B CG    1 
ATOM 1678  O OD1   . ASN B  1 92  ? 31.106  -78.123 41.296  1.00 0.00 ? 98  ASN B OD1   1 
ATOM 1679  N ND2   . ASN B  1 92  ? 28.934  -77.752 40.914  1.00 0.00 ? 98  ASN B ND2   1 
ATOM 1680  N N     . MET B  1 93  ? 31.830  -73.199 40.519  1.00 0.00 ? 99  MET B N     1 
ATOM 1681  C CA    . MET B  1 93  ? 32.172  -71.942 39.914  1.00 0.00 ? 99  MET B CA    1 
ATOM 1682  C C     . MET B  1 93  ? 33.638  -71.642 40.011  1.00 0.00 ? 99  MET B C     1 
ATOM 1683  O O     . MET B  1 93  ? 34.270  -71.301 39.011  1.00 0.00 ? 99  MET B O     1 
ATOM 1684  C CB    . MET B  1 93  ? 31.396  -70.825 40.567  1.00 0.00 ? 99  MET B CB    1 
ATOM 1685  C CG    . MET B  1 93  ? 31.771  -69.464 40.058  1.00 0.00 ? 99  MET B CG    1 
ATOM 1686  S SD    . MET B  1 93  ? 31.327  -69.231 38.358  1.00 0.00 ? 99  MET B SD    1 
ATOM 1687  C CE    . MET B  1 93  ? 29.582  -68.890 38.552  1.00 0.00 ? 99  MET B CE    1 
ATOM 1688  N N     . ILE B  1 94  ? 34.179  -71.745 41.214  1.00 0.00 ? 100 ILE B N     1 
ATOM 1689  C CA    . ILE B  1 94  ? 35.554  -71.382 41.449  1.00 0.00 ? 100 ILE B CA    1 
ATOM 1690  C C     . ILE B  1 94  ? 36.489  -72.243 40.664  1.00 0.00 ? 100 ILE B C     1 
ATOM 1691  O O     . ILE B  1 94  ? 37.484  -71.754 40.145  1.00 0.00 ? 100 ILE B O     1 
ATOM 1692  C CB    . ILE B  1 94  ? 35.917  -71.456 42.919  1.00 0.00 ? 100 ILE B CB    1 
ATOM 1693  C CG1   . ILE B  1 94  ? 35.166  -70.387 43.700  1.00 0.00 ? 100 ILE B CG1   1 
ATOM 1694  C CG2   . ILE B  1 94  ? 37.409  -71.243 43.073  1.00 0.00 ? 100 ILE B CG2   1 
ATOM 1695  C CD1   . ILE B  1 94  ? 35.257  -70.562 45.194  1.00 0.00 ? 100 ILE B CD1   1 
ATOM 1696  N N     . ASN B  1 95  ? 36.194  -73.535 40.579  1.00 0.00 ? 101 ASN B N     1 
ATOM 1697  C CA    . ASN B  1 95  ? 37.041  -74.438 39.819  1.00 0.00 ? 101 ASN B CA    1 
ATOM 1698  C C     . ASN B  1 95  ? 37.189  -73.971 38.386  1.00 0.00 ? 101 ASN B C     1 
ATOM 1699  O O     . ASN B  1 95  ? 38.303  -73.925 37.854  1.00 0.00 ? 101 ASN B O     1 
ATOM 1700  C CB    . ASN B  1 95  ? 36.494  -75.848 39.849  1.00 0.00 ? 101 ASN B CB    1 
ATOM 1701  C CG    . ASN B  1 95  ? 36.695  -76.507 41.168  1.00 0.00 ? 101 ASN B CG    1 
ATOM 1702  O OD1   . ASN B  1 95  ? 37.429  -75.979 42.009  1.00 0.00 ? 101 ASN B OD1   1 
ATOM 1703  N ND2   . ASN B  1 95  ? 36.079  -77.651 41.363  1.00 0.00 ? 101 ASN B ND2   1 
ATOM 1704  N N     . GLY B  1 96  ? 36.068  -73.596 37.765  1.00 0.00 ? 102 GLY B N     1 
ATOM 1705  C CA    . GLY B  1 96  ? 36.100  -73.122 36.393  1.00 0.00 ? 102 GLY B CA    1 
ATOM 1706  C C     . GLY B  1 96  ? 36.768  -71.780 36.287  1.00 0.00 ? 102 GLY B C     1 
ATOM 1707  O O     . GLY B  1 96  ? 37.546  -71.541 35.365  1.00 0.00 ? 102 GLY B O     1 
ATOM 1708  N N     . LEU B  1 97  ? 36.483  -70.910 37.238  1.00 0.00 ? 103 LEU B N     1 
ATOM 1709  C CA    . LEU B  1 97  ? 37.064  -69.589 37.264  1.00 0.00 ? 103 LEU B CA    1 
ATOM 1710  C C     . LEU B  1 97  ? 38.566  -69.623 37.402  1.00 0.00 ? 103 LEU B C     1 
ATOM 1711  O O     . LEU B  1 97  ? 39.278  -68.887 36.721  1.00 0.00 ? 103 LEU B O     1 
ATOM 1712  C CB    . LEU B  1 97  ? 36.469  -68.787 38.387  1.00 0.00 ? 103 LEU B CB    1 
ATOM 1713  C CG    . LEU B  1 97  ? 37.076  -67.423 38.550  1.00 0.00 ? 103 LEU B CG    1 
ATOM 1714  C CD1   . LEU B  1 97  ? 36.946  -66.696 37.252  1.00 0.00 ? 103 LEU B CD1   1 
ATOM 1715  C CD2   . LEU B  1 97  ? 36.365  -66.686 39.664  1.00 0.00 ? 103 LEU B CD2   1 
ATOM 1716  N N     . LYS B  1 98  ? 39.047  -70.429 38.318  1.00 0.00 ? 104 LYS B N     1 
ATOM 1717  C CA    . LYS B  1 98  ? 40.458  -70.577 38.516  1.00 0.00 ? 104 LYS B CA    1 
ATOM 1718  C C     . LYS B  1 98  ? 41.137  -71.021 37.244  1.00 0.00 ? 104 LYS B C     1 
ATOM 1719  O O     . LYS B  1 98  ? 42.072  -70.372 36.781  1.00 0.00 ? 104 LYS B O     1 
ATOM 1720  C CB    . LYS B  1 98  ? 40.733  -71.558 39.634  1.00 0.00 ? 104 LYS B CB    1 
ATOM 1721  C CG    . LYS B  1 98  ? 42.204  -71.802 39.881  1.00 0.00 ? 104 LYS B CG    1 
ATOM 1722  C CD    . LYS B  1 98  ? 42.419  -72.765 41.030  1.00 0.00 ? 104 LYS B CD    1 
ATOM 1723  C CE    . LYS B  1 98  ? 43.872  -73.195 41.118  1.00 0.00 ? 104 LYS B CE    1 
ATOM 1724  N NZ    . LYS B  1 98  ? 44.102  -74.128 42.246  1.00 0.00 ? 104 LYS B NZ    1 
ATOM 1725  N N     . GLY B  1 99  ? 40.652  -72.119 36.659  1.00 0.00 ? 105 GLY B N     1 
ATOM 1726  C CA    . GLY B  1 99  ? 41.229  -72.647 35.426  1.00 0.00 ? 105 GLY B CA    1 
ATOM 1727  C C     . GLY B  1 99  ? 41.213  -71.598 34.332  1.00 0.00 ? 105 GLY B C     1 
ATOM 1728  O O     . GLY B  1 99  ? 42.189  -71.443 33.593  1.00 0.00 ? 105 GLY B O     1 
ATOM 1729  N N     . TYR B  1 100 ? 40.107  -70.868 34.254  1.00 0.00 ? 106 TYR B N     1 
ATOM 1730  C CA    . TYR B  1 100 ? 39.940  -69.786 33.310  1.00 0.00 ? 106 TYR B CA    1 
ATOM 1731  C C     . TYR B  1 100 ? 41.073  -68.803 33.382  1.00 0.00 ? 106 TYR B C     1 
ATOM 1732  O O     . TYR B  1 100 ? 41.735  -68.557 32.390  1.00 0.00 ? 106 TYR B O     1 
ATOM 1733  C CB    . TYR B  1 100 ? 38.612  -69.101 33.577  1.00 0.00 ? 106 TYR B CB    1 
ATOM 1734  C CG    . TYR B  1 100 ? 38.380  -67.808 32.847  1.00 0.00 ? 106 TYR B CG    1 
ATOM 1735  C CD1   . TYR B  1 100 ? 38.195  -67.781 31.484  1.00 0.00 ? 106 TYR B CD1   1 
ATOM 1736  C CD2   . TYR B  1 100 ? 38.303  -66.642 33.573  1.00 0.00 ? 106 TYR B CD2   1 
ATOM 1737  C CE1   . TYR B  1 100 ? 37.952  -66.583 30.846  1.00 0.00 ? 106 TYR B CE1   1 
ATOM 1738  C CE2   . TYR B  1 100 ? 38.056  -65.449 32.947  1.00 0.00 ? 106 TYR B CE2   1 
ATOM 1739  C CZ    . TYR B  1 100 ? 37.884  -65.414 31.588  1.00 0.00 ? 106 TYR B CZ    1 
ATOM 1740  O OH    . TYR B  1 100 ? 37.639  -64.216 30.966  1.00 0.00 ? 106 TYR B OH    1 
ATOM 1741  N N     . TYR B  1 101 ? 41.330  -68.269 34.560  1.00 0.00 ? 107 TYR B N     1 
ATOM 1742  C CA    . TYR B  1 101 ? 42.414  -67.315 34.718  1.00 0.00 ? 107 TYR B CA    1 
ATOM 1743  C C     . TYR B  1 101 ? 43.783  -67.905 34.478  1.00 0.00 ? 107 TYR B C     1 
ATOM 1744  O O     . TYR B  1 101 ? 44.643  -67.253 33.879  1.00 0.00 ? 107 TYR B O     1 
ATOM 1745  C CB    . TYR B  1 101 ? 42.362  -66.681 36.089  1.00 0.00 ? 107 TYR B CB    1 
ATOM 1746  C CG    . TYR B  1 101 ? 41.613  -65.393 36.105  1.00 0.00 ? 107 TYR B CG    1 
ATOM 1747  C CD1   . TYR B  1 101 ? 40.251  -65.368 36.283  1.00 0.00 ? 107 TYR B CD1   1 
ATOM 1748  C CD2   . TYR B  1 101 ? 42.315  -64.218 35.943  1.00 0.00 ? 107 TYR B CD2   1 
ATOM 1749  C CE1   . TYR B  1 101 ? 39.585  -64.161 36.286  1.00 0.00 ? 107 TYR B CE1   1 
ATOM 1750  C CE2   . TYR B  1 101 ? 41.654  -63.015 35.947  1.00 0.00 ? 107 TYR B CE2   1 
ATOM 1751  C CZ    . TYR B  1 101 ? 40.297  -62.986 36.116  1.00 0.00 ? 107 TYR B CZ    1 
ATOM 1752  O OH    . TYR B  1 101 ? 39.642  -61.783 36.117  1.00 0.00 ? 107 TYR B OH    1 
ATOM 1753  N N     . ILE B  1 102 ? 43.988  -69.142 34.893  1.00 0.00 ? 108 ILE B N     1 
ATOM 1754  C CA    . ILE B  1 102 ? 45.279  -69.759 34.723  1.00 0.00 ? 108 ILE B CA    1 
ATOM 1755  C C     . ILE B  1 102 ? 45.675  -69.835 33.281  1.00 0.00 ? 108 ILE B C     1 
ATOM 1756  O O     . ILE B  1 102 ? 46.801  -69.514 32.927  1.00 0.00 ? 108 ILE B O     1 
ATOM 1757  C CB    . ILE B  1 102 ? 45.307  -71.171 35.293  1.00 0.00 ? 108 ILE B CB    1 
ATOM 1758  C CG1   . ILE B  1 102 ? 45.196  -71.139 36.796  1.00 0.00 ? 108 ILE B CG1   1 
ATOM 1759  C CG2   . ILE B  1 102 ? 46.592  -71.860 34.880  1.00 0.00 ? 108 ILE B CG2   1 
ATOM 1760  C CD1   . ILE B  1 102 ? 44.933  -72.488 37.409  1.00 0.00 ? 108 ILE B CD1   1 
ATOM 1761  N N     . SER B  1 103 ? 44.770  -70.294 32.444  1.00 0.00 ? 109 SER B N     1 
ATOM 1762  C CA    . SER B  1 103 ? 45.106  -70.502 31.056  1.00 0.00 ? 109 SER B CA    1 
ATOM 1763  C C     . SER B  1 103 ? 44.761  -69.332 30.151  1.00 0.00 ? 109 SER B C     1 
ATOM 1764  O O     . SER B  1 103 ? 45.426  -69.119 29.139  1.00 0.00 ? 109 SER B O     1 
ATOM 1765  C CB    . SER B  1 103 ? 44.418  -71.739 30.569  1.00 0.00 ? 109 SER B CB    1 
ATOM 1766  O OG    . SER B  1 103 ? 43.036  -71.595 30.648  1.00 0.00 ? 109 SER B OG    1 
ATOM 1767  N N     . ALA B  1 104 ? 43.741  -68.565 30.499  1.00 0.00 ? 110 ALA B N     1 
ATOM 1768  C CA    . ALA B  1 104 ? 43.368  -67.436 29.661  1.00 0.00 ? 110 ALA B CA    1 
ATOM 1769  C C     . ALA B  1 104 ? 44.306  -66.287 29.840  1.00 0.00 ? 110 ALA B C     1 
ATOM 1770  O O     . ALA B  1 104 ? 44.628  -65.609 28.872  1.00 0.00 ? 110 ALA B O     1 
ATOM 1771  C CB    . ALA B  1 104 ? 41.948  -66.968 29.950  1.00 0.00 ? 110 ALA B CB    1 
ATOM 1772  N N     . PHE B  1 105 ? 44.731  -66.042 31.086  1.00 0.00 ? 111 PHE B N     1 
ATOM 1773  C CA    . PHE B  1 105 ? 45.559  -64.889 31.382  1.00 0.00 ? 111 PHE B CA    1 
ATOM 1774  C C     . PHE B  1 105 ? 46.893  -65.254 31.963  1.00 0.00 ? 111 PHE B C     1 
ATOM 1775  O O     . PHE B  1 105 ? 47.629  -64.380 32.415  1.00 0.00 ? 111 PHE B O     1 
ATOM 1776  C CB    . PHE B  1 105 ? 44.839  -63.985 32.348  1.00 0.00 ? 111 PHE B CB    1 
ATOM 1777  C CG    . PHE B  1 105 ? 43.541  -63.529 31.816  1.00 0.00 ? 111 PHE B CG    1 
ATOM 1778  C CD1   . PHE B  1 105 ? 42.363  -63.968 32.376  1.00 0.00 ? 111 PHE B CD1   1 
ATOM 1779  C CD2   . PHE B  1 105 ? 43.490  -62.695 30.726  1.00 0.00 ? 111 PHE B CD2   1 
ATOM 1780  C CE1   . PHE B  1 105 ? 41.156  -63.570 31.866  1.00 0.00 ? 111 PHE B CE1   1 
ATOM 1781  C CE2   . PHE B  1 105 ? 42.289  -62.297 30.208  1.00 0.00 ? 111 PHE B CE2   1 
ATOM 1782  C CZ    . PHE B  1 105 ? 41.116  -62.733 30.780  1.00 0.00 ? 111 PHE B CZ    1 
ATOM 1783  N N     . ASN B  1 106 ? 47.208  -66.539 31.975  1.00 0.00 ? 112 ASN B N     1 
ATOM 1784  C CA    . ASN B  1 106 ? 48.472  -67.004 32.528  1.00 0.00 ? 112 ASN B CA    1 
ATOM 1785  C C     . ASN B  1 106 ? 48.618  -66.622 33.988  1.00 0.00 ? 112 ASN B C     1 
ATOM 1786  O O     . ASN B  1 106 ? 49.709  -66.270 34.434  1.00 0.00 ? 112 ASN B O     1 
ATOM 1787  C CB    . ASN B  1 106 ? 49.639  -66.481 31.726  1.00 0.00 ? 112 ASN B CB    1 
ATOM 1788  C CG    . ASN B  1 106 ? 49.622  -66.988 30.323  1.00 0.00 ? 112 ASN B CG    1 
ATOM 1789  O OD1   . ASN B  1 106 ? 49.205  -68.122 30.071  1.00 0.00 ? 112 ASN B OD1   1 
ATOM 1790  N ND2   . ASN B  1 106 ? 50.070  -66.178 29.403  1.00 0.00 ? 112 ASN B ND2   1 
ATOM 1791  N N     . ALA B  1 107 ? 47.521  -66.683 34.735  1.00 0.00 ? 113 ALA B N     1 
ATOM 1792  C CA    . ALA B  1 107 ? 47.576  -66.379 36.149  1.00 0.00 ? 113 ALA B CA    1 
ATOM 1793  C C     . ALA B  1 107 ? 48.236  -67.528 36.889  1.00 0.00 ? 113 ALA B C     1 
ATOM 1794  O O     . ALA B  1 107 ? 48.080  -68.687 36.511  1.00 0.00 ? 113 ALA B O     1 
ATOM 1795  C CB    . ALA B  1 107 ? 46.195  -66.110 36.684  1.00 0.00 ? 113 ALA B CB    1 
ATOM 1796  N N     . ASN B  1 108 ? 48.994  -67.202 37.927  1.00 0.00 ? 114 ASN B N     1 
ATOM 1797  C CA    . ASN B  1 108 ? 49.747  -68.202 38.668  1.00 0.00 ? 114 ASN B CA    1 
ATOM 1798  C C     . ASN B  1 108 ? 48.908  -68.890 39.750  1.00 0.00 ? 114 ASN B C     1 
ATOM 1799  O O     . ASN B  1 108 ? 48.657  -68.292 40.795  1.00 0.00 ? 114 ASN B O     1 
ATOM 1800  C CB    . ASN B  1 108 ? 50.963  -67.578 39.291  1.00 0.00 ? 114 ASN B CB    1 
ATOM 1801  C CG    . ASN B  1 108 ? 51.796  -68.577 40.015  1.00 0.00 ? 114 ASN B CG    1 
ATOM 1802  O OD1   . ASN B  1 108 ? 51.282  -69.567 40.544  1.00 0.00 ? 114 ASN B OD1   1 
ATOM 1803  N ND2   . ASN B  1 108 ? 53.080  -68.346 40.049  1.00 0.00 ? 114 ASN B ND2   1 
ATOM 1804  N N     . PRO B  1 109 ? 48.490  -70.152 39.509  1.00 0.00 ? 115 PRO B N     1 
ATOM 1805  C CA    . PRO B  1 109 ? 47.743  -71.036 40.428  1.00 0.00 ? 115 PRO B CA    1 
ATOM 1806  C C     . PRO B  1 109 ? 48.038  -70.777 41.898  1.00 0.00 ? 115 PRO B C     1 
ATOM 1807  O O     . PRO B  1 109 ? 47.124  -70.758 42.718  1.00 0.00 ? 115 PRO B O     1 
ATOM 1808  C CB    . PRO B  1 109 ? 48.242  -72.432 40.054  1.00 0.00 ? 115 PRO B CB    1 
ATOM 1809  C CG    . PRO B  1 109 ? 48.634  -72.314 38.644  1.00 0.00 ? 115 PRO B CG    1 
ATOM 1810  C CD    . PRO B  1 109 ? 49.279  -70.973 38.567  1.00 0.00 ? 115 PRO B CD    1 
ATOM 1811  N N     . GLN B  1 110 ? 49.310  -70.612 42.237  1.00 0.00 ? 116 GLN B N     1 
ATOM 1812  C CA    . GLN B  1 110 ? 49.708  -70.412 43.617  1.00 0.00 ? 116 GLN B CA    1 
ATOM 1813  C C     . GLN B  1 110 ? 49.112  -69.166 44.208  1.00 0.00 ? 116 GLN B C     1 
ATOM 1814  O O     . GLN B  1 110 ? 48.589  -69.181 45.325  1.00 0.00 ? 116 GLN B O     1 
ATOM 1815  C CB    . GLN B  1 110 ? 51.216  -70.342 43.727  1.00 0.00 ? 116 GLN B CB    1 
ATOM 1816  C CG    . GLN B  1 110 ? 51.705  -70.112 45.131  1.00 0.00 ? 116 GLN B CG    1 
ATOM 1817  C CD    . GLN B  1 110 ? 51.317  -71.234 46.046  1.00 0.00 ? 116 GLN B CD    1 
ATOM 1818  O OE1   . GLN B  1 110 ? 51.340  -72.400 45.648  1.00 0.00 ? 116 GLN B OE1   1 
ATOM 1819  N NE2   . GLN B  1 110 ? 50.955  -70.899 47.281  1.00 0.00 ? 116 GLN B NE2   1 
ATOM 1820  N N     . VAL B  1 111 ? 49.192  -68.083 43.477  1.00 0.00 ? 117 VAL B N     1 
ATOM 1821  C CA    . VAL B  1 111 ? 48.665  -66.851 43.963  1.00 0.00 ? 117 VAL B CA    1 
ATOM 1822  C C     . VAL B  1 111 ? 47.167  -66.907 43.937  1.00 0.00 ? 117 VAL B C     1 
ATOM 1823  O O     . VAL B  1 111 ? 46.511  -66.398 44.837  1.00 0.00 ? 117 VAL B O     1 
ATOM 1824  C CB    . VAL B  1 111 ? 49.163  -65.678 43.143  1.00 0.00 ? 117 VAL B CB    1 
ATOM 1825  C CG1   . VAL B  1 111 ? 48.493  -64.406 43.623  1.00 0.00 ? 117 VAL B CG1   1 
ATOM 1826  C CG2   . VAL B  1 111 ? 50.667  -65.573 43.259  1.00 0.00 ? 117 VAL B CG2   1 
ATOM 1827  N N     . LEU B  1 112 ? 46.619  -67.551 42.909  1.00 0.00 ? 118 LEU B N     1 
ATOM 1828  C CA    . LEU B  1 112 ? 45.177  -67.675 42.778  1.00 0.00 ? 118 LEU B CA    1 
ATOM 1829  C C     . LEU B  1 112 ? 44.597  -68.380 43.972  1.00 0.00 ? 118 LEU B C     1 
ATOM 1830  O O     . LEU B  1 112 ? 43.551  -67.988 44.486  1.00 0.00 ? 118 LEU B O     1 
ATOM 1831  C CB    . LEU B  1 112 ? 44.825  -68.455 41.524  1.00 0.00 ? 118 LEU B CB    1 
ATOM 1832  C CG    . LEU B  1 112 ? 45.120  -67.764 40.210  1.00 0.00 ? 118 LEU B CG    1 
ATOM 1833  C CD1   . LEU B  1 112 ? 44.891  -68.735 39.090  1.00 0.00 ? 118 LEU B CD1   1 
ATOM 1834  C CD2   . LEU B  1 112 ? 44.220  -66.569 40.060  1.00 0.00 ? 118 LEU B CD2   1 
ATOM 1835  N N     . ASP B  1 113 ? 45.293  -69.402 44.437  1.00 0.00 ? 119 ASP B N     1 
ATOM 1836  C CA    . ASP B  1 113 ? 44.868  -70.120 45.607  1.00 0.00 ? 119 ASP B CA    1 
ATOM 1837  C C     . ASP B  1 113 ? 44.930  -69.251 46.814  1.00 0.00 ? 119 ASP B C     1 
ATOM 1838  O O     . ASP B  1 113 ? 44.020  -69.271 47.634  1.00 0.00 ? 119 ASP B O     1 
ATOM 1839  C CB    . ASP B  1 113 ? 45.712  -71.349 45.804  1.00 0.00 ? 119 ASP B CB    1 
ATOM 1840  C CG    . ASP B  1 113 ? 45.366  -72.409 44.799  1.00 0.00 ? 119 ASP B CG    1 
ATOM 1841  O OD1   . ASP B  1 113 ? 44.282  -72.351 44.271  1.00 0.00 ? 119 ASP B OD1   1 
ATOM 1842  O OD2   . ASP B  1 113 ? 46.178  -73.263 44.546  1.00 0.00 ? 119 ASP B OD2   1 
ATOM 1843  N N     . ALA B  1 114 ? 45.979  -68.444 46.911  1.00 0.00 ? 120 ALA B N     1 
ATOM 1844  C CA    . ALA B  1 114 ? 46.110  -67.528 48.023  1.00 0.00 ? 120 ALA B CA    1 
ATOM 1845  C C     . ALA B  1 114 ? 44.934  -66.580 48.083  1.00 0.00 ? 120 ALA B C     1 
ATOM 1846  O O     . ALA B  1 114 ? 44.402  -66.323 49.156  1.00 0.00 ? 120 ALA B O     1 
ATOM 1847  C CB    . ALA B  1 114 ? 47.400  -66.754 47.918  1.00 0.00 ? 120 ALA B CB    1 
ATOM 1848  N N     . VAL B  1 115 ? 44.496  -66.090 46.926  1.00 0.00 ? 121 VAL B N     1 
ATOM 1849  C CA    . VAL B  1 115 ? 43.353  -65.197 46.876  1.00 0.00 ? 121 VAL B CA    1 
ATOM 1850  C C     . VAL B  1 115 ? 42.106  -65.888 47.385  1.00 0.00 ? 121 VAL B C     1 
ATOM 1851  O O     . VAL B  1 115 ? 41.379  -65.336 48.213  1.00 0.00 ? 121 VAL B O     1 
ATOM 1852  C CB    . VAL B  1 115 ? 43.106  -64.698 45.456  1.00 0.00 ? 121 VAL B CB    1 
ATOM 1853  C CG1   . VAL B  1 115 ? 41.798  -63.945 45.404  1.00 0.00 ? 121 VAL B CG1   1 
ATOM 1854  C CG2   . VAL B  1 115 ? 44.251  -63.803 45.011  1.00 0.00 ? 121 VAL B CG2   1 
ATOM 1855  N N     . VAL B  1 116 ? 41.881  -67.113 46.930  1.00 0.00 ? 122 VAL B N     1 
ATOM 1856  C CA    . VAL B  1 116 ? 40.736  -67.890 47.377  1.00 0.00 ? 122 VAL B CA    1 
ATOM 1857  C C     . VAL B  1 116 ? 40.817  -68.158 48.876  1.00 0.00 ? 122 VAL B C     1 
ATOM 1858  O O     . VAL B  1 116 ? 39.811  -68.111 49.582  1.00 0.00 ? 122 VAL B O     1 
ATOM 1859  C CB    . VAL B  1 116 ? 40.654  -69.217 46.613  1.00 0.00 ? 122 VAL B CB    1 
ATOM 1860  C CG1   . VAL B  1 116 ? 39.590  -70.101 47.208  1.00 0.00 ? 122 VAL B CG1   1 
ATOM 1861  C CG2   . VAL B  1 116 ? 40.348  -68.947 45.163  1.00 0.00 ? 122 VAL B CG2   1 
ATOM 1862  N N     . ASN B  1 117 ? 42.035  -68.368 49.370  1.00 0.00 ? 123 ASN B N     1 
ATOM 1863  C CA    . ASN B  1 117 ? 42.268  -68.630 50.782  1.00 0.00 ? 123 ASN B CA    1 
ATOM 1864  C C     . ASN B  1 117 ? 41.995  -67.421 51.673  1.00 0.00 ? 123 ASN B C     1 
ATOM 1865  O O     . ASN B  1 117 ? 42.072  -67.522 52.895  1.00 0.00 ? 123 ASN B O     1 
ATOM 1866  C CB    . ASN B  1 117 ? 43.669  -69.121 50.997  1.00 0.00 ? 123 ASN B CB    1 
ATOM 1867  C CG    . ASN B  1 117 ? 43.862  -70.482 50.439  1.00 0.00 ? 123 ASN B CG    1 
ATOM 1868  O OD1   . ASN B  1 117 ? 42.888  -71.183 50.161  1.00 0.00 ? 123 ASN B OD1   1 
ATOM 1869  N ND2   . ASN B  1 117 ? 45.098  -70.878 50.268  1.00 0.00 ? 123 ASN B ND2   1 
ATOM 1870  N N     . ILE B  1 118 ? 41.678  -66.287 51.075  1.00 0.00 ? 124 ILE B N     1 
ATOM 1871  C CA    . ILE B  1 118 ? 41.281  -65.129 51.817  1.00 0.00 ? 124 ILE B CA    1 
ATOM 1872  C C     . ILE B  1 118 ? 39.804  -64.992 51.796  1.00 0.00 ? 124 ILE B C     1 
ATOM 1873  O O     . ILE B  1 118 ? 39.166  -64.846 52.836  1.00 0.00 ? 124 ILE B O     1 
ATOM 1874  C CB    . ILE B  1 118 ? 41.881  -63.874 51.234  1.00 0.00 ? 124 ILE B CB    1 
ATOM 1875  C CG1   . ILE B  1 118 ? 43.379  -63.948 51.271  1.00 0.00 ? 124 ILE B CG1   1 
ATOM 1876  C CG2   . ILE B  1 118 ? 41.373  -62.664 51.964  1.00 0.00 ? 124 ILE B CG2   1 
ATOM 1877  C CD1   . ILE B  1 118 ? 43.935  -64.119 52.660  1.00 0.00 ? 124 ILE B CD1   1 
ATOM 1878  N N     . ILE B  1 119 ? 39.256  -65.022 50.602  1.00 0.00 ? 125 ILE B N     1 
ATOM 1879  C CA    . ILE B  1 119 ? 37.841  -64.826 50.403  1.00 0.00 ? 125 ILE B CA    1 
ATOM 1880  C C     . ILE B  1 119 ? 37.028  -65.960 50.988  1.00 0.00 ? 125 ILE B C     1 
ATOM 1881  O O     . ILE B  1 119 ? 36.058  -65.730 51.706  1.00 0.00 ? 125 ILE B O     1 
ATOM 1882  C CB    . ILE B  1 119 ? 37.543  -64.692 48.926  1.00 0.00 ? 125 ILE B CB    1 
ATOM 1883  C CG1   . ILE B  1 119 ? 38.177  -63.423 48.401  1.00 0.00 ? 125 ILE B CG1   1 
ATOM 1884  C CG2   . ILE B  1 119 ? 36.046  -64.674 48.694  1.00 0.00 ? 125 ILE B CG2   1 
ATOM 1885  C CD1   . ILE B  1 119 ? 38.198  -63.351 46.912  1.00 0.00 ? 125 ILE B CD1   1 
ATOM 1886  N N     . THR B  1 120 ? 37.418  -67.186 50.682  1.00 0.00 ? 126 THR B N     1 
ATOM 1887  C CA    . THR B  1 120 ? 36.713  -68.340 51.192  1.00 0.00 ? 126 THR B CA    1 
ATOM 1888  C C     . THR B  1 120 ? 37.372  -68.839 52.438  1.00 0.00 ? 126 THR B C     1 
ATOM 1889  O O     . THR B  1 120 ? 36.712  -69.322 53.356  1.00 0.00 ? 126 THR B O     1 
ATOM 1890  C CB    . THR B  1 120 ? 36.742  -69.469 50.197  1.00 0.00 ? 126 THR B CB    1 
ATOM 1891  O OG1   . THR B  1 120 ? 38.102  -69.885 50.037  1.00 0.00 ? 126 THR B OG1   1 
ATOM 1892  C CG2   . THR B  1 120 ? 36.192  -69.014 48.858  1.00 0.00 ? 126 THR B CG2   1 
ATOM 1893  N N     . GLY B  1 121 ? 38.687  -68.715 52.478  1.00 0.00 ? 127 GLY B N     1 
ATOM 1894  C CA    . GLY B  1 121 ? 39.449  -69.180 53.616  1.00 0.00 ? 127 GLY B CA    1 
ATOM 1895  C C     . GLY B  1 121 ? 40.092  -70.525 53.326  1.00 0.00 ? 127 GLY B C     1 
ATOM 1896  O O     . GLY B  1 121 ? 40.963  -70.976 54.063  1.00 0.00 ? 127 GLY B O     1 
ATOM 1897  N N     . SER B  1 122 ? 39.662  -71.165 52.247  1.00 0.00 ? 128 SER B N     1 
ATOM 1898  C CA    . SER B  1 122 ? 40.175  -72.471 51.901  1.00 0.00 ? 128 SER B CA    1 
ATOM 1899  C C     . SER B  1 122 ? 40.187  -72.646 50.398  1.00 0.00 ? 128 SER B C     1 
ATOM 1900  O O     . SER B  1 122 ? 39.385  -72.030 49.699  1.00 0.00 ? 128 SER B O     1 
ATOM 1901  C CB    . SER B  1 122 ? 39.306  -73.555 52.514  1.00 0.00 ? 128 SER B CB    1 
ATOM 1902  O OG    . SER B  1 122 ? 38.038  -73.565 51.918  1.00 0.00 ? 128 SER B OG    1 
ATOM 1903  N N     . PRO B  1 123 ? 41.049  -73.528 49.891  1.00 0.00 ? 129 PRO B N     1 
ATOM 1904  C CA    . PRO B  1 123 ? 41.198  -73.915 48.506  1.00 0.00 ? 129 PRO B CA    1 
ATOM 1905  C C     . PRO B  1 123 ? 39.914  -74.508 47.981  1.00 0.00 ? 129 PRO B C     1 
ATOM 1906  O O     . PRO B  1 123 ? 39.063  -74.960 48.743  1.00 0.00 ? 129 PRO B O     1 
ATOM 1907  C CB    . PRO B  1 123 ? 42.332  -74.938 48.536  1.00 0.00 ? 129 PRO B CB    1 
ATOM 1908  C CG    . PRO B  1 123 ? 43.143  -74.570 49.730  1.00 0.00 ? 129 PRO B CG    1 
ATOM 1909  C CD    . PRO B  1 123 ? 42.154  -74.054 50.727  1.00 0.00 ? 129 PRO B CD    1 
ATOM 1910  N N     . THR B  1 124 ? 39.772  -74.495 46.674  1.00 0.00 ? 130 THR B N     1 
ATOM 1911  C CA    . THR B  1 124 ? 38.595  -75.035 46.036  1.00 0.00 ? 130 THR B CA    1 
ATOM 1912  C C     . THR B  1 124 ? 38.767  -76.514 45.726  1.00 0.00 ? 130 THR B C     1 
ATOM 1913  O O     . THR B  1 124 ? 39.319  -77.258 46.534  1.00 0.00 ? 130 THR B O     1 
ATOM 1914  C CB    . THR B  1 124 ? 38.272  -74.245 44.761  1.00 0.00 ? 130 THR B CB    1 
ATOM 1915  O OG1   . THR B  1 124 ? 37.088  -74.781 44.159  1.00 0.00 ? 130 THR B OG1   1 
ATOM 1916  C CG2   . THR B  1 124 ? 39.445  -74.272 43.764  1.00 0.00 ? 130 THR B CG2   1 
ATOM 1917  N N     . GLY B  1 125 ? 38.273  -76.958 44.572  1.00 0.00 ? 131 GLY B N     1 
ATOM 1918  C CA    . GLY B  1 125 ? 38.389  -78.359 44.191  1.00 0.00 ? 131 GLY B CA    1 
ATOM 1919  C C     . GLY B  1 125 ? 37.282  -79.180 44.828  1.00 0.00 ? 131 GLY B C     1 
ATOM 1920  O O     . GLY B  1 125 ? 36.402  -79.687 44.134  1.00 0.00 ? 131 GLY B O     1 
ATOM 1921  N N     . TYR B  1 126 ? 37.307  -79.256 46.160  1.00 0.00 ? 132 TYR B N     1 
ATOM 1922  C CA    . TYR B  1 126 ? 36.311  -79.982 46.923  1.00 0.00 ? 132 TYR B CA    1 
ATOM 1923  C C     . TYR B  1 126 ? 35.677  -79.069 47.966  1.00 0.00 ? 132 TYR B C     1 
ATOM 1924  O O     . TYR B  1 126 ? 36.302  -78.120 48.437  1.00 0.00 ? 132 TYR B O     1 
ATOM 1925  C CB    . TYR B  1 126 ? 36.949  -81.187 47.596  1.00 0.00 ? 132 TYR B CB    1 
ATOM 1926  C CG    . TYR B  1 126 ? 37.628  -82.119 46.624  1.00 0.00 ? 132 TYR B CG    1 
ATOM 1927  C CD1   . TYR B  1 126 ? 38.994  -82.012 46.414  1.00 0.00 ? 132 TYR B CD1   1 
ATOM 1928  C CD2   . TYR B  1 126 ? 36.888  -83.058 45.924  1.00 0.00 ? 132 TYR B CD2   1 
ATOM 1929  C CE1   . TYR B  1 126 ? 39.621  -82.848 45.517  1.00 0.00 ? 132 TYR B CE1   1 
ATOM 1930  C CE2   . TYR B  1 126 ? 37.515  -83.893 45.024  1.00 0.00 ? 132 TYR B CE2   1 
ATOM 1931  C CZ    . TYR B  1 126 ? 38.877  -83.792 44.822  1.00 0.00 ? 132 TYR B CZ    1 
ATOM 1932  O OH    . TYR B  1 126 ? 39.505  -84.628 43.927  1.00 0.00 ? 132 TYR B OH    1 
ATOM 1933  N N     . VAL B  1 127 ? 34.433  -79.364 48.328  1.00 0.00 ? 133 VAL B N     1 
ATOM 1934  C CA    . VAL B  1 127 ? 33.708  -78.548 49.297  1.00 0.00 ? 133 VAL B CA    1 
ATOM 1935  C C     . VAL B  1 127 ? 34.332  -78.667 50.675  1.00 0.00 ? 133 VAL B C     1 
ATOM 1936  O O     . VAL B  1 127 ? 34.439  -79.767 51.221  1.00 0.00 ? 133 VAL B O     1 
ATOM 1937  C CB    . VAL B  1 127 ? 32.221  -78.986 49.370  1.00 0.00 ? 133 VAL B CB    1 
ATOM 1938  C CG1   . VAL B  1 127 ? 31.494  -78.200 50.448  1.00 0.00 ? 133 VAL B CG1   1 
ATOM 1939  C CG2   . VAL B  1 127 ? 31.544  -78.788 48.020  1.00 0.00 ? 133 VAL B CG2   1 
ATOM 1940  N N     . SER B  1 128 ? 34.741  -77.530 51.243  1.00 0.00 ? 134 SER B N     1 
ATOM 1941  C CA    . SER B  1 128 ? 35.367  -77.523 52.562  1.00 0.00 ? 134 SER B CA    1 
ATOM 1942  C C     . SER B  1 128 ? 35.399  -76.122 53.170  1.00 0.00 ? 134 SER B C     1 
ATOM 1943  O O     . SER B  1 128 ? 34.772  -75.878 54.204  1.00 0.00 ? 134 SER B O     1 
ATOM 1944  C CB    . SER B  1 128 ? 36.777  -78.071 52.465  1.00 0.00 ? 134 SER B CB    1 
ATOM 1945  O OG    . SER B  1 128 ? 37.410  -78.061 53.711  1.00 0.00 ? 134 SER B OG    1 
ATOM 1946  O OXT   . SER B  1 128 ? 36.246  -75.323 52.773  1.00 0.00 ? 134 SER B OXT   1 
ATOM 1947  N N     . SER C  1 1   ? 22.548  -59.211 43.849  1.00 0.00 ? 7   SER C N     1 
ATOM 1948  C CA    . SER C  1 1   ? 21.293  -59.787 44.308  1.00 0.00 ? 7   SER C CA    1 
ATOM 1949  C C     . SER C  1 1   ? 20.413  -58.747 44.984  1.00 0.00 ? 7   SER C C     1 
ATOM 1950  O O     . SER C  1 1   ? 20.907  -57.746 45.503  1.00 0.00 ? 7   SER C O     1 
ATOM 1951  C CB    . SER C  1 1   ? 21.535  -60.922 45.241  1.00 0.00 ? 7   SER C CB    1 
ATOM 1952  O OG    . SER C  1 1   ? 20.318  -61.417 45.715  1.00 0.00 ? 7   SER C OG    1 
ATOM 1953  N N     . ARG C  1 2   ? 19.102  -58.964 44.932  1.00 0.00 ? 8   ARG C N     1 
ATOM 1954  C CA    . ARG C  1 2   ? 18.146  -58.002 45.471  1.00 0.00 ? 8   ARG C CA    1 
ATOM 1955  C C     . ARG C  1 2   ? 17.047  -58.649 46.290  1.00 0.00 ? 8   ARG C C     1 
ATOM 1956  O O     . ARG C  1 2   ? 16.370  -59.564 45.828  1.00 0.00 ? 8   ARG C O     1 
ATOM 1957  C CB    . ARG C  1 2   ? 17.500  -57.252 44.352  1.00 0.00 ? 8   ARG C CB    1 
ATOM 1958  C CG    . ARG C  1 2   ? 18.425  -56.389 43.524  1.00 0.00 ? 8   ARG C CG    1 
ATOM 1959  C CD    . ARG C  1 2   ? 18.859  -55.194 44.247  1.00 0.00 ? 8   ARG C CD    1 
ATOM 1960  N NE    . ARG C  1 2   ? 19.664  -54.343 43.411  1.00 0.00 ? 8   ARG C NE    1 
ATOM 1961  C CZ    . ARG C  1 2   ? 20.990  -54.440 43.277  1.00 0.00 ? 8   ARG C CZ    1 
ATOM 1962  N NH1   . ARG C  1 2   ? 21.659  -55.353 43.937  1.00 0.00 ? 8   ARG C NH1   1 
ATOM 1963  N NH2   . ARG C  1 2   ? 21.648  -53.616 42.485  1.00 0.00 ? 8   ARG C NH2   1 
ATOM 1964  N N     . SER C  1 3   ? 16.843  -58.131 47.493  1.00 0.00 ? 9   SER C N     1 
ATOM 1965  C CA    . SER C  1 3   ? 15.763  -58.564 48.371  1.00 0.00 ? 9   SER C CA    1 
ATOM 1966  C C     . SER C  1 3   ? 14.467  -57.940 47.943  1.00 0.00 ? 9   SER C C     1 
ATOM 1967  O O     . SER C  1 3   ? 14.473  -56.996 47.168  1.00 0.00 ? 9   SER C O     1 
ATOM 1968  C CB    . SER C  1 3   ? 16.056  -58.138 49.779  1.00 0.00 ? 9   SER C CB    1 
ATOM 1969  O OG    . SER C  1 3   ? 16.039  -56.735 49.877  1.00 0.00 ? 9   SER C OG    1 
ATOM 1970  N N     . TYR C  1 4   ? 13.359  -58.409 48.494  1.00 0.00 ? 10  TYR C N     1 
ATOM 1971  C CA    . TYR C  1 4   ? 12.068  -57.819 48.177  1.00 0.00 ? 10  TYR C CA    1 
ATOM 1972  C C     . TYR C  1 4   ? 12.054  -56.343 48.409  1.00 0.00 ? 10  TYR C C     1 
ATOM 1973  O O     . TYR C  1 4   ? 11.556  -55.590 47.580  1.00 0.00 ? 10  TYR C O     1 
ATOM 1974  C CB    . TYR C  1 4   ? 10.947  -58.434 48.969  1.00 0.00 ? 10  TYR C CB    1 
ATOM 1975  C CG    . TYR C  1 4   ? 9.688   -57.634 48.805  1.00 0.00 ? 10  TYR C CG    1 
ATOM 1976  C CD1   . TYR C  1 4   ? 8.960   -57.704 47.632  1.00 0.00 ? 10  TYR C CD1   1 
ATOM 1977  C CD2   . TYR C  1 4   ? 9.287   -56.791 49.815  1.00 0.00 ? 10  TYR C CD2   1 
ATOM 1978  C CE1   . TYR C  1 4   ? 7.832   -56.929 47.477  1.00 0.00 ? 10  TYR C CE1   1 
ATOM 1979  C CE2   . TYR C  1 4   ? 8.164   -56.017 49.662  1.00 0.00 ? 10  TYR C CE2   1 
ATOM 1980  C CZ    . TYR C  1 4   ? 7.440   -56.082 48.501  1.00 0.00 ? 10  TYR C CZ    1 
ATOM 1981  O OH    . TYR C  1 4   ? 6.326   -55.297 48.355  1.00 0.00 ? 10  TYR C OH    1 
ATOM 1982  N N     . SER C  1 5   ? 12.554  -55.919 49.564  1.00 0.00 ? 11  SER C N     1 
ATOM 1983  C CA    . SER C  1 5   ? 12.596  -54.506 49.881  1.00 0.00 ? 11  SER C CA    1 
ATOM 1984  C C     . SER C  1 5   ? 13.232  -53.735 48.748  1.00 0.00 ? 11  SER C C     1 
ATOM 1985  O O     . SER C  1 5   ? 12.713  -52.706 48.318  1.00 0.00 ? 11  SER C O     1 
ATOM 1986  C CB    . SER C  1 5   ? 13.374  -54.265 51.171  1.00 0.00 ? 11  SER C CB    1 
ATOM 1987  O OG    . SER C  1 5   ? 12.702  -54.795 52.280  1.00 0.00 ? 11  SER C OG    1 
ATOM 1988  N N     . GLN C  1 6   ? 14.343  -54.250 48.245  1.00 0.00 ? 12  GLN C N     1 
ATOM 1989  C CA    . GLN C  1 6   ? 15.050  -53.621 47.152  1.00 0.00 ? 12  GLN C CA    1 
ATOM 1990  C C     . GLN C  1 6   ? 14.292  -53.708 45.846  1.00 0.00 ? 12  GLN C C     1 
ATOM 1991  O O     . GLN C  1 6   ? 14.252  -52.742 45.088  1.00 0.00 ? 12  GLN C O     1 
ATOM 1992  C CB    . GLN C  1 6   ? 16.402  -54.248 47.004  1.00 0.00 ? 12  GLN C CB    1 
ATOM 1993  C CG    . GLN C  1 6   ? 17.340  -53.919 48.132  1.00 0.00 ? 12  GLN C CG    1 
ATOM 1994  C CD    . GLN C  1 6   ? 18.565  -54.784 48.127  1.00 0.00 ? 12  GLN C CD    1 
ATOM 1995  O OE1   . GLN C  1 6   ? 18.469  -55.984 48.405  1.00 0.00 ? 12  GLN C OE1   1 
ATOM 1996  N NE2   . GLN C  1 6   ? 19.717  -54.203 47.808  1.00 0.00 ? 12  GLN C NE2   1 
ATOM 1997  N N     . ARG C  1 7   ? 13.673  -54.857 45.585  1.00 0.00 ? 13  ARG C N     1 
ATOM 1998  C CA    . ARG C  1 7   ? 12.931  -55.051 44.348  1.00 0.00 ? 13  ARG C CA    1 
ATOM 1999  C C     . ARG C  1 7   ? 11.868  -54.016 44.215  1.00 0.00 ? 13  ARG C C     1 
ATOM 2000  O O     . ARG C  1 7   ? 11.765  -53.331 43.197  1.00 0.00 ? 13  ARG C O     1 
ATOM 2001  C CB    . ARG C  1 7   ? 12.251  -56.415 44.320  1.00 0.00 ? 13  ARG C CB    1 
ATOM 2002  C CG    . ARG C  1 7   ? 13.168  -57.606 44.230  1.00 0.00 ? 13  ARG C CG    1 
ATOM 2003  C CD    . ARG C  1 7   ? 12.417  -58.856 44.010  1.00 0.00 ? 13  ARG C CD    1 
ATOM 2004  N NE    . ARG C  1 7   ? 11.830  -58.895 42.680  1.00 0.00 ? 13  ARG C NE    1 
ATOM 2005  C CZ    . ARG C  1 7   ? 10.921  -59.797 42.268  1.00 0.00 ? 13  ARG C CZ    1 
ATOM 2006  N NH1   . ARG C  1 7   ? 10.495  -60.723 43.096  1.00 0.00 ? 13  ARG C NH1   1 
ATOM 2007  N NH2   . ARG C  1 7   ? 10.454  -59.758 41.029  1.00 0.00 ? 13  ARG C NH2   1 
ATOM 2008  N N     . TYR C  1 8   ? 11.074  -53.899 45.254  1.00 0.00 ? 14  TYR C N     1 
ATOM 2009  C CA    . TYR C  1 8   ? 9.985   -52.981 45.286  1.00 0.00 ? 14  TYR C CA    1 
ATOM 2010  C C     . TYR C  1 8   ? 10.440  -51.563 45.272  1.00 0.00 ? 14  TYR C C     1 
ATOM 2011  O O     . TYR C  1 8   ? 9.891   -50.755 44.536  1.00 0.00 ? 14  TYR C O     1 
ATOM 2012  C CB    . TYR C  1 8   ? 9.120   -53.234 46.486  1.00 0.00 ? 14  TYR C CB    1 
ATOM 2013  C CG    . TYR C  1 8   ? 8.055   -52.213 46.632  1.00 0.00 ? 14  TYR C CG    1 
ATOM 2014  C CD1   . TYR C  1 8   ? 7.287   -51.874 45.547  1.00 0.00 ? 14  TYR C CD1   1 
ATOM 2015  C CD2   . TYR C  1 8   ? 7.841   -51.612 47.851  1.00 0.00 ? 14  TYR C CD2   1 
ATOM 2016  C CE1   . TYR C  1 8   ? 6.314   -50.925 45.672  1.00 0.00 ? 14  TYR C CE1   1 
ATOM 2017  C CE2   . TYR C  1 8   ? 6.867   -50.659 47.980  1.00 0.00 ? 14  TYR C CE2   1 
ATOM 2018  C CZ    . TYR C  1 8   ? 6.109   -50.312 46.892  1.00 0.00 ? 14  TYR C CZ    1 
ATOM 2019  O OH    . TYR C  1 8   ? 5.146   -49.347 47.006  1.00 0.00 ? 14  TYR C OH    1 
ATOM 2020  N N     . ALA C  1 9   ? 11.419  -51.239 46.101  1.00 0.00 ? 15  ALA C N     1 
ATOM 2021  C CA    . ALA C  1 9   ? 11.901  -49.872 46.192  1.00 0.00 ? 15  ALA C CA    1 
ATOM 2022  C C     . ALA C  1 9   ? 12.207  -49.296 44.827  1.00 0.00 ? 15  ALA C C     1 
ATOM 2023  O O     . ALA C  1 9   ? 11.712  -48.221 44.475  1.00 0.00 ? 15  ALA C O     1 
ATOM 2024  C CB    . ALA C  1 9   ? 13.143  -49.812 47.060  1.00 0.00 ? 15  ALA C CB    1 
ATOM 2025  N N     . LYS C  1 10  ? 13.017  -50.001 44.054  1.00 0.00 ? 16  LYS C N     1 
ATOM 2026  C CA    . LYS C  1 10  ? 13.403  -49.495 42.764  1.00 0.00 ? 16  LYS C CA    1 
ATOM 2027  C C     . LYS C  1 10  ? 12.249  -49.501 41.799  1.00 0.00 ? 16  LYS C C     1 
ATOM 2028  O O     . LYS C  1 10  ? 12.101  -48.575 41.007  1.00 0.00 ? 16  LYS C O     1 
ATOM 2029  C CB    . LYS C  1 10  ? 14.547  -50.264 42.190  1.00 0.00 ? 16  LYS C CB    1 
ATOM 2030  C CG    . LYS C  1 10  ? 15.097  -49.636 40.938  1.00 0.00 ? 16  LYS C CG    1 
ATOM 2031  C CD    . LYS C  1 10  ? 16.328  -50.343 40.452  1.00 0.00 ? 16  LYS C CD    1 
ATOM 2032  C CE    . LYS C  1 10  ? 16.920  -49.614 39.267  1.00 0.00 ? 16  LYS C CE    1 
ATOM 2033  N NZ    . LYS C  1 10  ? 18.093  -50.320 38.697  1.00 0.00 ? 16  LYS C NZ    1 
ATOM 2034  N N     . TRP C  1 11  ? 11.410  -50.534 41.866  1.00 0.00 ? 17  TRP C N     1 
ATOM 2035  C CA    . TRP C  1 11  ? 10.239  -50.593 41.013  1.00 0.00 ? 17  TRP C CA    1 
ATOM 2036  C C     . TRP C  1 11  ? 9.387   -49.383 41.198  1.00 0.00 ? 17  TRP C C     1 
ATOM 2037  O O     . TRP C  1 11  ? 8.860   -48.835 40.235  1.00 0.00 ? 17  TRP C O     1 
ATOM 2038  C CB    . TRP C  1 11  ? 9.402   -51.814 41.309  1.00 0.00 ? 17  TRP C CB    1 
ATOM 2039  C CG    . TRP C  1 11  ? 8.149   -51.861 40.499  1.00 0.00 ? 17  TRP C CG    1 
ATOM 2040  C CD1   . TRP C  1 11  ? 8.005   -52.400 39.262  1.00 0.00 ? 17  TRP C CD1   1 
ATOM 2041  C CD2   . TRP C  1 11  ? 6.848   -51.348 40.864  1.00 0.00 ? 17  TRP C CD2   1 
ATOM 2042  N NE1   . TRP C  1 11  ? 6.710   -52.267 38.838  1.00 0.00 ? 17  TRP C NE1   1 
ATOM 2043  C CE2   . TRP C  1 11  ? 5.989   -51.624 39.803  1.00 0.00 ? 17  TRP C CE2   1 
ATOM 2044  C CE3   . TRP C  1 11  ? 6.349   -50.699 41.988  1.00 0.00 ? 17  TRP C CE3   1 
ATOM 2045  C CZ2   . TRP C  1 11  ? 4.652   -51.270 39.830  1.00 0.00 ? 17  TRP C CZ2   1 
ATOM 2046  C CZ3   . TRP C  1 11  ? 5.009   -50.345 42.019  1.00 0.00 ? 17  TRP C CZ3   1 
ATOM 2047  C CH2   . TRP C  1 11  ? 4.182   -50.623 40.967  1.00 0.00 ? 17  TRP C CH2   1 
ATOM 2048  N N     . GLN C  1 12  ? 9.224   -48.976 42.439  1.00 0.00 ? 18  GLN C N     1 
ATOM 2049  C CA    . GLN C  1 12  ? 8.408   -47.845 42.752  1.00 0.00 ? 18  GLN C CA    1 
ATOM 2050  C C     . GLN C  1 12  ? 8.979   -46.592 42.178  1.00 0.00 ? 18  GLN C C     1 
ATOM 2051  O O     . GLN C  1 12  ? 8.259   -45.788 41.594  1.00 0.00 ? 18  GLN C O     1 
ATOM 2052  C CB    . GLN C  1 12  ? 8.288   -47.687 44.244  1.00 0.00 ? 18  GLN C CB    1 
ATOM 2053  C CG    . GLN C  1 12  ? 7.324   -46.618 44.640  1.00 0.00 ? 18  GLN C CG    1 
ATOM 2054  C CD    . GLN C  1 12  ? 5.943   -46.994 44.251  1.00 0.00 ? 18  GLN C CD    1 
ATOM 2055  O OE1   . GLN C  1 12  ? 5.453   -48.031 44.695  1.00 0.00 ? 18  GLN C OE1   1 
ATOM 2056  N NE2   . GLN C  1 12  ? 5.292   -46.189 43.423  1.00 0.00 ? 18  GLN C NE2   1 
ATOM 2057  N N     . ALA C  1 13  ? 10.282  -46.425 42.317  1.00 0.00 ? 19  ALA C N     1 
ATOM 2058  C CA    . ALA C  1 13  ? 10.945  -45.236 41.823  1.00 0.00 ? 19  ALA C CA    1 
ATOM 2059  C C     . ALA C  1 13  ? 10.782  -45.095 40.330  1.00 0.00 ? 19  ALA C C     1 
ATOM 2060  O O     . ALA C  1 13  ? 10.519  -44.001 39.830  1.00 0.00 ? 19  ALA C O     1 
ATOM 2061  C CB    . ALA C  1 13  ? 12.410  -45.274 42.185  1.00 0.00 ? 19  ALA C CB    1 
ATOM 2062  N N     . LYS C  1 14  ? 10.907  -46.201 39.617  1.00 0.00 ? 20  LYS C N     1 
ATOM 2063  C CA    . LYS C  1 14  ? 10.803  -46.167 38.180  1.00 0.00 ? 20  LYS C CA    1 
ATOM 2064  C C     . LYS C  1 14  ? 9.394   -46.002 37.730  1.00 0.00 ? 20  LYS C C     1 
ATOM 2065  O O     . LYS C  1 14  ? 9.138   -45.314 36.746  1.00 0.00 ? 20  LYS C O     1 
ATOM 2066  C CB    . LYS C  1 14  ? 11.394  -47.421 37.584  1.00 0.00 ? 20  LYS C CB    1 
ATOM 2067  C CG    . LYS C  1 14  ? 12.882  -47.534 37.796  1.00 0.00 ? 20  LYS C CG    1 
ATOM 2068  C CD    . LYS C  1 14  ? 13.606  -46.430 37.057  1.00 0.00 ? 20  LYS C CD    1 
ATOM 2069  C CE    . LYS C  1 14  ? 13.756  -46.744 35.579  1.00 0.00 ? 20  LYS C CE    1 
ATOM 2070  N NZ    . LYS C  1 14  ? 14.880  -47.682 35.338  1.00 0.00 ? 20  LYS C NZ    1 
ATOM 2071  N N     . PHE C  1 15  ? 8.459   -46.587 38.461  1.00 0.00 ? 21  PHE C N     1 
ATOM 2072  C CA    . PHE C  1 15  ? 7.066   -46.424 38.133  1.00 0.00 ? 21  PHE C CA    1 
ATOM 2073  C C     . PHE C  1 15  ? 6.678   -44.968 38.250  1.00 0.00 ? 21  PHE C C     1 
ATOM 2074  O O     . PHE C  1 15  ? 6.024   -44.416 37.365  1.00 0.00 ? 21  PHE C O     1 
ATOM 2075  C CB    . PHE C  1 15  ? 6.185   -47.255 39.035  1.00 0.00 ? 21  PHE C CB    1 
ATOM 2076  C CG    . PHE C  1 15  ? 4.755   -47.167 38.644  1.00 0.00 ? 21  PHE C CG    1 
ATOM 2077  C CD1   . PHE C  1 15  ? 4.234   -48.025 37.692  1.00 0.00 ? 21  PHE C CD1   1 
ATOM 2078  C CD2   . PHE C  1 15  ? 3.937   -46.198 39.177  1.00 0.00 ? 21  PHE C CD2   1 
ATOM 2079  C CE1   . PHE C  1 15  ? 2.916   -47.924 37.293  1.00 0.00 ? 21  PHE C CE1   1 
ATOM 2080  C CE2   . PHE C  1 15  ? 2.622   -46.089 38.777  1.00 0.00 ? 21  PHE C CE2   1 
ATOM 2081  C CZ    . PHE C  1 15  ? 2.110   -46.955 37.835  1.00 0.00 ? 21  PHE C CZ    1 
ATOM 2082  N N     . ASN C  1 16  ? 7.089   -44.346 39.352  1.00 0.00 ? 22  ASN C N     1 
ATOM 2083  C CA    . ASN C  1 16  ? 6.802   -42.954 39.596  1.00 0.00 ? 22  ASN C CA    1 
ATOM 2084  C C     . ASN C  1 16  ? 7.343   -42.095 38.490  1.00 0.00 ? 22  ASN C C     1 
ATOM 2085  O O     . ASN C  1 16  ? 6.641   -41.240 37.955  1.00 0.00 ? 22  ASN C O     1 
ATOM 2086  C CB    . ASN C  1 16  ? 7.408   -42.514 40.903  1.00 0.00 ? 22  ASN C CB    1 
ATOM 2087  C CG    . ASN C  1 16  ? 6.745   -43.124 42.084  1.00 0.00 ? 22  ASN C CG    1 
ATOM 2088  O OD1   . ASN C  1 16  ? 5.673   -43.723 41.978  1.00 0.00 ? 22  ASN C OD1   1 
ATOM 2089  N ND2   . ASN C  1 16  ? 7.360   -42.986 43.227  1.00 0.00 ? 22  ASN C ND2   1 
ATOM 2090  N N     . ALA C  1 17  ? 8.594   -42.349 38.113  1.00 0.00 ? 23  ALA C N     1 
ATOM 2091  C CA    . ALA C  1 17  ? 9.236   -41.591 37.064  1.00 0.00 ? 23  ALA C CA    1 
ATOM 2092  C C     . ALA C  1 17  ? 8.445   -41.657 35.788  1.00 0.00 ? 23  ALA C C     1 
ATOM 2093  O O     . ALA C  1 17  ? 8.126   -40.630 35.194  1.00 0.00 ? 23  ALA C O     1 
ATOM 2094  C CB    . ALA C  1 17  ? 10.639  -42.110 36.828  1.00 0.00 ? 23  ALA C CB    1 
ATOM 2095  N N     . PHE C  1 18  ? 8.098   -42.865 35.377  1.00 0.00 ? 24  PHE C N     1 
ATOM 2096  C CA    . PHE C  1 18  ? 7.368   -43.066 34.150  1.00 0.00 ? 24  PHE C CA    1 
ATOM 2097  C C     . PHE C  1 18  ? 6.049   -42.345 34.128  1.00 0.00 ? 24  PHE C C     1 
ATOM 2098  O O     . PHE C  1 18  ? 5.655   -41.816 33.096  1.00 0.00 ? 24  PHE C O     1 
ATOM 2099  C CB    . PHE C  1 18  ? 7.154   -44.530 33.881  1.00 0.00 ? 24  PHE C CB    1 
ATOM 2100  C CG    . PHE C  1 18  ? 6.400   -44.779 32.612  1.00 0.00 ? 24  PHE C CG    1 
ATOM 2101  C CD1   . PHE C  1 18  ? 6.900   -44.340 31.399  1.00 0.00 ? 24  PHE C CD1   1 
ATOM 2102  C CD2   . PHE C  1 18  ? 5.209   -45.483 32.622  1.00 0.00 ? 24  PHE C CD2   1 
ATOM 2103  C CE1   . PHE C  1 18  ? 6.216   -44.587 30.225  1.00 0.00 ? 24  PHE C CE1   1 
ATOM 2104  C CE2   . PHE C  1 18  ? 4.529   -45.737 31.449  1.00 0.00 ? 24  PHE C CE2   1 
ATOM 2105  C CZ    . PHE C  1 18  ? 5.031   -45.287 30.253  1.00 0.00 ? 24  PHE C CZ    1 
ATOM 2106  N N     . SER C  1 19  ? 5.354   -42.304 35.262  1.00 0.00 ? 25  SER C N     1 
ATOM 2107  C CA    . SER C  1 19  ? 4.027   -41.690 35.313  1.00 0.00 ? 25  SER C CA    1 
ATOM 2108  C C     . SER C  1 19  ? 4.041   -40.190 34.990  1.00 0.00 ? 25  SER C C     1 
ATOM 2109  O O     . SER C  1 19  ? 2.996   -39.609 34.715  1.00 0.00 ? 25  SER C O     1 
ATOM 2110  C CB    . SER C  1 19  ? 3.418   -41.877 36.673  1.00 0.00 ? 25  SER C CB    1 
ATOM 2111  O OG    . SER C  1 19  ? 4.042   -41.053 37.621  1.00 0.00 ? 25  SER C OG    1 
ATOM 2112  N N     . ASN C  1 20  ? 5.217   -39.568 35.044  1.00 0.00 ? 26  ASN C N     1 
ATOM 2113  C CA    . ASN C  1 20  ? 5.358   -38.151 34.734  1.00 0.00 ? 26  ASN C CA    1 
ATOM 2114  C C     . ASN C  1 20  ? 5.016   -37.860 33.272  1.00 0.00 ? 26  ASN C C     1 
ATOM 2115  O O     . ASN C  1 20  ? 5.690   -38.361 32.382  1.00 0.00 ? 26  ASN C O     1 
ATOM 2116  C CB    . ASN C  1 20  ? 6.767   -37.704 35.036  1.00 0.00 ? 26  ASN C CB    1 
ATOM 2117  C CG    . ASN C  1 20  ? 7.006   -36.259 34.752  1.00 0.00 ? 26  ASN C CG    1 
ATOM 2118  O OD1   . ASN C  1 20  ? 6.694   -35.764 33.657  1.00 0.00 ? 26  ASN C OD1   1 
ATOM 2119  N ND2   . ASN C  1 20  ? 7.554   -35.564 35.713  1.00 0.00 ? 26  ASN C ND2   1 
ATOM 2120  N N     . PRO C  1 21  ? 3.953   -37.064 33.017  1.00 0.00 ? 27  PRO C N     1 
ATOM 2121  C CA    . PRO C  1 21  ? 3.460   -36.653 31.685  1.00 0.00 ? 27  PRO C CA    1 
ATOM 2122  C C     . PRO C  1 21  ? 4.539   -36.578 30.621  1.00 0.00 ? 27  PRO C C     1 
ATOM 2123  O O     . PRO C  1 21  ? 4.366   -37.083 29.507  1.00 0.00 ? 27  PRO C O     1 
ATOM 2124  C CB    . PRO C  1 21  ? 2.927   -35.236 31.927  1.00 0.00 ? 27  PRO C CB    1 
ATOM 2125  C CG    . PRO C  1 21  ? 2.549   -35.215 33.343  1.00 0.00 ? 27  PRO C CG    1 
ATOM 2126  C CD    . PRO C  1 21  ? 3.613   -36.022 34.017  1.00 0.00 ? 27  PRO C CD    1 
ATOM 2127  N N     . THR C  1 22  ? 5.635   -35.912 30.948  1.00 0.00 ? 28  THR C N     1 
ATOM 2128  C CA    . THR C  1 22  ? 6.656   -35.638 29.971  1.00 0.00 ? 28  THR C CA    1 
ATOM 2129  C C     . THR C  1 22  ? 7.553   -36.808 29.771  1.00 0.00 ? 28  THR C C     1 
ATOM 2130  O O     . THR C  1 22  ? 8.093   -36.996 28.692  1.00 0.00 ? 28  THR C O     1 
ATOM 2131  C CB    . THR C  1 22  ? 7.495   -34.463 30.400  1.00 0.00 ? 28  THR C CB    1 
ATOM 2132  O OG1   . THR C  1 22  ? 8.153   -34.788 31.626  1.00 0.00 ? 28  THR C OG1   1 
ATOM 2133  C CG2   . THR C  1 22  ? 6.622   -33.242 30.606  1.00 0.00 ? 28  THR C CG2   1 
ATOM 2134  N N     . VAL C  1 23  ? 7.703   -37.612 30.793  1.00 0.00 ? 29  VAL C N     1 
ATOM 2135  C CA    . VAL C  1 23  ? 8.544   -38.764 30.696  1.00 0.00 ? 29  VAL C CA    1 
ATOM 2136  C C     . VAL C  1 23  ? 7.862   -39.827 29.910  1.00 0.00 ? 29  VAL C C     1 
ATOM 2137  O O     . VAL C  1 23  ? 8.456   -40.433 29.020  1.00 0.00 ? 29  VAL C O     1 
ATOM 2138  C CB    . VAL C  1 23  ? 8.896   -39.279 32.071  1.00 0.00 ? 29  VAL C CB    1 
ATOM 2139  C CG1   . VAL C  1 23  ? 9.668   -40.573 31.963  1.00 0.00 ? 29  VAL C CG1   1 
ATOM 2140  C CG2   . VAL C  1 23  ? 9.701   -38.237 32.789  1.00 0.00 ? 29  VAL C CG2   1 
ATOM 2141  N N     . ALA C  1 24  ? 6.604   -40.053 30.224  1.00 0.00 ? 30  ALA C N     1 
ATOM 2142  C CA    . ALA C  1 24  ? 5.830   -41.036 29.520  1.00 0.00 ? 30  ALA C CA    1 
ATOM 2143  C C     . ALA C  1 24  ? 5.742   -40.697 28.060  1.00 0.00 ? 30  ALA C C     1 
ATOM 2144  O O     . ALA C  1 24  ? 5.992   -41.541 27.209  1.00 0.00 ? 30  ALA C O     1 
ATOM 2145  C CB    . ALA C  1 24  ? 4.437   -41.137 30.106  1.00 0.00 ? 30  ALA C CB    1 
ATOM 2146  N N     . SER C  1 25  ? 5.411   -39.451 27.760  1.00 0.00 ? 31  SER C N     1 
ATOM 2147  C CA    . SER C  1 25  ? 5.244   -39.055 26.390  1.00 0.00 ? 31  SER C CA    1 
ATOM 2148  C C     . SER C  1 25  ? 6.535   -39.000 25.638  1.00 0.00 ? 31  SER C C     1 
ATOM 2149  O O     . SER C  1 25  ? 6.580   -39.338 24.462  1.00 0.00 ? 31  SER C O     1 
ATOM 2150  C CB    . SER C  1 25  ? 4.589   -37.735 26.335  1.00 0.00 ? 31  SER C CB    1 
ATOM 2151  O OG    . SER C  1 25  ? 5.376   -36.773 26.967  1.00 0.00 ? 31  SER C OG    1 
ATOM 2152  N N     . THR C  1 26  ? 7.615   -38.636 26.316  1.00 0.00 ? 32  THR C N     1 
ATOM 2153  C CA    . THR C  1 26  ? 8.908   -38.629 25.666  1.00 0.00 ? 32  THR C CA    1 
ATOM 2154  C C     . THR C  1 26  ? 9.267   -39.998 25.204  1.00 0.00 ? 32  THR C C     1 
ATOM 2155  O O     . THR C  1 26  ? 9.576   -40.207 24.033  1.00 0.00 ? 32  THR C O     1 
ATOM 2156  C CB    . THR C  1 26  ? 10.004  -38.117 26.592  1.00 0.00 ? 32  THR C CB    1 
ATOM 2157  O OG1   . THR C  1 26  ? 9.751   -36.754 26.926  1.00 0.00 ? 32  THR C OG1   1 
ATOM 2158  C CG2   . THR C  1 26  ? 11.342  -38.231 25.917  1.00 0.00 ? 32  THR C CG2   1 
ATOM 2159  N N     . ILE C  1 27  ? 9.211   -40.942 26.111  1.00 0.00 ? 33  ILE C N     1 
ATOM 2160  C CA    . ILE C  1 27  ? 9.586   -42.285 25.796  1.00 0.00 ? 33  ILE C CA    1 
ATOM 2161  C C     . ILE C  1 27  ? 8.673   -42.894 24.771  1.00 0.00 ? 33  ILE C C     1 
ATOM 2162  O O     . ILE C  1 27  ? 9.133   -43.429 23.767  1.00 0.00 ? 33  ILE C O     1 
ATOM 2163  C CB    . ILE C  1 27  ? 9.568   -43.143 27.041  1.00 0.00 ? 33  ILE C CB    1 
ATOM 2164  C CG1   . ILE C  1 27  ? 10.655  -42.699 27.993  1.00 0.00 ? 33  ILE C CG1   1 
ATOM 2165  C CG2   . ILE C  1 27  ? 9.747   -44.589 26.664  1.00 0.00 ? 33  ILE C CG2   1 
ATOM 2166  C CD1   . ILE C  1 27  ? 10.527  -43.301 29.361  1.00 0.00 ? 33  ILE C CD1   1 
ATOM 2167  N N     . LEU C  1 28  ? 7.379   -42.818 25.025  1.00 0.00 ? 34  LEU C N     1 
ATOM 2168  C CA    . LEU C  1 28  ? 6.404   -43.475 24.194  1.00 0.00 ? 34  LEU C CA    1 
ATOM 2169  C C     . LEU C  1 28  ? 6.345   -42.905 22.802  1.00 0.00 ? 34  LEU C C     1 
ATOM 2170  O O     . LEU C  1 28  ? 6.195   -43.651 21.833  1.00 0.00 ? 34  LEU C O     1 
ATOM 2171  C CB    . LEU C  1 28  ? 5.044   -43.379 24.847  1.00 0.00 ? 34  LEU C CB    1 
ATOM 2172  C CG    . LEU C  1 28  ? 4.896   -44.177 26.140  1.00 0.00 ? 34  LEU C CG    1 
ATOM 2173  C CD1   . LEU C  1 28  ? 3.577   -43.826 26.797  1.00 0.00 ? 34  LEU C CD1   1 
ATOM 2174  C CD2   . LEU C  1 28  ? 4.973   -45.657 25.825  1.00 0.00 ? 34  LEU C CD2   1 
ATOM 2175  N N     . SER C  1 29  ? 6.487   -41.595 22.676  1.00 0.00 ? 35  SER C N     1 
ATOM 2176  C CA    . SER C  1 29  ? 6.468   -40.994 21.364  1.00 0.00 ? 35  SER C CA    1 
ATOM 2177  C C     . SER C  1 29  ? 7.739   -41.298 20.601  1.00 0.00 ? 35  SER C C     1 
ATOM 2178  O O     . SER C  1 29  ? 7.719   -41.402 19.376  1.00 0.00 ? 35  SER C O     1 
ATOM 2179  C CB    . SER C  1 29  ? 6.287   -39.510 21.466  1.00 0.00 ? 35  SER C CB    1 
ATOM 2180  O OG    . SER C  1 29  ? 7.398   -38.915 22.065  1.00 0.00 ? 35  SER C OG    1 
ATOM 2181  N N     . ASN C  1 30  ? 8.846   -41.496 21.320  1.00 0.00 ? 36  ASN C N     1 
ATOM 2182  C CA    . ASN C  1 30  ? 10.088  -41.840 20.662  1.00 0.00 ? 36  ASN C CA    1 
ATOM 2183  C C     . ASN C  1 30  ? 10.093  -43.259 20.161  1.00 0.00 ? 36  ASN C C     1 
ATOM 2184  O O     . ASN C  1 30  ? 10.628  -43.535 19.094  1.00 0.00 ? 36  ASN C O     1 
ATOM 2185  C CB    . ASN C  1 30  ? 11.262  -41.597 21.566  1.00 0.00 ? 36  ASN C CB    1 
ATOM 2186  C CG    . ASN C  1 30  ? 11.552  -40.139 21.713  1.00 0.00 ? 36  ASN C CG    1 
ATOM 2187  O OD1   . ASN C  1 30  ? 10.985  -39.313 20.992  1.00 0.00 ? 36  ASN C OD1   1 
ATOM 2188  N ND2   . ASN C  1 30  ? 12.438  -39.801 22.609  1.00 0.00 ? 36  ASN C ND2   1 
ATOM 2189  N N     . VAL C  1 31  ? 9.468   -44.167 20.905  1.00 0.00 ? 37  VAL C N     1 
ATOM 2190  C CA    . VAL C  1 31  ? 9.459   -45.565 20.501  1.00 0.00 ? 37  VAL C CA    1 
ATOM 2191  C C     . VAL C  1 31  ? 8.230   -45.924 19.729  1.00 0.00 ? 37  VAL C C     1 
ATOM 2192  O O     . VAL C  1 31  ? 8.043   -47.085 19.390  1.00 0.00 ? 37  VAL C O     1 
ATOM 2193  C CB    . VAL C  1 31  ? 9.542   -46.495 21.703  1.00 0.00 ? 37  VAL C CB    1 
ATOM 2194  C CG1   . VAL C  1 31  ? 10.783  -46.204 22.512  1.00 0.00 ? 37  VAL C CG1   1 
ATOM 2195  C CG2   . VAL C  1 31  ? 8.288   -46.365 22.533  1.00 0.00 ? 37  VAL C CG2   1 
ATOM 2196  N N     . SER C  1 32  ? 7.376   -44.939 19.463  1.00 0.00 ? 38  SER C N     1 
ATOM 2197  C CA    . SER C  1 32  ? 6.174   -45.168 18.686  1.00 0.00 ? 38  SER C CA    1 
ATOM 2198  C C     . SER C  1 32  ? 6.448   -45.948 17.394  1.00 0.00 ? 38  SER C C     1 
ATOM 2199  O O     . SER C  1 32  ? 6.134   -47.134 17.329  1.00 0.00 ? 38  SER C O     1 
ATOM 2200  C CB    . SER C  1 32  ? 5.454   -43.860 18.400  1.00 0.00 ? 38  SER C CB    1 
ATOM 2201  O OG    . SER C  1 32  ? 4.898   -43.329 19.569  1.00 0.00 ? 38  SER C OG    1 
ATOM 2202  N N     . PRO C  1 33  ? 6.991   -45.294 16.342  1.00 0.00 ? 39  PRO C N     1 
ATOM 2203  C CA    . PRO C  1 33  ? 7.222   -45.915 15.037  1.00 0.00 ? 39  PRO C CA    1 
ATOM 2204  C C     . PRO C  1 33  ? 8.027   -47.225 15.133  1.00 0.00 ? 39  PRO C C     1 
ATOM 2205  O O     . PRO C  1 33  ? 7.884   -48.109 14.287  1.00 0.00 ? 39  PRO C O     1 
ATOM 2206  C CB    . PRO C  1 33  ? 8.032   -44.874 14.302  1.00 0.00 ? 39  PRO C CB    1 
ATOM 2207  C CG    . PRO C  1 33  ? 8.874   -44.254 15.353  1.00 0.00 ? 39  PRO C CG    1 
ATOM 2208  C CD    . PRO C  1 33  ? 8.067   -44.307 16.613  1.00 0.00 ? 39  PRO C CD    1 
ATOM 2209  N N     . VAL C  1 34  ? 8.844   -47.356 16.175  1.00 0.00 ? 40  VAL C N     1 
ATOM 2210  C CA    . VAL C  1 34  ? 9.630   -48.543 16.370  1.00 0.00 ? 40  VAL C CA    1 
ATOM 2211  C C     . VAL C  1 34  ? 8.736   -49.683 16.766  1.00 0.00 ? 40  VAL C C     1 
ATOM 2212  O O     . VAL C  1 34  ? 8.789   -50.762 16.175  1.00 0.00 ? 40  VAL C O     1 
ATOM 2213  C CB    . VAL C  1 34  ? 10.671  -48.314 17.462  1.00 0.00 ? 40  VAL C CB    1 
ATOM 2214  C CG1   . VAL C  1 34  ? 11.402  -49.607 17.762  1.00 0.00 ? 40  VAL C CG1   1 
ATOM 2215  C CG2   . VAL C  1 34  ? 11.634  -47.226 17.033  1.00 0.00 ? 40  VAL C CG2   1 
ATOM 2216  N N     . ALA C  1 35  ? 7.888   -49.430 17.750  1.00 0.00 ? 41  ALA C N     1 
ATOM 2217  C CA    . ALA C  1 35  ? 6.943   -50.410 18.212  1.00 0.00 ? 41  ALA C CA    1 
ATOM 2218  C C     . ALA C  1 35  ? 6.016   -50.808 17.106  1.00 0.00 ? 41  ALA C C     1 
ATOM 2219  O O     . ALA C  1 35  ? 5.670   -51.978 16.973  1.00 0.00 ? 41  ALA C O     1 
ATOM 2220  C CB    . ALA C  1 35  ? 6.151   -49.866 19.385  1.00 0.00 ? 41  ALA C CB    1 
ATOM 2221  N N     . GLN C  1 36  ? 5.630   -49.836 16.289  1.00 0.00 ? 42  GLN C N     1 
ATOM 2222  C CA    . GLN C  1 36  ? 4.730   -50.082 15.187  1.00 0.00 ? 42  GLN C CA    1 
ATOM 2223  C C     . GLN C  1 36  ? 5.309   -51.087 14.260  1.00 0.00 ? 42  GLN C C     1 
ATOM 2224  O O     . GLN C  1 36  ? 4.630   -52.020 13.845  1.00 0.00 ? 42  GLN C O     1 
ATOM 2225  C CB    . GLN C  1 36  ? 4.462   -48.803 14.438  1.00 0.00 ? 42  GLN C CB    1 
ATOM 2226  C CG    . GLN C  1 36  ? 3.683   -47.795 15.230  1.00 0.00 ? 42  GLN C CG    1 
ATOM 2227  C CD    . GLN C  1 36  ? 3.462   -46.515 14.472  1.00 0.00 ? 42  GLN C CD    1 
ATOM 2228  O OE1   . GLN C  1 36  ? 3.246   -46.528 13.257  1.00 0.00 ? 42  GLN C OE1   1 
ATOM 2229  N NE2   . GLN C  1 36  ? 3.516   -45.397 15.178  1.00 0.00 ? 42  GLN C NE2   1 
ATOM 2230  N N     . GLN C  1 37  ? 6.585   -50.926 13.956  1.00 0.00 ? 43  GLN C N     1 
ATOM 2231  C CA    . GLN C  1 37  ? 7.276   -51.860 13.108  1.00 0.00 ? 43  GLN C CA    1 
ATOM 2232  C C     . GLN C  1 37  ? 7.242   -53.246 13.675  1.00 0.00 ? 43  GLN C C     1 
ATOM 2233  O O     . GLN C  1 37  ? 6.946   -54.207 12.964  1.00 0.00 ? 43  GLN C O     1 
ATOM 2234  C CB    . GLN C  1 37  ? 8.721   -51.437 12.927  1.00 0.00 ? 43  GLN C CB    1 
ATOM 2235  C CG    . GLN C  1 37  ? 9.511   -52.364 12.048  1.00 0.00 ? 43  GLN C CG    1 
ATOM 2236  C CD    . GLN C  1 37  ? 9.037   -52.331 10.625  1.00 0.00 ? 43  GLN C CD    1 
ATOM 2237  O OE1   . GLN C  1 37  ? 8.955   -51.263 10.018  1.00 0.00 ? 43  GLN C OE1   1 
ATOM 2238  N NE2   . GLN C  1 37  ? 8.717   -53.497 10.074  1.00 0.00 ? 43  GLN C NE2   1 
ATOM 2239  N N     . ASN C  1 38  ? 7.541   -53.358 14.957  1.00 0.00 ? 44  ASN C N     1 
ATOM 2240  C CA    . ASN C  1 38  ? 7.620   -54.645 15.605  1.00 0.00 ? 44  ASN C CA    1 
ATOM 2241  C C     . ASN C  1 38  ? 6.278   -55.329 15.666  1.00 0.00 ? 44  ASN C C     1 
ATOM 2242  O O     . ASN C  1 38  ? 6.180   -56.538 15.447  1.00 0.00 ? 44  ASN C O     1 
ATOM 2243  C CB    . ASN C  1 38  ? 8.205   -54.481 16.971  1.00 0.00 ? 44  ASN C CB    1 
ATOM 2244  C CG    . ASN C  1 38  ? 9.664   -54.167 16.898  1.00 0.00 ? 44  ASN C CG    1 
ATOM 2245  O OD1   . ASN C  1 38  ? 10.314  -54.484 15.894  1.00 0.00 ? 44  ASN C OD1   1 
ATOM 2246  N ND2   . ASN C  1 38  ? 10.192  -53.539 17.917  1.00 0.00 ? 44  ASN C ND2   1 
ATOM 2247  N N     . PHE C  1 39  ? 5.238   -54.559 15.936  1.00 0.00 ? 45  PHE C N     1 
ATOM 2248  C CA    . PHE C  1 39  ? 3.899   -55.093 16.003  1.00 0.00 ? 45  PHE C CA    1 
ATOM 2249  C C     . PHE C  1 39  ? 3.483   -55.610 14.654  1.00 0.00 ? 45  PHE C C     1 
ATOM 2250  O O     . PHE C  1 39  ? 3.002   -56.729 14.526  1.00 0.00 ? 45  PHE C O     1 
ATOM 2251  C CB    . PHE C  1 39  ? 2.923   -54.029 16.435  1.00 0.00 ? 45  PHE C CB    1 
ATOM 2252  C CG    . PHE C  1 39  ? 1.552   -54.557 16.665  1.00 0.00 ? 45  PHE C CG    1 
ATOM 2253  C CD1   . PHE C  1 39  ? 1.097   -54.780 17.949  1.00 0.00 ? 45  PHE C CD1   1 
ATOM 2254  C CD2   . PHE C  1 39  ? 0.724   -54.872 15.608  1.00 0.00 ? 45  PHE C CD2   1 
ATOM 2255  C CE1   . PHE C  1 39  ? -0.174  -55.268 18.178  1.00 0.00 ? 45  PHE C CE1   1 
ATOM 2256  C CE2   . PHE C  1 39  ? -0.546  -55.370 15.832  1.00 0.00 ? 45  PHE C CE2   1 
ATOM 2257  C CZ    . PHE C  1 39  ? -1.000  -55.558 17.118  1.00 0.00 ? 45  PHE C CZ    1 
ATOM 2258  N N     . GLN C  1 40  ? 3.691   -54.801 13.632  1.00 0.00 ? 46  GLN C N     1 
ATOM 2259  C CA    . GLN C  1 40  ? 3.336   -55.178 12.282  1.00 0.00 ? 46  GLN C CA    1 
ATOM 2260  C C     . GLN C  1 40  ? 4.132   -56.355 11.797  1.00 0.00 ? 46  GLN C C     1 
ATOM 2261  O O     . GLN C  1 40  ? 3.624   -57.190 11.054  1.00 0.00 ? 46  GLN C O     1 
ATOM 2262  C CB    . GLN C  1 40  ? 3.554   -54.020 11.340  1.00 0.00 ? 46  GLN C CB    1 
ATOM 2263  C CG    . GLN C  1 40  ? 2.577   -52.893 11.505  1.00 0.00 ? 46  GLN C CG    1 
ATOM 2264  C CD    . GLN C  1 40  ? 2.953   -51.718 10.654  1.00 0.00 ? 46  GLN C CD    1 
ATOM 2265  O OE1   . GLN C  1 40  ? 4.111   -51.292 10.648  1.00 0.00 ? 46  GLN C OE1   1 
ATOM 2266  N NE2   . GLN C  1 40  ? 1.989   -51.192 9.912   1.00 0.00 ? 46  GLN C NE2   1 
ATOM 2267  N N     . THR C  1 41  ? 5.390   -56.417 12.182  1.00 0.00 ? 47  THR C N     1 
ATOM 2268  C CA    . THR C  1 41  ? 6.256   -57.470 11.719  1.00 0.00 ? 47  THR C CA    1 
ATOM 2269  C C     . THR C  1 41  ? 5.860   -58.840 12.241  1.00 0.00 ? 47  THR C C     1 
ATOM 2270  O O     . THR C  1 41  ? 5.829   -59.803 11.482  1.00 0.00 ? 47  THR C O     1 
ATOM 2271  C CB    . THR C  1 41  ? 7.703   -57.187 12.111  1.00 0.00 ? 47  THR C CB    1 
ATOM 2272  O OG1   . THR C  1 41  ? 8.132   -55.964 11.503  1.00 0.00 ? 47  THR C OG1   1 
ATOM 2273  C CG2   . THR C  1 41  ? 8.602   -58.319 11.654  1.00 0.00 ? 47  THR C CG2   1 
ATOM 2274  N N     . ASN C  1 42  ? 5.591   -58.947 13.533  1.00 0.00 ? 48  ASN C N     1 
ATOM 2275  C CA    . ASN C  1 42  ? 5.341   -60.256 14.106  1.00 0.00 ? 48  ASN C CA    1 
ATOM 2276  C C     . ASN C  1 42  ? 3.880   -60.632 14.289  1.00 0.00 ? 48  ASN C C     1 
ATOM 2277  O O     . ASN C  1 42  ? 3.541   -61.800 14.180  1.00 0.00 ? 48  ASN C O     1 
ATOM 2278  C CB    . ASN C  1 42  ? 6.080   -60.399 15.412  1.00 0.00 ? 48  ASN C CB    1 
ATOM 2279  C CG    . ASN C  1 42  ? 7.568   -60.526 15.216  1.00 0.00 ? 48  ASN C CG    1 
ATOM 2280  O OD1   . ASN C  1 42  ? 8.027   -61.003 14.167  1.00 0.00 ? 48  ASN C OD1   1 
ATOM 2281  N ND2   . ASN C  1 42  ? 8.333   -60.130 16.202  1.00 0.00 ? 48  ASN C ND2   1 
ATOM 2282  N N     . VAL C  1 43  ? 3.009   -59.675 14.559  1.00 0.00 ? 49  VAL C N     1 
ATOM 2283  C CA    . VAL C  1 43  ? 1.628   -60.032 14.906  1.00 0.00 ? 49  VAL C CA    1 
ATOM 2284  C C     . VAL C  1 43  ? 0.851   -60.839 13.851  1.00 0.00 ? 49  VAL C C     1 
ATOM 2285  O O     . VAL C  1 43  ? 0.197   -61.818 14.213  1.00 0.00 ? 49  VAL C O     1 
ATOM 2286  C CB    . VAL C  1 43  ? 0.835   -58.803 15.306  1.00 0.00 ? 49  VAL C CB    1 
ATOM 2287  C CG1   . VAL C  1 43  ? -0.638  -59.139 15.414  1.00 0.00 ? 49  VAL C CG1   1 
ATOM 2288  C CG2   . VAL C  1 43  ? 1.355   -58.341 16.631  1.00 0.00 ? 49  VAL C CG2   1 
ATOM 2289  N N     . PRO C  1 44  ? 0.904   -60.470 12.559  1.00 0.00 ? 50  PRO C N     1 
ATOM 2290  C CA    . PRO C  1 44  ? 0.266   -61.130 11.433  1.00 0.00 ? 50  PRO C CA    1 
ATOM 2291  C C     . PRO C  1 44  ? 0.613   -62.609 11.391  1.00 0.00 ? 50  PRO C C     1 
ATOM 2292  O O     . PRO C  1 44  ? -0.179  -63.427 10.918  1.00 0.00 ? 50  PRO C O     1 
ATOM 2293  C CB    . PRO C  1 44  ? 0.829   -60.394 10.231  1.00 0.00 ? 50  PRO C CB    1 
ATOM 2294  C CG    . PRO C  1 44  ? 1.137   -59.041 10.742  1.00 0.00 ? 50  PRO C CG    1 
ATOM 2295  C CD    . PRO C  1 44  ? 1.648   -59.275 12.124  1.00 0.00 ? 50  PRO C CD    1 
ATOM 2296  N N     . LYS C  1 45  ? 1.801   -62.951 11.890  1.00 0.00 ? 51  LYS C N     1 
ATOM 2297  C CA    . LYS C  1 45  ? 2.273   -64.320 11.894  1.00 0.00 ? 51  LYS C CA    1 
ATOM 2298  C C     . LYS C  1 45  ? 1.425   -65.172 12.803  1.00 0.00 ? 51  LYS C C     1 
ATOM 2299  O O     . LYS C  1 45  ? 1.219   -66.353 12.542  1.00 0.00 ? 51  LYS C O     1 
ATOM 2300  C CB    . LYS C  1 45  ? 3.713   -64.371 12.368  1.00 0.00 ? 51  LYS C CB    1 
ATOM 2301  C CG    . LYS C  1 45  ? 4.713   -63.720 11.432  1.00 0.00 ? 51  LYS C CG    1 
ATOM 2302  C CD    . LYS C  1 45  ? 6.094   -63.671 12.063  1.00 0.00 ? 51  LYS C CD    1 
ATOM 2303  C CE    . LYS C  1 45  ? 7.094   -62.977 11.157  1.00 0.00 ? 51  LYS C CE    1 
ATOM 2304  N NZ    . LYS C  1 45  ? 8.400   -62.765 11.833  1.00 0.00 ? 51  LYS C NZ    1 
ATOM 2305  N N     . PHE C  1 46  ? 0.940   -64.571 13.879  1.00 0.00 ? 52  PHE C N     1 
ATOM 2306  C CA    . PHE C  1 46  ? 0.149   -65.278 14.853  1.00 0.00 ? 52  PHE C CA    1 
ATOM 2307  C C     . PHE C  1 46  ? -1.317  -65.186 14.546  1.00 0.00 ? 52  PHE C C     1 
ATOM 2308  O O     . PHE C  1 46  ? -2.086  -66.070 14.911  1.00 0.00 ? 52  PHE C O     1 
ATOM 2309  C CB    . PHE C  1 46  ? 0.437   -64.742 16.230  1.00 0.00 ? 52  PHE C CB    1 
ATOM 2310  C CG    . PHE C  1 46  ? 1.808   -65.084 16.683  1.00 0.00 ? 52  PHE C CG    1 
ATOM 2311  C CD1   . PHE C  1 46  ? 2.864   -64.256 16.380  1.00 0.00 ? 52  PHE C CD1   1 
ATOM 2312  C CD2   . PHE C  1 46  ? 2.048   -66.237 17.403  1.00 0.00 ? 52  PHE C CD2   1 
ATOM 2313  C CE1   . PHE C  1 46  ? 4.138   -64.572 16.785  1.00 0.00 ? 52  PHE C CE1   1 
ATOM 2314  C CE2   . PHE C  1 46  ? 3.319   -66.553 17.818  1.00 0.00 ? 52  PHE C CE2   1 
ATOM 2315  C CZ    . PHE C  1 46  ? 4.367   -65.722 17.506  1.00 0.00 ? 52  PHE C CZ    1 
ATOM 2316  N N     . THR C  1 47  ? -1.714  -64.138 13.845  1.00 0.00 ? 53  THR C N     1 
ATOM 2317  C CA    . THR C  1 47  ? -3.091  -64.033 13.430  1.00 0.00 ? 53  THR C CA    1 
ATOM 2318  C C     . THR C  1 47  ? -3.437  -65.150 12.487  1.00 0.00 ? 53  THR C C     1 
ATOM 2319  O O     . THR C  1 47  ? -4.498  -65.758 12.605  1.00 0.00 ? 53  THR C O     1 
ATOM 2320  C CB    . THR C  1 47  ? -3.388  -62.712 12.763  1.00 0.00 ? 53  THR C CB    1 
ATOM 2321  O OG1   . THR C  1 47  ? -3.175  -61.645 13.692  1.00 0.00 ? 53  THR C OG1   1 
ATOM 2322  C CG2   . THR C  1 47  ? -4.826  -62.700 12.289  1.00 0.00 ? 53  THR C CG2   1 
ATOM 2323  N N     . SER C  1 48  ? -2.534  -65.441 11.557  1.00 0.00 ? 54  SER C N     1 
ATOM 2324  C CA    . SER C  1 48  ? -2.762  -66.524 10.618  1.00 0.00 ? 54  SER C CA    1 
ATOM 2325  C C     . SER C  1 48  ? -2.876  -67.861 11.338  1.00 0.00 ? 54  SER C C     1 
ATOM 2326  O O     . SER C  1 48  ? -3.622  -68.738 10.912  1.00 0.00 ? 54  SER C O     1 
ATOM 2327  C CB    . SER C  1 48  ? -1.637  -66.587 9.619   1.00 0.00 ? 54  SER C CB    1 
ATOM 2328  O OG    . SER C  1 48  ? -0.442  -66.978 10.235  1.00 0.00 ? 54  SER C OG    1 
ATOM 2329  N N     . VAL C  1 49  ? -2.179  -67.986 12.466  1.00 0.00 ? 55  VAL C N     1 
ATOM 2330  C CA    . VAL C  1 49  ? -2.268  -69.180 13.284  1.00 0.00 ? 55  VAL C CA    1 
ATOM 2331  C C     . VAL C  1 49  ? -3.623  -69.281 13.907  1.00 0.00 ? 55  VAL C C     1 
ATOM 2332  O O     . VAL C  1 49  ? -4.261  -70.323 13.848  1.00 0.00 ? 55  VAL C O     1 
ATOM 2333  C CB    . VAL C  1 49  ? -1.208  -69.169 14.386  1.00 0.00 ? 55  VAL C CB    1 
ATOM 2334  C CG1   . VAL C  1 49  ? -1.442  -70.313 15.348  1.00 0.00 ? 55  VAL C CG1   1 
ATOM 2335  C CG2   . VAL C  1 49  ? 0.161   -69.275 13.768  1.00 0.00 ? 55  VAL C CG2   1 
ATOM 2336  N N     . ASN C  1 50  ? -4.092  -68.181 14.472  1.00 0.00 ? 56  ASN C N     1 
ATOM 2337  C CA    . ASN C  1 50  ? -5.396  -68.151 15.091  1.00 0.00 ? 56  ASN C CA    1 
ATOM 2338  C C     . ASN C  1 50  ? -6.454  -68.543 14.114  1.00 0.00 ? 56  ASN C C     1 
ATOM 2339  O O     . ASN C  1 50  ? -7.381  -69.266 14.457  1.00 0.00 ? 56  ASN C O     1 
ATOM 2340  C CB    . ASN C  1 50  ? -5.688  -66.784 15.639  1.00 0.00 ? 56  ASN C CB    1 
ATOM 2341  C CG    . ASN C  1 50  ? -4.906  -66.492 16.859  1.00 0.00 ? 56  ASN C CG    1 
ATOM 2342  O OD1   . ASN C  1 50  ? -4.447  -67.415 17.534  1.00 0.00 ? 56  ASN C OD1   1 
ATOM 2343  N ND2   . ASN C  1 50  ? -4.739  -65.234 17.165  1.00 0.00 ? 56  ASN C ND2   1 
ATOM 2344  N N     . GLU C  1 51  ? -6.306  -68.091 12.883  1.00 0.00 ? 57  GLU C N     1 
ATOM 2345  C CA    . GLU C  1 51  ? -7.258  -68.390 11.845  1.00 0.00 ? 57  GLU C CA    1 
ATOM 2346  C C     . GLU C  1 51  ? -7.267  -69.846 11.466  1.00 0.00 ? 57  GLU C C     1 
ATOM 2347  O O     . GLU C  1 51  ? -8.322  -70.479 11.434  1.00 0.00 ? 57  GLU C O     1 
ATOM 2348  C CB    . GLU C  1 51  ? -6.958  -67.574 10.612  1.00 0.00 ? 57  GLU C CB    1 
ATOM 2349  C CG    . GLU C  1 51  ? -7.885  -67.867 9.464   1.00 0.00 ? 57  GLU C CG    1 
ATOM 2350  C CD    . GLU C  1 51  ? -9.284  -67.475 9.767   1.00 0.00 ? 57  GLU C CD    1 
ATOM 2351  O OE1   . GLU C  1 51  ? -9.465  -66.581 10.557  1.00 0.00 ? 57  GLU C OE1   1 
ATOM 2352  O OE2   . GLU C  1 51  ? -10.182 -68.078 9.231   1.00 0.00 ? 57  GLU C OE2   1 
ATOM 2353  N N     . ASN C  1 52  ? -6.102  -70.376 11.151  1.00 0.00 ? 58  ASN C N     1 
ATOM 2354  C CA    . ASN C  1 52  ? -6.017  -71.736 10.689  1.00 0.00 ? 58  ASN C CA    1 
ATOM 2355  C C     . ASN C  1 52  ? -6.363  -72.716 11.784  1.00 0.00 ? 58  ASN C C     1 
ATOM 2356  O O     . ASN C  1 52  ? -7.053  -73.703 11.539  1.00 0.00 ? 58  ASN C O     1 
ATOM 2357  C CB    . ASN C  1 52  ? -4.660  -72.005 10.132  1.00 0.00 ? 58  ASN C CB    1 
ATOM 2358  C CG    . ASN C  1 52  ? -4.432  -71.299 8.832   1.00 0.00 ? 58  ASN C CG    1 
ATOM 2359  O OD1   . ASN C  1 52  ? -5.382  -70.849 8.180   1.00 0.00 ? 58  ASN C OD1   1 
ATOM 2360  N ND2   . ASN C  1 52  ? -3.192  -71.195 8.435   1.00 0.00 ? 58  ASN C ND2   1 
ATOM 2361  N N     . VAL C  1 53  ? -5.928  -72.428 13.001  1.00 0.00 ? 59  VAL C N     1 
ATOM 2362  C CA    . VAL C  1 53  ? -6.255  -73.268 14.130  1.00 0.00 ? 59  VAL C CA    1 
ATOM 2363  C C     . VAL C  1 53  ? -7.731  -73.226 14.403  1.00 0.00 ? 59  VAL C C     1 
ATOM 2364  O O     . VAL C  1 53  ? -8.335  -74.246 14.713  1.00 0.00 ? 59  VAL C O     1 
ATOM 2365  C CB    . VAL C  1 53  ? -5.479  -72.842 15.376  1.00 0.00 ? 59  VAL C CB    1 
ATOM 2366  C CG1   . VAL C  1 53  ? -5.994  -73.596 16.589  1.00 0.00 ? 59  VAL C CG1   1 
ATOM 2367  C CG2   . VAL C  1 53  ? -4.001  -73.126 15.173  1.00 0.00 ? 59  VAL C CG2   1 
ATOM 2368  N N     . SER C  1 54  ? -8.326  -72.049 14.279  1.00 0.00 ? 60  SER C N     1 
ATOM 2369  C CA    . SER C  1 54  ? -9.747  -71.918 14.454  1.00 0.00 ? 60  SER C CA    1 
ATOM 2370  C C     . SER C  1 54  ? -10.482 -72.814 13.495  1.00 0.00 ? 60  SER C C     1 
ATOM 2371  O O     . SER C  1 54  ? -11.415 -73.510 13.887  1.00 0.00 ? 60  SER C O     1 
ATOM 2372  C CB    . SER C  1 54  ? -10.175 -70.494 14.246  1.00 0.00 ? 60  SER C CB    1 
ATOM 2373  O OG    . SER C  1 54  ? -11.555 -70.360 14.415  1.00 0.00 ? 60  SER C OG    1 
ATOM 2374  N N     . ALA C  1 55  ? -10.057 -72.815 12.235  1.00 0.00 ? 61  ALA C N     1 
ATOM 2375  C CA    . ALA C  1 55  ? -10.682 -73.660 11.232  1.00 0.00 ? 61  ALA C CA    1 
ATOM 2376  C C     . ALA C  1 55  ? -10.671 -75.102 11.673  1.00 0.00 ? 61  ALA C C     1 
ATOM 2377  O O     . ALA C  1 55  ? -11.696 -75.784 11.608  1.00 0.00 ? 61  ALA C O     1 
ATOM 2378  C CB    . ALA C  1 55  ? -9.974  -73.516 9.902   1.00 0.00 ? 61  ALA C CB    1 
ATOM 2379  N N     . VAL C  1 56  ? -9.530  -75.551 12.163  1.00 0.00 ? 62  VAL C N     1 
ATOM 2380  C CA    . VAL C  1 56  ? -9.388  -76.901 12.666  1.00 0.00 ? 62  VAL C CA    1 
ATOM 2381  C C     . VAL C  1 56  ? -10.356 -77.189 13.773  1.00 0.00 ? 62  VAL C C     1 
ATOM 2382  O O     . VAL C  1 56  ? -11.046 -78.205 13.757  1.00 0.00 ? 62  VAL C O     1 
ATOM 2383  C CB    . VAL C  1 56  ? -7.969  -77.115 13.185  1.00 0.00 ? 62  VAL C CB    1 
ATOM 2384  C CG1   . VAL C  1 56  ? -7.865  -78.418 13.932  1.00 0.00 ? 62  VAL C CG1   1 
ATOM 2385  C CG2   . VAL C  1 56  ? -7.019  -77.105 12.033  1.00 0.00 ? 62  VAL C CG2   1 
ATOM 2386  N N     . LEU C  1 57  ? -10.423 -76.292 14.730  1.00 0.00 ? 63  LEU C N     1 
ATOM 2387  C CA    . LEU C  1 57  ? -11.245 -76.486 15.892  1.00 0.00 ? 63  LEU C CA    1 
ATOM 2388  C C     . LEU C  1 57  ? -12.705 -76.584 15.535  1.00 0.00 ? 63  LEU C C     1 
ATOM 2389  O O     . LEU C  1 57  ? -13.442 -77.366 16.129  1.00 0.00 ? 63  LEU C O     1 
ATOM 2390  C CB    . LEU C  1 57  ? -10.996 -75.361 16.861  1.00 0.00 ? 63  LEU C CB    1 
ATOM 2391  C CG    . LEU C  1 57  ? -9.601  -75.386 17.469  1.00 0.00 ? 63  LEU C CG    1 
ATOM 2392  C CD1   . LEU C  1 57  ? -9.384  -74.144 18.303  1.00 0.00 ? 63  LEU C CD1   1 
ATOM 2393  C CD2   . LEU C  1 57  ? -9.448  -76.645 18.290  1.00 0.00 ? 63  LEU C CD2   1 
ATOM 2394  N N     . THR C  1 58  ? -13.121 -75.840 14.526  1.00 0.00 ? 64  THR C N     1 
ATOM 2395  C CA    . THR C  1 58  ? -14.482 -75.939 14.053  1.00 0.00 ? 64  THR C CA    1 
ATOM 2396  C C     . THR C  1 58  ? -14.741 -77.308 13.447  1.00 0.00 ? 64  THR C C     1 
ATOM 2397  O O     . THR C  1 58  ? -15.785 -77.913 13.690  1.00 0.00 ? 64  THR C O     1 
ATOM 2398  C CB    . THR C  1 58  ? -14.806 -74.824 13.072  1.00 0.00 ? 64  THR C CB    1 
ATOM 2399  O OG1   . THR C  1 58  ? -14.679 -73.564 13.754  1.00 0.00 ? 64  THR C OG1   1 
ATOM 2400  C CG2   . THR C  1 58  ? -16.224 -74.976 12.546  1.00 0.00 ? 64  THR C CG2   1 
ATOM 2401  N N     . GLN C  1 59  ? -13.767 -77.831 12.705  1.00 0.00 ? 65  GLN C N     1 
ATOM 2402  C CA    . GLN C  1 59  ? -13.882 -79.181 12.149  1.00 0.00 ? 65  GLN C CA    1 
ATOM 2403  C C     . GLN C  1 59  ? -13.965 -80.247 13.249  1.00 0.00 ? 65  GLN C C     1 
ATOM 2404  O O     . GLN C  1 59  ? -14.618 -81.273 13.075  1.00 0.00 ? 65  GLN C O     1 
ATOM 2405  C CB    . GLN C  1 59  ? -12.705 -79.499 11.235  1.00 0.00 ? 65  GLN C CB    1 
ATOM 2406  C CG    . GLN C  1 59  ? -12.690 -78.719 9.942   1.00 0.00 ? 65  GLN C CG    1 
ATOM 2407  C CD    . GLN C  1 59  ? -11.491 -79.064 9.078   1.00 0.00 ? 65  GLN C CD    1 
ATOM 2408  O OE1   . GLN C  1 59  ? -10.691 -79.943 9.414   1.00 0.00 ? 65  GLN C OE1   1 
ATOM 2409  N NE2   . GLN C  1 59  ? -11.358 -78.373 7.952   1.00 0.00 ? 65  GLN C NE2   1 
ATOM 2410  N N     . TYR C  1 60  ? -13.305 -80.004 14.379  1.00 0.00 ? 66  TYR C N     1 
ATOM 2411  C CA    . TYR C  1 60  ? -13.362 -80.937 15.500  1.00 0.00 ? 66  TYR C CA    1 
ATOM 2412  C C     . TYR C  1 60  ? -14.506 -80.682 16.466  1.00 0.00 ? 66  TYR C C     1 
ATOM 2413  O O     . TYR C  1 60  ? -14.619 -81.367 17.478  1.00 0.00 ? 66  TYR C O     1 
ATOM 2414  C CB    . TYR C  1 60  ? -12.054 -80.943 16.258  1.00 0.00 ? 66  TYR C CB    1 
ATOM 2415  C CG    . TYR C  1 60  ? -10.996 -81.738 15.571  1.00 0.00 ? 66  TYR C CG    1 
ATOM 2416  C CD1   . TYR C  1 60  ? -10.053 -81.117 14.800  1.00 0.00 ? 66  TYR C CD1   1 
ATOM 2417  C CD2   . TYR C  1 60  ? -10.981 -83.108 15.717  1.00 0.00 ? 66  TYR C CD2   1 
ATOM 2418  C CE1   . TYR C  1 60  ? -9.091  -81.861 14.159  1.00 0.00 ? 66  TYR C CE1   1 
ATOM 2419  C CE2   . TYR C  1 60  ? -10.018 -83.855 15.085  1.00 0.00 ? 66  TYR C CE2   1 
ATOM 2420  C CZ    . TYR C  1 60  ? -9.075  -83.233 14.307  1.00 0.00 ? 66  TYR C CZ    1 
ATOM 2421  O OH    . TYR C  1 60  ? -8.112  -83.972 13.672  1.00 0.00 ? 66  TYR C OH    1 
ATOM 2422  N N     . GLY C  1 61  ? -15.347 -79.703 16.179  1.00 0.00 ? 67  GLY C N     1 
ATOM 2423  C CA    . GLY C  1 61  ? -16.510 -79.470 17.018  1.00 0.00 ? 67  GLY C CA    1 
ATOM 2424  C C     . GLY C  1 61  ? -16.173 -78.796 18.340  1.00 0.00 ? 67  GLY C C     1 
ATOM 2425  O O     . GLY C  1 61  ? -16.960 -78.854 19.287  1.00 0.00 ? 67  GLY C O     1 
ATOM 2426  N N     . ILE C  1 62  ? -15.024 -78.142 18.403  1.00 0.00 ? 68  ILE C N     1 
ATOM 2427  C CA    . ILE C  1 62  ? -14.572 -77.524 19.633  1.00 0.00 ? 68  ILE C CA    1 
ATOM 2428  C C     . ILE C  1 62  ? -15.192 -76.155 19.798  1.00 0.00 ? 68  ILE C C     1 
ATOM 2429  O O     . ILE C  1 62  ? -15.124 -75.327 18.892  1.00 0.00 ? 68  ILE C O     1 
ATOM 2430  C CB    . ILE C  1 62  ? -13.052 -77.400 19.644  1.00 0.00 ? 68  ILE C CB    1 
ATOM 2431  C CG1   . ILE C  1 62  ? -12.408 -78.763 19.413  1.00 0.00 ? 68  ILE C CG1   1 
ATOM 2432  C CG2   . ILE C  1 62  ? -12.591 -76.830 20.956  1.00 0.00 ? 68  ILE C CG2   1 
ATOM 2433  C CD1   . ILE C  1 62  ? -12.779 -79.792 20.446  1.00 0.00 ? 68  ILE C CD1   1 
ATOM 2434  N N     . THR C  1 63  ? -15.816 -75.919 20.945  1.00 0.00 ? 69  THR C N     1 
ATOM 2435  C CA    . THR C  1 63  ? -16.491 -74.645 21.198  1.00 0.00 ? 69  THR C CA    1 
ATOM 2436  C C     . THR C  1 63  ? -16.060 -74.011 22.506  1.00 0.00 ? 69  THR C C     1 
ATOM 2437  O O     . THR C  1 63  ? -15.519 -74.676 23.390  1.00 0.00 ? 69  THR C O     1 
ATOM 2438  C CB    . THR C  1 63  ? -17.990 -74.834 21.259  1.00 0.00 ? 69  THR C CB    1 
ATOM 2439  O OG1   . THR C  1 63  ? -18.278 -75.672 22.371  1.00 0.00 ? 69  THR C OG1   1 
ATOM 2440  C CG2   . THR C  1 63  ? -18.525 -75.472 19.988  1.00 0.00 ? 69  THR C CG2   1 
ATOM 2441  N N     . GLY C  1 64  ? -16.362 -72.734 22.645  1.00 0.00 ? 70  GLY C N     1 
ATOM 2442  C CA    . GLY C  1 64  ? -16.107 -72.015 23.873  1.00 0.00 ? 70  GLY C CA    1 
ATOM 2443  C C     . GLY C  1 64  ? -14.635 -71.973 24.215  1.00 0.00 ? 70  GLY C C     1 
ATOM 2444  O O     . GLY C  1 64  ? -13.772 -71.997 23.336  1.00 0.00 ? 70  GLY C O     1 
ATOM 2445  N N     . PRO C  1 65  ? -14.340 -71.946 25.504  1.00 0.00 ? 71  PRO C N     1 
ATOM 2446  C CA    . PRO C  1 65  ? -13.031 -71.891 26.107  1.00 0.00 ? 71  PRO C CA    1 
ATOM 2447  C C     . PRO C  1 65  ? -12.182 -73.064 25.709  1.00 0.00 ? 71  PRO C C     1 
ATOM 2448  O O     . PRO C  1 65  ? -10.963 -73.011 25.815  1.00 0.00 ? 71  PRO C O     1 
ATOM 2449  C CB    . PRO C  1 65  ? -13.332 -71.851 27.588  1.00 0.00 ? 71  PRO C CB    1 
ATOM 2450  C CG    . PRO C  1 65  ? -14.634 -71.120 27.676  1.00 0.00 ? 71  PRO C CG    1 
ATOM 2451  C CD    . PRO C  1 65  ? -15.388 -71.516 26.442  1.00 0.00 ? 71  PRO C CD    1 
ATOM 2452  N N     . ASN C  1 66  ? -12.808 -74.129 25.233  1.00 0.00 ? 72  ASN C N     1 
ATOM 2453  C CA    . ASN C  1 66  ? -12.054 -75.265 24.801  1.00 0.00 ? 72  ASN C CA    1 
ATOM 2454  C C     . ASN C  1 66  ? -11.263 -74.916 23.571  1.00 0.00 ? 72  ASN C C     1 
ATOM 2455  O O     . ASN C  1 66  ? -10.167 -75.432 23.365  1.00 0.00 ? 72  ASN C O     1 
ATOM 2456  C CB    . ASN C  1 66  ? -12.955 -76.426 24.562  1.00 0.00 ? 72  ASN C CB    1 
ATOM 2457  C CG    . ASN C  1 66  ? -13.474 -76.980 25.842  1.00 0.00 ? 72  ASN C CG    1 
ATOM 2458  O OD1   . ASN C  1 66  ? -12.769 -76.987 26.853  1.00 0.00 ? 72  ASN C OD1   1 
ATOM 2459  N ND2   . ASN C  1 66  ? -14.703 -77.418 25.834  1.00 0.00 ? 72  ASN C ND2   1 
ATOM 2460  N N     . ARG C  1 67  ? -11.797 -74.002 22.763  1.00 0.00 ? 73  ARG C N     1 
ATOM 2461  C CA    . ARG C  1 67  ? -11.085 -73.548 21.600  1.00 0.00 ? 73  ARG C CA    1 
ATOM 2462  C C     . ARG C  1 67  ? -9.901  -72.778 22.054  1.00 0.00 ? 73  ARG C C     1 
ATOM 2463  O O     . ARG C  1 67  ? -8.803  -72.954 21.537  1.00 0.00 ? 73  ARG C O     1 
ATOM 2464  C CB    . ARG C  1 67  ? -11.946 -72.656 20.732  1.00 0.00 ? 73  ARG C CB    1 
ATOM 2465  C CG    . ARG C  1 67  ? -13.118 -73.341 20.086  1.00 0.00 ? 73  ARG C CG    1 
ATOM 2466  C CD    . ARG C  1 67  ? -13.947 -72.395 19.326  1.00 0.00 ? 73  ARG C CD    1 
ATOM 2467  N NE    . ARG C  1 67  ? -13.332 -71.994 18.074  1.00 0.00 ? 73  ARG C NE    1 
ATOM 2468  C CZ    . ARG C  1 67  ? -13.566 -72.593 16.887  1.00 0.00 ? 73  ARG C CZ    1 
ATOM 2469  N NH1   . ARG C  1 67  ? -14.363 -73.626 16.801  1.00 0.00 ? 73  ARG C NH1   1 
ATOM 2470  N NH2   . ARG C  1 67  ? -13.019 -72.143 15.780  1.00 0.00 ? 73  ARG C NH2   1 
ATOM 2471  N N     . ALA C  1 68  ? -10.115 -71.960 23.082  1.00 0.00 ? 74  ALA C N     1 
ATOM 2472  C CA    . ALA C  1 68  ? -9.057  -71.133 23.647  1.00 0.00 ? 74  ALA C CA    1 
ATOM 2473  C C     . ALA C  1 68  ? -7.890  -71.974 24.139  1.00 0.00 ? 74  ALA C C     1 
ATOM 2474  O O     . ALA C  1 68  ? -6.739  -71.573 23.998  1.00 0.00 ? 74  ALA C O     1 
ATOM 2475  C CB    . ALA C  1 68  ? -9.599  -70.279 24.775  1.00 0.00 ? 74  ALA C CB    1 
ATOM 2476  N N     . ILE C  1 69  ? -8.182  -73.155 24.679  1.00 0.00 ? 75  ILE C N     1 
ATOM 2477  C CA    . ILE C  1 69  ? -7.123  -74.053 25.119  1.00 0.00 ? 75  ILE C CA    1 
ATOM 2478  C C     . ILE C  1 69  ? -6.208  -74.405 23.982  1.00 0.00 ? 75  ILE C C     1 
ATOM 2479  O O     . ILE C  1 69  ? -4.984  -74.290 24.090  1.00 0.00 ? 75  ILE C O     1 
ATOM 2480  C CB    . ILE C  1 69  ? -7.689  -75.360 25.686  1.00 0.00 ? 75  ILE C CB    1 
ATOM 2481  C CG1   . ILE C  1 69  ? -8.420  -75.102 26.982  1.00 0.00 ? 75  ILE C CG1   1 
ATOM 2482  C CG2   . ILE C  1 69  ? -6.572  -76.368 25.887  1.00 0.00 ? 75  ILE C CG2   1 
ATOM 2483  C CD1   . ILE C  1 69  ? -9.233  -76.273 27.465  1.00 0.00 ? 75  ILE C CD1   1 
ATOM 2484  N N     . TYR C  1 70  ? -6.799  -74.832 22.883  1.00 0.00 ? 76  TYR C N     1 
ATOM 2485  C CA    . TYR C  1 70  ? -6.027  -75.265 21.749  1.00 0.00 ? 76  TYR C CA    1 
ATOM 2486  C C     . TYR C  1 70  ? -5.370  -74.101 21.041  1.00 0.00 ? 76  TYR C C     1 
ATOM 2487  O O     . TYR C  1 70  ? -4.266  -74.236 20.518  1.00 0.00 ? 76  TYR C O     1 
ATOM 2488  C CB    . TYR C  1 70  ? -6.905  -76.041 20.812  1.00 0.00 ? 76  TYR C CB    1 
ATOM 2489  C CG    . TYR C  1 70  ? -7.367  -77.331 21.418  1.00 0.00 ? 76  TYR C CG    1 
ATOM 2490  C CD1   . TYR C  1 70  ? -8.703  -77.524 21.684  1.00 0.00 ? 76  TYR C CD1   1 
ATOM 2491  C CD2   . TYR C  1 70  ? -6.449  -78.303 21.742  1.00 0.00 ? 76  TYR C CD2   1 
ATOM 2492  C CE1   . TYR C  1 70  ? -9.123  -78.690 22.276  1.00 0.00 ? 76  TYR C CE1   1 
ATOM 2493  C CE2   . TYR C  1 70  ? -6.862  -79.472 22.336  1.00 0.00 ? 76  TYR C CE2   1 
ATOM 2494  C CZ    . TYR C  1 70  ? -8.196  -79.663 22.606  1.00 0.00 ? 76  TYR C CZ    1 
ATOM 2495  O OH    . TYR C  1 70  ? -8.617  -80.818 23.213  1.00 0.00 ? 76  TYR C OH    1 
ATOM 2496  N N     . GLN C  1 71  ? -6.023  -72.947 21.059  1.00 0.00 ? 77  GLN C N     1 
ATOM 2497  C CA    . GLN C  1 71  ? -5.453  -71.762 20.466  1.00 0.00 ? 77  GLN C CA    1 
ATOM 2498  C C     . GLN C  1 71  ? -4.191  -71.370 21.187  1.00 0.00 ? 77  GLN C C     1 
ATOM 2499  O O     . GLN C  1 71  ? -3.194  -71.045 20.555  1.00 0.00 ? 77  GLN C O     1 
ATOM 2500  C CB    . GLN C  1 71  ? -6.453  -70.618 20.503  1.00 0.00 ? 77  GLN C CB    1 
ATOM 2501  C CG    . GLN C  1 71  ? -7.617  -70.781 19.547  1.00 0.00 ? 77  GLN C CG    1 
ATOM 2502  C CD    . GLN C  1 71  ? -7.204  -70.576 18.124  1.00 0.00 ? 77  GLN C CD    1 
ATOM 2503  O OE1   . GLN C  1 71  ? -6.011  -70.583 17.817  1.00 0.00 ? 77  GLN C OE1   1 
ATOM 2504  N NE2   . GLN C  1 71  ? -8.173  -70.366 17.240  1.00 0.00 ? 77  GLN C NE2   1 
ATOM 2505  N N     . GLY C  1 72  ? -4.218  -71.455 22.515  1.00 0.00 ? 78  GLY C N     1 
ATOM 2506  C CA    . GLY C  1 72  ? -3.045  -71.141 23.321  1.00 0.00 ? 78  GLY C CA    1 
ATOM 2507  C C     . GLY C  1 72  ? -1.900  -72.061 22.969  1.00 0.00 ? 78  GLY C C     1 
ATOM 2508  O O     . GLY C  1 72  ? -0.767  -71.613 22.783  1.00 0.00 ? 78  GLY C O     1 
ATOM 2509  N N     . PHE C  1 73  ? -2.201  -73.341 22.855  1.00 0.00 ? 79  PHE C N     1 
ATOM 2510  C CA    . PHE C  1 73  ? -1.221  -74.321 22.464  1.00 0.00 ? 79  PHE C CA    1 
ATOM 2511  C C     . PHE C  1 73  ? -0.598  -73.977 21.125  1.00 0.00 ? 79  PHE C C     1 
ATOM 2512  O O     . PHE C  1 73  ? 0.624   -73.969 20.991  1.00 0.00 ? 79  PHE C O     1 
ATOM 2513  C CB    . PHE C  1 73  ? -1.865  -75.685 22.404  1.00 0.00 ? 79  PHE C CB    1 
ATOM 2514  C CG    . PHE C  1 73  ? -1.005  -76.740 21.808  1.00 0.00 ? 79  PHE C CG    1 
ATOM 2515  C CD1   . PHE C  1 73  ? -0.024  -77.370 22.544  1.00 0.00 ? 79  PHE C CD1   1 
ATOM 2516  C CD2   . PHE C  1 73  ? -1.200  -77.123 20.501  1.00 0.00 ? 79  PHE C CD2   1 
ATOM 2517  C CE1   . PHE C  1 73  ? 0.744   -78.367 21.978  1.00 0.00 ? 79  PHE C CE1   1 
ATOM 2518  C CE2   . PHE C  1 73  ? -0.438  -78.109 19.932  1.00 0.00 ? 79  PHE C CE2   1 
ATOM 2519  C CZ    . PHE C  1 73  ? 0.537   -78.734 20.671  1.00 0.00 ? 79  PHE C CZ    1 
ATOM 2520  N N     . GLY C  1 74  ? -1.438  -73.701 20.134  1.00 0.00 ? 80  GLY C N     1 
ATOM 2521  C CA    . GLY C  1 74  ? -0.970  -73.367 18.798  1.00 0.00 ? 80  GLY C CA    1 
ATOM 2522  C C     . GLY C  1 74  ? -0.077  -72.141 18.809  1.00 0.00 ? 80  GLY C C     1 
ATOM 2523  O O     . GLY C  1 74  ? 0.987   -72.133 18.193  1.00 0.00 ? 80  GLY C O     1 
ATOM 2524  N N     . LEU C  1 75  ? -0.495  -71.123 19.527  1.00 0.00 ? 81  LEU C N     1 
ATOM 2525  C CA    . LEU C  1 75  ? 0.264   -69.900 19.615  1.00 0.00 ? 81  LEU C CA    1 
ATOM 2526  C C     . LEU C  1 75  ? 1.632   -70.140 20.210  1.00 0.00 ? 81  LEU C C     1 
ATOM 2527  O O     . LEU C  1 75  ? 2.621   -69.570 19.751  1.00 0.00 ? 81  LEU C O     1 
ATOM 2528  C CB    . LEU C  1 75  ? -0.500  -68.898 20.447  1.00 0.00 ? 81  LEU C CB    1 
ATOM 2529  C CG    . LEU C  1 75  ? -1.750  -68.336 19.793  1.00 0.00 ? 81  LEU C CG    1 
ATOM 2530  C CD1   . LEU C  1 75  ? -2.535  -67.535 20.812  1.00 0.00 ? 81  LEU C CD1   1 
ATOM 2531  C CD2   . LEU C  1 75  ? -1.335  -67.473 18.620  1.00 0.00 ? 81  LEU C CD2   1 
ATOM 2532  N N     . LYS C  1 76  ? 1.696   -71.013 21.201  1.00 0.00 ? 82  LYS C N     1 
ATOM 2533  C CA    . LYS C  1 76  ? 2.954   -71.367 21.818  1.00 0.00 ? 82  LYS C CA    1 
ATOM 2534  C C     . LYS C  1 76  ? 3.880   -72.047 20.847  1.00 0.00 ? 82  LYS C C     1 
ATOM 2535  O O     . LYS C  1 76  ? 5.076   -71.760 20.822  1.00 0.00 ? 82  LYS C O     1 
ATOM 2536  C CB    . LYS C  1 76  ? 2.716   -72.253 23.010  1.00 0.00 ? 82  LYS C CB    1 
ATOM 2537  C CG    . LYS C  1 76  ? 3.975   -72.752 23.672  1.00 0.00 ? 82  LYS C CG    1 
ATOM 2538  C CD    . LYS C  1 76  ? 4.770   -71.640 24.254  1.00 0.00 ? 82  LYS C CD    1 
ATOM 2539  C CE    . LYS C  1 76  ? 5.920   -72.161 25.080  1.00 0.00 ? 82  LYS C CE    1 
ATOM 2540  N NZ    . LYS C  1 76  ? 5.442   -72.754 26.351  1.00 0.00 ? 82  LYS C NZ    1 
ATOM 2541  N N     . VAL C  1 77  ? 3.331   -72.933 20.023  1.00 0.00 ? 83  VAL C N     1 
ATOM 2542  C CA    . VAL C  1 77  ? 4.130   -73.609 19.018  1.00 0.00 ? 83  VAL C CA    1 
ATOM 2543  C C     . VAL C  1 77  ? 4.768   -72.600 18.090  1.00 0.00 ? 83  VAL C C     1 
ATOM 2544  O O     . VAL C  1 77  ? 5.964   -72.673 17.805  1.00 0.00 ? 83  VAL C O     1 
ATOM 2545  C CB    . VAL C  1 77  ? 3.268   -74.584 18.191  1.00 0.00 ? 83  VAL C CB    1 
ATOM 2546  C CG1   . VAL C  1 77  ? 4.061   -75.114 17.015  1.00 0.00 ? 83  VAL C CG1   1 
ATOM 2547  C CG2   . VAL C  1 77  ? 2.795   -75.731 19.065  1.00 0.00 ? 83  VAL C CG2   1 
ATOM 2548  N N     . ALA C  1 78  ? 3.964   -71.651 17.632  1.00 0.00 ? 84  ALA C N     1 
ATOM 2549  C CA    . ALA C  1 78  ? 4.430   -70.613 16.737  1.00 0.00 ? 84  ALA C CA    1 
ATOM 2550  C C     . ALA C  1 78  ? 5.481   -69.733 17.397  1.00 0.00 ? 84  ALA C C     1 
ATOM 2551  O O     . ALA C  1 78  ? 6.447   -69.333 16.754  1.00 0.00 ? 84  ALA C O     1 
ATOM 2552  C CB    . ALA C  1 78  ? 3.264   -69.779 16.267  1.00 0.00 ? 84  ALA C CB    1 
ATOM 2553  N N     . ARG C  1 79  ? 5.295   -69.436 18.679  1.00 0.00 ? 85  ARG C N     1 
ATOM 2554  C CA    . ARG C  1 79  ? 6.251   -68.621 19.410  1.00 0.00 ? 85  ARG C CA    1 
ATOM 2555  C C     . ARG C  1 79  ? 7.617   -69.230 19.393  1.00 0.00 ? 85  ARG C C     1 
ATOM 2556  O O     . ARG C  1 79  ? 8.601   -68.565 19.066  1.00 0.00 ? 85  ARG C O     1 
ATOM 2557  C CB    . ARG C  1 79  ? 5.821   -68.448 20.838  1.00 0.00 ? 85  ARG C CB    1 
ATOM 2558  C CG    . ARG C  1 79  ? 6.761   -67.612 21.690  1.00 0.00 ? 85  ARG C CG    1 
ATOM 2559  C CD    . ARG C  1 79  ? 6.224   -67.443 23.055  1.00 0.00 ? 85  ARG C CD    1 
ATOM 2560  N NE    . ARG C  1 79  ? 6.868   -66.375 23.792  1.00 0.00 ? 85  ARG C NE    1 
ATOM 2561  C CZ    . ARG C  1 79  ? 7.992   -66.503 24.521  1.00 0.00 ? 85  ARG C CZ    1 
ATOM 2562  N NH1   . ARG C  1 79  ? 8.605   -67.664 24.577  1.00 0.00 ? 85  ARG C NH1   1 
ATOM 2563  N NH2   . ARG C  1 79  ? 8.473   -65.460 25.180  1.00 0.00 ? 85  ARG C NH2   1 
ATOM 2564  N N     . ALA C  1 80  ? 7.682   -70.502 19.740  1.00 0.00 ? 86  ALA C N     1 
ATOM 2565  C CA    . ALA C  1 80  ? 8.930   -71.222 19.753  1.00 0.00 ? 86  ALA C CA    1 
ATOM 2566  C C     . ALA C  1 80  ? 9.540   -71.238 18.375  1.00 0.00 ? 86  ALA C C     1 
ATOM 2567  O O     . ALA C  1 80  ? 10.741  -71.043 18.218  1.00 0.00 ? 86  ALA C O     1 
ATOM 2568  C CB    . ALA C  1 80  ? 8.712   -72.627 20.247  1.00 0.00 ? 86  ALA C CB    1 
ATOM 2569  N N     . LEU C  1 81  ? 8.710   -71.433 17.372  1.00 0.00 ? 87  LEU C N     1 
ATOM 2570  C CA    . LEU C  1 81  ? 9.185   -71.431 16.022  1.00 0.00 ? 87  LEU C CA    1 
ATOM 2571  C C     . LEU C  1 81  ? 9.892   -70.130 15.707  1.00 0.00 ? 87  LEU C C     1 
ATOM 2572  O O     . LEU C  1 81  ? 11.000  -70.136 15.190  1.00 0.00 ? 87  LEU C O     1 
ATOM 2573  C CB    . LEU C  1 81  ? 8.037   -71.653 15.059  1.00 0.00 ? 87  LEU C CB    1 
ATOM 2574  C CG    . LEU C  1 81  ? 8.410   -71.658 13.590  1.00 0.00 ? 87  LEU C CG    1 
ATOM 2575  C CD1   . LEU C  1 81  ? 9.384   -72.789 13.330  1.00 0.00 ? 87  LEU C CD1   1 
ATOM 2576  C CD2   . LEU C  1 81  ? 7.150   -71.816 12.757  1.00 0.00 ? 87  LEU C CD2   1 
ATOM 2577  N N     . ASN C  1 82  ? 9.281   -69.012 16.060  1.00 0.00 ? 88  ASN C N     1 
ATOM 2578  C CA    . ASN C  1 82  ? 9.901   -67.717 15.793  1.00 0.00 ? 88  ASN C CA    1 
ATOM 2579  C C     . ASN C  1 82  ? 11.203  -67.493 16.560  1.00 0.00 ? 88  ASN C C     1 
ATOM 2580  O O     . ASN C  1 82  ? 12.147  -66.917 16.025  1.00 0.00 ? 88  ASN C O     1 
ATOM 2581  C CB    . ASN C  1 82  ? 8.944   -66.589 16.091  1.00 0.00 ? 88  ASN C CB    1 
ATOM 2582  C CG    . ASN C  1 82  ? 7.892   -66.442 15.050  1.00 0.00 ? 88  ASN C CG    1 
ATOM 2583  O OD1   . ASN C  1 82  ? 7.962   -67.057 13.984  1.00 0.00 ? 88  ASN C OD1   1 
ATOM 2584  N ND2   . ASN C  1 82  ? 6.928   -65.613 15.319  1.00 0.00 ? 88  ASN C ND2   1 
ATOM 2585  N N     . ARG C  1 83  ? 11.256  -67.935 17.811  1.00 0.00 ? 89  ARG C N     1 
ATOM 2586  C CA    . ARG C  1 83  ? 12.421  -67.659 18.649  1.00 0.00 ? 89  ARG C CA    1 
ATOM 2587  C C     . ARG C  1 83  ? 13.490  -68.756 18.582  1.00 0.00 ? 89  ARG C C     1 
ATOM 2588  O O     . ARG C  1 83  ? 14.622  -68.542 19.007  1.00 0.00 ? 89  ARG C O     1 
ATOM 2589  C CB    . ARG C  1 83  ? 11.985  -67.456 20.092  1.00 0.00 ? 89  ARG C CB    1 
ATOM 2590  C CG    . ARG C  1 83  ? 11.154  -66.189 20.334  1.00 0.00 ? 89  ARG C CG    1 
ATOM 2591  C CD    . ARG C  1 83  ? 10.676  -66.097 21.743  1.00 0.00 ? 89  ARG C CD    1 
ATOM 2592  N NE    . ARG C  1 83  ? 9.782   -64.955 21.960  1.00 0.00 ? 89  ARG C NE    1 
ATOM 2593  C CZ    . ARG C  1 83  ? 10.167  -63.730 22.364  1.00 0.00 ? 89  ARG C CZ    1 
ATOM 2594  N NH1   . ARG C  1 83  ? 11.431  -63.474 22.602  1.00 0.00 ? 89  ARG C NH1   1 
ATOM 2595  N NH2   . ARG C  1 83  ? 9.265   -62.786 22.530  1.00 0.00 ? 89  ARG C NH2   1 
ATOM 2596  N N     . ILE C  1 84  ? 13.137  -69.913 18.039  1.00 0.00 ? 90  ILE C N     1 
ATOM 2597  C CA    . ILE C  1 84  ? 14.078  -71.027 17.904  1.00 0.00 ? 90  ILE C CA    1 
ATOM 2598  C C     . ILE C  1 84  ? 14.327  -71.397 16.455  1.00 0.00 ? 90  ILE C C     1 
ATOM 2599  O O     . ILE C  1 84  ? 15.467  -71.622 16.042  1.00 0.00 ? 90  ILE C O     1 
ATOM 2600  C CB    . ILE C  1 84  ? 13.572  -72.282 18.635  1.00 0.00 ? 90  ILE C CB    1 
ATOM 2601  C CG1   . ILE C  1 84  ? 13.486  -72.048 20.135  1.00 0.00 ? 90  ILE C CG1   1 
ATOM 2602  C CG2   . ILE C  1 84  ? 14.461  -73.453 18.331  1.00 0.00 ? 90  ILE C CG2   1 
ATOM 2603  C CD1   . ILE C  1 84  ? 12.830  -73.185 20.879  1.00 0.00 ? 90  ILE C CD1   1 
ATOM 2604  N N     . GLY C  1 85  ? 13.256  -71.525 15.701  1.00 0.00 ? 91  GLY C N     1 
ATOM 2605  C CA    . GLY C  1 85  ? 13.351  -71.970 14.321  1.00 0.00 ? 91  GLY C CA    1 
ATOM 2606  C C     . GLY C  1 85  ? 13.049  -73.450 14.249  1.00 0.00 ? 91  GLY C C     1 
ATOM 2607  O O     . GLY C  1 85  ? 13.079  -74.138 15.263  1.00 0.00 ? 91  GLY C O     1 
ATOM 2608  N N     . SER C  1 86  ? 12.743  -73.940 13.057  1.00 0.00 ? 92  SER C N     1 
ATOM 2609  C CA    . SER C  1 86  ? 12.386  -75.342 12.893  1.00 0.00 ? 92  SER C CA    1 
ATOM 2610  C C     . SER C  1 86  ? 13.583  -76.243 13.075  1.00 0.00 ? 92  SER C C     1 
ATOM 2611  O O     . SER C  1 86  ? 14.726  -75.796 12.978  1.00 0.00 ? 92  SER C O     1 
ATOM 2612  C CB    . SER C  1 86  ? 11.795  -75.576 11.530  1.00 0.00 ? 92  SER C CB    1 
ATOM 2613  O OG    . SER C  1 86  ? 12.769  -75.431 10.536  1.00 0.00 ? 92  SER C OG    1 
ATOM 2614  N N     . GLY C  1 87  ? 13.321  -77.523 13.303  1.00 0.00 ? 93  GLY C N     1 
ATOM 2615  C CA    . GLY C  1 87  ? 14.382  -78.493 13.492  1.00 0.00 ? 93  GLY C CA    1 
ATOM 2616  C C     . GLY C  1 87  ? 14.378  -79.043 14.910  1.00 0.00 ? 93  GLY C C     1 
ATOM 2617  O O     . GLY C  1 87  ? 13.489  -78.729 15.698  1.00 0.00 ? 93  GLY C O     1 
ATOM 2618  N N     . PRO C  1 88  ? 15.364  -79.882 15.212  1.00 0.00 ? 94  PRO C N     1 
ATOM 2619  C CA    . PRO C  1 88  ? 15.615  -80.576 16.491  1.00 0.00 ? 94  PRO C CA    1 
ATOM 2620  C C     . PRO C  1 88  ? 15.057  -79.845 17.708  1.00 0.00 ? 94  PRO C C     1 
ATOM 2621  O O     . PRO C  1 88  ? 14.231  -80.387 18.435  1.00 0.00 ? 94  PRO C O     1 
ATOM 2622  C CB    . PRO C  1 88  ? 17.141  -80.634 16.564  1.00 0.00 ? 94  PRO C CB    1 
ATOM 2623  C CG    . PRO C  1 88  ? 17.566  -80.606 15.157  1.00 0.00 ? 94  PRO C CG    1 
ATOM 2624  C CD    . PRO C  1 88  ? 16.642  -79.621 14.534  1.00 0.00 ? 94  PRO C CD    1 
ATOM 2625  N N     . ALA C  1 89  ? 15.543  -78.636 17.953  1.00 0.00 ? 95  ALA C N     1 
ATOM 2626  C CA    . ALA C  1 89  ? 15.141  -77.890 19.136  1.00 0.00 ? 95  ALA C CA    1 
ATOM 2627  C C     . ALA C  1 89  ? 13.641  -77.677 19.197  1.00 0.00 ? 95  ALA C C     1 
ATOM 2628  O O     . ALA C  1 89  ? 13.051  -77.735 20.276  1.00 0.00 ? 95  ALA C O     1 
ATOM 2629  C CB    . ALA C  1 89  ? 15.864  -76.570 19.175  1.00 0.00 ? 95  ALA C CB    1 
ATOM 2630  N N     . LEU C  1 90  ? 13.018  -77.434 18.050  1.00 0.00 ? 96  LEU C N     1 
ATOM 2631  C CA    . LEU C  1 90  ? 11.584  -77.239 18.014  1.00 0.00 ? 96  LEU C CA    1 
ATOM 2632  C C     . LEU C  1 90  ? 10.895  -78.507 18.387  1.00 0.00 ? 96  LEU C C     1 
ATOM 2633  O O     . LEU C  1 90  ? 9.915   -78.496 19.124  1.00 0.00 ? 96  LEU C O     1 
ATOM 2634  C CB    . LEU C  1 90  ? 11.112  -76.802 16.646  1.00 0.00 ? 96  LEU C CB    1 
ATOM 2635  C CG    . LEU C  1 90  ? 9.615   -76.514 16.559  1.00 0.00 ? 96  LEU C CG    1 
ATOM 2636  C CD1   . LEU C  1 90  ? 9.267   -75.385 17.518  1.00 0.00 ? 96  LEU C CD1   1 
ATOM 2637  C CD2   . LEU C  1 90  ? 9.247   -76.155 15.137  1.00 0.00 ? 96  LEU C CD2   1 
ATOM 2638  N N     . VAL C  1 91  ? 11.401  -79.614 17.870  1.00 0.00 ? 97  VAL C N     1 
ATOM 2639  C CA    . VAL C  1 91  ? 10.852  -80.916 18.187  1.00 0.00 ? 97  VAL C CA    1 
ATOM 2640  C C     . VAL C  1 91  ? 10.873  -81.155 19.679  1.00 0.00 ? 97  VAL C C     1 
ATOM 2641  O O     . VAL C  1 91  ? 9.876   -81.586 20.262  1.00 0.00 ? 97  VAL C O     1 
ATOM 2642  C CB    . VAL C  1 91  ? 11.645  -82.023 17.482  1.00 0.00 ? 97  VAL C CB    1 
ATOM 2643  C CG1   . VAL C  1 91  ? 11.215  -83.381 17.996  1.00 0.00 ? 97  VAL C CG1   1 
ATOM 2644  C CG2   . VAL C  1 91  ? 11.438  -81.917 15.982  1.00 0.00 ? 97  VAL C CG2   1 
ATOM 2645  N N     . ASN C  1 92  ? 12.005  -80.844 20.302  1.00 0.00 ? 98  ASN C N     1 
ATOM 2646  C CA    . ASN C  1 92  ? 12.152  -81.000 21.732  1.00 0.00 ? 98  ASN C CA    1 
ATOM 2647  C C     . ASN C  1 92  ? 11.124  -80.165 22.463  1.00 0.00 ? 98  ASN C C     1 
ATOM 2648  O O     . ASN C  1 92  ? 10.482  -80.634 23.408  1.00 0.00 ? 98  ASN C O     1 
ATOM 2649  C CB    . ASN C  1 92  ? 13.553  -80.618 22.156  1.00 0.00 ? 98  ASN C CB    1 
ATOM 2650  C CG    . ASN C  1 92  ? 14.552  -81.630 21.712  1.00 0.00 ? 98  ASN C CG    1 
ATOM 2651  O OD1   . ASN C  1 92  ? 14.171  -82.752 21.366  1.00 0.00 ? 98  ASN C OD1   1 
ATOM 2652  N ND2   . ASN C  1 92  ? 15.817  -81.277 21.708  1.00 0.00 ? 98  ASN C ND2   1 
ATOM 2653  N N     . MET C  1 93  ? 10.932  -78.945 21.984  1.00 0.00 ? 99  MET C N     1 
ATOM 2654  C CA    . MET C  1 93  ? 9.976   -78.042 22.563  1.00 0.00 ? 99  MET C CA    1 
ATOM 2655  C C     . MET C  1 93  ? 8.571   -78.563 22.494  1.00 0.00 ? 99  MET C C     1 
ATOM 2656  O O     . MET C  1 93  ? 7.859   -78.569 23.498  1.00 0.00 ? 99  MET C O     1 
ATOM 2657  C CB    . MET C  1 93  ? 10.045  -76.706 21.874  1.00 0.00 ? 99  MET C CB    1 
ATOM 2658  C CG    . MET C  1 93  ? 9.050   -75.715 22.400  1.00 0.00 ? 99  MET C CG    1 
ATOM 2659  S SD    . MET C  1 93  ? 9.386   -75.251 24.082  1.00 0.00 ? 99  MET C SD    1 
ATOM 2660  C CE    . MET C  1 93  ? 10.735  -74.109 23.818  1.00 0.00 ? 99  MET C CE    1 
ATOM 2661  N N     . ILE C  1 94  ? 8.152   -78.977 21.305  1.00 0.00 ? 100 ILE C N     1 
ATOM 2662  C CA    . ILE C  1 94  ? 6.785   -79.395 21.099  1.00 0.00 ? 100 ILE C CA    1 
ATOM 2663  C C     . ILE C  1 94  ? 6.441   -80.593 21.927  1.00 0.00 ? 100 ILE C C     1 
ATOM 2664  O O     . ILE C  1 94  ? 5.344   -80.675 22.465  1.00 0.00 ? 100 ILE C O     1 
ATOM 2665  C CB    . ILE C  1 94  ? 6.496   -79.688 19.639  1.00 0.00 ? 100 ILE C CB    1 
ATOM 2666  C CG1   . ILE C  1 94  ? 6.573   -78.402 18.824  1.00 0.00 ? 100 ILE C CG1   1 
ATOM 2667  C CG2   . ILE C  1 94  ? 5.107   -80.292 19.518  1.00 0.00 ? 100 ILE C CG2   1 
ATOM 2668  C CD1   . ILE C  1 94  ? 6.563   -78.631 17.335  1.00 0.00 ? 100 ILE C CD1   1 
ATOM 2669  N N     . ASN C  1 95  ? 7.368   -81.538 22.029  1.00 0.00 ? 101 ASN C N     1 
ATOM 2670  C CA    . ASN C  1 95  ? 7.135   -82.719 22.843  1.00 0.00 ? 101 ASN C CA    1 
ATOM 2671  C C     . ASN C  1 95  ? 6.789   -82.340 24.266  1.00 0.00 ? 101 ASN C C     1 
ATOM 2672  O O     . ASN C  1 95  ? 5.809   -82.837 24.829  1.00 0.00 ? 101 ASN C O     1 
ATOM 2673  C CB    . ASN C  1 95  ? 8.344   -83.619 22.836  1.00 0.00 ? 101 ASN C CB    1 
ATOM 2674  C CG    . ASN C  1 95  ? 8.497   -84.368 21.565  1.00 0.00 ? 101 ASN C CG    1 
ATOM 2675  O OD1   . ASN C  1 95  ? 7.526   -84.568 20.830  1.00 0.00 ? 101 ASN C OD1   1 
ATOM 2676  N ND2   . ASN C  1 95  ? 9.699   -84.795 21.285  1.00 0.00 ? 101 ASN C ND2   1 
ATOM 2677  N N     . GLY C  1 96  ? 7.580   -81.436 24.845  1.00 0.00 ? 102 GLY C N     1 
ATOM 2678  C CA    . GLY C  1 96  ? 7.334   -80.994 26.202  1.00 0.00 ? 102 GLY C CA    1 
ATOM 2679  C C     . GLY C  1 96  ? 6.051   -80.215 26.294  1.00 0.00 ? 102 GLY C C     1 
ATOM 2680  O O     . GLY C  1 96  ? 5.279   -80.391 27.237  1.00 0.00 ? 102 GLY C O     1 
ATOM 2681  N N     . LEU C  1 97  ? 5.814   -79.364 25.306  1.00 0.00 ? 103 LEU C N     1 
ATOM 2682  C CA    . LEU C  1 97  ? 4.622   -78.552 25.259  1.00 0.00 ? 103 LEU C CA    1 
ATOM 2683  C C     . LEU C  1 97  ? 3.366   -79.380 25.251  1.00 0.00 ? 103 LEU C C     1 
ATOM 2684  O O     . LEU C  1 97  ? 2.402   -79.062 25.944  1.00 0.00 ? 103 LEU C O     1 
ATOM 2685  C CB    . LEU C  1 97  ? 4.637   -77.677 24.044  1.00 0.00 ? 103 LEU C CB    1 
ATOM 2686  C CG    . LEU C  1 97  ? 3.408   -76.830 23.890  1.00 0.00 ? 103 LEU C CG    1 
ATOM 2687  C CD1   . LEU C  1 97  ? 3.282   -75.947 25.108  1.00 0.00 ? 103 LEU C CD1   1 
ATOM 2688  C CD2   . LEU C  1 97  ? 3.514   -76.026 22.615  1.00 0.00 ? 103 LEU C CD2   1 
ATOM 2689  N N     . LYS C  1 98  ? 3.347   -80.413 24.435  1.00 0.00 ? 104 LYS C N     1 
ATOM 2690  C CA    . LYS C  1 98  ? 2.218   -81.294 24.401  1.00 0.00 ? 104 LYS C CA    1 
ATOM 2691  C C     . LYS C  1 98  ? 1.995   -81.919 25.751  1.00 0.00 ? 104 LYS C C     1 
ATOM 2692  O O     . LYS C  1 98  ? 0.876   -81.943 26.245  1.00 0.00 ? 104 LYS C O     1 
ATOM 2693  C CB    . LYS C  1 98  ? 2.402   -82.360 23.351  1.00 0.00 ? 104 LYS C CB    1 
ATOM 2694  C CG    . LYS C  1 98  ? 2.179   -81.886 21.931  1.00 0.00 ? 104 LYS C CG    1 
ATOM 2695  C CD    . LYS C  1 98  ? 2.517   -82.978 20.941  1.00 0.00 ? 104 LYS C CD    1 
ATOM 2696  C CE    . LYS C  1 98  ? 1.753   -84.251 21.266  1.00 0.00 ? 104 LYS C CE    1 
ATOM 2697  N NZ    . LYS C  1 98  ? 1.965   -85.301 20.245  1.00 0.00 ? 104 LYS C NZ    1 
ATOM 2698  N N     . GLY C  1 99  ? 3.070   -82.376 26.384  1.00 0.00 ? 105 GLY C N     1 
ATOM 2699  C CA    . GLY C  1 99  ? 2.959   -82.954 27.714  1.00 0.00 ? 105 GLY C CA    1 
ATOM 2700  C C     . GLY C  1 99  ? 2.320   -81.961 28.672  1.00 0.00 ? 105 GLY C C     1 
ATOM 2701  O O     . GLY C  1 99  ? 1.447   -82.319 29.465  1.00 0.00 ? 105 GLY C O     1 
ATOM 2702  N N     . TYR C  1 100 ? 2.741   -80.707 28.569  1.00 0.00 ? 106 TYR C N     1 
ATOM 2703  C CA    . TYR C  1 100 ? 2.213   -79.639 29.391  1.00 0.00 ? 106 TYR C CA    1 
ATOM 2704  C C     . TYR C  1 100 ? 0.716   -79.540 29.259  1.00 0.00 ? 106 TYR C C     1 
ATOM 2705  O O     . TYR C  1 100 ? 0.003   -79.645 30.241  1.00 0.00 ? 106 TYR C O     1 
ATOM 2706  C CB    . TYR C  1 100 ? 2.873   -78.319 28.991  1.00 0.00 ? 106 TYR C CB    1 
ATOM 2707  C CG    . TYR C  1 100 ? 2.431   -77.102 29.746  1.00 0.00 ? 106 TYR C CG    1 
ATOM 2708  C CD1   . TYR C  1 100 ? 2.628   -77.003 31.111  1.00 0.00 ? 106 TYR C CD1   1 
ATOM 2709  C CD2   . TYR C  1 100 ? 1.894   -76.045 29.047  1.00 0.00 ? 106 TYR C CD2   1 
ATOM 2710  C CE1   . TYR C  1 100 ? 2.254   -75.847 31.775  1.00 0.00 ? 106 TYR C CE1   1 
ATOM 2711  C CE2   . TYR C  1 100 ? 1.531   -74.893 29.700  1.00 0.00 ? 106 TYR C CE2   1 
ATOM 2712  C CZ    . TYR C  1 100 ? 1.705   -74.789 31.058  1.00 0.00 ? 106 TYR C CZ    1 
ATOM 2713  O OH    . TYR C  1 100 ? 1.332   -73.629 31.709  1.00 0.00 ? 106 TYR C OH    1 
ATOM 2714  N N     . TYR C  1 101 ? 0.230   -79.371 28.044  1.00 0.00 ? 107 TYR C N     1 
ATOM 2715  C CA    . TYR C  1 101 ? -1.201  -79.208 27.841  1.00 0.00 ? 107 TYR C CA    1 
ATOM 2716  C C     . TYR C  1 101 ? -2.015  -80.455 28.076  1.00 0.00 ? 107 TYR C C     1 
ATOM 2717  O O     . TYR C  1 101 ? -3.095  -80.389 28.667  1.00 0.00 ? 107 TYR C O     1 
ATOM 2718  C CB    . TYR C  1 101 ? -1.472  -78.678 26.456  1.00 0.00 ? 107 TYR C CB    1 
ATOM 2719  C CG    . TYR C  1 101 ? -1.472  -77.193 26.400  1.00 0.00 ? 107 TYR C CG    1 
ATOM 2720  C CD1   . TYR C  1 101 ? -0.307  -76.496 26.174  1.00 0.00 ? 107 TYR C CD1   1 
ATOM 2721  C CD2   . TYR C  1 101 ? -2.662  -76.522 26.580  1.00 0.00 ? 107 TYR C CD2   1 
ATOM 2722  C CE1   . TYR C  1 101 ? -0.333  -75.119 26.134  1.00 0.00 ? 107 TYR C CE1   1 
ATOM 2723  C CE2   . TYR C  1 101 ? -2.691  -75.152 26.539  1.00 0.00 ? 107 TYR C CE2   1 
ATOM 2724  C CZ    . TYR C  1 101 ? -1.534  -74.451 26.320  1.00 0.00 ? 107 TYR C CZ    1 
ATOM 2725  O OH    . TYR C  1 101 ? -1.568  -73.085 26.281  1.00 0.00 ? 107 TYR C OH    1 
ATOM 2726  N N     . ILE C  1 102 ? -1.499  -81.591 27.665  1.00 0.00 ? 108 ILE C N     1 
ATOM 2727  C CA    . ILE C  1 102 ? -2.230  -82.821 27.814  1.00 0.00 ? 108 ILE C CA    1 
ATOM 2728  C C     . ILE C  1 102 ? -2.496  -83.138 29.250  1.00 0.00 ? 108 ILE C C     1 
ATOM 2729  O O     . ILE C  1 102 ? -3.602  -83.520 29.610  1.00 0.00 ? 108 ILE C O     1 
ATOM 2730  C CB    . ILE C  1 102 ? -1.484  -83.997 27.192  1.00 0.00 ? 108 ILE C CB    1 
ATOM 2731  C CG1   . ILE C  1 102 ? -1.437  -83.854 25.684  1.00 0.00 ? 108 ILE C CG1   1 
ATOM 2732  C CG2   . ILE C  1 102 ? -2.165  -85.295 27.576  1.00 0.00 ? 108 ILE C CG2   1 
ATOM 2733  C CD1   . ILE C  1 102 ? -0.479  -84.806 25.007  1.00 0.00 ? 108 ILE C CD1   1 
ATOM 2734  N N     . SER C  1 103 ? -1.480  -83.025 30.079  1.00 0.00 ? 109 SER C N     1 
ATOM 2735  C CA    . SER C  1 103 ? -1.625  -83.423 31.457  1.00 0.00 ? 109 SER C CA    1 
ATOM 2736  C C     . SER C  1 103 ? -1.981  -82.290 32.409  1.00 0.00 ? 109 SER C C     1 
ATOM 2737  O O     . SER C  1 103 ? -2.609  -82.532 33.436  1.00 0.00 ? 109 SER C O     1 
ATOM 2738  C CB    . SER C  1 103 ? -0.362  -84.089 31.906  1.00 0.00 ? 109 SER C CB    1 
ATOM 2739  O OG    . SER C  1 103 ? 0.709   -83.207 31.835  1.00 0.00 ? 109 SER C OG    1 
ATOM 2740  N N     . ALA C  1 104 ? -1.602  -81.056 32.087  1.00 0.00 ? 110 ALA C N     1 
ATOM 2741  C CA    . ALA C  1 104 ? -1.926  -79.957 32.991  1.00 0.00 ? 110 ALA C CA    1 
ATOM 2742  C C     . ALA C  1 104 ? -3.310  -79.443 32.760  1.00 0.00 ? 110 ALA C C     1 
ATOM 2743  O O     . ALA C  1 104 ? -3.974  -79.050 33.709  1.00 0.00 ? 110 ALA C O     1 
ATOM 2744  C CB    . ALA C  1 104 ? -0.940  -78.801 32.861  1.00 0.00 ? 110 ALA C CB    1 
ATOM 2745  N N     . PHE C  1 105 ? -3.753  -79.427 31.497  1.00 0.00 ? 111 PHE C N     1 
ATOM 2746  C CA    . PHE C  1 105 ? -5.055  -78.870 31.168  1.00 0.00 ? 111 PHE C CA    1 
ATOM 2747  C C     . PHE C  1 105 ? -5.992  -79.888 30.583  1.00 0.00 ? 111 PHE C C     1 
ATOM 2748  O O     . PHE C  1 105 ? -7.097  -79.547 30.168  1.00 0.00 ? 111 PHE C O     1 
ATOM 2749  C CB    . PHE C  1 105 ? -4.899  -77.729 30.190  1.00 0.00 ? 111 PHE C CB    1 
ATOM 2750  C CG    . PHE C  1 105 ? -4.060  -76.629 30.724  1.00 0.00 ? 111 PHE C CG    1 
ATOM 2751  C CD1   . PHE C  1 105 ? -2.830  -76.357 30.174  1.00 0.00 ? 111 PHE C CD1   1 
ATOM 2752  C CD2   . PHE C  1 105 ? -4.487  -75.884 31.797  1.00 0.00 ? 111 PHE C CD2   1 
ATOM 2753  C CE1   . PHE C  1 105 ? -2.045  -75.352 30.674  1.00 0.00 ? 111 PHE C CE1   1 
ATOM 2754  C CE2   . PHE C  1 105 ? -3.706  -74.875 32.304  1.00 0.00 ? 111 PHE C CE2   1 
ATOM 2755  C CZ    . PHE C  1 105 ? -2.480  -74.609 31.739  1.00 0.00 ? 111 PHE C CZ    1 
ATOM 2756  N N     . ASN C  1 106 ? -5.557  -81.138 30.538  1.00 0.00 ? 112 ASN C N     1 
ATOM 2757  C CA    . ASN C  1 106 ? -6.374  -82.216 30.004  1.00 0.00 ? 112 ASN C CA    1 
ATOM 2758  C C     . ASN C  1 106 ? -6.747  -81.980 28.554  1.00 0.00 ? 112 ASN C C     1 
ATOM 2759  O O     . ASN C  1 106 ? -7.862  -82.291 28.139  1.00 0.00 ? 112 ASN C O     1 
ATOM 2760  C CB    . ASN C  1 106 ? -7.611  -82.414 30.845  1.00 0.00 ? 112 ASN C CB    1 
ATOM 2761  C CG    . ASN C  1 106 ? -7.274  -82.827 32.239  1.00 0.00 ? 112 ASN C CG    1 
ATOM 2762  O OD1   . ASN C  1 106 ? -6.321  -83.581 32.459  1.00 0.00 ? 112 ASN C OD1   1 
ATOM 2763  N ND2   . ASN C  1 106 ? -8.034  -82.355 33.190  1.00 0.00 ? 112 ASN C ND2   1 
ATOM 2764  N N     . ALA C  1 107 ? -5.818  -81.431 27.780  1.00 0.00 ? 113 ALA C N     1 
ATOM 2765  C CA    . ALA C  1 107 ? -6.062  -81.212 26.366  1.00 0.00 ? 113 ALA C CA    1 
ATOM 2766  C C     . ALA C  1 107 ? -6.002  -82.539 25.629  1.00 0.00 ? 113 ALA C C     1 
ATOM 2767  O O     . ALA C  1 107 ? -5.258  -83.435 26.020  1.00 0.00 ? 113 ALA C O     1 
ATOM 2768  C CB    . ALA C  1 107 ? -5.063  -80.236 25.805  1.00 0.00 ? 113 ALA C CB    1 
ATOM 2769  N N     . ASN C  1 108 ? -6.804  -82.671 24.573  1.00 0.00 ? 114 ASN C N     1 
ATOM 2770  C CA    . ASN C  1 108 ? -6.886  -83.920 23.823  1.00 0.00 ? 114 ASN C CA    1 
ATOM 2771  C C     . ASN C  1 108 ? -5.749  -84.081 22.814  1.00 0.00 ? 114 ASN C C     1 
ATOM 2772  O O     . ASN C  1 108 ? -5.811  -83.505 21.730  1.00 0.00 ? 114 ASN C O     1 
ATOM 2773  C CB    . ASN C  1 108 ? -8.200  -84.016 23.107  1.00 0.00 ? 114 ASN C CB    1 
ATOM 2774  C CG    . ASN C  1 108 ? -8.324  -85.297 22.359  1.00 0.00 ? 114 ASN C CG    1 
ATOM 2775  O OD1   . ASN C  1 108 ? -7.318  -85.868 21.920  1.00 0.00 ? 114 ASN C OD1   1 
ATOM 2776  N ND2   . ASN C  1 108 ? -9.531  -85.772 22.203  1.00 0.00 ? 114 ASN C ND2   1 
ATOM 2777  N N     . PRO C  1 109 ? -4.722  -84.883 23.158  1.00 0.00 ? 115 PRO C N     1 
ATOM 2778  C CA    . PRO C  1 109 ? -3.548  -85.228 22.332  1.00 0.00 ? 115 PRO C CA    1 
ATOM 2779  C C     . PRO C  1 109 ? -3.829  -85.228 20.838  1.00 0.00 ? 115 PRO C C     1 
ATOM 2780  O O     . PRO C  1 109 ? -3.038  -84.702 20.054  1.00 0.00 ? 115 PRO C O     1 
ATOM 2781  C CB    . PRO C  1 109 ? -3.212  -86.655 22.772  1.00 0.00 ? 115 PRO C CB    1 
ATOM 2782  C CG    . PRO C  1 109 ? -3.719  -86.742 24.145  1.00 0.00 ? 115 PRO C CG    1 
ATOM 2783  C CD    . PRO C  1 109 ? -5.008  -85.998 24.089  1.00 0.00 ? 115 PRO C CD    1 
ATOM 2784  N N     . GLN C  1 110 ? -4.927  -85.855 20.440  1.00 0.00 ? 116 GLN C N     1 
ATOM 2785  C CA    . GLN C  1 110 ? -5.247  -85.997 19.035  1.00 0.00 ? 116 GLN C CA    1 
ATOM 2786  C C     . GLN C  1 110 ? -5.513  -84.649 18.385  1.00 0.00 ? 116 GLN C C     1 
ATOM 2787  O O     . GLN C  1 110 ? -5.046  -84.379 17.276  1.00 0.00 ? 116 GLN C O     1 
ATOM 2788  C CB    . GLN C  1 110 ? -6.452  -86.903 18.859  1.00 0.00 ? 116 GLN C CB    1 
ATOM 2789  C CG    . GLN C  1 110 ? -6.697  -87.311 17.432  1.00 0.00 ? 116 GLN C CG    1 
ATOM 2790  C CD    . GLN C  1 110 ? -7.424  -86.247 16.660  1.00 0.00 ? 116 GLN C CD    1 
ATOM 2791  O OE1   . GLN C  1 110 ? -8.285  -85.549 17.201  1.00 0.00 ? 116 GLN C OE1   1 
ATOM 2792  N NE2   . GLN C  1 110 ? -7.076  -86.104 15.388  1.00 0.00 ? 116 GLN C NE2   1 
ATOM 2793  N N     . VAL C  1 111 ? -6.251  -83.802 19.074  1.00 0.00 ? 117 VAL C N     1 
ATOM 2794  C CA    . VAL C  1 111 ? -6.542  -82.495 18.558  1.00 0.00 ? 117 VAL C CA    1 
ATOM 2795  C C     . VAL C  1 111 ? -5.293  -81.662 18.560  1.00 0.00 ? 117 VAL C C     1 
ATOM 2796  O O     . VAL C  1 111 ? -5.063  -80.879 17.647  1.00 0.00 ? 117 VAL C O     1 
ATOM 2797  C CB    . VAL C  1 111 ? -7.626  -81.809 19.375  1.00 0.00 ? 117 VAL C CB    1 
ATOM 2798  C CG1   . VAL C  1 111 ? -7.805  -80.377 18.894  1.00 0.00 ? 117 VAL C CG1   1 
ATOM 2799  C CG2   . VAL C  1 111 ? -8.922  -82.585 19.250  1.00 0.00 ? 117 VAL C CG2   1 
ATOM 2800  N N     . LEU C  1 112 ? -4.470  -81.842 19.586  1.00 0.00 ? 118 LEU C N     1 
ATOM 2801  C CA    . LEU C  1 112 ? -3.223  -81.107 19.690  1.00 0.00 ? 118 LEU C CA    1 
ATOM 2802  C C     . LEU C  1 112 ? -2.335  -81.396 18.507  1.00 0.00 ? 118 LEU C C     1 
ATOM 2803  O O     . LEU C  1 112 ? -1.703  -80.494 17.962  1.00 0.00 ? 118 LEU C O     1 
ATOM 2804  C CB    . LEU C  1 112 ? -2.495  -81.486 20.967  1.00 0.00 ? 118 LEU C CB    1 
ATOM 2805  C CG    . LEU C  1 112 ? -3.157  -81.038 22.252  1.00 0.00 ? 118 LEU C CG    1 
ATOM 2806  C CD1   . LEU C  1 112 ? -2.429  -81.637 23.411  1.00 0.00 ? 118 LEU C CD1   1 
ATOM 2807  C CD2   . LEU C  1 112 ? -3.121  -79.546 22.331  1.00 0.00 ? 118 LEU C CD2   1 
ATOM 2808  N N     . ASP C  1 113 ? -2.318  -82.648 18.082  1.00 0.00 ? 119 ASP C N     1 
ATOM 2809  C CA    . ASP C  1 113 ? -1.558  -83.031 16.921  1.00 0.00 ? 119 ASP C CA    1 
ATOM 2810  C C     . ASP C  1 113 ? -2.121  -82.422 15.672  1.00 0.00 ? 119 ASP C C     1 
ATOM 2811  O O     . ASP C  1 113 ? -1.372  -82.040 14.779  1.00 0.00 ? 119 ASP C O     1 
ATOM 2812  C CB    . ASP C  1 113 ? -1.499  -84.527 16.809  1.00 0.00 ? 119 ASP C CB    1 
ATOM 2813  C CG    . ASP C  1 113 ? -0.564  -85.108 17.834  1.00 0.00 ? 119 ASP C CG    1 
ATOM 2814  O OD1   . ASP C  1 113 ? 0.284   -84.380 18.298  1.00 0.00 ? 119 ASP C OD1   1 
ATOM 2815  O OD2   . ASP C  1 113 ? -0.697  -86.260 18.167  1.00 0.00 ? 119 ASP C OD2   1 
ATOM 2816  N N     . ALA C  1 114 ? -3.444  -82.283 15.619  1.00 0.00 ? 120 ALA C N     1 
ATOM 2817  C CA    . ALA C  1 114 ? -4.080  -81.614 14.497  1.00 0.00 ? 120 ALA C CA    1 
ATOM 2818  C C     . ALA C  1 114 ? -3.623  -80.163 14.409  1.00 0.00 ? 120 ALA C C     1 
ATOM 2819  O O     . ALA C  1 114 ? -3.386  -79.653 13.321  1.00 0.00 ? 120 ALA C O     1 
ATOM 2820  C CB    . ALA C  1 114 ? -5.587  -81.684 14.616  1.00 0.00 ? 120 ALA C CB    1 
ATOM 2821  N N     . VAL C  1 115 ? -3.463  -79.511 15.559  1.00 0.00 ? 121 VAL C N     1 
ATOM 2822  C CA    . VAL C  1 115 ? -2.975  -78.140 15.579  1.00 0.00 ? 121 VAL C CA    1 
ATOM 2823  C C     . VAL C  1 115 ? -1.560  -78.064 15.054  1.00 0.00 ? 121 VAL C C     1 
ATOM 2824  O O     . VAL C  1 115 ? -1.257  -77.236 14.196  1.00 0.00 ? 121 VAL C O     1 
ATOM 2825  C CB    . VAL C  1 115 ? -3.018  -77.556 16.993  1.00 0.00 ? 121 VAL C CB    1 
ATOM 2826  C CG1   . VAL C  1 115 ? -2.319  -76.215 17.010  1.00 0.00 ? 121 VAL C CG1   1 
ATOM 2827  C CG2   . VAL C  1 115 ? -4.458  -77.411 17.454  1.00 0.00 ? 121 VAL C CG2   1 
ATOM 2828  N N     . VAL C  1 116 ? -0.702  -78.955 15.536  1.00 0.00 ? 122 VAL C N     1 
ATOM 2829  C CA    . VAL C  1 116 ? 0.686   -79.000 15.091  1.00 0.00 ? 122 VAL C CA    1 
ATOM 2830  C C     . VAL C  1 116 ? 0.753   -79.271 13.588  1.00 0.00 ? 122 VAL C C     1 
ATOM 2831  O O     . VAL C  1 116 ? 1.522   -78.637 12.859  1.00 0.00 ? 122 VAL C O     1 
ATOM 2832  C CB    . VAL C  1 116 ? 1.464   -80.086 15.857  1.00 0.00 ? 122 VAL C CB    1 
ATOM 2833  C CG1   . VAL C  1 116 ? 2.837   -80.260 15.273  1.00 0.00 ? 122 VAL C CG1   1 
ATOM 2834  C CG2   . VAL C  1 116 ? 1.564   -79.712 17.312  1.00 0.00 ? 122 VAL C CG2   1 
ATOM 2835  N N     . ASN C  1 117 ? -0.121  -80.161 13.118  1.00 0.00 ? 123 ASN C N     1 
ATOM 2836  C CA    . ASN C  1 117 ? -0.218  -80.508 11.705  1.00 0.00 ? 123 ASN C CA    1 
ATOM 2837  C C     . ASN C  1 117 ? -0.495  -79.317 10.795  1.00 0.00 ? 123 ASN C C     1 
ATOM 2838  O O     . ASN C  1 117 ? -0.361  -79.425 9.580   1.00 0.00 ? 123 ASN C O     1 
ATOM 2839  C CB    . ASN C  1 117 ? -1.276  -81.552 11.481  1.00 0.00 ? 123 ASN C CB    1 
ATOM 2840  C CG    . ASN C  1 117 ? -1.279  -82.044 10.064  1.00 0.00 ? 123 ASN C CG    1 
ATOM 2841  O OD1   . ASN C  1 117 ? -0.364  -82.751 9.634   1.00 0.00 ? 123 ASN C OD1   1 
ATOM 2842  N ND2   . ASN C  1 117 ? -2.285  -81.666 9.316   1.00 0.00 ? 123 ASN C ND2   1 
ATOM 2843  N N     . ILE C  1 118 ? -0.919  -78.204 11.360  1.00 0.00 ? 124 ILE C N     1 
ATOM 2844  C CA    . ILE C  1 118 ? -1.158  -77.029 10.579  1.00 0.00 ? 124 ILE C CA    1 
ATOM 2845  C C     . ILE C  1 118 ? -0.002  -76.092 10.652  1.00 0.00 ? 124 ILE C C     1 
ATOM 2846  O O     . ILE C  1 118 ? 0.506   -75.632 9.632   1.00 0.00 ? 124 ILE C O     1 
ATOM 2847  C CB    . ILE C  1 118 ? -2.385  -76.316 11.058  1.00 0.00 ? 124 ILE C CB    1 
ATOM 2848  C CG1   . ILE C  1 118 ? -3.569  -77.228 10.956  1.00 0.00 ? 124 ILE C CG1   1 
ATOM 2849  C CG2   . ILE C  1 118 ? -2.600  -75.059 10.272  1.00 0.00 ? 124 ILE C CG2   1 
ATOM 2850  C CD1   . ILE C  1 118 ? -3.817  -77.743 9.564   1.00 0.00 ? 124 ILE C CD1   1 
ATOM 2851  N N     . ILE C  1 119 ? 0.411   -75.788 11.864  1.00 0.00 ? 125 ILE C N     1 
ATOM 2852  C CA    . ILE C  1 119 ? 1.469   -74.827 12.087  1.00 0.00 ? 125 ILE C CA    1 
ATOM 2853  C C     . ILE C  1 119 ? 2.789   -75.310 11.526  1.00 0.00 ? 125 ILE C C     1 
ATOM 2854  O O     . ILE C  1 119 ? 3.500   -74.558 10.862  1.00 0.00 ? 125 ILE C O     1 
ATOM 2855  C CB    . ILE C  1 119 ? 1.614   -74.540 13.563  1.00 0.00 ? 125 ILE C CB    1 
ATOM 2856  C CG1   . ILE C  1 119 ? 0.375   -73.834 14.064  1.00 0.00 ? 125 ILE C CG1   1 
ATOM 2857  C CG2   . ILE C  1 119 ? 2.843   -73.691 13.808  1.00 0.00 ? 125 ILE C CG2   1 
ATOM 2858  C CD1   . ILE C  1 119 ? 0.300   -73.771 15.552  1.00 0.00 ? 125 ILE C CD1   1 
ATOM 2859  N N     . THR C  1 120 ? 3.122   -76.561 11.796  1.00 0.00 ? 126 THR C N     1 
ATOM 2860  C CA    . THR C  1 120 ? 4.352   -77.134 11.293  1.00 0.00 ? 126 THR C CA    1 
ATOM 2861  C C     . THR C  1 120 ? 4.107   -77.844 9.996   1.00 0.00 ? 126 THR C C     1 
ATOM 2862  O O     . THR C  1 120 ? 4.983   -77.914 9.137   1.00 0.00 ? 126 THR C O     1 
ATOM 2863  C CB    . THR C  1 120 ? 4.907   -78.145 12.255  1.00 0.00 ? 126 THR C CB    1 
ATOM 2864  O OG1   . THR C  1 120 ? 3.973   -79.218 12.347  1.00 0.00 ? 126 THR C OG1   1 
ATOM 2865  C CG2   . THR C  1 120 ? 5.106   -77.527 13.628  1.00 0.00 ? 126 THR C CG2   1 
ATOM 2866  N N     . GLY C  1 121 ? 2.900   -78.364 9.845   1.00 0.00 ? 127 GLY C N     1 
ATOM 2867  C CA    . GLY C  1 121 ? 2.530   -79.085 8.642   1.00 0.00 ? 127 GLY C CA    1 
ATOM 2868  C C     . GLY C  1 121 ? 2.443   -80.570 8.914   1.00 0.00 ? 127 GLY C C     1 
ATOM 2869  O O     . GLY C  1 121 ? 1.929   -81.331 8.094   1.00 0.00 ? 127 GLY C O     1 
ATOM 2870  N N     . SER C  1 122 ? 2.941   -80.982 10.073  1.00 0.00 ? 128 SER C N     1 
ATOM 2871  C CA    . SER C  1 122 ? 2.902   -82.372 10.479  1.00 0.00 ? 128 SER C CA    1 
ATOM 2872  C C     . SER C  1 122 ? 3.159   -82.467 11.960  1.00 0.00 ? 128 SER C C     1 
ATOM 2873  O O     . SER C  1 122 ? 3.758   -81.570 12.541  1.00 0.00 ? 128 SER C O     1 
ATOM 2874  C CB    . SER C  1 122 ? 3.962   -83.160 9.746   1.00 0.00 ? 128 SER C CB    1 
ATOM 2875  O OG    . SER C  1 122 ? 5.240   -82.794 10.192  1.00 0.00 ? 128 SER C OG    1 
ATOM 2876  N N     . PRO C  1 123 ? 2.786   -83.577 12.573  1.00 0.00 ? 129 PRO C N     1 
ATOM 2877  C CA    . PRO C  1 123 ? 3.058   -83.906 13.949  1.00 0.00 ? 129 PRO C CA    1 
ATOM 2878  C C     . PRO C  1 123 ? 4.557   -83.940 14.139  1.00 0.00 ? 129 PRO C C     1 
ATOM 2879  O O     . PRO C  1 123 ? 5.305   -84.088 13.173  1.00 0.00 ? 129 PRO C O     1 
ATOM 2880  C CB    . PRO C  1 123 ? 2.370   -85.241 14.139  1.00 0.00 ? 129 PRO C CB    1 
ATOM 2881  C CG    . PRO C  1 123 ? 1.184   -85.166 13.225  1.00 0.00 ? 129 PRO C CG    1 
ATOM 2882  C CD    . PRO C  1 123 ? 1.611   -84.293 12.072  1.00 0.00 ? 129 PRO C CD    1 
ATOM 2883  N N     . THR C  1 124 ? 5.007   -83.765 15.361  1.00 0.00 ? 130 THR C N     1 
ATOM 2884  C CA    . THR C  1 124 ? 6.425   -83.620 15.583  1.00 0.00 ? 130 THR C CA    1 
ATOM 2885  C C     . THR C  1 124 ? 7.119   -84.949 15.763  1.00 0.00 ? 130 THR C C     1 
ATOM 2886  O O     . THR C  1 124 ? 6.773   -85.926 15.106  1.00 0.00 ? 130 THR C O     1 
ATOM 2887  C CB    . THR C  1 124 ? 6.679   -82.726 16.801  1.00 0.00 ? 130 THR C CB    1 
ATOM 2888  O OG1   . THR C  1 124 ? 8.084   -82.527 16.959  1.00 0.00 ? 130 THR C OG1   1 
ATOM 2889  C CG2   . THR C  1 124 ? 6.085   -83.336 18.077  1.00 0.00 ? 130 THR C CG2   1 
ATOM 2890  N N     . GLY C  1 125 ? 8.131   -84.989 16.628  1.00 0.00 ? 131 GLY C N     1 
ATOM 2891  C CA    . GLY C  1 125 ? 8.914   -86.210 16.822  1.00 0.00 ? 131 GLY C CA    1 
ATOM 2892  C C     . GLY C  1 125 ? 9.957   -86.335 15.713  1.00 0.00 ? 131 GLY C C     1 
ATOM 2893  O O     . GLY C  1 125 ? 11.162  -86.290 15.962  1.00 0.00 ? 131 GLY C O     1 
ATOM 2894  N N     . TYR C  1 126 ? 9.472   -86.466 14.490  1.00 0.00 ? 132 TYR C N     1 
ATOM 2895  C CA    . TYR C  1 126 ? 10.309  -86.519 13.328  1.00 0.00 ? 132 TYR C CA    1 
ATOM 2896  C C     . TYR C  1 126 ? 10.252  -85.185 12.618  1.00 0.00 ? 132 TYR C C     1 
ATOM 2897  O O     . TYR C  1 126 ? 9.214   -84.528 12.607  1.00 0.00 ? 132 TYR C O     1 
ATOM 2898  C CB    . TYR C  1 126 ? 9.833   -87.630 12.406  1.00 0.00 ? 132 TYR C CB    1 
ATOM 2899  C CG    . TYR C  1 126 ? 9.860   -88.981 13.066  1.00 0.00 ? 132 TYR C CG    1 
ATOM 2900  C CD1   . TYR C  1 126 ? 8.753   -89.406 13.785  1.00 0.00 ? 132 TYR C CD1   1 
ATOM 2901  C CD2   . TYR C  1 126 ? 10.979  -89.788 12.971  1.00 0.00 ? 132 TYR C CD2   1 
ATOM 2902  C CE1   . TYR C  1 126 ? 8.766   -90.635 14.406  1.00 0.00 ? 132 TYR C CE1   1 
ATOM 2903  C CE2   . TYR C  1 126 ? 10.990  -91.019 13.594  1.00 0.00 ? 132 TYR C CE2   1 
ATOM 2904  C CZ    . TYR C  1 126 ? 9.886   -91.441 14.308  1.00 0.00 ? 132 TYR C CZ    1 
ATOM 2905  O OH    . TYR C  1 126 ? 9.895   -92.667 14.926  1.00 0.00 ? 132 TYR C OH    1 
ATOM 2906  N N     . VAL C  1 127 ? 11.355  -84.785 12.024  1.00 0.00 ? 133 VAL C N     1 
ATOM 2907  C CA    . VAL C  1 127 ? 11.385  -83.532 11.297  1.00 0.00 ? 133 VAL C CA    1 
ATOM 2908  C C     . VAL C  1 127 ? 10.971  -83.749 9.854   1.00 0.00 ? 133 VAL C C     1 
ATOM 2909  O O     . VAL C  1 127 ? 11.654  -84.439 9.100   1.00 0.00 ? 133 VAL C O     1 
ATOM 2910  C CB    . VAL C  1 127 ? 12.794  -82.906 11.346  1.00 0.00 ? 133 VAL C CB    1 
ATOM 2911  C CG1   . VAL C  1 127 ? 12.825  -81.616 10.538  1.00 0.00 ? 133 VAL C CG1   1 
ATOM 2912  C CG2   . VAL C  1 127 ? 13.187  -82.635 12.791  1.00 0.00 ? 133 VAL C CG2   1 
ATOM 2913  N N     . SER C  1 128 ? 9.851   -83.161 9.475   1.00 0.00 ? 134 SER C N     1 
ATOM 2914  C CA    . SER C  1 128 ? 9.354   -83.291 8.119   1.00 0.00 ? 134 SER C CA    1 
ATOM 2915  C C     . SER C  1 128 ? 8.201   -82.323 7.874   1.00 0.00 ? 134 SER C C     1 
ATOM 2916  O O     . SER C  1 128 ? 8.389   -81.270 7.262   1.00 0.00 ? 134 SER C O     1 
ATOM 2917  C CB    . SER C  1 128 ? 8.905   -84.725 7.862   1.00 0.00 ? 134 SER C CB    1 
ATOM 2918  O OG    . SER C  1 128 ? 8.412   -84.876 6.558   1.00 0.00 ? 134 SER C OG    1 
ATOM 2919  O OXT   . SER C  1 128 ? 7.125   -82.514 8.436   1.00 0.00 ? 134 SER C OXT   1 
ATOM 2920  N N     . SER D  1 1   ? -13.987 -61.679 16.899  1.00 0.00 ? 7   SER D N     1 
ATOM 2921  C CA    . SER D  1 1   ? -13.657 -62.024 15.520  1.00 0.00 ? 7   SER D CA    1 
ATOM 2922  C C     . SER D  1 1   ? -13.026 -60.855 14.790  1.00 0.00 ? 7   SER D C     1 
ATOM 2923  O O     . SER D  1 1   ? -13.729 -59.956 14.329  1.00 0.00 ? 7   SER D O     1 
ATOM 2924  C CB    . SER D  1 1   ? -14.889 -62.464 14.786  1.00 0.00 ? 7   SER D CB    1 
ATOM 2925  O OG    . SER D  1 1   ? -14.594 -62.724 13.447  1.00 0.00 ? 7   SER D OG    1 
ATOM 2926  N N     . ARG D  1 2   ? -11.700 -60.866 14.687  1.00 0.00 ? 8   ARG D N     1 
ATOM 2927  C CA    . ARG D  1 2   ? -10.976 -59.777 14.018  1.00 0.00 ? 8   ARG D CA    1 
ATOM 2928  C C     . ARG D  1 2   ? -9.773  -60.278 13.233  1.00 0.00 ? 8   ARG D C     1 
ATOM 2929  O O     . ARG D  1 2   ? -9.074  -61.190 13.673  1.00 0.00 ? 8   ARG D O     1 
ATOM 2930  C CB    . ARG D  1 2   ? -10.469 -58.769 15.032  1.00 0.00 ? 8   ARG D CB    1 
ATOM 2931  C CG    . ARG D  1 2   ? -11.524 -58.044 15.857  1.00 0.00 ? 8   ARG D CG    1 
ATOM 2932  C CD    . ARG D  1 2   ? -12.311 -57.077 15.069  1.00 0.00 ? 8   ARG D CD    1 
ATOM 2933  N NE    . ARG D  1 2   ? -13.195 -56.312 15.926  1.00 0.00 ? 8   ARG D NE    1 
ATOM 2934  C CZ    . ARG D  1 2   ? -14.409 -56.714 16.330  1.00 0.00 ? 8   ARG D CZ    1 
ATOM 2935  N NH1   . ARG D  1 2   ? -14.884 -57.872 15.933  1.00 0.00 ? 8   ARG D NH1   1 
ATOM 2936  N NH2   . ARG D  1 2   ? -15.134 -55.948 17.134  1.00 0.00 ? 8   ARG D NH2   1 
ATOM 2937  N N     . SER D  1 3   ? -9.505  -59.640 12.100  1.00 0.00 ? 9   SER D N     1 
ATOM 2938  C CA    . SER D  1 3   ? -8.303  -59.906 11.312  1.00 0.00 ? 9   SER D CA    1 
ATOM 2939  C C     . SER D  1 3   ? -7.145  -59.211 11.949  1.00 0.00 ? 9   SER D C     1 
ATOM 2940  O O     . SER D  1 3   ? -7.339  -58.395 12.843  1.00 0.00 ? 9   SER D O     1 
ATOM 2941  C CB    . SER D  1 3   ? -8.470  -59.393 9.916   1.00 0.00 ? 9   SER D CB    1 
ATOM 2942  O OG    . SER D  1 3   ? -8.553  -57.993 9.921   1.00 0.00 ? 9   SER D OG    1 
ATOM 2943  N N     . TYR D  1 4   ? -5.934  -59.467 11.474  1.00 0.00 ? 10  TYR D N     1 
ATOM 2944  C CA    . TYR D  1 4   ? -4.807  -58.812 12.097  1.00 0.00 ? 10  TYR D CA    1 
ATOM 2945  C C     . TYR D  1 4   ? -4.844  -57.355 11.769  1.00 0.00 ? 10  TYR D C     1 
ATOM 2946  O O     . TYR D  1 4   ? -4.336  -56.536 12.519  1.00 0.00 ? 10  TYR D O     1 
ATOM 2947  C CB    . TYR D  1 4   ? -3.458  -59.335 11.631  1.00 0.00 ? 10  TYR D CB    1 
ATOM 2948  C CG    . TYR D  1 4   ? -2.749  -58.327 10.782  1.00 0.00 ? 10  TYR D CG    1 
ATOM 2949  C CD1   . TYR D  1 4   ? -2.094  -57.276 11.413  1.00 0.00 ? 10  TYR D CD1   1 
ATOM 2950  C CD2   . TYR D  1 4   ? -2.766  -58.407 9.408   1.00 0.00 ? 10  TYR D CD2   1 
ATOM 2951  C CE1   . TYR D  1 4   ? -1.475  -56.301 10.672  1.00 0.00 ? 10  TYR D CE1   1 
ATOM 2952  C CE2   . TYR D  1 4   ? -2.140  -57.431 8.660   1.00 0.00 ? 10  TYR D CE2   1 
ATOM 2953  C CZ    . TYR D  1 4   ? -1.502  -56.375 9.289   1.00 0.00 ? 10  TYR D CZ    1 
ATOM 2954  O OH    . TYR D  1 4   ? -0.888  -55.391 8.540   1.00 0.00 ? 10  TYR D OH    1 
ATOM 2955  N N     . SER D  1 5   ? -5.423  -57.018 10.621  1.00 0.00 ? 11  SER D N     1 
ATOM 2956  C CA    . SER D  1 5   ? -5.461  -55.648 10.199  1.00 0.00 ? 11  SER D CA    1 
ATOM 2957  C C     . SER D  1 5   ? -6.319  -54.849 11.125  1.00 0.00 ? 11  SER D C     1 
ATOM 2958  O O     . SER D  1 5   ? -6.019  -53.697 11.426  1.00 0.00 ? 11  SER D O     1 
ATOM 2959  C CB    . SER D  1 5   ? -5.997  -55.557 8.804   1.00 0.00 ? 11  SER D CB    1 
ATOM 2960  O OG    . SER D  1 5   ? -7.355  -55.900 8.767   1.00 0.00 ? 11  SER D OG    1 
ATOM 2961  N N     . GLN D  1 6   ? -7.355  -55.482 11.640  1.00 0.00 ? 12  GLN D N     1 
ATOM 2962  C CA    . GLN D  1 6   ? -8.217  -54.862 12.612  1.00 0.00 ? 12  GLN D CA    1 
ATOM 2963  C C     . GLN D  1 6   ? -7.552  -54.808 13.960  1.00 0.00 ? 12  GLN D C     1 
ATOM 2964  O O     . GLN D  1 6   ? -7.642  -53.801 14.659  1.00 0.00 ? 12  GLN D O     1 
ATOM 2965  C CB    . GLN D  1 6   ? -9.514  -55.609 12.689  1.00 0.00 ? 12  GLN D CB    1 
ATOM 2966  C CG    . GLN D  1 6   ? -10.365 -55.437 11.463  1.00 0.00 ? 12  GLN D CG    1 
ATOM 2967  C CD    . GLN D  1 6   ? -11.473 -56.441 11.392  1.00 0.00 ? 12  GLN D CD    1 
ATOM 2968  O OE1   . GLN D  1 6   ? -11.211 -57.618 11.125  1.00 0.00 ? 12  GLN D OE1   1 
ATOM 2969  N NE2   . GLN D  1 6   ? -12.706 -56.010 11.634  1.00 0.00 ? 12  GLN D NE2   1 
ATOM 2970  N N     . ARG D  1 7   ? -6.846  -55.877 14.312  1.00 0.00 ? 13  ARG D N     1 
ATOM 2971  C CA    . ARG D  1 7   ? -6.135  -55.926 15.571  1.00 0.00 ? 13  ARG D CA    1 
ATOM 2972  C C     . ARG D  1 7   ? -5.137  -54.808 15.642  1.00 0.00 ? 13  ARG D C     1 
ATOM 2973  O O     . ARG D  1 7   ? -5.077  -54.079 16.628  1.00 0.00 ? 13  ARG D O     1 
ATOM 2974  C CB    . ARG D  1 7   ? -5.405  -57.250 15.721  1.00 0.00 ? 13  ARG D CB    1 
ATOM 2975  C CG    . ARG D  1 7   ? -6.306  -58.451 15.912  1.00 0.00 ? 13  ARG D CG    1 
ATOM 2976  C CD    . ARG D  1 7   ? -5.541  -59.726 15.929  1.00 0.00 ? 13  ARG D CD    1 
ATOM 2977  N NE    . ARG D  1 7   ? -4.739  -59.853 17.127  1.00 0.00 ? 13  ARG D NE    1 
ATOM 2978  C CZ    . ARG D  1 7   ? -3.740  -60.736 17.300  1.00 0.00 ? 13  ARG D CZ    1 
ATOM 2979  N NH1   . ARG D  1 7   ? -3.400  -61.562 16.335  1.00 0.00 ? 13  ARG D NH1   1 
ATOM 2980  N NH2   . ARG D  1 7   ? -3.093  -60.773 18.449  1.00 0.00 ? 13  ARG D NH2   1 
ATOM 2981  N N     . TYR D  1 8   ? -4.380  -54.657 14.574  1.00 0.00 ? 14  TYR D N     1 
ATOM 2982  C CA    . TYR D  1 8   ? -3.401  -53.613 14.467  1.00 0.00 ? 14  TYR D CA    1 
ATOM 2983  C C     . TYR D  1 8   ? -4.016  -52.266 14.457  1.00 0.00 ? 14  TYR D C     1 
ATOM 2984  O O     . TYR D  1 8   ? -3.578  -51.389 15.187  1.00 0.00 ? 14  TYR D O     1 
ATOM 2985  C CB    . TYR D  1 8   ? -2.557  -53.787 13.239  1.00 0.00 ? 14  TYR D CB    1 
ATOM 2986  C CG    . TYR D  1 8   ? -1.695  -52.600 12.986  1.00 0.00 ? 14  TYR D CG    1 
ATOM 2987  C CD1   . TYR D  1 8   ? -0.765  -52.212 13.919  1.00 0.00 ? 14  TYR D CD1   1 
ATOM 2988  C CD2   . TYR D  1 8   ? -1.848  -51.886 11.818  1.00 0.00 ? 14  TYR D CD2   1 
ATOM 2989  C CE1   . TYR D  1 8   ? 0.006   -51.101 13.696  1.00 0.00 ? 14  TYR D CE1   1 
ATOM 2990  C CE2   . TYR D  1 8   ? -1.076  -50.774 11.591  1.00 0.00 ? 14  TYR D CE2   1 
ATOM 2991  C CZ    . TYR D  1 8   ? -0.157  -50.378 12.528  1.00 0.00 ? 14  TYR D CZ    1 
ATOM 2992  O OH    . TYR D  1 8   ? 0.593   -49.250 12.317  1.00 0.00 ? 14  TYR D OH    1 
ATOM 2993  N N     . ALA D  1 9   ? -5.011  -52.064 13.611  1.00 0.00 ? 15  ALA D N     1 
ATOM 2994  C CA    . ALA D  1 9   ? -5.640  -50.766 13.488  1.00 0.00 ? 15  ALA D CA    1 
ATOM 2995  C C     . ALA D  1 9   ? -6.018  -50.207 14.837  1.00 0.00 ? 15  ALA D C     1 
ATOM 2996  O O     . ALA D  1 9   ? -5.649  -49.080 15.174  1.00 0.00 ? 15  ALA D O     1 
ATOM 2997  C CB    . ALA D  1 9   ? -6.871  -50.859 12.612  1.00 0.00 ? 15  ALA D CB    1 
ATOM 2998  N N     . LYS D  1 10  ? -6.747  -50.988 15.618  1.00 0.00 ? 16  LYS D N     1 
ATOM 2999  C CA    . LYS D  1 10  ? -7.184  -50.512 16.899  1.00 0.00 ? 16  LYS D CA    1 
ATOM 3000  C C     . LYS D  1 10  ? -6.030  -50.378 17.857  1.00 0.00 ? 16  LYS D C     1 
ATOM 3001  O O     . LYS D  1 10  ? -5.966  -49.415 18.613  1.00 0.00 ? 16  LYS D O     1 
ATOM 3002  C CB    . LYS D  1 10  ? -8.236  -51.402 17.491  1.00 0.00 ? 16  LYS D CB    1 
ATOM 3003  C CG    . LYS D  1 10  ? -8.839  -50.817 18.739  1.00 0.00 ? 16  LYS D CG    1 
ATOM 3004  C CD    . LYS D  1 10  ? -9.959  -51.661 19.279  1.00 0.00 ? 16  LYS D CD    1 
ATOM 3005  C CE    . LYS D  1 10  ? -10.602 -50.964 20.457  1.00 0.00 ? 16  LYS D CE    1 
ATOM 3006  N NZ    . LYS D  1 10  ? -11.592 -51.818 21.156  1.00 0.00 ? 16  LYS D NZ    1 
ATOM 3007  N N     . TRP D  1 11  ? -5.105  -51.331 17.821  1.00 0.00 ? 17  TRP D N     1 
ATOM 3008  C CA    . TRP D  1 11  ? -3.934  -51.261 18.676  1.00 0.00 ? 17  TRP D CA    1 
ATOM 3009  C C     . TRP D  1 11  ? -3.184  -49.988 18.458  1.00 0.00 ? 17  TRP D C     1 
ATOM 3010  O O     . TRP D  1 11  ? -2.697  -49.379 19.404  1.00 0.00 ? 17  TRP D O     1 
ATOM 3011  C CB    . TRP D  1 11  ? -2.998  -52.419 18.426  1.00 0.00 ? 17  TRP D CB    1 
ATOM 3012  C CG    . TRP D  1 11  ? -1.736  -52.298 19.205  1.00 0.00 ? 17  TRP D CG    1 
ATOM 3013  C CD1   . TRP D  1 11  ? -1.529  -52.703 20.483  1.00 0.00 ? 17  TRP D CD1   1 
ATOM 3014  C CD2   . TRP D  1 11  ? -0.485  -51.720 18.762  1.00 0.00 ? 17  TRP D CD2   1 
ATOM 3015  N NE1   . TRP D  1 11  ? -0.243  -52.421 20.867  1.00 0.00 ? 17  TRP D NE1   1 
ATOM 3016  C CE2   . TRP D  1 11  ? 0.408   -51.821 19.825  1.00 0.00 ? 17  TRP D CE2   1 
ATOM 3017  C CE3   . TRP D  1 11  ? -0.062  -51.142 17.565  1.00 0.00 ? 17  TRP D CE3   1 
ATOM 3018  C CZ2   . TRP D  1 11  ? 1.713   -51.365 19.731  1.00 0.00 ? 17  TRP D CZ2   1 
ATOM 3019  C CZ3   . TRP D  1 11  ? 1.246   -50.687 17.470  1.00 0.00 ? 17  TRP D CZ3   1 
ATOM 3020  C CH2   . TRP D  1 11  ? 2.111   -50.796 18.525  1.00 0.00 ? 17  TRP D CH2   1 
ATOM 3021  N N     . GLN D  1 12  ? -3.057  -49.596 17.206  1.00 0.00 ? 18  GLN D N     1 
ATOM 3022  C CA    . GLN D  1 12  ? -2.359  -48.398 16.862  1.00 0.00 ? 18  GLN D CA    1 
ATOM 3023  C C     . GLN D  1 12  ? -3.039  -47.197 17.430  1.00 0.00 ? 18  GLN D C     1 
ATOM 3024  O O     . GLN D  1 12  ? -2.395  -46.333 18.014  1.00 0.00 ? 18  GLN D O     1 
ATOM 3025  C CB    . GLN D  1 12  ? -2.286  -48.249 15.363  1.00 0.00 ? 18  GLN D CB    1 
ATOM 3026  C CG    . GLN D  1 12  ? -1.489  -47.062 14.928  1.00 0.00 ? 18  GLN D CG    1 
ATOM 3027  C CD    . GLN D  1 12  ? -0.054  -47.234 15.268  1.00 0.00 ? 18  GLN D CD    1 
ATOM 3028  O OE1   . GLN D  1 12  ? 0.590   -48.137 14.735  1.00 0.00 ? 18  GLN D OE1   1 
ATOM 3029  N NE2   . GLN D  1 12  ? 0.475   -46.398 16.151  1.00 0.00 ? 18  GLN D NE2   1 
ATOM 3030  N N     . ALA D  1 13  ? -4.351  -47.146 17.287  1.00 0.00 ? 19  ALA D N     1 
ATOM 3031  C CA    . ALA D  1 13  ? -5.118  -46.024 17.778  1.00 0.00 ? 19  ALA D CA    1 
ATOM 3032  C C     . ALA D  1 13  ? -4.978  -45.876 19.270  1.00 0.00 ? 19  ALA D C     1 
ATOM 3033  O O     . ALA D  1 13  ? -4.845  -44.764 19.779  1.00 0.00 ? 19  ALA D O     1 
ATOM 3034  C CB    . ALA D  1 13  ? -6.569  -46.188 17.408  1.00 0.00 ? 19  ALA D CB    1 
ATOM 3035  N N     . LYS D  1 14  ? -4.983  -46.991 19.977  1.00 0.00 ? 20  LYS D N     1 
ATOM 3036  C CA    . LYS D  1 14  ? -4.894  -46.955 21.412  1.00 0.00 ? 20  LYS D CA    1 
ATOM 3037  C C     . LYS D  1 14  ? -3.512  -46.662 21.882  1.00 0.00 ? 20  LYS D C     1 
ATOM 3038  O O     . LYS D  1 14  ? -3.335  -45.982 22.887  1.00 0.00 ? 20  LYS D O     1 
ATOM 3039  C CB    . LYS D  1 14  ? -5.373  -48.253 21.995  1.00 0.00 ? 20  LYS D CB    1 
ATOM 3040  C CG    . LYS D  1 14  ? -6.839  -48.495 21.769  1.00 0.00 ? 20  LYS D CG    1 
ATOM 3041  C CD    . LYS D  1 14  ? -7.650  -47.409 22.431  1.00 0.00 ? 20  LYS D CD    1 
ATOM 3042  C CE    . LYS D  1 14  ? -7.681  -47.572 23.937  1.00 0.00 ? 20  LYS D CE    1 
ATOM 3043  N NZ    . LYS D  1 14  ? -8.688  -48.576 24.357  1.00 0.00 ? 20  LYS D NZ    1 
ATOM 3044  N N     . PHE D  1 15  ? -2.520  -47.132 21.148  1.00 0.00 ? 21  PHE D N     1 
ATOM 3045  C CA    . PHE D  1 15  ? -1.155  -46.827 21.493  1.00 0.00 ? 21  PHE D CA    1 
ATOM 3046  C C     . PHE D  1 15  ? -0.930  -45.340 21.371  1.00 0.00 ? 21  PHE D C     1 
ATOM 3047  O O     . PHE D  1 15  ? -0.339  -44.718 22.252  1.00 0.00 ? 21  PHE D O     1 
ATOM 3048  C CB    . PHE D  1 15  ? -0.177  -47.566 20.608  1.00 0.00 ? 21  PHE D CB    1 
ATOM 3049  C CG    . PHE D  1 15  ? 1.230   -47.357 21.039  1.00 0.00 ? 21  PHE D CG    1 
ATOM 3050  C CD1   . PHE D  1 15  ? 1.793   -48.170 22.006  1.00 0.00 ? 21  PHE D CD1   1 
ATOM 3051  C CD2   . PHE D  1 15  ? 1.981   -46.321 20.529  1.00 0.00 ? 21  PHE D CD2   1 
ATOM 3052  C CE1   . PHE D  1 15  ? 3.087   -47.959 22.443  1.00 0.00 ? 21  PHE D CE1   1 
ATOM 3053  C CE2   . PHE D  1 15  ? 3.272   -46.106 20.969  1.00 0.00 ? 21  PHE D CE2   1 
ATOM 3054  C CZ    . PHE D  1 15  ? 3.826   -46.926 21.925  1.00 0.00 ? 21  PHE D CZ    1 
ATOM 3055  N N     . ASN D  1 16  ? -1.414  -44.770 20.271  1.00 0.00 ? 22  ASN D N     1 
ATOM 3056  C CA    . ASN D  1 16  ? -1.290  -43.352 20.029  1.00 0.00 ? 22  ASN D CA    1 
ATOM 3057  C C     . ASN D  1 16  ? -1.913  -42.571 21.148  1.00 0.00 ? 22  ASN D C     1 
ATOM 3058  O O     . ASN D  1 16  ? -1.299  -41.657 21.698  1.00 0.00 ? 22  ASN D O     1 
ATOM 3059  C CB    . ASN D  1 16  ? -1.967  -42.976 18.738  1.00 0.00 ? 22  ASN D CB    1 
ATOM 3060  C CG    . ASN D  1 16  ? -1.275  -43.513 17.545  1.00 0.00 ? 22  ASN D CG    1 
ATOM 3061  O OD1   . ASN D  1 16  ? -0.152  -44.017 17.632  1.00 0.00 ? 22  ASN D OD1   1 
ATOM 3062  N ND2   . ASN D  1 16  ? -1.918  -43.421 16.413  1.00 0.00 ? 22  ASN D ND2   1 
ATOM 3063  N N     . ALA D  1 17  ? -3.128  -42.956 21.519  1.00 0.00 ? 23  ALA D N     1 
ATOM 3064  C CA    . ALA D  1 17  ? -3.844  -42.284 22.573  1.00 0.00 ? 23  ALA D CA    1 
ATOM 3065  C C     . ALA D  1 17  ? -3.046  -42.276 23.847  1.00 0.00 ? 23  ALA D C     1 
ATOM 3066  O O     . ALA D  1 17  ? -2.826  -41.225 24.441  1.00 0.00 ? 23  ALA D O     1 
ATOM 3067  C CB    . ALA D  1 17  ? -5.182  -42.956 22.806  1.00 0.00 ? 23  ALA D CB    1 
ATOM 3068  N N     . PHE D  1 18  ? -2.578  -43.443 24.253  1.00 0.00 ? 24  PHE D N     1 
ATOM 3069  C CA    . PHE D  1 18  ? -1.838  -43.570 25.483  1.00 0.00 ? 24  PHE D CA    1 
ATOM 3070  C C     . PHE D  1 18  ? -0.596  -42.729 25.510  1.00 0.00 ? 24  PHE D C     1 
ATOM 3071  O O     . PHE D  1 18  ? -0.251  -42.177 26.545  1.00 0.00 ? 24  PHE D O     1 
ATOM 3072  C CB    . PHE D  1 18  ? -1.491  -45.001 25.768  1.00 0.00 ? 24  PHE D CB    1 
ATOM 3073  C CG    . PHE D  1 18  ? -0.763  -45.167 27.063  1.00 0.00 ? 24  PHE D CG    1 
ATOM 3074  C CD1   . PHE D  1 18  ? -1.351  -44.777 28.254  1.00 0.00 ? 24  PHE D CD1   1 
ATOM 3075  C CD2   . PHE D  1 18  ? 0.499   -45.740 27.105  1.00 0.00 ? 24  PHE D CD2   1 
ATOM 3076  C CE1   . PHE D  1 18  ? -0.691  -44.948 29.454  1.00 0.00 ? 24  PHE D CE1   1 
ATOM 3077  C CE2   . PHE D  1 18  ? 1.155   -45.917 28.304  1.00 0.00 ? 24  PHE D CE2   1 
ATOM 3078  C CZ    . PHE D  1 18  ? 0.561   -45.520 29.478  1.00 0.00 ? 24  PHE D CZ    1 
ATOM 3079  N N     . SER D  1 19  ? 0.088   -42.612 24.373  1.00 0.00 ? 25  SER D N     1 
ATOM 3080  C CA    . SER D  1 19  ? 1.345   -41.864 24.321  1.00 0.00 ? 25  SER D CA    1 
ATOM 3081  C C     . SER D  1 19  ? 1.173   -40.367 24.614  1.00 0.00 ? 25  SER D C     1 
ATOM 3082  O O     . SER D  1 19  ? 2.151   -39.669 24.865  1.00 0.00 ? 25  SER D O     1 
ATOM 3083  C CB    . SER D  1 19  ? 1.983   -42.015 22.970  1.00 0.00 ? 25  SER D CB    1 
ATOM 3084  O OG    . SER D  1 19  ? 1.286   -41.280 21.998  1.00 0.00 ? 25  SER D OG    1 
ATOM 3085  N N     . ASN D  1 20  ? -0.063  -39.874 24.560  1.00 0.00 ? 26  ASN D N     1 
ATOM 3086  C CA    . ASN D  1 20  ? -0.347  -38.470 24.824  1.00 0.00 ? 26  ASN D CA    1 
ATOM 3087  C C     . ASN D  1 20  ? -0.081  -38.120 26.283  1.00 0.00 ? 26  ASN D C     1 
ATOM 3088  O O     . ASN D  1 20  ? -0.737  -38.661 27.161  1.00 0.00 ? 26  ASN D O     1 
ATOM 3089  C CB    . ASN D  1 20  ? -1.787  -38.168 24.473  1.00 0.00 ? 26  ASN D CB    1 
ATOM 3090  C CG    . ASN D  1 20  ? -2.156  -36.732 24.667  1.00 0.00 ? 26  ASN D CG    1 
ATOM 3091  O OD1   . ASN D  1 20  ? -1.908  -36.143 25.728  1.00 0.00 ? 26  ASN D OD1   1 
ATOM 3092  N ND2   . ASN D  1 20  ? -2.749  -36.150 23.659  1.00 0.00 ? 26  ASN D ND2   1 
ATOM 3093  N N     . PRO D  1 21  ? 0.899   -37.225 26.553  1.00 0.00 ? 27  PRO D N     1 
ATOM 3094  C CA    . PRO D  1 21  ? 1.302   -36.744 27.893  1.00 0.00 ? 27  PRO D CA    1 
ATOM 3095  C C     . PRO D  1 21  ? 0.172   -36.758 28.902  1.00 0.00 ? 27  PRO D C     1 
ATOM 3096  O O     . PRO D  1 21  ? 0.337   -37.231 30.031  1.00 0.00 ? 27  PRO D O     1 
ATOM 3097  C CB    . PRO D  1 21  ? 1.706   -35.285 27.641  1.00 0.00 ? 27  PRO D CB    1 
ATOM 3098  C CG    . PRO D  1 21  ? 2.135   -35.252 26.237  1.00 0.00 ? 27  PRO D CG    1 
ATOM 3099  C CD    . PRO D  1 21  ? 1.183   -36.177 25.542  1.00 0.00 ? 27  PRO D CD    1 
ATOM 3100  N N     . THR D  1 22  ? -0.966  -36.202 28.509  1.00 0.00 ? 28  THR D N     1 
ATOM 3101  C CA    . THR D  1 22  ? -2.087  -36.077 29.399  1.00 0.00 ? 28  THR D CA    1 
ATOM 3102  C C     . THR D  1 22  ? -2.710  -37.400 29.679  1.00 0.00 ? 28  THR D C     1 
ATOM 3103  O O     . THR D  1 22  ? -3.001  -37.715 30.824  1.00 0.00 ? 28  THR D O     1 
ATOM 3104  C CB    . THR D  1 22  ? -3.133  -35.134 28.831  1.00 0.00 ? 28  THR D CB    1 
ATOM 3105  O OG1   . THR D  1 22  ? -2.561  -33.834 28.661  1.00 0.00 ? 28  THR D OG1   1 
ATOM 3106  C CG2   . THR D  1 22  ? -4.312  -35.044 29.769  1.00 0.00 ? 28  THR D CG2   1 
ATOM 3107  N N     . VAL D  1 23  ? -2.914  -38.184 28.641  1.00 0.00 ? 29  VAL D N     1 
ATOM 3108  C CA    . VAL D  1 23  ? -3.534  -39.474 28.794  1.00 0.00 ? 29  VAL D CA    1 
ATOM 3109  C C     . VAL D  1 23  ? -2.679  -40.396 29.602  1.00 0.00 ? 29  VAL D C     1 
ATOM 3110  O O     . VAL D  1 23  ? -3.166  -41.087 30.495  1.00 0.00 ? 29  VAL D O     1 
ATOM 3111  C CB    . VAL D  1 23  ? -3.795  -40.098 27.440  1.00 0.00 ? 29  VAL D CB    1 
ATOM 3112  C CG1   . VAL D  1 23  ? -4.279  -41.519 27.607  1.00 0.00 ? 29  VAL D CG1   1 
ATOM 3113  C CG2   . VAL D  1 23  ? -4.811  -39.280 26.702  1.00 0.00 ? 29  VAL D CG2   1 
ATOM 3114  N N     . ALA D  1 24  ? -1.401  -40.414 29.296  1.00 0.00 ? 30  ALA D N     1 
ATOM 3115  C CA    . ALA D  1 24  ? -0.480  -41.270 29.996  1.00 0.00 ? 30  ALA D CA    1 
ATOM 3116  C C     . ALA D  1 24  ? -0.466  -40.960 31.465  1.00 0.00 ? 30  ALA D C     1 
ATOM 3117  O O     . ALA D  1 24  ? -0.638  -41.848 32.293  1.00 0.00 ? 30  ALA D O     1 
ATOM 3118  C CB    . ALA D  1 24  ? 0.919   -41.119 29.429  1.00 0.00 ? 30  ALA D CB    1 
ATOM 3119  N N     . SER D  1 25  ? -0.283  -39.693 31.797  1.00 0.00 ? 31  SER D N     1 
ATOM 3120  C CA    . SER D  1 25  ? -0.186  -39.307 33.177  1.00 0.00 ? 31  SER D CA    1 
ATOM 3121  C C     . SER D  1 25  ? -1.491  -39.407 33.901  1.00 0.00 ? 31  SER D C     1 
ATOM 3122  O O     . SER D  1 25  ? -1.516  -39.732 35.081  1.00 0.00 ? 31  SER D O     1 
ATOM 3123  C CB    . SER D  1 25  ? 0.315   -37.922 33.266  1.00 0.00 ? 31  SER D CB    1 
ATOM 3124  O OG    . SER D  1 25  ? -0.566  -37.038 32.638  1.00 0.00 ? 31  SER D OG    1 
ATOM 3125  N N     . THR D  1 26  ? -2.589  -39.181 33.204  1.00 0.00 ? 32  THR D N     1 
ATOM 3126  C CA    . THR D  1 26  ? -3.884  -39.295 33.835  1.00 0.00 ? 32  THR D CA    1 
ATOM 3127  C C     . THR D  1 26  ? -4.112  -40.686 34.310  1.00 0.00 ? 32  THR D C     1 
ATOM 3128  O O     . THR D  1 26  ? -4.426  -40.910 35.477  1.00 0.00 ? 32  THR D O     1 
ATOM 3129  C CB    . THR D  1 26  ? -5.010  -38.900 32.894  1.00 0.00 ? 32  THR D CB    1 
ATOM 3130  O OG1   . THR D  1 26  ? -4.875  -37.526 32.534  1.00 0.00 ? 32  THR D OG1   1 
ATOM 3131  C CG2   . THR D  1 26  ? -6.338  -39.113 33.574  1.00 0.00 ? 32  THR D CG2   1 
ATOM 3132  N N     . ILE D  1 27  ? -3.936  -41.634 33.419  1.00 0.00 ? 33  ILE D N     1 
ATOM 3133  C CA    . ILE D  1 27  ? -4.165  -43.002 33.760  1.00 0.00 ? 33  ILE D CA    1 
ATOM 3134  C C     . ILE D  1 27  ? -3.187  -43.485 34.791  1.00 0.00 ? 33  ILE D C     1 
ATOM 3135  O O     . ILE D  1 27  ? -3.580  -44.054 35.806  1.00 0.00 ? 33  ILE D O     1 
ATOM 3136  C CB    . ILE D  1 27  ? -4.058  -43.883 32.534  1.00 0.00 ? 33  ILE D CB    1 
ATOM 3137  C CG1   . ILE D  1 27  ? -5.186  -43.584 31.573  1.00 0.00 ? 33  ILE D CG1   1 
ATOM 3138  C CG2   . ILE D  1 27  ? -4.087  -45.332 32.946  1.00 0.00 ? 33  ILE D CG2   1 
ATOM 3139  C CD1   . ILE D  1 27  ? -4.995  -44.209 30.221  1.00 0.00 ? 33  ILE D CD1   1 
ATOM 3140  N N     . LEU D  1 28  ? -1.912  -43.262 34.535  1.00 0.00 ? 34  LEU D N     1 
ATOM 3141  C CA    . LEU D  1 28  ? -0.868  -43.792 35.373  1.00 0.00 ? 34  LEU D CA    1 
ATOM 3142  C C     . LEU D  1 28  ? -0.876  -43.207 36.763  1.00 0.00 ? 34  LEU D C     1 
ATOM 3143  O O     . LEU D  1 28  ? -0.639  -43.919 37.735  1.00 0.00 ? 34  LEU D O     1 
ATOM 3144  C CB    . LEU D  1 28  ? 0.468   -43.544 34.719  1.00 0.00 ? 34  LEU D CB    1 
ATOM 3145  C CG    . LEU D  1 28  ? 0.704   -44.330 33.432  1.00 0.00 ? 34  LEU D CG    1 
ATOM 3146  C CD1   . LEU D  1 28  ? 1.974   -43.834 32.771  1.00 0.00 ? 34  LEU D CD1   1 
ATOM 3147  C CD2   . LEU D  1 28  ? 0.794   -45.809 33.754  1.00 0.00 ? 34  LEU D CD2   1 
ATOM 3148  N N     . SER D  1 29  ? -1.171  -41.920 36.875  1.00 0.00 ? 35  SER D N     1 
ATOM 3149  C CA    . SER D  1 29  ? -1.220  -41.306 38.181  1.00 0.00 ? 35  SER D CA    1 
ATOM 3150  C C     . SER D  1 29  ? -2.445  -41.748 38.952  1.00 0.00 ? 35  SER D C     1 
ATOM 3151  O O     . SER D  1 29  ? -2.411  -41.822 40.179  1.00 0.00 ? 35  SER D O     1 
ATOM 3152  C CB    . SER D  1 29  ? -1.210  -39.812 38.063  1.00 0.00 ? 35  SER D CB    1 
ATOM 3153  O OG    . SER D  1 29  ? -2.384  -39.352 37.460  1.00 0.00 ? 35  SER D OG    1 
ATOM 3154  N N     . ASN D  1 30  ? -3.518  -42.092 38.239  1.00 0.00 ? 36  ASN D N     1 
ATOM 3155  C CA    . ASN D  1 30  ? -4.710  -42.571 38.905  1.00 0.00 ? 36  ASN D CA    1 
ATOM 3156  C C     . ASN D  1 30  ? -4.553  -43.981 39.405  1.00 0.00 ? 36  ASN D C     1 
ATOM 3157  O O     . ASN D  1 30  ? -5.052  -44.317 40.473  1.00 0.00 ? 36  ASN D O     1 
ATOM 3158  C CB    . ASN D  1 30  ? -5.909  -42.457 38.013  1.00 0.00 ? 36  ASN D CB    1 
ATOM 3159  C CG    . ASN D  1 30  ? -6.358  -41.039 37.877  1.00 0.00 ? 36  ASN D CG    1 
ATOM 3160  O OD1   . ASN D  1 30  ? -5.899  -40.167 38.622  1.00 0.00 ? 36  ASN D OD1   1 
ATOM 3161  N ND2   . ASN D  1 30  ? -7.258  -40.787 36.969  1.00 0.00 ? 36  ASN D ND2   1 
ATOM 3162  N N     . VAL D  1 31  ? -3.828  -44.812 38.661  1.00 0.00 ? 37  VAL D N     1 
ATOM 3163  C CA    . VAL D  1 31  ? -3.661  -46.201 39.066  1.00 0.00 ? 37  VAL D CA    1 
ATOM 3164  C C     . VAL D  1 31  ? -2.408  -46.409 39.857  1.00 0.00 ? 37  VAL D C     1 
ATOM 3165  O O     . VAL D  1 31  ? -2.095  -47.535 40.213  1.00 0.00 ? 37  VAL D O     1 
ATOM 3166  C CB    . VAL D  1 31  ? -3.616  -47.138 37.860  1.00 0.00 ? 37  VAL D CB    1 
ATOM 3167  C CG1   . VAL D  1 31  ? -4.869  -46.997 37.028  1.00 0.00 ? 37  VAL D CG1   1 
ATOM 3168  C CG2   . VAL D  1 31  ? -2.375  -46.862 37.049  1.00 0.00 ? 37  VAL D CG2   1 
ATOM 3169  N N     . SER D  1 32  ? -1.676  -45.331 40.123  1.00 0.00 ? 38  SER D N     1 
ATOM 3170  C CA    . SER D  1 32  ? -0.462  -45.412 40.911  1.00 0.00 ? 38  SER D CA    1 
ATOM 3171  C C     . SER D  1 32  ? -0.647  -46.211 42.215  1.00 0.00 ? 38  SER D C     1 
ATOM 3172  O O     . SER D  1 32  ? -0.169  -47.339 42.303  1.00 0.00 ? 38  SER D O     1 
ATOM 3173  C CB    . SER D  1 32  ? 0.098   -44.025 41.183  1.00 0.00 ? 38  SER D CB    1 
ATOM 3174  O OG    . SER D  1 32  ? 0.597   -43.446 40.010  1.00 0.00 ? 38  SER D OG    1 
ATOM 3175  N N     . PRO D  1 33  ? -1.280  -45.624 43.256  1.00 0.00 ? 39  PRO D N     1 
ATOM 3176  C CA    . PRO D  1 33  ? -1.453  -46.268 44.560  1.00 0.00 ? 39  PRO D CA    1 
ATOM 3177  C C     . PRO D  1 33  ? -2.111  -47.660 44.453  1.00 0.00 ? 39  PRO D C     1 
ATOM 3178  O O     . PRO D  1 33  ? -1.873  -48.529 45.293  1.00 0.00 ? 39  PRO D O     1 
ATOM 3179  C CB    . PRO D  1 33  ? -2.381  -45.322 45.285  1.00 0.00 ? 39  PRO D CB    1 
ATOM 3180  C CG    . PRO D  1 33  ? -3.274  -44.793 44.222  1.00 0.00 ? 39  PRO D CG    1 
ATOM 3181  C CD    . PRO D  1 33  ? -2.451  -44.759 42.971  1.00 0.00 ? 39  PRO D CD    1 
ATOM 3182  N N     . VAL D  1 34  ? -2.905  -47.874 43.406  1.00 0.00 ? 40  VAL D N     1 
ATOM 3183  C CA    . VAL D  1 34  ? -3.548  -49.143 43.189  1.00 0.00 ? 40  VAL D CA    1 
ATOM 3184  C C     . VAL D  1 34  ? -2.522  -50.165 42.798  1.00 0.00 ? 40  VAL D C     1 
ATOM 3185  O O     . VAL D  1 34  ? -2.471  -51.259 43.362  1.00 0.00 ? 40  VAL D O     1 
ATOM 3186  C CB    . VAL D  1 34  ? -4.592  -49.027 42.087  1.00 0.00 ? 40  VAL D CB    1 
ATOM 3187  C CG1   . VAL D  1 34  ? -5.160  -50.394 41.763  1.00 0.00 ? 40  VAL D CG1   1 
ATOM 3188  C CG2   . VAL D  1 34  ? -5.683  -48.064 42.514  1.00 0.00 ? 40  VAL D CG2   1 
ATOM 3189  N N     . ALA D  1 35  ? -1.681  -49.790 41.849  1.00 0.00 ? 41  ALA D N     1 
ATOM 3190  C CA    . ALA D  1 35  ? -0.606  -50.630 41.388  1.00 0.00 ? 41  ALA D CA    1 
ATOM 3191  C C     . ALA D  1 35  ? 0.307   -50.981 42.512  1.00 0.00 ? 41  ALA D C     1 
ATOM 3192  O O     . ALA D  1 35  ? 0.767   -52.112 42.615  1.00 0.00 ? 41  ALA D O     1 
ATOM 3193  C CB    . ALA D  1 35  ? 0.177   -49.927 40.299  1.00 0.00 ? 41  ALA D CB    1 
ATOM 3194  N N     . GLN D  1 36  ? 0.556   -50.014 43.378  1.00 0.00 ? 42  GLN D N     1 
ATOM 3195  C CA    . GLN D  1 36  ? 1.439   -50.213 44.494  1.00 0.00 ? 42  GLN D CA    1 
ATOM 3196  C C     . GLN D  1 36  ? 0.924   -51.292 45.376  1.00 0.00 ? 42  GLN D C     1 
ATOM 3197  O O     . GLN D  1 36  ? 1.672   -52.166 45.793  1.00 0.00 ? 42  GLN D O     1 
ATOM 3198  C CB    . GLN D  1 36  ? 1.578   -48.935 45.280  1.00 0.00 ? 42  GLN D CB    1 
ATOM 3199  C CG    . GLN D  1 36  ? 2.281   -47.850 44.518  1.00 0.00 ? 42  GLN D CG    1 
ATOM 3200  C CD    . GLN D  1 36  ? 2.415   -46.575 45.305  1.00 0.00 ? 42  GLN D CD    1 
ATOM 3201  O OE1   . GLN D  1 36  ? 2.691   -46.595 46.507  1.00 0.00 ? 42  GLN D OE1   1 
ATOM 3202  N NE2   . GLN D  1 36  ? 2.221   -45.451 44.630  1.00 0.00 ? 42  GLN D NE2   1 
ATOM 3203  N N     . GLN D  1 37  ? -0.373  -51.273 45.629  1.00 0.00 ? 43  GLN D N     1 
ATOM 3204  C CA    . GLN D  1 37  ? -0.981  -52.291 46.445  1.00 0.00 ? 43  GLN D CA    1 
ATOM 3205  C C     . GLN D  1 37  ? -0.844  -53.652 45.828  1.00 0.00 ? 43  GLN D C     1 
ATOM 3206  O O     . GLN D  1 37  ? -0.506  -54.618 46.512  1.00 0.00 ? 43  GLN D O     1 
ATOM 3207  C CB    . GLN D  1 37  ? -2.448  -51.994 46.655  1.00 0.00 ? 43  GLN D CB    1 
ATOM 3208  C CG    . GLN D  1 37  ? -3.144  -53.007 47.521  1.00 0.00 ? 43  GLN D CG    1 
ATOM 3209  C CD    . GLN D  1 37  ? -2.613  -53.002 48.926  1.00 0.00 ? 43  GLN D CD    1 
ATOM 3210  O OE1   . GLN D  1 37  ? -2.587  -51.957 49.580  1.00 0.00 ? 43  GLN D OE1   1 
ATOM 3211  N NE2   . GLN D  1 37  ? -2.183  -54.163 49.410  1.00 0.00 ? 43  GLN D NE2   1 
ATOM 3212  N N     . ASN D  1 38  ? -1.092  -53.732 44.530  1.00 0.00 ? 44  ASN D N     1 
ATOM 3213  C CA    . ASN D  1 38  ? -1.055  -54.996 43.838  1.00 0.00 ? 44  ASN D CA    1 
ATOM 3214  C C     . ASN D  1 38  ? 0.342   -55.564 43.791  1.00 0.00 ? 44  ASN D C     1 
ATOM 3215  O O     . ASN D  1 38  ? 0.539   -56.764 43.985  1.00 0.00 ? 44  ASN D O     1 
ATOM 3216  C CB    . ASN D  1 38  ? -1.631  -54.838 42.461  1.00 0.00 ? 44  ASN D CB    1 
ATOM 3217  C CG    . ASN D  1 38  ? -3.115  -54.650 42.515  1.00 0.00 ? 44  ASN D CG    1 
ATOM 3218  O OD1   . ASN D  1 38  ? -3.742  -54.985 43.525  1.00 0.00 ? 44  ASN D OD1   1 
ATOM 3219  N ND2   . ASN D  1 38  ? -3.694  -54.127 41.464  1.00 0.00 ? 44  ASN D ND2   1 
ATOM 3220  N N     . PHE D  1 39  ? 1.316   -54.698 43.564  1.00 0.00 ? 45  PHE D N     1 
ATOM 3221  C CA    . PHE D  1 39  ? 2.701   -55.102 43.535  1.00 0.00 ? 45  PHE D CA    1 
ATOM 3222  C C     . PHE D  1 39  ? 3.126   -55.598 44.892  1.00 0.00 ? 45  PHE D C     1 
ATOM 3223  O O     . PHE D  1 39  ? 3.709   -56.666 45.020  1.00 0.00 ? 45  PHE D O     1 
ATOM 3224  C CB    . PHE D  1 39  ? 3.589   -53.952 43.141  1.00 0.00 ? 45  PHE D CB    1 
ATOM 3225  C CG    . PHE D  1 39  ? 5.010   -54.352 42.984  1.00 0.00 ? 45  PHE D CG    1 
ATOM 3226  C CD1   . PHE D  1 39  ? 5.544   -54.554 41.728  1.00 0.00 ? 45  PHE D CD1   1 
ATOM 3227  C CD2   . PHE D  1 39  ? 5.809   -54.581 44.085  1.00 0.00 ? 45  PHE D CD2   1 
ATOM 3228  C CE1   . PHE D  1 39  ? 6.861   -54.939 41.571  1.00 0.00 ? 45  PHE D CE1   1 
ATOM 3229  C CE2   . PHE D  1 39  ? 7.123   -54.977 43.934  1.00 0.00 ? 45  PHE D CE2   1 
ATOM 3230  C CZ    . PHE D  1 39  ? 7.654   -55.145 42.675  1.00 0.00 ? 45  PHE D CZ    1 
ATOM 3231  N N     . GLN D  1 40  ? 2.816   -54.824 45.918  1.00 0.00 ? 46  GLN D N     1 
ATOM 3232  C CA    . GLN D  1 40  ? 3.184   -55.185 47.265  1.00 0.00 ? 46  GLN D CA    1 
ATOM 3233  C C     . GLN D  1 40  ? 2.565   -56.483 47.693  1.00 0.00 ? 46  GLN D C     1 
ATOM 3234  O O     . GLN D  1 40  ? 3.171   -57.252 48.433  1.00 0.00 ? 46  GLN D O     1 
ATOM 3235  C CB    . GLN D  1 40  ? 2.758   -54.113 48.243  1.00 0.00 ? 46  GLN D CB    1 
ATOM 3236  C CG    . GLN D  1 40  ? 3.540   -52.828 48.176  1.00 0.00 ? 46  GLN D CG    1 
ATOM 3237  C CD    . GLN D  1 40  ? 2.934   -51.800 49.091  1.00 0.00 ? 46  GLN D CD    1 
ATOM 3238  O OE1   . GLN D  1 40  ? 2.236   -52.159 50.041  1.00 0.00 ? 46  GLN D OE1   1 
ATOM 3239  N NE2   . GLN D  1 40  ? 3.175   -50.524 48.821  1.00 0.00 ? 46  GLN D NE2   1 
ATOM 3240  N N     . THR D  1 41  ? 1.338   -56.714 47.266  1.00 0.00 ? 47  THR D N     1 
ATOM 3241  C CA    . THR D  1 41  ? 0.619   -57.885 47.681  1.00 0.00 ? 47  THR D CA    1 
ATOM 3242  C C     . THR D  1 41  ? 1.174   -59.176 47.091  1.00 0.00 ? 47  THR D C     1 
ATOM 3243  O O     . THR D  1 41  ? 1.415   -60.134 47.815  1.00 0.00 ? 47  THR D O     1 
ATOM 3244  C CB    . THR D  1 41  ? -0.853  -57.761 47.302  1.00 0.00 ? 47  THR D CB    1 
ATOM 3245  O OG1   . THR D  1 41  ? -1.416  -56.612 47.941  1.00 0.00 ? 47  THR D OG1   1 
ATOM 3246  C CG2   . THR D  1 41  ? -1.616  -58.999 47.734  1.00 0.00 ? 47  THR D CG2   1 
ATOM 3247  N N     . ASN D  1 42  ? 1.347   -59.219 45.776  1.00 0.00 ? 48  ASN D N     1 
ATOM 3248  C CA    . ASN D  1 42  ? 1.717   -60.474 45.141  1.00 0.00 ? 48  ASN D CA    1 
ATOM 3249  C C     . ASN D  1 42  ? 3.197   -60.696 44.907  1.00 0.00 ? 48  ASN D C     1 
ATOM 3250  O O     . ASN D  1 42  ? 3.607   -61.828 44.695  1.00 0.00 ? 48  ASN D O     1 
ATOM 3251  C CB    . ASN D  1 42  ? 0.973   -60.645 43.841  1.00 0.00 ? 48  ASN D CB    1 
ATOM 3252  C CG    . ASN D  1 42  ? -0.484  -60.952 44.046  1.00 0.00 ? 48  ASN D CG    1 
ATOM 3253  O OD1   . ASN D  1 42  ? -0.880  -61.484 45.094  1.00 0.00 ? 48  ASN D OD1   1 
ATOM 3254  N ND2   . ASN D  1 42  ? -1.289  -60.658 43.062  1.00 0.00 ? 48  ASN D ND2   1 
ATOM 3255  N N     . VAL D  1 43  ? 4.013   -59.656 44.946  1.00 0.00 ? 49  VAL D N     1 
ATOM 3256  C CA    . VAL D  1 43  ? 5.428   -59.848 44.624  1.00 0.00 ? 49  VAL D CA    1 
ATOM 3257  C C     . VAL D  1 43  ? 6.305   -60.546 45.692  1.00 0.00 ? 49  VAL D C     1 
ATOM 3258  O O     . VAL D  1 43  ? 7.011   -61.497 45.354  1.00 0.00 ? 49  VAL D O     1 
ATOM 3259  C CB    . VAL D  1 43  ? 6.054   -58.540 44.239  1.00 0.00 ? 49  VAL D CB    1 
ATOM 3260  C CG1   . VAL D  1 43  ? 7.551   -58.698 44.093  1.00 0.00 ? 49  VAL D CG1   1 
ATOM 3261  C CG2   . VAL D  1 43  ? 5.445   -58.112 42.925  1.00 0.00 ? 49  VAL D CG2   1 
ATOM 3262  N N     . PRO D  1 44  ? 6.309   -60.085 46.962  1.00 0.00 ? 50  PRO D N     1 
ATOM 3263  C CA    . PRO D  1 44  ? 7.133   -60.658 48.029  1.00 0.00 ? 50  PRO D CA    1 
ATOM 3264  C C     . PRO D  1 44  ? 6.909   -62.170 48.175  1.00 0.00 ? 50  PRO D C     1 
ATOM 3265  O O     . PRO D  1 44  ? 7.788   -62.892 48.650  1.00 0.00 ? 50  PRO D O     1 
ATOM 3266  C CB    . PRO D  1 44  ? 6.649   -59.933 49.267  1.00 0.00 ? 50  PRO D CB    1 
ATOM 3267  C CG    . PRO D  1 44  ? 5.210   -59.682 49.015  1.00 0.00 ? 50  PRO D CG    1 
ATOM 3268  C CD    . PRO D  1 44  ? 5.063   -59.540 47.529  1.00 0.00 ? 50  PRO D CD    1 
ATOM 3269  N N     . LYS D  1 45  ? 5.752   -62.647 47.714  1.00 0.00 ? 51  LYS D N     1 
ATOM 3270  C CA    . LYS D  1 45  ? 5.422   -64.053 47.714  1.00 0.00 ? 51  LYS D CA    1 
ATOM 3271  C C     . LYS D  1 45  ? 6.404   -64.845 46.879  1.00 0.00 ? 51  LYS D C     1 
ATOM 3272  O O     . LYS D  1 45  ? 6.774   -65.961 47.231  1.00 0.00 ? 51  LYS D O     1 
ATOM 3273  C CB    . LYS D  1 45  ? 4.029   -64.248 47.147  1.00 0.00 ? 51  LYS D CB    1 
ATOM 3274  C CG    . LYS D  1 45  ? 2.904   -63.724 48.015  1.00 0.00 ? 51  LYS D CG    1 
ATOM 3275  C CD    . LYS D  1 45  ? 1.568   -63.863 47.302  1.00 0.00 ? 51  LYS D CD    1 
ATOM 3276  C CE    . LYS D  1 45  ? 0.426   -63.335 48.146  1.00 0.00 ? 51  LYS D CE    1 
ATOM 3277  N NZ    . LYS D  1 45  ? -0.857  -63.329 47.398  1.00 0.00 ? 51  LYS D NZ    1 
ATOM 3278  N N     . PHE D  1 46  ? 6.821   -64.264 45.764  1.00 0.00 ? 52  PHE D N     1 
ATOM 3279  C CA    . PHE D  1 46  ? 7.725   -64.922 44.850  1.00 0.00 ? 52  PHE D CA    1 
ATOM 3280  C C     . PHE D  1 46  ? 9.156   -64.635 45.199  1.00 0.00 ? 52  PHE D C     1 
ATOM 3281  O O     . PHE D  1 46  ? 10.042  -65.433 44.907  1.00 0.00 ? 52  PHE D O     1 
ATOM 3282  C CB    . PHE D  1 46  ? 7.437   -64.476 43.439  1.00 0.00 ? 52  PHE D CB    1 
ATOM 3283  C CG    . PHE D  1 46  ? 6.120   -64.954 42.952  1.00 0.00 ? 52  PHE D CG    1 
ATOM 3284  C CD1   . PHE D  1 46  ? 4.991   -64.219 43.209  1.00 0.00 ? 52  PHE D CD1   1 
ATOM 3285  C CD2   . PHE D  1 46  ? 6.002   -66.132 42.244  1.00 0.00 ? 52  PHE D CD2   1 
ATOM 3286  C CE1   . PHE D  1 46  ? 3.757   -64.646 42.778  1.00 0.00 ? 52  PHE D CE1   1 
ATOM 3287  C CE2   . PHE D  1 46  ? 4.775   -66.560 41.799  1.00 0.00 ? 52  PHE D CE2   1 
ATOM 3288  C CZ    . PHE D  1 46  ? 3.649   -65.820 42.071  1.00 0.00 ? 52  PHE D CZ    1 
ATOM 3289  N N     . THR D  1 47  ? 9.395   -63.509 45.849  1.00 0.00 ? 53  THR D N     1 
ATOM 3290  C CA    . THR D  1 47  ? 10.738  -63.201 46.284  1.00 0.00 ? 53  THR D CA    1 
ATOM 3291  C C     . THR D  1 47  ? 11.215  -64.228 47.284  1.00 0.00 ? 53  THR D C     1 
ATOM 3292  O O     . THR D  1 47  ? 12.356  -64.686 47.217  1.00 0.00 ? 53  THR D O     1 
ATOM 3293  C CB    . THR D  1 47  ? 10.835  -61.823 46.900  1.00 0.00 ? 53  THR D CB    1 
ATOM 3294  O OG1   . THR D  1 47  ? 10.465  -60.831 45.936  1.00 0.00 ? 53  THR D OG1   1 
ATOM 3295  C CG2   . THR D  1 47  ? 12.256  -61.581 47.353  1.00 0.00 ? 53  THR D CG2   1 
ATOM 3296  N N     . SER D  1 48  ? 10.334  -64.609 48.208  1.00 0.00 ? 54  SER D N     1 
ATOM 3297  C CA    . SER D  1 48  ? 10.677  -65.618 49.195  1.00 0.00 ? 54  SER D CA    1 
ATOM 3298  C C     . SER D  1 48  ? 10.968  -66.953 48.532  1.00 0.00 ? 54  SER D C     1 
ATOM 3299  O O     . SER D  1 48  ? 11.833  -67.705 48.990  1.00 0.00 ? 54  SER D O     1 
ATOM 3300  C CB    . SER D  1 48  ? 9.543   -65.793 50.170  1.00 0.00 ? 54  SER D CB    1 
ATOM 3301  O OG    . SER D  1 48  ? 8.429   -66.369 49.545  1.00 0.00 ? 54  SER D OG    1 
ATOM 3302  N N     . VAL D  1 49  ? 10.295  -67.216 47.418  1.00 0.00 ? 55  VAL D N     1 
ATOM 3303  C CA    . VAL D  1 49  ? 10.540  -68.419 46.657  1.00 0.00 ? 55  VAL D CA    1 
ATOM 3304  C C     . VAL D  1 49  ? 11.920  -68.394 46.101  1.00 0.00 ? 55  VAL D C     1 
ATOM 3305  O O     . VAL D  1 49  ? 12.651  -69.370 46.198  1.00 0.00 ? 55  VAL D O     1 
ATOM 3306  C CB    . VAL D  1 49  ? 9.530   -68.563 45.505  1.00 0.00 ? 55  VAL D CB    1 
ATOM 3307  C CG1   . VAL D  1 49  ? 9.929   -69.708 44.599  1.00 0.00 ? 55  VAL D CG1   1 
ATOM 3308  C CG2   . VAL D  1 49  ? 8.149   -68.796 46.065  1.00 0.00 ? 55  VAL D CG2   1 
ATOM 3309  N N     . ASN D  1 50  ? 12.300  -67.260 45.541  1.00 0.00 ? 56  ASN D N     1 
ATOM 3310  C CA    . ASN D  1 50  ? 13.602  -67.118 44.946  1.00 0.00 ? 56  ASN D CA    1 
ATOM 3311  C C     . ASN D  1 50  ? 14.705  -67.369 45.938  1.00 0.00 ? 56  ASN D C     1 
ATOM 3312  O O     . ASN D  1 50  ? 15.686  -68.018 45.606  1.00 0.00 ? 56  ASN D O     1 
ATOM 3313  C CB    . ASN D  1 50  ? 13.750  -65.760 44.333  1.00 0.00 ? 56  ASN D CB    1 
ATOM 3314  C CG    . ASN D  1 50  ? 12.959  -65.638 43.085  1.00 0.00 ? 56  ASN D CG    1 
ATOM 3315  O OD1   . ASN D  1 50  ? 12.608  -66.653 42.478  1.00 0.00 ? 56  ASN D OD1   1 
ATOM 3316  N ND2   . ASN D  1 50  ? 12.666  -64.429 42.683  1.00 0.00 ? 56  ASN D ND2   1 
ATOM 3317  N N     . GLU D  1 51  ? 14.549  -66.881 47.168  1.00 0.00 ? 57  GLU D N     1 
ATOM 3318  C CA    . GLU D  1 51  ? 15.581  -67.109 48.176  1.00 0.00 ? 57  GLU D CA    1 
ATOM 3319  C C     . GLU D  1 51  ? 15.744  -68.590 48.472  1.00 0.00 ? 57  GLU D C     1 
ATOM 3320  O O     . GLU D  1 51  ? 16.857  -69.115 48.417  1.00 0.00 ? 57  GLU D O     1 
ATOM 3321  C CB    . GLU D  1 51  ? 15.289  -66.350 49.487  1.00 0.00 ? 57  GLU D CB    1 
ATOM 3322  C CG    . GLU D  1 51  ? 16.398  -66.516 50.551  1.00 0.00 ? 57  GLU D CG    1 
ATOM 3323  C CD    . GLU D  1 51  ? 16.196  -65.703 51.829  1.00 0.00 ? 57  GLU D CD    1 
ATOM 3324  O OE1   . GLU D  1 51  ? 15.166  -65.092 51.983  1.00 0.00 ? 57  GLU D OE1   1 
ATOM 3325  O OE2   . GLU D  1 51  ? 17.098  -65.687 52.636  1.00 0.00 ? 57  GLU D OE2   1 
ATOM 3326  N N     . ASN D  1 52  ? 14.644  -69.264 48.789  1.00 0.00 ? 58  ASN D N     1 
ATOM 3327  C CA    . ASN D  1 52  ? 14.727  -70.670 49.151  1.00 0.00 ? 58  ASN D CA    1 
ATOM 3328  C C     . ASN D  1 52  ? 15.148  -71.545 47.989  1.00 0.00 ? 58  ASN D C     1 
ATOM 3329  O O     . ASN D  1 52  ? 15.997  -72.418 48.148  1.00 0.00 ? 58  ASN D O     1 
ATOM 3330  C CB    . ASN D  1 52  ? 13.424  -71.161 49.725  1.00 0.00 ? 58  ASN D CB    1 
ATOM 3331  C CG    . ASN D  1 52  ? 13.183  -70.686 51.128  1.00 0.00 ? 58  ASN D CG    1 
ATOM 3332  O OD1   . ASN D  1 52  ? 14.092  -70.181 51.792  1.00 0.00 ? 58  ASN D OD1   1 
ATOM 3333  N ND2   . ASN D  1 52  ? 11.977  -70.862 51.601  1.00 0.00 ? 58  ASN D ND2   1 
ATOM 3334  N N     . VAL D  1 53  ? 14.579  -71.303 46.817  1.00 0.00 ? 59  VAL D N     1 
ATOM 3335  C CA    . VAL D  1 53  ? 14.919  -72.085 45.646  1.00 0.00 ? 59  VAL D CA    1 
ATOM 3336  C C     . VAL D  1 53  ? 16.362  -71.916 45.289  1.00 0.00 ? 59  VAL D C     1 
ATOM 3337  O O     . VAL D  1 53  ? 17.038  -72.885 44.958  1.00 0.00 ? 59  VAL D O     1 
ATOM 3338  C CB    . VAL D  1 53  ? 14.047  -71.695 44.449  1.00 0.00 ? 59  VAL D CB    1 
ATOM 3339  C CG1   . VAL D  1 53  ? 14.577  -72.350 43.186  1.00 0.00 ? 59  VAL D CG1   1 
ATOM 3340  C CG2   . VAL D  1 53  ? 12.617  -72.137 44.701  1.00 0.00 ? 59  VAL D CG2   1 
ATOM 3341  N N     . SER D  1 54  ? 16.841  -70.687 45.353  1.00 0.00 ? 60  SER D N     1 
ATOM 3342  C CA    . SER D  1 54  ? 18.217  -70.410 45.050  1.00 0.00 ? 60  SER D CA    1 
ATOM 3343  C C     . SER D  1 54  ? 19.120  -71.181 45.983  1.00 0.00 ? 60  SER D C     1 
ATOM 3344  O O     . SER D  1 54  ? 20.099  -71.780 45.549  1.00 0.00 ? 60  SER D O     1 
ATOM 3345  C CB    . SER D  1 54  ? 18.485  -68.937 45.168  1.00 0.00 ? 60  SER D CB    1 
ATOM 3346  O OG    . SER D  1 54  ? 19.787  -68.624 44.771  1.00 0.00 ? 60  SER D OG    1 
ATOM 3347  N N     . ALA D  1 55  ? 18.783  -71.183 47.270  1.00 0.00 ? 61  ALA D N     1 
ATOM 3348  C CA    . ALA D  1 55  ? 19.570  -71.906 48.253  1.00 0.00 ? 61  ALA D CA    1 
ATOM 3349  C C     . ALA D  1 55  ? 19.685  -73.364 47.882  1.00 0.00 ? 61  ALA D C     1 
ATOM 3350  O O     . ALA D  1 55  ? 20.774  -73.939 47.924  1.00 0.00 ? 61  ALA D O     1 
ATOM 3351  C CB    . ALA D  1 55  ? 18.952  -71.768 49.628  1.00 0.00 ? 61  ALA D CB    1 
ATOM 3352  N N     . VAL D  1 56  ? 18.572  -73.956 47.478  1.00 0.00 ? 62  VAL D N     1 
ATOM 3353  C CA    . VAL D  1 56  ? 18.557  -75.340 47.054  1.00 0.00 ? 62  VAL D CA    1 
ATOM 3354  C C     . VAL D  1 56  ? 19.468  -75.575 45.892  1.00 0.00 ? 62  VAL D C     1 
ATOM 3355  O O     . VAL D  1 56  ? 20.244  -76.526 45.889  1.00 0.00 ? 62  VAL D O     1 
ATOM 3356  C CB    . VAL D  1 56  ? 17.150  -75.757 46.666  1.00 0.00 ? 62  VAL D CB    1 
ATOM 3357  C CG1   . VAL D  1 56  ? 17.169  -77.106 45.992  1.00 0.00 ? 62  VAL D CG1   1 
ATOM 3358  C CG2   . VAL D  1 56  ? 16.302  -75.806 47.901  1.00 0.00 ? 62  VAL D CG2   1 
ATOM 3359  N N     . LEU D  1 57  ? 19.396  -74.702 44.912  1.00 0.00 ? 63  LEU D N     1 
ATOM 3360  C CA    . LEU D  1 57  ? 20.191  -74.841 43.722  1.00 0.00 ? 63  LEU D CA    1 
ATOM 3361  C C     . LEU D  1 57  ? 21.665  -74.800 44.044  1.00 0.00 ? 63  LEU D C     1 
ATOM 3362  O O     . LEU D  1 57  ? 22.453  -75.535 43.453  1.00 0.00 ? 63  LEU D O     1 
ATOM 3363  C CB    . LEU D  1 57  ? 19.815  -73.754 42.744  1.00 0.00 ? 63  LEU D CB    1 
ATOM 3364  C CG    . LEU D  1 57  ? 18.411  -73.901 42.169  1.00 0.00 ? 63  LEU D CG    1 
ATOM 3365  C CD1   . LEU D  1 57  ? 18.064  -72.683 41.340  1.00 0.00 ? 63  LEU D CD1   1 
ATOM 3366  C CD2   . LEU D  1 57  ? 18.350  -75.165 41.348  1.00 0.00 ? 63  LEU D CD2   1 
ATOM 3367  N N     . THR D  1 58  ? 22.041  -73.991 45.023  1.00 0.00 ? 64  THR D N     1 
ATOM 3368  C CA    . THR D  1 58  ? 23.419  -73.962 45.471  1.00 0.00 ? 64  THR D CA    1 
ATOM 3369  C C     . THR D  1 58  ? 23.816  -75.286 46.097  1.00 0.00 ? 64  THR D C     1 
ATOM 3370  O O     . THR D  1 58  ? 24.898  -75.805 45.831  1.00 0.00 ? 64  THR D O     1 
ATOM 3371  C CB    . THR D  1 58  ? 23.665  -72.804 46.430  1.00 0.00 ? 64  THR D CB    1 
ATOM 3372  O OG1   . THR D  1 58  ? 23.441  -71.573 45.726  1.00 0.00 ? 64  THR D OG1   1 
ATOM 3373  C CG2   . THR D  1 58  ? 25.090  -72.840 46.956  1.00 0.00 ? 64  THR D CG2   1 
ATOM 3374  N N     . GLN D  1 59  ? 22.920  -75.869 46.881  1.00 0.00 ? 65  GLN D N     1 
ATOM 3375  C CA    . GLN D  1 59  ? 23.179  -77.181 47.472  1.00 0.00 ? 65  GLN D CA    1 
ATOM 3376  C C     . GLN D  1 59  ? 23.271  -78.289 46.405  1.00 0.00 ? 65  GLN D C     1 
ATOM 3377  O O     . GLN D  1 59  ? 23.983  -79.273 46.591  1.00 0.00 ? 65  GLN D O     1 
ATOM 3378  C CB    . GLN D  1 59  ? 22.110  -77.530 48.489  1.00 0.00 ? 65  GLN D CB    1 
ATOM 3379  C CG    . GLN D  1 59  ? 22.161  -76.691 49.752  1.00 0.00 ? 65  GLN D CG    1 
ATOM 3380  C CD    . GLN D  1 59  ? 23.440  -76.918 50.549  1.00 0.00 ? 65  GLN D CD    1 
ATOM 3381  O OE1   . GLN D  1 59  ? 23.951  -78.038 50.609  1.00 0.00 ? 65  GLN D OE1   1 
ATOM 3382  N NE2   . GLN D  1 59  ? 23.951  -75.863 51.177  1.00 0.00 ? 65  GLN D NE2   1 
ATOM 3383  N N     . TYR D  1 60  ? 22.573  -78.111 45.285  1.00 0.00 ? 66  TYR D N     1 
ATOM 3384  C CA    . TYR D  1 60  ? 22.674  -79.053 44.170  1.00 0.00 ? 66  TYR D CA    1 
ATOM 3385  C C     . TYR D  1 60  ? 23.791  -78.730 43.186  1.00 0.00 ? 66  TYR D C     1 
ATOM 3386  O O     . TYR D  1 60  ? 23.947  -79.423 42.185  1.00 0.00 ? 66  TYR D O     1 
ATOM 3387  C CB    . TYR D  1 60  ? 21.364  -79.152 43.422  1.00 0.00 ? 66  TYR D CB    1 
ATOM 3388  C CG    . TYR D  1 60  ? 20.385  -80.102 44.040  1.00 0.00 ? 66  TYR D CG    1 
ATOM 3389  C CD1   . TYR D  1 60  ? 19.482  -79.671 44.978  1.00 0.00 ? 66  TYR D CD1   1 
ATOM 3390  C CD2   . TYR D  1 60  ? 20.385  -81.424 43.634  1.00 0.00 ? 66  TYR D CD2   1 
ATOM 3391  C CE1   . TYR D  1 60  ? 18.576  -80.558 45.518  1.00 0.00 ? 66  TYR D CE1   1 
ATOM 3392  C CE2   . TYR D  1 60  ? 19.478  -82.310 44.167  1.00 0.00 ? 66  TYR D CE2   1 
ATOM 3393  C CZ    . TYR D  1 60  ? 18.574  -81.881 45.104  1.00 0.00 ? 66  TYR D CZ    1 
ATOM 3394  O OH    . TYR D  1 60  ? 17.664  -82.762 45.635  1.00 0.00 ? 66  TYR D OH    1 
ATOM 3395  N N     . GLY D  1 61  ? 24.560  -77.682 43.445  1.00 0.00 ? 67  GLY D N     1 
ATOM 3396  C CA    . GLY D  1 61  ? 25.694  -77.370 42.588  1.00 0.00 ? 67  GLY D CA    1 
ATOM 3397  C C     . GLY D  1 61  ? 25.294  -76.727 41.262  1.00 0.00 ? 67  GLY D C     1 
ATOM 3398  O O     . GLY D  1 61  ? 26.087  -76.703 40.319  1.00 0.00 ? 67  GLY D O     1 
ATOM 3399  N N     . ILE D  1 62  ? 24.084  -76.189 41.196  1.00 0.00 ? 68  ILE D N     1 
ATOM 3400  C CA    . ILE D  1 62  ? 23.569  -75.617 39.964  1.00 0.00 ? 68  ILE D CA    1 
ATOM 3401  C C     . ILE D  1 62  ? 24.056  -74.195 39.789  1.00 0.00 ? 68  ILE D C     1 
ATOM 3402  O O     . ILE D  1 62  ? 23.924  -73.376 40.695  1.00 0.00 ? 68  ILE D O     1 
ATOM 3403  C CB    . ILE D  1 62  ? 22.038  -75.633 39.960  1.00 0.00 ? 68  ILE D CB    1 
ATOM 3404  C CG1   . ILE D  1 62  ? 21.519  -77.044 40.200  1.00 0.00 ? 68  ILE D CG1   1 
ATOM 3405  C CG2   . ILE D  1 62  ? 21.519  -75.112 38.647  1.00 0.00 ? 68  ILE D CG2   1 
ATOM 3406  C CD1   . ILE D  1 62  ? 21.968  -78.039 39.165  1.00 0.00 ? 68  ILE D CD1   1 
ATOM 3407  N N     . THR D  1 63  ? 24.636  -73.900 38.632  1.00 0.00 ? 69  THR D N     1 
ATOM 3408  C CA    . THR D  1 63  ? 25.178  -72.568 38.375  1.00 0.00 ? 69  THR D CA    1 
ATOM 3409  C C     . THR D  1 63  ? 24.676  -71.973 37.074  1.00 0.00 ? 69  THR D C     1 
ATOM 3410  O O     . THR D  1 63  ? 24.210  -72.684 36.185  1.00 0.00 ? 69  THR D O     1 
ATOM 3411  C CB    . THR D  1 63  ? 26.682  -72.609 38.301  1.00 0.00 ? 69  THR D CB    1 
ATOM 3412  O OG1   . THR D  1 63  ? 27.038  -73.422 37.190  1.00 0.00 ? 69  THR D OG1   1 
ATOM 3413  C CG2   . THR D  1 63  ? 27.291  -73.181 39.568  1.00 0.00 ? 69  THR D CG2   1 
ATOM 3414  N N     . GLY D  1 64  ? 24.842  -70.670 36.946  1.00 0.00 ? 70  GLY D N     1 
ATOM 3415  C CA    . GLY D  1 64  ? 24.516  -69.970 35.723  1.00 0.00 ? 70  GLY D CA    1 
ATOM 3416  C C     . GLY D  1 64  ? 23.050  -70.072 35.378  1.00 0.00 ? 70  GLY D C     1 
ATOM 3417  O O     . GLY D  1 64  ? 22.194  -70.193 36.254  1.00 0.00 ? 70  GLY D O     1 
ATOM 3418  N N     . PRO D  1 65  ? 22.759  -70.064 34.090  1.00 0.00 ? 71  PRO D N     1 
ATOM 3419  C CA    . PRO D  1 65  ? 21.447  -70.130 33.492  1.00 0.00 ? 71  PRO D CA    1 
ATOM 3420  C C     . PRO D  1 65  ? 20.723  -71.386 33.872  1.00 0.00 ? 71  PRO D C     1 
ATOM 3421  O O     . PRO D  1 65  ? 19.504  -71.451 33.768  1.00 0.00 ? 71  PRO D O     1 
ATOM 3422  C CB    . PRO D  1 65  ? 21.731  -70.028 32.015  1.00 0.00 ? 71  PRO D CB    1 
ATOM 3423  C CG    . PRO D  1 65  ? 22.942  -69.147 31.939  1.00 0.00 ? 71  PRO D CG    1 
ATOM 3424  C CD    . PRO D  1 65  ? 23.740  -69.465 33.168  1.00 0.00 ? 71  PRO D CD    1 
ATOM 3425  N N     . ASN D  1 66  ? 21.452  -72.387 34.338  1.00 0.00 ? 72  ASN D N     1 
ATOM 3426  C CA    . ASN D  1 66  ? 20.814  -73.593 34.765  1.00 0.00 ? 72  ASN D CA    1 
ATOM 3427  C C     . ASN D  1 66  ? 19.994  -73.322 35.996  1.00 0.00 ? 72  ASN D C     1 
ATOM 3428  O O     . ASN D  1 66  ? 18.940  -73.925 36.188  1.00 0.00 ? 72  ASN D O     1 
ATOM 3429  C CB    . ASN D  1 66  ? 21.828  -74.661 35.005  1.00 0.00 ? 72  ASN D CB    1 
ATOM 3430  C CG    . ASN D  1 66  ? 22.405  -75.155 33.726  1.00 0.00 ? 72  ASN D CG    1 
ATOM 3431  O OD1   . ASN D  1 66  ? 21.705  -75.238 32.715  1.00 0.00 ? 72  ASN D OD1   1 
ATOM 3432  N ND2   . ASN D  1 66  ? 23.674  -75.458 33.734  1.00 0.00 ? 72  ASN D ND2   1 
ATOM 3433  N N     . ARG D  1 67  ? 20.447  -72.377 36.814  1.00 0.00 ? 73  ARG D N     1 
ATOM 3434  C CA    . ARG D  1 67  ? 19.698  -71.998 37.983  1.00 0.00 ? 73  ARG D CA    1 
ATOM 3435  C C     . ARG D  1 67  ? 18.441  -71.349 37.539  1.00 0.00 ? 73  ARG D C     1 
ATOM 3436  O O     . ARG D  1 67  ? 17.367  -71.638 38.058  1.00 0.00 ? 73  ARG D O     1 
ATOM 3437  C CB    . ARG D  1 67  ? 20.467  -71.024 38.843  1.00 0.00 ? 73  ARG D CB    1 
ATOM 3438  C CG    . ARG D  1 67  ? 21.713  -71.578 39.468  1.00 0.00 ? 73  ARG D CG    1 
ATOM 3439  C CD    . ARG D  1 67  ? 22.441  -70.544 40.214  1.00 0.00 ? 73  ARG D CD    1 
ATOM 3440  N NE    . ARG D  1 67  ? 21.816  -70.227 41.485  1.00 0.00 ? 73  ARG D NE    1 
ATOM 3441  C CZ    . ARG D  1 67  ? 22.165  -70.791 42.658  1.00 0.00 ? 73  ARG D CZ    1 
ATOM 3442  N NH1   . ARG D  1 67  ? 23.097  -71.703 42.716  1.00 0.00 ? 73  ARG D NH1   1 
ATOM 3443  N NH2   . ARG D  1 67  ? 21.594  -70.424 43.781  1.00 0.00 ? 73  ARG D NH2   1 
ATOM 3444  N N     . ALA D  1 68  ? 18.569  -70.500 36.522  1.00 0.00 ? 74  ALA D N     1 
ATOM 3445  C CA    . ALA D  1 68  ? 17.436  -69.776 35.968  1.00 0.00 ? 74  ALA D CA    1 
ATOM 3446  C C     . ALA D  1 68  ? 16.368  -70.709 35.442  1.00 0.00 ? 74  ALA D C     1 
ATOM 3447  O O     . ALA D  1 68  ? 15.183  -70.411 35.550  1.00 0.00 ? 74  ALA D O     1 
ATOM 3448  C CB    . ALA D  1 68  ? 17.886  -68.850 34.876  1.00 0.00 ? 74  ALA D CB    1 
ATOM 3449  N N     . ILE D  1 69  ? 16.773  -71.853 34.902  1.00 0.00 ? 75  ILE D N     1 
ATOM 3450  C CA    . ILE D  1 69  ? 15.802  -72.835 34.453  1.00 0.00 ? 75  ILE D CA    1 
ATOM 3451  C C     . ILE D  1 69  ? 14.916  -73.249 35.590  1.00 0.00 ? 75  ILE D C     1 
ATOM 3452  O O     . ILE D  1 69  ? 13.688  -73.279 35.462  1.00 0.00 ? 75  ILE D O     1 
ATOM 3453  C CB    . ILE D  1 69  ? 16.474  -74.091 33.894  1.00 0.00 ? 75  ILE D CB    1 
ATOM 3454  C CG1   . ILE D  1 69  ? 17.189  -73.776 32.600  1.00 0.00 ? 75  ILE D CG1   1 
ATOM 3455  C CG2   . ILE D  1 69  ? 15.444  -75.185 33.690  1.00 0.00 ? 75  ILE D CG2   1 
ATOM 3456  C CD1   . ILE D  1 69  ? 18.094  -74.878 32.124  1.00 0.00 ? 75  ILE D CD1   1 
ATOM 3457  N N     . TYR D  1 70  ? 15.533  -73.558 36.710  1.00 0.00 ? 76  TYR D N     1 
ATOM 3458  C CA    . TYR D  1 70  ? 14.797  -74.024 37.856  1.00 0.00 ? 76  TYR D CA    1 
ATOM 3459  C C     . TYR D  1 70  ? 14.061  -72.897 38.545  1.00 0.00 ? 76  TYR D C     1 
ATOM 3460  O O     . TYR D  1 70  ? 12.997  -73.111 39.117  1.00 0.00 ? 76  TYR D O     1 
ATOM 3461  C CB    . TYR D  1 70  ? 15.727  -74.724 38.796  1.00 0.00 ? 76  TYR D CB    1 
ATOM 3462  C CG    . TYR D  1 70  ? 16.327  -75.938 38.164  1.00 0.00 ? 76  TYR D CG    1 
ATOM 3463  C CD1   . TYR D  1 70  ? 17.678  -75.982 37.927  1.00 0.00 ? 76  TYR D CD1   1 
ATOM 3464  C CD2   . TYR D  1 70  ? 15.519  -76.981 37.771  1.00 0.00 ? 76  TYR D CD2   1 
ATOM 3465  C CE1   . TYR D  1 70  ? 18.232  -77.070 37.298  1.00 0.00 ? 76  TYR D CE1   1 
ATOM 3466  C CE2   . TYR D  1 70  ? 16.066  -78.075 37.140  1.00 0.00 ? 76  TYR D CE2   1 
ATOM 3467  C CZ    . TYR D  1 70  ? 17.421  -78.114 36.900  1.00 0.00 ? 76  TYR D CZ    1 
ATOM 3468  O OH    . TYR D  1 70  ? 17.976  -79.189 36.256  1.00 0.00 ? 76  TYR D OH    1 
ATOM 3469  N N     . GLN D  1 71  ? 14.595  -71.684 38.454  1.00 0.00 ? 77  GLN D N     1 
ATOM 3470  C CA    . GLN D  1 71  ? 13.913  -70.538 39.012  1.00 0.00 ? 77  GLN D CA    1 
ATOM 3471  C C     . GLN D  1 71  ? 12.629  -70.296 38.271  1.00 0.00 ? 77  GLN D C     1 
ATOM 3472  O O     . GLN D  1 71  ? 11.594  -70.061 38.883  1.00 0.00 ? 77  GLN D O     1 
ATOM 3473  C CB    . GLN D  1 71  ? 14.790  -69.288 38.943  1.00 0.00 ? 77  GLN D CB    1 
ATOM 3474  C CG    . GLN D  1 71  ? 15.976  -69.294 39.884  1.00 0.00 ? 77  GLN D CG    1 
ATOM 3475  C CD    . GLN D  1 71  ? 15.545  -69.302 41.318  1.00 0.00 ? 77  GLN D CD    1 
ATOM 3476  O OE1   . GLN D  1 71  ? 14.361  -69.486 41.604  1.00 0.00 ? 77  GLN D OE1   1 
ATOM 3477  N NE2   . GLN D  1 71  ? 16.482  -69.091 42.237  1.00 0.00 ? 77  GLN D NE2   1 
ATOM 3478  N N     . GLY D  1 72  ? 12.678  -70.408 36.946  1.00 0.00 ? 78  GLY D N     1 
ATOM 3479  C CA    . GLY D  1 72  ? 11.492  -70.238 36.122  1.00 0.00 ? 78  GLY D CA    1 
ATOM 3480  C C     . GLY D  1 72  ? 10.450  -71.270 36.484  1.00 0.00 ? 78  GLY D C     1 
ATOM 3481  O O     . GLY D  1 72  ? 9.276   -70.946 36.664  1.00 0.00 ? 78  GLY D O     1 
ATOM 3482  N N     . PHE D  1 73  ? 10.889  -72.509 36.617  1.00 0.00 ? 79  PHE D N     1 
ATOM 3483  C CA    . PHE D  1 73  ? 10.018  -73.583 37.010  1.00 0.00 ? 79  PHE D CA    1 
ATOM 3484  C C     . PHE D  1 73  ? 9.361   -73.313 38.344  1.00 0.00 ? 79  PHE D C     1 
ATOM 3485  O O     . PHE D  1 73  ? 8.142   -73.384 38.460  1.00 0.00 ? 79  PHE D O     1 
ATOM 3486  C CB    . PHE D  1 73  ? 10.798  -74.874 37.074  1.00 0.00 ? 79  PHE D CB    1 
ATOM 3487  C CG    . PHE D  1 73  ? 10.047  -76.006 37.682  1.00 0.00 ? 79  PHE D CG    1 
ATOM 3488  C CD1   . PHE D  1 73  ? 9.065   -76.674 36.983  1.00 0.00 ? 79  PHE D CD1   1 
ATOM 3489  C CD2   . PHE D  1 73  ? 10.345  -76.420 38.961  1.00 0.00 ? 79  PHE D CD2   1 
ATOM 3490  C CE1   . PHE D  1 73  ? 8.398   -77.736 37.555  1.00 0.00 ? 79  PHE D CE1   1 
ATOM 3491  C CE2   . PHE D  1 73  ? 9.683   -77.473 39.536  1.00 0.00 ? 79  PHE D CE2   1 
ATOM 3492  C CZ    . PHE D  1 73  ? 8.707   -78.133 38.831  1.00 0.00 ? 79  PHE D CZ    1 
ATOM 3493  N N     . GLY D  1 74  ? 10.169  -72.999 39.348  1.00 0.00 ? 80  GLY D N     1 
ATOM 3494  C CA    . GLY D  1 74  ? 9.671   -72.759 40.691  1.00 0.00 ? 80  GLY D CA    1 
ATOM 3495  C C     . GLY D  1 74  ? 8.683   -71.622 40.729  1.00 0.00 ? 80  GLY D C     1 
ATOM 3496  O O     . GLY D  1 74  ? 7.622   -71.731 41.338  1.00 0.00 ? 80  GLY D O     1 
ATOM 3497  N N     . LEU D  1 75  ? 9.012   -70.538 40.066  1.00 0.00 ? 81  LEU D N     1 
ATOM 3498  C CA    . LEU D  1 75  ? 8.145   -69.392 40.037  1.00 0.00 ? 81  LEU D CA    1 
ATOM 3499  C C     . LEU D  1 75  ? 6.808   -69.730 39.416  1.00 0.00 ? 81  LEU D C     1 
ATOM 3500  O O     . LEU D  1 75  ? 5.766   -69.285 39.891  1.00 0.00 ? 81  LEU D O     1 
ATOM 3501  C CB    . LEU D  1 75  ? 8.810   -68.278 39.259  1.00 0.00 ? 81  LEU D CB    1 
ATOM 3502  C CG    . LEU D  1 75  ? 10.011  -67.637 39.932  1.00 0.00 ? 81  LEU D CG    1 
ATOM 3503  C CD1   . LEU D  1 75  ? 10.703  -66.719 38.942  1.00 0.00 ? 81  LEU D CD1   1 
ATOM 3504  C CD2   . LEU D  1 75  ? 9.539   -66.871 41.148  1.00 0.00 ? 81  LEU D CD2   1 
ATOM 3505  N N     . LYS D  1 76  ? 6.835   -70.542 38.372  1.00 0.00 ? 82  LYS D N     1 
ATOM 3506  C CA    . LYS D  1 76  ? 5.624   -70.949 37.700  1.00 0.00 ? 82  LYS D CA    1 
ATOM 3507  C C     . LYS D  1 76  ? 4.781   -71.846 38.591  1.00 0.00 ? 82  LYS D C     1 
ATOM 3508  O O     . LYS D  1 76  ? 3.556   -71.743 38.594  1.00 0.00 ? 82  LYS D O     1 
ATOM 3509  C CB    . LYS D  1 76  ? 5.970   -71.620 36.387  1.00 0.00 ? 82  LYS D CB    1 
ATOM 3510  C CG    . LYS D  1 76  ? 4.785   -71.962 35.515  1.00 0.00 ? 82  LYS D CG    1 
ATOM 3511  C CD    . LYS D  1 76  ? 5.246   -72.279 34.105  1.00 0.00 ? 82  LYS D CD    1 
ATOM 3512  C CE    . LYS D  1 76  ? 4.119   -72.825 33.262  1.00 0.00 ? 82  LYS D CE    1 
ATOM 3513  N NZ    . LYS D  1 76  ? 3.115   -71.799 32.937  1.00 0.00 ? 82  LYS D NZ    1 
ATOM 3514  N N     . VAL D  1 77  ? 5.435   -72.694 39.381  1.00 0.00 ? 83  VAL D N     1 
ATOM 3515  C CA    . VAL D  1 77  ? 4.722   -73.511 40.349  1.00 0.00 ? 83  VAL D CA    1 
ATOM 3516  C C     . VAL D  1 77  ? 3.984   -72.635 41.336  1.00 0.00 ? 83  VAL D C     1 
ATOM 3517  O O     . VAL D  1 77  ? 2.805   -72.852 41.615  1.00 0.00 ? 83  VAL D O     1 
ATOM 3518  C CB    . VAL D  1 77  ? 5.689   -74.437 41.120  1.00 0.00 ? 83  VAL D CB    1 
ATOM 3519  C CG1   . VAL D  1 77  ? 4.965   -75.097 42.276  1.00 0.00 ? 83  VAL D CG1   1 
ATOM 3520  C CG2   . VAL D  1 77  ? 6.254   -75.492 40.193  1.00 0.00 ? 83  VAL D CG2   1 
ATOM 3521  N N     . ALA D  1 78  ? 4.684   -71.634 41.857  1.00 0.00 ? 84  ALA D N     1 
ATOM 3522  C CA    . ALA D  1 78  ? 4.110   -70.713 42.815  1.00 0.00 ? 84  ALA D CA    1 
ATOM 3523  C C     . ALA D  1 78  ? 2.955   -69.930 42.207  1.00 0.00 ? 84  ALA D C     1 
ATOM 3524  O O     . ALA D  1 78  ? 1.946   -69.702 42.868  1.00 0.00 ? 84  ALA D O     1 
ATOM 3525  C CB    . ALA D  1 78  ? 5.178   -69.774 43.329  1.00 0.00 ? 84  ALA D CB    1 
ATOM 3526  N N     . ARG D  1 79  ? 3.097   -69.535 40.946  1.00 0.00 ? 85  ARG D N     1 
ATOM 3527  C CA    . ARG D  1 79  ? 2.021   -68.856 40.248  1.00 0.00 ? 85  ARG D CA    1 
ATOM 3528  C C     . ARG D  1 79  ? 0.747   -69.640 40.293  1.00 0.00 ? 85  ARG D C     1 
ATOM 3529  O O     . ARG D  1 79  ? -0.305  -69.113 40.662  1.00 0.00 ? 85  ARG D O     1 
ATOM 3530  C CB    . ARG D  1 79  ? 2.364   -68.627 38.809  1.00 0.00 ? 85  ARG D CB    1 
ATOM 3531  C CG    . ARG D  1 79  ? 1.210   -68.077 38.005  1.00 0.00 ? 85  ARG D CG    1 
ATOM 3532  C CD    . ARG D  1 79  ? 1.518   -68.009 36.569  1.00 0.00 ? 85  ARG D CD    1 
ATOM 3533  N NE    . ARG D  1 79  ? 0.327   -67.761 35.790  1.00 0.00 ? 85  ARG D NE    1 
ATOM 3534  C CZ    . ARG D  1 79  ? 0.216   -67.984 34.470  1.00 0.00 ? 85  ARG D CZ    1 
ATOM 3535  N NH1   . ARG D  1 79  ? 1.234   -68.440 33.780  1.00 0.00 ? 85  ARG D NH1   1 
ATOM 3536  N NH2   . ARG D  1 79  ? -0.929  -67.751 33.859  1.00 0.00 ? 85  ARG D NH2   1 
ATOM 3537  N N     . ALA D  1 80  ? 0.834   -70.899 39.896  1.00 0.00 ? 86  ALA D N     1 
ATOM 3538  C CA    . ALA D  1 80  ? -0.318  -71.770 39.878  1.00 0.00 ? 86  ALA D CA    1 
ATOM 3539  C C     . ALA D  1 80  ? -0.906  -71.901 41.258  1.00 0.00 ? 86  ALA D C     1 
ATOM 3540  O O     . ALA D  1 80  ? -2.121  -71.884 41.428  1.00 0.00 ? 86  ALA D O     1 
ATOM 3541  C CB    . ALA D  1 80  ? 0.067   -73.124 39.341  1.00 0.00 ? 86  ALA D CB    1 
ATOM 3542  N N     . LEU D  1 81  ? -0.049  -71.992 42.257  1.00 0.00 ? 87  LEU D N     1 
ATOM 3543  C CA    . LEU D  1 81  ? -0.516  -72.062 43.609  1.00 0.00 ? 87  LEU D CA    1 
ATOM 3544  C C     . LEU D  1 81  ? -1.389  -70.869 43.934  1.00 0.00 ? 87  LEU D C     1 
ATOM 3545  O O     . LEU D  1 81  ? -2.483  -71.030 44.460  1.00 0.00 ? 87  LEU D O     1 
ATOM 3546  C CB    . LEU D  1 81  ? 0.652   -72.145 44.573  1.00 0.00 ? 87  LEU D CB    1 
ATOM 3547  C CG    . LEU D  1 81  ? 0.283   -72.169 46.046  1.00 0.00 ? 87  LEU D CG    1 
ATOM 3548  C CD1   . LEU D  1 81  ? -0.578  -73.382 46.329  1.00 0.00 ? 87  LEU D CD1   1 
ATOM 3549  C CD2   . LEU D  1 81  ? 1.556   -72.204 46.874  1.00 0.00 ? 87  LEU D CD2   1 
ATOM 3550  N N     . ASN D  1 82  ? -0.939  -69.674 43.585  1.00 0.00 ? 88  ASN D N     1 
ATOM 3551  C CA    . ASN D  1 82  ? -1.732  -68.479 43.862  1.00 0.00 ? 88  ASN D CA    1 
ATOM 3552  C C     . ASN D  1 82  ? -3.068  -68.445 43.118  1.00 0.00 ? 88  ASN D C     1 
ATOM 3553  O O     . ASN D  1 82  ? -4.092  -68.087 43.696  1.00 0.00 ? 88  ASN D O     1 
ATOM 3554  C CB    . ASN D  1 82  ? -0.955  -67.224 43.533  1.00 0.00 ? 88  ASN D CB    1 
ATOM 3555  C CG    . ASN D  1 82  ? 0.090   -66.904 44.541  1.00 0.00 ? 88  ASN D CG    1 
ATOM 3556  O OD1   . ASN D  1 82  ? 0.129   -67.487 45.627  1.00 0.00 ? 88  ASN D OD1   1 
ATOM 3557  N ND2   . ASN D  1 82  ? 0.930   -65.964 44.218  1.00 0.00 ? 88  ASN D ND2   1 
ATOM 3558  N N     . ARG D  1 83  ? -3.054  -68.787 41.837  1.00 0.00 ? 89  ARG D N     1 
ATOM 3559  C CA    . ARG D  1 83  ? -4.257  -68.659 41.016  1.00 0.00 ? 89  ARG D CA    1 
ATOM 3560  C C     . ARG D  1 83  ? -5.208  -69.855 41.137  1.00 0.00 ? 89  ARG D C     1 
ATOM 3561  O O     . ARG D  1 83  ? -6.407  -69.720 40.912  1.00 0.00 ? 89  ARG D O     1 
ATOM 3562  C CB    . ARG D  1 83  ? -3.872  -68.441 39.560  1.00 0.00 ? 89  ARG D CB    1 
ATOM 3563  C CG    . ARG D  1 83  ? -3.204  -67.085 39.277  1.00 0.00 ? 89  ARG D CG    1 
ATOM 3564  C CD    . ARG D  1 83  ? -2.810  -66.942 37.845  1.00 0.00 ? 89  ARG D CD    1 
ATOM 3565  N NE    . ARG D  1 83  ? -2.035  -65.718 37.590  1.00 0.00 ? 89  ARG D NE    1 
ATOM 3566  C CZ    . ARG D  1 83  ? -2.550  -64.522 37.243  1.00 0.00 ? 89  ARG D CZ    1 
ATOM 3567  N NH1   . ARG D  1 83  ? -3.845  -64.372 37.104  1.00 0.00 ? 89  ARG D NH1   1 
ATOM 3568  N NH2   . ARG D  1 83  ? -1.746  -63.500 37.033  1.00 0.00 ? 89  ARG D NH2   1 
ATOM 3569  N N     . ILE D  1 84  ? -4.676  -71.013 41.502  1.00 0.00 ? 90  ILE D N     1 
ATOM 3570  C CA    . ILE D  1 84  ? -5.483  -72.223 41.672  1.00 0.00 ? 90  ILE D CA    1 
ATOM 3571  C C     . ILE D  1 84  ? -5.698  -72.564 43.138  1.00 0.00 ? 90  ILE D C     1 
ATOM 3572  O O     . ILE D  1 84  ? -6.813  -72.875 43.563  1.00 0.00 ? 90  ILE D O     1 
ATOM 3573  C CB    . ILE D  1 84  ? -4.833  -73.438 40.981  1.00 0.00 ? 90  ILE D CB    1 
ATOM 3574  C CG1   . ILE D  1 84  ? -4.766  -73.238 39.475  1.00 0.00 ? 90  ILE D CG1   1 
ATOM 3575  C CG2   . ILE D  1 84  ? -5.595  -74.695 41.309  1.00 0.00 ? 90  ILE D CG2   1 
ATOM 3576  C CD1   . ILE D  1 84  ? -3.966  -74.305 38.768  1.00 0.00 ? 90  ILE D CD1   1 
ATOM 3577  N N     . GLY D  1 85  ? -4.612  -72.589 43.891  1.00 0.00 ? 91  GLY D N     1 
ATOM 3578  C CA    . GLY D  1 85  ? -4.668  -73.003 45.285  1.00 0.00 ? 91  GLY D CA    1 
ATOM 3579  C C     . GLY D  1 85  ? -4.257  -74.450 45.384  1.00 0.00 ? 91  GLY D C     1 
ATOM 3580  O O     . GLY D  1 85  ? -4.275  -75.163 44.389  1.00 0.00 ? 91  GLY D O     1 
ATOM 3581  N N     . SER D  1 86  ? -3.877  -74.888 46.574  1.00 0.00 ? 92  SER D N     1 
ATOM 3582  C CA    . SER D  1 86  ? -3.408  -76.258 46.739  1.00 0.00 ? 92  SER D CA    1 
ATOM 3583  C C     . SER D  1 86  ? -4.532  -77.249 46.569  1.00 0.00 ? 92  SER D C     1 
ATOM 3584  O O     . SER D  1 86  ? -5.705  -76.901 46.705  1.00 0.00 ? 92  SER D O     1 
ATOM 3585  C CB    . SER D  1 86  ? -2.780  -76.442 48.093  1.00 0.00 ? 92  SER D CB    1 
ATOM 3586  O OG    . SER D  1 86  ? -3.746  -76.365 49.102  1.00 0.00 ? 92  SER D OG    1 
ATOM 3587  N N     . GLY D  1 87  ? -4.171  -78.496 46.299  1.00 0.00 ? 93  GLY D N     1 
ATOM 3588  C CA    . GLY D  1 87  ? -5.150  -79.546 46.097  1.00 0.00 ? 93  GLY D CA    1 
ATOM 3589  C C     . GLY D  1 87  ? -5.064  -80.106 44.686  1.00 0.00 ? 93  GLY D C     1 
ATOM 3590  O O     . GLY D  1 87  ? -4.214  -79.691 43.900  1.00 0.00 ? 93  GLY D O     1 
ATOM 3591  N N     . PRO D  1 88  ? -5.940  -81.057 44.386  1.00 0.00 ? 94  PRO D N     1 
ATOM 3592  C CA    . PRO D  1 88  ? -6.085  -81.792 43.115  1.00 0.00 ? 94  PRO D CA    1 
ATOM 3593  C C     . PRO D  1 88  ? -5.603  -81.013 41.896  1.00 0.00 ? 94  PRO D C     1 
ATOM 3594  O O     . PRO D  1 88  ? -4.676  -81.444 41.211  1.00 0.00 ? 94  PRO D O     1 
ATOM 3595  C CB    . PRO D  1 88  ? -7.597  -82.035 43.024  1.00 0.00 ? 94  PRO D CB    1 
ATOM 3596  C CG    . PRO D  1 88  ? -8.043  -82.035 44.425  1.00 0.00 ? 94  PRO D CG    1 
ATOM 3597  C CD    . PRO D  1 88  ? -7.249  -80.936 45.041  1.00 0.00 ? 94  PRO D CD    1 
ATOM 3598  N N     . ALA D  1 89  ? -6.256  -79.891 41.605  1.00 0.00 ? 95  ALA D N     1 
ATOM 3599  C CA    . ALA D  1 89  ? -5.952  -79.124 40.408  1.00 0.00 ? 95  ALA D CA    1 
ATOM 3600  C C     . ALA D  1 89  ? -4.509  -78.690 40.356  1.00 0.00 ? 95  ALA D C     1 
ATOM 3601  O O     . ALA D  1 89  ? -3.912  -78.662 39.280  1.00 0.00 ? 95  ALA D O     1 
ATOM 3602  C CB    . ALA D  1 89  ? -6.854  -77.918 40.329  1.00 0.00 ? 95  ALA D CB    1 
ATOM 3603  N N     . LEU D  1 90  ? -3.941  -78.344 41.501  1.00 0.00 ? 96  LEU D N     1 
ATOM 3604  C CA    . LEU D  1 90  ? -2.564  -77.916 41.533  1.00 0.00 ? 96  LEU D CA    1 
ATOM 3605  C C     . LEU D  1 90  ? -1.675  -79.049 41.172  1.00 0.00 ? 96  LEU D C     1 
ATOM 3606  O O     . LEU D  1 90  ? -0.720  -78.883 40.426  1.00 0.00 ? 96  LEU D O     1 
ATOM 3607  C CB    . LEU D  1 90  ? -2.170  -77.400 42.891  1.00 0.00 ? 96  LEU D CB    1 
ATOM 3608  C CG    . LEU D  1 90  ? -0.745  -76.878 42.966  1.00 0.00 ? 96  LEU D CG    1 
ATOM 3609  C CD1   . LEU D  1 90  ? -0.592  -75.714 42.000  1.00 0.00 ? 96  LEU D CD1   1 
ATOM 3610  C CD2   . LEU D  1 90  ? -0.428  -76.460 44.378  1.00 0.00 ? 96  LEU D CD2   1 
ATOM 3611  N N     . VAL D  1 91  ? -1.978  -80.215 41.714  1.00 0.00 ? 97  VAL D N     1 
ATOM 3612  C CA    . VAL D  1 91  ? -1.206  -81.398 41.411  1.00 0.00 ? 97  VAL D CA    1 
ATOM 3613  C C     . VAL D  1 91  ? -1.253  -81.694 39.927  1.00 0.00 ? 97  VAL D C     1 
ATOM 3614  O O     . VAL D  1 91  ? -0.225  -81.987 39.316  1.00 0.00 ? 97  VAL D O     1 
ATOM 3615  C CB    . VAL D  1 91  ? -1.722  -82.600 42.205  1.00 0.00 ? 97  VAL D CB    1 
ATOM 3616  C CG1   . VAL D  1 91  ? -1.056  -83.876 41.721  1.00 0.00 ? 97  VAL D CG1   1 
ATOM 3617  C CG2   . VAL D  1 91  ? -1.444  -82.377 43.679  1.00 0.00 ? 97  VAL D CG2   1 
ATOM 3618  N N     . ASN D  1 92  ? -2.444  -81.581 39.337  1.00 0.00 ? 98  ASN D N     1 
ATOM 3619  C CA    . ASN D  1 92  ? -2.603  -81.788 37.909  1.00 0.00 ? 98  ASN D CA    1 
ATOM 3620  C C     . ASN D  1 92  ? -1.703  -80.841 37.141  1.00 0.00 ? 98  ASN D C     1 
ATOM 3621  O O     . ASN D  1 92  ? -0.993  -81.252 36.216  1.00 0.00 ? 98  ASN D O     1 
ATOM 3622  C CB    . ASN D  1 92  ? -4.052  -81.589 37.503  1.00 0.00 ? 98  ASN D CB    1 
ATOM 3623  C CG    . ASN D  1 92  ? -4.916  -82.708 37.973  1.00 0.00 ? 98  ASN D CG    1 
ATOM 3624  O OD1   . ASN D  1 92  ? -4.395  -83.765 38.345  1.00 0.00 ? 98  ASN D OD1   1 
ATOM 3625  N ND2   . ASN D  1 92  ? -6.216  -82.522 37.965  1.00 0.00 ? 98  ASN D ND2   1 
ATOM 3626  N N     . MET D  1 93  ? -1.689  -79.587 37.569  1.00 0.00 ? 99  MET D N     1 
ATOM 3627  C CA    . MET D  1 93  ? -0.854  -78.586 36.966  1.00 0.00 ? 99  MET D CA    1 
ATOM 3628  C C     . MET D  1 93  ? 0.604   -78.924 37.061  1.00 0.00 ? 99  MET D C     1 
ATOM 3629  O O     . MET D  1 93  ? 1.320   -78.877 36.061  1.00 0.00 ? 99  MET D O     1 
ATOM 3630  C CB    . MET D  1 93  ? -1.096  -77.249 37.618  1.00 0.00 ? 99  MET D CB    1 
ATOM 3631  C CG    . MET D  1 93  ? -0.189  -76.167 37.109  1.00 0.00 ? 99  MET D CG    1 
ATOM 3632  S SD    . MET D  1 93  ? -0.495  -75.769 35.409  1.00 0.00 ? 99  MET D SD    1 
ATOM 3633  C CE    . MET D  1 93  ? -1.941  -74.734 35.605  1.00 0.00 ? 99  MET D CE    1 
ATOM 3634  N N     . ILE D  1 94  ? 1.053   -79.243 38.264  1.00 0.00 ? 100 ILE D N     1 
ATOM 3635  C CA    . ILE D  1 94  ? 2.454   -79.485 38.497  1.00 0.00 ? 100 ILE D CA    1 
ATOM 3636  C C     . ILE D  1 94  ? 2.945   -80.657 37.712  1.00 0.00 ? 100 ILE D C     1 
ATOM 3637  O O     . ILE D  1 94  ? 4.053   -80.626 37.194  1.00 0.00 ? 100 ILE D O     1 
ATOM 3638  C CB    . ILE D  1 94  ? 2.753   -79.705 39.968  1.00 0.00 ? 100 ILE D CB    1 
ATOM 3639  C CG1   . ILE D  1 94  ? 2.516   -78.420 40.750  1.00 0.00 ? 100 ILE D CG1   1 
ATOM 3640  C CG2   . ILE D  1 94  ? 4.200   -80.132 40.121  1.00 0.00 ? 100 ILE D CG2   1 
ATOM 3641  C CD1   . ILE D  1 94  ? 2.526   -78.618 42.244  1.00 0.00 ? 100 ILE D CD1   1 
ATOM 3642  N N     . ASN D  1 95  ? 2.139   -81.709 37.626  1.00 0.00 ? 101 ASN D N     1 
ATOM 3643  C CA    . ASN D  1 95  ? 2.535   -82.882 36.866  1.00 0.00 ? 101 ASN D CA    1 
ATOM 3644  C C     . ASN D  1 95  ? 2.862   -82.519 35.433  1.00 0.00 ? 101 ASN D C     1 
ATOM 3645  O O     . ASN D  1 95  ? 3.894   -82.940 34.901  1.00 0.00 ? 101 ASN D O     1 
ATOM 3646  C CB    . ASN D  1 95  ? 1.450   -83.937 36.896  1.00 0.00 ? 101 ASN D CB    1 
ATOM 3647  C CG    . ASN D  1 95  ? 1.359   -84.620 38.215  1.00 0.00 ? 101 ASN D CG    1 
ATOM 3648  O OD1   . ASN D  1 95  ? 2.247   -84.446 39.056  1.00 0.00 ? 101 ASN D OD1   1 
ATOM 3649  N ND2   . ASN D  1 95  ? 0.323   -85.404 38.410  1.00 0.00 ? 101 ASN D ND2   1 
ATOM 3650  N N     . GLY D  1 96  ? 1.999   -81.711 34.812  1.00 0.00 ? 102 GLY D N     1 
ATOM 3651  C CA    . GLY D  1 96  ? 2.225   -81.292 33.441  1.00 0.00 ? 102 GLY D CA    1 
ATOM 3652  C C     . GLY D  1 96  ? 3.391   -80.349 33.335  1.00 0.00 ? 102 GLY D C     1 
ATOM 3653  O O     . GLY D  1 96  ? 4.197   -80.456 32.414  1.00 0.00 ? 102 GLY D O     1 
ATOM 3654  N N     . LEU D  1 97  ? 3.494   -79.440 34.287  1.00 0.00 ? 103 LEU D N     1 
ATOM 3655  C CA    . LEU D  1 97  ? 4.572   -78.482 34.313  1.00 0.00 ? 103 LEU D CA    1 
ATOM 3656  C C     . LEU D  1 97  ? 5.924   -79.137 34.450  1.00 0.00 ? 103 LEU D C     1 
ATOM 3657  O O     . LEU D  1 97  ? 6.877   -78.764 33.769  1.00 0.00 ? 103 LEU D O     1 
ATOM 3658  C CB    . LEU D  1 97  ? 4.365   -77.505 35.436  1.00 0.00 ? 103 LEU D CB    1 
ATOM 3659  C CG    . LEU D  1 97  ? 5.485   -76.518 35.600  1.00 0.00 ? 103 LEU D CG    1 
ATOM 3660  C CD1   . LEU D  1 97  ? 5.668   -75.802 34.302  1.00 0.00 ? 103 LEU D CD1   1 
ATOM 3661  C CD2   . LEU D  1 97  ? 5.145   -75.553 36.715  1.00 0.00 ? 103 LEU D CD2   1 
ATOM 3662  N N     . LYS D  1 98  ? 6.025   -80.071 35.366  1.00 0.00 ? 104 LYS D N     1 
ATOM 3663  C CA    . LYS D  1 98  ? 7.247   -80.793 35.563  1.00 0.00 ? 104 LYS D CA    1 
ATOM 3664  C C     . LYS D  1 98  ? 7.680   -81.478 34.290  1.00 0.00 ? 104 LYS D C     1 
ATOM 3665  O O     . LYS D  1 98  ? 8.800   -81.277 33.826  1.00 0.00 ? 104 LYS D O     1 
ATOM 3666  C CB    . LYS D  1 98  ? 7.090   -81.800 36.680  1.00 0.00 ? 104 LYS D CB    1 
ATOM 3667  C CG    . LYS D  1 98  ? 8.326   -82.634 36.926  1.00 0.00 ? 104 LYS D CG    1 
ATOM 3668  C CD    . LYS D  1 98  ? 8.120   -83.599 38.075  1.00 0.00 ? 104 LYS D CD    1 
ATOM 3669  C CE    . LYS D  1 98  ? 9.264   -84.595 38.163  1.00 0.00 ? 104 LYS D CE    1 
ATOM 3670  N NZ    . LYS D  1 98  ? 9.084   -85.541 39.291  1.00 0.00 ? 104 LYS D NZ    1 
ATOM 3671  N N     . GLY D  1 99  ? 6.782   -82.275 33.705  1.00 0.00 ? 105 GLY D N     1 
ATOM 3672  C CA    . GLY D  1 99  ? 7.086   -82.994 32.472  1.00 0.00 ? 105 GLY D CA    1 
ATOM 3673  C C     . GLY D  1 99  ? 7.508   -82.034 31.378  1.00 0.00 ? 105 GLY D C     1 
ATOM 3674  O O     . GLY D  1 99  ? 8.460   -82.297 30.638  1.00 0.00 ? 105 GLY D O     1 
ATOM 3675  N N     . TYR D  1 100 ? 6.805   -80.909 31.300  1.00 0.00 ? 106 TYR D N     1 
ATOM 3676  C CA    . TYR D  1 100 ? 7.104   -79.856 30.357  1.00 0.00 ? 106 TYR D CA    1 
ATOM 3677  C C     . TYR D  1 100 ? 8.543   -79.434 30.429  1.00 0.00 ? 106 TYR D C     1 
ATOM 3678  O O     . TYR D  1 100 ? 9.248   -79.484 29.436  1.00 0.00 ? 106 TYR D O     1 
ATOM 3679  C CB    . TYR D  1 100 ? 6.182   -78.680 30.625  1.00 0.00 ? 106 TYR D CB    1 
ATOM 3680  C CG    . TYR D  1 100 ? 6.508   -77.408 29.896  1.00 0.00 ? 106 TYR D CG    1 
ATOM 3681  C CD1   . TYR D  1 100 ? 6.351   -77.306 28.533  1.00 0.00 ? 106 TYR D CD1   1 
ATOM 3682  C CD2   . TYR D  1 100 ? 6.924   -76.315 30.623  1.00 0.00 ? 106 TYR D CD2   1 
ATOM 3683  C CE1   . TYR D  1 100 ? 6.629   -76.115 27.896  1.00 0.00 ? 106 TYR D CE1   1 
ATOM 3684  C CE2   . TYR D  1 100 ? 7.195   -75.128 29.997  1.00 0.00 ? 106 TYR D CE2   1 
ATOM 3685  C CZ    . TYR D  1 100 ? 7.053   -75.024 28.639  1.00 0.00 ? 106 TYR D CZ    1 
ATOM 3686  O OH    . TYR D  1 100 ? 7.329   -73.831 28.015  1.00 0.00 ? 106 TYR D OH    1 
ATOM 3687  N N     . TYR D  1 101 ? 9.000   -79.055 31.607  1.00 0.00 ? 107 TYR D N     1 
ATOM 3688  C CA    . TYR D  1 101 ? 10.382  -78.639 31.765  1.00 0.00 ? 107 TYR D CA    1 
ATOM 3689  C C     . TYR D  1 101 ? 11.382  -79.745 31.525  1.00 0.00 ? 107 TYR D C     1 
ATOM 3690  O O     . TYR D  1 101 ? 12.435  -79.510 30.925  1.00 0.00 ? 107 TYR D O     1 
ATOM 3691  C CB    . TYR D  1 101 ? 10.599  -78.041 33.136  1.00 0.00 ? 107 TYR D CB    1 
ATOM 3692  C CG    . TYR D  1 101 ? 10.454  -76.558 33.152  1.00 0.00 ? 107 TYR D CG    1 
ATOM 3693  C CD1   . TYR D  1 101 ? 9.226   -75.969 33.331  1.00 0.00 ? 107 TYR D CD1   1 
ATOM 3694  C CD2   . TYR D  1 101 ? 11.581  -75.782 32.991  1.00 0.00 ? 107 TYR D CD2   1 
ATOM 3695  C CE1   . TYR D  1 101 ? 9.122   -74.595 33.335  1.00 0.00 ? 107 TYR D CE1   1 
ATOM 3696  C CE2   . TYR D  1 101 ? 11.480  -74.413 32.995  1.00 0.00 ? 107 TYR D CE2   1 
ATOM 3697  C CZ    . TYR D  1 101 ? 10.259  -73.822 33.165  1.00 0.00 ? 107 TYR D CZ    1 
ATOM 3698  O OH    . TYR D  1 101 ? 10.164  -72.455 33.168  1.00 0.00 ? 107 TYR D OH    1 
ATOM 3699  N N     . ILE D  1 102 ? 11.053  -80.955 31.938  1.00 0.00 ? 108 ILE D N     1 
ATOM 3700  C CA    . ILE D  1 102 ? 11.971  -82.053 31.768  1.00 0.00 ? 108 ILE D CA    1 
ATOM 3701  C C     . ILE D  1 102 ? 12.298  -82.286 30.326  1.00 0.00 ? 108 ILE D C     1 
ATOM 3702  O O     . ILE D  1 102 ? 13.455  -82.463 29.970  1.00 0.00 ? 108 ILE D O     1 
ATOM 3703  C CB    . ILE D  1 102 ? 11.410  -83.349 32.337  1.00 0.00 ? 108 ILE D CB    1 
ATOM 3704  C CG1   . ILE D  1 102 ? 11.321  -83.274 33.840  1.00 0.00 ? 108 ILE D CG1   1 
ATOM 3705  C CG2   . ILE D  1 102 ? 12.290  -84.510 31.922  1.00 0.00 ? 108 ILE D CG2   1 
ATOM 3706  C CD1   . ILE D  1 102 ? 10.522  -84.393 34.453  1.00 0.00 ? 108 ILE D CD1   1 
ATOM 3707  N N     . SER D  1 103 ? 11.284  -82.326 29.489  1.00 0.00 ? 109 SER D N     1 
ATOM 3708  C CA    . SER D  1 103 ? 11.502  -82.655 28.100  1.00 0.00 ? 109 SER D CA    1 
ATOM 3709  C C     . SER D  1 103 ? 11.676  -81.447 27.196  1.00 0.00 ? 109 SER D C     1 
ATOM 3710  O O     . SER D  1 103 ? 12.369  -81.530 26.184  1.00 0.00 ? 109 SER D O     1 
ATOM 3711  C CB    . SER D  1 103 ? 10.362  -83.494 27.613  1.00 0.00 ? 109 SER D CB    1 
ATOM 3712  O OG    . SER D  1 103 ? 9.164   -82.788 27.694  1.00 0.00 ? 109 SER D OG    1 
ATOM 3713  N N     . ALA D  1 104 ? 11.067  -80.325 27.546  1.00 0.00 ? 110 ALA D N     1 
ATOM 3714  C CA    . ALA D  1 104 ? 11.198  -79.143 26.708  1.00 0.00 ? 110 ALA D CA    1 
ATOM 3715  C C     . ALA D  1 104 ? 12.528  -78.489 26.887  1.00 0.00 ? 110 ALA D C     1 
ATOM 3716  O O     . ALA D  1 104 ? 13.104  -78.007 25.918  1.00 0.00 ? 110 ALA D O     1 
ATOM 3717  C CB    . ALA D  1 104 ? 10.101  -78.127 26.996  1.00 0.00 ? 110 ALA D CB    1 
ATOM 3718  N N     . PHE D  1 105 ? 13.018  -78.443 28.132  1.00 0.00 ? 111 PHE D N     1 
ATOM 3719  C CA    . PHE D  1 105 ? 14.251  -77.740 28.429  1.00 0.00 ? 111 PHE D CA    1 
ATOM 3720  C C     . PHE D  1 105 ? 15.312  -78.627 29.008  1.00 0.00 ? 111 PHE D C     1 
ATOM 3721  O O     . PHE D  1 105 ? 16.345  -78.139 29.461  1.00 0.00 ? 111 PHE D O     1 
ATOM 3722  C CB    . PHE D  1 105 ? 13.972  -76.619 29.395  1.00 0.00 ? 111 PHE D CB    1 
ATOM 3723  C CG    . PHE D  1 105 ? 12.981  -75.664 28.863  1.00 0.00 ? 111 PHE D CG    1 
ATOM 3724  C CD1   . PHE D  1 105 ? 11.728  -75.572 29.424  1.00 0.00 ? 111 PHE D CD1   1 
ATOM 3725  C CD2   . PHE D  1 105 ? 13.282  -74.883 27.774  1.00 0.00 ? 111 PHE D CD2   1 
ATOM 3726  C CE1   . PHE D  1 105 ? 10.795  -74.708 28.914  1.00 0.00 ? 111 PHE D CE1   1 
ATOM 3727  C CE2   . PHE D  1 105 ? 12.355  -74.021 27.256  1.00 0.00 ? 111 PHE D CE2   1 
ATOM 3728  C CZ    . PHE D  1 105 ? 11.107  -73.930 27.828  1.00 0.00 ? 111 PHE D CZ    1 
ATOM 3729  N N     . ASN D  1 106 ? 15.063  -79.927 29.020  1.00 0.00 ? 112 ASN D N     1 
ATOM 3730  C CA    . ASN D  1 106 ? 16.019  -80.876 29.571  1.00 0.00 ? 112 ASN D CA    1 
ATOM 3731  C C     . ASN D  1 106 ? 16.311  -80.590 31.031  1.00 0.00 ? 112 ASN D C     1 
ATOM 3732  O O     . ASN D  1 106 ? 17.451  -80.724 31.478  1.00 0.00 ? 112 ASN D O     1 
ATOM 3733  C CB    . ASN D  1 106 ? 17.297  -80.885 28.770  1.00 0.00 ? 112 ASN D CB    1 
ATOM 3734  C CG    . ASN D  1 106 ? 17.071  -81.338 27.367  1.00 0.00 ? 112 ASN D CG    1 
ATOM 3735  O OD1   . ASN D  1 106 ? 16.220  -82.196 27.114  1.00 0.00 ? 112 ASN D OD1   1 
ATOM 3736  N ND2   . ASN D  1 106 ? 17.815  -80.788 26.447  1.00 0.00 ? 112 ASN D ND2   1 
ATOM 3737  N N     . ALA D  1 107 ? 15.289  -80.190 31.780  1.00 0.00 ? 113 ALA D N     1 
ATOM 3738  C CA    . ALA D  1 107 ? 15.466  -79.936 33.193  1.00 0.00 ? 113 ALA D CA    1 
ATOM 3739  C C     . ALA D  1 107 ? 15.588  -81.256 33.932  1.00 0.00 ? 113 ALA D C     1 
ATOM 3740  O O     . ALA D  1 107 ? 14.964  -82.244 33.555  1.00 0.00 ? 113 ALA D O     1 
ATOM 3741  C CB    . ALA D  1 107 ? 14.322  -79.118 33.729  1.00 0.00 ? 113 ALA D CB    1 
ATOM 3742  N N     . ASN D  1 108 ? 16.413  -81.276 34.971  1.00 0.00 ? 114 ASN D N     1 
ATOM 3743  C CA    . ASN D  1 108 ? 16.683  -82.499 35.711  1.00 0.00 ? 114 ASN D CA    1 
ATOM 3744  C C     . ASN D  1 108 ? 15.634  -82.776 36.793  1.00 0.00 ? 114 ASN D C     1 
ATOM 3745  O O     . ASN D  1 108 ? 15.654  -82.128 37.838  1.00 0.00 ? 114 ASN D O     1 
ATOM 3746  C CB    . ASN D  1 108 ? 18.048  -82.438 36.334  1.00 0.00 ? 114 ASN D CB    1 
ATOM 3747  C CG    . ASN D  1 108 ? 18.390  -83.694 37.057  1.00 0.00 ? 114 ASN D CG    1 
ATOM 3748  O OD1   . ASN D  1 108 ? 17.511  -84.379 37.585  1.00 0.00 ? 114 ASN D OD1   1 
ATOM 3749  N ND2   . ASN D  1 108 ? 19.654  -84.017 37.090  1.00 0.00 ? 114 ASN D ND2   1 
ATOM 3750  N N     . PRO D  1 109 ? 14.728  -83.750 36.553  1.00 0.00 ? 115 PRO D N     1 
ATOM 3751  C CA    . PRO D  1 109 ? 13.682  -84.244 37.471  1.00 0.00 ? 115 PRO D CA    1 
ATOM 3752  C C     . PRO D  1 109 ? 14.058  -84.131 38.941  1.00 0.00 ? 115 PRO D C     1 
ATOM 3753  O O     . PRO D  1 109 ? 13.235  -83.734 39.760  1.00 0.00 ? 115 PRO D O     1 
ATOM 3754  C CB    . PRO D  1 109 ? 13.554  -85.720 37.096  1.00 0.00 ? 115 PRO D CB    1 
ATOM 3755  C CG    . PRO D  1 109 ? 13.960  -85.774 35.687  1.00 0.00 ? 115 PRO D CG    1 
ATOM 3756  C CD    . PRO D  1 109 ? 15.103  -84.823 35.609  1.00 0.00 ? 115 PRO D CD    1 
ATOM 3757  N N     . GLN D  1 110 ? 15.283  -84.510 39.279  1.00 0.00 ? 116 GLN D N     1 
ATOM 3758  C CA    . GLN D  1 110 ? 15.728  -84.494 40.660  1.00 0.00 ? 116 GLN D CA    1 
ATOM 3759  C C     . GLN D  1 110 ? 15.705  -83.114 41.251  1.00 0.00 ? 116 GLN D C     1 
ATOM 3760  O O     . GLN D  1 110 ? 15.224  -82.910 42.368  1.00 0.00 ? 116 GLN D O     1 
ATOM 3761  C CB    . GLN D  1 110 ? 17.129  -85.059 40.768  1.00 0.00 ? 116 GLN D CB    1 
ATOM 3762  C CG    . GLN D  1 110 ? 17.669  -85.053 42.172  1.00 0.00 ? 116 GLN D CG    1 
ATOM 3763  C CD    . GLN D  1 110 ? 16.851  -85.912 43.087  1.00 0.00 ? 116 GLN D CD    1 
ATOM 3764  O OE1   . GLN D  1 110 ? 16.386  -86.982 42.688  1.00 0.00 ? 116 GLN D OE1   1 
ATOM 3765  N NE2   . GLN D  1 110 ? 16.661  -85.458 44.322  1.00 0.00 ? 116 GLN D NE2   1 
ATOM 3766  N N     . VAL D  1 111 ? 16.228  -82.161 40.520  1.00 0.00 ? 117 VAL D N     1 
ATOM 3767  C CA    . VAL D  1 111 ? 16.263  -80.823 41.008  1.00 0.00 ? 117 VAL D CA    1 
ATOM 3768  C C     . VAL D  1 111 ? 14.877  -80.250 40.981  1.00 0.00 ? 117 VAL D C     1 
ATOM 3769  O O     . VAL D  1 111 ? 14.493  -79.514 41.881  1.00 0.00 ? 117 VAL D O     1 
ATOM 3770  C CB    . VAL D  1 111 ? 17.203  -79.962 40.188  1.00 0.00 ? 117 VAL D CB    1 
ATOM 3771  C CG1   . VAL D  1 111 ? 17.124  -78.527 40.667  1.00 0.00 ? 117 VAL D CG1   1 
ATOM 3772  C CG2   . VAL D  1 111 ? 18.614  -80.494 40.302  1.00 0.00 ? 117 VAL D CG2   1 
ATOM 3773  N N     . LEU D  1 112 ? 14.110  -80.606 39.954  1.00 0.00 ? 118 LEU D N     1 
ATOM 3774  C CA    . LEU D  1 112 ? 12.748  -80.120 39.823  1.00 0.00 ? 118 LEU D CA    1 
ATOM 3775  C C     . LEU D  1 112 ? 11.927  -80.520 41.017  1.00 0.00 ? 118 LEU D C     1 
ATOM 3776  O O     . LEU D  1 112 ? 11.139  -79.728 41.533  1.00 0.00 ? 118 LEU D O     1 
ATOM 3777  C CB    . LEU D  1 112 ? 12.102  -80.682 38.570  1.00 0.00 ? 118 LEU D CB    1 
ATOM 3778  C CG    . LEU D  1 112 ? 12.657  -80.176 37.255  1.00 0.00 ? 118 LEU D CG    1 
ATOM 3779  C CD1   . LEU D  1 112 ? 12.045  -80.963 36.135  1.00 0.00 ? 118 LEU D CD1   1 
ATOM 3780  C CD2   . LEU D  1 112 ? 12.336  -78.714 37.106  1.00 0.00 ? 118 LEU D CD2   1 
ATOM 3781  N N     . ASP D  1 113 ? 12.134  -81.739 41.482  1.00 0.00 ? 119 ASP D N     1 
ATOM 3782  C CA    . ASP D  1 113 ? 11.450  -82.216 42.651  1.00 0.00 ? 119 ASP D CA    1 
ATOM 3783  C C     . ASP D  1 113 ? 11.868  -81.452 43.859  1.00 0.00 ? 119 ASP D C     1 
ATOM 3784  O O     . ASP D  1 113 ? 11.032  -81.092 44.679  1.00 0.00 ? 119 ASP D O     1 
ATOM 3785  C CB    . ASP D  1 113 ? 11.706  -83.684 42.848  1.00 0.00 ? 119 ASP D CB    1 
ATOM 3786  C CG    . ASP D  1 113 ? 10.950  -84.504 41.843  1.00 0.00 ? 119 ASP D CG    1 
ATOM 3787  O OD1   . ASP D  1 113 ? 9.988   -84.000 41.316  1.00 0.00 ? 119 ASP D OD1   1 
ATOM 3788  O OD2   . ASP D  1 113 ? 11.334  -85.618 41.589  1.00 0.00 ? 119 ASP D OD2   1 
ATOM 3789  N N     . ALA D  1 114 ? 13.159  -81.154 43.956  1.00 0.00 ? 120 ALA D N     1 
ATOM 3790  C CA    . ALA D  1 114 ? 13.659  -80.377 45.067  1.00 0.00 ? 120 ALA D CA    1 
ATOM 3791  C C     . ALA D  1 114 ? 12.984  -79.025 45.129  1.00 0.00 ? 120 ALA D C     1 
ATOM 3792  O O     . ALA D  1 114 ? 12.607  -78.570 46.202  1.00 0.00 ? 120 ALA D O     1 
ATOM 3793  C CB    . ALA D  1 114 ? 15.154  -80.210 44.963  1.00 0.00 ? 120 ALA D CB    1 
ATOM 3794  N N     . VAL D  1 115 ? 12.789  -78.398 43.972  1.00 0.00 ? 121 VAL D N     1 
ATOM 3795  C CA    . VAL D  1 115 ? 12.121  -77.109 43.924  1.00 0.00 ? 121 VAL D CA    1 
ATOM 3796  C C     . VAL D  1 115 ? 10.700  -77.219 44.432  1.00 0.00 ? 121 VAL D C     1 
ATOM 3797  O O     . VAL D  1 115 ? 10.269  -76.416 45.260  1.00 0.00 ? 121 VAL D O     1 
ATOM 3798  C CB    . VAL D  1 115 ? 12.104  -76.552 42.503  1.00 0.00 ? 121 VAL D CB    1 
ATOM 3799  C CG1   . VAL D  1 115 ? 11.228  -75.323 42.452  1.00 0.00 ? 121 VAL D CG1   1 
ATOM 3800  C CG2   . VAL D  1 115 ? 13.518  -76.215 42.059  1.00 0.00 ? 121 VAL D CG2   1 
ATOM 3801  N N     . VAL D  1 116 ? 9.986   -78.239 43.976  1.00 0.00 ? 122 VAL D N     1 
ATOM 3802  C CA    . VAL D  1 116 ? 8.622   -78.470 44.425  1.00 0.00 ? 122 VAL D CA    1 
ATOM 3803  C C     . VAL D  1 116 ? 8.584   -78.748 45.924  1.00 0.00 ? 122 VAL D C     1 
ATOM 3804  O O     . VAL D  1 116 ? 7.688   -78.287 46.630  1.00 0.00 ? 122 VAL D O     1 
ATOM 3805  C CB    . VAL D  1 116 ? 7.994   -79.642 43.660  1.00 0.00 ? 122 VAL D CB    1 
ATOM 3806  C CG1   . VAL D  1 116 ? 6.660   -80.004 44.256  1.00 0.00 ? 122 VAL D CG1   1 
ATOM 3807  C CG2   . VAL D  1 116 ? 7.828   -79.268 42.210  1.00 0.00 ? 122 VAL D CG2   1 
ATOM 3808  N N     . ASN D  1 117 ? 9.604   -79.445 46.417  1.00 0.00 ? 123 ASN D N     1 
ATOM 3809  C CA    . ASN D  1 117 ? 9.708   -79.781 47.827  1.00 0.00 ? 123 ASN D CA    1 
ATOM 3810  C C     . ASN D  1 117 ? 9.963   -78.569 48.719  1.00 0.00 ? 123 ASN D C     1 
ATOM 3811  O O     . ASN D  1 117 ? 9.991   -78.695 49.941  1.00 0.00 ? 123 ASN D O     1 
ATOM 3812  C CB    . ASN D  1 117 ? 10.777  -80.811 48.043  1.00 0.00 ? 123 ASN D CB    1 
ATOM 3813  C CG    . ASN D  1 117 ? 10.387  -82.129 47.485  1.00 0.00 ? 123 ASN D CG    1 
ATOM 3814  O OD1   . ASN D  1 117 ? 9.208   -82.360 47.207  1.00 0.00 ? 123 ASN D OD1   1 
ATOM 3815  N ND2   . ASN D  1 117 ? 11.346  -83.003 47.312  1.00 0.00 ? 123 ASN D ND2   1 
ATOM 3816  N N     . ILE D  1 118 ? 10.146  -77.405 48.122  1.00 0.00 ? 124 ILE D N     1 
ATOM 3817  C CA    . ILE D  1 118 ? 10.268  -76.188 48.864  1.00 0.00 ? 124 ILE D CA    1 
ATOM 3818  C C     . ILE D  1 118 ? 8.982   -75.448 48.845  1.00 0.00 ? 124 ILE D C     1 
ATOM 3819  O O     . ILE D  1 118 ? 8.462   -75.051 49.885  1.00 0.00 ? 124 ILE D O     1 
ATOM 3820  C CB    . ILE D  1 118 ? 11.335  -75.296 48.282  1.00 0.00 ? 124 ILE D CB    1 
ATOM 3821  C CG1   . ILE D  1 118 ? 12.666  -75.986 48.319  1.00 0.00 ? 124 ILE D CG1   1 
ATOM 3822  C CG2   . ILE D  1 118 ? 11.378  -73.984 49.012  1.00 0.00 ? 124 ILE D CG2   1 
ATOM 3823  C CD1   . ILE D  1 118 ? 13.101  -76.374 49.707  1.00 0.00 ? 124 ILE D CD1   1 
ATOM 3824  N N     . ILE D  1 119 ? 8.470   -75.247 47.651  1.00 0.00 ? 125 ILE D N     1 
ATOM 3825  C CA    . ILE D  1 119 ? 7.264   -74.479 47.453  1.00 0.00 ? 125 ILE D CA    1 
ATOM 3826  C C     . ILE D  1 119 ? 6.054   -75.173 48.038  1.00 0.00 ? 125 ILE D C     1 
ATOM 3827  O O     . ILE D  1 119 ? 5.267   -74.561 48.756  1.00 0.00 ? 125 ILE D O     1 
ATOM 3828  C CB    . ILE D  1 119 ? 7.049   -74.234 45.976  1.00 0.00 ? 125 ILE D CB    1 
ATOM 3829  C CG1   . ILE D  1 119 ? 8.154   -73.344 45.452  1.00 0.00 ? 125 ILE D CG1   1 
ATOM 3830  C CG2   . ILE D  1 119 ? 5.695   -73.595 45.745  1.00 0.00 ? 125 ILE D CG2   1 
ATOM 3831  C CD1   . ILE D  1 119 ? 8.203   -73.286 43.962  1.00 0.00 ? 125 ILE D CD1   1 
ATOM 3832  N N     . THR D  1 120 ? 5.898   -76.450 47.731  1.00 0.00 ? 126 THR D N     1 
ATOM 3833  C CA    . THR D  1 120 ? 4.778   -77.207 48.242  1.00 0.00 ? 126 THR D CA    1 
ATOM 3834  C C     . THR D  1 120 ? 5.170   -77.935 49.486  1.00 0.00 ? 126 THR D C     1 
ATOM 3835  O O     . THR D  1 120 ? 4.368   -78.099 50.405  1.00 0.00 ? 126 THR D O     1 
ATOM 3836  C CB    . THR D  1 120 ? 4.333   -78.245 47.246  1.00 0.00 ? 126 THR D CB    1 
ATOM 3837  O OG1   . THR D  1 120 ? 5.396   -79.189 47.085  1.00 0.00 ? 126 THR D OG1   1 
ATOM 3838  C CG2   . THR D  1 120 ? 4.022   -77.601 45.908  1.00 0.00 ? 126 THR D CG2   1 
ATOM 3839  N N     . GLY D  1 121 ? 6.417   -78.370 49.527  1.00 0.00 ? 127 GLY D N     1 
ATOM 3840  C CA    . GLY D  1 121 ? 6.917   -79.109 50.664  1.00 0.00 ? 127 GLY D CA    1 
ATOM 3841  C C     . GLY D  1 121 ? 6.941   -80.599 50.372  1.00 0.00 ? 127 GLY D C     1 
ATOM 3842  O O     . GLY D  1 121 ? 7.546   -81.374 51.110  1.00 0.00 ? 127 GLY D O     1 
ATOM 3843  N N     . SER D  1 122 ? 6.283   -81.003 49.295  1.00 0.00 ? 128 SER D N     1 
ATOM 3844  C CA    . SER D  1 122 ? 6.206   -82.404 48.947  1.00 0.00 ? 128 SER D CA    1 
ATOM 3845  C C     . SER D  1 122 ? 6.143   -82.567 47.444  1.00 0.00 ? 128 SER D C     1 
ATOM 3846  O O     . SER D  1 122 ? 5.671   -81.673 46.747  1.00 0.00 ? 128 SER D O     1 
ATOM 3847  C CB    . SER D  1 122 ? 4.967   -83.028 49.561  1.00 0.00 ? 128 SER D CB    1 
ATOM 3848  O OG    . SER D  1 122 ? 3.807   -82.510 48.965  1.00 0.00 ? 128 SER D OG    1 
ATOM 3849  N N     . PRO D  1 123 ? 6.561   -83.728 46.936  1.00 0.00 ? 129 PRO D N     1 
ATOM 3850  C CA    . PRO D  1 123 ? 6.535   -84.141 45.551  1.00 0.00 ? 129 PRO D CA    1 
ATOM 3851  C C     . PRO D  1 123 ? 5.119   -84.146 45.027  1.00 0.00 ? 129 PRO D C     1 
ATOM 3852  O O     . PRO D  1 123 ? 4.158   -84.203 45.789  1.00 0.00 ? 129 PRO D O     1 
ATOM 3853  C CB    . PRO D  1 123 ? 7.141   -85.543 45.581  1.00 0.00 ? 129 PRO D CB    1 
ATOM 3854  C CG    . PRO D  1 123 ? 8.032   -85.547 46.775  1.00 0.00 ? 129 PRO D CG    1 
ATOM 3855  C CD    . PRO D  1 123 ? 7.346   -84.666 47.772  1.00 0.00 ? 129 PRO D CD    1 
ATOM 3856  N N     . THR D  1 124 ? 4.996   -84.075 43.720  1.00 0.00 ? 130 THR D N     1 
ATOM 3857  C CA    . THR D  1 124 ? 3.700   -84.075 43.082  1.00 0.00 ? 130 THR D CA    1 
ATOM 3858  C C     . THR D  1 124 ? 3.242   -85.490 42.772  1.00 0.00 ? 130 THR D C     1 
ATOM 3859  O O     . THR D  1 124 ? 3.434   -86.397 43.580  1.00 0.00 ? 130 THR D O     1 
ATOM 3860  C CB    . THR D  1 124 ? 3.736   -83.222 41.807  1.00 0.00 ? 130 THR D CB    1 
ATOM 3861  O OG1   . THR D  1 124 ? 2.436   -83.216 41.206  1.00 0.00 ? 130 THR D OG1   1 
ATOM 3862  C CG2   . THR D  1 124 ? 4.790   -83.734 40.810  1.00 0.00 ? 130 THR D CG2   1 
ATOM 3863  N N     . GLY D  1 125 ? 2.607   -85.690 41.618  1.00 0.00 ? 131 GLY D N     1 
ATOM 3864  C CA    . GLY D  1 125 ? 2.130   -87.011 41.237  1.00 0.00 ? 131 GLY D CA    1 
ATOM 3865  C C     . GLY D  1 125 ? 0.782   -87.297 41.874  1.00 0.00 ? 131 GLY D C     1 
ATOM 3866  O O     . GLY D  1 125 ? -0.229  -87.391 41.180  1.00 0.00 ? 131 GLY D O     1 
ATOM 3867  N N     . TYR D  1 126 ? 0.774   -87.378 43.206  1.00 0.00 ? 132 TYR D N     1 
ATOM 3868  C CA    . TYR D  1 126 ? -0.434  -87.623 43.969  1.00 0.00 ? 132 TYR D CA    1 
ATOM 3869  C C     . TYR D  1 126 ? -0.631  -86.529 45.013  1.00 0.00 ? 132 TYR D C     1 
ATOM 3870  O O     . TYR D  1 126 ? 0.333   -85.927 45.484  1.00 0.00 ? 132 TYR D O     1 
ATOM 3871  C CB    . TYR D  1 126 ? -0.355  -88.984 44.641  1.00 0.00 ? 132 TYR D CB    1 
ATOM 3872  C CG    . TYR D  1 126 ? -0.126  -90.114 43.669  1.00 0.00 ? 132 TYR D CG    1 
ATOM 3873  C CD1   . TYR D  1 126 ? 1.160   -90.586 43.459  1.00 0.00 ? 132 TYR D CD1   1 
ATOM 3874  C CD2   . TYR D  1 126 ? -1.189  -90.661 42.970  1.00 0.00 ? 132 TYR D CD2   1 
ATOM 3875  C CE1   . TYR D  1 126 ? 1.382   -91.606 42.560  1.00 0.00 ? 132 TYR D CE1   1 
ATOM 3876  C CE2   . TYR D  1 126 ? -0.968  -91.679 42.069  1.00 0.00 ? 132 TYR D CE2   1 
ATOM 3877  C CZ    . TYR D  1 126 ? 0.312   -92.154 41.866  1.00 0.00 ? 132 TYR D CZ    1 
ATOM 3878  O OH    . TYR D  1 126 ? 0.536   -93.175 40.971  1.00 0.00 ? 132 TYR D OH    1 
ATOM 3879  N N     . VAL D  1 127 ? -1.885  -86.281 45.376  1.00 0.00 ? 133 VAL D N     1 
ATOM 3880  C CA    . VAL D  1 127 ? -2.204  -85.237 46.345  1.00 0.00 ? 133 VAL D CA    1 
ATOM 3881  C C     . VAL D  1 127 ? -1.685  -85.605 47.722  1.00 0.00 ? 133 VAL D C     1 
ATOM 3882  O O     . VAL D  1 127 ? -2.046  -86.650 48.268  1.00 0.00 ? 133 VAL D O     1 
ATOM 3883  C CB    . VAL D  1 127 ? -3.739  -85.017 46.418  1.00 0.00 ? 133 VAL D CB    1 
ATOM 3884  C CG1   . VAL D  1 127 ? -4.072  -84.000 47.498  1.00 0.00 ? 133 VAL D CG1   1 
ATOM 3885  C CG2   . VAL D  1 127 ? -4.271  -84.555 45.070  1.00 0.00 ? 133 VAL D CG2   1 
ATOM 3886  N N     . SER D  1 128 ? -0.840  -84.742 48.290  1.00 0.00 ? 134 SER D N     1 
ATOM 3887  C CA    . SER D  1 128 ? -0.268  -84.997 49.609  1.00 0.00 ? 134 SER D CA    1 
ATOM 3888  C C     . SER D  1 128 ? 0.345   -83.738 50.218  1.00 0.00 ? 134 SER D C     1 
ATOM 3889  O O     . SER D  1 128 ? -0.123  -83.255 51.252  1.00 0.00 ? 134 SER D O     1 
ATOM 3890  C CB    . SER D  1 128 ? 0.787   -86.082 49.510  1.00 0.00 ? 134 SER D CB    1 
ATOM 3891  O OG    . SER D  1 128 ? 1.367   -86.337 50.758  1.00 0.00 ? 134 SER D OG    1 
ATOM 3892  O OXT   . SER D  1 128 ? 1.448   -83.363 49.820  1.00 0.00 ? 134 SER D OXT   1 
ATOM 3893  N N     . SER E  1 1   ? -4.307  -63.007 40.908  1.00 0.00 ? 7   SER E N     1 
ATOM 3894  C CA    . SER E  1 1   ? -5.688  -63.009 41.368  1.00 0.00 ? 7   SER E CA    1 
ATOM 3895  C C     . SER E  1 1   ? -6.054  -61.699 42.045  1.00 0.00 ? 7   SER E C     1 
ATOM 3896  O O     . SER E  1 1   ? -5.189  -60.994 42.564  1.00 0.00 ? 7   SER E O     1 
ATOM 3897  C CB    . SER E  1 1   ? -5.939  -64.142 42.301  1.00 0.00 ? 7   SER E CB    1 
ATOM 3898  O OG    . SER E  1 1   ? -7.252  -64.087 42.775  1.00 0.00 ? 7   SER E OG    1 
ATOM 3899  N N     . ARG E  1 2   ? -7.337  -61.349 41.994  1.00 0.00 ? 8   ARG E N     1 
ATOM 3900  C CA    . ARG E  1 2   ? -7.806  -60.077 42.534  1.00 0.00 ? 8   ARG E CA    1 
ATOM 3901  C C     . ARG E  1 2   ? -9.074  -60.207 43.352  1.00 0.00 ? 8   ARG E C     1 
ATOM 3902  O O     . ARG E  1 2   ? -10.071 -60.759 42.891  1.00 0.00 ? 8   ARG E O     1 
ATOM 3903  C CB    . ARG E  1 2   ? -8.082  -59.126 41.415  1.00 0.00 ? 8   ARG E CB    1 
ATOM 3904  C CG    . ARG E  1 2   ? -6.882  -58.725 40.587  1.00 0.00 ? 8   ARG E CG    1 
ATOM 3905  C CD    . ARG E  1 2   ? -5.990  -57.820 41.310  1.00 0.00 ? 8   ARG E CD    1 
ATOM 3906  N NE    . ARG E  1 2   ? -4.903  -57.380 40.473  1.00 0.00 ? 8   ARG E NE    1 
ATOM 3907  C CZ    . ARG E  1 2   ? -3.739  -58.021 40.338  1.00 0.00 ? 8   ARG E CZ    1 
ATOM 3908  N NH1   . ARG E  1 2   ? -3.508  -59.129 40.998  1.00 0.00 ? 8   ARG E NH1   1 
ATOM 3909  N NH2   . ARG E  1 2   ? -2.796  -57.545 39.546  1.00 0.00 ? 8   ARG E NH2   1 
ATOM 3910  N N     . SER E  1 3   ? -9.043  -59.653 44.556  1.00 0.00 ? 9   SER E N     1 
ATOM 3911  C CA    . SER E  1 3   ? -10.205 -59.598 45.434  1.00 0.00 ? 9   SER E CA    1 
ATOM 3912  C C     . SER E  1 3   ? -11.125 -58.490 45.007  1.00 0.00 ? 9   SER E C     1 
ATOM 3913  O O     . SER E  1 3   ? -10.726 -57.635 44.232  1.00 0.00 ? 9   SER E O     1 
ATOM 3914  C CB    . SER E  1 3   ? -9.761  -59.334 46.842  1.00 0.00 ? 9   SER E CB    1 
ATOM 3915  O OG    . SER E  1 3   ? -9.193  -58.050 46.941  1.00 0.00 ? 9   SER E OG    1 
ATOM 3916  N N     . TYR E  1 4   ? -12.327 -58.457 45.559  1.00 0.00 ? 10  TYR E N     1 
ATOM 3917  C CA    . TYR E  1 4   ? -13.255 -57.383 45.242  1.00 0.00 ? 10  TYR E CA    1 
ATOM 3918  C C     . TYR E  1 4   ? -12.654 -56.035 45.475  1.00 0.00 ? 10  TYR E C     1 
ATOM 3919  O O     . TYR E  1 4   ? -12.794 -55.142 44.646  1.00 0.00 ? 10  TYR E O     1 
ATOM 3920  C CB    . TYR E  1 4   ? -14.530 -57.476 46.035  1.00 0.00 ? 10  TYR E CB    1 
ATOM 3921  C CG    . TYR E  1 4   ? -15.343 -56.225 45.872  1.00 0.00 ? 10  TYR E CG    1 
ATOM 3922  C CD1   . TYR E  1 4   ? -16.034 -55.984 44.699  1.00 0.00 ? 10  TYR E CD1   1 
ATOM 3923  C CD2   . TYR E  1 4   ? -15.357 -55.292 46.882  1.00 0.00 ? 10  TYR E CD2   1 
ATOM 3924  C CE1   . TYR E  1 4   ? -16.737 -54.809 44.545  1.00 0.00 ? 10  TYR E CE1   1 
ATOM 3925  C CE2   . TYR E  1 4   ? -16.054 -54.121 46.730  1.00 0.00 ? 10  TYR E CE2   1 
ATOM 3926  C CZ    . TYR E  1 4   ? -16.740 -53.878 45.569  1.00 0.00 ? 10  TYR E CZ    1 
ATOM 3927  O OH    . TYR E  1 4   ? -17.427 -52.701 45.424  1.00 0.00 ? 10  TYR E OH    1 
ATOM 3928  N N     . SER E  1 5   ? -12.022 -55.858 46.630  1.00 0.00 ? 11  SER E N     1 
ATOM 3929  C CA    . SER E  1 5   ? -11.397 -54.590 46.947  1.00 0.00 ? 11  SER E CA    1 
ATOM 3930  C C     . SER E  1 5   ? -10.497 -54.154 45.813  1.00 0.00 ? 11  SER E C     1 
ATOM 3931  O O     . SER E  1 5   ? -10.541 -53.003 45.385  1.00 0.00 ? 11  SER E O     1 
ATOM 3932  C CB    . SER E  1 5   ? -10.588 -54.696 48.237  1.00 0.00 ? 11  SER E CB    1 
ATOM 3933  O OG    . SER E  1 5   ? -11.419 -54.899 49.346  1.00 0.00 ? 11  SER E OG    1 
ATOM 3934  N N     . GLN E  1 6   ? -9.702  -55.085 45.310  1.00 0.00 ? 12  GLN E N     1 
ATOM 3935  C CA    . GLN E  1 6   ? -8.798  -54.805 44.217  1.00 0.00 ? 12  GLN E CA    1 
ATOM 3936  C C     . GLN E  1 6   ? -9.524  -54.569 42.911  1.00 0.00 ? 12  GLN E C     1 
ATOM 3937  O O     . GLN E  1 6   ? -9.158  -53.673 42.154  1.00 0.00 ? 12  GLN E O     1 
ATOM 3938  C CB    . GLN E  1 6   ? -7.829  -55.939 44.068  1.00 0.00 ? 12  GLN E CB    1 
ATOM 3939  C CG    . GLN E  1 6   ? -6.839  -56.030 45.196  1.00 0.00 ? 12  GLN E CG    1 
ATOM 3940  C CD    . GLN E  1 6   ? -6.085  -57.327 45.190  1.00 0.00 ? 12  GLN E CD    1 
ATOM 3941  O OE1   . GLN E  1 6   ? -6.672  -58.377 45.468  1.00 0.00 ? 12  GLN E OE1   1 
ATOM 3942  N NE2   . GLN E  1 6   ? -4.796  -57.278 44.871  1.00 0.00 ? 12  GLN E NE2   1 
ATOM 3943  N N     . ARG E  1 7   ? -10.564 -55.356 42.650  1.00 0.00 ? 13  ARG E N     1 
ATOM 3944  C CA    . ARG E  1 7   ? -11.321 -55.223 41.414  1.00 0.00 ? 13  ARG E CA    1 
ATOM 3945  C C     . ARG E  1 7   ? -11.857 -53.839 41.281  1.00 0.00 ? 13  ARG E C     1 
ATOM 3946  O O     . ARG E  1 7   ? -11.664 -53.173 40.263  1.00 0.00 ? 13  ARG E O     1 
ATOM 3947  C CB    . ARG E  1 7   ? -12.507 -56.180 41.385  1.00 0.00 ? 13  ARG E CB    1 
ATOM 3948  C CG    . ARG E  1 7   ? -12.168 -57.645 41.294  1.00 0.00 ? 13  ARG E CG    1 
ATOM 3949  C CD    . ARG E  1 7   ? -13.372 -58.468 41.075  1.00 0.00 ? 13  ARG E CD    1 
ATOM 3950  N NE    . ARG E  1 7   ? -13.922 -58.258 39.745  1.00 0.00 ? 13  ARG E NE    1 
ATOM 3951  C CZ    . ARG E  1 7   ? -15.123 -58.702 39.334  1.00 0.00 ? 13  ARG E CZ    1 
ATOM 3952  N NH1   . ARG E  1 7   ? -15.897 -59.366 40.162  1.00 0.00 ? 13  ARG E NH1   1 
ATOM 3953  N NH2   . ARG E  1 7   ? -15.532 -58.472 38.094  1.00 0.00 ? 13  ARG E NH2   1 
ATOM 3954  N N     . TYR E  1 8   ? -12.530 -53.403 42.321  1.00 0.00 ? 14  TYR E N     1 
ATOM 3955  C CA    . TYR E  1 8   ? -13.138 -52.115 42.353  1.00 0.00 ? 14  TYR E CA    1 
ATOM 3956  C C     . TYR E  1 8   ? -12.134 -51.015 42.340  1.00 0.00 ? 14  TYR E C     1 
ATOM 3957  O O     . TYR E  1 8   ? -12.297 -50.052 41.605  1.00 0.00 ? 14  TYR E O     1 
ATOM 3958  C CB    . TYR E  1 8   ? -14.029 -51.986 43.553  1.00 0.00 ? 14  TYR E CB    1 
ATOM 3959  C CG    . TYR E  1 8   ? -14.573 -50.614 43.700  1.00 0.00 ? 14  TYR E CG    1 
ATOM 3960  C CD1   . TYR E  1 8   ? -15.130 -49.985 42.617  1.00 0.00 ? 14  TYR E CD1   1 
ATOM 3961  C CD2   . TYR E  1 8   ? -14.516 -49.981 44.920  1.00 0.00 ? 14  TYR E CD2   1 
ATOM 3962  C CE1   . TYR E  1 8   ? -15.620 -48.717 42.742  1.00 0.00 ? 14  TYR E CE1   1 
ATOM 3963  C CE2   . TYR E  1 8   ? -15.006 -48.707 45.051  1.00 0.00 ? 14  TYR E CE2   1 
ATOM 3964  C CZ    . TYR E  1 8   ? -15.550 -48.076 43.962  1.00 0.00 ? 14  TYR E CZ    1 
ATOM 3965  O OH    . TYR E  1 8   ? -16.024 -46.798 44.077  1.00 0.00 ? 14  TYR E OH    1 
ATOM 3966  N N     . ALA E  1 9   ? -11.108 -51.128 43.169  1.00 0.00 ? 15  ALA E N     1 
ATOM 3967  C CA    . ALA E  1 9   ? -10.100 -50.086 43.260  1.00 0.00 ? 15  ALA E CA    1 
ATOM 3968  C C     . ALA E  1 9   ? -9.583  -49.689 41.895  1.00 0.00 ? 15  ALA E C     1 
ATOM 3969  O O     . ALA E  1 9   ? -9.586  -48.506 41.544  1.00 0.00 ? 15  ALA E O     1 
ATOM 3970  C CB    . ALA E  1 9   ? -8.948  -50.549 44.127  1.00 0.00 ? 15  ALA E CB    1 
ATOM 3971  N N     . LYS E  1 10  ? -9.140  -50.666 41.121  1.00 0.00 ? 16  LYS E N     1 
ATOM 3972  C CA    . LYS E  1 10  ? -8.579  -50.366 39.831  1.00 0.00 ? 16  LYS E CA    1 
ATOM 3973  C C     . LYS E  1 10  ? -9.631  -49.892 38.866  1.00 0.00 ? 16  LYS E C     1 
ATOM 3974  O O     . LYS E  1 10  ? -9.381  -48.987 38.075  1.00 0.00 ? 16  LYS E O     1 
ATOM 3975  C CB    . LYS E  1 10  ? -7.860  -51.542 39.257  1.00 0.00 ? 16  LYS E CB    1 
ATOM 3976  C CG    . LYS E  1 10  ? -7.098  -51.197 38.003  1.00 0.00 ? 16  LYS E CG    1 
ATOM 3977  C CD    . LYS E  1 10  ? -6.273  -52.354 37.517  1.00 0.00 ? 16  LYS E CD    1 
ATOM 3978  C CE    . LYS E  1 10  ? -5.432  -51.937 36.332  1.00 0.00 ? 16  LYS E CE    1 
ATOM 3979  N NZ    . LYS E  1 10  ? -4.660  -53.066 35.761  1.00 0.00 ? 16  LYS E NZ    1 
ATOM 3980  N N     . TRP E  1 11  ? -10.825 -50.482 38.934  1.00 0.00 ? 17  TRP E N     1 
ATOM 3981  C CA    . TRP E  1 11  ? -11.914 -50.047 38.081  1.00 0.00 ? 17  TRP E CA    1 
ATOM 3982  C C     . TRP E  1 11  ? -12.185 -48.594 38.267  1.00 0.00 ? 17  TRP E C     1 
ATOM 3983  O O     . TRP E  1 11  ? -12.437 -47.874 37.304  1.00 0.00 ? 17  TRP E O     1 
ATOM 3984  C CB    . TRP E  1 11  ? -13.184 -50.809 38.378  1.00 0.00 ? 17  TRP E CB    1 
ATOM 3985  C CG    . TRP E  1 11  ? -14.342 -50.331 37.568  1.00 0.00 ? 17  TRP E CG    1 
ATOM 3986  C CD1   . TRP E  1 11  ? -14.698 -50.761 36.330  1.00 0.00 ? 17  TRP E CD1   1 
ATOM 3987  C CD2   . TRP E  1 11  ? -15.312 -49.323 37.934  1.00 0.00 ? 17  TRP E CD2   1 
ATOM 3988  N NE1   . TRP E  1 11  ? -15.820 -50.099 35.907  1.00 0.00 ? 17  TRP E NE1   1 
ATOM 3989  C CE2   . TRP E  1 11  ? -16.208 -49.215 36.873  1.00 0.00 ? 17  TRP E CE2   1 
ATOM 3990  C CE3   . TRP E  1 11  ? -15.495 -48.525 39.058  1.00 0.00 ? 17  TRP E CE3   1 
ATOM 3991  C CZ2   . TRP E  1 11  ? -17.277 -48.337 36.902  1.00 0.00 ? 17  TRP E CZ2   1 
ATOM 3992  C CZ3   . TRP E  1 11  ? -16.566 -47.646 39.089  1.00 0.00 ? 17  TRP E CZ3   1 
ATOM 3993  C CH2   . TRP E  1 11  ? -17.435 -47.554 38.039  1.00 0.00 ? 17  TRP E CH2   1 
ATOM 3994  N N     . GLN E  1 12  ? -12.163 -48.155 39.510  1.00 0.00 ? 18  GLN E N     1 
ATOM 3995  C CA    . GLN E  1 12  ? -12.435 -46.789 39.822  1.00 0.00 ? 18  GLN E CA    1 
ATOM 3996  C C     . GLN E  1 12  ? -11.394 -45.886 39.248  1.00 0.00 ? 18  GLN E C     1 
ATOM 3997  O O     . GLN E  1 12  ? -11.715 -44.855 38.664  1.00 0.00 ? 18  GLN E O     1 
ATOM 3998  C CB    . GLN E  1 12  ? -12.478 -46.595 41.314  1.00 0.00 ? 18  GLN E CB    1 
ATOM 3999  C CG    . GLN E  1 12  ? -12.910 -45.222 41.711  1.00 0.00 ? 18  GLN E CG    1 
ATOM 4000  C CD    . GLN E  1 12  ? -14.322 -44.989 41.323  1.00 0.00 ? 18  GLN E CD    1 
ATOM 4001  O OE1   . GLN E  1 12  ? -15.198 -45.729 41.767  1.00 0.00 ? 18  GLN E OE1   1 
ATOM 4002  N NE2   . GLN E  1 12  ? -14.579 -43.985 40.495  1.00 0.00 ? 18  GLN E NE2   1 
ATOM 4003  N N     . ALA E  1 13  ? -10.140 -46.275 39.387  1.00 0.00 ? 19  ALA E N     1 
ATOM 4004  C CA    . ALA E  1 13  ? -9.043  -45.470 38.893  1.00 0.00 ? 19  ALA E CA    1 
ATOM 4005  C C     . ALA E  1 13  ? -9.134  -45.274 37.401  1.00 0.00 ? 19  ALA E C     1 
ATOM 4006  O O     . ALA E  1 13  ? -8.917  -44.170 36.900  1.00 0.00 ? 19  ALA E O     1 
ATOM 4007  C CB    . ALA E  1 13  ? -7.726  -46.115 39.253  1.00 0.00 ? 19  ALA E CB    1 
ATOM 4008  N N     . LYS E  1 14  ? -9.480  -46.331 36.686  1.00 0.00 ? 20  LYS E N     1 
ATOM 4009  C CA    . LYS E  1 14  ? -9.561  -46.256 35.250  1.00 0.00 ? 20  LYS E CA    1 
ATOM 4010  C C     . LYS E  1 14  ? -10.773 -45.520 34.800  1.00 0.00 ? 20  LYS E C     1 
ATOM 4011  O O     . LYS E  1 14  ? -10.720 -44.786 33.816  1.00 0.00 ? 20  LYS E O     1 
ATOM 4012  C CB    . LYS E  1 14  ? -9.545  -47.643 34.652  1.00 0.00 ? 20  LYS E CB    1 
ATOM 4013  C CG    . LYS E  1 14  ? -8.239  -48.365 34.864  1.00 0.00 ? 20  LYS E CG    1 
ATOM 4014  C CD    . LYS E  1 14  ? -7.121  -47.660 34.125  1.00 0.00 ? 20  LYS E CD    1 
ATOM 4015  C CE    . LYS E  1 14  ? -7.116  -48.009 32.646  1.00 0.00 ? 20  LYS E CE    1 
ATOM 4016  N NZ    . LYS E  1 14  ? -6.485  -49.329 32.406  1.00 0.00 ? 20  LYS E NZ    1 
ATOM 4017  N N     . PHE E  1 15  ? -11.866 -45.663 35.532  1.00 0.00 ? 21  PHE E N     1 
ATOM 4018  C CA    . PHE E  1 15  ? -13.065 -44.934 35.204  1.00 0.00 ? 21  PHE E CA    1 
ATOM 4019  C C     . PHE E  1 15  ? -12.812 -43.449 35.323  1.00 0.00 ? 21  PHE E C     1 
ATOM 4020  O O     . PHE E  1 15  ? -13.177 -42.675 34.438  1.00 0.00 ? 21  PHE E O     1 
ATOM 4021  C CB    . PHE E  1 15  ? -14.212 -45.324 36.107  1.00 0.00 ? 21  PHE E CB    1 
ATOM 4022  C CG    . PHE E  1 15  ? -15.476 -44.650 35.716  1.00 0.00 ? 21  PHE E CG    1 
ATOM 4023  C CD1   . PHE E  1 15  ? -16.307 -45.212 34.764  1.00 0.00 ? 21  PHE E CD1   1 
ATOM 4024  C CD2   . PHE E  1 15  ? -15.817 -43.428 36.250  1.00 0.00 ? 21  PHE E CD2   1 
ATOM 4025  C CE1   . PHE E  1 15  ? -17.463 -44.571 34.366  1.00 0.00 ? 21  PHE E CE1   1 
ATOM 4026  C CE2   . PHE E  1 15  ? -16.966 -42.782 35.850  1.00 0.00 ? 21  PHE E CE2   1 
ATOM 4027  C CZ    . PHE E  1 15  ? -17.793 -43.356 34.909  1.00 0.00 ? 21  PHE E CZ    1 
ATOM 4028  N N     . ASN E  1 16  ? -12.180 -43.056 36.423  1.00 0.00 ? 22  ASN E N     1 
ATOM 4029  C CA    . ASN E  1 16  ? -11.862 -41.670 36.669  1.00 0.00 ? 22  ASN E CA    1 
ATOM 4030  C C     . ASN E  1 16  ? -11.012 -41.114 35.562  1.00 0.00 ? 22  ASN E C     1 
ATOM 4031  O O     . ASN E  1 16  ? -11.295 -40.044 35.027  1.00 0.00 ? 22  ASN E O     1 
ATOM 4032  C CB    . ASN E  1 16  ? -11.126 -41.523 37.975  1.00 0.00 ? 22  ASN E CB    1 
ATOM 4033  C CG    . ASN E  1 16  ? -11.983 -41.803 39.157  1.00 0.00 ? 22  ASN E CG    1 
ATOM 4034  O OD1   . ASN E  1 16  ? -13.207 -41.902 39.050  1.00 0.00 ? 22  ASN E OD1   1 
ATOM 4035  N ND2   . ASN E  1 16  ? -11.366 -41.933 40.299  1.00 0.00 ? 22  ASN E ND2   1 
ATOM 4036  N N     . ALA E  1 17  ? -9.980  -41.866 35.184  1.00 0.00 ? 23  ALA E N     1 
ATOM 4037  C CA    . ALA E  1 17  ? -9.082  -41.443 34.136  1.00 0.00 ? 23  ALA E CA    1 
ATOM 4038  C C     . ALA E  1 17  ? -9.828  -41.172 32.859  1.00 0.00 ? 23  ALA E C     1 
ATOM 4039  O O     . ALA E  1 17  ? -9.692  -40.106 32.267  1.00 0.00 ? 23  ALA E O     1 
ATOM 4040  C CB    . ALA E  1 17  ? -8.021  -42.498 33.899  1.00 0.00 ? 23  ALA E CB    1 
ATOM 4041  N N     . PHE E  1 18  ? -10.648 -42.126 32.449  1.00 0.00 ? 24  PHE E N     1 
ATOM 4042  C CA    . PHE E  1 18  ? -11.396 -42.005 31.222  1.00 0.00 ? 24  PHE E CA    1 
ATOM 4043  C C     . PHE E  1 18  ? -12.295 -40.800 31.200  1.00 0.00 ? 24  PHE E C     1 
ATOM 4044  O O     . PHE E  1 18  ? -12.432 -40.155 30.169  1.00 0.00 ? 24  PHE E O     1 
ATOM 4045  C CB    . PHE E  1 18  ? -12.198 -43.246 30.952  1.00 0.00 ? 24  PHE E CB    1 
ATOM 4046  C CG    . PHE E  1 18  ? -12.988 -43.160 29.685  1.00 0.00 ? 24  PHE E CG    1 
ATOM 4047  C CD1   . PHE E  1 18  ? -12.351 -42.968 28.470  1.00 0.00 ? 24  PHE E CD1   1 
ATOM 4048  C CD2   . PHE E  1 18  ? -14.364 -43.303 29.694  1.00 0.00 ? 24  PHE E CD2   1 
ATOM 4049  C CE1   . PHE E  1 18  ? -13.077 -42.907 27.298  1.00 0.00 ? 24  PHE E CE1   1 
ATOM 4050  C CE2   . PHE E  1 18  ? -15.088 -43.251 28.522  1.00 0.00 ? 24  PHE E CE2   1 
ATOM 4051  C CZ    . PHE E  1 18  ? -14.445 -43.050 27.325  1.00 0.00 ? 24  PHE E CZ    1 
ATOM 4052  N N     . SER E  1 19  ? -12.909 -40.474 32.336  1.00 0.00 ? 25  SER E N     1 
ATOM 4053  C CA    . SER E  1 19  ? -13.860 -39.364 32.387  1.00 0.00 ? 25  SER E CA    1 
ATOM 4054  C C     . SER E  1 19  ? -13.223 -38.007 32.065  1.00 0.00 ? 25  SER E C     1 
ATOM 4055  O O     . SER E  1 19  ? -13.932 -37.042 31.790  1.00 0.00 ? 25  SER E O     1 
ATOM 4056  C CB    . SER E  1 19  ? -14.492 -39.282 33.748  1.00 0.00 ? 25  SER E CB    1 
ATOM 4057  O OG    . SER E  1 19  ? -13.581 -38.793 34.696  1.00 0.00 ? 25  SER E OG    1 
ATOM 4058  N N     . ASN E  1 20  ? -11.894 -37.930 32.119  1.00 0.00 ? 26  ASN E N     1 
ATOM 4059  C CA    . ASN E  1 20  ? -11.178 -36.699 31.809  1.00 0.00 ? 26  ASN E CA    1 
ATOM 4060  C C     . ASN E  1 20  ? -11.368 -36.292 30.347  1.00 0.00 ? 26  ASN E C     1 
ATOM 4061  O O     . ASN E  1 20  ? -10.963 -37.027 29.457  1.00 0.00 ? 26  ASN E O     1 
ATOM 4062  C CB    . ASN E  1 20  ? -9.709  -36.880 32.110  1.00 0.00 ? 26  ASN E CB    1 
ATOM 4063  C CG    . ASN E  1 20  ? -8.891  -35.664 31.826  1.00 0.00 ? 26  ASN E CG    1 
ATOM 4064  O OD1   . ASN E  1 20  ? -8.969  -35.086 30.732  1.00 0.00 ? 26  ASN E OD1   1 
ATOM 4065  N ND2   . ASN E  1 20  ? -8.104  -35.261 32.786  1.00 0.00 ? 26  ASN E ND2   1 
ATOM 4066  N N     . PRO E  1 21  ? -12.002 -35.126 30.093  1.00 0.00 ? 27  PRO E N     1 
ATOM 4067  C CA    . PRO E  1 21  ? -12.280 -34.547 28.760  1.00 0.00 ? 27  PRO E CA    1 
ATOM 4068  C C     . PRO E  1 21  ? -11.269 -34.926 27.697  1.00 0.00 ? 27  PRO E C     1 
ATOM 4069  O O     . PRO E  1 21  ? -11.637 -35.313 26.583  1.00 0.00 ? 27  PRO E O     1 
ATOM 4070  C CB    . PRO E  1 21  ? -12.176 -33.036 29.004  1.00 0.00 ? 27  PRO E CB    1 
ATOM 4071  C CG    . PRO E  1 21  ? -12.511 -32.861 30.420  1.00 0.00 ? 27  PRO E CG    1 
ATOM 4072  C CD    . PRO E  1 21  ? -11.877 -34.037 31.092  1.00 0.00 ? 27  PRO E CD    1 
ATOM 4073  N N     . THR E  1 22  ? -9.994  -34.777 28.023  1.00 0.00 ? 28  THR E N     1 
ATOM 4074  C CA    . THR E  1 22  ? -8.953  -34.953 27.046  1.00 0.00 ? 28  THR E CA    1 
ATOM 4075  C C     . THR E  1 22  ? -8.624  -36.389 26.844  1.00 0.00 ? 28  THR E C     1 
ATOM 4076  O O     . THR E  1 22  ? -8.211  -36.785 25.765  1.00 0.00 ? 28  THR E O     1 
ATOM 4077  C CB    . THR E  1 22  ? -7.700  -34.233 27.475  1.00 0.00 ? 28  THR E CB    1 
ATOM 4078  O OG1   . THR E  1 22  ? -7.237  -34.803 28.700  1.00 0.00 ? 28  THR E OG1   1 
ATOM 4079  C CG2   . THR E  1 22  ? -7.986  -32.760 27.680  1.00 0.00 ? 28  THR E CG2   1 
ATOM 4080  N N     . VAL E  1 23  ? -8.822  -37.183 27.866  1.00 0.00 ? 29  VAL E N     1 
ATOM 4081  C CA    . VAL E  1 23  ? -8.537  -38.581 27.770  1.00 0.00 ? 29  VAL E CA    1 
ATOM 4082  C C     . VAL E  1 23  ? -9.600  -39.263 26.983  1.00 0.00 ? 29  VAL E C     1 
ATOM 4083  O O     . VAL E  1 23  ? -9.312  -40.061 26.092  1.00 0.00 ? 29  VAL E O     1 
ATOM 4084  C CB    . VAL E  1 23  ? -8.430  -39.197 29.143  1.00 0.00 ? 29  VAL E CB    1 
ATOM 4085  C CG1   . VAL E  1 23  ? -8.267  -40.694 29.035  1.00 0.00 ? 29  VAL E CG1   1 
ATOM 4086  C CG2   . VAL E  1 23  ? -7.265  -38.584 29.861  1.00 0.00 ? 29  VAL E CG2   1 
ATOM 4087  N N     . ALA E  1 24  ? -10.838 -38.946 27.297  1.00 0.00 ? 30  ALA E N     1 
ATOM 4088  C CA    . ALA E  1 24  ? -11.950 -39.518 26.593  1.00 0.00 ? 30  ALA E CA    1 
ATOM 4089  C C     . ALA E  1 24  ? -11.889 -39.172 25.133  1.00 0.00 ? 30  ALA E C     1 
ATOM 4090  O O     . ALA E  1 24  ? -12.014 -40.043 24.282  1.00 0.00 ? 30  ALA E O     1 
ATOM 4091  C CB    . ALA E  1 24  ? -13.259 -39.029 27.180  1.00 0.00 ? 30  ALA E CB    1 
ATOM 4092  N N     . SER E  1 25  ? -11.672 -37.901 24.835  1.00 0.00 ? 31  SER E N     1 
ATOM 4093  C CA    . SER E  1 25  ? -11.660 -37.470 23.464  1.00 0.00 ? 31  SER E CA    1 
ATOM 4094  C C     . SER E  1 25  ? -10.463 -37.956 22.712  1.00 0.00 ? 31  SER E C     1 
ATOM 4095  O O     . SER E  1 25  ? -10.564 -38.283 21.536  1.00 0.00 ? 31  SER E O     1 
ATOM 4096  C CB    . SER E  1 25  ? -11.707 -35.998 23.410  1.00 0.00 ? 31  SER E CB    1 
ATOM 4097  O OG    . SER E  1 25  ? -10.590 -35.450 24.042  1.00 0.00 ? 31  SER E OG    1 
ATOM 4098  N N     . THR E  1 26  ? -9.329  -38.076 23.388  1.00 0.00 ? 32  THR E N     1 
ATOM 4099  C CA    . THR E  1 26  ? -8.151  -38.607 22.738  1.00 0.00 ? 32  THR E CA    1 
ATOM 4100  C C     . THR E  1 26  ? -8.395  -40.000 22.275  1.00 0.00 ? 32  THR E C     1 
ATOM 4101  O O     . THR E  1 26  ? -8.200  -40.318 21.105  1.00 0.00 ? 32  THR E O     1 
ATOM 4102  C CB    . THR E  1 26  ? -6.941  -38.599 23.664  1.00 0.00 ? 32  THR E CB    1 
ATOM 4103  O OG1   . THR E  1 26  ? -6.603  -37.254 23.999  1.00 0.00 ? 32  THR E OG1   1 
ATOM 4104  C CG2   . THR E  1 26  ? -5.773  -39.257 22.989  1.00 0.00 ? 32  THR E CG2   1 
ATOM 4105  N N     . ILE E  1 27  ? -8.837  -40.837 23.183  1.00 0.00 ? 33  ILE E N     1 
ATOM 4106  C CA    . ILE E  1 27  ? -9.056  -42.214 22.868  1.00 0.00 ? 33  ILE E CA    1 
ATOM 4107  C C     . ILE E  1 27  ? -10.140 -42.388 21.843  1.00 0.00 ? 33  ILE E C     1 
ATOM 4108  O O     . ILE E  1 27  ? -9.945  -43.064 20.839  1.00 0.00 ? 33  ILE E O     1 
ATOM 4109  C CB    . ILE E  1 27  ? -9.429  -42.987 24.112  1.00 0.00 ? 33  ILE E CB    1 
ATOM 4110  C CG1   . ILE E  1 27  ? -8.255  -43.037 25.063  1.00 0.00 ? 33  ILE E CG1   1 
ATOM 4111  C CG2   . ILE E  1 27  ? -9.867  -44.376 23.734  1.00 0.00 ? 33  ILE E CG2   1 
ATOM 4112  C CD1   . ILE E  1 27  ? -8.622  -43.530 26.431  1.00 0.00 ? 33  ILE E CD1   1 
ATOM 4113  N N     . LEU E  1 28  ? -11.285 -41.780 22.097  1.00 0.00 ? 34  LEU E N     1 
ATOM 4114  C CA    . LEU E  1 28  ? -12.445 -41.972 21.267  1.00 0.00 ? 34  LEU E CA    1 
ATOM 4115  C C     . LEU E  1 28  ? -12.263 -41.428 19.874  1.00 0.00 ? 34  LEU E C     1 
ATOM 4116  O O     . LEU E  1 28  ? -12.708 -42.043 18.906  1.00 0.00 ? 34  LEU E O     1 
ATOM 4117  C CB    . LEU E  1 28  ? -13.641 -41.318 21.921  1.00 0.00 ? 34  LEU E CB    1 
ATOM 4118  C CG    . LEU E  1 28  ? -14.107 -41.983 23.213  1.00 0.00 ? 34  LEU E CG    1 
ATOM 4119  C CD1   . LEU E  1 28  ? -15.161 -41.115 23.870  1.00 0.00 ? 34  LEU E CD1   1 
ATOM 4120  C CD2   . LEU E  1 28  ? -14.654 -43.360 22.898  1.00 0.00 ? 34  LEU E CD2   1 
ATOM 4121  N N     . SER E  1 29  ? -11.587 -40.296 19.749  1.00 0.00 ? 35  SER E N     1 
ATOM 4122  C CA    . SER E  1 29  ? -11.355 -39.739 18.436  1.00 0.00 ? 35  SER E CA    1 
ATOM 4123  C C     . SER E  1 29  ? -10.326 -40.546 17.673  1.00 0.00 ? 35  SER E C     1 
ATOM 4124  O O     . SER E  1 29  ? -10.389 -40.631 16.448  1.00 0.00 ? 35  SER E O     1 
ATOM 4125  C CB    . SER E  1 29  ? -10.904 -38.316 18.539  1.00 0.00 ? 35  SER E CB    1 
ATOM 4126  O OG    . SER E  1 29  ? -9.644  -38.236 19.138  1.00 0.00 ? 35  SER E OG    1 
ATOM 4127  N N     . ASN E  1 30  ? -9.403  -41.187 18.391  1.00 0.00 ? 36  ASN E N     1 
ATOM 4128  C CA    . ASN E  1 30  ? -8.415  -42.015 17.733  1.00 0.00 ? 36  ASN E CA    1 
ATOM 4129  C C     . ASN E  1 30  ? -9.002  -43.308 17.231  1.00 0.00 ? 36  ASN E C     1 
ATOM 4130  O O     . ASN E  1 30  ? -8.631  -43.781 16.164  1.00 0.00 ? 36  ASN E O     1 
ATOM 4131  C CB    . ASN E  1 30  ? -7.246  -42.283 18.636  1.00 0.00 ? 36  ASN E CB    1 
ATOM 4132  C CG    . ASN E  1 30  ? -6.376  -41.078 18.783  1.00 0.00 ? 36  ASN E CG    1 
ATOM 4133  O OD1   . ASN E  1 30  ? -6.549  -40.091 18.063  1.00 0.00 ? 36  ASN E OD1   1 
ATOM 4134  N ND2   . ASN E  1 30  ? -5.430  -41.140 19.680  1.00 0.00 ? 36  ASN E ND2   1 
ATOM 4135  N N     . VAL E  1 31  ? -9.948  -43.873 17.976  1.00 0.00 ? 37  VAL E N     1 
ATOM 4136  C CA    . VAL E  1 31  ? -10.537 -45.141 17.571  1.00 0.00 ? 37  VAL E CA    1 
ATOM 4137  C C     . VAL E  1 31  ? -11.805 -44.955 16.800  1.00 0.00 ? 37  VAL E C     1 
ATOM 4138  O O     . VAL E  1 31  ? -12.459 -45.933 16.460  1.00 0.00 ? 37  VAL E O     1 
ATOM 4139  C CB    . VAL E  1 31  ? -10.850 -46.023 18.772  1.00 0.00 ? 37  VAL E CB    1 
ATOM 4140  C CG1   . VAL E  1 31  ? -9.600  -46.274 19.582  1.00 0.00 ? 37  VAL E CG1   1 
ATOM 4141  C CG2   . VAL E  1 31  ? -11.934 -45.382 19.604  1.00 0.00 ? 37  VAL E CG2   1 
ATOM 4142  N N     . SER E  1 32  ? -12.172 -43.705 16.534  1.00 0.00 ? 38  SER E N     1 
ATOM 4143  C CA    . SER E  1 32  ? -13.361 -43.412 15.758  1.00 0.00 ? 38  SER E CA    1 
ATOM 4144  C C     . SER E  1 32  ? -13.436 -44.235 14.466  1.00 0.00 ? 38  SER E C     1 
ATOM 4145  O O     . SER E  1 32  ? -14.216 -45.183 14.401  1.00 0.00 ? 38  SER E O     1 
ATOM 4146  C CB    . SER E  1 32  ? -13.471 -41.923 15.473  1.00 0.00 ? 38  SER E CB    1 
ATOM 4147  O OG    . SER E  1 32  ? -13.755 -41.209 16.643  1.00 0.00 ? 38  SER E OG    1 
ATOM 4148  N N     . PRO E  1 33  ? -12.671 -43.866 13.414  1.00 0.00 ? 39  PRO E N     1 
ATOM 4149  C CA    . PRO E  1 33  ? -12.721 -44.525 12.108  1.00 0.00 ? 39  PRO E CA    1 
ATOM 4150  C C     . PRO E  1 33  ? -12.532 -46.051 12.203  1.00 0.00 ? 39  PRO E C     1 
ATOM 4151  O O     . PRO E  1 33  ? -13.031 -46.795 11.358  1.00 0.00 ? 39  PRO E O     1 
ATOM 4152  C CB    . PRO E  1 33  ? -11.550 -43.915 11.373  1.00 0.00 ? 39  PRO E CB    1 
ATOM 4153  C CG    . PRO E  1 33  ? -10.525 -43.703 12.424  1.00 0.00 ? 39  PRO E CG    1 
ATOM 4154  C CD    . PRO E  1 33  ? -11.282 -43.416 13.684  1.00 0.00 ? 39  PRO E CD    1 
ATOM 4155  N N     . VAL E  1 34  ? -11.844 -46.512 13.245  1.00 0.00 ? 40  VAL E N     1 
ATOM 4156  C CA    . VAL E  1 34  ? -11.623 -47.918 13.439  1.00 0.00 ? 40  VAL E CA    1 
ATOM 4157  C C     . VAL E  1 34  ? -12.909 -48.582 13.835  1.00 0.00 ? 40  VAL E C     1 
ATOM 4158  O O     . VAL E  1 34  ? -13.311 -49.586 13.245  1.00 0.00 ? 40  VAL E O     1 
ATOM 4159  C CB    . VAL E  1 34  ? -10.581 -48.143 14.531  1.00 0.00 ? 40  VAL E CB    1 
ATOM 4160  C CG1   . VAL E  1 34  ? -10.454 -49.623 14.831  1.00 0.00 ? 40  VAL E CG1   1 
ATOM 4161  C CG2   . VAL E  1 34  ? -9.252  -47.554 14.102  1.00 0.00 ? 40  VAL E CG2   1 
ATOM 4162  N N     . ALA E  1 35  ? -13.576 -48.001 14.819  1.00 0.00 ? 41  ALA E N     1 
ATOM 4163  C CA    . ALA E  1 35  ? -14.842 -48.498 15.282  1.00 0.00 ? 41  ALA E CA    1 
ATOM 4164  C C     . ALA E  1 35  ? -15.852 -48.474 14.177  1.00 0.00 ? 41  ALA E C     1 
ATOM 4165  O O     . ALA E  1 35  ? -16.653 -49.394 14.043  1.00 0.00 ? 41  ALA E O     1 
ATOM 4166  C CB    . ALA E  1 35  ? -15.336 -47.675 16.456  1.00 0.00 ? 41  ALA E CB    1 
ATOM 4167  N N     . GLN E  1 36  ? -15.798 -47.429 13.360  1.00 0.00 ? 42  GLN E N     1 
ATOM 4168  C CA    . GLN E  1 36  ? -16.720 -47.278 12.259  1.00 0.00 ? 42  GLN E CA    1 
ATOM 4169  C C     . GLN E  1 36  ? -16.612 -48.433 11.330  1.00 0.00 ? 42  GLN E C     1 
ATOM 4170  O O     . GLN E  1 36  ? -17.618 -48.998 10.916  1.00 0.00 ? 42  GLN E O     1 
ATOM 4171  C CB    . GLN E  1 36  ? -16.432 -46.003 11.509  1.00 0.00 ? 42  GLN E CB    1 
ATOM 4172  C CG    . GLN E  1 36  ? -16.719 -44.763 12.303  1.00 0.00 ? 42  GLN E CG    1 
ATOM 4173  C CD    . GLN E  1 36  ? -16.389 -43.507 11.545  1.00 0.00 ? 42  GLN E CD    1 
ATOM 4174  O OE1   . GLN E  1 36  ? -16.590 -43.428 10.331  1.00 0.00 ? 42  GLN E OE1   1 
ATOM 4175  N NE2   . GLN E  1 36  ? -15.875 -42.513 12.252  1.00 0.00 ? 42  GLN E NE2   1 
ATOM 4176  N N     . GLN E  1 37  ? -15.385 -48.817 11.026  1.00 0.00 ? 43  GLN E N     1 
ATOM 4177  C CA    . GLN E  1 37  ? -15.145 -49.953 10.178  1.00 0.00 ? 43  GLN E CA    1 
ATOM 4178  C C     . GLN E  1 37  ? -15.754 -51.199 10.744  1.00 0.00 ? 43  GLN E C     1 
ATOM 4179  O O     . GLN E  1 37  ? -16.422 -51.949 10.033  1.00 0.00 ? 43  GLN E O     1 
ATOM 4180  C CB    . GLN E  1 37  ? -13.656 -50.170 9.996   1.00 0.00 ? 43  GLN E CB    1 
ATOM 4181  C CG    . GLN E  1 37  ? -13.323 -51.340 9.116   1.00 0.00 ? 43  GLN E CG    1 
ATOM 4182  C CD    . GLN E  1 37  ? -13.741 -51.114 7.693   1.00 0.00 ? 43  GLN E CD    1 
ATOM 4183  O OE1   . GLN E  1 37  ? -13.371 -50.108 7.088   1.00 0.00 ? 43  GLN E OE1   1 
ATOM 4184  N NE2   . GLN E  1 37  ? -14.517 -52.040 7.143   1.00 0.00 ? 43  GLN E NE2   1 
ATOM 4185  N N     . ASN E  1 38  ? -15.527 -51.427 12.026  1.00 0.00 ? 44  ASN E N     1 
ATOM 4186  C CA    . ASN E  1 38  ? -15.991 -52.630 12.673  1.00 0.00 ? 44  ASN E CA    1 
ATOM 4187  C C     . ASN E  1 38  ? -17.495 -52.694 12.735  1.00 0.00 ? 44  ASN E C     1 
ATOM 4188  O O     . ASN E  1 38  ? -18.088 -53.751 12.515  1.00 0.00 ? 44  ASN E O     1 
ATOM 4189  C CB    . ASN E  1 38  ? -15.390 -52.725 14.040  1.00 0.00 ? 44  ASN E CB    1 
ATOM 4190  C CG    . ASN E  1 38  ? -13.933 -53.046 13.965  1.00 0.00 ? 44  ASN E CG    1 
ATOM 4191  O OD1   . ASN E  1 38  ? -13.473 -53.605 12.961  1.00 0.00 ? 44  ASN E OD1   1 
ATOM 4192  N ND2   . ASN E  1 38  ? -13.191 -52.696 14.985  1.00 0.00 ? 44  ASN E ND2   1 
ATOM 4193  N N     . PHE E  1 39  ? -18.120 -51.560 13.006  1.00 0.00 ? 45  PHE E N     1 
ATOM 4194  C CA    . PHE E  1 39  ? -19.561 -51.488 13.073  1.00 0.00 ? 45  PHE E CA    1 
ATOM 4195  C C     . PHE E  1 39  ? -20.153 -51.787 11.724  1.00 0.00 ? 45  PHE E C     1 
ATOM 4196  O O     . PHE E  1 39  ? -21.058 -52.603 11.597  1.00 0.00 ? 45  PHE E O     1 
ATOM 4197  C CB    . PHE E  1 39  ? -20.005 -50.115 13.506  1.00 0.00 ? 45  PHE E CB    1 
ATOM 4198  C CG    . PHE E  1 39  ? -21.471 -50.025 13.737  1.00 0.00 ? 45  PHE E CG    1 
ATOM 4199  C CD1   . PHE E  1 39  ? -21.978 -50.039 15.021  1.00 0.00 ? 45  PHE E CD1   1 
ATOM 4200  C CD2   . PHE E  1 39  ? -22.355 -49.967 12.680  1.00 0.00 ? 45  PHE E CD2   1 
ATOM 4201  C CE1   . PHE E  1 39  ? -23.336 -49.954 15.250  1.00 0.00 ? 45  PHE E CE1   1 
ATOM 4202  C CE2   . PHE E  1 39  ? -23.718 -49.891 12.905  1.00 0.00 ? 45  PHE E CE2   1 
ATOM 4203  C CZ    . PHE E  1 39  ? -24.208 -49.874 14.190  1.00 0.00 ? 45  PHE E CZ    1 
ATOM 4204  N N     . GLN E  1 40  ? -19.629 -51.135 10.702  1.00 0.00 ? 46  GLN E N     1 
ATOM 4205  C CA    . GLN E  1 40  ? -20.108 -51.330 9.353   1.00 0.00 ? 46  GLN E CA    1 
ATOM 4206  C C     . GLN E  1 40  ? -19.875 -52.732 8.866   1.00 0.00 ? 46  GLN E C     1 
ATOM 4207  O O     . GLN E  1 40  ? -20.685 -53.279 8.123   1.00 0.00 ? 46  GLN E O     1 
ATOM 4208  C CB    . GLN E  1 40  ? -19.429 -50.367 8.411   1.00 0.00 ? 46  GLN E CB    1 
ATOM 4209  C CG    . GLN E  1 40  ? -19.849 -48.936 8.577   1.00 0.00 ? 46  GLN E CG    1 
ATOM 4210  C CD    . GLN E  1 40  ? -19.018 -48.024 7.726   1.00 0.00 ? 46  GLN E CD    1 
ATOM 4211  O OE1   . GLN E  1 40  ? -17.787 -48.119 7.720   1.00 0.00 ? 46  GLN E OE1   1 
ATOM 4212  N NE2   . GLN E  1 40  ? -19.676 -47.144 6.986   1.00 0.00 ? 46  GLN E NE2   1 
ATOM 4213  N N     . THR E  1 41  ? -18.757 -53.311 9.251   1.00 0.00 ? 47  THR E N     1 
ATOM 4214  C CA    . THR E  1 41  ? -18.408 -54.629 8.787   1.00 0.00 ? 47  THR E CA    1 
ATOM 4215  C C     . THR E  1 41  ? -19.337 -55.710 9.309   1.00 0.00 ? 47  THR E C     1 
ATOM 4216  O O     . THR E  1 41  ? -19.767 -56.572 8.549   1.00 0.00 ? 47  THR E O     1 
ATOM 4217  C CB    . THR E  1 41  ? -16.974 -54.974 9.178   1.00 0.00 ? 47  THR E CB    1 
ATOM 4218  O OG1   . THR E  1 41  ? -16.076 -54.040 8.571   1.00 0.00 ? 47  THR E OG1   1 
ATOM 4219  C CG2   . THR E  1 41  ? -16.627 -56.377 8.720   1.00 0.00 ? 47  THR E CG2   1 
ATOM 4220  N N     . ASN E  1 42  ? -19.626 -55.696 10.601  1.00 0.00 ? 48  ASN E N     1 
ATOM 4221  C CA    . ASN E  1 42  ? -20.397 -56.783 11.174  1.00 0.00 ? 48  ASN E CA    1 
ATOM 4222  C C     . ASN E  1 42  ? -21.882 -56.517 11.358  1.00 0.00 ? 48  ASN E C     1 
ATOM 4223  O O     . ASN E  1 42  ? -22.677 -57.437 11.249  1.00 0.00 ? 48  ASN E O     1 
ATOM 4224  C CB    . ASN E  1 42  ? -19.786 -57.220 12.480  1.00 0.00 ? 48  ASN E CB    1 
ATOM 4225  C CG    . ASN E  1 42  ? -18.485 -57.955 12.283  1.00 0.00 ? 48  ASN E CG    1 
ATOM 4226  O OD1   . ASN E  1 42  ? -18.266 -58.580 11.234  1.00 0.00 ? 48  ASN E OD1   1 
ATOM 4227  N ND2   . ASN E  1 42  ? -17.625 -57.915 13.270  1.00 0.00 ? 48  ASN E ND2   1 
ATOM 4228  N N     . VAL E  1 43  ? -22.277 -55.284 11.628  1.00 0.00 ? 49  VAL E N     1 
ATOM 4229  C CA    . VAL E  1 43  ? -23.681 -55.035 11.976  1.00 0.00 ? 49  VAL E CA    1 
ATOM 4230  C C     . VAL E  1 43  ? -24.724 -55.445 10.921  1.00 0.00 ? 49  VAL E C     1 
ATOM 4231  O O     . VAL E  1 43  ? -25.725 -56.063 11.282  1.00 0.00 ? 49  VAL E O     1 
ATOM 4232  C CB    . VAL E  1 43  ? -23.891 -53.587 12.377  1.00 0.00 ? 49  VAL E CB    1 
ATOM 4233  C CG1   . VAL E  1 43  ? -25.370 -53.280 12.486  1.00 0.00 ? 49  VAL E CG1   1 
ATOM 4234  C CG2   . VAL E  1 43  ? -23.224 -53.384 13.702  1.00 0.00 ? 49  VAL E CG2   1 
ATOM 4235  N N     . PRO E  1 44  ? -24.523 -55.131 9.629   1.00 0.00 ? 50  PRO E N     1 
ATOM 4236  C CA    . PRO E  1 44  ? -25.379 -55.464 8.503   1.00 0.00 ? 50  PRO E CA    1 
ATOM 4237  C C     . PRO E  1 44  ? -25.678 -56.953 8.461   1.00 0.00 ? 50  PRO E C     1 
ATOM 4238  O O     . PRO E  1 44  ? -26.738 -57.368 7.987   1.00 0.00 ? 50  PRO E O     1 
ATOM 4239  C CB    . PRO E  1 44  ? -24.560 -55.029 7.301   1.00 0.00 ? 50  PRO E CB    1 
ATOM 4240  C CG    . PRO E  1 44  ? -23.717 -53.927 7.812   1.00 0.00 ? 50  PRO E CG    1 
ATOM 4241  C CD    . PRO E  1 44  ? -23.349 -54.352 9.194   1.00 0.00 ? 50  PRO E CD    1 
ATOM 4242  N N     . LYS E  1 45  ? -24.740 -57.759 8.959   1.00 0.00 ? 51  LYS E N     1 
ATOM 4243  C CA    . LYS E  1 45  ? -24.880 -59.200 8.962   1.00 0.00 ? 51  LYS E CA    1 
ATOM 4244  C C     . LYS E  1 45  ? -26.006 -59.623 9.871   1.00 0.00 ? 51  LYS E C     1 
ATOM 4245  O O     . LYS E  1 45  ? -26.684 -60.611 9.610   1.00 0.00 ? 51  LYS E O     1 
ATOM 4246  C CB    . LYS E  1 45  ? -23.591 -59.846 9.436   1.00 0.00 ? 51  LYS E CB    1 
ATOM 4247  C CG    . LYS E  1 45  ? -22.412 -59.669 8.499   1.00 0.00 ? 51  LYS E CG    1 
ATOM 4248  C CD    . LYS E  1 45  ? -21.136 -60.201 9.129   1.00 0.00 ? 51  LYS E CD    1 
ATOM 4249  C CE    . LYS E  1 45  ? -19.937 -59.985 8.223   1.00 0.00 ? 51  LYS E CE    1 
ATOM 4250  N NZ    . LYS E  1 45  ? -18.662 -60.336 8.899   1.00 0.00 ? 51  LYS E NZ    1 
ATOM 4251  N N     . PHE E  1 46  ? -26.197 -58.875 10.949  1.00 0.00 ? 52  PHE E N     1 
ATOM 4252  C CA    . PHE E  1 46  ? -27.209 -59.190 11.923  1.00 0.00 ? 52  PHE E CA    1 
ATOM 4253  C C     . PHE E  1 46  ? -28.504 -58.495 11.616  1.00 0.00 ? 52  PHE E C     1 
ATOM 4254  O O     . PHE E  1 46  ? -29.570 -58.979 11.982  1.00 0.00 ? 52  PHE E O     1 
ATOM 4255  C CB    . PHE E  1 46  ? -26.723 -58.822 13.299  1.00 0.00 ? 52  PHE E CB    1 
ATOM 4256  C CG    . PHE E  1 46  ? -25.620 -59.704 13.751  1.00 0.00 ? 52  PHE E CG    1 
ATOM 4257  C CD1   . PHE E  1 46  ? -24.314 -59.390 13.449  1.00 0.00 ? 52  PHE E CD1   1 
ATOM 4258  C CD2   . PHE E  1 46  ? -25.879 -60.853 14.471  1.00 0.00 ? 52  PHE E CD2   1 
ATOM 4259  C CE1   . PHE E  1 46  ? -23.287 -60.209 13.851  1.00 0.00 ? 52  PHE E CE1   1 
ATOM 4260  C CE2   . PHE E  1 46  ? -24.855 -61.669 14.885  1.00 0.00 ? 52  PHE E CE2   1 
ATOM 4261  C CZ    . PHE E  1 46  ? -23.557 -61.350 14.574  1.00 0.00 ? 52  PHE E CZ    1 
ATOM 4262  N N     . THR E  1 47  ? -28.429 -57.376 10.916  1.00 0.00 ? 53  THR E N     1 
ATOM 4263  C CA    . THR E  1 47  ? -29.637 -56.708 10.501  1.00 0.00 ? 53  THR E CA    1 
ATOM 4264  C C     . THR E  1 47  ? -30.418 -57.579 9.558   1.00 0.00 ? 53  THR E C     1 
ATOM 4265  O O     . THR E  1 47  ? -31.635 -57.691 9.676   1.00 0.00 ? 53  THR E O     1 
ATOM 4266  C CB    . THR E  1 47  ? -29.357 -55.382 9.835   1.00 0.00 ? 53  THR E CB    1 
ATOM 4267  O OG1   . THR E  1 47  ? -28.720 -54.502 10.765  1.00 0.00 ? 53  THR E OG1   1 
ATOM 4268  C CG2   . THR E  1 47  ? -30.660 -54.773 9.362   1.00 0.00 ? 53  THR E CG2   1 
ATOM 4269  N N     . SER E  1 48  ? -29.718 -58.220 8.627   1.00 0.00 ? 54  SER E N     1 
ATOM 4270  C CA    . SER E  1 48  ? -30.375 -59.109 7.689   1.00 0.00 ? 54  SER E CA    1 
ATOM 4271  C C     . SER E  1 48  ? -31.035 -60.277 8.409   1.00 0.00 ? 54  SER E C     1 
ATOM 4272  O O     . SER E  1 48  ? -32.079 -60.764 7.982   1.00 0.00 ? 54  SER E O     1 
ATOM 4273  C CB    . SER E  1 48  ? -29.379 -59.633 6.688   1.00 0.00 ? 54  SER E CB    1 
ATOM 4274  O OG    . SER E  1 48  ? -28.455 -60.486 7.304   1.00 0.00 ? 54  SER E OG    1 
ATOM 4275  N N     . VAL E  1 49  ? -30.454 -60.682 9.536   1.00 0.00 ? 55  VAL E N     1 
ATOM 4276  C CA    . VAL E  1 49  ? -31.031 -61.730 10.353  1.00 0.00 ? 55  VAL E CA    1 
ATOM 4277  C C     . VAL E  1 49  ? -32.305 -61.259 10.978  1.00 0.00 ? 55  VAL E C     1 
ATOM 4278  O O     . VAL E  1 49  ? -33.319 -61.941 10.918  1.00 0.00 ? 55  VAL E O     1 
ATOM 4279  C CB    . VAL E  1 49  ? -30.062 -62.162 11.455  1.00 0.00 ? 55  VAL E CB    1 
ATOM 4280  C CG1   . VAL E  1 49  ? -30.751 -63.105 12.417  1.00 0.00 ? 55  VAL E CG1   1 
ATOM 4281  C CG2   . VAL E  1 49  ? -28.862 -62.829 10.836  1.00 0.00 ? 55  VAL E CG2   1 
ATOM 4282  N N     . ASN E  1 50  ? -32.273 -60.064 11.542  1.00 0.00 ? 56  ASN E N     1 
ATOM 4283  C CA    . ASN E  1 50  ? -33.446 -59.494 12.163  1.00 0.00 ? 56  ASN E CA    1 
ATOM 4284  C C     . ASN E  1 50  ? -34.572 -59.410 11.185  1.00 0.00 ? 56  ASN E C     1 
ATOM 4285  O O     . ASN E  1 50  ? -35.715 -59.681 11.528  1.00 0.00 ? 56  ASN E O     1 
ATOM 4286  C CB    . ASN E  1 50  ? -33.143 -58.130 12.710  1.00 0.00 ? 56  ASN E CB    1 
ATOM 4287  C CG    . ASN E  1 50  ? -32.310 -58.191 13.931  1.00 0.00 ? 56  ASN E CG    1 
ATOM 4288  O OD1   . ASN E  1 50  ? -32.276 -59.221 14.605  1.00 0.00 ? 56  ASN E OD1   1 
ATOM 4289  N ND2   . ASN E  1 50  ? -31.634 -57.116 14.236  1.00 0.00 ? 56  ASN E ND2   1 
ATOM 4290  N N     . GLU E  1 51  ? -34.250 -59.060 9.955   1.00 0.00 ? 57  GLU E N     1 
ATOM 4291  C CA    . GLU E  1 51  ? -35.241 -58.936 8.917   1.00 0.00 ? 57  GLU E CA    1 
ATOM 4292  C C     . GLU E  1 51  ? -35.854 -60.256 8.538   1.00 0.00 ? 57  GLU E C     1 
ATOM 4293  O O     . GLU E  1 51  ? -37.077 -60.391 8.507   1.00 0.00 ? 57  GLU E O     1 
ATOM 4294  C CB    . GLU E  1 51  ? -34.628 -58.318 7.684   1.00 0.00 ? 57  GLU E CB    1 
ATOM 4295  C CG    . GLU E  1 51  ? -35.593 -58.198 6.536   1.00 0.00 ? 57  GLU E CG    1 
ATOM 4296  C CD    . GLU E  1 51  ? -36.703 -57.258 6.841   1.00 0.00 ? 57  GLU E CD    1 
ATOM 4297  O OE1   . GLU E  1 51  ? -36.494 -56.370 7.632   1.00 0.00 ? 57  GLU E OE1   1 
ATOM 4298  O OE2   . GLU E  1 51  ? -37.770 -57.433 6.304   1.00 0.00 ? 57  GLU E OE2   1 
ATOM 4299  N N     . ASN E  1 52  ? -35.015 -61.222 8.222   1.00 0.00 ? 58  ASN E N     1 
ATOM 4300  C CA    . ASN E  1 52  ? -35.504 -62.494 7.759   1.00 0.00 ? 58  ASN E CA    1 
ATOM 4301  C C     . ASN E  1 52  ? -36.227 -63.241 8.854   1.00 0.00 ? 58  ASN E C     1 
ATOM 4302  O O     . ASN E  1 52  ? -37.265 -63.852 8.610   1.00 0.00 ? 58  ASN E O     1 
ATOM 4303  C CB    . ASN E  1 52  ? -34.383 -63.303 7.201   1.00 0.00 ? 58  ASN E CB    1 
ATOM 4304  C CG    . ASN E  1 52  ? -33.883 -62.754 5.901   1.00 0.00 ? 58  ASN E CG    1 
ATOM 4305  O OD1   . ASN E  1 52  ? -34.559 -61.950 5.251   1.00 0.00 ? 58  ASN E OD1   1 
ATOM 4306  N ND2   . ASN E  1 52  ? -32.711 -63.176 5.504   1.00 0.00 ? 58  ASN E ND2   1 
ATOM 4307  N N     . VAL E  1 53  ? -35.710 -63.161 10.071  1.00 0.00 ? 59  VAL E N     1 
ATOM 4308  C CA    . VAL E  1 53  ? -36.356 -63.790 11.200  1.00 0.00 ? 59  VAL E CA    1 
ATOM 4309  C C     . VAL E  1 53  ? -37.682 -63.136 11.473  1.00 0.00 ? 59  VAL E C     1 
ATOM 4310  O O     . VAL E  1 53  ? -38.655 -63.813 11.784  1.00 0.00 ? 59  VAL E O     1 
ATOM 4311  C CB    . VAL E  1 53  ? -35.473 -63.726 12.446  1.00 0.00 ? 59  VAL E CB    1 
ATOM 4312  C CG1   . VAL E  1 53  ? -36.255 -64.198 13.659  1.00 0.00 ? 59  VAL E CG1   1 
ATOM 4313  C CG2   . VAL E  1 53  ? -34.249 -64.598 12.243  1.00 0.00 ? 59  VAL E CG2   1 
ATOM 4314  N N     . SER E  1 54  ? -37.732 -61.819 11.350  1.00 0.00 ? 60  SER E N     1 
ATOM 4315  C CA    . SER E  1 54  ? -38.971 -61.109 11.527  1.00 0.00 ? 60  SER E CA    1 
ATOM 4316  C C     . SER E  1 54  ? -40.012 -61.618 10.567  1.00 0.00 ? 60  SER E C     1 
ATOM 4317  O O     . SER E  1 54  ? -41.151 -61.861 10.960  1.00 0.00 ? 60  SER E O     1 
ATOM 4318  C CB    . SER E  1 54  ? -38.768 -59.636 11.319  1.00 0.00 ? 60  SER E CB    1 
ATOM 4319  O OG    . SER E  1 54  ? -39.967 -58.940 11.488  1.00 0.00 ? 60  SER E OG    1 
ATOM 4320  N N     . ALA E  1 55  ? -39.626 -61.795 9.307   1.00 0.00 ? 61  ALA E N     1 
ATOM 4321  C CA    . ALA E  1 55  ? -40.547 -62.302 8.304   1.00 0.00 ? 61  ALA E CA    1 
ATOM 4322  C C     . ALA E  1 55  ? -41.137 -63.618 8.744   1.00 0.00 ? 61  ALA E C     1 
ATOM 4323  O O     . ALA E  1 55  ? -42.352 -63.812 8.680   1.00 0.00 ? 61  ALA E O     1 
ATOM 4324  C CB    . ALA E  1 55  ? -39.843 -62.464 6.974   1.00 0.00 ? 61  ALA E CB    1 
ATOM 4325  N N     . VAL E  1 56  ? -40.285 -64.501 9.234   1.00 0.00 ? 62  VAL E N     1 
ATOM 4326  C CA    . VAL E  1 56  ? -40.717 -65.788 9.736   1.00 0.00 ? 62  VAL E CA    1 
ATOM 4327  C C     . VAL E  1 56  ? -41.717 -65.649 10.844  1.00 0.00 ? 62  VAL E C     1 
ATOM 4328  O O     . VAL E  1 56  ? -42.768 -66.285 10.827  1.00 0.00 ? 62  VAL E O     1 
ATOM 4329  C CB    . VAL E  1 56  ? -39.517 -66.573 10.255  1.00 0.00 ? 62  VAL E CB    1 
ATOM 4330  C CG1   . VAL E  1 56  ? -39.965 -67.802 11.001  1.00 0.00 ? 62  VAL E CG1   1 
ATOM 4331  C CG2   . VAL E  1 56  ? -38.649 -66.959 9.103   1.00 0.00 ? 62  VAL E CG2   1 
ATOM 4332  N N     . LEU E  1 57  ? -41.405 -64.805 11.801  1.00 0.00 ? 63  LEU E N     1 
ATOM 4333  C CA    . LEU E  1 57  ? -42.233 -64.640 12.964  1.00 0.00 ? 63  LEU E CA    1 
ATOM 4334  C C     . LEU E  1 57  ? -43.601 -64.122 12.607  1.00 0.00 ? 63  LEU E C     1 
ATOM 4335  O O     . LEU E  1 57  ? -44.597 -64.526 13.201  1.00 0.00 ? 63  LEU E O     1 
ATOM 4336  C CB    . LEU E  1 57  ? -41.538 -63.721 13.933  1.00 0.00 ? 63  LEU E CB    1 
ATOM 4337  C CG    . LEU E  1 57  ? -40.280 -64.324 14.541  1.00 0.00 ? 63  LEU E CG    1 
ATOM 4338  C CD1   . LEU E  1 57  ? -39.566 -63.287 15.374  1.00 0.00 ? 63  LEU E CD1   1 
ATOM 4339  C CD2   . LEU E  1 57  ? -40.665 -65.533 15.360  1.00 0.00 ? 63  LEU E CD2   1 
ATOM 4340  N N     . THR E  1 58  ? -43.670 -63.271 11.599  1.00 0.00 ? 64  THR E N     1 
ATOM 4341  C CA    . THR E  1 58  ? -44.949 -62.794 11.127  1.00 0.00 ? 64  THR E CA    1 
ATOM 4342  C C     . THR E  1 58  ? -45.756 -63.932 10.521  1.00 0.00 ? 64  THR E C     1 
ATOM 4343  O O     . THR E  1 58  ? -46.956 -64.046 10.764  1.00 0.00 ? 64  THR E O     1 
ATOM 4344  C CB    . THR E  1 58  ? -44.780 -61.646 10.146  1.00 0.00 ? 64  THR E CB    1 
ATOM 4345  O OG1   . THR E  1 58  ? -44.140 -60.553 10.828  1.00 0.00 ? 64  THR E OG1   1 
ATOM 4346  C CG2   . THR E  1 58  ? -46.134 -61.194 9.620   1.00 0.00 ? 64  THR E CG2   1 
ATOM 4347  N N     . GLN E  1 59  ? -45.087 -64.812 9.777   1.00 0.00 ? 65  GLN E N     1 
ATOM 4348  C CA    . GLN E  1 59  ? -45.753 -65.992 9.220   1.00 0.00 ? 65  GLN E CA    1 
ATOM 4349  C C     . GLN E  1 59  ? -46.273 -66.927 10.320  1.00 0.00 ? 65  GLN E C     1 
ATOM 4350  O O     . GLN E  1 59  ? -47.294 -67.587 10.147  1.00 0.00 ? 65  GLN E O     1 
ATOM 4351  C CB    . GLN E  1 59  ? -44.816 -66.769 8.307   1.00 0.00 ? 65  GLN E CB    1 
ATOM 4352  C CG    . GLN E  1 59  ? -44.479 -66.067 7.014   1.00 0.00 ? 65  GLN E CG    1 
ATOM 4353  C CD    . GLN E  1 59  ? -43.531 -66.879 6.149   1.00 0.00 ? 65  GLN E CD    1 
ATOM 4354  O OE1   . GLN E  1 59  ? -43.170 -68.011 6.485   1.00 0.00 ? 65  GLN E OE1   1 
ATOM 4355  N NE2   . GLN E  1 59  ? -43.124 -66.306 5.024   1.00 0.00 ? 65  GLN E NE2   1 
ATOM 4356  N N     . TYR E  1 60  ? -45.571 -66.980 11.451  1.00 0.00 ? 66  TYR E N     1 
ATOM 4357  C CA    . TYR E  1 60  ? -46.010 -67.807 12.572  1.00 0.00 ? 66  TYR E CA    1 
ATOM 4358  C C     . TYR E  1 60  ? -46.944 -67.098 13.538  1.00 0.00 ? 66  TYR E C     1 
ATOM 4359  O O     . TYR E  1 60  ? -47.332 -67.674 14.550  1.00 0.00 ? 66  TYR E O     1 
ATOM 4360  C CB    . TYR E  1 60  ? -44.823 -68.356 13.328  1.00 0.00 ? 66  TYR E CB    1 
ATOM 4361  C CG    . TYR E  1 60  ? -44.193 -69.519 12.641  1.00 0.00 ? 66  TYR E CG    1 
ATOM 4362  C CD1   . TYR E  1 60  ? -43.077 -69.346 11.869  1.00 0.00 ? 66  TYR E CD1   1 
ATOM 4363  C CD2   . TYR E  1 60  ? -44.749 -70.771 12.786  1.00 0.00 ? 66  TYR E CD2   1 
ATOM 4364  C CE1   . TYR E  1 60  ? -42.512 -70.423 11.229  1.00 0.00 ? 66  TYR E CE1   1 
ATOM 4365  C CE2   . TYR E  1 60  ? -44.184 -71.851 12.153  1.00 0.00 ? 66  TYR E CE2   1 
ATOM 4366  C CZ    . TYR E  1 60  ? -43.068 -71.677 11.376  1.00 0.00 ? 66  TYR E CZ    1 
ATOM 4367  O OH    . TYR E  1 60  ? -42.500 -72.751 10.740  1.00 0.00 ? 66  TYR E OH    1 
ATOM 4368  N N     . GLY E  1 61  ? -47.302 -65.858 13.252  1.00 0.00 ? 67  GLY E N     1 
ATOM 4369  C CA    . GLY E  1 61  ? -48.262 -65.163 14.091  1.00 0.00 ? 67  GLY E CA    1 
ATOM 4370  C C     . GLY E  1 61  ? -47.675 -64.690 15.414  1.00 0.00 ? 67  GLY E C     1 
ATOM 4371  O O     . GLY E  1 61  ? -48.414 -64.416 16.361  1.00 0.00 ? 67  GLY E O     1 
ATOM 4372  N N     . ILE E  1 62  ? -46.359 -64.575 15.476  1.00 0.00 ? 68  ILE E N     1 
ATOM 4373  C CA    . ILE E  1 62  ? -45.689 -64.201 16.707  1.00 0.00 ? 68  ILE E CA    1 
ATOM 4374  C C     . ILE E  1 62  ? -45.682 -62.698 16.871  1.00 0.00 ? 68  ILE E C     1 
ATOM 4375  O O     . ILE E  1 62  ? -45.277 -61.973 15.965  1.00 0.00 ? 68  ILE E O     1 
ATOM 4376  C CB    . ILE E  1 62  ? -44.255 -64.721 16.716  1.00 0.00 ? 68  ILE E CB    1 
ATOM 4377  C CG1   . ILE E  1 62  ? -44.237 -66.228 16.484  1.00 0.00 ? 68  ILE E CG1   1 
ATOM 4378  C CG2   . ILE E  1 62  ? -43.599 -64.394 18.029  1.00 0.00 ? 68  ILE E CG2   1 
ATOM 4379  C CD1   . ILE E  1 62  ? -45.003 -67.011 17.518  1.00 0.00 ? 68  ILE E CD1   1 
ATOM 4380  N N     . THR E  1 63  ? -46.152 -62.225 18.019  1.00 0.00 ? 69  THR E N     1 
ATOM 4381  C CA    . THR E  1 63  ? -46.235 -60.785 18.273  1.00 0.00 ? 69  THR E CA    1 
ATOM 4382  C C     . THR E  1 63  ? -45.579 -60.388 19.581  1.00 0.00 ? 69  THR E C     1 
ATOM 4383  O O     . THR E  1 63  ? -45.364 -61.219 20.464  1.00 0.00 ? 69  THR E O     1 
ATOM 4384  C CB    . THR E  1 63  ? -47.677 -60.333 18.335  1.00 0.00 ? 69  THR E CB    1 
ATOM 4385  O OG1   . THR E  1 63  ? -48.288 -60.976 19.447  1.00 0.00 ? 69  THR E OG1   1 
ATOM 4386  C CG2   . THR E  1 63  ? -48.430 -60.690 17.064  1.00 0.00 ? 69  THR E CG2   1 
ATOM 4387  N N     . GLY E  1 64  ? -45.322 -59.102 19.721  1.00 0.00 ? 70  GLY E N     1 
ATOM 4388  C CA    . GLY E  1 64  ? -44.791 -58.554 20.948  1.00 0.00 ? 70  GLY E CA    1 
ATOM 4389  C C     . GLY E  1 64  ? -43.435 -59.129 21.290  1.00 0.00 ? 70  GLY E C     1 
ATOM 4390  O O     . GLY E  1 64  ? -42.661 -59.510 20.410  1.00 0.00 ? 70  GLY E O     1 
ATOM 4391  N N     . PRO E  1 65  ? -43.155 -59.228 22.578  1.00 0.00 ? 71  PRO E N     1 
ATOM 4392  C CA    . PRO E  1 65  ? -41.941 -59.722 23.181  1.00 0.00 ? 71  PRO E CA    1 
ATOM 4393  C C     . PRO E  1 65  ? -41.659 -61.143 22.783  1.00 0.00 ? 71  PRO E C     1 
ATOM 4394  O O     . PRO E  1 65  ? -40.527 -61.602 22.888  1.00 0.00 ? 71  PRO E O     1 
ATOM 4395  C CB    . PRO E  1 65  ? -42.197 -59.562 24.662  1.00 0.00 ? 71  PRO E CB    1 
ATOM 4396  C CG    . PRO E  1 65  ? -43.078 -58.356 24.750  1.00 0.00 ? 71  PRO E CG    1 
ATOM 4397  C CD    . PRO E  1 65  ? -43.929 -58.400 23.518  1.00 0.00 ? 71  PRO E CD    1 
ATOM 4398  N N     . ASN E  1 66  ? -42.671 -61.851 22.307  1.00 0.00 ? 72  ASN E N     1 
ATOM 4399  C CA    . ASN E  1 66  ? -42.457 -63.197 21.873  1.00 0.00 ? 72  ASN E CA    1 
ATOM 4400  C C     . ASN E  1 66  ? -41.593 -63.208 20.643  1.00 0.00 ? 72  ASN E C     1 
ATOM 4401  O O     . ASN E  1 66  ? -40.811 -64.134 20.436  1.00 0.00 ? 72  ASN E O     1 
ATOM 4402  C CB    . ASN E  1 66  ? -43.761 -63.878 21.635  1.00 0.00 ? 72  ASN E CB    1 
ATOM 4403  C CG    . ASN E  1 66  ? -44.462 -64.166 22.914  1.00 0.00 ? 72  ASN E CG    1 
ATOM 4404  O OD1   . ASN E  1 66  ? -43.823 -64.467 23.926  1.00 0.00 ? 72  ASN E OD1   1 
ATOM 4405  N ND2   . ASN E  1 66  ? -45.762 -64.052 22.908  1.00 0.00 ? 72  ASN E ND2   1 
ATOM 4406  N N     . ARG E  1 67  ? -41.699 -62.154 19.836  1.00 0.00 ? 73  ARG E N     1 
ATOM 4407  C CA    . ARG E  1 67  ? -40.863 -62.038 18.673  1.00 0.00 ? 73  ARG E CA    1 
ATOM 4408  C C     . ARG E  1 67  ? -39.466 -61.830 19.126  1.00 0.00 ? 73  ARG E C     1 
ATOM 4409  O O     . ARG E  1 67  ? -38.541 -62.447 18.608  1.00 0.00 ? 73  ARG E O     1 
ATOM 4410  C CB    . ARG E  1 67  ? -41.275 -60.868 17.804  1.00 0.00 ? 73  ARG E CB    1 
ATOM 4411  C CG    . ARG E  1 67  ? -42.626 -61.003 17.160  1.00 0.00 ? 73  ARG E CG    1 
ATOM 4412  C CD    . ARG E  1 67  ? -42.987 -59.797 16.400  1.00 0.00 ? 73  ARG E CD    1 
ATOM 4413  N NE    . ARG E  1 67  ? -42.261 -59.688 15.148  1.00 0.00 ? 73  ARG E NE    1 
ATOM 4414  C CZ    . ARG E  1 67  ? -42.724 -60.134 13.962  1.00 0.00 ? 73  ARG E CZ    1 
ATOM 4415  N NH1   . ARG E  1 67  ? -43.878 -60.741 13.875  1.00 0.00 ? 73  ARG E NH1   1 
ATOM 4416  N NH2   . ARG E  1 67  ? -42.039 -59.953 12.854  1.00 0.00 ? 73  ARG E NH2   1 
ATOM 4417  N N     . ALA E  1 68  ? -39.320 -60.997 20.154  1.00 0.00 ? 74  ALA E N     1 
ATOM 4418  C CA    . ALA E  1 68  ? -38.013 -60.687 20.719  1.00 0.00 ? 74  ALA E CA    1 
ATOM 4419  C C     . ALA E  1 68  ? -37.302 -61.936 21.211  1.00 0.00 ? 74  ALA E C     1 
ATOM 4420  O O     . ALA E  1 68  ? -36.088 -62.051 21.069  1.00 0.00 ? 74  ALA E O     1 
ATOM 4421  C CB    . ALA E  1 68  ? -38.149 -59.685 21.848  1.00 0.00 ? 74  ALA E CB    1 
ATOM 4422  N N     . ILE E  1 69  ? -38.059 -62.890 21.751  1.00 0.00 ? 75  ILE E N     1 
ATOM 4423  C CA    . ILE E  1 69  ? -37.469 -64.147 22.190  1.00 0.00 ? 75  ILE E CA    1 
ATOM 4424  C C     . ILE E  1 69  ? -36.784 -64.846 21.051  1.00 0.00 ? 75  ILE E C     1 
ATOM 4425  O O     . ILE E  1 69  ? -35.623 -65.253 21.159  1.00 0.00 ? 75  ILE E O     1 
ATOM 4426  C CB    . ILE E  1 69  ? -38.528 -65.100 22.756  1.00 0.00 ? 75  ILE E CB    1 
ATOM 4427  C CG1   . ILE E  1 69  ? -39.084 -64.563 24.053  1.00 0.00 ? 75  ILE E CG1   1 
ATOM 4428  C CG2   . ILE E  1 69  ? -37.932 -66.482 22.956  1.00 0.00 ? 75  ILE E CG2   1 
ATOM 4429  C CD1   . ILE E  1 69  ? -40.311 -65.289 24.536  1.00 0.00 ? 75  ILE E CD1   1 
ATOM 4430  N N     . TYR E  1 70  ? -37.500 -64.989 19.954  1.00 0.00 ? 76  TYR E N     1 
ATOM 4431  C CA    . TYR E  1 70  ? -36.978 -65.703 18.818  1.00 0.00 ? 76  TYR E CA    1 
ATOM 4432  C C     . TYR E  1 70  ? -35.896 -64.919 18.110  1.00 0.00 ? 76  TYR E C     1 
ATOM 4433  O O     . TYR E  1 70  ? -34.949 -65.499 17.587  1.00 0.00 ? 76  TYR E O     1 
ATOM 4434  C CB    . TYR E  1 70  ? -38.100 -66.044 17.882  1.00 0.00 ? 76  TYR E CB    1 
ATOM 4435  C CG    . TYR E  1 70  ? -39.057 -67.024 18.487  1.00 0.00 ? 76  TYR E CG    1 
ATOM 4436  C CD1   . TYR E  1 70  ? -40.352 -66.644 18.754  1.00 0.00 ? 76  TYR E CD1   1 
ATOM 4437  C CD2   . TYR E  1 70  ? -38.626 -68.290 18.810  1.00 0.00 ? 76  TYR E CD2   1 
ATOM 4438  C CE1   . TYR E  1 70  ? -41.218 -67.530 19.346  1.00 0.00 ? 76  TYR E CE1   1 
ATOM 4439  C CE2   . TYR E  1 70  ? -39.488 -69.182 19.404  1.00 0.00 ? 76  TYR E CE2   1 
ATOM 4440  C CZ    . TYR E  1 70  ? -40.781 -68.802 19.675  1.00 0.00 ? 76  TYR E CZ    1 
ATOM 4441  O OH    . TYR E  1 70  ? -41.643 -69.677 20.283  1.00 0.00 ? 76  TYR E OH    1 
ATOM 4442  N N     . GLN E  1 71  ? -36.010 -63.597 18.129  1.00 0.00 ? 77  GLN E N     1 
ATOM 4443  C CA    . GLN E  1 71  ? -35.000 -62.757 17.536  1.00 0.00 ? 77  GLN E CA    1 
ATOM 4444  C C     . GLN E  1 71  ? -33.689 -62.926 18.257  1.00 0.00 ? 77  GLN E C     1 
ATOM 4445  O O     . GLN E  1 71  ? -32.646 -63.045 17.624  1.00 0.00 ? 77  GLN E O     1 
ATOM 4446  C CB    . GLN E  1 71  ? -35.432 -61.300 17.574  1.00 0.00 ? 77  GLN E CB    1 
ATOM 4447  C CG    . GLN E  1 71  ? -36.559 -60.963 16.618  1.00 0.00 ? 77  GLN E CG    1 
ATOM 4448  C CD    . GLN E  1 71  ? -36.098 -60.948 15.195  1.00 0.00 ? 77  GLN E CD    1 
ATOM 4449  O OE1   . GLN E  1 71  ? -35.017 -61.451 14.888  1.00 0.00 ? 77  GLN E OE1   1 
ATOM 4450  N NE2   . GLN E  1 71  ? -36.893 -60.353 14.313  1.00 0.00 ? 77  GLN E NE2   1 
ATOM 4451  N N     . GLY E  1 72  ? -33.747 -62.992 19.585  1.00 0.00 ? 78  GLY E N     1 
ATOM 4452  C CA    . GLY E  1 72  ? -32.550 -63.196 20.390  1.00 0.00 ? 78  GLY E CA    1 
ATOM 4453  C C     . GLY E  1 72  ? -31.892 -64.508 20.037  1.00 0.00 ? 78  GLY E C     1 
ATOM 4454  O O     . GLY E  1 72  ? -30.676 -64.572 19.850  1.00 0.00 ? 78  GLY E O     1 
ATOM 4455  N N     . PHE E  1 73  ? -32.699 -65.547 19.923  1.00 0.00 ? 79  PHE E N     1 
ATOM 4456  C CA    . PHE E  1 73  ? -32.215 -66.846 19.531  1.00 0.00 ? 79  PHE E CA    1 
ATOM 4457  C C     . PHE E  1 73  ? -31.506 -66.791 18.192  1.00 0.00 ? 79  PHE E C     1 
ATOM 4458  O O     . PHE E  1 73  ? -30.392 -67.291 18.057  1.00 0.00 ? 79  PHE E O     1 
ATOM 4459  C CB    . PHE E  1 73  ? -33.369 -67.818 19.471  1.00 0.00 ? 79  PHE E CB    1 
ATOM 4460  C CG    . PHE E  1 73  ? -33.025 -69.135 18.874  1.00 0.00 ? 79  PHE E CG    1 
ATOM 4461  C CD1   . PHE E  1 73  ? -32.395 -70.116 19.610  1.00 0.00 ? 79  PHE E CD1   1 
ATOM 4462  C CD2   . PHE E  1 73  ? -33.363 -69.402 17.567  1.00 0.00 ? 79  PHE E CD2   1 
ATOM 4463  C CE1   . PHE E  1 73  ? -32.111 -71.342 19.043  1.00 0.00 ? 79  PHE E CE1   1 
ATOM 4464  C CE2   . PHE E  1 73  ? -33.080 -70.615 16.998  1.00 0.00 ? 79  PHE E CE2   1 
ATOM 4465  C CZ    . PHE E  1 73  ? -32.454 -71.590 17.736  1.00 0.00 ? 79  PHE E CZ    1 
ATOM 4466  N N     . GLY E  1 74  ? -32.155 -66.191 17.201  1.00 0.00 ? 80  GLY E N     1 
ATOM 4467  C CA    . GLY E  1 74  ? -31.591 -66.081 15.866  1.00 0.00 ? 80  GLY E CA    1 
ATOM 4468  C C     . GLY E  1 74  ? -30.269 -65.338 15.876  1.00 0.00 ? 80  GLY E C     1 
ATOM 4469  O O     . GLY E  1 74  ? -29.298 -65.772 15.259  1.00 0.00 ? 80  GLY E O     1 
ATOM 4470  N N     . LEU E  1 75  ? -30.226 -64.238 16.594  1.00 0.00 ? 81  LEU E N     1 
ATOM 4471  C CA    . LEU E  1 75  ? -29.027 -63.442 16.682  1.00 0.00 ? 81  LEU E CA    1 
ATOM 4472  C C     . LEU E  1 75  ? -27.881 -64.230 17.277  1.00 0.00 ? 81  LEU E C     1 
ATOM 4473  O O     . LEU E  1 75  ? -26.746 -64.124 16.817  1.00 0.00 ? 81  LEU E O     1 
ATOM 4474  C CB    . LEU E  1 75  ? -29.303 -62.213 17.516  1.00 0.00 ? 81  LEU E CB    1 
ATOM 4475  C CG    . LEU E  1 75  ? -30.206 -61.183 16.862  1.00 0.00 ? 81  LEU E CG    1 
ATOM 4476  C CD1   . LEU E  1 75  ? -30.587 -60.128 17.882  1.00 0.00 ? 81  LEU E CD1   1 
ATOM 4477  C CD2   . LEU E  1 75  ? -29.470 -60.569 15.689  1.00 0.00 ? 81  LEU E CD2   1 
ATOM 4478  N N     . LYS E  1 76  ? -28.186 -65.051 18.268  1.00 0.00 ? 82  LYS E N     1 
ATOM 4479  C CA    . LYS E  1 76  ? -27.190 -65.895 18.884  1.00 0.00 ? 82  LYS E CA    1 
ATOM 4480  C C     . LYS E  1 76  ? -26.631 -66.901 17.912  1.00 0.00 ? 82  LYS E C     1 
ATOM 4481  O O     . LYS E  1 76  ? -25.424 -67.136 17.887  1.00 0.00 ? 82  LYS E O     1 
ATOM 4482  C CB    . LYS E  1 76  ? -27.774 -66.604 20.076  1.00 0.00 ? 82  LYS E CB    1 
ATOM 4483  C CG    . LYS E  1 76  ? -26.837 -67.582 20.737  1.00 0.00 ? 82  LYS E CG    1 
ATOM 4484  C CD    . LYS E  1 76  ? -25.651 -66.900 21.319  1.00 0.00 ? 82  LYS E CD    1 
ATOM 4485  C CE    . LYS E  1 76  ? -24.822 -67.854 22.144  1.00 0.00 ? 82  LYS E CE    1 
ATOM 4486  N NZ    . LYS E  1 76  ? -25.503 -68.194 23.415  1.00 0.00 ? 82  LYS E NZ    1 
ATOM 4487  N N     . VAL E  1 77  ? -27.500 -67.476 17.087  1.00 0.00 ? 83  VAL E N     1 
ATOM 4488  C CA    . VAL E  1 77  ? -27.054 -68.424 16.083  1.00 0.00 ? 83  VAL E CA    1 
ATOM 4489  C C     . VAL E  1 77  ? -26.055 -67.772 15.155  1.00 0.00 ? 83  VAL E C     1 
ATOM 4490  O O     . VAL E  1 77  ? -24.998 -68.335 14.870  1.00 0.00 ? 83  VAL E O     1 
ATOM 4491  C CB    . VAL E  1 77  ? -28.244 -68.951 15.255  1.00 0.00 ? 83  VAL E CB    1 
ATOM 4492  C CG1   . VAL E  1 77  ? -27.744 -69.762 14.079  1.00 0.00 ? 83  VAL E CG1   1 
ATOM 4493  C CG2   . VAL E  1 77  ? -29.151 -69.797 16.130  1.00 0.00 ? 83  VAL E CG2   1 
ATOM 4494  N N     . ALA E  1 78  ? -26.390 -66.573 14.697  1.00 0.00 ? 84  ALA E N     1 
ATOM 4495  C CA    . ALA E  1 78  ? -25.535 -65.823 13.802  1.00 0.00 ? 84  ALA E CA    1 
ATOM 4496  C C     . ALA E  1 78  ? -24.213 -65.460 14.462  1.00 0.00 ? 84  ALA E C     1 
ATOM 4497  O O     . ALA E  1 78  ? -23.168 -65.498 13.818  1.00 0.00 ? 84  ALA E O     1 
ATOM 4498  C CB    . ALA E  1 78  ? -26.249 -64.578 13.334  1.00 0.00 ? 84  ALA E CB    1 
ATOM 4499  N N     . ARG E  1 79  ? -24.257 -65.113 15.743  1.00 0.00 ? 85  ARG E N     1 
ATOM 4500  C CA    . ARG E  1 79  ? -23.049 -64.770 16.476  1.00 0.00 ? 85  ARG E CA    1 
ATOM 4501  C C     . ARG E  1 79  ? -22.061 -65.893 16.457  1.00 0.00 ? 85  ARG E C     1 
ATOM 4502  O O     . ARG E  1 79  ? -20.889 -65.697 16.130  1.00 0.00 ? 85  ARG E O     1 
ATOM 4503  C CB    . ARG E  1 79  ? -23.368 -64.435 17.904  1.00 0.00 ? 85  ARG E CB    1 
ATOM 4504  C CG    . ARG E  1 79  ? -22.165 -64.066 18.755  1.00 0.00 ? 85  ARG E CG    1 
ATOM 4505  C CD    . ARG E  1 79  ? -22.583 -63.689 20.121  1.00 0.00 ? 85  ARG E CD    1 
ATOM 4506  N NE    . ARG E  1 79  ? -21.553 -62.987 20.857  1.00 0.00 ? 85  ARG E NE    1 
ATOM 4507  C CZ    . ARG E  1 79  ? -20.584 -63.572 21.585  1.00 0.00 ? 85  ARG E CZ    1 
ATOM 4508  N NH1   . ARG E  1 79  ? -20.510 -64.883 21.641  1.00 0.00 ? 85  ARG E NH1   1 
ATOM 4509  N NH2   . ARG E  1 79  ? -19.712 -62.824 22.244  1.00 0.00 ? 85  ARG E NH2   1 
ATOM 4510  N N     . ALA E  1 80  ? -22.533 -67.077 16.803  1.00 0.00 ? 86  ALA E N     1 
ATOM 4511  C CA    . ALA E  1 80  ? -21.695 -68.250 16.816  1.00 0.00 ? 86  ALA E CA    1 
ATOM 4512  C C     . ALA E  1 80  ? -21.149 -68.519 15.438  1.00 0.00 ? 86  ALA E C     1 
ATOM 4513  O O     . ALA E  1 80  ? -19.976 -68.841 15.279  1.00 0.00 ? 86  ALA E O     1 
ATOM 4514  C CB    . ALA E  1 80  ? -22.479 -69.437 17.310  1.00 0.00 ? 86  ALA E CB    1 
ATOM 4515  N N     . LEU E  1 81  ? -21.984 -68.349 14.435  1.00 0.00 ? 87  LEU E N     1 
ATOM 4516  C CA    . LEU E  1 81  ? -21.552 -68.546 13.084  1.00 0.00 ? 87  LEU E CA    1 
ATOM 4517  C C     . LEU E  1 81  ? -20.369 -67.656 12.770  1.00 0.00 ? 87  LEU E C     1 
ATOM 4518  O O     . LEU E  1 81  ? -19.363 -68.123 12.252  1.00 0.00 ? 87  LEU E O     1 
ATOM 4519  C CB    . LEU E  1 81  ? -22.689 -68.269 12.122  1.00 0.00 ? 87  LEU E CB    1 
ATOM 4520  C CG    . LEU E  1 81  ? -22.353 -68.427 10.653  1.00 0.00 ? 87  LEU E CG    1 
ATOM 4521  C CD1   . LEU E  1 81  ? -21.939 -69.861 10.392  1.00 0.00 ? 87  LEU E CD1   1 
ATOM 4522  C CD2   . LEU E  1 81  ? -23.564 -68.047 9.821   1.00 0.00 ? 87  LEU E CD2   1 
ATOM 4523  N N     . ASN E  1 82  ? -20.459 -66.385 13.123  1.00 0.00 ? 88  ASN E N     1 
ATOM 4524  C CA    . ASN E  1 82  ? -19.356 -65.465 12.856  1.00 0.00 ? 88  ASN E CA    1 
ATOM 4525  C C     . ASN E  1 82  ? -18.079 -65.804 13.623  1.00 0.00 ? 88  ASN E C     1 
ATOM 4526  O O     . ASN E  1 82  ? -16.980 -65.673 13.087  1.00 0.00 ? 88  ASN E O     1 
ATOM 4527  C CB    . ASN E  1 82  ? -19.757 -64.042 13.155  1.00 0.00 ? 88  ASN E CB    1 
ATOM 4528  C CG    . ASN E  1 82  ? -20.652 -63.470 12.115  1.00 0.00 ? 88  ASN E CG    1 
ATOM 4529  O OD1   . ASN E  1 82  ? -20.845 -64.057 11.048  1.00 0.00 ? 88  ASN E OD1   1 
ATOM 4530  N ND2   . ASN E  1 82  ? -21.184 -62.316 12.385  1.00 0.00 ? 88  ASN E ND2   1 
ATOM 4531  N N     . ARG E  1 83  ? -18.214 -66.228 14.874  1.00 0.00 ? 89  ARG E N     1 
ATOM 4532  C CA    . ARG E  1 83  ? -17.039 -66.463 15.710  1.00 0.00 ? 89  ARG E CA    1 
ATOM 4533  C C     . ARG E  1 83  ? -16.523 -67.905 15.643  1.00 0.00 ? 89  ARG E C     1 
ATOM 4534  O O     . ARG E  1 83  ? -15.405 -68.181 16.068  1.00 0.00 ? 89  ARG E O     1 
ATOM 4535  C CB    . ARG E  1 83  ? -17.351 -66.096 17.155  1.00 0.00 ? 89  ARG E CB    1 
ATOM 4536  C CG    . ARG E  1 83  ? -17.580 -64.600 17.397  1.00 0.00 ? 89  ARG E CG    1 
ATOM 4537  C CD    . ARG E  1 83  ? -17.975 -64.318 18.807  1.00 0.00 ? 89  ARG E CD    1 
ATOM 4538  N NE    . ARG E  1 83  ? -18.312 -62.908 19.024  1.00 0.00 ? 89  ARG E NE    1 
ATOM 4539  C CZ    . ARG E  1 83  ? -17.453 -61.954 19.428  1.00 0.00 ? 89  ARG E CZ    1 
ATOM 4540  N NH1   . ARG E  1 83  ? -16.197 -62.247 19.665  1.00 0.00 ? 89  ARG E NH1   1 
ATOM 4541  N NH2   . ARG E  1 83  ? -17.881 -60.721 19.595  1.00 0.00 ? 89  ARG E NH2   1 
ATOM 4542  N N     . ILE E  1 84  ? -17.327 -68.809 15.101  1.00 0.00 ? 90  ILE E N     1 
ATOM 4543  C CA    . ILE E  1 84  ? -16.935 -70.215 14.965  1.00 0.00 ? 90  ILE E CA    1 
ATOM 4544  C C     . ILE E  1 84  ? -16.861 -70.654 13.516  1.00 0.00 ? 90  ILE E C     1 
ATOM 4545  O O     . ILE E  1 84  ? -15.919 -71.333 13.101  1.00 0.00 ? 90  ILE E O     1 
ATOM 4546  C CB    . ILE E  1 84  ? -17.916 -71.146 15.695  1.00 0.00 ? 90  ILE E CB    1 
ATOM 4547  C CG1   . ILE E  1 84  ? -17.897 -70.897 17.195  1.00 0.00 ? 90  ILE E CG1   1 
ATOM 4548  C CG2   . ILE E  1 84  ? -17.595 -72.580 15.391  1.00 0.00 ? 90  ILE E CG2   1 
ATOM 4549  C CD1   . ILE E  1 84  ? -18.967 -71.659 17.939  1.00 0.00 ? 90  ILE E CD1   1 
ATOM 4550  N N     . GLY E  1 85  ? -17.891 -70.324 12.761  1.00 0.00 ? 91  GLY E N     1 
ATOM 4551  C CA    . GLY E  1 85  ? -17.990 -70.768 11.381  1.00 0.00 ? 91  GLY E CA    1 
ATOM 4552  C C     . GLY E  1 85  ? -18.879 -71.987 11.309  1.00 0.00 ? 91  GLY E C     1 
ATOM 4553  O O     . GLY E  1 85  ? -19.138 -72.627 12.323  1.00 0.00 ? 91  GLY E O     1 
ATOM 4554  N N     . SER E  1 86  ? -19.361 -72.305 10.117  1.00 0.00 ? 92  SER E N     1 
ATOM 4555  C CA    . SER E  1 86  ? -20.270 -73.431 9.952   1.00 0.00 ? 92  SER E CA    1 
ATOM 4556  C C     . SER E  1 86  ? -19.556 -74.749 10.134  1.00 0.00 ? 92  SER E C     1 
ATOM 4557  O O     . SER E  1 86  ? -18.332 -74.818 10.036  1.00 0.00 ? 92  SER E O     1 
ATOM 4558  C CB    . SER E  1 86  ? -20.906 -73.398 8.590   1.00 0.00 ? 92  SER E CB    1 
ATOM 4559  O OG    . SER E  1 86  ? -19.960 -73.670 7.597   1.00 0.00 ? 92  SER E OG    1 
ATOM 4560  N N     . GLY E  1 87  ? -20.328 -75.804 10.361  1.00 0.00 ? 93  GLY E N     1 
ATOM 4561  C CA    . GLY E  1 87  ? -19.767 -77.128 10.549  1.00 0.00 ? 93  GLY E CA    1 
ATOM 4562  C C     . GLY E  1 87  ? -19.998 -77.627 11.968  1.00 0.00 ? 93  GLY E C     1 
ATOM 4563  O O     . GLY E  1 87  ? -20.676 -76.973 12.756  1.00 0.00 ? 93  GLY E O     1 
ATOM 4564  N N     . PRO E  1 88  ? -19.450 -78.801 12.269  1.00 0.00 ? 94  PRO E N     1 
ATOM 4565  C CA    . PRO E  1 88  ? -19.510 -79.536 13.547  1.00 0.00 ? 94  PRO E CA    1 
ATOM 4566  C C     . PRO E  1 88  ? -19.713 -78.640 14.765  1.00 0.00 ? 94  PRO E C     1 
ATOM 4567  O O     . PRO E  1 88  ? -20.690 -78.790 15.492  1.00 0.00 ? 94  PRO E O     1 
ATOM 4568  C CB    . PRO E  1 88  ? -18.147 -80.225 13.620  1.00 0.00 ? 94  PRO E CB    1 
ATOM 4569  C CG    . PRO E  1 88  ? -17.750 -80.375 12.212  1.00 0.00 ? 94  PRO E CG    1 
ATOM 4570  C CD    . PRO E  1 88  ? -18.180 -79.094 11.591  1.00 0.00 ? 94  PRO E CD    1 
ATOM 4571  N N     . ALA E  1 89  ? -18.769 -77.743 15.009  1.00 0.00 ? 95  ALA E N     1 
ATOM 4572  C CA    . ALA E  1 89  ? -18.823 -76.899 16.194  1.00 0.00 ? 95  ALA E CA    1 
ATOM 4573  C C     . ALA E  1 89  ? -20.099 -76.080 16.256  1.00 0.00 ? 95  ALA E C     1 
ATOM 4574  O O     . ALA E  1 89  ? -20.659 -75.889 17.334  1.00 0.00 ? 95  ALA E O     1 
ATOM 4575  C CB    . ALA E  1 89  ? -17.616 -75.999 16.232  1.00 0.00 ? 95  ALA E CB    1 
ATOM 4576  N N     . LEU E  1 90  ? -20.565 -75.600 15.108  1.00 0.00 ? 96  LEU E N     1 
ATOM 4577  C CA    . LEU E  1 90  ? -21.787 -74.825 15.073  1.00 0.00 ? 96  LEU E CA    1 
ATOM 4578  C C     . LEU E  1 90  ? -22.942 -75.693 15.447  1.00 0.00 ? 96  LEU E C     1 
ATOM 4579  O O     . LEU E  1 90  ? -23.828 -75.273 16.184  1.00 0.00 ? 96  LEU E O     1 
ATOM 4580  C CB    . LEU E  1 90  ? -22.035 -74.231 13.706  1.00 0.00 ? 96  LEU E CB    1 
ATOM 4581  C CG    . LEU E  1 90  ? -23.277 -73.347 13.619  1.00 0.00 ? 96  LEU E CG    1 
ATOM 4582  C CD1   . LEU E  1 90  ? -23.123 -72.175 14.579  1.00 0.00 ? 96  LEU E CD1   1 
ATOM 4583  C CD2   . LEU E  1 90  ? -23.463 -72.866 12.198  1.00 0.00 ? 96  LEU E CD2   1 
ATOM 4584  N N     . VAL E  1 91  ? -22.942 -76.909 14.928  1.00 0.00 ? 97  VAL E N     1 
ATOM 4585  C CA    . VAL E  1 91  ? -23.983 -77.864 15.246  1.00 0.00 ? 97  VAL E CA    1 
ATOM 4586  C C     . VAL E  1 91  ? -24.063 -78.090 16.738  1.00 0.00 ? 97  VAL E C     1 
ATOM 4587  O O     . VAL E  1 91  ? -25.148 -78.069 17.321  1.00 0.00 ? 97  VAL E O     1 
ATOM 4588  C CB    . VAL E  1 91  ? -23.722 -79.200 14.540  1.00 0.00 ? 97  VAL E CB    1 
ATOM 4589  C CG1   . VAL E  1 91  ? -24.678 -80.256 15.054  1.00 0.00 ? 97  VAL E CG1   1 
ATOM 4590  C CG2   . VAL E  1 91  ? -23.868 -79.018 13.041  1.00 0.00 ? 97  VAL E CG2   1 
ATOM 4591  N N     . ASN E  1 92  ? -22.904 -78.280 17.361  1.00 0.00 ? 98  ASN E N     1 
ATOM 4592  C CA    . ASN E  1 92  ? -22.835 -78.483 18.791  1.00 0.00 ? 98  ASN E CA    1 
ATOM 4593  C C     . ASN E  1 92  ? -23.422 -77.296 19.522  1.00 0.00 ? 98  ASN E C     1 
ATOM 4594  O O     . ASN E  1 92  ? -24.200 -77.456 20.467  1.00 0.00 ? 98  ASN E O     1 
ATOM 4595  C CB    . ASN E  1 92  ? -21.402 -78.720 19.214  1.00 0.00 ? 98  ASN E CB    1 
ATOM 4596  C CG    . ASN E  1 92  ? -20.914 -80.055 18.768  1.00 0.00 ? 98  ASN E CG    1 
ATOM 4597  O OD1   . ASN E  1 92  ? -21.728 -80.917 18.422  1.00 0.00 ? 98  ASN E OD1   1 
ATOM 4598  N ND2   . ASN E  1 92  ? -19.618 -80.261 18.764  1.00 0.00 ? 98  ASN E ND2   1 
ATOM 4599  N N     . MET E  1 93  ? -23.088 -76.107 19.044  1.00 0.00 ? 99  MET E N     1 
ATOM 4600  C CA    . MET E  1 93  ? -23.582 -74.889 19.624  1.00 0.00 ? 99  MET E CA    1 
ATOM 4601  C C     . MET E  1 93  ? -25.077 -74.777 19.554  1.00 0.00 ? 99  MET E C     1 
ATOM 4602  O O     . MET E  1 93  ? -25.725 -74.488 20.560  1.00 0.00 ? 99  MET E O     1 
ATOM 4603  C CB    . MET E  1 93  ? -22.964 -73.701 18.935  1.00 0.00 ? 99  MET E CB    1 
ATOM 4604  C CG    . MET E  1 93  ? -23.456 -72.387 19.462  1.00 0.00 ? 99  MET E CG    1 
ATOM 4605  S SD    . MET E  1 93  ? -22.956 -72.106 21.143  1.00 0.00 ? 99  MET E SD    1 
ATOM 4606  C CE    . MET E  1 93  ? -21.254 -71.629 20.878  1.00 0.00 ? 99  MET E CE    1 
ATOM 4607  N N     . ILE E  1 94  ? -25.629 -74.980 18.367  1.00 0.00 ? 100 ILE E N     1 
ATOM 4608  C CA    . ILE E  1 94  ? -27.047 -74.790 18.160  1.00 0.00 ? 100 ILE E CA    1 
ATOM 4609  C C     . ILE E  1 94  ? -27.858 -75.737 18.988  1.00 0.00 ? 100 ILE E C     1 
ATOM 4610  O O     . ILE E  1 94  ? -28.890 -75.355 19.527  1.00 0.00 ? 100 ILE E O     1 
ATOM 4611  C CB    . ILE E  1 94  ? -27.433 -74.936 16.701  1.00 0.00 ? 100 ILE E CB    1 
ATOM 4612  C CG1   . ILE E  1 94  ? -26.828 -73.798 15.886  1.00 0.00 ? 100 ILE E CG1   1 
ATOM 4613  C CG2   . ILE E  1 94  ? -28.947 -74.907 16.580  1.00 0.00 ? 100 ILE E CG2   1 
ATOM 4614  C CD1   . ILE E  1 94  ? -26.934 -74.001 14.397  1.00 0.00 ? 100 ILE E CD1   1 
ATOM 4615  N N     . ASN E  1 95  ? -27.409 -76.982 19.089  1.00 0.00 ? 101 ASN E N     1 
ATOM 4616  C CA    . ASN E  1 95  ? -28.111 -77.959 19.903  1.00 0.00 ? 101 ASN E CA    1 
ATOM 4617  C C     . ASN E  1 95  ? -28.267 -77.471 21.327  1.00 0.00 ? 101 ASN E C     1 
ATOM 4618  O O     . ASN E  1 95  ? -29.366 -77.515 21.889  1.00 0.00 ? 101 ASN E O     1 
ATOM 4619  C CB    . ASN E  1 95  ? -27.387 -79.281 19.895  1.00 0.00 ? 101 ASN E CB    1 
ATOM 4620  C CG    . ASN E  1 95  ? -27.560 -80.025 18.624  1.00 0.00 ? 101 ASN E CG    1 
ATOM 4621  O OD1   . ASN E  1 95  ? -28.527 -79.803 17.889  1.00 0.00 ? 101 ASN E OD1   1 
ATOM 4622  N ND2   . ASN E  1 95  ? -26.644 -80.913 18.342  1.00 0.00 ? 101 ASN E ND2   1 
ATOM 4623  N N     . GLY E  1 96  ? -27.172 -76.979 21.905  1.00 0.00 ? 102 GLY E N     1 
ATOM 4624  C CA    . GLY E  1 96  ? -27.212 -76.475 23.262  1.00 0.00 ? 102 GLY E CA    1 
ATOM 4625  C C     . GLY E  1 96  ? -28.054 -75.233 23.355  1.00 0.00 ? 102 GLY E C     1 
ATOM 4626  O O     . GLY E  1 96  ? -28.828 -75.072 24.299  1.00 0.00 ? 102 GLY E O     1 
ATOM 4627  N N     . LEU E  1 97  ? -27.916 -74.360 22.368  1.00 0.00 ? 103 LEU E N     1 
ATOM 4628  C CA    . LEU E  1 97  ? -28.661 -73.125 22.321  1.00 0.00 ? 103 LEU E CA    1 
ATOM 4629  C C     . LEU E  1 97  ? -30.148 -73.356 22.315  1.00 0.00 ? 103 LEU E C     1 
ATOM 4630  O O     . LEU E  1 97  ? -30.892 -72.666 23.007  1.00 0.00 ? 103 LEU E O     1 
ATOM 4631  C CB    . LEU E  1 97  ? -28.285 -72.336 21.107  1.00 0.00 ? 103 LEU E CB    1 
ATOM 4632  C CG    . LEU E  1 97  ? -29.049 -71.054 20.955  1.00 0.00 ? 103 LEU E CG    1 
ATOM 4633  C CD1   . LEU E  1 97  ? -28.796 -70.199 22.171  1.00 0.00 ? 103 LEU E CD1   1 
ATOM 4634  C CD2   . LEU E  1 97  ? -28.619 -70.366 19.679  1.00 0.00 ? 103 LEU E CD2   1 
ATOM 4635  N N     . LYS E  1 98  ? -30.595 -74.286 21.498  1.00 0.00 ? 104 LYS E N     1 
ATOM 4636  C CA    . LYS E  1 98  ? -31.988 -74.618 21.464  1.00 0.00 ? 104 LYS E CA    1 
ATOM 4637  C C     . LYS E  1 98  ? -32.451 -75.094 22.815  1.00 0.00 ? 104 LYS E C     1 
ATOM 4638  O O     . LYS E  1 98  ? -33.478 -74.650 23.309  1.00 0.00 ? 104 LYS E O     1 
ATOM 4639  C CB    . LYS E  1 98  ? -32.265 -75.664 20.415  1.00 0.00 ? 104 LYS E CB    1 
ATOM 4640  C CG    . LYS E  1 98  ? -32.272 -75.139 18.995  1.00 0.00 ? 104 LYS E CG    1 
ATOM 4641  C CD    . LYS E  1 98  ? -32.419 -76.273 18.004  1.00 0.00 ? 104 LYS E CD    1 
ATOM 4642  C CE    . LYS E  1 98  ? -33.642 -77.112 18.329  1.00 0.00 ? 104 LYS E CE    1 
ATOM 4643  N NZ    . LYS E  1 98  ? -33.888 -78.155 17.307  1.00 0.00 ? 104 LYS E NZ    1 
ATOM 4644  N N     . GLY E  1 99  ? -31.663 -75.958 23.446  1.00 0.00 ? 105 GLY E N     1 
ATOM 4645  C CA    . GLY E  1 99  ? -32.005 -76.437 24.776  1.00 0.00 ? 105 GLY E CA    1 
ATOM 4646  C C     . GLY E  1 99  ? -32.172 -75.269 25.736  1.00 0.00 ? 105 GLY E C     1 
ATOM 4647  O O     . GLY E  1 99  ? -33.115 -75.232 26.528  1.00 0.00 ? 105 GLY E O     1 
ATOM 4648  N N     . TYR E  1 100 ? -31.268 -74.304 25.632  1.00 0.00 ? 106 TYR E N     1 
ATOM 4649  C CA    . TYR E  1 100 ? -31.302 -73.115 26.455  1.00 0.00 ? 106 TYR E CA    1 
ATOM 4650  C C     . TYR E  1 100 ? -32.624 -72.400 26.324  1.00 0.00 ? 106 TYR E C     1 
ATOM 4651  O O     . TYR E  1 100 ? -33.315 -72.200 27.305  1.00 0.00 ? 106 TYR E O     1 
ATOM 4652  C CB    . TYR E  1 100 ? -30.154 -72.188 26.056  1.00 0.00 ? 106 TYR E CB    1 
ATOM 4653  C CG    . TYR E  1 100 ? -30.049 -70.898 26.811  1.00 0.00 ? 106 TYR E CG    1 
ATOM 4654  C CD1   . TYR E  1 100 ? -29.829 -70.891 28.175  1.00 0.00 ? 106 TYR E CD1   1 
ATOM 4655  C CD2   . TYR E  1 100 ? -30.098 -69.712 26.112  1.00 0.00 ? 106 TYR E CD2   1 
ATOM 4656  C CE1   . TYR E  1 100 ? -29.687 -69.684 28.839  1.00 0.00 ? 106 TYR E CE1   1 
ATOM 4657  C CE2   . TYR E  1 100 ? -29.948 -68.515 26.767  1.00 0.00 ? 106 TYR E CE2   1 
ATOM 4658  C CZ    . TYR E  1 100 ? -29.746 -68.492 28.125  1.00 0.00 ? 106 TYR E CZ    1 
ATOM 4659  O OH    . TYR E  1 100 ? -29.602 -67.283 28.774  1.00 0.00 ? 106 TYR E OH    1 
ATOM 4660  N N     . TYR E  1 101 ? -32.996 -72.044 25.109  1.00 0.00 ? 107 TYR E N     1 
ATOM 4661  C CA    . TYR E  1 101 ? -34.229 -71.300 24.906  1.00 0.00 ? 107 TYR E CA    1 
ATOM 4662  C C     . TYR E  1 101 ? -35.488 -72.095 25.142  1.00 0.00 ? 107 TYR E C     1 
ATOM 4663  O O     . TYR E  1 101 ? -36.441 -71.586 25.733  1.00 0.00 ? 107 TYR E O     1 
ATOM 4664  C CB    . TYR E  1 101 ? -34.256 -70.706 23.523  1.00 0.00 ? 107 TYR E CB    1 
ATOM 4665  C CG    . TYR E  1 101 ? -33.638 -69.354 23.467  1.00 0.00 ? 107 TYR E CG    1 
ATOM 4666  C CD1   . TYR E  1 101 ? -32.287 -69.206 23.240  1.00 0.00 ? 107 TYR E CD1   1 
ATOM 4667  C CD2   . TYR E  1 101 ? -34.440 -68.249 23.647  1.00 0.00 ? 107 TYR E CD2   1 
ATOM 4668  C CE1   . TYR E  1 101 ? -31.739 -67.943 23.201  1.00 0.00 ? 107 TYR E CE1   1 
ATOM 4669  C CE2   . TYR E  1 101 ? -33.896 -66.991 23.607  1.00 0.00 ? 107 TYR E CE2   1 
ATOM 4670  C CZ    . TYR E  1 101 ? -32.552 -66.836 23.388  1.00 0.00 ? 107 TYR E CZ    1 
ATOM 4671  O OH    . TYR E  1 101 ? -32.015 -65.580 23.349  1.00 0.00 ? 107 TYR E OH    1 
ATOM 4672  N N     . ILE E  1 102 ? -35.491 -73.344 24.729  1.00 0.00 ? 108 ILE E N     1 
ATOM 4673  C CA    . ILE E  1 102 ? -36.668 -74.159 24.879  1.00 0.00 ? 108 ILE E CA    1 
ATOM 4674  C C     . ILE E  1 102 ? -37.042 -74.336 26.316  1.00 0.00 ? 108 ILE E C     1 
ATOM 4675  O O     . ILE E  1 102 ? -38.206 -74.223 26.675  1.00 0.00 ? 108 ILE E O     1 
ATOM 4676  C CB    . ILE E  1 102 ? -36.479 -75.538 24.256  1.00 0.00 ? 108 ILE E CB    1 
ATOM 4677  C CG1   . ILE E  1 102 ? -36.378 -75.426 22.748  1.00 0.00 ? 108 ILE E CG1   1 
ATOM 4678  C CG2   . ILE E  1 102 ? -37.639 -76.433 24.640  1.00 0.00 ? 108 ILE E CG2   1 
ATOM 4679  C CD1   . ILE E  1 102 ? -35.902 -76.690 22.071  1.00 0.00 ? 108 ILE E CD1   1 
ATOM 4680  N N     . SER E  1 103 ? -36.070 -74.657 27.143  1.00 0.00 ? 109 SER E N     1 
ATOM 4681  C CA    . SER E  1 103 ? -36.367 -74.958 28.521  1.00 0.00 ? 109 SER E CA    1 
ATOM 4682  C C     . SER E  1 103 ? -36.219 -73.780 29.475  1.00 0.00 ? 109 SER E C     1 
ATOM 4683  O O     . SER E  1 103 ? -36.890 -73.740 30.502  1.00 0.00 ? 109 SER E O     1 
ATOM 4684  C CB    . SER E  1 103 ? -35.496 -76.090 28.970  1.00 0.00 ? 109 SER E CB    1 
ATOM 4685  O OG    . SER E  1 103 ? -34.154 -75.733 28.899  1.00 0.00 ? 109 SER E OG    1 
ATOM 4686  N N     . ALA E  1 104 ? -35.361 -72.817 29.153  1.00 0.00 ? 110 ALA E N     1 
ATOM 4687  C CA    . ALA E  1 104 ? -35.198 -71.682 30.057  1.00 0.00 ? 110 ALA E CA    1 
ATOM 4688  C C     . ALA E  1 104 ? -36.243 -70.639 29.827  1.00 0.00 ? 110 ALA E C     1 
ATOM 4689  O O     . ALA E  1 104 ? -36.682 -70.006 30.777  1.00 0.00 ? 110 ALA E O     1 
ATOM 4690  C CB    . ALA E  1 104 ? -33.820 -71.041 29.927  1.00 0.00 ? 110 ALA E CB    1 
ATOM 4691  N N     . PHE E  1 105 ? -36.638 -70.439 28.564  1.00 0.00 ? 111 PHE E N     1 
ATOM 4692  C CA    . PHE E  1 105 ? -37.591 -69.390 28.236  1.00 0.00 ? 111 PHE E CA    1 
ATOM 4693  C C     . PHE E  1 105 ? -38.867 -69.927 27.651  1.00 0.00 ? 111 PHE E C     1 
ATOM 4694  O O     . PHE E  1 105 ? -39.730 -69.156 27.237  1.00 0.00 ? 111 PHE E O     1 
ATOM 4695  C CB    . PHE E  1 105 ? -36.975 -68.418 27.258  1.00 0.00 ? 111 PHE E CB    1 
ATOM 4696  C CG    . PHE E  1 105 ? -35.754 -67.768 27.792  1.00 0.00 ? 111 PHE E CG    1 
ATOM 4697  C CD1   . PHE E  1 105 ? -34.523 -68.031 27.242  1.00 0.00 ? 111 PHE E CD1   1 
ATOM 4698  C CD2   . PHE E  1 105 ? -35.832 -66.912 28.865  1.00 0.00 ? 111 PHE E CD2   1 
ATOM 4699  C CE1   . PHE E  1 105 ? -33.391 -67.445 27.741  1.00 0.00 ? 111 PHE E CE1   1 
ATOM 4700  C CE2   . PHE E  1 105 ? -34.702 -66.320 29.372  1.00 0.00 ? 111 PHE E CE2   1 
ATOM 4701  C CZ    . PHE E  1 105 ? -33.477 -66.588 28.808  1.00 0.00 ? 111 PHE E CZ    1 
ATOM 4702  N N     . ASN E  1 106 ? -38.992 -71.245 27.605  1.00 0.00 ? 112 ASN E N     1 
ATOM 4703  C CA    . ASN E  1 106 ? -40.183 -71.883 27.071  1.00 0.00 ? 112 ASN E CA    1 
ATOM 4704  C C     . ASN E  1 106 ? -40.425 -71.514 25.621  1.00 0.00 ? 112 ASN E C     1 
ATOM 4705  O O     . ASN E  1 106 ? -41.568 -71.332 25.207  1.00 0.00 ? 112 ASN E O     1 
ATOM 4706  C CB    . ASN E  1 106 ? -41.391 -71.551 27.912  1.00 0.00 ? 112 ASN E CB    1 
ATOM 4707  C CG    . ASN E  1 106 ? -41.255 -72.067 29.306  1.00 0.00 ? 112 ASN E CG    1 
ATOM 4708  O OD1   . ASN E  1 106 ? -40.703 -73.149 29.526  1.00 0.00 ? 112 ASN E OD1   1 
ATOM 4709  N ND2   . ASN E  1 106 ? -41.750 -71.321 30.258  1.00 0.00 ? 112 ASN E ND2   1 
ATOM 4710  N N     . ALA E  1 107 ? -39.353 -71.401 24.847  1.00 0.00 ? 113 ALA E N     1 
ATOM 4711  C CA    . ALA E  1 107 ? -39.484 -71.100 23.434  1.00 0.00 ? 113 ALA E CA    1 
ATOM 4712  C C     . ALA E  1 107 ? -39.981 -72.330 22.696  1.00 0.00 ? 113 ALA E C     1 
ATOM 4713  O O     . ALA E  1 107 ? -39.678 -73.454 23.087  1.00 0.00 ? 113 ALA E O     1 
ATOM 4714  C CB    . ALA E  1 107 ? -38.169 -70.627 22.872  1.00 0.00 ? 113 ALA E CB    1 
ATOM 4715  N N     . ASN E  1 108 ? -40.766 -72.117 21.641  1.00 0.00 ? 114 ASN E N     1 
ATOM 4716  C CA    . ASN E  1 108 ? -41.361 -73.217 20.890  1.00 0.00 ? 114 ASN E CA    1 
ATOM 4717  C C     . ASN E  1 108 ? -40.394 -73.836 19.880  1.00 0.00 ? 114 ASN E C     1 
ATOM 4718  O O     . ASN E  1 108 ? -40.211 -73.286 18.796  1.00 0.00 ? 114 ASN E O     1 
ATOM 4719  C CB    . ASN E  1 108 ? -42.595 -72.757 20.175  1.00 0.00 ? 114 ASN E CB    1 
ATOM 4720  C CG    . ASN E  1 108 ? -43.242 -73.871 19.427  1.00 0.00 ? 114 ASN E CG    1 
ATOM 4721  O OD1   . ASN E  1 108 ? -42.564 -74.808 18.986  1.00 0.00 ? 114 ASN E OD1   1 
ATOM 4722  N ND2   . ASN E  1 108 ? -44.537 -73.800 19.271  1.00 0.00 ? 114 ASN E ND2   1 
ATOM 4723  N N     . PRO E  1 109 ? -39.793 -74.993 20.225  1.00 0.00 ? 115 PRO E N     1 
ATOM 4724  C CA    . PRO E  1 109 ? -38.869 -75.795 19.398  1.00 0.00 ? 115 PRO E CA    1 
ATOM 4725  C C     . PRO E  1 109 ? -39.126 -75.677 17.903  1.00 0.00 ? 115 PRO E C     1 
ATOM 4726  O O     . PRO E  1 109 ? -38.188 -75.527 17.119  1.00 0.00 ? 115 PRO E O     1 
ATOM 4727  C CB    . PRO E  1 109 ? -39.158 -77.232 19.836  1.00 0.00 ? 115 PRO E CB    1 
ATOM 4728  C CG    . PRO E  1 109 ? -39.655 -77.102 21.210  1.00 0.00 ? 115 PRO E CG    1 
ATOM 4729  C CD    . PRO E  1 109 ? -40.517 -75.888 21.155  1.00 0.00 ? 115 PRO E CD    1 
ATOM 4730  N N     . GLN E  1 110 ? -40.386 -75.791 17.506  1.00 0.00 ? 116 GLN E N     1 
ATOM 4731  C CA    . GLN E  1 110 ? -40.736 -75.786 16.100  1.00 0.00 ? 116 GLN E CA    1 
ATOM 4732  C C     . GLN E  1 110 ? -40.417 -74.449 15.451  1.00 0.00 ? 116 GLN E C     1 
ATOM 4733  O O     . GLN E  1 110 ? -39.881 -74.397 14.343  1.00 0.00 ? 116 GLN E O     1 
ATOM 4734  C CB    . GLN E  1 110 ? -42.209 -76.109 15.926  1.00 0.00 ? 116 GLN E CB    1 
ATOM 4735  C CG    . GLN E  1 110 ? -42.601 -76.377 14.498  1.00 0.00 ? 116 GLN E CG    1 
ATOM 4736  C CD    . GLN E  1 110 ? -42.821 -75.106 13.727  1.00 0.00 ? 116 GLN E CD    1 
ATOM 4737  O OE1   . GLN E  1 110 ? -43.314 -74.113 14.268  1.00 0.00 ? 116 GLN E OE1   1 
ATOM 4738  N NE2   . GLN E  1 110 ? -42.444 -75.120 12.454  1.00 0.00 ? 116 GLN E NE2   1 
ATOM 4739  N N     . VAL E  1 111 ? -40.735 -73.373 16.141  1.00 0.00 ? 117 VAL E N     1 
ATOM 4740  C CA    . VAL E  1 111 ? -40.456 -72.063 15.625  1.00 0.00 ? 117 VAL E CA    1 
ATOM 4741  C C     . VAL E  1 111 ? -38.973 -71.825 15.627  1.00 0.00 ? 117 VAL E C     1 
ATOM 4742  O O     . VAL E  1 111 ? -38.440 -71.208 14.713  1.00 0.00 ? 117 VAL E O     1 
ATOM 4743  C CB    . VAL E  1 111 ? -41.156 -70.987 16.443  1.00 0.00 ? 117 VAL E CB    1 
ATOM 4744  C CG1   . VAL E  1 111 ? -40.723 -69.611 15.963  1.00 0.00 ? 117 VAL E CG1   1 
ATOM 4745  C CG2   . VAL E  1 111 ? -42.658 -71.154 16.319  1.00 0.00 ? 117 VAL E CG2   1 
ATOM 4746  N N     . LEU E  1 112 ? -38.300 -72.331 16.653  1.00 0.00 ? 118 LEU E N     1 
ATOM 4747  C CA    . LEU E  1 112 ? -36.860 -72.182 16.757  1.00 0.00 ? 118 LEU E CA    1 
ATOM 4748  C C     . LEU E  1 112 ? -36.173 -72.814 15.573  1.00 0.00 ? 118 LEU E C     1 
ATOM 4749  O O     . LEU E  1 112 ? -35.223 -72.255 15.028  1.00 0.00 ? 118 LEU E O     1 
ATOM 4750  C CB    . LEU E  1 112 ? -36.356 -72.830 18.033  1.00 0.00 ? 118 LEU E CB    1 
ATOM 4751  C CG    . LEU E  1 112 ? -36.771 -72.147 19.319  1.00 0.00 ? 118 LEU E CG    1 
ATOM 4752  C CD1   . LEU E  1 112 ? -36.357 -72.996 20.477  1.00 0.00 ? 118 LEU E CD1   1 
ATOM 4753  C CD2   . LEU E  1 112 ? -36.117 -70.805 19.398  1.00 0.00 ? 118 LEU E CD2   1 
ATOM 4754  N N     . ASP E  1 113 ? -36.680 -73.958 15.147  1.00 0.00 ? 119 ASP E N     1 
ATOM 4755  C CA    . ASP E  1 113 ? -36.147 -74.623 13.985  1.00 0.00 ? 119 ASP E CA    1 
ATOM 4756  C C     . ASP E  1 113 ? -36.407 -73.833 12.737  1.00 0.00 ? 119 ASP E C     1 
ATOM 4757  O O     . ASP E  1 113 ? -35.567 -73.798 11.843  1.00 0.00 ? 119 ASP E O     1 
ATOM 4758  C CB    . ASP E  1 113 ? -36.717 -76.007 13.872  1.00 0.00 ? 119 ASP E CB    1 
ATOM 4759  C CG    . ASP E  1 113 ? -36.107 -76.926 14.899  1.00 0.00 ? 119 ASP E CG    1 
ATOM 4760  O OD1   . ASP E  1 113 ? -35.034 -76.616 15.361  1.00 0.00 ? 119 ASP E OD1   1 
ATOM 4761  O OD2   . ASP E  1 113 ? -36.707 -77.918 15.231  1.00 0.00 ? 119 ASP E OD2   1 
ATOM 4762  N N     . ALA E  1 114 ? -37.553 -73.157 12.684  1.00 0.00 ? 120 ALA E N     1 
ATOM 4763  C CA    . ALA E  1 114 ? -37.852 -72.283 11.564  1.00 0.00 ? 120 ALA E CA    1 
ATOM 4764  C C     . ALA E  1 114 ? -36.834 -71.154 11.476  1.00 0.00 ? 120 ALA E C     1 
ATOM 4765  O O     . ALA E  1 114 ? -36.405 -70.788 10.387  1.00 0.00 ? 120 ALA E O     1 
ATOM 4766  C CB    . ALA E  1 114 ? -39.252 -71.720 11.682  1.00 0.00 ? 120 ALA E CB    1 
ATOM 4767  N N     . VAL E  1 115 ? -36.416 -70.629 12.626  1.00 0.00 ? 121 VAL E N     1 
ATOM 4768  C CA    . VAL E  1 115 ? -35.402 -69.586 12.646  1.00 0.00 ? 121 VAL E CA    1 
ATOM 4769  C C     . VAL E  1 115 ? -34.083 -70.104 12.121  1.00 0.00 ? 121 VAL E C     1 
ATOM 4770  O O     . VAL E  1 115 ? -33.464 -69.477 11.263  1.00 0.00 ? 121 VAL E O     1 
ATOM 4771  C CB    . VAL E  1 115 ? -35.197 -69.037 14.060  1.00 0.00 ? 121 VAL E CB    1 
ATOM 4772  C CG1   . VAL E  1 115 ? -34.003 -68.108 14.077  1.00 0.00 ? 121 VAL E CG1   1 
ATOM 4773  C CG2   . VAL E  1 115 ? -36.445 -68.306 14.522  1.00 0.00 ? 121 VAL E CG2   1 
ATOM 4774  N N     . VAL E  1 116 ? -33.674 -71.272 12.601  1.00 0.00 ? 122 VAL E N     1 
ATOM 4775  C CA    . VAL E  1 116 ? -32.431 -71.890 12.156  1.00 0.00 ? 122 VAL E CA    1 
ATOM 4776  C C     . VAL E  1 116 ? -32.483 -72.164 10.653  1.00 0.00 ? 122 VAL E C     1 
ATOM 4777  O O     . VAL E  1 116 ? -31.520 -71.908 9.923   1.00 0.00 ? 122 VAL E O     1 
ATOM 4778  C CB    . VAL E  1 116 ? -32.175 -73.201 12.921  1.00 0.00 ? 122 VAL E CB    1 
ATOM 4779  C CG1   . VAL E  1 116 ? -30.999 -73.932 12.336  1.00 0.00 ? 122 VAL E CG1   1 
ATOM 4780  C CG2   . VAL E  1 116 ? -31.928 -72.905 14.376  1.00 0.00 ? 122 VAL E CG2   1 
ATOM 4781  N N     . ASN E  1 117 ? -33.648 -72.609 10.183  1.00 0.00 ? 123 ASN E N     1 
ATOM 4782  C CA    . ASN E  1 117 ? -33.882 -72.883 8.770   1.00 0.00 ? 123 ASN E CA    1 
ATOM 4783  C C     . ASN E  1 117 ? -33.638 -71.685 7.860   1.00 0.00 ? 123 ASN E C     1 
ATOM 4784  O O     . ASN E  1 117 ? -33.561 -71.839 6.645   1.00 0.00 ? 123 ASN E O     1 
ATOM 4785  C CB    . ASN E  1 117 ? -35.278 -73.393 8.546   1.00 0.00 ? 123 ASN E CB    1 
ATOM 4786  C CG    . ASN E  1 117 ? -35.486 -73.838 7.128   1.00 0.00 ? 123 ASN E CG    1 
ATOM 4787  O OD1   . ASN E  1 117 ? -34.947 -74.861 6.699   1.00 0.00 ? 123 ASN E OD1   1 
ATOM 4788  N ND2   . ASN E  1 117 ? -36.242 -73.074 6.382   1.00 0.00 ? 123 ASN E ND2   1 
ATOM 4789  N N     . ILE E  1 118 ? -33.560 -70.496 8.425   1.00 0.00 ? 124 ILE E N     1 
ATOM 4790  C CA    . ILE E  1 118 ? -33.289 -69.328 7.645   1.00 0.00 ? 124 ILE E CA    1 
ATOM 4791  C C     . ILE E  1 118 ? -31.847 -68.957 7.719   1.00 0.00 ? 124 ILE E C     1 
ATOM 4792  O O     . ILE E  1 118 ? -31.196 -68.750 6.697   1.00 0.00 ? 124 ILE E O     1 
ATOM 4793  C CB    . ILE E  1 118 ? -34.107 -68.171 8.125   1.00 0.00 ? 124 ILE E CB    1 
ATOM 4794  C CG1   . ILE E  1 118 ? -35.564 -68.506 8.024   1.00 0.00 ? 124 ILE E CG1   1 
ATOM 4795  C CG2   . ILE E  1 118 ? -33.780 -66.937 7.340   1.00 0.00 ? 124 ILE E CG2   1 
ATOM 4796  C CD1   . ILE E  1 118 ? -36.005 -68.871 6.632   1.00 0.00 ? 124 ILE E CD1   1 
ATOM 4797  N N     . ILE E  1 119 ? -31.346 -68.853 8.929   1.00 0.00 ? 125 ILE E N     1 
ATOM 4798  C CA    . ILE E  1 119 ? -29.983 -68.420 9.153   1.00 0.00 ? 125 ILE E CA    1 
ATOM 4799  C C     . ILE E  1 119 ? -28.984 -69.408 8.591   1.00 0.00 ? 125 ILE E C     1 
ATOM 4800  O O     . ILE E  1 119 ? -28.025 -69.020 7.926   1.00 0.00 ? 125 ILE E O     1 
ATOM 4801  C CB    . ILE E  1 119 ? -29.731 -68.221 10.630  1.00 0.00 ? 125 ILE E CB    1 
ATOM 4802  C CG1   . ILE E  1 119 ? -30.564 -67.063 11.132  1.00 0.00 ? 125 ILE E CG1   1 
ATOM 4803  C CG2   . ILE E  1 119 ? -28.260 -67.959 10.874  1.00 0.00 ? 125 ILE E CG2   1 
ATOM 4804  C CD1   . ILE E  1 119 ? -30.606 -66.975 12.620  1.00 0.00 ? 125 ILE E CD1   1 
ATOM 4805  N N     . THR E  1 120 ? -29.202 -70.685 8.860   1.00 0.00 ? 126 THR E N     1 
ATOM 4806  C CA    . THR E  1 120 ? -28.322 -71.718 8.357   1.00 0.00 ? 126 THR E CA    1 
ATOM 4807  C C     . THR E  1 120 ? -28.841 -72.261 7.059   1.00 0.00 ? 126 THR E C     1 
ATOM 4808  O O     . THR E  1 120 ? -28.074 -72.687 6.199   1.00 0.00 ? 126 THR E O     1 
ATOM 4809  C CB    . THR E  1 120 ? -28.238 -72.867 9.318   1.00 0.00 ? 126 THR E CB    1 
ATOM 4810  O OG1   . THR E  1 120 ? -29.533 -73.455 9.410   1.00 0.00 ? 126 THR E OG1   1 
ATOM 4811  C CG2   . THR E  1 120 ? -27.799 -72.389 10.690  1.00 0.00 ? 126 THR E CG2   1 
ATOM 4812  N N     . GLY E  1 121 ? -30.155 -72.230 6.909   1.00 0.00 ? 127 GLY E N     1 
ATOM 4813  C CA    . GLY E  1 121 ? -30.791 -72.733 5.705   1.00 0.00 ? 127 GLY E CA    1 
ATOM 4814  C C     . GLY E  1 121 ? -31.489 -74.047 5.978   1.00 0.00 ? 127 GLY E C     1 
ATOM 4815  O O     . GLY E  1 121 ? -32.272 -74.523 5.158   1.00 0.00 ? 127 GLY E O     1 
ATOM 4816  N N     . SER E  1 122 ? -31.206 -74.629 7.136   1.00 0.00 ? 128 SER E N     1 
ATOM 4817  C CA    . SER E  1 122 ? -31.819 -75.876 7.541   1.00 0.00 ? 128 SER E CA    1 
ATOM 4818  C C     . SER E  1 122 ? -31.626 -76.071 9.022   1.00 0.00 ? 128 SER E C     1 
ATOM 4819  O O     . SER E  1 122 ? -30.707 -75.504 9.603   1.00 0.00 ? 128 SER E O     1 
ATOM 4820  C CB    . SER E  1 122 ? -31.185 -77.034 6.807   1.00 0.00 ? 128 SER E CB    1 
ATOM 4821  O OG    . SER E  1 122 ? -29.871 -77.233 7.254   1.00 0.00 ? 128 SER E OG    1 
ATOM 4822  N N     . PRO E  1 123 ? -32.426 -76.924 9.635   1.00 0.00 ? 129 PRO E N     1 
ATOM 4823  C CA    . PRO E  1 123 ? -32.315 -77.338 11.011  1.00 0.00 ? 129 PRO E CA    1 
ATOM 4824  C C     . PRO E  1 123 ? -30.967 -77.992 11.200  1.00 0.00 ? 129 PRO E C     1 
ATOM 4825  O O     . PRO E  1 123 ? -30.348 -78.438 10.233  1.00 0.00 ? 129 PRO E O     1 
ATOM 4826  C CB    . PRO E  1 123 ? -33.496 -78.266 11.202  1.00 0.00 ? 129 PRO E CB    1 
ATOM 4827  C CG    . PRO E  1 123 ? -34.543 -77.703 10.288  1.00 0.00 ? 129 PRO E CG    1 
ATOM 4828  C CD    . PRO E  1 123 ? -33.793 -77.087 9.135   1.00 0.00 ? 129 PRO E CD    1 
ATOM 4829  N N     . THR E  1 124 ? -30.484 -78.022 12.423  1.00 0.00 ? 130 THR E N     1 
ATOM 4830  C CA    . THR E  1 124 ? -29.134 -78.479 12.644  1.00 0.00 ? 130 THR E CA    1 
ATOM 4831  C C     . THR E  1 124 ? -29.056 -79.977 12.822  1.00 0.00 ? 130 THR E C     1 
ATOM 4832  O O     . THR E  1 124 ? -29.778 -80.722 12.165  1.00 0.00 ? 130 THR E O     1 
ATOM 4833  C CB    . THR E  1 124 ? -28.531 -77.773 13.863  1.00 0.00 ? 130 THR E CB    1 
ATOM 4834  O OG1   . THR E  1 124 ? -27.171 -78.177 14.019  1.00 0.00 ? 130 THR E OG1   1 
ATOM 4835  C CG2   . THR E  1 124 ? -29.325 -78.082 15.138  1.00 0.00 ? 130 THR E CG2   1 
ATOM 4836  N N     . GLY E  1 125 ? -28.154 -80.434 13.687  1.00 0.00 ? 131 GLY E N     1 
ATOM 4837  C CA    . GLY E  1 125 ? -27.948 -81.872 13.881  1.00 0.00 ? 131 GLY E CA    1 
ATOM 4838  C C     . GLY E  1 125 ? -27.052 -82.418 12.771  1.00 0.00 ? 131 GLY E C     1 
ATOM 4839  O O     . GLY E  1 125 ? -25.938 -82.879 13.018  1.00 0.00 ? 131 GLY E O     1 
ATOM 4840  N N     . TYR E  1 126 ? -27.548 -82.335 11.548  1.00 0.00 ? 132 TYR E N     1 
ATOM 4841  C CA    . TYR E  1 126 ? -26.810 -82.731 10.386  1.00 0.00 ? 132 TYR E CA    1 
ATOM 4842  C C     . TYR E  1 126 ? -26.307 -81.494 9.676   1.00 0.00 ? 132 TYR E C     1 
ATOM 4843  O O     . TYR E  1 126 ? -26.977 -80.464 9.666   1.00 0.00 ? 132 TYR E O     1 
ATOM 4844  C CB    . TYR E  1 126 ? -27.705 -83.542 9.463   1.00 0.00 ? 132 TYR E CB    1 
ATOM 4845  C CG    . TYR E  1 126 ? -28.243 -84.783 10.123  1.00 0.00 ? 132 TYR E CG    1 
ATOM 4846  C CD1   . TYR E  1 126 ? -29.426 -84.709 10.843  1.00 0.00 ? 132 TYR E CD1   1 
ATOM 4847  C CD2   . TYR E  1 126 ? -27.561 -85.982 10.028  1.00 0.00 ? 132 TYR E CD2   1 
ATOM 4848  C CE1   . TYR E  1 126 ? -29.925 -85.831 11.463  1.00 0.00 ? 132 TYR E CE1   1 
ATOM 4849  C CE2   . TYR E  1 126 ? -28.063 -87.107 10.650  1.00 0.00 ? 132 TYR E CE2   1 
ATOM 4850  C CZ    . TYR E  1 126 ? -29.242 -87.032 11.365  1.00 0.00 ? 132 TYR E CZ    1 
ATOM 4851  O OH    . TYR E  1 126 ? -29.744 -88.149 11.983  1.00 0.00 ? 132 TYR E OH    1 
ATOM 4852  N N     . VAL E  1 127 ? -25.138 -81.588 9.082   1.00 0.00 ? 133 VAL E N     1 
ATOM 4853  C CA    . VAL E  1 127 ? -24.589 -80.462 8.355   1.00 0.00 ? 133 VAL E CA    1 
ATOM 4854  C C     . VAL E  1 127 ? -25.056 -80.485 6.912   1.00 0.00 ? 133 VAL E C     1 
ATOM 4855  O O     . VAL E  1 127 ? -24.723 -81.397 6.157   1.00 0.00 ? 133 VAL E O     1 
ATOM 4856  C CB    . VAL E  1 127 ? -23.046 -80.478 8.404   1.00 0.00 ? 133 VAL E CB    1 
ATOM 4857  C CG1   . VAL E  1 127 ? -22.482 -79.319 7.595   1.00 0.00 ? 133 VAL E CG1   1 
ATOM 4858  C CG2   . VAL E  1 127 ? -22.577 -80.397 9.849   1.00 0.00 ? 133 VAL E CG2   1 
ATOM 4859  N N     . SER E  1 128 ? -25.829 -79.485 6.534   1.00 0.00 ? 134 SER E N     1 
ATOM 4860  C CA    . SER E  1 128 ? -26.337 -79.396 5.178   1.00 0.00 ? 134 SER E CA    1 
ATOM 4861  C C     . SER E  1 128 ? -26.982 -78.036 4.934   1.00 0.00 ? 134 SER E C     1 
ATOM 4862  O O     . SER E  1 128 ? -26.373 -77.156 4.321   1.00 0.00 ? 134 SER E O     1 
ATOM 4863  C CB    . SER E  1 128 ? -27.342 -80.514 4.921   1.00 0.00 ? 134 SER E CB    1 
ATOM 4864  O OG    . SER E  1 128 ? -27.853 -80.445 3.617   1.00 0.00 ? 134 SER E OG    1 
ATOM 4865  O OXT   . SER E  1 128 ? -28.040 -77.762 5.496   1.00 0.00 ? 134 SER E OXT   1 
ATOM 4866  N N     . SER F  1 1   ? -38.564 -50.036 13.976  1.00 0.00 ? 7   SER F N     1 
ATOM 4867  C CA    . SER F  1 1   ? -38.408 -50.486 12.597  1.00 0.00 ? 7   SER F CA    1 
ATOM 4868  C C     . SER F  1 1   ? -37.349 -49.685 11.867  1.00 0.00 ? 7   SER F C     1 
ATOM 4869  O O     . SER F  1 1   ? -37.613 -48.575 11.406  1.00 0.00 ? 7   SER F O     1 
ATOM 4870  C CB    . SER F  1 1   ? -39.712 -50.373 11.864  1.00 0.00 ? 7   SER F CB    1 
ATOM 4871  O OG    . SER F  1 1   ? -39.552 -50.732 10.525  1.00 0.00 ? 7   SER F OG    1 
ATOM 4872  N N     . ARG F  1 2   ? -36.147 -50.247 11.764  1.00 0.00 ? 8   ARG F N     1 
ATOM 4873  C CA    . ARG F  1 2   ? -35.037 -49.557 11.095  1.00 0.00 ? 8   ARG F CA    1 
ATOM 4874  C C     . ARG F  1 2   ? -34.151 -50.513 10.309  1.00 0.00 ? 8   ARG F C     1 
ATOM 4875  O O     . ARG F  1 2   ? -33.895 -51.632 10.748  1.00 0.00 ? 8   ARG F O     1 
ATOM 4876  C CB    . ARG F  1 2   ? -34.156 -48.852 12.109  1.00 0.00 ? 8   ARG F CB    1 
ATOM 4877  C CG    . ARG F  1 2   ? -34.812 -47.754 12.934  1.00 0.00 ? 8   ARG F CG    1 
ATOM 4878  C CD    . ARG F  1 2   ? -35.126 -46.547 12.147  1.00 0.00 ? 8   ARG F CD    1 
ATOM 4879  N NE    . ARG F  1 2   ? -35.612 -45.484 13.005  1.00 0.00 ? 8   ARG F NE    1 
ATOM 4880  C CZ    . ARG F  1 2   ? -36.883 -45.345 13.409  1.00 0.00 ? 8   ARG F CZ    1 
ATOM 4881  N NH1   . ARG F  1 2   ? -37.796 -46.200 13.012  1.00 0.00 ? 8   ARG F NH1   1 
ATOM 4882  N NH2   . ARG F  1 2   ? -37.222 -44.347 14.214  1.00 0.00 ? 8   ARG F NH2   1 
ATOM 4883  N N     . SER F  1 3   ? -33.642 -50.043 9.176   1.00 0.00 ? 9   SER F N     1 
ATOM 4884  C CA    . SER F  1 3   ? -32.660 -50.785 8.386   1.00 0.00 ? 9   SER F CA    1 
ATOM 4885  C C     . SER F  1 3   ? -31.317 -50.636 9.025   1.00 0.00 ? 9   SER F C     1 
ATOM 4886  O O     . SER F  1 3   ? -31.154 -49.814 9.917   1.00 0.00 ? 9   SER F O     1 
ATOM 4887  C CB    . SER F  1 3   ? -32.599 -50.249 6.992   1.00 0.00 ? 9   SER F CB    1 
ATOM 4888  O OG    . SER F  1 3   ? -32.091 -48.940 6.997   1.00 0.00 ? 9   SER F OG    1 
ATOM 4889  N N     . TYR F  1 4   ? -30.323 -51.372 8.548   1.00 0.00 ? 10  TYR F N     1 
ATOM 4890  C CA    . TYR F  1 4   ? -29.025 -51.246 9.171   1.00 0.00 ? 10  TYR F CA    1 
ATOM 4891  C C     . TYR F  1 4   ? -28.453 -49.905 8.843   1.00 0.00 ? 10  TYR F C     1 
ATOM 4892  O O     . TYR F  1 4   ? -27.649 -49.373 9.594   1.00 0.00 ? 10  TYR F O     1 
ATOM 4893  C CB    . TYR F  1 4   ? -28.017 -52.282 8.704   1.00 0.00 ? 10  TYR F CB    1 
ATOM 4894  C CG    . TYR F  1 4   ? -26.953 -51.660 7.855   1.00 0.00 ? 10  TYR F CG    1 
ATOM 4895  C CD1   . TYR F  1 4   ? -25.920 -50.978 8.486   1.00 0.00 ? 10  TYR F CD1   1 
ATOM 4896  C CD2   . TYR F  1 4   ? -27.002 -51.726 6.481   1.00 0.00 ? 10  TYR F CD2   1 
ATOM 4897  C CE1   . TYR F  1 4   ? -24.951 -50.349 7.745   1.00 0.00 ? 10  TYR F CE1   1 
ATOM 4898  C CE2   . TYR F  1 4   ? -26.027 -51.098 5.733   1.00 0.00 ? 10  TYR F CE2   1 
ATOM 4899  C CZ    . TYR F  1 4   ? -25.006 -50.404 6.362   1.00 0.00 ? 10  TYR F CZ    1 
ATOM 4900  O OH    . TYR F  1 4   ? -24.040 -49.765 5.612   1.00 0.00 ? 10  TYR F OH    1 
ATOM 4901  N N     . SER F  1 5   ? -28.839 -49.357 7.696   1.00 0.00 ? 11  SER F N     1 
ATOM 4902  C CA    . SER F  1 5   ? -28.305 -48.096 7.275   1.00 0.00 ? 11  SER F CA    1 
ATOM 4903  C C     . SER F  1 5   ? -28.752 -47.012 8.200   1.00 0.00 ? 11  SER F C     1 
ATOM 4904  O O     . SER F  1 5   ? -27.999 -46.090 8.501   1.00 0.00 ? 11  SER F O     1 
ATOM 4905  C CB    . SER F  1 5   ? -28.754 -47.789 5.879   1.00 0.00 ? 11  SER F CB    1 
ATOM 4906  O OG    . SER F  1 5   ? -30.132 -47.536 5.843   1.00 0.00 ? 11  SER F OG    1 
ATOM 4907  N N     . GLN F  1 6   ? -29.958 -47.158 8.715   1.00 0.00 ? 12  GLN F N     1 
ATOM 4908  C CA    . GLN F  1 6   ? -30.483 -46.235 9.689   1.00 0.00 ? 12  GLN F CA    1 
ATOM 4909  C C     . GLN F  1 6   ? -29.855 -46.463 11.036  1.00 0.00 ? 12  GLN F C     1 
ATOM 4910  O O     . GLN F  1 6   ? -29.517 -45.511 11.736  1.00 0.00 ? 12  GLN F O     1 
ATOM 4911  C CB    . GLN F  1 6   ? -31.972 -46.375 9.767   1.00 0.00 ? 12  GLN F CB    1 
ATOM 4912  C CG    . GLN F  1 6   ? -32.676 -45.863 8.540   1.00 0.00 ? 12  GLN F CG    1 
ATOM 4913  C CD    . GLN F  1 6   ? -34.100 -46.316 8.470   1.00 0.00 ? 12  GLN F CD    1 
ATOM 4914  O OE1   . GLN F  1 6   ? -34.352 -47.495 8.203   1.00 0.00 ? 12  GLN F OE1   1 
ATOM 4915  N NE2   . GLN F  1 6   ? -35.042 -45.410 8.713   1.00 0.00 ? 12  GLN F NE2   1 
ATOM 4916  N N     . ARG F  1 7   ? -29.658 -47.730 11.388  1.00 0.00 ? 13  ARG F N     1 
ATOM 4917  C CA    . ARG F  1 7   ? -29.032 -48.071 12.646  1.00 0.00 ? 13  ARG F CA    1 
ATOM 4918  C C     . ARG F  1 7   ? -27.659 -47.470 12.717  1.00 0.00 ? 13  ARG F C     1 
ATOM 4919  O O     . ARG F  1 7   ? -27.301 -46.832 13.703  1.00 0.00 ? 13  ARG F O     1 
ATOM 4920  C CB    . ARG F  1 7   ? -28.919 -49.578 12.796  1.00 0.00 ? 13  ARG F CB    1 
ATOM 4921  C CG    . ARG F  1 7   ? -30.237 -50.296 12.986  1.00 0.00 ? 13  ARG F CG    1 
ATOM 4922  C CD    . ARG F  1 7   ? -30.072 -51.773 13.002  1.00 0.00 ? 13  ARG F CD    1 
ATOM 4923  N NE    . ARG F  1 7   ? -29.395 -52.223 14.200  1.00 0.00 ? 13  ARG F NE    1 
ATOM 4924  C CZ    . ARG F  1 7   ? -28.855 -53.442 14.372  1.00 0.00 ? 13  ARG F CZ    1 
ATOM 4925  N NH1   . ARG F  1 7   ? -28.890 -54.334 13.408  1.00 0.00 ? 13  ARG F NH1   1 
ATOM 4926  N NH2   . ARG F  1 7   ? -28.281 -53.745 15.522  1.00 0.00 ? 13  ARG F NH2   1 
ATOM 4927  N N     . TYR F  1 8   ? -26.907 -47.646 11.648  1.00 0.00 ? 14  TYR F N     1 
ATOM 4928  C CA    . TYR F  1 8   ? -25.582 -47.104 11.542  1.00 0.00 ? 14  TYR F CA    1 
ATOM 4929  C C     . TYR F  1 8   ? -25.581 -45.624 11.532  1.00 0.00 ? 14  TYR F C     1 
ATOM 4930  O O     . TYR F  1 8   ? -24.818 -45.010 12.262  1.00 0.00 ? 14  TYR F O     1 
ATOM 4931  C CB    . TYR F  1 8   ? -24.889 -47.614 10.313  1.00 0.00 ? 14  TYR F CB    1 
ATOM 4932  C CG    . TYR F  1 8   ? -23.611 -46.893 10.060  1.00 0.00 ? 14  TYR F CG    1 
ATOM 4933  C CD1   . TYR F  1 8   ? -22.603 -46.927 10.993  1.00 0.00 ? 14  TYR F CD1   1 
ATOM 4934  C CD2   . TYR F  1 8   ? -23.452 -46.180 8.892   1.00 0.00 ? 14  TYR F CD2   1 
ATOM 4935  C CE1   . TYR F  1 8   ? -21.439 -46.239 10.770  1.00 0.00 ? 14  TYR F CE1   1 
ATOM 4936  C CE2   . TYR F  1 8   ? -22.288 -45.490 8.665   1.00 0.00 ? 14  TYR F CE2   1 
ATOM 4937  C CZ    . TYR F  1 8   ? -21.287 -45.512 9.602   1.00 0.00 ? 14  TYR F CZ    1 
ATOM 4938  O OH    . TYR F  1 8   ? -20.137 -44.799 9.391   1.00 0.00 ? 14  TYR F OH    1 
ATOM 4939  N N     . ALA F  1 9   ? -26.403 -45.027 10.688  1.00 0.00 ? 15  ALA F N     1 
ATOM 4940  C CA    . ALA F  1 9   ? -26.435 -43.584 10.564  1.00 0.00 ? 15  ALA F CA    1 
ATOM 4941  C C     . ALA F  1 9   ? -26.545 -42.920 11.913  1.00 0.00 ? 15  ALA F C     1 
ATOM 4942  O O     . ALA F  1 9   ? -25.740 -42.047 12.251  1.00 0.00 ? 15  ALA F O     1 
ATOM 4943  C CB    . ALA F  1 9   ? -27.592 -43.156 9.689   1.00 0.00 ? 15  ALA F CB    1 
ATOM 4944  N N     . LYS F  1 10  ? -27.532 -43.326 12.695  1.00 0.00 ? 16  LYS F N     1 
ATOM 4945  C CA    . LYS F  1 10  ? -27.732 -42.712 13.976  1.00 0.00 ? 16  LYS F CA    1 
ATOM 4946  C C     . LYS F  1 10  ? -26.626 -43.071 14.933  1.00 0.00 ? 16  LYS F C     1 
ATOM 4947  O O     . LYS F  1 10  ? -26.168 -42.223 15.690  1.00 0.00 ? 16  LYS F O     1 
ATOM 4948  C CB    . LYS F  1 10  ? -29.058 -43.085 14.569  1.00 0.00 ? 16  LYS F CB    1 
ATOM 4949  C CG    . LYS F  1 10  ? -29.363 -42.302 15.817  1.00 0.00 ? 16  LYS F CG    1 
ATOM 4950  C CD    . LYS F  1 10  ? -30.733 -42.603 16.357  1.00 0.00 ? 16  LYS F CD    1 
ATOM 4951  C CE    . LYS F  1 10  ? -31.026 -41.703 17.536  1.00 0.00 ? 16  LYS F CE    1 
ATOM 4952  N NZ    . LYS F  1 10  ? -32.282 -42.067 18.235  1.00 0.00 ? 16  LYS F NZ    1 
ATOM 4953  N N     . TRP F  1 11  ? -26.181 -44.322 14.898  1.00 0.00 ? 17  TRP F N     1 
ATOM 4954  C CA    . TRP F  1 11  ? -25.087 -44.746 15.751  1.00 0.00 ? 17  TRP F CA    1 
ATOM 4955  C C     . TRP F  1 11  ? -23.876 -43.901 15.533  1.00 0.00 ? 17  TRP F C     1 
ATOM 4956  O O     . TRP F  1 11  ? -23.180 -43.549 16.479  1.00 0.00 ? 17  TRP F O     1 
ATOM 4957  C CB    . TRP F  1 11  ? -24.718 -46.189 15.501  1.00 0.00 ? 17  TRP F CB    1 
ATOM 4958  C CG    . TRP F  1 11  ? -23.519 -46.603 16.279  1.00 0.00 ? 17  TRP F CG    1 
ATOM 4959  C CD1   . TRP F  1 11  ? -23.500 -47.059 17.557  1.00 0.00 ? 17  TRP F CD1   1 
ATOM 4960  C CD2   . TRP F  1 11  ? -22.142 -46.598 15.835  1.00 0.00 ? 17  TRP F CD2   1 
ATOM 4961  N NE1   . TRP F  1 11  ? -22.213 -47.339 17.940  1.00 0.00 ? 17  TRP F NE1   1 
ATOM 4962  C CE2   . TRP F  1 11  ? -21.372 -47.063 16.898  1.00 0.00 ? 17  TRP F CE2   1 
ATOM 4963  C CE3   . TRP F  1 11  ? -21.518 -46.249 14.639  1.00 0.00 ? 17  TRP F CE3   1 
ATOM 4964  C CZ2   . TRP F  1 11  ? -19.996 -47.192 16.804  1.00 0.00 ? 17  TRP F CZ2   1 
ATOM 4965  C CZ3   . TRP F  1 11  ? -20.139 -46.379 14.542  1.00 0.00 ? 17  TRP F CZ3   1 
ATOM 4966  C CH2   . TRP F  1 11  ? -19.397 -46.839 15.598  1.00 0.00 ? 17  TRP F CH2   1 
ATOM 4967  N N     . GLN F  1 12  ? -23.598 -43.597 14.281  1.00 0.00 ? 18  GLN F N     1 
ATOM 4968  C CA    . GLN F  1 12  ? -22.465 -42.797 13.937  1.00 0.00 ? 18  GLN F CA    1 
ATOM 4969  C C     . GLN F  1 12  ? -22.582 -41.423 14.506  1.00 0.00 ? 18  GLN F C     1 
ATOM 4970  O O     . GLN F  1 12  ? -21.637 -40.905 15.090  1.00 0.00 ? 18  GLN F O     1 
ATOM 4971  C CB    . GLN F  1 12  ? -22.337 -42.691 12.439  1.00 0.00 ? 18  GLN F CB    1 
ATOM 4972  C CG    . GLN F  1 12  ? -21.117 -41.944 12.004  1.00 0.00 ? 18  GLN F CG    1 
ATOM 4973  C CD    . GLN F  1 12  ? -19.885 -42.698 12.342  1.00 0.00 ? 18  GLN F CD    1 
ATOM 4974  O OE1   . GLN F  1 12  ? -19.676 -43.786 11.810  1.00 0.00 ? 18  GLN F OE1   1 
ATOM 4975  N NE2   . GLN F  1 12  ? -19.056 -42.157 13.225  1.00 0.00 ? 18  GLN F NE2   1 
ATOM 4976  N N     . ALA F  1 13  ? -23.755 -40.831 14.363  1.00 0.00 ? 19  ALA F N     1 
ATOM 4977  C CA    . ALA F  1 13  ? -23.985 -39.491 14.856  1.00 0.00 ? 19  ALA F CA    1 
ATOM 4978  C C     . ALA F  1 13  ? -23.795 -39.416 16.348  1.00 0.00 ? 19  ALA F C     1 
ATOM 4979  O O     . ALA F  1 13  ? -23.212 -38.459 16.857  1.00 0.00 ? 19  ALA F O     1 
ATOM 4980  C CB    . ALA F  1 13  ? -25.373 -39.037 14.486  1.00 0.00 ? 19  ALA F CB    1 
ATOM 4981  N N     . LYS F  1 14  ? -24.264 -40.427 17.055  1.00 0.00 ? 20  LYS F N     1 
ATOM 4982  C CA    . LYS F  1 14  ? -24.168 -40.433 18.490  1.00 0.00 ? 20  LYS F CA    1 
ATOM 4983  C C     . LYS F  1 14  ? -22.789 -40.741 18.959  1.00 0.00 ? 20  LYS F C     1 
ATOM 4984  O O     . LYS F  1 14  ? -22.344 -40.197 19.965  1.00 0.00 ? 20  LYS F O     1 
ATOM 4985  C CB    . LYS F  1 14  ? -25.143 -41.414 19.072  1.00 0.00 ? 20  LYS F CB    1 
ATOM 4986  C CG    . LYS F  1 14  ? -26.578 -41.024 18.846  1.00 0.00 ? 20  LYS F CG    1 
ATOM 4987  C CD    . LYS F  1 14  ? -26.861 -39.700 19.510  1.00 0.00 ? 20  LYS F CD    1 
ATOM 4988  C CE    . LYS F  1 14  ? -26.957 -39.836 21.016  1.00 0.00 ? 20  LYS F CE    1 
ATOM 4989  N NZ    . LYS F  1 14  ? -28.291 -40.329 21.436  1.00 0.00 ? 20  LYS F NZ    1 
ATOM 4990  N N     . PHE F  1 15  ? -22.082 -41.581 18.224  1.00 0.00 ? 21  PHE F N     1 
ATOM 4991  C CA    . PHE F  1 15  ? -20.715 -41.872 18.569  1.00 0.00 ? 21  PHE F CA    1 
ATOM 4992  C C     . PHE F  1 15  ? -19.892 -40.614 18.447  1.00 0.00 ? 21  PHE F C     1 
ATOM 4993  O O     . PHE F  1 15  ? -19.095 -40.295 19.329  1.00 0.00 ? 21  PHE F O     1 
ATOM 4994  C CB    . PHE F  1 15  ? -20.132 -42.950 17.682  1.00 0.00 ? 21  PHE F CB    1 
ATOM 4995  C CG    . PHE F  1 15  ? -18.767 -43.346 18.113  1.00 0.00 ? 21  PHE F CG    1 
ATOM 4996  C CD1   . PHE F  1 15  ? -18.592 -44.320 19.080  1.00 0.00 ? 21  PHE F CD1   1 
ATOM 4997  C CD2   . PHE F  1 15  ? -17.653 -42.717 17.603  1.00 0.00 ? 21  PHE F CD2   1 
ATOM 4998  C CE1   . PHE F  1 15  ? -17.327 -44.668 19.516  1.00 0.00 ? 21  PHE F CE1   1 
ATOM 4999  C CE2   . PHE F  1 15  ? -16.389 -43.058 18.042  1.00 0.00 ? 21  PHE F CE2   1 
ATOM 5000  C CZ    . PHE F  1 15  ? -16.226 -44.036 18.997  1.00 0.00 ? 21  PHE F CZ    1 
ATOM 5001  N N     . ASN F  1 16  ? -20.095 -39.894 17.347  1.00 0.00 ? 22  ASN F N     1 
ATOM 5002  C CA    . ASN F  1 16  ? -19.392 -38.656 17.105  1.00 0.00 ? 22  ASN F CA    1 
ATOM 5003  C C     . ASN F  1 16  ? -19.633 -37.686 18.225  1.00 0.00 ? 22  ASN F C     1 
ATOM 5004  O O     . ASN F  1 16  ? -18.694 -37.112 18.774  1.00 0.00 ? 22  ASN F O     1 
ATOM 5005  C CB    . ASN F  1 16  ? -19.852 -38.030 15.815  1.00 0.00 ? 22  ASN F CB    1 
ATOM 5006  C CG    . ASN F  1 16  ? -19.445 -38.807 14.621  1.00 0.00 ? 22  ASN F CG    1 
ATOM 5007  O OD1   . ASN F  1 16  ? -18.634 -39.732 14.707  1.00 0.00 ? 22  ASN F OD1   1 
ATOM 5008  N ND2   . ASN F  1 16  ? -19.991 -38.455 13.490  1.00 0.00 ? 22  ASN F ND2   1 
ATOM 5009  N N     . ALA F  1 17  ? -20.899 -37.532 18.597  1.00 0.00 ? 23  ALA F N     1 
ATOM 5010  C CA    . ALA F  1 17  ? -21.269 -36.623 19.651  1.00 0.00 ? 23  ALA F CA    1 
ATOM 5011  C C     . ALA F  1 17  ? -20.538 -36.948 20.924  1.00 0.00 ? 23  ALA F C     1 
ATOM 5012  O O     . ALA F  1 17  ? -19.902 -36.084 21.519  1.00 0.00 ? 23  ALA F O     1 
ATOM 5013  C CB    . ALA F  1 17  ? -22.765 -36.677 19.884  1.00 0.00 ? 23  ALA F CB    1 
ATOM 5014  N N     . PHE F  1 18  ? -20.599 -38.205 21.330  1.00 0.00 ? 24  PHE F N     1 
ATOM 5015  C CA    . PHE F  1 18  ? -19.979 -38.629 22.560  1.00 0.00 ? 24  PHE F CA    1 
ATOM 5016  C C     . PHE F  1 18  ? -18.499 -38.380 22.586  1.00 0.00 ? 24  PHE F C     1 
ATOM 5017  O O     . PHE F  1 18  ? -17.956 -38.023 23.622  1.00 0.00 ? 24  PHE F O     1 
ATOM 5018  C CB    . PHE F  1 18  ? -20.260 -40.074 22.844  1.00 0.00 ? 24  PHE F CB    1 
ATOM 5019  C CG    . PHE F  1 18  ? -19.665 -40.528 24.139  1.00 0.00 ? 24  PHE F CG    1 
ATOM 5020  C CD1   . PHE F  1 18  ? -20.037 -39.929 25.330  1.00 0.00 ? 24  PHE F CD1   1 
ATOM 5021  C CD2   . PHE F  1 18  ? -18.756 -41.574 24.180  1.00 0.00 ? 24  PHE F CD2   1 
ATOM 5022  C CE1   . PHE F  1 18  ? -19.507 -40.362 26.530  1.00 0.00 ? 24  PHE F CE1   1 
ATOM 5023  C CE2   . PHE F  1 18  ? -18.233 -42.010 25.378  1.00 0.00 ? 24  PHE F CE2   1 
ATOM 5024  C CZ    . PHE F  1 18  ? -18.607 -41.402 26.553  1.00 0.00 ? 24  PHE F CZ    1 
ATOM 5025  N N     . SER F  1 19  ? -17.829 -38.558 21.449  1.00 0.00 ? 25  SER F N     1 
ATOM 5026  C CA    . SER F  1 19  ? -16.374 -38.401 21.397  1.00 0.00 ? 25  SER F CA    1 
ATOM 5027  C C     . SER F  1 19  ? -15.909 -36.967 21.690  1.00 0.00 ? 25  SER F C     1 
ATOM 5028  O O     . SER F  1 19  ? -14.728 -36.741 21.940  1.00 0.00 ? 25  SER F O     1 
ATOM 5029  C CB    . SER F  1 19  ? -15.858 -38.803 20.044  1.00 0.00 ? 25  SER F CB    1 
ATOM 5030  O OG    . SER F  1 19  ? -16.186 -37.844 19.074  1.00 0.00 ? 25  SER F OG    1 
ATOM 5031  N N     . ASN F  1 20  ? -16.828 -36.006 21.636  1.00 0.00 ? 26  ASN F N     1 
ATOM 5032  C CA    . ASN F  1 20  ? -16.501 -34.611 21.901  1.00 0.00 ? 26  ASN F CA    1 
ATOM 5033  C C     . ASN F  1 20  ? -16.112 -34.404 23.361  1.00 0.00 ? 26  ASN F C     1 
ATOM 5034  O O     . ASN F  1 20  ? -16.934 -34.624 24.239  1.00 0.00 ? 26  ASN F O     1 
ATOM 5035  C CB    . ASN F  1 20  ? -17.684 -33.737 21.551  1.00 0.00 ? 26  ASN F CB    1 
ATOM 5036  C CG    . ASN F  1 20  ? -17.422 -32.278 21.745  1.00 0.00 ? 26  ASN F CG    1 
ATOM 5037  O OD1   . ASN F  1 20  ? -16.952 -31.846 22.807  1.00 0.00 ? 26  ASN F OD1   1 
ATOM 5038  N ND2   . ASN F  1 20  ? -17.720 -31.501 20.739  1.00 0.00 ? 26  ASN F ND2   1 
ATOM 5039  N N     . PRO F  1 21  ? -14.849 -33.999 23.630  1.00 0.00 ? 27  PRO F N     1 
ATOM 5040  C CA    . PRO F  1 21  ? -14.282 -33.729 24.970  1.00 0.00 ? 27  PRO F CA    1 
ATOM 5041  C C     . PRO F  1 21  ? -15.316 -33.273 25.980  1.00 0.00 ? 27  PRO F C     1 
ATOM 5042  O O     . PRO F  1 21  ? -15.362 -33.772 27.108  1.00 0.00 ? 27  PRO F O     1 
ATOM 5043  C CB    . PRO F  1 21  ? -13.307 -32.570 24.718  1.00 0.00 ? 27  PRO F CB    1 
ATOM 5044  C CG    . PRO F  1 21  ? -12.904 -32.719 23.315  1.00 0.00 ? 27  PRO F CG    1 
ATOM 5045  C CD    . PRO F  1 21  ? -14.156 -33.162 22.619  1.00 0.00 ? 27  PRO F CD    1 
ATOM 5046  N N     . THR F  1 22  ? -16.120 -32.293 25.587  1.00 0.00 ? 28  THR F N     1 
ATOM 5047  C CA    . THR F  1 22  ? -17.085 -31.713 26.478  1.00 0.00 ? 28  THR F CA    1 
ATOM 5048  C C     . THR F  1 22  ? -18.202 -32.656 26.758  1.00 0.00 ? 28  THR F C     1 
ATOM 5049  O O     . THR F  1 22  ? -18.598 -32.823 27.904  1.00 0.00 ? 28  THR F O     1 
ATOM 5050  C CB    . THR F  1 22  ? -17.644 -30.420 25.911  1.00 0.00 ? 28  THR F CB    1 
ATOM 5051  O OG1   . THR F  1 22  ? -16.583 -29.476 25.741  1.00 0.00 ? 28  THR F OG1   1 
ATOM 5052  C CG2   . THR F  1 22  ? -18.678 -29.847 26.850  1.00 0.00 ? 28  THR F CG2   1 
ATOM 5053  N N     . VAL F  1 23  ? -18.715 -33.284 25.721  1.00 0.00 ? 29  VAL F N     1 
ATOM 5054  C CA    . VAL F  1 23  ? -19.816 -34.199 25.873  1.00 0.00 ? 29  VAL F CA    1 
ATOM 5055  C C     . VAL F  1 23  ? -19.421 -35.395 26.679  1.00 0.00 ? 29  VAL F C     1 
ATOM 5056  O O     . VAL F  1 23  ? -20.151 -35.820 27.573  1.00 0.00 ? 29  VAL F O     1 
ATOM 5057  C CB    . VAL F  1 23  ? -20.313 -34.658 24.519  1.00 0.00 ? 29  VAL F CB    1 
ATOM 5058  C CG1   . VAL F  1 23  ? -21.344 -35.749 24.686  1.00 0.00 ? 29  VAL F CG1   1 
ATOM 5059  C CG2   . VAL F  1 23  ? -20.896 -33.490 23.781  1.00 0.00 ? 29  VAL F CG2   1 
ATOM 5060  N N     . ALA F  1 24  ? -18.266 -35.942 26.374  1.00 0.00 ? 30  ALA F N     1 
ATOM 5061  C CA    . ALA F  1 24  ? -17.784 -37.104 27.072  1.00 0.00 ? 30  ALA F CA    1 
ATOM 5062  C C     . ALA F  1 24  ? -17.643 -36.829 28.541  1.00 0.00 ? 30  ALA F C     1 
ATOM 5063  O O     . ALA F  1 24  ? -18.167 -37.565 29.370  1.00 0.00 ? 30  ALA F O     1 
ATOM 5064  C CB    . ALA F  1 24  ? -16.450 -37.549 26.505  1.00 0.00 ? 30  ALA F CB    1 
ATOM 5065  N N     . SER F  1 25  ? -16.950 -35.753 28.874  1.00 0.00 ? 31  SER F N     1 
ATOM 5066  C CA    . SER F  1 25  ? -16.700 -35.443 30.254  1.00 0.00 ? 31  SER F CA    1 
ATOM 5067  C C     . SER F  1 25  ? -17.928 -34.991 30.980  1.00 0.00 ? 31  SER F C     1 
ATOM 5068  O O     . SER F  1 25  ? -18.085 -35.276 32.160  1.00 0.00 ? 31  SER F O     1 
ATOM 5069  C CB    . SER F  1 25  ? -15.669 -34.392 30.342  1.00 0.00 ? 31  SER F CB    1 
ATOM 5070  O OG    . SER F  1 25  ? -16.101 -33.222 29.716  1.00 0.00 ? 31  SER F OG    1 
ATOM 5071  N N     . THR F  1 26  ? -18.833 -34.328 30.282  1.00 0.00 ? 32  THR F N     1 
ATOM 5072  C CA    . THR F  1 26  ? -20.056 -33.893 30.914  1.00 0.00 ? 32  THR F CA    1 
ATOM 5073  C C     . THR F  1 26  ? -20.842 -35.064 31.389  1.00 0.00 ? 32  THR F C     1 
ATOM 5074  O O     . THR F  1 26  ? -21.221 -35.137 32.555  1.00 0.00 ? 32  THR F O     1 
ATOM 5075  C CB    . THR F  1 26  ? -20.918 -33.064 29.974  1.00 0.00 ? 32  THR F CB    1 
ATOM 5076  O OG1   . THR F  1 26  ? -20.222 -31.873 29.614  1.00 0.00 ? 32  THR F OG1   1 
ATOM 5077  C CG2   . THR F  1 26  ? -22.213 -32.707 30.653  1.00 0.00 ? 32  THR F CG2   1 
ATOM 5078  N N     . ILE F  1 27  ? -21.078 -35.998 30.497  1.00 0.00 ? 33  ILE F N     1 
ATOM 5079  C CA    . ILE F  1 27  ? -21.856 -37.148 30.838  1.00 0.00 ? 33  ILE F CA    1 
ATOM 5080  C C     . ILE F  1 27  ? -21.166 -37.994 31.868  1.00 0.00 ? 33  ILE F C     1 
ATOM 5081  O O     . ILE F  1 27  ? -21.760 -38.348 32.883  1.00 0.00 ? 33  ILE F O     1 
ATOM 5082  C CB    . ILE F  1 27  ? -22.125 -37.993 29.612  1.00 0.00 ? 33  ILE F CB    1 
ATOM 5083  C CG1   . ILE F  1 27  ? -23.027 -37.251 28.651  1.00 0.00 ? 33  ILE F CG1   1 
ATOM 5084  C CG2   . ILE F  1 27  ? -22.755 -39.299 30.022  1.00 0.00 ? 33  ILE F CG2   1 
ATOM 5085  C CD1   . ILE F  1 27  ? -23.113 -37.898 27.300  1.00 0.00 ? 33  ILE F CD1   1 
ATOM 5086  N N     . LEU F  1 28  ? -19.914 -38.322 31.613  1.00 0.00 ? 34  LEU F N     1 
ATOM 5087  C CA    . LEU F  1 28  ? -19.185 -39.238 32.449  1.00 0.00 ? 34  LEU F CA    1 
ATOM 5088  C C     . LEU F  1 28  ? -18.949 -38.703 33.838  1.00 0.00 ? 34  LEU F C     1 
ATOM 5089  O O     . LEU F  1 28  ? -19.030 -39.450 34.812  1.00 0.00 ? 34  LEU F O     1 
ATOM 5090  C CB    . LEU F  1 28  ? -17.868 -39.569 31.794  1.00 0.00 ? 34  LEU F CB    1 
ATOM 5091  C CG    . LEU F  1 28  ? -17.980 -40.381 30.507  1.00 0.00 ? 34  LEU F CG    1 
ATOM 5092  C CD1   . LEU F  1 28  ? -16.620 -40.458 29.846  1.00 0.00 ? 34  LEU F CD1   1 
ATOM 5093  C CD2   . LEU F  1 28  ? -18.514 -41.763 30.829  1.00 0.00 ? 34  LEU F CD2   1 
ATOM 5094  N N     . SER F  1 29  ? -18.682 -37.412 33.951  1.00 0.00 ? 35  SER F N     1 
ATOM 5095  C CA    . SER F  1 29  ? -18.469 -36.833 35.258  1.00 0.00 ? 35  SER F CA    1 
ATOM 5096  C C     . SER F  1 29  ? -19.767 -36.725 36.028  1.00 0.00 ? 35  SER F C     1 
ATOM 5097  O O     . SER F  1 29  ? -19.767 -36.808 37.255  1.00 0.00 ? 35  SER F O     1 
ATOM 5098  C CB    . SER F  1 29  ? -17.840 -35.478 35.141  1.00 0.00 ? 35  SER F CB    1 
ATOM 5099  O OG    . SER F  1 29  ? -18.715 -34.572 34.538  1.00 0.00 ? 35  SER F OG    1 
ATOM 5100  N N     . ASN F  1 30  ? -20.887 -36.593 35.317  1.00 0.00 ? 36  ASN F N     1 
ATOM 5101  C CA    . ASN F  1 30  ? -22.169 -36.531 35.984  1.00 0.00 ? 36  ASN F CA    1 
ATOM 5102  C C     . ASN F  1 30  ? -22.614 -37.879 36.483  1.00 0.00 ? 36  ASN F C     1 
ATOM 5103  O O     . ASN F  1 30  ? -23.207 -37.977 37.551  1.00 0.00 ? 36  ASN F O     1 
ATOM 5104  C CB    . ASN F  1 30  ? -23.213 -35.928 35.092  1.00 0.00 ? 36  ASN F CB    1 
ATOM 5105  C CG    . ASN F  1 30  ? -23.032 -34.452 34.957  1.00 0.00 ? 36  ASN F CG    1 
ATOM 5106  O OD1   . ASN F  1 30  ? -22.251 -33.850 35.702  1.00 0.00 ? 36  ASN F OD1   1 
ATOM 5107  N ND2   . ASN F  1 30  ? -23.745 -33.848 34.049  1.00 0.00 ? 36  ASN F ND2   1 
ATOM 5108  N N     . VAL F  1 31  ? -22.301 -38.936 35.738  1.00 0.00 ? 37  VAL F N     1 
ATOM 5109  C CA    . VAL F  1 31  ? -22.726 -40.269 36.143  1.00 0.00 ? 37  VAL F CA    1 
ATOM 5110  C C     . VAL F  1 31  ? -21.674 -40.979 36.933  1.00 0.00 ? 37  VAL F C     1 
ATOM 5111  O O     . VAL F  1 31  ? -21.858 -42.134 37.288  1.00 0.00 ? 37  VAL F O     1 
ATOM 5112  C CB    . VAL F  1 31  ? -23.075 -41.139 34.937  1.00 0.00 ? 37  VAL F CB    1 
ATOM 5113  C CG1   . VAL F  1 31  ? -24.158 -40.489 34.106  1.00 0.00 ? 37  VAL F CG1   1 
ATOM 5114  C CG2   . VAL F  1 31  ? -21.833 -41.404 34.125  1.00 0.00 ? 37  VAL F CG2   1 
ATOM 5115  N N     . SER F  1 32  ? -20.560 -40.303 37.198  1.00 0.00 ? 38  SER F N     1 
ATOM 5116  C CA    . SER F  1 32  ? -19.489 -40.884 37.987  1.00 0.00 ? 38  SER F CA    1 
ATOM 5117  C C     . SER F  1 32  ? -19.989 -41.533 39.290  1.00 0.00 ? 38  SER F C     1 
ATOM 5118  O O     . SER F  1 32  ? -20.023 -42.758 39.377  1.00 0.00 ? 38  SER F O     1 
ATOM 5119  C CB    . SER F  1 32  ? -18.403 -39.855 38.259  1.00 0.00 ? 38  SER F CB    1 
ATOM 5120  O OG    . SER F  1 32  ? -17.708 -39.536 37.085  1.00 0.00 ? 38  SER F OG    1 
ATOM 5121  N N     . PRO F  1 33  ? -20.320 -40.736 40.331  1.00 0.00 ? 39  PRO F N     1 
ATOM 5122  C CA    . PRO F  1 33  ? -20.745 -41.251 41.635  1.00 0.00 ? 39  PRO F CA    1 
ATOM 5123  C C     . PRO F  1 33  ? -21.923 -42.243 41.528  1.00 0.00 ? 39  PRO F C     1 
ATOM 5124  O O     . PRO F  1 33  ? -22.068 -43.133 42.368  1.00 0.00 ? 39  PRO F O     1 
ATOM 5125  C CB    . PRO F  1 33  ? -21.194 -40.005 42.362  1.00 0.00 ? 39  PRO F CB    1 
ATOM 5126  C CG    . PRO F  1 33  ? -21.786 -39.151 41.298  1.00 0.00 ? 39  PRO F CG    1 
ATOM 5127  C CD    . PRO F  1 33  ? -21.024 -39.463 40.048  1.00 0.00 ? 39  PRO F CD    1 
ATOM 5128  N N     . VAL F  1 34  ? -22.734 -42.107 40.481  1.00 0.00 ? 40  VAL F N     1 
ATOM 5129  C CA    . VAL F  1 34  ? -23.846 -42.994 40.265  1.00 0.00 ? 40  VAL F CA    1 
ATOM 5130  C C     . VAL F  1 34  ? -23.340 -44.349 39.874  1.00 0.00 ? 40  VAL F C     1 
ATOM 5131  O O     . VAL F  1 34  ? -23.748 -45.365 40.437  1.00 0.00 ? 40  VAL F O     1 
ATOM 5132  C CB    . VAL F  1 34  ? -24.748 -42.452 39.162  1.00 0.00 ? 40  VAL F CB    1 
ATOM 5133  C CG1   . VAL F  1 34  ? -25.833 -43.459 38.839  1.00 0.00 ? 40  VAL F CG1   1 
ATOM 5134  C CG2   . VAL F  1 34  ? -25.340 -41.124 39.591  1.00 0.00 ? 40  VAL F CG2   1 
ATOM 5135  N N     . ALA F  1 35  ? -22.419 -44.357 38.924  1.00 0.00 ? 41  ALA F N     1 
ATOM 5136  C CA    . ALA F  1 35  ? -21.791 -45.568 38.461  1.00 0.00 ? 41  ALA F CA    1 
ATOM 5137  C C     . ALA F  1 35  ? -21.106 -46.267 39.586  1.00 0.00 ? 41  ALA F C     1 
ATOM 5138  O O     . ALA F  1 35  ? -21.158 -47.488 39.687  1.00 0.00 ? 41  ALA F O     1 
ATOM 5139  C CB    . ALA F  1 35  ? -20.787 -45.254 37.373  1.00 0.00 ? 41  ALA F CB    1 
ATOM 5140  N N     . GLN F  1 36  ? -20.477 -45.492 40.452  1.00 0.00 ? 42  GLN F N     1 
ATOM 5141  C CA    . GLN F  1 36  ? -19.757 -46.042 41.567  1.00 0.00 ? 42  GLN F CA    1 
ATOM 5142  C C     . GLN F  1 36  ? -20.673 -46.809 42.449  1.00 0.00 ? 42  GLN F C     1 
ATOM 5143  O O     . GLN F  1 36  ? -20.357 -47.915 42.866  1.00 0.00 ? 42  GLN F O     1 
ATOM 5144  C CB    . GLN F  1 36  ? -19.098 -44.938 42.353  1.00 0.00 ? 42  GLN F CB    1 
ATOM 5145  C CG    . GLN F  1 36  ? -18.009 -44.244 41.591  1.00 0.00 ? 42  GLN F CG    1 
ATOM 5146  C CD    . GLN F  1 36  ? -17.355 -43.141 42.377  1.00 0.00 ? 42  GLN F CD    1 
ATOM 5147  O OE1   . GLN F  1 36  ? -17.112 -43.274 43.580  1.00 0.00 ? 42  GLN F OE1   1 
ATOM 5148  N NE2   . GLN F  1 36  ? -17.063 -42.037 41.704  1.00 0.00 ? 42  GLN F NE2   1 
ATOM 5149  N N     . GLN F  1 37  ? -21.844 -46.251 42.703  1.00 0.00 ? 43  GLN F N     1 
ATOM 5150  C CA    . GLN F  1 37  ? -22.822 -46.926 43.519  1.00 0.00 ? 43  GLN F CA    1 
ATOM 5151  C C     . GLN F  1 37  ? -23.264 -48.219 42.901  1.00 0.00 ? 43  GLN F C     1 
ATOM 5152  O O     . GLN F  1 37  ? -23.358 -49.239 43.584  1.00 0.00 ? 43  GLN F O     1 
ATOM 5153  C CB    . GLN F  1 37  ? -24.033 -46.045 43.730  1.00 0.00 ? 43  GLN F CB    1 
ATOM 5154  C CG    . GLN F  1 37  ? -25.086 -46.677 44.595  1.00 0.00 ? 43  GLN F CG    1 
ATOM 5155  C CD    . GLN F  1 37  ? -24.601 -46.893 46.001  1.00 0.00 ? 43  GLN F CD    1 
ATOM 5156  O OE1   . GLN F  1 37  ? -24.142 -45.954 46.655  1.00 0.00 ? 43  GLN F OE1   1 
ATOM 5157  N NE2   . GLN F  1 37  ? -24.692 -48.129 46.483  1.00 0.00 ? 43  GLN F NE2   1 
ATOM 5158  N N     . ASN F  1 38  ? -23.523 -48.187 41.604  1.00 0.00 ? 44  ASN F N     1 
ATOM 5159  C CA    . ASN F  1 38  ? -24.015 -49.353 40.912  1.00 0.00 ? 44  ASN F CA    1 
ATOM 5160  C C     . ASN F  1 38  ? -22.981 -50.451 40.862  1.00 0.00 ? 44  ASN F C     1 
ATOM 5161  O O     . ASN F  1 38  ? -23.301 -51.623 41.056  1.00 0.00 ? 44  ASN F O     1 
ATOM 5162  C CB    . ASN F  1 38  ? -24.473 -48.969 39.534  1.00 0.00 ? 44  ASN F CB    1 
ATOM 5163  C CG    . ASN F  1 38  ? -25.745 -48.180 39.589  1.00 0.00 ? 44  ASN F CG    1 
ATOM 5164  O OD1   . ASN F  1 38  ? -26.454 -48.225 40.600  1.00 0.00 ? 44  ASN F OD1   1 
ATOM 5165  N ND2   . ASN F  1 38  ? -26.053 -47.464 38.538  1.00 0.00 ? 44  ASN F ND2   1 
ATOM 5166  N N     . PHE F  1 39  ? -21.735 -50.068 40.637  1.00 0.00 ? 45  PHE F N     1 
ATOM 5167  C CA    . PHE F  1 39  ? -20.643 -51.012 40.605  1.00 0.00 ? 45  PHE F CA    1 
ATOM 5168  C C     . PHE F  1 39  ? -20.462 -51.641 41.963  1.00 0.00 ? 45  PHE F C     1 
ATOM 5169  O O     . PHE F  1 39  ? -20.378 -52.854 42.090  1.00 0.00 ? 45  PHE F O     1 
ATOM 5170  C CB    . PHE F  1 39  ? -19.358 -50.336 40.212  1.00 0.00 ? 45  PHE F CB    1 
ATOM 5171  C CG    . PHE F  1 39  ? -18.232 -51.290 40.054  1.00 0.00 ? 45  PHE F CG    1 
ATOM 5172  C CD1   . PHE F  1 39  ? -17.831 -51.696 38.798  1.00 0.00 ? 45  PHE F CD1   1 
ATOM 5173  C CD2   . PHE F  1 39  ? -17.601 -51.832 41.155  1.00 0.00 ? 45  PHE F CD2   1 
ATOM 5174  C CE1   . PHE F  1 39  ? -16.794 -52.594 38.639  1.00 0.00 ? 45  PHE F CE1   1 
ATOM 5175  C CE2   . PHE F  1 39  ? -16.570 -52.739 41.003  1.00 0.00 ? 45  PHE F CE2   1 
ATOM 5176  C CZ    . PHE F  1 39  ? -16.159 -53.111 39.743  1.00 0.00 ? 45  PHE F CZ    1 
ATOM 5177  N N     . GLN F  1 40  ? -20.422 -50.809 42.989  1.00 0.00 ? 46  GLN F N     1 
ATOM 5178  C CA    . GLN F  1 40  ? -20.238 -51.290 44.336  1.00 0.00 ? 46  GLN F CA    1 
ATOM 5179  C C     . GLN F  1 40  ? -21.341 -52.213 44.764  1.00 0.00 ? 46  GLN F C     1 
ATOM 5180  O O     . GLN F  1 40  ? -21.110 -53.165 45.503  1.00 0.00 ? 46  GLN F O     1 
ATOM 5181  C CB    . GLN F  1 40  ? -20.179 -50.138 45.314  1.00 0.00 ? 46  GLN F CB    1 
ATOM 5182  C CG    . GLN F  1 40  ? -18.933 -49.295 45.248  1.00 0.00 ? 46  GLN F CG    1 
ATOM 5183  C CD    . GLN F  1 40  ? -19.056 -48.110 46.163  1.00 0.00 ? 46  GLN F CD    1 
ATOM 5184  O OE1   . GLN F  1 40  ? -19.838 -48.146 47.113  1.00 0.00 ? 46  GLN F OE1   1 
ATOM 5185  N NE2   . GLN F  1 40  ? -18.306 -47.049 45.893  1.00 0.00 ? 46  GLN F NE2   1 
ATOM 5186  N N     . THR F  1 41  ? -22.553 -51.913 44.337  1.00 0.00 ? 47  THR F N     1 
ATOM 5187  C CA    . THR F  1 41  ? -23.694 -52.677 44.752  1.00 0.00 ? 47  THR F CA    1 
ATOM 5188  C C     . THR F  1 41  ? -23.726 -54.083 44.161  1.00 0.00 ? 47  THR F C     1 
ATOM 5189  O O     . THR F  1 41  ? -23.906 -55.055 44.885  1.00 0.00 ? 47  THR F O     1 
ATOM 5190  C CB    . THR F  1 41  ? -24.982 -51.953 44.374  1.00 0.00 ? 47  THR F CB    1 
ATOM 5191  O OG1   . THR F  1 41  ? -25.013 -50.675 45.014  1.00 0.00 ? 47  THR F OG1   1 
ATOM 5192  C CG2   . THR F  1 41  ? -26.189 -52.762 44.806  1.00 0.00 ? 47  THR F CG2   1 
ATOM 5193  N N     . ASN F  1 42  ? -23.588 -54.193 42.846  1.00 0.00 ? 48  ASN F N     1 
ATOM 5194  C CA    . ASN F  1 42  ? -23.774 -55.488 42.211  1.00 0.00 ? 48  ASN F CA    1 
ATOM 5195  C C     . ASN F  1 42  ? -22.520 -56.306 41.975  1.00 0.00 ? 48  ASN F C     1 
ATOM 5196  O O     . ASN F  1 42  ? -22.618 -57.504 41.764  1.00 0.00 ? 48  ASN F O     1 
ATOM 5197  C CB    . ASN F  1 42  ? -24.522 -55.333 40.911  1.00 0.00 ? 48  ASN F CB    1 
ATOM 5198  C CG    . ASN F  1 42  ? -25.975 -55.006 41.118  1.00 0.00 ? 48  ASN F CG    1 
ATOM 5199  O OD1   . ASN F  1 42  ? -26.556 -55.326 42.165  1.00 0.00 ? 48  ASN F OD1   1 
ATOM 5200  N ND2   . ASN F  1 42  ? -26.584 -54.403 40.132  1.00 0.00 ? 48  ASN F ND2   1 
ATOM 5201  N N     . VAL F  1 43  ? -21.345 -55.700 42.016  1.00 0.00 ? 49  VAL F N     1 
ATOM 5202  C CA    . VAL F  1 43  ? -20.139 -56.463 41.692  1.00 0.00 ? 49  VAL F CA    1 
ATOM 5203  C C     . VAL F  1 43  ? -19.632 -57.463 42.760  1.00 0.00 ? 49  VAL F C     1 
ATOM 5204  O O     . VAL F  1 43  ? -19.385 -58.622 42.420  1.00 0.00 ? 49  VAL F O     1 
ATOM 5205  C CB    . VAL F  1 43  ? -19.026 -55.534 41.306  1.00 0.00 ? 49  VAL F CB    1 
ATOM 5206  C CG1   . VAL F  1 43  ? -17.730 -56.300 41.160  1.00 0.00 ? 49  VAL F CG1   1 
ATOM 5207  C CG2   . VAL F  1 43  ? -19.401 -54.890 39.994  1.00 0.00 ? 49  VAL F CG2   1 
ATOM 5208  N N     . PRO F  1 44  ? -19.436 -57.046 44.030  1.00 0.00 ? 50  PRO F N     1 
ATOM 5209  C CA    . PRO F  1 44  ? -18.925 -57.911 45.095  1.00 0.00 ? 50  PRO F CA    1 
ATOM 5210  C C     . PRO F  1 44  ? -19.758 -59.192 45.241  1.00 0.00 ? 50  PRO F C     1 
ATOM 5211  O O     . PRO F  1 44  ? -19.258 -60.215 45.716  1.00 0.00 ? 50  PRO F O     1 
ATOM 5212  C CB    . PRO F  1 44  ? -19.062 -57.051 46.335  1.00 0.00 ? 50  PRO F CB    1 
ATOM 5213  C CG    . PRO F  1 44  ? -20.266 -56.223 46.084  1.00 0.00 ? 50  PRO F CG    1 
ATOM 5214  C CD    . PRO F  1 44  ? -20.342 -56.032 44.598  1.00 0.00 ? 50  PRO F CD    1 
ATOM 5215  N N     . LYS F  1 45  ? -21.007 -59.144 44.781  1.00 0.00 ? 51  LYS F N     1 
ATOM 5216  C CA    . LYS F  1 45  ? -21.894 -60.286 44.781  1.00 0.00 ? 51  LYS F CA    1 
ATOM 5217  C C     . LYS F  1 45  ? -21.330 -61.414 43.945  1.00 0.00 ? 51  LYS F C     1 
ATOM 5218  O O     . LYS F  1 45  ? -21.458 -62.583 44.296  1.00 0.00 ? 51  LYS F O     1 
ATOM 5219  C CB    . LYS F  1 45  ? -23.241 -59.883 44.213  1.00 0.00 ? 51  LYS F CB    1 
ATOM 5220  C CG    . LYS F  1 45  ? -24.045 -58.939 45.083  1.00 0.00 ? 51  LYS F CG    1 
ATOM 5221  C CD    . LYS F  1 45  ? -25.320 -58.509 44.371  1.00 0.00 ? 51  LYS F CD    1 
ATOM 5222  C CE    . LYS F  1 45  ? -26.138 -57.553 45.216  1.00 0.00 ? 51  LYS F CE    1 
ATOM 5223  N NZ    . LYS F  1 45  ? -27.301 -57.014 44.468  1.00 0.00 ? 51  LYS F NZ    1 
ATOM 5224  N N     . PHE F  1 46  ? -20.709 -61.058 42.829  1.00 0.00 ? 52  PHE F N     1 
ATOM 5225  C CA    . PHE F  1 46  ? -20.162 -62.033 41.916  1.00 0.00 ? 52  PHE F CA    1 
ATOM 5226  C C     . PHE F  1 46  ? -18.741 -62.367 42.264  1.00 0.00 ? 52  PHE F C     1 
ATOM 5227  O O     . PHE F  1 46  ? -18.268 -63.463 41.971  1.00 0.00 ? 52  PHE F O     1 
ATOM 5228  C CB    . PHE F  1 46  ? -20.238 -61.506 40.505  1.00 0.00 ? 52  PHE F CB    1 
ATOM 5229  C CG    . PHE F  1 46  ? -21.635 -61.393 40.018  1.00 0.00 ? 52  PHE F CG    1 
ATOM 5230  C CD1   . PHE F  1 46  ? -22.355 -60.255 40.276  1.00 0.00 ? 52  PHE F CD1   1 
ATOM 5231  C CD2   . PHE F  1 46  ? -22.233 -62.414 39.309  1.00 0.00 ? 52  PHE F CD2   1 
ATOM 5232  C CE1   . PHE F  1 46  ? -23.655 -60.130 39.846  1.00 0.00 ? 52  PHE F CE1   1 
ATOM 5233  C CE2   . PHE F  1 46  ? -23.527 -62.293 38.866  1.00 0.00 ? 52  PHE F CE2   1 
ATOM 5234  C CZ    . PHE F  1 46  ? -24.242 -61.151 39.138  1.00 0.00 ? 52  PHE F CZ    1 
ATOM 5235  N N     . THR F  1 47  ? -18.055 -61.444 42.915  1.00 0.00 ? 53  THR F N     1 
ATOM 5236  C CA    . THR F  1 47  ? -16.704 -61.721 43.348  1.00 0.00 ? 53  THR F CA    1 
ATOM 5237  C C     . THR F  1 47  ? -16.699 -62.855 44.347  1.00 0.00 ? 53  THR F C     1 
ATOM 5238  O O     . THR F  1 47  ? -15.852 -63.746 44.279  1.00 0.00 ? 53  THR F O     1 
ATOM 5239  C CB    . THR F  1 47  ? -16.044 -60.509 43.965  1.00 0.00 ? 53  THR F CB    1 
ATOM 5240  O OG1   . THR F  1 47  ? -15.967 -59.454 43.002  1.00 0.00 ? 53  THR F OG1   1 
ATOM 5241  C CG2   . THR F  1 47  ? -14.651 -60.881 44.417  1.00 0.00 ? 53  THR F CG2   1 
ATOM 5242  N N     . SER F  1 48  ? -17.659 -62.835 45.272  1.00 0.00 ? 54  SER F N     1 
ATOM 5243  C CA    . SER F  1 48  ? -17.766 -63.896 46.258  1.00 0.00 ? 54  SER F CA    1 
ATOM 5244  C C     . SER F  1 48  ? -18.056 -65.231 45.596  1.00 0.00 ? 54  SER F C     1 
ATOM 5245  O O     . SER F  1 48  ? -17.582 -66.275 46.053  1.00 0.00 ? 54  SER F O     1 
ATOM 5246  C CB    . SER F  1 48  ? -18.870 -63.584 47.234  1.00 0.00 ? 54  SER F CB    1 
ATOM 5247  O OG    . SER F  1 48  ? -20.122 -63.644 46.609  1.00 0.00 ? 54  SER F OG    1 
ATOM 5248  N N     . VAL F  1 49  ? -18.778 -65.189 44.481  1.00 0.00 ? 55  VAL F N     1 
ATOM 5249  C CA    . VAL F  1 49  ? -19.056 -66.384 43.721  1.00 0.00 ? 55  VAL F CA    1 
ATOM 5250  C C     . VAL F  1 49  ? -17.792 -66.937 43.163  1.00 0.00 ? 55  VAL F C     1 
ATOM 5251  O O     . VAL F  1 49  ? -17.532 -68.128 43.260  1.00 0.00 ? 55  VAL F O     1 
ATOM 5252  C CB    . VAL F  1 49  ? -20.036 -66.095 42.568  1.00 0.00 ? 55  VAL F CB    1 
ATOM 5253  C CG1   . VAL F  1 49  ? -20.149 -67.302 41.663  1.00 0.00 ? 55  VAL F CG1   1 
ATOM 5254  C CG2   . VAL F  1 49  ? -21.388 -65.732 43.129  1.00 0.00 ? 55  VAL F CG2   1 
ATOM 5255  N N     . ASN F  1 50  ? -16.974 -66.063 42.602  1.00 0.00 ? 56  ASN F N     1 
ATOM 5256  C CA    . ASN F  1 50  ? -15.731 -66.475 42.007  1.00 0.00 ? 56  ASN F CA    1 
ATOM 5257  C C     . ASN F  1 50  ? -14.833 -67.163 42.999  1.00 0.00 ? 56  ASN F C     1 
ATOM 5258  O O     . ASN F  1 50  ? -14.211 -68.161 42.666  1.00 0.00 ? 56  ASN F O     1 
ATOM 5259  C CB    . ASN F  1 50  ? -15.033 -65.302 41.395  1.00 0.00 ? 56  ASN F CB    1 
ATOM 5260  C CG    . ASN F  1 50  ? -15.701 -64.861 40.147  1.00 0.00 ? 56  ASN F CG    1 
ATOM 5261  O OD1   . ASN F  1 50  ? -16.442 -65.637 39.540  1.00 0.00 ? 56  ASN F OD1   1 
ATOM 5262  N ND2   . ASN F  1 50  ? -15.464 -63.638 39.746  1.00 0.00 ? 56  ASN F ND2   1 
ATOM 5263  N N     . GLU F  1 51  ? -14.771 -66.655 44.229  1.00 0.00 ? 57  GLU F N     1 
ATOM 5264  C CA    . GLU F  1 51  ? -13.927 -67.292 45.237  1.00 0.00 ? 57  GLU F CA    1 
ATOM 5265  C C     . GLU F  1 51  ? -14.395 -68.706 45.532  1.00 0.00 ? 57  GLU F C     1 
ATOM 5266  O O     . GLU F  1 51  ? -13.601 -69.647 45.477  1.00 0.00 ? 57  GLU F O     1 
ATOM 5267  C CB    . GLU F  1 51  ? -13.876 -66.481 46.547  1.00 0.00 ? 57  GLU F CB    1 
ATOM 5268  C CG    . GLU F  1 51  ? -12.937 -67.094 47.611  1.00 0.00 ? 57  GLU F CG    1 
ATOM 5269  C CD    . GLU F  1 51  ? -12.782 -66.272 48.890  1.00 0.00 ? 57  GLU F CD    1 
ATOM 5270  O OE1   . GLU F  1 51  ? -13.464 -65.288 49.044  1.00 0.00 ? 57  GLU F OE1   1 
ATOM 5271  O OE2   . GLU F  1 51  ? -11.955 -66.632 49.696  1.00 0.00 ? 57  GLU F OE2   1 
ATOM 5272  N N     . ASN F  1 52  ? -15.676 -68.862 45.851  1.00 0.00 ? 58  ASN F N     1 
ATOM 5273  C CA    . ASN F  1 52  ? -16.186 -70.175 46.211  1.00 0.00 ? 58  ASN F CA    1 
ATOM 5274  C C     . ASN F  1 52  ? -16.167 -71.145 45.048  1.00 0.00 ? 58  ASN F C     1 
ATOM 5275  O O     . ASN F  1 52  ? -15.758 -72.293 45.207  1.00 0.00 ? 58  ASN F O     1 
ATOM 5276  C CB    . ASN F  1 52  ? -17.573 -70.080 46.785  1.00 0.00 ? 58  ASN F CB    1 
ATOM 5277  C CG    . ASN F  1 52  ? -17.595 -69.548 48.189  1.00 0.00 ? 58  ASN F CG    1 
ATOM 5278  O OD1   . ASN F  1 52  ? -16.558 -69.468 48.852  1.00 0.00 ? 58  ASN F OD1   1 
ATOM 5279  N ND2   . ASN F  1 52  ? -18.765 -69.207 48.662  1.00 0.00 ? 58  ASN F ND2   1 
ATOM 5280  N N     . VAL F  1 53  ? -16.583 -70.688 43.878  1.00 0.00 ? 59  VAL F N     1 
ATOM 5281  C CA    . VAL F  1 53  ? -16.601 -71.540 42.706  1.00 0.00 ? 59  VAL F CA    1 
ATOM 5282  C C     . VAL F  1 53  ? -15.218 -71.987 42.348  1.00 0.00 ? 59  VAL F C     1 
ATOM 5283  O O     . VAL F  1 53  ? -15.007 -73.149 42.017  1.00 0.00 ? 59  VAL F O     1 
ATOM 5284  C CB    . VAL F  1 53  ? -17.231 -70.821 41.509  1.00 0.00 ? 59  VAL F CB    1 
ATOM 5285  C CG1   . VAL F  1 53  ? -17.023 -71.638 40.245  1.00 0.00 ? 59  VAL F CG1   1 
ATOM 5286  C CG2   . VAL F  1 53  ? -18.715 -70.629 41.762  1.00 0.00 ? 59  VAL F CG2   1 
ATOM 5287  N N     . SER F  1 54  ? -14.272 -71.069 42.412  1.00 0.00 ? 60  SER F N     1 
ATOM 5288  C CA    . SER F  1 54  ? -12.905 -71.389 42.108  1.00 0.00 ? 60  SER F CA    1 
ATOM 5289  C C     . SER F  1 54  ? -12.404 -72.466 43.040  1.00 0.00 ? 60  SER F C     1 
ATOM 5290  O O     . SER F  1 54  ? -11.764 -73.419 42.606  1.00 0.00 ? 60  SER F O     1 
ATOM 5291  C CB    . SER F  1 54  ? -12.047 -70.161 42.227  1.00 0.00 ? 60  SER F CB    1 
ATOM 5292  O OG    . SER F  1 54  ? -10.734 -70.419 41.830  1.00 0.00 ? 60  SER F OG    1 
ATOM 5293  N N     . ALA F  1 55  ? -12.710 -72.329 44.328  1.00 0.00 ? 61  ALA F N     1 
ATOM 5294  C CA    . ALA F  1 55  ? -12.296 -73.314 45.310  1.00 0.00 ? 61  ALA F CA    1 
ATOM 5295  C C     . ALA F  1 55  ? -12.797 -74.688 44.938  1.00 0.00 ? 61  ALA F C     1 
ATOM 5296  O O     . ALA F  1 55  ? -12.047 -75.663 44.980  1.00 0.00 ? 61  ALA F O     1 
ATOM 5297  C CB    . ALA F  1 55  ? -12.800 -72.932 46.685  1.00 0.00 ? 61  ALA F CB    1 
ATOM 5298  N N     . VAL F  1 56  ? -14.057 -74.762 44.536  1.00 0.00 ? 62  VAL F N     1 
ATOM 5299  C CA    . VAL F  1 56  ? -14.646 -76.014 44.110  1.00 0.00 ? 62  VAL F CA    1 
ATOM 5300  C C     . VAL F  1 56  ? -13.916 -76.607 42.948  1.00 0.00 ? 62  VAL F C     1 
ATOM 5301  O O     . VAL F  1 56  ? -13.606 -77.795 42.944  1.00 0.00 ? 62  VAL F O     1 
ATOM 5302  C CB    . VAL F  1 56  ? -16.099 -75.808 43.724  1.00 0.00 ? 62  VAL F CB    1 
ATOM 5303  C CG1   . VAL F  1 56  ? -16.644 -77.042 43.049  1.00 0.00 ? 62  VAL F CG1   1 
ATOM 5304  C CG2   . VAL F  1 56  ? -16.891 -75.500 44.959  1.00 0.00 ? 62  VAL F CG2   1 
ATOM 5305  N N     . LEU F  1 57  ? -13.619 -75.781 41.968  1.00 0.00 ? 63  LEU F N     1 
ATOM 5306  C CA    . LEU F  1 57  ? -12.954 -76.240 40.778  1.00 0.00 ? 63  LEU F CA    1 
ATOM 5307  C C     . LEU F  1 57  ? -11.596 -76.816 41.099  1.00 0.00 ? 63  LEU F C     1 
ATOM 5308  O O     . LEU F  1 57  ? -11.186 -77.811 40.508  1.00 0.00 ? 63  LEU F O     1 
ATOM 5309  C CB    . LEU F  1 57  ? -12.844 -75.094 39.800  1.00 0.00 ? 63  LEU F CB    1 
ATOM 5310  C CG    . LEU F  1 57  ? -14.183 -74.643 39.227  1.00 0.00 ? 63  LEU F CG    1 
ATOM 5311  C CD1   . LEU F  1 57  ? -13.991 -73.391 38.399  1.00 0.00 ? 63  LEU F CD1   1 
ATOM 5312  C CD2   . LEU F  1 57  ? -14.764 -75.766 38.405  1.00 0.00 ? 63  LEU F CD2   1 
ATOM 5313  N N     . THR F  1 58  ? -10.917 -76.236 42.078  1.00 0.00 ? 64  THR F N     1 
ATOM 5314  C CA    . THR F  1 58  ? -9.652  -76.783 42.526  1.00 0.00 ? 64  THR F CA    1 
ATOM 5315  C C     . THR F  1 58  ? -9.843  -78.153 43.151  1.00 0.00 ? 64  THR F C     1 
ATOM 5316  O O     . THR F  1 58  ? -9.074  -79.074 42.884  1.00 0.00 ? 64  THR F O     1 
ATOM 5317  C CB    . THR F  1 58  ? -8.947  -75.834 43.485  1.00 0.00 ? 64  THR F CB    1 
ATOM 5318  O OG1   . THR F  1 58  ? -8.639  -74.620 42.781  1.00 0.00 ? 64  THR F OG1   1 
ATOM 5319  C CG2   . THR F  1 58  ? -7.665  -76.460 44.011  1.00 0.00 ? 64  THR F CG2   1 
ATOM 5320  N N     . GLN F  1 59  ? -10.899 -78.311 43.935  1.00 0.00 ? 65  GLN F N     1 
ATOM 5321  C CA    . GLN F  1 59  ? -11.210 -79.612 44.525  1.00 0.00 ? 65  GLN F CA    1 
ATOM 5322  C C     . GLN F  1 59  ? -11.587 -80.657 43.459  1.00 0.00 ? 65  GLN F C     1 
ATOM 5323  O O     . GLN F  1 59  ? -11.350 -81.848 43.643  1.00 0.00 ? 65  GLN F O     1 
ATOM 5324  C CB    . GLN F  1 59  ? -12.326 -79.485 45.544  1.00 0.00 ? 65  GLN F CB    1 
ATOM 5325  C CG    . GLN F  1 59  ? -11.930 -78.744 46.807  1.00 0.00 ? 65  GLN F CG    1 
ATOM 5326  C CD    . GLN F  1 59  ? -10.862 -79.482 47.602  1.00 0.00 ? 65  GLN F CD    1 
ATOM 5327  O OE1   . GLN F  1 59  ? -10.863 -80.715 47.662  1.00 0.00 ? 65  GLN F OE1   1 
ATOM 5328  N NE2   . GLN F  1 59  ? -9.958  -78.737 48.232  1.00 0.00 ? 65  GLN F NE2   1 
ATOM 5329  N N     . TYR F  1 60  ? -12.148 -80.204 42.338  1.00 0.00 ? 66  TYR F N     1 
ATOM 5330  C CA    . TYR F  1 60  ? -12.449 -81.103 41.223  1.00 0.00 ? 66  TYR F CA    1 
ATOM 5331  C C     . TYR F  1 60  ? -11.298 -81.273 40.239  1.00 0.00 ? 66  TYR F C     1 
ATOM 5332  O O     . TYR F  1 60  ? -11.446 -81.967 39.237  1.00 0.00 ? 66  TYR F O     1 
ATOM 5333  C CB    . TYR F  1 60  ? -13.682 -80.647 40.476  1.00 0.00 ? 66  TYR F CB    1 
ATOM 5334  C CG    . TYR F  1 60  ? -14.966 -81.104 41.095  1.00 0.00 ? 66  TYR F CG    1 
ATOM 5335  C CD1   . TYR F  1 60  ? -15.607 -80.336 42.033  1.00 0.00 ? 66  TYR F CD1   1 
ATOM 5336  C CD2   . TYR F  1 60  ? -15.517 -82.306 40.689  1.00 0.00 ? 66  TYR F CD2   1 
ATOM 5337  C CE1   . TYR F  1 60  ? -16.801 -80.766 42.573  1.00 0.00 ? 66  TYR F CE1   1 
ATOM 5338  C CE2   . TYR F  1 60  ? -16.710 -82.735 41.220  1.00 0.00 ? 66  TYR F CE2   1 
ATOM 5339  C CZ    . TYR F  1 60  ? -17.354 -81.969 42.159  1.00 0.00 ? 66  TYR F CZ    1 
ATOM 5340  O OH    . TYR F  1 60  ? -18.548 -82.392 42.691  1.00 0.00 ? 66  TYR F OH    1 
ATOM 5341  N N     . GLY F  1 61  ? -10.164 -80.640 40.498  1.00 0.00 ? 67  GLY F N     1 
ATOM 5342  C CA    . GLY F  1 61  ? -9.004  -80.827 39.640  1.00 0.00 ? 67  GLY F CA    1 
ATOM 5343  C C     . GLY F  1 61  ? -9.100  -80.077 38.315  1.00 0.00 ? 67  GLY F C     1 
ATOM 5344  O O     . GLY F  1 61  ? -8.369  -80.383 37.372  1.00 0.00 ? 67  GLY F O     1 
ATOM 5345  N N     . ILE F  1 62  ? -9.976  -79.083 38.249  1.00 0.00 ? 68  ILE F N     1 
ATOM 5346  C CA    . ILE F  1 62  ? -10.207 -78.349 37.017  1.00 0.00 ? 68  ILE F CA    1 
ATOM 5347  C C     . ILE F  1 62  ? -9.172  -77.257 36.843  1.00 0.00 ? 68  ILE F C     1 
ATOM 5348  O O     . ILE F  1 62  ? -8.951  -76.459 37.749  1.00 0.00 ? 68  ILE F O     1 
ATOM 5349  C CB    . ILE F  1 62  ? -11.606 -77.725 37.015  1.00 0.00 ? 68  ILE F CB    1 
ATOM 5350  C CG1   . ILE F  1 62  ? -12.665 -78.793 37.255  1.00 0.00 ? 68  ILE F CG1   1 
ATOM 5351  C CG2   . ILE F  1 62  ? -11.861 -77.036 35.701  1.00 0.00 ? 68  ILE F CG2   1 
ATOM 5352  C CD1   . ILE F  1 62  ? -12.671 -79.884 36.219  1.00 0.00 ? 68  ILE F CD1   1 
ATOM 5353  N N     . THR F  1 63  ? -8.523  -77.231 35.687  1.00 0.00 ? 69  THR F N     1 
ATOM 5354  C CA    . THR F  1 63  ? -7.476  -76.245 35.430  1.00 0.00 ? 69  THR F CA    1 
ATOM 5355  C C     . THR F  1 63  ? -7.685  -75.493 34.128  1.00 0.00 ? 69  THR F C     1 
ATOM 5356  O O     . THR F  1 63  ? -8.405  -75.946 33.240  1.00 0.00 ? 69  THR F O     1 
ATOM 5357  C CB    . THR F  1 63  ? -6.125  -76.907 35.354  1.00 0.00 ? 69  THR F CB    1 
ATOM 5358  O OG1   . THR F  1 63  ? -6.140  -77.795 34.244  1.00 0.00 ? 69  THR F OG1   1 
ATOM 5359  C CG2   . THR F  1 63  ? -5.809  -77.681 36.621  1.00 0.00 ? 69  THR F CG2   1 
ATOM 5360  N N     . GLY F  1 64  ? -6.991  -74.377 34.000  1.00 0.00 ? 70  GLY F N     1 
ATOM 5361  C CA    . GLY F  1 64  ? -6.996  -73.605 32.778  1.00 0.00 ? 70  GLY F CA    1 
ATOM 5362  C C     . GLY F  1 64  ? -8.372  -73.088 32.434  1.00 0.00 ? 70  GLY F C     1 
ATOM 5363  O O     . GLY F  1 64  ? -9.201  -72.843 33.310  1.00 0.00 ? 70  GLY F O     1 
ATOM 5364  N N     . PRO F  1 65  ? -8.635  -72.958 31.146  1.00 0.00 ? 71  PRO F N     1 
ATOM 5365  C CA    . PRO F  1 65  ? -9.855  -72.473 30.549  1.00 0.00 ? 71  PRO F CA    1 
ATOM 5366  C C     . PRO F  1 65  ? -11.036 -73.314 30.929  1.00 0.00 ? 71  PRO F C     1 
ATOM 5367  O O     . PRO F  1 65  ? -12.172 -72.866 30.826  1.00 0.00 ? 71  PRO F O     1 
ATOM 5368  C CB    . PRO F  1 65  ? -9.555  -72.498 29.072  1.00 0.00 ? 71  PRO F CB    1 
ATOM 5369  C CG    . PRO F  1 65  ? -8.086  -72.201 28.996  1.00 0.00 ? 71  PRO F CG    1 
ATOM 5370  C CD    . PRO F  1 65  ? -7.494  -72.823 30.224  1.00 0.00 ? 71  PRO F CD    1 
ATOM 5371  N N     . ASN F  1 66  ? -10.790 -74.528 31.394  1.00 0.00 ? 72  ASN F N     1 
ATOM 5372  C CA    . ASN F  1 66  ? -11.871 -75.359 31.821  1.00 0.00 ? 72  ASN F CA    1 
ATOM 5373  C C     . ASN F  1 66  ? -12.504 -74.772 33.053  1.00 0.00 ? 72  ASN F C     1 
ATOM 5374  O O     . ASN F  1 66  ? -13.713 -74.882 33.244  1.00 0.00 ? 72  ASN F O     1 
ATOM 5375  C CB    . ASN F  1 66  ? -11.393 -76.753 32.060  1.00 0.00 ? 72  ASN F CB    1 
ATOM 5376  C CG    . ASN F  1 66  ? -11.075 -77.442 30.781  1.00 0.00 ? 72  ASN F CG    1 
ATOM 5377  O OD1   . ASN F  1 66  ? -11.745 -77.224 29.769  1.00 0.00 ? 72  ASN F OD1   1 
ATOM 5378  N ND2   . ASN F  1 66  ? -10.048 -78.244 30.788  1.00 0.00 ? 72  ASN F ND2   1 
ATOM 5379  N N     . ARG F  1 67  ? -11.699 -74.101 33.871  1.00 0.00 ? 73  ARG F N     1 
ATOM 5380  C CA    . ARG F  1 67  ? -12.222 -73.446 35.040  1.00 0.00 ? 73  ARG F CA    1 
ATOM 5381  C C     . ARG F  1 67  ? -13.095 -72.332 34.598  1.00 0.00 ? 73  ARG F C     1 
ATOM 5382  O O     . ARG F  1 67  ? -14.190 -72.149 35.117  1.00 0.00 ? 73  ARG F O     1 
ATOM 5383  C CB    . ARG F  1 67  ? -11.117 -72.881 35.900  1.00 0.00 ? 73  ARG F CB    1 
ATOM 5384  C CG    . ARG F  1 67  ? -10.214 -73.903 36.524  1.00 0.00 ? 73  ARG F CG    1 
ATOM 5385  C CD    . ARG F  1 67  ? -9.121  -73.265 37.270  1.00 0.00 ? 73  ARG F CD    1 
ATOM 5386  N NE    . ARG F  1 67  ? -9.557  -72.718 38.541  1.00 0.00 ? 73  ARG F NE    1 
ATOM 5387  C CZ    . ARG F  1 67  ? -9.474  -73.377 39.714  1.00 0.00 ? 73  ARG F CZ    1 
ATOM 5388  N NH1   . ARG F  1 67  ? -9.006  -74.595 39.771  1.00 0.00 ? 73  ARG F NH1   1 
ATOM 5389  N NH2   . ARG F  1 67  ? -9.840  -72.807 40.838  1.00 0.00 ? 73  ARG F NH2   1 
ATOM 5390  N N     . ALA F  1 68  ? -12.625 -71.615 33.580  1.00 0.00 ? 74  ALA F N     1 
ATOM 5391  C CA    . ALA F  1 68  ? -13.355 -70.483 33.027  1.00 0.00 ? 74  ALA F CA    1 
ATOM 5392  C C     . ALA F  1 68  ? -14.714 -70.888 32.502  1.00 0.00 ? 74  ALA F C     1 
ATOM 5393  O O     . ALA F  1 68  ? -15.666 -70.123 32.610  1.00 0.00 ? 74  ALA F O     1 
ATOM 5394  C CB    . ALA F  1 68  ? -12.560 -69.828 31.934  1.00 0.00 ? 74  ALA F CB    1 
ATOM 5395  N N     . ILE F  1 69  ? -14.822 -72.097 31.961  1.00 0.00 ? 75  ILE F N     1 
ATOM 5396  C CA    . ILE F  1 69  ? -16.113 -72.584 31.513  1.00 0.00 ? 75  ILE F CA    1 
ATOM 5397  C C     . ILE F  1 69  ? -17.091 -72.592 32.649  1.00 0.00 ? 75  ILE F C     1 
ATOM 5398  O O     . ILE F  1 69  ? -18.220 -72.108 32.522  1.00 0.00 ? 75  ILE F O     1 
ATOM 5399  C CB    . ILE F  1 69  ? -16.025 -74.006 30.952  1.00 0.00 ? 75  ILE F CB    1 
ATOM 5400  C CG1   . ILE F  1 69  ? -15.245 -74.016 29.658  1.00 0.00 ? 75  ILE F CG1   1 
ATOM 5401  C CG2   . ILE F  1 69  ? -17.417 -74.572 30.749  1.00 0.00 ? 75  ILE F CG2   1 
ATOM 5402  C CD1   . ILE F  1 69  ? -14.880 -75.394 29.181  1.00 0.00 ? 75  ILE F CD1   1 
ATOM 5403  N N     . TYR F  1 70  ? -16.658 -73.131 33.770  1.00 0.00 ? 76  TYR F N     1 
ATOM 5404  C CA    . TYR F  1 70  ? -17.521 -73.249 34.914  1.00 0.00 ? 76  TYR F CA    1 
ATOM 5405  C C     . TYR F  1 70  ? -17.721 -71.918 35.605  1.00 0.00 ? 76  TYR F C     1 
ATOM 5406  O O     . TYR F  1 70  ? -18.778 -71.669 36.177  1.00 0.00 ? 76  TYR F O     1 
ATOM 5407  C CB    . TYR F  1 70  ? -16.965 -74.273 35.855  1.00 0.00 ? 76  TYR F CB    1 
ATOM 5408  C CG    . TYR F  1 70  ? -16.926 -75.626 35.222  1.00 0.00 ? 76  TYR F CG    1 
ATOM 5409  C CD1   . TYR F  1 70  ? -15.715 -76.229 34.984  1.00 0.00 ? 76  TYR F CD1   1 
ATOM 5410  C CD2   . TYR F  1 70  ? -18.095 -76.238 34.829  1.00 0.00 ? 76  TYR F CD2   1 
ATOM 5411  C CE1   . TYR F  1 70  ? -15.665 -77.447 34.354  1.00 0.00 ? 76  TYR F CE1   1 
ATOM 5412  C CE2   . TYR F  1 70  ? -18.053 -77.461 34.197  1.00 0.00 ? 76  TYR F CE2   1 
ATOM 5413  C CZ    . TYR F  1 70  ? -16.838 -78.059 33.956  1.00 0.00 ? 76  TYR F CZ    1 
ATOM 5414  O OH    . TYR F  1 70  ? -16.780 -79.266 33.312  1.00 0.00 ? 76  TYR F OH    1 
ATOM 5415  N N     . GLN F  1 71  ? -16.731 -71.037 35.514  1.00 0.00 ? 77  GLN F N     1 
ATOM 5416  C CA    . GLN F  1 71  ? -16.874 -69.712 36.072  1.00 0.00 ? 77  GLN F CA    1 
ATOM 5417  C C     . GLN F  1 71  ? -17.941 -68.957 35.332  1.00 0.00 ? 77  GLN F C     1 
ATOM 5418  O O     . GLN F  1 71  ? -18.784 -68.313 35.945  1.00 0.00 ? 77  GLN F O     1 
ATOM 5419  C CB    . GLN F  1 71  ? -15.557 -68.939 36.004  1.00 0.00 ? 77  GLN F CB    1 
ATOM 5420  C CG    . GLN F  1 71  ? -14.480 -69.439 36.945  1.00 0.00 ? 77  GLN F CG    1 
ATOM 5421  C CD    . GLN F  1 71  ? -14.875 -69.268 38.378  1.00 0.00 ? 77  GLN F CD    1 
ATOM 5422  O OE1   . GLN F  1 71  ? -16.028 -68.944 38.664  1.00 0.00 ? 77  GLN F OE1   1 
ATOM 5423  N NE2   . GLN F  1 71  ? -13.935 -69.465 39.296  1.00 0.00 ? 77  GLN F NE2   1 
ATOM 5424  N N     . GLY F  1 72  ? -17.943 -69.079 34.007  1.00 0.00 ? 78  GLY F N     1 
ATOM 5425  C CA    . GLY F  1 72  ? -18.952 -68.431 33.183  1.00 0.00 ? 78  GLY F CA    1 
ATOM 5426  C C     . GLY F  1 72  ? -20.328 -68.935 33.546  1.00 0.00 ? 78  GLY F C     1 
ATOM 5427  O O     . GLY F  1 72  ? -21.260 -68.152 33.726  1.00 0.00 ? 78  GLY F O     1 
ATOM 5428  N N     . PHE F  1 73  ? -20.444 -70.244 33.678  1.00 0.00 ? 79  PHE F N     1 
ATOM 5429  C CA    . PHE F  1 73  ? -21.683 -70.859 34.072  1.00 0.00 ? 79  PHE F CA    1 
ATOM 5430  C C     . PHE F  1 73  ? -22.167 -70.340 35.406  1.00 0.00 ? 79  PHE F C     1 
ATOM 5431  O O     . PHE F  1 73  ? -23.306 -69.898 35.523  1.00 0.00 ? 79  PHE F O     1 
ATOM 5432  C CB    . PHE F  1 73  ? -21.510 -72.357 34.136  1.00 0.00 ? 79  PHE F CB    1 
ATOM 5433  C CG    . PHE F  1 73  ? -22.664 -73.074 34.743  1.00 0.00 ? 79  PHE F CG    1 
ATOM 5434  C CD1   . PHE F  1 73  ? -23.836 -73.271 34.044  1.00 0.00 ? 79  PHE F CD1   1 
ATOM 5435  C CD2   . PHE F  1 73  ? -22.566 -73.575 36.022  1.00 0.00 ? 79  PHE F CD2   1 
ATOM 5436  C CE1   . PHE F  1 73  ? -24.883 -73.961 34.617  1.00 0.00 ? 79  PHE F CE1   1 
ATOM 5437  C CE2   . PHE F  1 73  ? -23.606 -74.258 36.597  1.00 0.00 ? 79  PHE F CE2   1 
ATOM 5438  C CZ    . PHE F  1 73  ? -24.768 -74.452 35.892  1.00 0.00 ? 79  PHE F CZ    1 
ATOM 5439  N N     . GLY F  1 74  ? -21.303 -70.391 36.410  1.00 0.00 ? 80  GLY F N     1 
ATOM 5440  C CA    . GLY F  1 74  ? -21.654 -69.966 37.753  1.00 0.00 ? 80  GLY F CA    1 
ATOM 5441  C C     . GLY F  1 74  ? -22.079 -68.521 37.792  1.00 0.00 ? 80  GLY F C     1 
ATOM 5442  O O     . GLY F  1 74  ? -23.089 -68.179 38.402  1.00 0.00 ? 80  GLY F O     1 
ATOM 5443  N N     . LEU F  1 75  ? -21.330 -67.673 37.129  1.00 0.00 ? 81  LEU F N     1 
ATOM 5444  C CA    . LEU F  1 75  ? -21.641 -66.269 37.101  1.00 0.00 ? 81  LEU F CA    1 
ATOM 5445  C C     . LEU F  1 75  ? -22.997 -66.021 36.480  1.00 0.00 ? 81  LEU F C     1 
ATOM 5446  O O     . LEU F  1 75  ? -23.761 -65.182 36.957  1.00 0.00 ? 81  LEU F O     1 
ATOM 5447  C CB    . LEU F  1 75  ? -20.574 -65.533 36.323  1.00 0.00 ? 81  LEU F CB    1 
ATOM 5448  C CG    . LEU F  1 75  ? -19.214 -65.450 36.995  1.00 0.00 ? 81  LEU F CG    1 
ATOM 5449  C CD1   . LEU F  1 75  ? -18.203 -64.903 36.007  1.00 0.00 ? 81  LEU F CD1   1 
ATOM 5450  C CD2   . LEU F  1 75  ? -19.325 -64.558 38.212  1.00 0.00 ? 81  LEU F CD2   1 
ATOM 5451  N N     . LYS F  1 76  ? -23.312 -66.769 35.436  1.00 0.00 ? 82  LYS F N     1 
ATOM 5452  C CA    . LYS F  1 76  ? -24.582 -66.636 34.765  1.00 0.00 ? 82  LYS F CA    1 
ATOM 5453  C C     . LYS F  1 76  ? -25.721 -67.100 35.655  1.00 0.00 ? 82  LYS F C     1 
ATOM 5454  O O     . LYS F  1 76  ? -26.794 -66.497 35.660  1.00 0.00 ? 82  LYS F O     1 
ATOM 5455  C CB    . LYS F  1 76  ? -24.548 -67.389 33.451  1.00 0.00 ? 82  LYS F CB    1 
ATOM 5456  C CG    . LYS F  1 76  ? -25.768 -67.206 32.579  1.00 0.00 ? 82  LYS F CG    1 
ATOM 5457  C CD    . LYS F  1 76  ? -25.480 -67.685 31.169  1.00 0.00 ? 82  LYS F CD    1 
ATOM 5458  C CE    . LYS F  1 76  ? -26.734 -67.712 30.326  1.00 0.00 ? 82  LYS F CE    1 
ATOM 5459  N NZ    . LYS F  1 76  ? -27.219 -66.362 30.003  1.00 0.00 ? 82  LYS F NZ    1 
ATOM 5460  N N     . VAL F  1 77  ? -25.480 -68.144 36.445  1.00 0.00 ? 83  VAL F N     1 
ATOM 5461  C CA    . VAL F  1 77  ? -26.468 -68.592 37.413  1.00 0.00 ? 83  VAL F CA    1 
ATOM 5462  C C     . VAL F  1 77  ? -26.775 -67.488 38.401  1.00 0.00 ? 83  VAL F C     1 
ATOM 5463  O O     . VAL F  1 77  ? -27.936 -67.195 38.681  1.00 0.00 ? 83  VAL F O     1 
ATOM 5464  C CB    . VAL F  1 77  ? -25.974 -69.836 38.184  1.00 0.00 ? 83  VAL F CB    1 
ATOM 5465  C CG1   . VAL F  1 77  ? -26.906 -70.134 39.339  1.00 0.00 ? 83  VAL F CG1   1 
ATOM 5466  C CG2   . VAL F  1 77  ? -25.899 -71.030 37.256  1.00 0.00 ? 83  VAL F CG2   1 
ATOM 5467  N N     . ALA F  1 78  ? -25.721 -66.869 38.921  1.00 0.00 ? 84  ALA F N     1 
ATOM 5468  C CA    . ALA F  1 78  ? -25.858 -65.794 39.881  1.00 0.00 ? 84  ALA F CA    1 
ATOM 5469  C C     . ALA F  1 78  ? -26.584 -64.600 39.274  1.00 0.00 ? 84  ALA F C     1 
ATOM 5470  O O     . ALA F  1 78  ? -27.406 -63.973 39.935  1.00 0.00 ? 84  ALA F O     1 
ATOM 5471  C CB    . ALA F  1 78  ? -24.497 -65.384 40.393  1.00 0.00 ? 84  ALA F CB    1 
ATOM 5472  N N     . ARG F  1 79  ? -26.291 -64.299 38.013  1.00 0.00 ? 85  ARG F N     1 
ATOM 5473  C CA    . ARG F  1 79  ? -26.987 -63.234 37.316  1.00 0.00 ? 85  ARG F CA    1 
ATOM 5474  C C     . ARG F  1 79  ? -28.472 -63.416 37.360  1.00 0.00 ? 85  ARG F C     1 
ATOM 5475  O O     . ARG F  1 79  ? -29.209 -62.501 37.730  1.00 0.00 ? 85  ARG F O     1 
ATOM 5476  C CB    . ARG F  1 79  ? -26.580 -63.168 35.876  1.00 0.00 ? 85  ARG F CB    1 
ATOM 5477  C CG    . ARG F  1 79  ? -27.401 -62.186 35.072  1.00 0.00 ? 85  ARG F CG    1 
ATOM 5478  C CD    . ARG F  1 79  ? -27.094 -62.253 33.637  1.00 0.00 ? 85  ARG F CD    1 
ATOM 5479  N NE    . ARG F  1 79  ? -28.072 -61.532 32.858  1.00 0.00 ? 85  ARG F NE    1 
ATOM 5480  C CZ    . ARG F  1 79  ? -28.267 -61.687 31.539  1.00 0.00 ? 85  ARG F CZ    1 
ATOM 5481  N NH1   . ARG F  1 79  ? -27.531 -62.525 30.848  1.00 0.00 ? 85  ARG F NH1   1 
ATOM 5482  N NH2   . ARG F  1 79  ? -29.211 -60.999 30.929  1.00 0.00 ? 85  ARG F NH2   1 
ATOM 5483  N N     . ALA F  1 80  ? -28.917 -64.598 36.963  1.00 0.00 ? 86  ALA F N     1 
ATOM 5484  C CA    . ALA F  1 80  ? -30.326 -64.910 36.945  1.00 0.00 ? 86  ALA F CA    1 
ATOM 5485  C C     . ALA F  1 80  ? -30.915 -64.786 38.326  1.00 0.00 ? 86  ALA F C     1 
ATOM 5486  O O     . ALA F  1 80  ? -32.012 -64.265 38.496  1.00 0.00 ? 86  ALA F O     1 
ATOM 5487  C CB    . ALA F  1 80  ? -30.541 -66.301 36.409  1.00 0.00 ? 86  ALA F CB    1 
ATOM 5488  N N     . LEU F  1 81  ? -30.173 -65.225 39.324  1.00 0.00 ? 87  LEU F N     1 
ATOM 5489  C CA    . LEU F  1 81  ? -30.628 -65.095 40.676  1.00 0.00 ? 87  LEU F CA    1 
ATOM 5490  C C     . LEU F  1 81  ? -30.925 -63.648 41.002  1.00 0.00 ? 87  LEU F C     1 
ATOM 5491  O O     . LEU F  1 81  ? -31.986 -63.338 41.529  1.00 0.00 ? 87  LEU F O     1 
ATOM 5492  C CB    . LEU F  1 81  ? -29.599 -65.657 41.640  1.00 0.00 ? 87  LEU F CB    1 
ATOM 5493  C CG    . LEU F  1 81  ? -29.943 -65.526 43.114  1.00 0.00 ? 87  LEU F CG    1 
ATOM 5494  C CD1   . LEU F  1 81  ? -31.232 -66.270 43.395  1.00 0.00 ? 87  LEU F CD1   1 
ATOM 5495  C CD2   . LEU F  1 81  ? -28.801 -66.088 43.941  1.00 0.00 ? 87  LEU F CD2   1 
ATOM 5496  N N     . ASN F  1 82  ? -30.017 -62.748 40.654  1.00 0.00 ? 88  ASN F N     1 
ATOM 5497  C CA    . ASN F  1 82  ? -30.241 -61.331 40.931  1.00 0.00 ? 88  ASN F CA    1 
ATOM 5498  C C     . ASN F  1 82  ? -31.441 -60.744 40.188  1.00 0.00 ? 88  ASN F C     1 
ATOM 5499  O O     . ASN F  1 82  ? -32.225 -59.993 40.767  1.00 0.00 ? 88  ASN F O     1 
ATOM 5500  C CB    . ASN F  1 82  ? -29.013 -60.512 40.602  1.00 0.00 ? 88  ASN F CB    1 
ATOM 5501  C CG    . ASN F  1 82  ? -27.928 -60.658 41.610  1.00 0.00 ? 88  ASN F CG    1 
ATOM 5502  O OD1   . ASN F  1 82  ? -28.136 -61.204 42.695  1.00 0.00 ? 88  ASN F OD1   1 
ATOM 5503  N ND2   . ASN F  1 82  ? -26.774 -60.153 41.287  1.00 0.00 ? 88  ASN F ND2   1 
ATOM 5504  N N     . ARG F  1 83  ? -31.573 -61.061 38.907  1.00 0.00 ? 89  ARG F N     1 
ATOM 5505  C CA    . ARG F  1 83  ? -32.613 -60.443 38.086  1.00 0.00 ? 89  ARG F CA    1 
ATOM 5506  C C     . ARG F  1 83  ? -33.975 -61.135 38.208  1.00 0.00 ? 89  ARG F C     1 
ATOM 5507  O O     . ARG F  1 83  ? -35.010 -60.513 37.984  1.00 0.00 ? 89  ARG F O     1 
ATOM 5508  C CB    . ARG F  1 83  ? -32.173 -60.404 36.630  1.00 0.00 ? 89  ARG F CB    1 
ATOM 5509  C CG    . ARG F  1 83  ? -31.001 -59.448 36.347  1.00 0.00 ? 89  ARG F CG    1 
ATOM 5510  C CD    . ARG F  1 83  ? -30.584 -59.481 34.915  1.00 0.00 ? 89  ARG F CD    1 
ATOM 5511  N NE    . ARG F  1 83  ? -29.369 -58.691 34.661  1.00 0.00 ? 89  ARG F NE    1 
ATOM 5512  C CZ    . ARG F  1 83  ? -29.340 -57.389 34.313  1.00 0.00 ? 89  ARG F CZ    1 
ATOM 5513  N NH1   . ARG F  1 83  ? -30.455 -56.714 34.176  1.00 0.00 ? 89  ARG F NH1   1 
ATOM 5514  N NH2   . ARG F  1 83  ? -28.185 -56.795 34.105  1.00 0.00 ? 89  ARG F NH2   1 
ATOM 5515  N N     . ILE F  1 84  ? -33.973 -62.409 38.571  1.00 0.00 ? 90  ILE F N     1 
ATOM 5516  C CA    . ILE F  1 84  ? -35.211 -63.174 38.742  1.00 0.00 ? 90  ILE F CA    1 
ATOM 5517  C C     . ILE F  1 84  ? -35.548 -63.395 40.208  1.00 0.00 ? 90  ILE F C     1 
ATOM 5518  O O     . ILE F  1 84  ? -36.691 -63.214 40.634  1.00 0.00 ? 90  ILE F O     1 
ATOM 5519  C CB    . ILE F  1 84  ? -35.126 -64.548 38.050  1.00 0.00 ? 90  ILE F CB    1 
ATOM 5520  C CG1   . ILE F  1 84  ? -34.983 -64.393 36.544  1.00 0.00 ? 90  ILE F CG1   1 
ATOM 5521  C CG2   . ILE F  1 84  ? -36.341 -65.375 38.379  1.00 0.00 ? 90  ILE F CG2   1 
ATOM 5522  C CD1   . ILE F  1 84  ? -34.699 -65.697 35.837  1.00 0.00 ? 90  ILE F CD1   1 
ATOM 5523  N N     . GLY F  1 85  ? -34.571 -63.870 40.961  1.00 0.00 ? 91  GLY F N     1 
ATOM 5524  C CA    . GLY F  1 85  ? -34.793 -64.225 42.354  1.00 0.00 ? 91  GLY F CA    1 
ATOM 5525  C C     . GLY F  1 85  ? -35.022 -65.711 42.453  1.00 0.00 ? 91  GLY F C     1 
ATOM 5526  O O     . GLY F  1 85  ? -35.336 -66.352 41.458  1.00 0.00 ? 91  GLY F O     1 
ATOM 5527  N N     . SER F  1 86  ? -34.858 -66.267 43.642  1.00 0.00 ? 92  SER F N     1 
ATOM 5528  C CA    . SER F  1 86  ? -35.001 -67.708 43.807  1.00 0.00 ? 92  SER F CA    1 
ATOM 5529  C C     . SER F  1 86  ? -36.436 -68.142 43.637  1.00 0.00 ? 92  SER F C     1 
ATOM 5530  O O     . SER F  1 86  ? -37.358 -67.337 43.775  1.00 0.00 ? 92  SER F O     1 
ATOM 5531  C CB    . SER F  1 86  ? -34.507 -68.138 45.161  1.00 0.00 ? 92  SER F CB    1 
ATOM 5532  O OG    . SER F  1 86  ? -35.352 -67.666 46.169  1.00 0.00 ? 92  SER F OG    1 
ATOM 5533  N N     . GLY F  1 87  ? -36.627 -69.425 43.367  1.00 0.00 ? 93  GLY F N     1 
ATOM 5534  C CA    . GLY F  1 87  ? -37.954 -69.973 43.164  1.00 0.00 ? 93  GLY F CA    1 
ATOM 5535  C C     . GLY F  1 87  ? -38.109 -70.518 41.753  1.00 0.00 ? 93  GLY F C     1 
ATOM 5536  O O     . GLY F  1 87  ? -37.163 -70.494 40.967  1.00 0.00 ? 93  GLY F O     1 
ATOM 5537  N N     . PRO F  1 88  ? -39.302 -71.018 41.454  1.00 0.00 ? 94  PRO F N     1 
ATOM 5538  C CA    . PRO F  1 88  ? -39.740 -71.625 40.183  1.00 0.00 ? 94  PRO F CA    1 
ATOM 5539  C C     . PRO F  1 88  ? -38.978 -71.117 38.963  1.00 0.00 ? 94  PRO F C     1 
ATOM 5540  O O     . PRO F  1 88  ? -38.315 -71.894 38.278  1.00 0.00 ? 94  PRO F O     1 
ATOM 5541  C CB    . PRO F  1 88  ? -41.216 -71.216 40.092  1.00 0.00 ? 94  PRO F CB    1 
ATOM 5542  C CG    . PRO F  1 88  ? -41.621 -71.031 41.493  1.00 0.00 ? 94  PRO F CG    1 
ATOM 5543  C CD    . PRO F  1 88  ? -40.442 -70.364 42.110  1.00 0.00 ? 94  PRO F CD    1 
ATOM 5544  N N     . ALA F  1 89  ? -39.105 -69.825 38.673  1.00 0.00 ? 95  ALA F N     1 
ATOM 5545  C CA    . ALA F  1 89  ? -38.509 -69.252 37.477  1.00 0.00 ? 95  ALA F CA    1 
ATOM 5546  C C     . ALA F  1 89  ? -37.018 -69.459 37.423  1.00 0.00 ? 95  ALA F C     1 
ATOM 5547  O O     . ALA F  1 89  ? -36.463 -69.681 36.347  1.00 0.00 ? 95  ALA F O     1 
ATOM 5548  C CB    . ALA F  1 89  ? -38.828 -67.781 37.397  1.00 0.00 ? 95  ALA F CB    1 
ATOM 5549  N N     . LEU F  1 90  ? -36.355 -69.380 38.568  1.00 0.00 ? 96  LEU F N     1 
ATOM 5550  C CA    . LEU F  1 90  ? -34.925 -69.564 38.599  1.00 0.00 ? 96  LEU F CA    1 
ATOM 5551  C C     . LEU F  1 90  ? -34.589 -70.966 38.238  1.00 0.00 ? 96  LEU F C     1 
ATOM 5552  O O     . LEU F  1 90  ? -33.652 -71.212 37.491  1.00 0.00 ? 96  LEU F O     1 
ATOM 5553  C CB    . LEU F  1 90  ? -34.353 -69.260 39.957  1.00 0.00 ? 96  LEU F CB    1 
ATOM 5554  C CG    . LEU F  1 90  ? -32.839 -69.379 40.033  1.00 0.00 ? 96  LEU F CG    1 
ATOM 5555  C CD1   . LEU F  1 90  ? -32.216 -68.383 39.066  1.00 0.00 ? 96  LEU F CD1   1 
ATOM 5556  C CD2   . LEU F  1 90  ? -32.377 -69.131 41.444  1.00 0.00 ? 96  LEU F CD2   1 
ATOM 5557  N N     . VAL F  1 91  ? -35.349 -71.899 38.780  1.00 0.00 ? 97  VAL F N     1 
ATOM 5558  C CA    . VAL F  1 91  ? -35.140 -73.297 38.476  1.00 0.00 ? 97  VAL F CA    1 
ATOM 5559  C C     . VAL F  1 91  ? -35.307 -73.546 36.992  1.00 0.00 ? 97  VAL F C     1 
ATOM 5560  O O     . VAL F  1 91  ? -34.494 -74.239 36.381  1.00 0.00 ? 97  VAL F O     1 
ATOM 5561  C CB    . VAL F  1 91  ? -36.110 -74.175 39.271  1.00 0.00 ? 97  VAL F CB    1 
ATOM 5562  C CG1   . VAL F  1 91  ? -36.034 -75.611 38.786  1.00 0.00 ? 97  VAL F CG1   1 
ATOM 5563  C CG2   . VAL F  1 91  ? -35.763 -74.088 40.743  1.00 0.00 ? 97  VAL F CG2   1 
ATOM 5564  N N     . ASN F  1 92  ? -36.342 -72.946 36.403  1.00 0.00 ? 98  ASN F N     1 
ATOM 5565  C CA    . ASN F  1 92  ? -36.574 -73.067 34.974  1.00 0.00 ? 98  ASN F CA    1 
ATOM 5566  C C     . ASN F  1 92  ? -35.361 -72.581 34.207  1.00 0.00 ? 98  ASN F C     1 
ATOM 5567  O O     . ASN F  1 92  ? -34.887 -73.249 33.281  1.00 0.00 ? 98  ASN F O     1 
ATOM 5568  C CB    . ASN F  1 92  ? -37.809 -72.284 34.570  1.00 0.00 ? 98  ASN F CB    1 
ATOM 5569  C CG    . ASN F  1 92  ? -39.060 -72.942 35.040  1.00 0.00 ? 98  ASN F CG    1 
ATOM 5570  O OD1   . ASN F  1 92  ? -39.026 -74.119 35.411  1.00 0.00 ? 98  ASN F OD1   1 
ATOM 5571  N ND2   . ASN F  1 92  ? -40.164 -72.232 35.032  1.00 0.00 ? 98  ASN F ND2   1 
ATOM 5572  N N     . MET F  1 93  ? -34.827 -71.447 34.636  1.00 0.00 ? 99  MET F N     1 
ATOM 5573  C CA    . MET F  1 93  ? -33.652 -70.883 34.031  1.00 0.00 ? 99  MET F CA    1 
ATOM 5574  C C     . MET F  1 93  ? -32.466 -71.797 34.126  1.00 0.00 ? 99  MET F C     1 
ATOM 5575  O O     . MET F  1 93  ? -31.796 -72.052 33.126  1.00 0.00 ? 99  MET F O     1 
ATOM 5576  C CB    . MET F  1 93  ? -33.314 -69.567 34.684  1.00 0.00 ? 99  MET F CB    1 
ATOM 5577  C CG    . MET F  1 93  ? -32.040 -68.960 34.175  1.00 0.00 ? 99  MET F CG    1 
ATOM 5578  S SD    . MET F  1 93  ? -32.154 -68.470 32.476  1.00 0.00 ? 99  MET F SD    1 
ATOM 5579  C CE    . MET F  1 93  ? -33.038 -66.927 32.672  1.00 0.00 ? 99  MET F CE    1 
ATOM 5580  N N     . ILE F  1 94  ? -32.190 -72.275 35.329  1.00 0.00 ? 100 ILE F N     1 
ATOM 5581  C CA    . ILE F  1 94  ? -31.017 -73.079 35.562  1.00 0.00 ? 100 ILE F CA    1 
ATOM 5582  C C     . ILE F  1 94  ? -31.057 -74.348 34.774  1.00 0.00 ? 100 ILE F C     1 
ATOM 5583  O O     . ILE F  1 94  ? -30.037 -74.781 34.256  1.00 0.00 ? 100 ILE F O     1 
ATOM 5584  C CB    . ILE F  1 94  ? -30.835 -73.403 37.032  1.00 0.00 ? 100 ILE F CB    1 
ATOM 5585  C CG1   . ILE F  1 94  ? -30.517 -72.137 37.814  1.00 0.00 ? 100 ILE F CG1   1 
ATOM 5586  C CG2   . ILE F  1 94  ? -29.698 -74.393 37.183  1.00 0.00 ? 100 ILE F CG2   1 
ATOM 5587  C CD1   . ILE F  1 94  ? -30.588 -72.322 39.308  1.00 0.00 ? 100 ILE F CD1   1 
ATOM 5588  N N     . ASN F  1 95  ? -32.228 -74.969 34.690  1.00 0.00 ? 101 ASN F N     1 
ATOM 5589  C CA    . ASN F  1 95  ? -32.358 -76.200 33.928  1.00 0.00 ? 101 ASN F CA    1 
ATOM 5590  C C     . ASN F  1 95  ? -31.909 -76.005 32.495  1.00 0.00 ? 101 ASN F C     1 
ATOM 5591  O O     . ASN F  1 95  ? -31.146 -76.818 31.963  1.00 0.00 ? 101 ASN F O     1 
ATOM 5592  C CB    . ASN F  1 95  ? -33.782 -76.708 33.959  1.00 0.00 ? 101 ASN F CB    1 
ATOM 5593  C CG    . ASN F  1 95  ? -34.149 -77.292 35.277  1.00 0.00 ? 101 ASN F CG    1 
ATOM 5594  O OD1   . ASN F  1 95  ? -33.270 -77.503 36.119  1.00 0.00 ? 101 ASN F OD1   1 
ATOM 5595  N ND2   . ASN F  1 95  ? -35.418 -77.574 35.473  1.00 0.00 ? 101 ASN F ND2   1 
ATOM 5596  N N     . GLY F  1 96  ? -32.358 -74.912 31.876  1.00 0.00 ? 102 GLY F N     1 
ATOM 5597  C CA    . GLY F  1 96  ? -31.979 -74.624 30.504  1.00 0.00 ? 102 GLY F CA    1 
ATOM 5598  C C     . GLY F  1 96  ? -30.526 -74.251 30.398  1.00 0.00 ? 102 GLY F C     1 
ATOM 5599  O O     . GLY F  1 96  ? -29.838 -74.684 29.476  1.00 0.00 ? 102 GLY F O     1 
ATOM 5600  N N     . LEU F  1 97  ? -30.053 -73.470 31.350  1.00 0.00 ? 103 LEU F N     1 
ATOM 5601  C CA    . LEU F  1 97  ? -28.676 -73.046 31.375  1.00 0.00 ? 103 LEU F CA    1 
ATOM 5602  C C     . LEU F  1 97  ? -27.719 -74.205 31.512  1.00 0.00 ? 103 LEU F C     1 
ATOM 5603  O O     . LEU F  1 97  ? -26.696 -74.261 30.831  1.00 0.00 ? 103 LEU F O     1 
ATOM 5604  C CB    . LEU F  1 97  ? -28.456 -72.072 32.499  1.00 0.00 ? 103 LEU F CB    1 
ATOM 5605  C CG    . LEU F  1 97  ? -27.027 -71.639 32.662  1.00 0.00 ? 103 LEU F CG    1 
ATOM 5606  C CD1   . LEU F  1 97  ? -26.562 -71.066 31.365  1.00 0.00 ? 103 LEU F CD1   1 
ATOM 5607  C CD2   . LEU F  1 97  ? -26.934 -70.622 33.778  1.00 0.00 ? 103 LEU F CD2   1 
ATOM 5608  N N     . LYS F  1 98  ? -28.015 -75.096 32.427  1.00 0.00 ? 104 LYS F N     1 
ATOM 5609  C CA    . LYS F  1 98  ? -27.204 -76.262 32.624  1.00 0.00 ? 104 LYS F CA    1 
ATOM 5610  C C     . LYS F  1 98  ? -27.096 -77.063 31.350  1.00 0.00 ? 104 LYS F C     1 
ATOM 5611  O O     . LYS F  1 98  ? -25.994 -77.346 30.886  1.00 0.00 ? 104 LYS F O     1 
ATOM 5612  C CB    . LYS F  1 98  ? -27.765 -77.111 33.741  1.00 0.00 ? 104 LYS F CB    1 
ATOM 5613  C CG    . LYS F  1 98  ? -26.989 -78.385 33.986  1.00 0.00 ? 104 LYS F CG    1 
ATOM 5614  C CD    . LYS F  1 98  ? -27.577 -79.178 35.134  1.00 0.00 ? 104 LYS F CD    1 
ATOM 5615  C CE    . LYS F  1 98  ? -26.951 -80.558 35.222  1.00 0.00 ? 104 LYS F CE    1 
ATOM 5616  N NZ    . LYS F  1 98  ? -27.508 -81.344 36.349  1.00 0.00 ? 104 LYS F NZ    1 
ATOM 5617  N N     . GLY F  1 99  ? -28.245 -77.413 30.766  1.00 0.00 ? 105 GLY F N     1 
ATOM 5618  C CA    . GLY F  1 99  ? -28.266 -78.194 29.532  1.00 0.00 ? 105 GLY F CA    1 
ATOM 5619  C C     . GLY F  1 99  ? -27.484 -77.496 28.439  1.00 0.00 ? 105 GLY F C     1 
ATOM 5620  O O     . GLY F  1 99  ? -26.728 -78.131 27.698  1.00 0.00 ? 105 GLY F O     1 
ATOM 5621  N N     . TYR F  1 100 ? -27.655 -76.180 28.362  1.00 0.00 ? 106 TYR F N     1 
ATOM 5622  C CA    . TYR F  1 100 ? -26.946 -75.346 27.418  1.00 0.00 ? 106 TYR F CA    1 
ATOM 5623  C C     . TYR F  1 100 ? -25.462 -75.561 27.489  1.00 0.00 ? 106 TYR F C     1 
ATOM 5624  O O     . TYR F  1 100 ? -24.842 -75.900 26.497  1.00 0.00 ? 106 TYR F O     1 
ATOM 5625  C CB    . TYR F  1 100 ? -27.294 -73.894 27.687  1.00 0.00 ? 106 TYR F CB    1 
ATOM 5626  C CG    . TYR F  1 100 ? -26.469 -72.872 26.958  1.00 0.00 ? 106 TYR F CG    1 
ATOM 5627  C CD1   . TYR F  1 100 ? -26.570 -72.714 25.595  1.00 0.00 ? 106 TYR F CD1   1 
ATOM 5628  C CD2   . TYR F  1 100 ? -25.636 -72.052 27.686  1.00 0.00 ? 106 TYR F CD2   1 
ATOM 5629  C CE1   . TYR F  1 100 ? -25.822 -71.746 24.959  1.00 0.00 ? 106 TYR F CE1   1 
ATOM 5630  C CE2   . TYR F  1 100 ? -24.896 -71.086 27.060  1.00 0.00 ? 106 TYR F CE2   1 
ATOM 5631  C CZ    . TYR F  1 100 ? -24.982 -70.930 25.702  1.00 0.00 ? 106 TYR F CZ    1 
ATOM 5632  O OH    . TYR F  1 100 ? -24.235 -69.961 25.079  1.00 0.00 ? 106 TYR F OH    1 
ATOM 5633  N N     . TYR F  1 101 ? -24.888 -75.408 28.667  1.00 0.00 ? 107 TYR F N     1 
ATOM 5634  C CA    . TYR F  1 101 ? -23.459 -75.606 28.824  1.00 0.00 ? 107 TYR F CA    1 
ATOM 5635  C C     . TYR F  1 101 ? -23.009 -77.027 28.583  1.00 0.00 ? 107 TYR F C     1 
ATOM 5636  O O     . TYR F  1 101 ? -21.954 -77.250 27.984  1.00 0.00 ? 107 TYR F O     1 
ATOM 5637  C CB    . TYR F  1 101 ? -23.012 -75.152 30.196  1.00 0.00 ? 107 TYR F CB    1 
ATOM 5638  C CG    . TYR F  1 101 ? -22.526 -73.744 30.213  1.00 0.00 ? 107 TYR F CG    1 
ATOM 5639  C CD1   . TYR F  1 101 ? -23.398 -72.696 30.393  1.00 0.00 ? 107 TYR F CD1   1 
ATOM 5640  C CD2   . TYR F  1 101 ? -21.179 -73.506 30.050  1.00 0.00 ? 107 TYR F CD2   1 
ATOM 5641  C CE1   . TYR F  1 101 ? -22.920 -71.404 30.397  1.00 0.00 ? 107 TYR F CE1   1 
ATOM 5642  C CE2   . TYR F  1 101 ? -20.701 -72.220 30.056  1.00 0.00 ? 107 TYR F CE2   1 
ATOM 5643  C CZ    . TYR F  1 101 ? -21.564 -71.173 30.226  1.00 0.00 ? 107 TYR F CZ    1 
ATOM 5644  O OH    . TYR F  1 101 ? -21.082 -69.892 30.230  1.00 0.00 ? 107 TYR F OH    1 
ATOM 5645  N N     . ILE F  1 102 ? -23.812 -77.991 28.998  1.00 0.00 ? 108 ILE F N     1 
ATOM 5646  C CA    . ILE F  1 102 ? -23.434 -79.371 28.826  1.00 0.00 ? 108 ILE F CA    1 
ATOM 5647  C C     . ILE F  1 102 ? -23.233 -79.718 27.384  1.00 0.00 ? 108 ILE F C     1 
ATOM 5648  O O     . ILE F  1 102 ? -22.255 -80.361 27.028  1.00 0.00 ? 108 ILE F O     1 
ATOM 5649  C CB    . ILE F  1 102 ? -24.484 -80.316 29.395  1.00 0.00 ? 108 ILE F CB    1 
ATOM 5650  C CG1   . ILE F  1 102 ? -24.532 -80.211 30.898  1.00 0.00 ? 108 ILE F CG1   1 
ATOM 5651  C CG2   . ILE F  1 102 ? -24.166 -81.737 28.979  1.00 0.00 ? 108 ILE F CG2   1 
ATOM 5652  C CD1   . ILE F  1 102 ? -25.724 -80.895 31.511  1.00 0.00 ? 108 ILE F CD1   1 
ATOM 5653  N N     . SER F  1 103 ? -24.173 -79.331 26.547  1.00 0.00 ? 109 SER F N     1 
ATOM 5654  C CA    . SER F  1 103 ? -24.112 -79.721 25.158  1.00 0.00 ? 109 SER F CA    1 
ATOM 5655  C C     . SER F  1 103 ? -23.453 -78.694 24.254  1.00 0.00 ? 109 SER F C     1 
ATOM 5656  O O     . SER F  1 103 ? -22.857 -79.058 23.243  1.00 0.00 ? 109 SER F O     1 
ATOM 5657  C CB    . SER F  1 103 ? -25.498 -80.009 24.672  1.00 0.00 ? 109 SER F CB    1 
ATOM 5658  O OG    . SER F  1 103 ? -26.293 -78.869 24.753  1.00 0.00 ? 109 SER F OG    1 
ATOM 5659  N N     . ALA F  1 104 ? -23.538 -77.422 24.605  1.00 0.00 ? 110 ALA F N     1 
ATOM 5660  C CA    . ALA F  1 104 ? -22.928 -76.400 23.768  1.00 0.00 ? 110 ALA F CA    1 
ATOM 5661  C C     . ALA F  1 104 ? -21.446 -76.359 23.946  1.00 0.00 ? 110 ALA F C     1 
ATOM 5662  O O     . ALA F  1 104 ? -20.723 -76.159 22.977  1.00 0.00 ? 110 ALA F O     1 
ATOM 5663  C CB    . ALA F  1 104 ? -23.503 -75.021 24.057  1.00 0.00 ? 110 ALA F CB    1 
ATOM 5664  N N     . PHE F  1 105 ? -20.981 -76.522 25.191  1.00 0.00 ? 111 PHE F N     1 
ATOM 5665  C CA    . PHE F  1 105 ? -19.567 -76.396 25.486  1.00 0.00 ? 111 PHE F CA    1 
ATOM 5666  C C     . PHE F  1 105 ? -18.972 -77.644 26.066  1.00 0.00 ? 111 PHE F C     1 
ATOM 5667  O O     . PHE F  1 105 ? -17.828 -77.630 26.517  1.00 0.00 ? 111 PHE F O     1 
ATOM 5668  C CB    . PHE F  1 105 ? -19.354 -75.262 26.454  1.00 0.00 ? 111 PHE F CB    1 
ATOM 5669  C CG    . PHE F  1 105 ? -19.858 -73.979 25.923  1.00 0.00 ? 111 PHE F CG    1 
ATOM 5670  C CD1   . PHE F  1 105 ? -20.958 -73.376 26.484  1.00 0.00 ? 111 PHE F CD1   1 
ATOM 5671  C CD2   . PHE F  1 105 ? -19.260 -73.395 24.833  1.00 0.00 ? 111 PHE F CD2   1 
ATOM 5672  C CE1   . PHE F  1 105 ? -21.447 -72.201 25.976  1.00 0.00 ? 111 PHE F CE1   1 
ATOM 5673  C CE2   . PHE F  1 105 ? -19.743 -72.224 24.316  1.00 0.00 ? 111 PHE F CE2   1 
ATOM 5674  C CZ    . PHE F  1 105 ? -20.841 -71.622 24.889  1.00 0.00 ? 111 PHE F CZ    1 
ATOM 5675  N N     . ASN F  1 106 ? -19.738 -78.722 26.077  1.00 0.00 ? 112 ASN F N     1 
ATOM 5676  C CA    . ASN F  1 106 ? -19.264 -79.983 26.628  1.00 0.00 ? 112 ASN F CA    1 
ATOM 5677  C C     . ASN F  1 106 ? -18.879 -79.846 28.087  1.00 0.00 ? 112 ASN F C     1 
ATOM 5678  O O     . ASN F  1 106 ? -17.898 -80.443 28.533  1.00 0.00 ? 112 ASN F O     1 
ATOM 5679  C CB    . ASN F  1 106 ? -18.106 -80.523 25.825  1.00 0.00 ? 112 ASN F CB    1 
ATOM 5680  C CG    . ASN F  1 106 ? -18.501 -80.842 24.422  1.00 0.00 ? 112 ASN F CG    1 
ATOM 5681  O OD1   . ASN F  1 106 ? -19.632 -81.266 24.170  1.00 0.00 ? 112 ASN F OD1   1 
ATOM 5682  N ND2   . ASN F  1 106 ? -17.595 -80.650 23.502  1.00 0.00 ? 112 ASN F ND2   1 
ATOM 5683  N N     . ALA F  1 107 ? -19.641 -79.057 28.837  1.00 0.00 ? 113 ALA F N     1 
ATOM 5684  C CA    . ALA F  1 107 ? -19.374 -78.901 30.249  1.00 0.00 ? 113 ALA F CA    1 
ATOM 5685  C C     . ALA F  1 107 ? -19.812 -80.151 30.988  1.00 0.00 ? 113 ALA F C     1 
ATOM 5686  O O     . ALA F  1 107 ? -20.791 -80.792 30.611  1.00 0.00 ? 113 ALA F O     1 
ATOM 5687  C CB    . ALA F  1 107 ? -20.074 -77.681 30.787  1.00 0.00 ? 113 ALA F CB    1 
ATOM 5688  N N     . ASN F  1 108 ? -19.070 -80.514 32.027  1.00 0.00 ? 114 ASN F N     1 
ATOM 5689  C CA    . ASN F  1 108 ? -19.334 -81.739 32.766  1.00 0.00 ? 114 ASN F CA    1 
ATOM 5690  C C     . ASN F  1 108 ? -20.402 -81.554 33.849  1.00 0.00 ? 114 ASN F C     1 
ATOM 5691  O O     . ASN F  1 108 ? -20.115 -80.974 34.895  1.00 0.00 ? 114 ASN F O     1 
ATOM 5692  C CB    . ASN F  1 108 ? -18.067 -82.251 33.388  1.00 0.00 ? 114 ASN F CB    1 
ATOM 5693  C CG    . ASN F  1 108 ? -18.278 -83.536 34.111  1.00 0.00 ? 114 ASN F CG    1 
ATOM 5694  O OD1   . ASN F  1 108 ? -19.363 -83.794 34.640  1.00 0.00 ? 114 ASN F OD1   1 
ATOM 5695  N ND2   . ASN F  1 108 ? -17.263 -84.356 34.143  1.00 0.00 ? 114 ASN F ND2   1 
ATOM 5696  N N     . PRO F  1 109 ? -21.631 -82.063 33.609  1.00 0.00 ? 115 PRO F N     1 
ATOM 5697  C CA    . PRO F  1 109 ? -22.788 -82.077 34.527  1.00 0.00 ? 115 PRO F CA    1 
ATOM 5698  C C     . PRO F  1 109 ? -22.399 -82.132 35.997  1.00 0.00 ? 115 PRO F C     1 
ATOM 5699  O O     . PRO F  1 109 ? -22.982 -81.428 36.818  1.00 0.00 ? 115 PRO F O     1 
ATOM 5700  C CB    . PRO F  1 109 ? -23.518 -83.365 34.152  1.00 0.00 ? 115 PRO F CB    1 
ATOM 5701  C CG    . PRO F  1 109 ? -23.173 -83.584 32.743  1.00 0.00 ? 115 PRO F CG    1 
ATOM 5702  C CD    . PRO F  1 109 ? -21.736 -83.195 32.664  1.00 0.00 ? 115 PRO F CD    1 
ATOM 5703  N N     . GLN F  1 110 ? -21.442 -82.986 36.335  1.00 0.00 ? 116 GLN F N     1 
ATOM 5704  C CA    . GLN F  1 110 ? -21.030 -83.158 37.715  1.00 0.00 ? 116 GLN F CA    1 
ATOM 5705  C C     . GLN F  1 110 ? -20.477 -81.894 38.307  1.00 0.00 ? 116 GLN F C     1 
ATOM 5706  O O     . GLN F  1 110 ? -20.829 -81.509 39.424  1.00 0.00 ? 116 GLN F O     1 
ATOM 5707  C CB    . GLN F  1 110 ? -19.991 -84.254 37.823  1.00 0.00 ? 116 GLN F CB    1 
ATOM 5708  C CG    . GLN F  1 110 ? -19.497 -84.475 39.227  1.00 0.00 ? 116 GLN F CG    1 
ATOM 5709  C CD    . GLN F  1 110 ? -20.598 -84.916 40.142  1.00 0.00 ? 116 GLN F CD    1 
ATOM 5710  O OE1   . GLN F  1 110 ? -21.467 -85.695 39.743  1.00 0.00 ? 116 GLN F OE1   1 
ATOM 5711  N NE2   . GLN F  1 110 ? -20.582 -84.425 41.377  1.00 0.00 ? 116 GLN F NE2   1 
ATOM 5712  N N     . VAL F  1 111 ? -19.604 -81.245 37.576  1.00 0.00 ? 117 VAL F N     1 
ATOM 5713  C CA    . VAL F  1 111 ? -19.016 -80.042 38.064  1.00 0.00 ? 117 VAL F CA    1 
ATOM 5714  C C     . VAL F  1 111 ? -20.038 -78.945 38.039  1.00 0.00 ? 117 VAL F C     1 
ATOM 5715  O O     . VAL F  1 111 ? -20.082 -78.116 38.939  1.00 0.00 ? 117 VAL F O     1 
ATOM 5716  C CB    . VAL F  1 111 ? -17.804 -79.651 37.244  1.00 0.00 ? 117 VAL F CB    1 
ATOM 5717  C CG1   . VAL F  1 111 ? -17.278 -78.313 37.724  1.00 0.00 ? 117 VAL F CG1   1 
ATOM 5718  C CG2   . VAL F  1 111 ? -16.741 -80.722 37.357  1.00 0.00 ? 117 VAL F CG2   1 
ATOM 5719  N N     . LEU F  1 112 ? -20.884 -78.949 37.011  1.00 0.00 ? 118 LEU F N     1 
ATOM 5720  C CA    . LEU F  1 112 ? -21.920 -77.940 36.881  1.00 0.00 ? 118 LEU F CA    1 
ATOM 5721  C C     . LEU F  1 112 ? -22.832 -77.963 38.076  1.00 0.00 ? 118 LEU F C     1 
ATOM 5722  O O     . LEU F  1 112 ? -23.219 -76.915 38.592  1.00 0.00 ? 118 LEU F O     1 
ATOM 5723  C CB    . LEU F  1 112 ? -22.742 -78.181 35.628  1.00 0.00 ? 118 LEU F CB    1 
ATOM 5724  C CG    . LEU F  1 112 ? -22.026 -77.951 34.313  1.00 0.00 ? 118 LEU F CG    1 
ATOM 5725  C CD1   . LEU F  1 112 ? -22.911 -78.412 33.194  1.00 0.00 ? 118 LEU F CD1   1 
ATOM 5726  C CD2   . LEU F  1 112 ? -21.710 -76.489 34.166  1.00 0.00 ? 118 LEU F CD2   1 
ATOM 5727  N N     . ASP F  1 113 ? -23.152 -79.158 38.540  1.00 0.00 ? 119 ASP F N     1 
ATOM 5728  C CA    . ASP F  1 113 ? -23.970 -79.307 39.710  1.00 0.00 ? 119 ASP F CA    1 
ATOM 5729  C C     . ASP F  1 113 ? -23.274 -78.787 40.917  1.00 0.00 ? 119 ASP F C     1 
ATOM 5730  O O     . ASP F  1 113 ? -23.882 -78.112 41.739  1.00 0.00 ? 119 ASP F O     1 
ATOM 5731  C CB    . ASP F  1 113 ? -24.349 -80.749 39.906  1.00 0.00 ? 119 ASP F CB    1 
ATOM 5732  C CG    . ASP F  1 113 ? -25.379 -81.180 38.901  1.00 0.00 ? 119 ASP F CG    1 
ATOM 5733  O OD1   . ASP F  1 113 ? -26.043 -80.320 38.374  1.00 0.00 ? 119 ASP F OD1   1 
ATOM 5734  O OD2   . ASP F  1 113 ? -25.493 -82.351 38.646  1.00 0.00 ? 119 ASP F OD2   1 
ATOM 5735  N N     . ALA F  1 114 ? -21.976 -79.053 41.014  1.00 0.00 ? 120 ALA F N     1 
ATOM 5736  C CA    . ALA F  1 114 ? -21.197 -78.555 42.126  1.00 0.00 ? 120 ALA F CA    1 
ATOM 5737  C C     . ALA F  1 114 ? -21.248 -77.046 42.187  1.00 0.00 ? 120 ALA F C     1 
ATOM 5738  O O     . ALA F  1 114 ? -21.401 -76.475 43.261  1.00 0.00 ? 120 ALA F O     1 
ATOM 5739  C CB    . ALA F  1 114 ? -19.768 -79.026 42.020  1.00 0.00 ? 120 ALA F CB    1 
ATOM 5740  N N     . VAL F  1 115 ? -21.165 -76.393 41.030  1.00 0.00 ? 121 VAL F N     1 
ATOM 5741  C CA    . VAL F  1 115 ? -21.237 -74.943 40.983  1.00 0.00 ? 121 VAL F CA    1 
ATOM 5742  C C     . VAL F  1 115 ? -22.574 -74.452 41.493  1.00 0.00 ? 121 VAL F C     1 
ATOM 5743  O O     . VAL F  1 115 ? -22.631 -73.542 42.321  1.00 0.00 ? 121 VAL F O     1 
ATOM 5744  C CB    . VAL F  1 115 ? -21.020 -74.429 39.562  1.00 0.00 ? 121 VAL F CB    1 
ATOM 5745  C CG1   . VAL F  1 115 ? -21.304 -72.947 39.513  1.00 0.00 ? 121 VAL F CG1   1 
ATOM 5746  C CG2   . VAL F  1 115 ? -19.593 -74.711 39.118  1.00 0.00 ? 121 VAL F CG2   1 
ATOM 5747  N N     . VAL F  1 116 ? -23.648 -75.083 41.036  1.00 0.00 ? 122 VAL F N     1 
ATOM 5748  C CA    . VAL F  1 116 ? -24.984 -74.725 41.485  1.00 0.00 ? 122 VAL F CA    1 
ATOM 5749  C C     . VAL F  1 116 ? -25.133 -74.962 42.984  1.00 0.00 ? 122 VAL F C     1 
ATOM 5750  O O     . VAL F  1 116 ? -25.755 -74.171 43.692  1.00 0.00 ? 122 VAL F O     1 
ATOM 5751  C CB    . VAL F  1 116 ? -26.042 -75.529 40.721  1.00 0.00 ? 122 VAL F CB    1 
ATOM 5752  C CG1   . VAL F  1 116 ? -27.406 -75.302 41.318  1.00 0.00 ? 122 VAL F CG1   1 
ATOM 5753  C CG2   . VAL F  1 116 ? -26.038 -75.119 39.271  1.00 0.00 ? 122 VAL F CG2   1 
ATOM 5754  N N     . ASN F  1 117 ? -24.496 -76.021 43.477  1.00 0.00 ? 123 ASN F N     1 
ATOM 5755  C CA    . ASN F  1 117 ? -24.542 -76.370 44.888  1.00 0.00 ? 123 ASN F CA    1 
ATOM 5756  C C     . ASN F  1 117 ? -23.804 -75.375 45.779  1.00 0.00 ? 123 ASN F C     1 
ATOM 5757  O O     . ASN F  1 117 ? -23.830 -75.501 47.001  1.00 0.00 ? 123 ASN F O     1 
ATOM 5758  C CB    . ASN F  1 117 ? -23.997 -77.752 45.102  1.00 0.00 ? 123 ASN F CB    1 
ATOM 5759  C CG    . ASN F  1 117 ? -24.901 -78.789 44.544  1.00 0.00 ? 123 ASN F CG    1 
ATOM 5760  O OD1   . ASN F  1 117 ? -26.068 -78.508 44.267  1.00 0.00 ? 123 ASN F OD1   1 
ATOM 5761  N ND2   . ASN F  1 117 ? -24.393 -79.982 44.370  1.00 0.00 ? 123 ASN F ND2   1 
ATOM 5762  N N     . ILE F  1 118 ? -23.154 -74.393 45.182  1.00 0.00 ? 124 ILE F N     1 
ATOM 5763  C CA    . ILE F  1 118 ? -22.537 -73.337 45.925  1.00 0.00 ? 124 ILE F CA    1 
ATOM 5764  C C     . ILE F  1 118 ? -23.398 -72.129 45.907  1.00 0.00 ? 124 ILE F C     1 
ATOM 5765  O O     . ILE F  1 118 ? -23.705 -71.553 46.948  1.00 0.00 ? 124 ILE F O     1 
ATOM 5766  C CB    . ILE F  1 118 ? -21.195 -72.970 45.343  1.00 0.00 ? 124 ILE F CB    1 
ATOM 5767  C CG1   . ILE F  1 118 ? -20.272 -74.152 45.379  1.00 0.00 ? 124 ILE F CG1   1 
ATOM 5768  C CG2   . ILE F  1 118 ? -20.610 -71.795 46.074  1.00 0.00 ? 124 ILE F CG2   1 
ATOM 5769  C CD1   . ILE F  1 118 ? -20.037 -74.685 46.766  1.00 0.00 ? 124 ILE F CD1   1 
ATOM 5770  N N     . ILE F  1 119 ? -23.780 -71.733 44.714  1.00 0.00 ? 125 ILE F N     1 
ATOM 5771  C CA    . ILE F  1 119 ? -24.556 -70.533 44.516  1.00 0.00 ? 125 ILE F CA    1 
ATOM 5772  C C     . ILE F  1 119 ? -25.945 -70.660 45.101  1.00 0.00 ? 125 ILE F C     1 
ATOM 5773  O O     . ILE F  1 119 ? -26.406 -69.776 45.820  1.00 0.00 ? 125 ILE F O     1 
ATOM 5774  C CB    . ILE F  1 119 ? -24.651 -70.219 43.039  1.00 0.00 ? 125 ILE F CB    1 
ATOM 5775  C CG1   . ILE F  1 119 ? -23.276 -69.869 42.515  1.00 0.00 ? 125 ILE F CG1   1 
ATOM 5776  C CG2   . ILE F  1 119 ? -25.616 -69.074 42.809  1.00 0.00 ? 125 ILE F CG2   1 
ATOM 5777  C CD1   . ILE F  1 119 ? -23.208 -69.836 41.025  1.00 0.00 ? 125 ILE F CD1   1 
ATOM 5778  N N     . THR F  1 120 ? -26.619 -71.757 44.794  1.00 0.00 ? 126 THR F N     1 
ATOM 5779  C CA    . THR F  1 120 ? -27.953 -71.979 45.304  1.00 0.00 ? 126 THR F CA    1 
ATOM 5780  C C     . THR F  1 120 ? -27.899 -72.804 46.549  1.00 0.00 ? 126 THR F C     1 
ATOM 5781  O O     . THR F  1 120 ? -28.695 -72.621 47.467  1.00 0.00 ? 126 THR F O     1 
ATOM 5782  C CB    . THR F  1 120 ? -28.789 -72.737 44.308  1.00 0.00 ? 126 THR F CB    1 
ATOM 5783  O OG1   . THR F  1 120 ? -28.215 -74.037 44.148  1.00 0.00 ? 126 THR F OG1   1 
ATOM 5784  C CG2   . THR F  1 120 ? -28.804 -72.021 42.972  1.00 0.00 ? 126 THR F CG2   1 
ATOM 5785  N N     . GLY F  1 121 ? -26.945 -73.719 46.589  1.00 0.00 ? 127 GLY F N     1 
ATOM 5786  C CA    . GLY F  1 121 ? -26.799 -74.600 47.726  1.00 0.00 ? 127 GLY F CA    1 
ATOM 5787  C C     . GLY F  1 121 ? -27.397 -75.965 47.433  1.00 0.00 ? 127 GLY F C     1 
ATOM 5788  O O     . GLY F  1 121 ? -27.169 -76.920 48.170  1.00 0.00 ? 127 GLY F O     1 
ATOM 5789  N N     . SER F  1 122 ? -28.163 -76.057 46.356  1.00 0.00 ? 128 SER F N     1 
ATOM 5790  C CA    . SER F  1 122 ? -28.815 -77.300 46.009  1.00 0.00 ? 128 SER F CA    1 
ATOM 5791  C C     . SER F  1 122 ? -28.942 -77.421 44.505  1.00 0.00 ? 128 SER F C     1 
ATOM 5792  O O     . SER F  1 122 ? -28.999 -76.410 43.808  1.00 0.00 ? 128 SER F O     1 
ATOM 5793  C CB    . SER F  1 122 ? -30.203 -77.351 46.622  1.00 0.00 ? 128 SER F CB    1 
ATOM 5794  O OG    . SER F  1 122 ? -31.040 -76.397 46.028  1.00 0.00 ? 128 SER F OG    1 
ATOM 5795  N N     . PRO F  1 123 ? -29.045 -78.648 43.997  1.00 0.00 ? 129 PRO F N     1 
ATOM 5796  C CA    . PRO F  1 123 ? -29.241 -79.014 42.612  1.00 0.00 ? 129 PRO F CA    1 
ATOM 5797  C C     . PRO F  1 123 ? -30.530 -78.429 42.088  1.00 0.00 ? 129 PRO F C     1 
ATOM 5798  O O     . PRO F  1 123 ? -31.427 -78.080 42.851  1.00 0.00 ? 129 PRO F O     1 
ATOM 5799  C CB    . PRO F  1 123 ? -29.274 -80.541 42.640  1.00 0.00 ? 129 PRO F CB    1 
ATOM 5800  C CG    . PRO F  1 123 ? -28.464 -80.916 43.834  1.00 0.00 ? 129 PRO F CG    1 
ATOM 5801  C CD    . PRO F  1 123 ? -28.721 -79.830 44.832  1.00 0.00 ? 129 PRO F CD    1 
ATOM 5802  N N     . THR F  1 124 ? -30.614 -78.312 40.781  1.00 0.00 ? 130 THR F N     1 
ATOM 5803  C CA    . THR F  1 124 ? -31.791 -77.773 40.144  1.00 0.00 ? 130 THR F CA    1 
ATOM 5804  C C     . THR F  1 124 ? -32.798 -78.869 39.834  1.00 0.00 ? 130 THR F C     1 
ATOM 5805  O O     . THR F  1 124 ? -33.000 -79.775 40.642  1.00 0.00 ? 130 THR F O     1 
ATOM 5806  C CB    . THR F  1 124 ? -31.405 -77.011 38.870  1.00 0.00 ? 130 THR F CB    1 
ATOM 5807  O OG1   . THR F  1 124 ? -32.585 -76.466 38.269  1.00 0.00 ? 130 THR F OG1   1 
ATOM 5808  C CG2   . THR F  1 124 ? -30.660 -77.915 37.872  1.00 0.00 ? 130 THR F CG2   1 
ATOM 5809  N N     . GLY F  1 125 ? -33.458 -78.785 38.679  1.00 0.00 ? 131 GLY F N     1 
ATOM 5810  C CA    . GLY F  1 125 ? -34.442 -79.788 38.299  1.00 0.00 ? 131 GLY F CA    1 
ATOM 5811  C C     . GLY F  1 125 ? -35.787 -79.488 38.937  1.00 0.00 ? 131 GLY F C     1 
ATOM 5812  O O     . GLY F  1 125 ? -36.746 -79.152 38.242  1.00 0.00 ? 131 GLY F O     1 
ATOM 5813  N N     . TYR F  1 126 ? -35.828 -79.558 40.269  1.00 0.00 ? 132 TYR F N     1 
ATOM 5814  C CA    . TYR F  1 126 ? -37.027 -79.279 41.031  1.00 0.00 ? 132 TYR F CA    1 
ATOM 5815  C C     . TYR F  1 126 ? -36.751 -78.203 42.076  1.00 0.00 ? 132 TYR F C     1 
ATOM 5816  O O     . TYR F  1 126 ? -35.624 -78.057 42.547  1.00 0.00 ? 132 TYR F O     1 
ATOM 5817  C CB    . TYR F  1 126 ? -37.522 -80.550 41.704  1.00 0.00 ? 132 TYR F CB    1 
ATOM 5818  C CG    . TYR F  1 126 ? -37.785 -81.673 40.731  1.00 0.00 ? 132 TYR F CG    1 
ATOM 5819  C CD1   . TYR F  1 126 ? -36.810 -82.637 40.520  1.00 0.00 ? 132 TYR F CD1   1 
ATOM 5820  C CD2   . TYR F  1 126 ? -38.979 -81.727 40.032  1.00 0.00 ? 132 TYR F CD2   1 
ATOM 5821  C CE1   . TYR F  1 126 ? -37.034 -83.656 39.621  1.00 0.00 ? 132 TYR F CE1   1 
ATOM 5822  C CE2   . TYR F  1 126 ? -39.201 -82.745 39.131  1.00 0.00 ? 132 TYR F CE2   1 
ATOM 5823  C CZ    . TYR F  1 126 ? -38.234 -83.710 38.927  1.00 0.00 ? 132 TYR F CZ    1 
ATOM 5824  O OH    . TYR F  1 126 ? -38.457 -84.729 38.030  1.00 0.00 ? 132 TYR F OH    1 
ATOM 5825  N N     . VAL F  1 127 ? -37.787 -77.456 42.439  1.00 0.00 ? 133 VAL F N     1 
ATOM 5826  C CA    . VAL F  1 127 ? -37.644 -76.375 43.409  1.00 0.00 ? 133 VAL F CA    1 
ATOM 5827  C C     . VAL F  1 127 ? -37.325 -76.926 44.786  1.00 0.00 ? 133 VAL F C     1 
ATOM 5828  O O     . VAL F  1 127 ? -38.087 -77.727 45.332  1.00 0.00 ? 133 VAL F O     1 
ATOM 5829  C CB    . VAL F  1 127 ? -38.947 -75.535 43.484  1.00 0.00 ? 133 VAL F CB    1 
ATOM 5830  C CG1   . VAL F  1 127 ? -38.827 -74.472 44.564  1.00 0.00 ? 133 VAL F CG1   1 
ATOM 5831  C CG2   . VAL F  1 127 ? -39.240 -74.893 42.135  1.00 0.00 ? 133 VAL F CG2   1 
ATOM 5832  N N     . SER F  1 128 ? -36.196 -76.493 45.355  1.00 0.00 ? 134 SER F N     1 
ATOM 5833  C CA    . SER F  1 128 ? -35.781 -76.963 46.672  1.00 0.00 ? 134 SER F CA    1 
ATOM 5834  C C     . SER F  1 128 ? -34.700 -76.073 47.281  1.00 0.00 ? 134 SER F C     1 
ATOM 5835  O O     . SER F  1 128 ? -34.924 -75.440 48.315  1.00 0.00 ? 134 SER F O     1 
ATOM 5836  C CB    . SER F  1 128 ? -35.274 -78.388 46.574  1.00 0.00 ? 134 SER F CB    1 
ATOM 5837  O OG    . SER F  1 128 ? -34.852 -78.862 47.820  1.00 0.00 ? 134 SER F OG    1 
ATOM 5838  O OXT   . SER F  1 128 ? -33.542 -76.191 46.883  1.00 0.00 ? 134 SER F OXT   1 
ATOM 5839  N N     . SER G  1 1   ? -30.307 -55.283 37.980  1.00 0.00 ? 7   SER G N     1 
ATOM 5840  C CA    . SER G  1 1   ? -31.563 -54.711 38.441  1.00 0.00 ? 7   SER G CA    1 
ATOM 5841  C C     . SER G  1 1   ? -31.350 -53.366 39.118  1.00 0.00 ? 7   SER G C     1 
ATOM 5842  O O     . SER G  1 1   ? -30.270 -53.086 39.637  1.00 0.00 ? 7   SER G O     1 
ATOM 5843  C CB    . SER G  1 1   ? -32.262 -55.636 39.373  1.00 0.00 ? 7   SER G CB    1 
ATOM 5844  O OG    . SER G  1 1   ? -33.433 -55.039 39.848  1.00 0.00 ? 7   SER G OG    1 
ATOM 5845  N N     . ARG G  1 2   ? -32.372 -52.515 39.067  1.00 0.00 ? 8   ARG G N     1 
ATOM 5846  C CA    . ARG G  1 2   ? -32.268 -51.162 39.608  1.00 0.00 ? 8   ARG G CA    1 
ATOM 5847  C C     . ARG G  1 2   ? -33.476 -50.755 40.428  1.00 0.00 ? 8   ARG G C     1 
ATOM 5848  O O     . ARG G  1 2   ? -34.611 -50.841 39.967  1.00 0.00 ? 8   ARG G O     1 
ATOM 5849  C CB    . ARG G  1 2   ? -32.123 -50.182 38.490  1.00 0.00 ? 8   ARG G CB    1 
ATOM 5850  C CG    . ARG G  1 2   ? -30.867 -50.318 37.661  1.00 0.00 ? 8   ARG G CG    1 
ATOM 5851  C CD    . ARG G  1 2   ? -29.679 -49.865 38.385  1.00 0.00 ? 8   ARG G CD    1 
ATOM 5852  N NE    . ARG G  1 2   ? -28.508 -49.917 37.547  1.00 0.00 ? 8   ARG G NE    1 
ATOM 5853  C CZ    . ARG G  1 2   ? -27.715 -50.984 37.411  1.00 0.00 ? 8   ARG G CZ    1 
ATOM 5854  N NH1   . ARG G  1 2   ? -27.968 -52.089 38.072  1.00 0.00 ? 8   ARG G NH1   1 
ATOM 5855  N NH2   . ARG G  1 2   ? -26.660 -50.944 36.619  1.00 0.00 ? 8   ARG G NH2   1 
ATOM 5856  N N     . SER G  1 3   ? -33.216 -50.264 41.631  1.00 0.00 ? 9   SER G N     1 
ATOM 5857  C CA    . SER G  1 3   ? -34.250 -49.730 42.511  1.00 0.00 ? 9   SER G CA    1 
ATOM 5858  C C     . SER G  1 3   ? -34.625 -48.341 42.084  1.00 0.00 ? 9   SER G C     1 
ATOM 5859  O O     . SER G  1 3   ? -33.908 -47.728 41.309  1.00 0.00 ? 9   SER G O     1 
ATOM 5860  C CB    . SER G  1 3   ? -33.736 -49.675 43.918  1.00 0.00 ? 9   SER G CB    1 
ATOM 5861  O OG    . SER G  1 3   ? -32.684 -48.745 44.017  1.00 0.00 ? 9   SER G OG    1 
ATOM 5862  N N     . TYR G  1 4   ? -35.704 -47.810 42.637  1.00 0.00 ? 10  TYR G N     1 
ATOM 5863  C CA    . TYR G  1 4   ? -36.102 -46.448 42.321  1.00 0.00 ? 10  TYR G CA    1 
ATOM 5864  C C     . TYR G  1 4   ? -34.994 -45.472 42.554  1.00 0.00 ? 10  TYR G C     1 
ATOM 5865  O O     . TYR G  1 4   ? -34.750 -44.601 41.725  1.00 0.00 ? 10  TYR G O     1 
ATOM 5866  C CB    . TYR G  1 4   ? -37.299 -46.001 43.114  1.00 0.00 ? 10  TYR G CB    1 
ATOM 5867  C CG    . TYR G  1 4   ? -37.518 -44.525 42.951  1.00 0.00 ? 10  TYR G CG    1 
ATOM 5868  C CD1   . TYR G  1 4   ? -38.046 -44.019 41.780  1.00 0.00 ? 10  TYR G CD1   1 
ATOM 5869  C CD2   . TYR G  1 4   ? -37.141 -43.671 43.962  1.00 0.00 ? 10  TYR G CD2   1 
ATOM 5870  C CE1   . TYR G  1 4   ? -38.197 -42.658 41.626  1.00 0.00 ? 10  TYR G CE1   1 
ATOM 5871  C CE2   . TYR G  1 4   ? -37.289 -42.317 43.810  1.00 0.00 ? 10  TYR G CE2   1 
ATOM 5872  C CZ    . TYR G  1 4   ? -37.812 -41.809 42.651  1.00 0.00 ? 10  TYR G CZ    1 
ATOM 5873  O OH    . TYR G  1 4   ? -37.946 -40.454 42.506  1.00 0.00 ? 10  TYR G OH    1 
ATOM 5874  N N     . SER G  1 5   ? -34.345 -45.574 43.708  1.00 0.00 ? 11  SER G N     1 
ATOM 5875  C CA    . SER G  1 5   ? -33.249 -44.682 44.025  1.00 0.00 ? 11  SER G CA    1 
ATOM 5876  C C     . SER G  1 5   ? -32.249 -44.659 42.891  1.00 0.00 ? 11  SER G C     1 
ATOM 5877  O O     . SER G  1 5   ? -31.811 -43.593 42.464  1.00 0.00 ? 11  SER G O     1 
ATOM 5878  C CB    . SER G  1 5   ? -32.557 -45.115 45.315  1.00 0.00 ? 11  SER G CB    1 
ATOM 5879  O OG    . SER G  1 5   ? -33.397 -44.954 46.424  1.00 0.00 ? 11  SER G OG    1 
ATOM 5880  N N     . GLN G  1 6   ? -31.915 -45.836 42.387  1.00 0.00 ? 12  GLN G N     1 
ATOM 5881  C CA    . GLN G  1 6   ? -30.976 -45.957 41.295  1.00 0.00 ? 12  GLN G CA    1 
ATOM 5882  C C     . GLN G  1 6   ? -31.539 -45.440 39.988  1.00 0.00 ? 12  GLN G C     1 
ATOM 5883  O O     . GLN G  1 6   ? -30.833 -44.777 39.231  1.00 0.00 ? 12  GLN G O     1 
ATOM 5884  C CB    . GLN G  1 6   ? -30.567 -47.391 41.144  1.00 0.00 ? 12  GLN G CB    1 
ATOM 5885  C CG    . GLN G  1 6   ? -29.704 -47.887 42.271  1.00 0.00 ? 12  GLN G CG    1 
ATOM 5886  C CD    . GLN G  1 6   ? -29.559 -49.380 42.264  1.00 0.00 ? 12  GLN G CD    1 
ATOM 5887  O OE1   . GLN G  1 6   ? -30.529 -50.091 42.543  1.00 0.00 ? 12  GLN G OE1   1 
ATOM 5888  N NE2   . GLN G  1 6   ? -28.366 -49.871 41.944  1.00 0.00 ? 12  GLN G NE2   1 
ATOM 5889  N N     . ARG G  1 7   ? -32.812 -45.722 39.727  1.00 0.00 ? 13  ARG G N     1 
ATOM 5890  C CA    . ARG G  1 7   ? -33.446 -45.286 38.492  1.00 0.00 ? 13  ARG G CA    1 
ATOM 5891  C C     . ARG G  1 7   ? -33.356 -43.804 38.360  1.00 0.00 ? 13  ARG G C     1 
ATOM 5892  O O     . ARG G  1 7   ? -32.906 -43.279 37.343  1.00 0.00 ? 13  ARG G O     1 
ATOM 5893  C CB    . ARG G  1 7   ? -34.922 -45.663 38.463  1.00 0.00 ? 13  ARG G CB    1 
ATOM 5894  C CG    . ARG G  1 7   ? -35.223 -47.136 38.372  1.00 0.00 ? 13  ARG G CG    1 
ATOM 5895  C CD    . ARG G  1 7   ? -36.660 -47.384 38.153  1.00 0.00 ? 13  ARG G CD    1 
ATOM 5896  N NE    . ARG G  1 7   ? -37.074 -46.963 36.824  1.00 0.00 ? 13  ARG G NE    1 
ATOM 5897  C CZ    . ARG G  1 7   ? -38.350 -46.865 36.412  1.00 0.00 ? 13  ARG G CZ    1 
ATOM 5898  N NH1   . ARG G  1 7   ? -39.330 -47.148 37.241  1.00 0.00 ? 13  ARG G NH1   1 
ATOM 5899  N NH2   . ARG G  1 7   ? -38.628 -46.486 35.173  1.00 0.00 ? 13  ARG G NH2   1 
ATOM 5900  N N     . TYR G  1 8   ? -33.787 -43.129 39.400  1.00 0.00 ? 14  TYR G N     1 
ATOM 5901  C CA    . TYR G  1 8   ? -33.804 -41.704 39.433  1.00 0.00 ? 14  TYR G CA    1 
ATOM 5902  C C     . TYR G  1 8   ? -32.433 -41.122 39.419  1.00 0.00 ? 14  TYR G C     1 
ATOM 5903  O O     . TYR G  1 8   ? -32.180 -40.178 38.685  1.00 0.00 ? 14  TYR G O     1 
ATOM 5904  C CB    . TYR G  1 8   ? -34.560 -41.217 40.634  1.00 0.00 ? 14  TYR G CB    1 
ATOM 5905  C CG    . TYR G  1 8   ? -34.483 -39.743 40.782  1.00 0.00 ? 14  TYR G CG    1 
ATOM 5906  C CD1   . TYR G  1 8   ? -34.729 -38.939 39.698  1.00 0.00 ? 14  TYR G CD1   1 
ATOM 5907  C CD2   . TYR G  1 8   ? -34.167 -39.191 42.001  1.00 0.00 ? 14  TYR G CD2   1 
ATOM 5908  C CE1   . TYR G  1 8   ? -34.647 -37.582 39.824  1.00 0.00 ? 14  TYR G CE1   1 
ATOM 5909  C CE2   . TYR G  1 8   ? -34.084 -37.830 42.133  1.00 0.00 ? 14  TYR G CE2   1 
ATOM 5910  C CZ    . TYR G  1 8   ? -34.317 -37.029 41.044  1.00 0.00 ? 14  TYR G CZ    1 
ATOM 5911  O OH    . TYR G  1 8   ? -34.216 -35.669 41.161  1.00 0.00 ? 14  TYR G OH    1 
ATOM 5912  N N     . ALA G  1 9   ? -31.547 -41.653 40.248  1.00 0.00 ? 15  ALA G N     1 
ATOM 5913  C CA    . ALA G  1 9   ? -30.197 -41.123 40.338  1.00 0.00 ? 15  ALA G CA    1 
ATOM 5914  C C     . ALA G  1 9   ? -29.562 -40.977 38.974  1.00 0.00 ? 15  ALA G C     1 
ATOM 5915  O O     . ALA G  1 9   ? -29.072 -39.900 38.623  1.00 0.00 ? 15  ALA G O     1 
ATOM 5916  C CB    . ALA G  1 9   ? -29.340 -42.025 41.205  1.00 0.00 ? 15  ALA G CB    1 
ATOM 5917  N N     . LYS G  1 10  ? -29.566 -42.050 38.199  1.00 0.00 ? 16  LYS G N     1 
ATOM 5918  C CA    . LYS G  1 10  ? -28.932 -42.009 36.909  1.00 0.00 ? 16  LYS G CA    1 
ATOM 5919  C C     . LYS G  1 10  ? -29.691 -41.140 35.946  1.00 0.00 ? 16  LYS G C     1 
ATOM 5920  O O     . LYS G  1 10  ? -29.088 -40.422 35.155  1.00 0.00 ? 16  LYS G O     1 
ATOM 5921  C CB    . LYS G  1 10  ? -28.767 -43.378 36.334  1.00 0.00 ? 16  LYS G CB    1 
ATOM 5922  C CG    . LYS G  1 10  ? -27.931 -43.381 35.081  1.00 0.00 ? 16  LYS G CG    1 
ATOM 5923  C CD    . LYS G  1 10  ? -27.662 -44.775 34.594  1.00 0.00 ? 16  LYS G CD    1 
ATOM 5924  C CE    . LYS G  1 10  ? -26.725 -44.746 33.408  1.00 0.00 ? 16  LYS G CE    1 
ATOM 5925  N NZ    . LYS G  1 10  ? -26.493 -46.093 32.836  1.00 0.00 ? 16  LYS G NZ    1 
ATOM 5926  N N     . TRP G  1 11  ? -31.022 -41.180 36.014  1.00 0.00 ? 17  TRP G N     1 
ATOM 5927  C CA    . TRP G  1 11  ? -31.832 -40.331 35.161  1.00 0.00 ? 17  TRP G CA    1 
ATOM 5928  C C     . TRP G  1 11  ? -31.474 -38.897 35.348  1.00 0.00 ? 17  TRP G C     1 
ATOM 5929  O O     . TRP G  1 11  ? -31.403 -38.138 34.385  1.00 0.00 ? 17  TRP G O     1 
ATOM 5930  C CB    . TRP G  1 11  ? -33.303 -40.496 35.459  1.00 0.00 ? 17  TRP G CB    1 
ATOM 5931  C CG    . TRP G  1 11  ? -34.158 -39.579 34.649  1.00 0.00 ? 17  TRP G CG    1 
ATOM 5932  C CD1   . TRP G  1 11  ? -34.661 -39.821 33.412  1.00 0.00 ? 17  TRP G CD1   1 
ATOM 5933  C CD2   . TRP G  1 11  ? -34.620 -38.258 35.016  1.00 0.00 ? 17  TRP G CD2   1 
ATOM 5934  N NE1   . TRP G  1 11  ? -35.407 -38.752 32.989  1.00 0.00 ? 17  TRP G NE1   1 
ATOM 5935  C CE2   . TRP G  1 11  ? -35.391 -37.787 33.956  1.00 0.00 ? 17  TRP G CE2   1 
ATOM 5936  C CE3   . TRP G  1 11  ? -34.454 -37.458 36.141  1.00 0.00 ? 17  TRP G CE3   1 
ATOM 5937  C CZ2   . TRP G  1 11  ? -35.997 -36.544 33.984  1.00 0.00 ? 17  TRP G CZ2   1 
ATOM 5938  C CZ3   . TRP G  1 11  ? -35.063 -36.212 36.173  1.00 0.00 ? 17  TRP G CZ3   1 
ATOM 5939  C CH2   . TRP G  1 11  ? -35.815 -35.768 35.122  1.00 0.00 ? 17  TRP G CH2   1 
ATOM 5940  N N     . GLN G  1 12  ? -31.270 -38.508 36.589  1.00 0.00 ? 18  GLN G N     1 
ATOM 5941  C CA    . GLN G  1 12  ? -30.949 -37.152 36.903  1.00 0.00 ? 18  GLN G CA    1 
ATOM 5942  C C     . GLN G  1 12  ? -29.627 -36.764 36.329  1.00 0.00 ? 18  GLN G C     1 
ATOM 5943  O O     . GLN G  1 12  ? -29.490 -35.693 35.746  1.00 0.00 ? 18  GLN G O     1 
ATOM 5944  C CB    . GLN G  1 12  ? -30.907 -36.959 38.395  1.00 0.00 ? 18  GLN G CB    1 
ATOM 5945  C CG    . GLN G  1 12  ? -30.728 -35.531 38.793  1.00 0.00 ? 18  GLN G CG    1 
ATOM 5946  C CD    . GLN G  1 12  ? -31.916 -34.731 38.405  1.00 0.00 ? 18  GLN G CD    1 
ATOM 5947  O OE1   . GLN G  1 12  ? -33.020 -35.039 38.850  1.00 0.00 ? 18  GLN G OE1   1 
ATOM 5948  N NE2   . GLN G  1 12  ? -31.733 -33.711 37.579  1.00 0.00 ? 18  GLN G NE2   1 
ATOM 5949  N N     . ALA G  1 13  ? -28.649 -37.640 36.467  1.00 0.00 ? 19  ALA G N     1 
ATOM 5950  C CA    . ALA G  1 13  ? -27.316 -37.364 35.973  1.00 0.00 ? 19  ALA G CA    1 
ATOM 5951  C C     . ALA G  1 13  ? -27.317 -37.148 34.480  1.00 0.00 ? 19  ALA G C     1 
ATOM 5952  O O     . ALA G  1 13  ? -26.661 -36.234 33.980  1.00 0.00 ? 19  ALA G O     1 
ATOM 5953  C CB    . ALA G  1 13  ? -26.387 -38.499 36.332  1.00 0.00 ? 19  ALA G CB    1 
ATOM 5954  N N     . LYS G  1 14  ? -28.072 -37.965 33.766  1.00 0.00 ? 20  LYS G N     1 
ATOM 5955  C CA    . LYS G  1 14  ? -28.116 -37.863 32.330  1.00 0.00 ? 20  LYS G CA    1 
ATOM 5956  C C     . LYS G  1 14  ? -28.912 -36.687 31.880  1.00 0.00 ? 20  LYS G C     1 
ATOM 5957  O O     . LYS G  1 14  ? -28.559 -36.042 30.897  1.00 0.00 ? 20  LYS G O     1 
ATOM 5958  C CB    . LYS G  1 14  ? -28.679 -39.129 31.732  1.00 0.00 ? 20  LYS G CB    1 
ATOM 5959  C CG    . LYS G  1 14  ? -27.791 -40.329 31.943  1.00 0.00 ? 20  LYS G CG    1 
ATOM 5960  C CD    . LYS G  1 14  ? -26.481 -40.153 31.202  1.00 0.00 ? 20  LYS G CD    1 
ATOM 5961  C CE    . LYS G  1 14  ? -26.623 -40.472 29.724  1.00 0.00 ? 20  LYS G CE    1 
ATOM 5962  N NZ    . LYS G  1 14  ? -26.599 -41.935 29.483  1.00 0.00 ? 20  LYS G NZ    1 
ATOM 5963  N N     . PHE G  1 15  ? -29.964 -36.363 32.613  1.00 0.00 ? 21  PHE G N     1 
ATOM 5964  C CA    . PHE G  1 15  ? -30.752 -35.202 32.286  1.00 0.00 ? 21  PHE G CA    1 
ATOM 5965  C C     . PHE G  1 15  ? -29.904 -33.957 32.404  1.00 0.00 ? 21  PHE G C     1 
ATOM 5966  O O     . PHE G  1 15  ? -29.914 -33.100 31.521  1.00 0.00 ? 21  PHE G O     1 
ATOM 5967  C CB    . PHE G  1 15  ? -31.957 -35.080 33.189  1.00 0.00 ? 21  PHE G CB    1 
ATOM 5968  C CG    . PHE G  1 15  ? -32.825 -33.940 32.799  1.00 0.00 ? 21  PHE G CG    1 
ATOM 5969  C CD1   . PHE G  1 15  ? -33.816 -34.105 31.847  1.00 0.00 ? 21  PHE G CD1   1 
ATOM 5970  C CD2   . PHE G  1 15  ? -32.627 -32.688 33.334  1.00 0.00 ? 21  PHE G CD2   1 
ATOM 5971  C CE1   . PHE G  1 15  ? -34.600 -33.041 31.450  1.00 0.00 ? 21  PHE G CE1   1 
ATOM 5972  C CE2   . PHE G  1 15  ? -33.404 -31.621 32.935  1.00 0.00 ? 21  PHE G CE2   1 
ATOM 5973  C CZ    . PHE G  1 15  ? -34.393 -31.798 31.994  1.00 0.00 ? 21  PHE G CZ    1 
ATOM 5974  N N     . ASN G  1 16  ? -29.165 -33.863 33.506  1.00 0.00 ? 22  ASN G N     1 
ATOM 5975  C CA    . ASN G  1 16  ? -28.299 -32.735 33.751  1.00 0.00 ? 22  ASN G CA    1 
ATOM 5976  C C     . ASN G  1 16  ? -27.295 -32.582 32.644  1.00 0.00 ? 22  ASN G C     1 
ATOM 5977  O O     . ASN G  1 16  ? -27.107 -31.491 32.110  1.00 0.00 ? 22  ASN G O     1 
ATOM 5978  C CB    . ASN G  1 16  ? -27.569 -32.907 35.057  1.00 0.00 ? 22  ASN G CB    1 
ATOM 5979  C CG    . ASN G  1 16  ? -28.463 -32.806 36.239  1.00 0.00 ? 22  ASN G CG    1 
ATOM 5980  O OD1   . ASN G  1 16  ? -29.618 -32.387 36.133  1.00 0.00 ? 22  ASN G OD1   1 
ATOM 5981  N ND2   . ASN G  1 16  ? -27.956 -33.182 37.381  1.00 0.00 ? 22  ASN G ND2   1 
ATOM 5982  N N     . ALA G  1 17  ? -26.670 -33.695 32.266  1.00 0.00 ? 23  ALA G N     1 
ATOM 5983  C CA    . ALA G  1 17  ? -25.677 -33.684 31.217  1.00 0.00 ? 23  ALA G CA    1 
ATOM 5984  C C     . ALA G  1 17  ? -26.244 -33.127 29.941  1.00 0.00 ? 23  ALA G C     1 
ATOM 5985  O O     . ALA G  1 17  ? -25.677 -32.213 29.348  1.00 0.00 ? 23  ALA G O     1 
ATOM 5986  C CB    . ALA G  1 17  ? -25.152 -35.084 30.979  1.00 0.00 ? 23  ALA G CB    1 
ATOM 5987  N N     . PHE G  1 18  ? -27.385 -33.653 29.531  1.00 0.00 ? 24  PHE G N     1 
ATOM 5988  C CA    . PHE G  1 18  ? -28.017 -33.231 28.304  1.00 0.00 ? 24  PHE G CA    1 
ATOM 5989  C C     . PHE G  1 18  ? -28.333 -31.760 28.283  1.00 0.00 ? 24  PHE G C     1 
ATOM 5990  O O     . PHE G  1 18  ? -28.189 -31.117 27.253  1.00 0.00 ? 24  PHE G O     1 
ATOM 5991  C CB    . PHE G  1 18  ? -29.263 -34.025 28.035  1.00 0.00 ? 24  PHE G CB    1 
ATOM 5992  C CG    . PHE G  1 18  ? -29.945 -33.617 26.766  1.00 0.00 ? 24  PHE G CG    1 
ATOM 5993  C CD1   . PHE G  1 18  ? -29.287 -33.707 25.553  1.00 0.00 ? 24  PHE G CD1   1 
ATOM 5994  C CD2   . PHE G  1 18  ? -31.257 -33.175 26.777  1.00 0.00 ? 24  PHE G CD2   1 
ATOM 5995  C CE1   . PHE G  1 18  ? -29.921 -33.349 24.381  1.00 0.00 ? 24  PHE G CE1   1 
ATOM 5996  C CE2   . PHE G  1 18  ? -31.893 -32.827 25.605  1.00 0.00 ? 24  PHE G CE2   1 
ATOM 5997  C CZ    . PHE G  1 18  ? -31.225 -32.910 24.408  1.00 0.00 ? 24  PHE G CZ    1 
ATOM 5998  N N     . SER G  1 19  ? -28.755 -31.210 29.419  1.00 0.00 ? 25  SER G N     1 
ATOM 5999  C CA    . SER G  1 19  ? -29.158 -29.805 29.471  1.00 0.00 ? 25  SER G CA    1 
ATOM 6000  C C     . SER G  1 19  ? -28.014 -28.835 29.149  1.00 0.00 ? 25  SER G C     1 
ATOM 6001  O O     . SER G  1 19  ? -28.256 -27.662 28.875  1.00 0.00 ? 25  SER G O     1 
ATOM 6002  C CB    . SER G  1 19  ? -29.698 -29.467 30.832  1.00 0.00 ? 25  SER G CB    1 
ATOM 6003  O OG    . SER G  1 19  ? -28.665 -29.402 31.779  1.00 0.00 ? 25  SER G OG    1 
ATOM 6004  N N     . ASN G  1 20  ? -26.774 -29.318 29.202  1.00 0.00 ? 26  ASN G N     1 
ATOM 6005  C CA    . ASN G  1 20  ? -25.610 -28.497 28.893  1.00 0.00 ? 26  ASN G CA    1 
ATOM 6006  C C     . ASN G  1 20  ? -25.614 -28.047 27.431  1.00 0.00 ? 26  ASN G C     1 
ATOM 6007  O O     . ASN G  1 20  ? -25.552 -28.884 26.540  1.00 0.00 ? 26  ASN G O     1 
ATOM 6008  C CB    . ASN G  1 20  ? -24.350 -29.273 29.193  1.00 0.00 ? 26  ASN G CB    1 
ATOM 6009  C CG    . ASN G  1 20  ? -23.100 -28.508 28.909  1.00 0.00 ? 26  ASN G CG    1 
ATOM 6010  O OD1   . ASN G  1 20  ? -22.931 -27.948 27.814  1.00 0.00 ? 26  ASN G OD1   1 
ATOM 6011  N ND2   . ASN G  1 20  ? -22.216 -28.469 29.869  1.00 0.00 ? 26  ASN G ND2   1 
ATOM 6012  N N     . PRO G  1 21  ? -25.706 -26.723 27.177  1.00 0.00 ? 27  PRO G N     1 
ATOM 6013  C CA    . PRO G  1 21  ? -25.717 -26.079 25.845  1.00 0.00 ? 27  PRO G CA    1 
ATOM 6014  C C     . PRO G  1 21  ? -24.956 -26.845 24.781  1.00 0.00 ? 27  PRO G C     1 
ATOM 6015  O O     . PRO G  1 21  ? -25.452 -27.043 23.666  1.00 0.00 ? 27  PRO G O     1 
ATOM 6016  C CB    . PRO G  1 21  ? -24.994 -24.750 26.089  1.00 0.00 ? 27  PRO G CB    1 
ATOM 6017  C CG    . PRO G  1 21  ? -25.225 -24.452 27.505  1.00 0.00 ? 27  PRO G CG    1 
ATOM 6018  C CD    . PRO G  1 21  ? -25.139 -25.785 28.177  1.00 0.00 ? 27  PRO G CD    1 
ATOM 6019  N N     . THR G  1 22  ? -23.735 -27.240 25.106  1.00 0.00 ? 28  THR G N     1 
ATOM 6020  C CA    . THR G  1 22  ? -22.862 -27.833 24.129  1.00 0.00 ? 28  THR G CA    1 
ATOM 6021  C C     . THR G  1 22  ? -23.160 -29.275 23.927  1.00 0.00 ? 28  THR G C     1 
ATOM 6022  O O     . THR G  1 22  ? -22.950 -29.807 22.847  1.00 0.00 ? 28  THR G O     1 
ATOM 6023  C CB    . THR G  1 22  ? -21.423 -27.699 24.557  1.00 0.00 ? 28  THR G CB    1 
ATOM 6024  O OG1   . THR G  1 22  ? -21.239 -28.411 25.782  1.00 0.00 ? 28  THR G OG1   1 
ATOM 6025  C CG2   . THR G  1 22  ? -21.070 -26.241 24.764  1.00 0.00 ? 28  THR G CG2   1 
ATOM 6026  N N     . VAL G  1 23  ? -23.670 -29.916 24.948  1.00 0.00 ? 29  VAL G N     1 
ATOM 6027  C CA    . VAL G  1 23  ? -23.993 -31.305 24.851  1.00 0.00 ? 29  VAL G CA    1 
ATOM 6028  C C     . VAL G  1 23  ? -25.244 -31.483 24.065  1.00 0.00 ? 29  VAL G C     1 
ATOM 6029  O O     . VAL G  1 23  ? -25.314 -32.328 23.173  1.00 0.00 ? 29  VAL G O     1 
ATOM 6030  C CB    . VAL G  1 23  ? -24.151 -31.910 26.224  1.00 0.00 ? 29  VAL G CB    1 
ATOM 6031  C CG1   . VAL G  1 23  ? -24.627 -33.339 26.116  1.00 0.00 ? 29  VAL G CG1   1 
ATOM 6032  C CG2   . VAL G  1 23  ? -22.837 -31.838 26.941  1.00 0.00 ? 29  VAL G CG2   1 
ATOM 6033  N N     . ALA G  1 24  ? -26.237 -30.679 24.380  1.00 0.00 ? 30  ALA G N     1 
ATOM 6034  C CA    . ALA G  1 24  ? -27.487 -30.736 23.676  1.00 0.00 ? 30  ALA G CA    1 
ATOM 6035  C C     . ALA G  1 24  ? -27.289 -30.446 22.216  1.00 0.00 ? 30  ALA G C     1 
ATOM 6036  O O     . ALA G  1 24  ? -27.764 -31.186 21.365  1.00 0.00 ? 30  ALA G O     1 
ATOM 6037  C CB    . ALA G  1 24  ? -28.473 -29.748 24.264  1.00 0.00 ? 30  ALA G CB    1 
ATOM 6038  N N     . SER G  1 25  ? -26.562 -29.381 21.918  1.00 0.00 ? 31  SER G N     1 
ATOM 6039  C CA    . SER G  1 25  ? -26.373 -28.993 20.548  1.00 0.00 ? 31  SER G CA    1 
ATOM 6040  C C     . SER G  1 25  ? -25.486 -29.934 19.795  1.00 0.00 ? 31  SER G C     1 
ATOM 6041  O O     . SER G  1 25  ? -25.713 -30.188 18.619  1.00 0.00 ? 31  SER G O     1 
ATOM 6042  C CB    . SER G  1 25  ? -25.801 -27.635 20.494  1.00 0.00 ? 31  SER G CB    1 
ATOM 6043  O OG    . SER G  1 25  ? -24.559 -27.603 21.125  1.00 0.00 ? 31  SER G OG    1 
ATOM 6044  N N     . THR G  1 26  ? -24.505 -30.515 20.470  1.00 0.00 ? 32  THR G N     1 
ATOM 6045  C CA    . THR G  1 26  ? -23.654 -31.487 19.819  1.00 0.00 ? 32  THR G CA    1 
ATOM 6046  C C     . THR G  1 26  ? -24.456 -32.653 19.356  1.00 0.00 ? 32  THR G C     1 
ATOM 6047  O O     . THR G  1 26  ? -24.412 -33.022 18.186  1.00 0.00 ? 32  THR G O     1 
ATOM 6048  C CB    . THR G  1 26  ? -22.551 -31.984 20.744  1.00 0.00 ? 32  THR G CB    1 
ATOM 6049  O OG1   . THR G  1 26  ? -21.684 -30.901 21.080  1.00 0.00 ? 32  THR G OG1   1 
ATOM 6050  C CG2   . THR G  1 26  ? -21.763 -33.068 20.069  1.00 0.00 ? 32  THR G CG2   1 
ATOM 6051  N N     . ILE G  1 27  ? -25.207 -33.230 20.263  1.00 0.00 ? 33  ILE G N     1 
ATOM 6052  C CA    . ILE G  1 27  ? -25.978 -34.390 19.948  1.00 0.00 ? 33  ILE G CA    1 
ATOM 6053  C C     . ILE G  1 27  ? -27.037 -34.096 18.924  1.00 0.00 ? 33  ILE G C     1 
ATOM 6054  O O     . ILE G  1 27  ? -27.141 -34.793 17.920  1.00 0.00 ? 33  ILE G O     1 
ATOM 6055  C CB    . ILE G  1 27  ? -26.638 -34.938 21.192  1.00 0.00 ? 33  ILE G CB    1 
ATOM 6056  C CG1   . ILE G  1 27  ? -25.592 -35.473 22.143  1.00 0.00 ? 33  ILE G CG1   1 
ATOM 6057  C CG2   . ILE G  1 27  ? -27.616 -36.019 20.815  1.00 0.00 ? 33  ILE G CG2   1 
ATOM 6058  C CD1   . ILE G  1 27  ? -26.130 -35.770 23.510  1.00 0.00 ? 33  ILE G CD1   1 
ATOM 6059  N N     . LEU G  1 28  ? -27.825 -33.068 19.179  1.00 0.00 ? 34  LEU G N     1 
ATOM 6060  C CA    . LEU G  1 28  ? -28.960 -32.759 18.349  1.00 0.00 ? 34  LEU G CA    1 
ATOM 6061  C C     . LEU G  1 28  ? -28.568 -32.340 16.956  1.00 0.00 ? 34  LEU G C     1 
ATOM 6062  O O     . LEU G  1 28  ? -29.230 -32.713 15.989  1.00 0.00 ? 34  LEU G O     1 
ATOM 6063  C CB    . LEU G  1 28  ? -29.775 -31.668 19.003  1.00 0.00 ? 34  LEU G CB    1 
ATOM 6064  C CG    . LEU G  1 28  ? -30.476 -32.078 20.297  1.00 0.00 ? 34  LEU G CG    1 
ATOM 6065  C CD1   . LEU G  1 28  ? -31.072 -30.851 20.954  1.00 0.00 ? 34  LEU G CD1   1 
ATOM 6066  C CD2   . LEU G  1 28  ? -31.545 -33.104 19.981  1.00 0.00 ? 34  LEU G CD2   1 
ATOM 6067  N N     . SER G  1 29  ? -27.483 -31.591 16.832  1.00 0.00 ? 35  SER G N     1 
ATOM 6068  C CA    . SER G  1 29  ? -27.041 -31.182 15.519  1.00 0.00 ? 35  SER G CA    1 
ATOM 6069  C C     . SER G  1 29  ? -26.441 -32.342 14.755  1.00 0.00 ? 35  SER G C     1 
ATOM 6070  O O     . SER G  1 29  ? -26.533 -32.393 13.530  1.00 0.00 ? 35  SER G O     1 
ATOM 6071  C CB    . SER G  1 29  ? -26.037 -30.075 15.623  1.00 0.00 ? 35  SER G CB    1 
ATOM 6072  O OG    . SER G  1 29  ? -24.860 -30.528 16.221  1.00 0.00 ? 35  SER G OG    1 
ATOM 6073  N N     . ASN G  1 30  ? -25.868 -33.310 15.473  1.00 0.00 ? 36  ASN G N     1 
ATOM 6074  C CA    . ASN G  1 30  ? -25.315 -34.473 14.814  1.00 0.00 ? 36  ASN G CA    1 
ATOM 6075  C C     . ASN G  1 30  ? -26.387 -35.405 14.312  1.00 0.00 ? 36  ASN G C     1 
ATOM 6076  O O     . ASN G  1 30  ? -26.246 -35.989 13.243  1.00 0.00 ? 36  ASN G O     1 
ATOM 6077  C CB    . ASN G  1 30  ? -24.364 -35.204 15.715  1.00 0.00 ? 36  ASN G CB    1 
ATOM 6078  C CG    . ASN G  1 30  ? -23.071 -34.471 15.863  1.00 0.00 ? 36  ASN G CG    1 
ATOM 6079  O OD1   . ASN G  1 30  ? -22.817 -33.501 15.143  1.00 0.00 ? 36  ASN G OD1   1 
ATOM 6080  N ND2   . ASN G  1 30  ? -22.236 -34.922 16.759  1.00 0.00 ? 36  ASN G ND2   1 
ATOM 6081  N N     . VAL G  1 31  ? -27.482 -35.526 15.056  1.00 0.00 ? 37  VAL G N     1 
ATOM 6082  C CA    . VAL G  1 31  ? -28.546 -36.433 14.652  1.00 0.00 ? 37  VAL G CA    1 
ATOM 6083  C C     . VAL G  1 31  ? -29.621 -35.736 13.882  1.00 0.00 ? 37  VAL G C     1 
ATOM 6084  O O     . VAL G  1 31  ? -30.623 -36.353 13.542  1.00 0.00 ? 37  VAL G O     1 
ATOM 6085  C CB    . VAL G  1 31  ? -29.196 -37.105 15.853  1.00 0.00 ? 37  VAL G CB    1 
ATOM 6086  C CG1   . VAL G  1 31  ? -28.164 -37.854 16.662  1.00 0.00 ? 37  VAL G CG1   1 
ATOM 6087  C CG2   . VAL G  1 31  ? -29.916 -36.072 16.686  1.00 0.00 ? 37  VAL G CG2   1 
ATOM 6088  N N     . SER G  1 32  ? -29.435 -34.446 13.617  1.00 0.00 ? 38  SER G N     1 
ATOM 6089  C CA    . SER G  1 32  ? -30.394 -33.686 12.841  1.00 0.00 ? 38  SER G CA    1 
ATOM 6090  C C     . SER G  1 32  ? -30.805 -34.401 11.548  1.00 0.00 ? 38  SER G C     1 
ATOM 6091  O O     . SER G  1 32  ? -31.908 -34.939 11.483  1.00 0.00 ? 38  SER G O     1 
ATOM 6092  C CB    . SER G  1 32  ? -29.874 -32.284 12.556  1.00 0.00 ? 38  SER G CB    1 
ATOM 6093  O OG    . SER G  1 32  ? -29.835 -31.518 13.726  1.00 0.00 ? 38  SER G OG    1 
ATOM 6094  N N     . PRO G  1 33  ? -29.956 -34.383 10.496  1.00 0.00 ? 39  PRO G N     1 
ATOM 6095  C CA    . PRO G  1 33  ? -30.276 -34.963 9.191   1.00 0.00 ? 39  PRO G CA    1 
ATOM 6096  C C     . PRO G  1 33  ? -30.740 -36.428 9.285   1.00 0.00 ? 39  PRO G C     1 
ATOM 6097  O O     . PRO G  1 33  ? -31.504 -36.897 8.439   1.00 0.00 ? 39  PRO G O     1 
ATOM 6098  C CB    . PRO G  1 33  ? -28.959 -34.894 8.454   1.00 0.00 ? 39  PRO G CB    1 
ATOM 6099  C CG    . PRO G  1 33  ? -27.938 -35.128 9.505   1.00 0.00 ? 39  PRO G CG    1 
ATOM 6100  C CD    . PRO G  1 33  ? -28.506 -34.552 10.766  1.00 0.00 ? 39  PRO G CD    1 
ATOM 6101  N N     . VAL G  1 34  ? -30.305 -37.133 10.325  1.00 0.00 ? 40  VAL G N     1 
ATOM 6102  C CA    . VAL G  1 34  ? -30.690 -38.504 10.520  1.00 0.00 ? 40  VAL G CA    1 
ATOM 6103  C C     . VAL G  1 34  ? -32.136 -38.574 10.915  1.00 0.00 ? 40  VAL G C     1 
ATOM 6104  O O     . VAL G  1 34  ? -32.919 -39.318 10.325  1.00 0.00 ? 40  VAL G O     1 
ATOM 6105  C CB    . VAL G  1 34  ? -29.836 -39.143 11.611  1.00 0.00 ? 40  VAL G CB    1 
ATOM 6106  C CG1   . VAL G  1 34  ? -30.336 -40.541 11.910  1.00 0.00 ? 40  VAL G CG1   1 
ATOM 6107  C CG2   . VAL G  1 34  ? -28.383 -39.160 11.181  1.00 0.00 ? 40  VAL G CG2   1 
ATOM 6108  N N     . ALA G  1 35  ? -32.499 -37.768 11.901  1.00 0.00 ? 41  ALA G N     1 
ATOM 6109  C CA    . ALA G  1 35  ? -33.858 -37.694 12.364  1.00 0.00 ? 41  ALA G CA    1 
ATOM 6110  C C     . ALA G  1 35  ? -34.766 -37.250 11.259  1.00 0.00 ? 41  ALA G C     1 
ATOM 6111  O O     . ALA G  1 35  ? -35.877 -37.753 11.125  1.00 0.00 ? 41  ALA G O     1 
ATOM 6112  C CB    . ALA G  1 35  ? -33.964 -36.740 13.537  1.00 0.00 ? 41  ALA G CB    1 
ATOM 6113  N N     . GLN G  1 36  ? -34.283 -36.323 10.443  1.00 0.00 ? 42  GLN G N     1 
ATOM 6114  C CA    . GLN G  1 36  ? -35.058 -35.801 9.343   1.00 0.00 ? 42  GLN G CA    1 
ATOM 6115  C C     . GLN G  1 36  ? -35.442 -36.895 8.413   1.00 0.00 ? 42  GLN G C     1 
ATOM 6116  O O     . GLN G  1 36  ? -36.591 -36.991 7.999   1.00 0.00 ? 42  GLN G O     1 
ATOM 6117  C CB    . GLN G  1 36  ? -34.266 -34.761 8.593   1.00 0.00 ? 42  GLN G CB    1 
ATOM 6118  C CG    . GLN G  1 36  ? -34.011 -33.514 9.387   1.00 0.00 ? 42  GLN G CG    1 
ATOM 6119  C CD    . GLN G  1 36  ? -33.189 -32.509 8.629   1.00 0.00 ? 42  GLN G CD    1 
ATOM 6120  O OE1   . GLN G  1 36  ? -33.339 -32.352 7.416   1.00 0.00 ? 42  GLN G OE1   1 
ATOM 6121  N NE2   . GLN G  1 36  ? -32.306 -31.819 9.336   1.00 0.00 ? 42  GLN G NE2   1 
ATOM 6122  N N     . GLN G  1 37  ? -34.485 -37.755 8.108   1.00 0.00 ? 43  GLN G N     1 
ATOM 6123  C CA    . GLN G  1 37  ? -34.741 -38.888 7.260   1.00 0.00 ? 43  GLN G CA    1 
ATOM 6124  C C     . GLN G  1 37  ? -35.812 -39.768 7.825   1.00 0.00 ? 43  GLN G C     1 
ATOM 6125  O O     . GLN G  1 37  ? -36.733 -40.171 7.114   1.00 0.00 ? 43  GLN G O     1 
ATOM 6126  C CB    . GLN G  1 37  ? -33.476 -39.704 7.077   1.00 0.00 ? 43  GLN G CB    1 
ATOM 6127  C CG    . GLN G  1 37  ? -33.661 -40.907 6.197   1.00 0.00 ? 43  GLN G CG    1 
ATOM 6128  C CD    . GLN G  1 37  ? -33.947 -40.526 4.774   1.00 0.00 ? 43  GLN G CD    1 
ATOM 6129  O OE1   . GLN G  1 37  ? -33.193 -39.764 4.168   1.00 0.00 ? 43  GLN G OE1   1 
ATOM 6130  N NE2   . GLN G  1 37  ? -35.038 -41.045 4.223   1.00 0.00 ? 43  GLN G NE2   1 
ATOM 6131  N N     . ASN G  1 38  ? -35.700 -40.069 9.106   1.00 0.00 ? 44  ASN G N     1 
ATOM 6132  C CA    . ASN G  1 38  ? -36.623 -40.971 9.755   1.00 0.00 ? 44  ASN G CA    1 
ATOM 6133  C C     . ASN G  1 38  ? -38.018 -40.403 9.817   1.00 0.00 ? 44  ASN G C     1 
ATOM 6134  O O     . ASN G  1 38  ? -38.995 -41.118 9.597   1.00 0.00 ? 44  ASN G O     1 
ATOM 6135  C CB    . ASN G  1 38  ? -36.115 -41.309 11.121  1.00 0.00 ? 44  ASN G CB    1 
ATOM 6136  C CG    . ASN G  1 38  ? -34.923 -42.206 11.045  1.00 0.00 ? 44  ASN G CG    1 
ATOM 6137  O OD1   . ASN G  1 38  ? -34.739 -42.905 10.041  1.00 0.00 ? 44  ASN G OD1   1 
ATOM 6138  N ND2   . ASN G  1 38  ? -34.103 -42.197 12.064  1.00 0.00 ? 44  ASN G ND2   1 
ATOM 6139  N N     . PHE G  1 39  ? -38.114 -39.112 10.089  1.00 0.00 ? 45  PHE G N     1 
ATOM 6140  C CA    . PHE G  1 39  ? -39.393 -38.448 10.156  1.00 0.00 ? 45  PHE G CA    1 
ATOM 6141  C C     . PHE G  1 39  ? -40.057 -38.471 8.809   1.00 0.00 ? 45  PHE G C     1 
ATOM 6142  O O     . PHE G  1 39  ? -41.219 -38.837 8.680   1.00 0.00 ? 45  PHE G O     1 
ATOM 6143  C CB    . PHE G  1 39  ? -39.226 -37.014 10.590  1.00 0.00 ? 45  PHE G CB    1 
ATOM 6144  C CG    . PHE G  1 39  ? -40.521 -36.323 10.821  1.00 0.00 ? 45  PHE G CG    1 
ATOM 6145  C CD1   . PHE G  1 39  ? -40.987 -36.126 12.107  1.00 0.00 ? 45  PHE G CD1   1 
ATOM 6146  C CD2   . PHE G  1 39  ? -41.301 -35.902 9.765   1.00 0.00 ? 45  PHE G CD2   1 
ATOM 6147  C CE1   . PHE G  1 39  ? -42.187 -35.483 12.336  1.00 0.00 ? 45  PHE G CE1   1 
ATOM 6148  C CE2   . PHE G  1 39  ? -42.508 -35.265 9.991   1.00 0.00 ? 45  PHE G CE2   1 
ATOM 6149  C CZ    . PHE G  1 39  ? -42.947 -35.046 11.277  1.00 0.00 ? 45  PHE G CZ    1 
ATOM 6150  N N     . GLN G  1 40  ? -39.309 -38.097 7.786   1.00 0.00 ? 46  GLN G N     1 
ATOM 6151  C CA    . GLN G  1 40  ? -39.827 -38.074 6.437   1.00 0.00 ? 46  GLN G CA    1 
ATOM 6152  C C     . GLN G  1 40  ? -40.198 -39.445 5.949   1.00 0.00 ? 46  GLN G C     1 
ATOM 6153  O O     . GLN G  1 40  ? -41.162 -39.606 5.207   1.00 0.00 ? 46  GLN G O     1 
ATOM 6154  C CB    . GLN G  1 40  ? -38.808 -37.481 5.494   1.00 0.00 ? 46  GLN G CB    1 
ATOM 6155  C CG    . GLN G  1 40  ? -38.595 -36.005 5.661   1.00 0.00 ? 46  GLN G CG    1 
ATOM 6156  C CD    . GLN G  1 40  ? -37.461 -35.520 4.810   1.00 0.00 ? 46  GLN G CD    1 
ATOM 6157  O OE1   . GLN G  1 40  ? -36.380 -36.119 4.803   1.00 0.00 ? 46  GLN G OE1   1 
ATOM 6158  N NE2   . GLN G  1 40  ? -37.693 -34.446 4.070   1.00 0.00 ? 46  GLN G NE2   1 
ATOM 6159  N N     . THR G  1 41  ? -39.422 -40.438 6.334   1.00 0.00 ? 47  THR G N     1 
ATOM 6160  C CA    . THR G  1 41  ? -39.654 -41.781 5.869   1.00 0.00 ? 47  THR G CA    1 
ATOM 6161  C C     . THR G  1 41  ? -40.949 -42.378 6.391   1.00 0.00 ? 47  THR G C     1 
ATOM 6162  O O     . THR G  1 41  ? -41.698 -42.982 5.631   1.00 0.00 ? 47  THR G O     1 
ATOM 6163  C CB    . THR G  1 41  ? -38.493 -42.692 6.260   1.00 0.00 ? 47  THR G CB    1 
ATOM 6164  O OG1   . THR G  1 41  ? -37.287 -42.216 5.651   1.00 0.00 ? 47  THR G OG1   1 
ATOM 6165  C CG2   . THR G  1 41  ? -38.763 -44.112 5.801   1.00 0.00 ? 47  THR G CG2   1 
ATOM 6166  N N     . ASN G  1 42  ? -41.205 -42.246 7.683   1.00 0.00 ? 48  ASN G N     1 
ATOM 6167  C CA    . ASN G  1 42  ? -42.357 -42.912 8.256   1.00 0.00 ? 48  ASN G CA    1 
ATOM 6168  C C     . ASN G  1 42  ? -43.597 -42.053 8.441   1.00 0.00 ? 48  ASN G C     1 
ATOM 6169  O O     . ASN G  1 42  ? -44.704 -42.560 8.332   1.00 0.00 ? 48  ASN G O     1 
ATOM 6170  C CB    . ASN G  1 42  ? -41.983 -43.566 9.562   1.00 0.00 ? 48  ASN G CB    1 
ATOM 6171  C CG    . ASN G  1 42  ? -41.107 -44.775 9.363   1.00 0.00 ? 48  ASN G CG    1 
ATOM 6172  O OD1   . ASN G  1 42  ? -41.167 -45.434 8.314   1.00 0.00 ? 48  ASN G OD1   1 
ATOM 6173  N ND2   . ASN G  1 42  ? -40.307 -45.096 10.350  1.00 0.00 ? 48  ASN G ND2   1 
ATOM 6174  N N     . VAL G  1 43  ? -43.443 -40.769 8.713   1.00 0.00 ? 49  VAL G N     1 
ATOM 6175  C CA    . VAL G  1 43  ? -44.616 -39.957 9.061   1.00 0.00 ? 49  VAL G CA    1 
ATOM 6176  C C     . VAL G  1 43  ? -45.735 -39.895 8.006   1.00 0.00 ? 49  VAL G C     1 
ATOM 6177  O O     . VAL G  1 43  ? -46.903 -40.041 8.367   1.00 0.00 ? 49  VAL G O     1 
ATOM 6178  C CB    . VAL G  1 43  ? -44.204 -38.554 9.462   1.00 0.00 ? 49  VAL G CB    1 
ATOM 6179  C CG1   . VAL G  1 43  ? -45.421 -37.659 9.572   1.00 0.00 ? 49  VAL G CG1   1 
ATOM 6180  C CG2   . VAL G  1 43  ? -43.513 -38.648 10.786  1.00 0.00 ? 49  VAL G CG2   1 
ATOM 6181  N N     . PRO G  1 44  ? -45.422 -39.693 6.714   1.00 0.00 ? 50  PRO G N     1 
ATOM 6182  C CA    . PRO G  1 44  ? -46.339 -39.640 5.588   1.00 0.00 ? 50  PRO G CA    1 
ATOM 6183  C C     . PRO G  1 44  ? -47.231 -40.869 5.546   1.00 0.00 ? 50  PRO G C     1 
ATOM 6184  O O     . PRO G  1 44  ? -48.368 -40.805 5.073   1.00 0.00 ? 50  PRO G O     1 
ATOM 6185  C CB    . PRO G  1 44  ? -45.414 -39.584 4.386   1.00 0.00 ? 50  PRO G CB    1 
ATOM 6186  C CG    . PRO G  1 44  ? -44.190 -38.933 4.897   1.00 0.00 ? 50  PRO G CG    1 
ATOM 6187  C CD    . PRO G  1 44  ? -44.031 -39.474 6.279   1.00 0.00 ? 50  PRO G CD    1 
ATOM 6188  N N     . LYS G  1 45  ? -46.713 -41.992 6.043   1.00 0.00 ? 51  LYS G N     1 
ATOM 6189  C CA    . LYS G  1 45  ? -47.441 -43.244 6.046   1.00 0.00 ? 51  LYS G CA    1 
ATOM 6190  C C     . LYS G  1 45  ? -48.640 -43.161 6.956   1.00 0.00 ? 51  LYS G C     1 
ATOM 6191  O O     . LYS G  1 45  ? -49.668 -43.777 6.694   1.00 0.00 ? 51  LYS G O     1 
ATOM 6192  C CB    . LYS G  1 45  ? -46.537 -44.368 6.518   1.00 0.00 ? 51  LYS G CB    1 
ATOM 6193  C CG    . LYS G  1 45  ? -45.392 -44.698 5.581   1.00 0.00 ? 51  LYS G CG    1 
ATOM 6194  C CD    . LYS G  1 45  ? -44.453 -45.712 6.211   1.00 0.00 ? 51  LYS G CD    1 
ATOM 6195  C CE    . LYS G  1 45  ? -43.273 -46.015 5.304   1.00 0.00 ? 51  LYS G CE    1 
ATOM 6196  N NZ    . LYS G  1 45  ? -42.260 -46.865 5.980   1.00 0.00 ? 51  LYS G NZ    1 
ATOM 6197  N N     . PHE G  1 46  ? -48.502 -42.402 8.033   1.00 0.00 ? 52  PHE G N     1 
ATOM 6198  C CA    . PHE G  1 46  ? -49.553 -42.267 9.008   1.00 0.00 ? 52  PHE G CA    1 
ATOM 6199  C C     . PHE G  1 46  ? -50.442 -41.096 8.702   1.00 0.00 ? 52  PHE G C     1 
ATOM 6200  O O     . PHE G  1 46  ? -51.612 -41.093 9.067   1.00 0.00 ? 52  PHE G O     1 
ATOM 6201  C CB    . PHE G  1 46  ? -48.957 -42.136 10.385  1.00 0.00 ? 52  PHE G CB    1 
ATOM 6202  C CG    . PHE G  1 46  ? -48.321 -43.396 10.835  1.00 0.00 ? 52  PHE G CG    1 
ATOM 6203  C CD1   . PHE G  1 46  ? -47.004 -43.654 10.532  1.00 0.00 ? 52  PHE G CD1   1 
ATOM 6204  C CD2   . PHE G  1 46  ? -49.036 -44.334 11.555  1.00 0.00 ? 52  PHE G CD2   1 
ATOM 6205  C CE1   . PHE G  1 46  ? -46.410 -44.827 10.934  1.00 0.00 ? 52  PHE G CE1   1 
ATOM 6206  C CE2   . PHE G  1 46  ? -48.445 -45.502 11.968  1.00 0.00 ? 52  PHE G CE2   1 
ATOM 6207  C CZ    . PHE G  1 46  ? -47.130 -45.752 11.656  1.00 0.00 ? 52  PHE G CZ    1 
ATOM 6208  N N     . THR G  1 47  ? -49.908 -40.110 8.001   1.00 0.00 ? 53  THR G N     1 
ATOM 6209  C CA    . THR G  1 47  ? -50.728 -39.000 7.588   1.00 0.00 ? 53  THR G CA    1 
ATOM 6210  C C     . THR G  1 47  ? -51.802 -39.466 6.645   1.00 0.00 ? 53  THR G C     1 
ATOM 6211  O O     . THR G  1 47  ? -52.954 -39.061 6.764   1.00 0.00 ? 53  THR G O     1 
ATOM 6212  C CB    . THR G  1 47  ? -49.923 -37.910 6.922   1.00 0.00 ? 53  THR G CB    1 
ATOM 6213  O OG1   . THR G  1 47  ? -48.977 -37.375 7.852   1.00 0.00 ? 53  THR G OG1   1 
ATOM 6214  C CG2   . THR G  1 47  ? -50.854 -36.814 6.450   1.00 0.00 ? 53  THR G CG2   1 
ATOM 6215  N N     . SER G  1 48  ? -51.432 -40.340 5.713   1.00 0.00 ? 54  SER G N     1 
ATOM 6216  C CA    . SER G  1 48  ? -52.401 -40.875 4.776   1.00 0.00 ? 54  SER G CA    1 
ATOM 6217  C C     . SER G  1 48  ? -53.486 -41.663 5.495   1.00 0.00 ? 54  SER G C     1 
ATOM 6218  O O     . SER G  1 48  ? -54.639 -41.670 5.069   1.00 0.00 ? 54  SER G O     1 
ATOM 6219  C CB    . SER G  1 48  ? -51.713 -41.765 3.775   1.00 0.00 ? 54  SER G CB    1 
ATOM 6220  O OG    . SER G  1 48  ? -51.228 -42.926 4.390   1.00 0.00 ? 54  SER G OG    1 
ATOM 6221  N N     . VAL G  1 49  ? -53.126 -42.273 6.622   1.00 0.00 ? 55  VAL G N     1 
ATOM 6222  C CA    . VAL G  1 49  ? -54.086 -42.986 7.439   1.00 0.00 ? 55  VAL G CA    1 
ATOM 6223  C C     . VAL G  1 49  ? -55.047 -42.027 8.065   1.00 0.00 ? 55  VAL G C     1 
ATOM 6224  O O     . VAL G  1 49  ? -56.254 -42.225 8.005   1.00 0.00 ? 55  VAL G O     1 
ATOM 6225  C CB    . VAL G  1 49  ? -53.384 -43.782 8.541   1.00 0.00 ? 55  VAL G CB    1 
ATOM 6226  C CG1   . VAL G  1 49  ? -54.403 -44.353 9.503   1.00 0.00 ? 55  VAL G CG1   1 
ATOM 6227  C CG2   . VAL G  1 49  ? -52.571 -44.887 7.920   1.00 0.00 ? 55  VAL G CG2   1 
ATOM 6228  N N     . ASN G  1 50  ? -54.522 -40.954 8.630   1.00 0.00 ? 56  ASN G N     1 
ATOM 6229  C CA    . ASN G  1 50  ? -55.350 -39.949 9.250   1.00 0.00 ? 56  ASN G CA    1 
ATOM 6230  C C     . ASN G  1 50  ? -56.340 -39.403 8.273   1.00 0.00 ? 56  ASN G C     1 
ATOM 6231  O O     . ASN G  1 50  ? -57.493 -39.174 8.617   1.00 0.00 ? 56  ASN G O     1 
ATOM 6232  C CB    . ASN G  1 50  ? -54.507 -38.834 9.799   1.00 0.00 ? 56  ASN G CB    1 
ATOM 6233  C CG    . ASN G  1 50  ? -53.775 -39.237 11.019  1.00 0.00 ? 56  ASN G CG    1 
ATOM 6234  O OD1   . ASN G  1 50  ? -54.174 -40.188 11.692  1.00 0.00 ? 56  ASN G OD1   1 
ATOM 6235  N ND2   . ASN G  1 50  ? -52.713 -38.541 11.323  1.00 0.00 ? 56  ASN G ND2   1 
ATOM 6236  N N     . GLU G  1 51  ? -55.901 -39.218 7.043   1.00 0.00 ? 57  GLU G N     1 
ATOM 6237  C CA    . GLU G  1 51  ? -56.751 -38.693 6.006   1.00 0.00 ? 57  GLU G CA    1 
ATOM 6238  C C     . GLU G  1 51  ? -57.860 -39.637 5.627   1.00 0.00 ? 57  GLU G C     1 
ATOM 6239  O O     . GLU G  1 51  ? -59.028 -39.251 5.596   1.00 0.00 ? 57  GLU G O     1 
ATOM 6240  C CB    . GLU G  1 51  ? -55.937 -38.385 4.773   1.00 0.00 ? 57  GLU G CB    1 
ATOM 6241  C CG    . GLU G  1 51  ? -56.766 -37.873 3.626   1.00 0.00 ? 57  GLU G CG    1 
ATOM 6242  C CD    . GLU G  1 51  ? -57.384 -36.558 3.931   1.00 0.00 ? 57  GLU G CD    1 
ATOM 6243  O OE1   . GLU G  1 51  ? -56.825 -35.838 4.722   1.00 0.00 ? 57  GLU G OE1   1 
ATOM 6244  O OE2   . GLU G  1 51  ? -58.427 -36.272 3.396   1.00 0.00 ? 57  GLU G OE2   1 
ATOM 6245  N N     . ASN G  1 52  ? -57.498 -40.865 5.311   1.00 0.00 ? 58  ASN G N     1 
ATOM 6246  C CA    . ASN G  1 52  ? -58.473 -41.817 4.847   1.00 0.00 ? 58  ASN G CA    1 
ATOM 6247  C C     . ASN G  1 52  ? -59.440 -42.197 5.943   1.00 0.00 ? 58  ASN G C     1 
ATOM 6248  O O     . ASN G  1 52  ? -60.638 -42.321 5.699   1.00 0.00 ? 58  ASN G O     1 
ATOM 6249  C CB    . ASN G  1 52  ? -57.790 -43.020 4.289   1.00 0.00 ? 58  ASN G CB    1 
ATOM 6250  C CG    . ASN G  1 52  ? -57.107 -42.728 2.988   1.00 0.00 ? 58  ASN G CG    1 
ATOM 6251  O OD1   . ASN G  1 52  ? -57.386 -41.716 2.339   1.00 0.00 ? 58  ASN G OD1   1 
ATOM 6252  N ND2   . ASN G  1 52  ? -56.217 -43.599 2.591   1.00 0.00 ? 58  ASN G ND2   1 
ATOM 6253  N N     . VAL G  1 53  ? -58.937 -42.339 7.159   1.00 0.00 ? 59  VAL G N     1 
ATOM 6254  C CA    . VAL G  1 53  ? -59.786 -42.643 8.289   1.00 0.00 ? 59  VAL G CA    1 
ATOM 6255  C C     . VAL G  1 53  ? -60.718 -41.498 8.562   1.00 0.00 ? 59  VAL G C     1 
ATOM 6256  O O     . VAL G  1 53  ? -61.885 -41.708 8.873   1.00 0.00 ? 59  VAL G O     1 
ATOM 6257  C CB    . VAL G  1 53  ? -58.956 -42.954 9.534   1.00 0.00 ? 59  VAL G CB    1 
ATOM 6258  C CG1   . VAL G  1 53  ? -59.863 -43.058 10.748  1.00 0.00 ? 59  VAL G CG1   1 
ATOM 6259  C CG2   . VAL G  1 53  ? -58.205 -44.256 9.330   1.00 0.00 ? 59  VAL G CG2   1 
ATOM 6260  N N     . SER G  1 54  ? -60.217 -40.278 8.440   1.00 0.00 ? 60  SER G N     1 
ATOM 6261  C CA    . SER G  1 54  ? -61.048 -39.118 8.617   1.00 0.00 ? 60  SER G CA    1 
ATOM 6262  C C     . SER G  1 54  ? -62.206 -39.147 7.659   1.00 0.00 ? 60  SER G C     1 
ATOM 6263  O O     . SER G  1 54  ? -63.342 -38.894 8.052   1.00 0.00 ? 60  SER G O     1 
ATOM 6264  C CB    . SER G  1 54  ? -60.249 -37.863 8.410   1.00 0.00 ? 60  SER G CB    1 
ATOM 6265  O OG    . SER G  1 54  ? -61.050 -36.731 8.580   1.00 0.00 ? 60  SER G OG    1 
ATOM 6266  N N     . ALA G  1 55  ? -61.929 -39.468 6.397   1.00 0.00 ? 61  ALA G N     1 
ATOM 6267  C CA    . ALA G  1 55  ? -62.977 -39.545 5.395   1.00 0.00 ? 61  ALA G CA    1 
ATOM 6268  C C     . ALA G  1 55  ? -64.062 -40.497 5.835   1.00 0.00 ? 61  ALA G C     1 
ATOM 6269  O O     . ALA G  1 55  ? -65.247 -40.167 5.771   1.00 0.00 ? 61  ALA G O     1 
ATOM 6270  C CB    . ALA G  1 55  ? -62.406 -39.985 4.064   1.00 0.00 ? 61  ALA G CB    1 
ATOM 6271  N N     . VAL G  1 56  ? -63.655 -41.654 6.324   1.00 0.00 ? 62  VAL G N     1 
ATOM 6272  C CA    . VAL G  1 56  ? -64.583 -42.646 6.826   1.00 0.00 ? 62  VAL G CA    1 
ATOM 6273  C C     . VAL G  1 56  ? -65.434 -42.102 7.934   1.00 0.00 ? 62  VAL G C     1 
ATOM 6274  O O     . VAL G  1 56  ? -66.654 -42.244 7.918   1.00 0.00 ? 62  VAL G O     1 
ATOM 6275  C CB    . VAL G  1 56  ? -63.818 -43.859 7.344   1.00 0.00 ? 62  VAL G CB    1 
ATOM 6276  C CG1   . VAL G  1 56  ? -64.736 -44.790 8.090   1.00 0.00 ? 62  VAL G CG1   1 
ATOM 6277  C CG2   . VAL G  1 56  ? -63.190 -44.570 6.191   1.00 0.00 ? 62  VAL G CG2   1 
ATOM 6278  N N     . LEU G  1 57  ? -64.798 -41.465 8.891   1.00 0.00 ? 63  LEU G N     1 
ATOM 6279  C CA    . LEU G  1 57  ? -65.482 -40.972 10.055  1.00 0.00 ? 63  LEU G CA    1 
ATOM 6280  C C     . LEU G  1 57  ? -66.510 -39.931 9.698   1.00 0.00 ? 63  LEU G C     1 
ATOM 6281  O O     . LEU G  1 57  ? -67.584 -39.884 10.293  1.00 0.00 ? 63  LEU G O     1 
ATOM 6282  C CB    . LEU G  1 57  ? -64.468 -40.426 11.024  1.00 0.00 ? 63  LEU G CB    1 
ATOM 6283  C CG    . LEU G  1 57  ? -63.575 -41.498 11.631  1.00 0.00 ? 63  LEU G CG    1 
ATOM 6284  C CD1   . LEU G  1 57  ? -62.493 -40.852 12.465  1.00 0.00 ? 63  LEU G CD1   1 
ATOM 6285  C CD2   . LEU G  1 57  ? -64.427 -42.437 12.450  1.00 0.00 ? 63  LEU G CD2   1 
ATOM 6286  N N     . THR G  1 58  ? -66.220 -39.128 8.692   1.00 0.00 ? 64  THR G N     1 
ATOM 6287  C CA    . THR G  1 58  ? -67.184 -38.162 8.220   1.00 0.00 ? 64  THR G CA    1 
ATOM 6288  C C     . THR G  1 58  ? -68.391 -38.860 7.614   1.00 0.00 ? 64  THR G C     1 
ATOM 6289  O O     . THR G  1 58  ? -69.530 -38.466 7.857   1.00 0.00 ? 64  THR G O     1 
ATOM 6290  C CB    . THR G  1 58  ? -66.554 -37.187 7.239   1.00 0.00 ? 64  THR G CB    1 
ATOM 6291  O OG1   . THR G  1 58  ? -65.516 -36.461 7.921   1.00 0.00 ? 64  THR G OG1   1 
ATOM 6292  C CG2   . THR G  1 58  ? -67.596 -36.213 6.715   1.00 0.00 ? 64  THR G CG2   1 
ATOM 6293  N N     . GLN G  1 59  ? -68.150 -39.939 6.870   1.00 0.00 ? 65  GLN G N     1 
ATOM 6294  C CA    . GLN G  1 59  ? -69.246 -40.734 6.313   1.00 0.00 ? 65  GLN G CA    1 
ATOM 6295  C C     . GLN G  1 59  ? -70.109 -41.369 7.413   1.00 0.00 ? 65  GLN G C     1 
ATOM 6296  O O     . GLN G  1 59  ? -71.311 -41.545 7.240   1.00 0.00 ? 65  GLN G O     1 
ATOM 6297  C CB    . GLN G  1 59  ? -68.719 -41.831 5.398   1.00 0.00 ? 65  GLN G CB    1 
ATOM 6298  C CG    . GLN G  1 59  ? -68.120 -41.332 4.106   1.00 0.00 ? 65  GLN G CG    1 
ATOM 6299  C CD    . GLN G  1 59  ? -67.597 -42.464 3.240   1.00 0.00 ? 65  GLN G CD    1 
ATOM 6300  O OE1   . GLN G  1 59  ? -67.739 -43.644 3.576   1.00 0.00 ? 65  GLN G OE1   1 
ATOM 6301  N NE2   . GLN G  1 59  ? -66.987 -42.112 2.114   1.00 0.00 ? 65  GLN G NE2   1 
ATOM 6302  N N     . TYR G  1 60  ? -69.492 -41.710 8.543   1.00 0.00 ? 66  TYR G N     1 
ATOM 6303  C CA    . TYR G  1 60  ? -70.235 -42.279 9.664   1.00 0.00 ? 66  TYR G CA    1 
ATOM 6304  C C     . TYR G  1 60  ? -70.789 -41.247 10.632  1.00 0.00 ? 66  TYR G C     1 
ATOM 6305  O O     . TYR G  1 60  ? -71.380 -41.610 11.643  1.00 0.00 ? 66  TYR G O     1 
ATOM 6306  C CB    . TYR G  1 60  ? -69.383 -43.273 10.419  1.00 0.00 ? 66  TYR G CB    1 
ATOM 6307  C CG    . TYR G  1 60  ? -69.295 -44.592 9.732   1.00 0.00 ? 66  TYR G CG    1 
ATOM 6308  C CD1   . TYR G  1 60  ? -68.208 -44.899 8.959   1.00 0.00 ? 66  TYR G CD1   1 
ATOM 6309  C CD2   . TYR G  1 60  ? -70.321 -45.499 9.877   1.00 0.00 ? 66  TYR G CD2   1 
ATOM 6310  C CE1   . TYR G  1 60  ? -68.142 -46.113 8.318   1.00 0.00 ? 66  TYR G CE1   1 
ATOM 6311  C CE2   . TYR G  1 60  ? -70.257 -46.716 9.244   1.00 0.00 ? 66  TYR G CE2   1 
ATOM 6312  C CZ    . TYR G  1 60  ? -69.170 -47.021 8.465   1.00 0.00 ? 66  TYR G CZ    1 
ATOM 6313  O OH    . TYR G  1 60  ? -69.101 -48.234 7.829   1.00 0.00 ? 66  TYR G OH    1 
ATOM 6314  N N     . GLY G  1 61  ? -70.598 -39.970 10.345  1.00 0.00 ? 67  GLY G N     1 
ATOM 6315  C CA    . GLY G  1 61  ? -71.181 -38.939 11.185  1.00 0.00 ? 67  GLY G CA    1 
ATOM 6316  C C     . GLY G  1 61  ? -70.450 -38.754 12.508  1.00 0.00 ? 67  GLY G C     1 
ATOM 6317  O O     . GLY G  1 61  ? -71.008 -38.198 13.455  1.00 0.00 ? 67  GLY G O     1 
ATOM 6318  N N     . ILE G  1 62  ? -69.205 -39.197 12.570  1.00 0.00 ? 68  ILE G N     1 
ATOM 6319  C CA    . ILE G  1 62  ? -68.441 -39.137 13.800  1.00 0.00 ? 68  ILE G CA    1 
ATOM 6320  C C     . ILE G  1 62  ? -67.810 -37.773 13.966  1.00 0.00 ? 68  ILE G C     1 
ATOM 6321  O O     . ILE G  1 62  ? -67.140 -37.281 13.059  1.00 0.00 ? 68  ILE G O     1 
ATOM 6322  C CB    . ILE G  1 62  ? -67.354 -40.206 13.808  1.00 0.00 ? 68  ILE G CB    1 
ATOM 6323  C CG1   . ILE G  1 62  ? -67.964 -41.583 13.576  1.00 0.00 ? 68  ILE G CG1   1 
ATOM 6324  C CG2   . ILE G  1 62  ? -66.620 -40.182 15.120  1.00 0.00 ? 68  ILE G CG2   1 
ATOM 6325  C CD1   . ILE G  1 62  ? -68.986 -41.977 14.610  1.00 0.00 ? 68  ILE G CD1   1 
ATOM 6326  N N     . THR G  1 63  ? -68.039 -37.146 15.113  1.00 0.00 ? 69  THR G N     1 
ATOM 6327  C CA    . THR G  1 63  ? -67.516 -35.804 15.368  1.00 0.00 ? 69  THR G CA    1 
ATOM 6328  C C     . THR G  1 63  ? -66.753 -35.717 16.676  1.00 0.00 ? 69  THR G C     1 
ATOM 6329  O O     . THR G  1 63  ? -66.903 -36.562 17.558  1.00 0.00 ? 69  THR G O     1 
ATOM 6330  C CB    . THR G  1 63  ? -68.638 -34.793 15.430  1.00 0.00 ? 69  THR G CB    1 
ATOM 6331  O OG1   . THR G  1 63  ? -69.460 -35.124 16.542  1.00 0.00 ? 69  THR G OG1   1 
ATOM 6332  C CG2   . THR G  1 63  ? -69.472 -34.804 14.160  1.00 0.00 ? 69  THR G CG2   1 
ATOM 6333  N N     . GLY G  1 64  ? -65.984 -34.654 16.815  1.00 0.00 ? 70  GLY G N     1 
ATOM 6334  C CA    . GLY G  1 64  ? -65.273 -34.377 18.042  1.00 0.00 ? 70  GLY G CA    1 
ATOM 6335  C C     . GLY G  1 64  ? -64.279 -35.465 18.383  1.00 0.00 ? 70  GLY G C     1 
ATOM 6336  O O     . GLY G  1 64  ? -63.734 -36.133 17.503  1.00 0.00 ? 70  GLY G O     1 
ATOM 6337  N N     . PRO G  1 65  ? -64.065 -35.671 19.671  1.00 0.00 ? 71  PRO G N     1 
ATOM 6338  C CA    . PRO G  1 65  ? -63.168 -36.626 20.274  1.00 0.00 ? 71  PRO G CA    1 
ATOM 6339  C C     . PRO G  1 65  ? -63.502 -38.036 19.874  1.00 0.00 ? 71  PRO G C     1 
ATOM 6340  O O     . PRO G  1 65  ? -62.663 -38.924 19.978  1.00 0.00 ? 71  PRO G O     1 
ATOM 6341  C CB    . PRO G  1 65  ? -63.333 -36.375 21.755  1.00 0.00 ? 71  PRO G CB    1 
ATOM 6342  C CG    . PRO G  1 65  ? -63.631 -34.912 21.844  1.00 0.00 ? 71  PRO G CG    1 
ATOM 6343  C CD    . PRO G  1 65  ? -64.424 -34.598 20.611  1.00 0.00 ? 71  PRO G CD    1 
ATOM 6344  N N     . ASN G  1 66  ? -64.716 -38.258 19.399  1.00 0.00 ? 72  ASN G N     1 
ATOM 6345  C CA    . ASN G  1 66  ? -65.082 -39.571 18.966  1.00 0.00 ? 72  ASN G CA    1 
ATOM 6346  C C     . ASN G  1 66  ? -64.302 -39.940 17.734  1.00 0.00 ? 72  ASN G C     1 
ATOM 6347  O O     . ASN G  1 66  ? -63.977 -41.107 17.526  1.00 0.00 ? 72  ASN G O     1 
ATOM 6348  C CB    . ASN G  1 66  ? -66.551 -39.648 18.727  1.00 0.00 ? 72  ASN G CB    1 
ATOM 6349  C CG    . ASN G  1 66  ? -67.308 -39.618 20.007  1.00 0.00 ? 72  ASN G CG    1 
ATOM 6350  O OD1   . ASN G  1 66  ? -66.853 -40.158 21.017  1.00 0.00 ? 72  ASN G OD1   1 
ATOM 6351  N ND2   . ASN G  1 66  ? -68.443 -38.974 20.001  1.00 0.00 ? 72  ASN G ND2   1 
ATOM 6352  N N     . ARG G  1 67  ? -63.959 -38.937 16.928  1.00 0.00 ? 73  ARG G N     1 
ATOM 6353  C CA    . ARG G  1 67  ? -63.152 -39.179 15.764  1.00 0.00 ? 73  ARG G CA    1 
ATOM 6354  C C     . ARG G  1 67  ? -61.795 -39.571 16.216  1.00 0.00 ? 73  ARG G C     1 
ATOM 6355  O O     . ARG G  1 67  ? -61.210 -40.517 15.698  1.00 0.00 ? 73  ARG G O     1 
ATOM 6356  C CB    . ARG G  1 67  ? -63.040 -37.944 14.896  1.00 0.00 ? 73  ARG G CB    1 
ATOM 6357  C CG    . ARG G  1 67  ? -64.324 -37.502 14.252  1.00 0.00 ? 73  ARG G CG    1 
ATOM 6358  C CD    . ARG G  1 67  ? -64.152 -36.255 13.493  1.00 0.00 ? 73  ARG G CD    1 
ATOM 6359  N NE    . ARG G  1 67  ? -63.445 -36.458 12.241  1.00 0.00 ? 73  ARG G NE    1 
ATOM 6360  C CZ    . ARG G  1 67  ? -64.053 -36.671 11.055  1.00 0.00 ? 73  ARG G CZ    1 
ATOM 6361  N NH1   . ARG G  1 67  ? -65.355 -36.742 10.968  1.00 0.00 ? 73  ARG G NH1   1 
ATOM 6362  N NH2   . ARG G  1 67  ? -63.355 -36.791 9.946   1.00 0.00 ? 73  ARG G NH2   1 
ATOM 6363  N N     . ALA G  1 68  ? -61.314 -38.875 17.245  1.00 0.00 ? 74  ALA G N     1 
ATOM 6364  C CA    . ALA G  1 68  ? -59.997 -39.137 17.809  1.00 0.00 ? 74  ALA G CA    1 
ATOM 6365  C C     . ALA G  1 68  ? -59.871 -40.570 18.300  1.00 0.00 ? 74  ALA G C     1 
ATOM 6366  O O     . ALA G  1 68  ? -58.815 -41.178 18.157  1.00 0.00 ? 74  ALA G O     1 
ATOM 6367  C CB    . ALA G  1 68  ? -59.704 -38.170 18.939  1.00 0.00 ? 74  ALA G CB    1 
ATOM 6368  N N     . ILE G  1 69  ? -60.956 -41.122 18.840  1.00 0.00 ? 75  ILE G N     1 
ATOM 6369  C CA    . ILE G  1 69  ? -60.942 -42.511 19.279  1.00 0.00 ? 75  ILE G CA    1 
ATOM 6370  C C     . ILE G  1 69  ? -60.610 -43.431 18.140  1.00 0.00 ? 75  ILE G C     1 
ATOM 6371  O O     . ILE G  1 69  ? -59.725 -44.283 18.247  1.00 0.00 ? 75  ILE G O     1 
ATOM 6372  C CB    . ILE G  1 69  ? -62.301 -42.937 19.845  1.00 0.00 ? 75  ILE G CB    1 
ATOM 6373  C CG1   . ILE G  1 69  ? -62.583 -42.217 21.142  1.00 0.00 ? 75  ILE G CG1   1 
ATOM 6374  C CG2   . ILE G  1 69  ? -62.334 -44.441 20.045  1.00 0.00 ? 75  ILE G CG2   1 
ATOM 6375  C CD1   . ILE G  1 69  ? -64.001 -42.367 21.626  1.00 0.00 ? 75  ILE G CD1   1 
ATOM 6376  N N     . TYR G  1 70  ? -61.321 -43.262 17.042  1.00 0.00 ? 76  TYR G N     1 
ATOM 6377  C CA    . TYR G  1 70  ? -61.144 -44.129 15.906  1.00 0.00 ? 76  TYR G CA    1 
ATOM 6378  C C     . TYR G  1 70  ? -59.835 -43.864 15.197  1.00 0.00 ? 76  TYR G C     1 
ATOM 6379  O O     . TYR G  1 70  ? -59.215 -44.787 14.674  1.00 0.00 ? 76  TYR G O     1 
ATOM 6380  C CB    . TYR G  1 70  ? -62.306 -43.971 14.970  1.00 0.00 ? 76  TYR G CB    1 
ATOM 6381  C CG    . TYR G  1 70  ? -63.584 -44.464 15.575  1.00 0.00 ? 76  TYR G CG    1 
ATOM 6382  C CD1   . TYR G  1 70  ? -64.604 -43.579 15.844  1.00 0.00 ? 76  TYR G CD1   1 
ATOM 6383  C CD2   . TYR G  1 70  ? -63.719 -45.795 15.899  1.00 0.00 ? 76  TYR G CD2   1 
ATOM 6384  C CE1   . TYR G  1 70  ? -65.761 -44.025 16.435  1.00 0.00 ? 76  TYR G CE1   1 
ATOM 6385  C CE2   . TYR G  1 70  ? -64.874 -46.247 16.493  1.00 0.00 ? 76  TYR G CE2   1 
ATOM 6386  C CZ    . TYR G  1 70  ? -65.891 -45.363 16.765  1.00 0.00 ? 76  TYR G CZ    1 
ATOM 6387  O OH    . TYR G  1 70  ? -67.039 -45.801 17.372  1.00 0.00 ? 76  TYR G OH    1 
ATOM 6388  N N     . GLN G  1 71  ? -59.388 -42.615 15.217  1.00 0.00 ? 77  GLN G N     1 
ATOM 6389  C CA    . GLN G  1 71  ? -58.119 -42.272 14.624  1.00 0.00 ? 77  GLN G CA    1 
ATOM 6390  C C     . GLN G  1 71  ? -56.998 -42.972 15.344  1.00 0.00 ? 77  GLN G C     1 
ATOM 6391  O O     . GLN G  1 71  ? -56.100 -43.513 14.711  1.00 0.00 ? 77  GLN G O     1 
ATOM 6392  C CB    . GLN G  1 71  ? -57.907 -40.767 14.662  1.00 0.00 ? 77  GLN G CB    1 
ATOM 6393  C CG    . GLN G  1 71  ? -58.791 -39.991 13.708  1.00 0.00 ? 77  GLN G CG    1 
ATOM 6394  C CD    . GLN G  1 71  ? -58.367 -40.169 12.284  1.00 0.00 ? 77  GLN G CD    1 
ATOM 6395  O OE1   . GLN G  1 71  ? -57.594 -41.075 11.977  1.00 0.00 ? 77  GLN G OE1   1 
ATOM 6396  N NE2   . GLN G  1 71  ? -58.842 -39.297 11.402  1.00 0.00 ? 77  GLN G NE2   1 
ATOM 6397  N N     . GLY G  1 72  ? -57.077 -43.008 16.672  1.00 0.00 ? 78  GLY G N     1 
ATOM 6398  C CA    . GLY G  1 72  ? -56.074 -43.691 17.477  1.00 0.00 ? 78  GLY G CA    1 
ATOM 6399  C C     . GLY G  1 72  ? -56.021 -45.159 17.124  1.00 0.00 ? 78  GLY G C     1 
ATOM 6400  O O     . GLY G  1 72  ? -54.942 -45.723 16.936  1.00 0.00 ? 78  GLY G O     1 
ATOM 6401  N N     . PHE G  1 73  ? -57.188 -45.767 17.009  1.00 0.00 ? 79  PHE G N     1 
ATOM 6402  C CA    . PHE G  1 73  ? -57.288 -47.149 16.616  1.00 0.00 ? 79  PHE G CA    1 
ATOM 6403  C C     . PHE G  1 73  ? -56.621 -47.393 15.277  1.00 0.00 ? 79  PHE G C     1 
ATOM 6404  O O     . PHE G  1 73  ? -55.816 -48.313 15.142  1.00 0.00 ? 79  PHE G O     1 
ATOM 6405  C CB    . PHE G  1 73  ? -58.742 -47.554 16.556  1.00 0.00 ? 79  PHE G CB    1 
ATOM 6406  C CG    . PHE G  1 73  ? -58.978 -48.893 15.959  1.00 0.00 ? 79  PHE G CG    1 
ATOM 6407  C CD1   . PHE G  1 73  ? -58.813 -50.049 16.694  1.00 0.00 ? 79  PHE G CD1   1 
ATOM 6408  C CD2   . PHE G  1 73  ? -59.396 -48.995 14.653  1.00 0.00 ? 79  PHE G CD2   1 
ATOM 6409  C CE1   . PHE G  1 73  ? -59.066 -51.281 16.127  1.00 0.00 ? 79  PHE G CE1   1 
ATOM 6410  C CE2   . PHE G  1 73  ? -59.645 -50.214 14.082  1.00 0.00 ? 79  PHE G CE2   1 
ATOM 6411  C CZ    . PHE G  1 73  ? -59.481 -51.362 14.820  1.00 0.00 ? 79  PHE G CZ    1 
ATOM 6412  N N     . GLY G  1 74  ? -56.962 -46.577 14.286  1.00 0.00 ? 80  GLY G N     1 
ATOM 6413  C CA    . GLY G  1 74  ? -56.403 -46.713 12.951  1.00 0.00 ? 80  GLY G CA    1 
ATOM 6414  C C     . GLY G  1 74  ? -54.892 -46.586 12.960  1.00 0.00 ? 80  GLY G C     1 
ATOM 6415  O O     . GLY G  1 74  ? -54.191 -47.386 12.344  1.00 0.00 ? 80  GLY G O     1 
ATOM 6416  N N     . LEU G  1 75  ? -54.396 -45.605 13.679  1.00 0.00 ? 81  LEU G N     1 
ATOM 6417  C CA    . LEU G  1 75  ? -52.974 -45.380 13.767  1.00 0.00 ? 81  LEU G CA    1 
ATOM 6418  C C     . LEU G  1 75  ? -52.260 -46.574 14.361  1.00 0.00 ? 81  LEU G C     1 
ATOM 6419  O O     . LEU G  1 75  ? -51.183 -46.949 13.901  1.00 0.00 ? 81  LEU G O     1 
ATOM 6420  C CB    . LEU G  1 75  ? -52.714 -44.148 14.601  1.00 0.00 ? 81  LEU G CB    1 
ATOM 6421  C CG    . LEU G  1 75  ? -53.106 -42.834 13.948  1.00 0.00 ? 81  LEU G CG    1 
ATOM 6422  C CD1   . LEU G  1 75  ? -53.013 -41.718 14.969  1.00 0.00 ? 81  LEU G CD1   1 
ATOM 6423  C CD2   . LEU G  1 75  ? -52.182 -42.582 12.775  1.00 0.00 ? 81  LEU G CD2   1 
ATOM 6424  N N     . LYS G  1 76  ? -52.879 -47.193 15.351  1.00 0.00 ? 82  LYS G N     1 
ATOM 6425  C CA    . LYS G  1 76  ? -52.324 -48.377 15.967  1.00 0.00 ? 82  LYS G CA    1 
ATOM 6426  C C     . LYS G  1 76  ? -52.233 -49.522 14.994  1.00 0.00 ? 82  LYS G C     1 
ATOM 6427  O O     . LYS G  1 76  ? -51.235 -50.239 14.968  1.00 0.00 ? 82  LYS G O     1 
ATOM 6428  C CB    . LYS G  1 76  ? -53.149 -48.777 17.159  1.00 0.00 ? 82  LYS G CB    1 
ATOM 6429  C CG    . LYS G  1 76  ? -52.705 -50.057 17.819  1.00 0.00 ? 82  LYS G CG    1 
ATOM 6430  C CD    . LYS G  1 76  ? -51.343 -49.932 18.400  1.00 0.00 ? 82  LYS G CD    1 
ATOM 6431  C CE    . LYS G  1 76  ? -50.984 -51.145 19.224  1.00 0.00 ? 82  LYS G CE    1 
ATOM 6432  N NZ    . LYS G  1 76  ? -51.746 -51.171 20.497  1.00 0.00 ? 82  LYS G NZ    1 
ATOM 6433  N N     . VAL G  1 77  ? -53.264 -49.683 14.171  1.00 0.00 ? 83  VAL G N     1 
ATOM 6434  C CA    . VAL G  1 77  ? -53.253 -50.730 13.164  1.00 0.00 ? 83  VAL G CA    1 
ATOM 6435  C C     . VAL G  1 77  ? -52.073 -50.553 12.238  1.00 0.00 ? 83  VAL G C     1 
ATOM 6436  O O     . VAL G  1 77  ? -51.346 -51.504 11.950  1.00 0.00 ? 83  VAL G O     1 
ATOM 6437  C CB    . VAL G  1 77  ? -54.555 -50.714 12.338  1.00 0.00 ? 83  VAL G CB    1 
ATOM 6438  C CG1   . VAL G  1 77  ? -54.437 -51.659 11.162  1.00 0.00 ? 83  VAL G CG1   1 
ATOM 6439  C CG2   . VAL G  1 77  ? -55.732 -51.106 13.213  1.00 0.00 ? 83  VAL G CG2   1 
ATOM 6440  N N     . ALA G  1 78  ? -51.880 -49.323 11.779  1.00 0.00 ? 84  ALA G N     1 
ATOM 6441  C CA    . ALA G  1 78  ? -50.791 -48.997 10.884  1.00 0.00 ? 84  ALA G CA    1 
ATOM 6442  C C     . ALA G  1 78  ? -49.438 -49.217 11.545  1.00 0.00 ? 84  ALA G C     1 
ATOM 6443  O O     . ALA G  1 78  ? -48.504 -49.687 10.900  1.00 0.00 ? 84  ALA G O     1 
ATOM 6444  C CB    . ALA G  1 78  ? -50.923 -47.568 10.417  1.00 0.00 ? 84  ALA G CB    1 
ATOM 6445  N N     . ARG G  1 79  ? -49.334 -48.883 12.826  1.00 0.00 ? 85  ARG G N     1 
ATOM 6446  C CA    . ARG G  1 79  ? -48.092 -49.074 13.557  1.00 0.00 ? 85  ARG G CA    1 
ATOM 6447  C C     . ARG G  1 79  ? -47.660 -50.507 13.537  1.00 0.00 ? 85  ARG G C     1 
ATOM 6448  O O     . ARG G  1 79  ? -46.513 -50.816 13.209  1.00 0.00 ? 85  ARG G O     1 
ATOM 6449  C CB    . ARG G  1 79  ? -48.241 -48.638 14.985  1.00 0.00 ? 85  ARG G CB    1 
ATOM 6450  C CG    . ARG G  1 79  ? -46.994 -48.804 15.836  1.00 0.00 ? 85  ARG G CG    1 
ATOM 6451  C CD    . ARG G  1 79  ? -47.216 -48.288 17.202  1.00 0.00 ? 85  ARG G CD    1 
ATOM 6452  N NE    . ARG G  1 79  ? -45.986 -48.078 17.938  1.00 0.00 ? 85  ARG G NE    1 
ATOM 6453  C CZ    . ARG G  1 79  ? -45.349 -49.014 18.666  1.00 0.00 ? 85  ARG G CZ    1 
ATOM 6454  N NH1   . ARG G  1 79  ? -45.827 -50.236 18.721  1.00 0.00 ? 85  ARG G NH1   1 
ATOM 6455  N NH2   . ARG G  1 79  ? -44.244 -48.696 19.324  1.00 0.00 ? 85  ARG G NH2   1 
ATOM 6456  N N     . ALA G  1 80  ? -48.581 -51.388 13.885  1.00 0.00 ? 86  ALA G N     1 
ATOM 6457  C CA    . ALA G  1 80  ? -48.308 -52.803 13.895  1.00 0.00 ? 86  ALA G CA    1 
ATOM 6458  C C     . ALA G  1 80  ? -47.923 -53.274 12.518  1.00 0.00 ? 86  ALA G C     1 
ATOM 6459  O O     . ALA G  1 80  ? -46.990 -54.055 12.358  1.00 0.00 ? 86  ALA G O     1 
ATOM 6460  C CB    . ALA G  1 80  ? -49.514 -53.557 14.389  1.00 0.00 ? 86  ALA G CB    1 
ATOM 6461  N N     . LEU G  1 81  ? -48.613 -52.771 11.514  1.00 0.00 ? 87  LEU G N     1 
ATOM 6462  C CA    . LEU G  1 81  ? -48.302 -53.128 10.163  1.00 0.00 ? 87  LEU G CA    1 
ATOM 6463  C C     . LEU G  1 81  ? -46.856 -52.813 9.850   1.00 0.00 ? 87  LEU G C     1 
ATOM 6464  O O     . LEU G  1 81  ? -46.137 -53.655 9.330   1.00 0.00 ? 87  LEU G O     1 
ATOM 6465  C CB    . LEU G  1 81  ? -49.222 -52.403 9.202   1.00 0.00 ? 87  LEU G CB    1 
ATOM 6466  C CG    . LEU G  1 81  ? -48.982 -52.687 7.733   1.00 0.00 ? 87  LEU G CG    1 
ATOM 6467  C CD1   . LEU G  1 81  ? -49.201 -54.164 7.471   1.00 0.00 ? 87  LEU G CD1   1 
ATOM 6468  C CD2   . LEU G  1 81  ? -49.925 -51.837 6.901   1.00 0.00 ? 87  LEU G CD2   1 
ATOM 6469  N N     . ASN G  1 82  ? -46.409 -51.620 10.203  1.00 0.00 ? 88  ASN G N     1 
ATOM 6470  C CA    . ASN G  1 82  ? -45.024 -51.242 9.935   1.00 0.00 ? 88  ASN G CA    1 
ATOM 6471  C C     . ASN G  1 82  ? -44.003 -52.082 10.702  1.00 0.00 ? 88  ASN G C     1 
ATOM 6472  O O     . ASN G  1 82  ? -42.950 -52.419 10.165  1.00 0.00 ? 88  ASN G O     1 
ATOM 6473  C CB    . ASN G  1 82  ? -44.796 -49.781 10.235  1.00 0.00 ? 88  ASN G CB    1 
ATOM 6474  C CG    . ASN G  1 82  ? -45.373 -48.888 9.195   1.00 0.00 ? 88  ASN G CG    1 
ATOM 6475  O OD1   . ASN G  1 82  ? -45.793 -49.341 8.129   1.00 0.00 ? 88  ASN G OD1   1 
ATOM 6476  N ND2   . ASN G  1 82  ? -45.375 -47.617 9.466   1.00 0.00 ? 88  ASN G ND2   1 
ATOM 6477  N N     . ARG G  1 83  ? -44.302 -52.412 11.952  1.00 0.00 ? 89  ARG G N     1 
ATOM 6478  C CA    . ARG G  1 83  ? -43.330 -53.114 12.788  1.00 0.00 ? 89  ARG G CA    1 
ATOM 6479  C C     . ARG G  1 83  ? -43.462 -54.641 12.720  1.00 0.00 ? 89  ARG G C     1 
ATOM 6480  O O     . ARG G  1 83  ? -42.560 -55.357 13.144  1.00 0.00 ? 89  ARG G O     1 
ATOM 6481  C CB    . ARG G  1 83  ? -43.462 -52.652 14.232  1.00 0.00 ? 89  ARG G CB    1 
ATOM 6482  C CG    . ARG G  1 83  ? -43.047 -51.196 14.476  1.00 0.00 ? 89  ARG G CG    1 
ATOM 6483  C CD    . ARG G  1 83  ? -43.288 -50.777 15.885  1.00 0.00 ? 89  ARG G CD    1 
ATOM 6484  N NE    . ARG G  1 83  ? -43.008 -49.354 16.104  1.00 0.00 ? 89  ARG G NE    1 
ATOM 6485  C CZ    . ARG G  1 83  ? -41.829 -48.844 16.507  1.00 0.00 ? 89  ARG G CZ    1 
ATOM 6486  N NH1   . ARG G  1 83  ? -40.809 -49.633 16.744  1.00 0.00 ? 89  ARG G NH1   1 
ATOM 6487  N NH2   . ARG G  1 83  ? -41.704 -47.545 16.675  1.00 0.00 ? 89  ARG G NH2   1 
ATOM 6488  N N     . ILE G  1 84  ? -44.570 -55.128 12.177  1.00 0.00 ? 90  ILE G N     1 
ATOM 6489  C CA    . ILE G  1 84  ? -44.797 -56.569 12.041  1.00 0.00 ? 90  ILE G CA    1 
ATOM 6490  C C     . ILE G  1 84  ? -44.915 -56.998 10.592  1.00 0.00 ? 90  ILE G C     1 
ATOM 6491  O O     . ILE G  1 84  ? -44.340 -58.008 10.177  1.00 0.00 ? 90  ILE G O     1 
ATOM 6492  C CB    . ILE G  1 84  ? -46.078 -57.008 12.771  1.00 0.00 ? 90  ILE G CB    1 
ATOM 6493  C CG1   . ILE G  1 84  ? -45.955 -56.791 14.271  1.00 0.00 ? 90  ILE G CG1   1 
ATOM 6494  C CG2   . ILE G  1 84  ? -46.383 -58.446 12.467  1.00 0.00 ? 90  ILE G CG2   1 
ATOM 6495  C CD1   . ILE G  1 84  ? -47.244 -57.039 15.016  1.00 0.00 ? 90  ILE G CD1   1 
ATOM 6496  N N     . GLY G  1 85  ? -45.713 -56.270 9.839   1.00 0.00 ? 91  GLY G N     1 
ATOM 6497  C CA    . GLY G  1 85  ? -45.988 -56.632 8.458   1.00 0.00 ? 91  GLY G CA    1 
ATOM 6498  C C     . GLY G  1 85  ? -47.305 -57.371 8.386   1.00 0.00 ? 91  GLY G C     1 
ATOM 6499  O O     . GLY G  1 85  ? -47.805 -57.844 9.400   1.00 0.00 ? 91  GLY G O     1 
ATOM 6500  N N     . SER G  1 86  ? -47.876 -57.458 7.193   1.00 0.00 ? 92  SER G N     1 
ATOM 6501  C CA    . SER G  1 86  ? -49.170 -58.103 7.030   1.00 0.00 ? 92  SER G CA    1 
ATOM 6502  C C     . SER G  1 86  ? -49.070 -59.599 7.210   1.00 0.00 ? 92  SER G C     1 
ATOM 6503  O O     . SER G  1 86  ? -47.985 -60.171 7.112   1.00 0.00 ? 92  SER G O     1 
ATOM 6504  C CB    . SER G  1 86  ? -49.735 -57.808 5.667   1.00 0.00 ? 92  SER G CB    1 
ATOM 6505  O OG    . SER G  1 86  ? -48.989 -58.449 4.674   1.00 0.00 ? 92  SER G OG    1 
ATOM 6506  N N     . GLY G  1 87  ? -50.210 -60.238 7.438   1.00 0.00 ? 93  GLY G N     1 
ATOM 6507  C CA    . GLY G  1 87  ? -50.251 -61.675 7.625   1.00 0.00 ? 93  GLY G CA    1 
ATOM 6508  C C     . GLY G  1 87  ? -50.669 -62.033 9.045   1.00 0.00 ? 93  GLY G C     1 
ATOM 6509  O O     . GLY G  1 87  ? -51.012 -61.156 9.832   1.00 0.00 ? 93  GLY G O     1 
ATOM 6510  N N     . PRO G  1 88  ? -50.659 -63.328 9.344   1.00 0.00 ? 94  PRO G N     1 
ATOM 6511  C CA    . PRO G  1 88  ? -51.019 -63.973 10.623  1.00 0.00 ? 94  PRO G CA    1 
ATOM 6512  C C     . PRO G  1 88  ? -50.830 -63.074 11.840  1.00 0.00 ? 94  PRO G C     1 
ATOM 6513  O O     . PRO G  1 88  ? -51.780 -62.805 12.568  1.00 0.00 ? 94  PRO G O     1 
ATOM 6514  C CB    . PRO G  1 88  ? -50.066 -65.166 10.694  1.00 0.00 ? 94  PRO G CB    1 
ATOM 6515  C CG    . PRO G  1 88  ? -49.768 -65.467 9.286   1.00 0.00 ? 94  PRO G CG    1 
ATOM 6516  C CD    . PRO G  1 88  ? -49.625 -64.123 8.665   1.00 0.00 ? 94  PRO G CD    1 
ATOM 6517  N N     . ALA G  1 89  ? -49.598 -62.651 12.085  1.00 0.00 ? 95  ALA G N     1 
ATOM 6518  C CA    . ALA G  1 89  ? -49.295 -61.862 13.269  1.00 0.00 ? 95  ALA G CA    1 
ATOM 6519  C C     . ALA G  1 89  ? -50.115 -60.587 13.332  1.00 0.00 ? 95  ALA G C     1 
ATOM 6520  O O     . ALA G  1 89  ? -50.544 -60.180 14.411  1.00 0.00 ? 95  ALA G O     1 
ATOM 6521  C CB    . ALA G  1 89  ? -47.824 -61.546 13.308  1.00 0.00 ? 95  ALA G CB    1 
ATOM 6522  N N     . LEU G  1 90  ? -50.339 -59.955 12.186  1.00 0.00 ? 96  LEU G N     1 
ATOM 6523  C CA    . LEU G  1 90  ? -51.127 -58.742 12.151  1.00 0.00 ? 96  LEU G CA    1 
ATOM 6524  C C     . LEU G  1 90  ? -52.539 -59.051 12.525  1.00 0.00 ? 96  LEU G C     1 
ATOM 6525  O O     . LEU G  1 90  ? -53.171 -58.302 13.264  1.00 0.00 ? 96  LEU G O     1 
ATOM 6526  C CB    . LEU G  1 90  ? -51.107 -58.098 10.784  1.00 0.00 ? 96  LEU G CB    1 
ATOM 6527  C CG    . LEU G  1 90  ? -51.868 -56.777 10.698  1.00 0.00 ? 96  LEU G CG    1 
ATOM 6528  C CD1   . LEU G  1 90  ? -51.241 -55.777 11.658  1.00 0.00 ? 96  LEU G CD1   1 
ATOM 6529  C CD2   . LEU G  1 90  ? -51.837 -56.262 9.278   1.00 0.00 ? 96  LEU G CD2   1 
ATOM 6530  N N     . VAL G  1 91  ? -53.045 -60.157 12.006  1.00 0.00 ? 97  VAL G N     1 
ATOM 6531  C CA    . VAL G  1 91  ? -54.390 -60.592 12.324  1.00 0.00 ? 97  VAL G CA    1 
ATOM 6532  C C     . VAL G  1 91  ? -54.555 -60.765 13.815  1.00 0.00 ? 97  VAL G C     1 
ATOM 6533  O O     . VAL G  1 91  ? -55.534 -60.294 14.400  1.00 0.00 ? 97  VAL G O     1 
ATOM 6534  C CB    . VAL G  1 91  ? -54.710 -61.915 11.617  1.00 0.00 ? 97  VAL G CB    1 
ATOM 6535  C CG1   . VAL G  1 91  ? -56.018 -62.478 12.131  1.00 0.00 ? 97  VAL G CG1   1 
ATOM 6536  C CG2   . VAL G  1 91  ? -54.766 -61.688 10.119  1.00 0.00 ? 97  VAL G CG2   1 
ATOM 6537  N N     . ASN G  1 92  ? -53.580 -61.420 14.438  1.00 0.00 ? 98  ASN G N     1 
ATOM 6538  C CA    . ASN G  1 92  ? -53.602 -61.635 15.868  1.00 0.00 ? 98  ASN G CA    1 
ATOM 6539  C C     . ASN G  1 92  ? -53.641 -60.312 16.599  1.00 0.00 ? 98  ASN G C     1 
ATOM 6540  O O     . ASN G  1 92  ? -54.415 -60.134 17.545  1.00 0.00 ? 98  ASN G O     1 
ATOM 6541  C CB    . ASN G  1 92  ? -52.397 -62.446 16.290  1.00 0.00 ? 98  ASN G CB    1 
ATOM 6542  C CG    . ASN G  1 92  ? -52.509 -63.862 15.844  1.00 0.00 ? 98  ASN G CG    1 
ATOM 6543  O OD1   . ASN G  1 92  ? -53.608 -64.308 15.498  1.00 0.00 ? 98  ASN G OD1   1 
ATOM 6544  N ND2   . ASN G  1 92  ? -51.416 -64.589 15.839  1.00 0.00 ? 98  ASN G ND2   1 
ATOM 6545  N N     . MET G  1 93  ? -52.844 -59.368 16.122  1.00 0.00 ? 99  MET G N     1 
ATOM 6546  C CA    . MET G  1 93  ? -52.785 -58.056 16.702  1.00 0.00 ? 99  MET G CA    1 
ATOM 6547  C C     . MET G  1 93  ? -54.097 -57.332 16.634  1.00 0.00 ? 99  MET G C     1 
ATOM 6548  O O     . MET G  1 93  ? -54.567 -56.799 17.639  1.00 0.00 ? 99  MET G O     1 
ATOM 6549  C CB    . MET G  1 93  ? -51.729 -57.233 16.013  1.00 0.00 ? 99  MET G CB    1 
ATOM 6550  C CG    . MET G  1 93  ? -51.630 -55.833 16.541  1.00 0.00 ? 99  MET G CG    1 
ATOM 6551  S SD    . MET G  1 93  ? -51.058 -55.786 18.223  1.00 0.00 ? 99  MET G SD    1 
ATOM 6552  C CE    . MET G  1 93  ? -49.312 -56.060 17.956  1.00 0.00 ? 99  MET G CE    1 
ATOM 6553  N N     . ILE G  1 94  ? -54.686 -57.285 15.445  1.00 0.00 ? 100 ILE G N     1 
ATOM 6554  C CA    . ILE G  1 94  ? -55.895 -56.524 15.241  1.00 0.00 ? 100 ILE G CA    1 
ATOM 6555  C C     . ILE G  1 94  ? -57.026 -57.047 16.068  1.00 0.00 ? 100 ILE G C     1 
ATOM 6556  O O     . ILE G  1 94  ? -57.806 -56.270 16.608  1.00 0.00 ? 100 ILE G O     1 
ATOM 6557  C CB    . ILE G  1 94  ? -56.307 -56.495 13.781  1.00 0.00 ? 100 ILE G CB    1 
ATOM 6558  C CG1   . ILE G  1 94  ? -55.284 -55.711 12.966  1.00 0.00 ? 100 ILE G CG1   1 
ATOM 6559  C CG2   . ILE G  1 94  ? -57.672 -55.839 13.661  1.00 0.00 ? 100 ILE G CG2   1 
ATOM 6560  C CD1   . ILE G  1 94  ? -55.465 -55.852 11.477  1.00 0.00 ? 100 ILE G CD1   1 
ATOM 6561  N N     . ASN G  1 95  ? -57.136 -58.367 16.169  1.00 0.00 ? 101 ASN G N     1 
ATOM 6562  C CA    . ASN G  1 95  ? -58.182 -58.963 16.983  1.00 0.00 ? 101 ASN G CA    1 
ATOM 6563  C C     . ASN G  1 95  ? -58.120 -58.454 18.407  1.00 0.00 ? 101 ASN G C     1 
ATOM 6564  O O     . ASN G  1 95  ? -59.137 -58.037 18.970  1.00 0.00 ? 101 ASN G O     1 
ATOM 6565  C CB    . ASN G  1 95  ? -58.072 -60.466 16.975  1.00 0.00 ? 101 ASN G CB    1 
ATOM 6566  C CG    . ASN G  1 95  ? -58.540 -61.071 15.703  1.00 0.00 ? 101 ASN G CG    1 
ATOM 6567  O OD1   . ASN G  1 95  ? -59.327 -60.465 14.969  1.00 0.00 ? 101 ASN G OD1   1 
ATOM 6568  N ND2   . ASN G  1 95  ? -58.077 -62.258 15.421  1.00 0.00 ? 101 ASN G ND2   1 
ATOM 6569  N N     . GLY G  1 96  ? -56.919 -58.463 18.985  1.00 0.00 ? 102 GLY G N     1 
ATOM 6570  C CA    . GLY G  1 96  ? -56.745 -57.990 20.342  1.00 0.00 ? 102 GLY G CA    1 
ATOM 6571  C C     . GLY G  1 96  ? -56.994 -56.509 20.436  1.00 0.00 ? 102 GLY G C     1 
ATOM 6572  O O     . GLY G  1 96  ? -57.630 -56.041 21.380  1.00 0.00 ? 102 GLY G O     1 
ATOM 6573  N N     . LEU G  1 97  ? -56.505 -55.772 19.448  1.00 0.00 ? 103 LEU G N     1 
ATOM 6574  C CA    . LEU G  1 97  ? -56.670 -54.340 19.403  1.00 0.00 ? 103 LEU G CA    1 
ATOM 6575  C C     . LEU G  1 97  ? -58.117 -53.930 19.397  1.00 0.00 ? 103 LEU G C     1 
ATOM 6576  O O     . LEU G  1 97  ? -58.506 -52.994 20.090  1.00 0.00 ? 103 LEU G O     1 
ATOM 6577  C CB    . LEU G  1 97  ? -55.999 -53.778 18.188  1.00 0.00 ? 103 LEU G CB    1 
ATOM 6578  C CG    . LEU G  1 97  ? -56.160 -52.294 18.037  1.00 0.00 ? 103 LEU G CG    1 
ATOM 6579  C CD1   . LEU G  1 97  ? -55.574 -51.622 19.254  1.00 0.00 ? 103 LEU G CD1   1 
ATOM 6580  C CD2   . LEU G  1 97  ? -55.483 -51.848 16.762  1.00 0.00 ? 103 LEU G CD2   1 
ATOM 6581  N N     . LYS G  1 98  ? -58.911 -54.591 18.580  1.00 0.00 ? 104 LYS G N     1 
ATOM 6582  C CA    . LYS G  1 98  ? -60.315 -54.312 18.547  1.00 0.00 ? 104 LYS G CA    1 
ATOM 6583  C C     . LYS G  1 98  ? -60.934 -54.553 19.897  1.00 0.00 ? 104 LYS G C     1 
ATOM 6584  O O     . LYS G  1 98  ? -61.683 -53.722 20.392  1.00 0.00 ? 104 LYS G O     1 
ATOM 6585  C CB    . LYS G  1 98  ? -61.003 -55.147 17.497  1.00 0.00 ? 104 LYS G CB    1 
ATOM 6586  C CG    . LYS G  1 98  ? -60.791 -54.666 16.077  1.00 0.00 ? 104 LYS G CG    1 
ATOM 6587  C CD    . LYS G  1 98  ? -61.398 -55.636 15.086  1.00 0.00 ? 104 LYS G CD    1 
ATOM 6588  C CE    . LYS G  1 98  ? -62.859 -55.889 15.412  1.00 0.00 ? 104 LYS G CE    1 
ATOM 6589  N NZ    . LYS G  1 98  ? -63.515 -56.736 14.390  1.00 0.00 ? 104 LYS G NZ    1 
ATOM 6590  N N     . GLY G  1 99  ? -60.578 -55.667 20.528  1.00 0.00 ? 105 GLY G N     1 
ATOM 6591  C CA    . GLY G  1 99  ? -61.086 -55.961 21.859  1.00 0.00 ? 105 GLY G CA    1 
ATOM 6592  C C     . GLY G  1 99  ? -60.753 -54.830 22.818  1.00 0.00 ? 105 GLY G C     1 
ATOM 6593  O O     . GLY G  1 99  ? -61.594 -54.404 23.612  1.00 0.00 ? 105 GLY G O     1 
ATOM 6594  N N     . TYR G  1 100 ? -59.528 -54.329 22.716  1.00 0.00 ? 106 TYR G N     1 
ATOM 6595  C CA    . TYR G  1 100 ? -59.065 -53.232 23.538  1.00 0.00 ? 106 TYR G CA    1 
ATOM 6596  C C     . TYR G  1 100 ? -59.968 -52.033 23.407  1.00 0.00 ? 106 TYR G C     1 
ATOM 6597  O O     . TYR G  1 100 ? -60.515 -51.564 24.390  1.00 0.00 ? 106 TYR G O     1 
ATOM 6598  C CB    . TYR G  1 100 ? -57.635 -52.868 23.138  1.00 0.00 ? 106 TYR G CB    1 
ATOM 6599  C CG    . TYR G  1 100 ? -57.003 -51.739 23.893  1.00 0.00 ? 106 TYR G CG    1 
ATOM 6600  C CD1   . TYR G  1 100 ? -56.798 -51.825 25.257  1.00 0.00 ? 106 TYR G CD1   1 
ATOM 6601  C CD2   . TYR G  1 100 ? -56.554 -50.640 23.196  1.00 0.00 ? 106 TYR G CD2   1 
ATOM 6602  C CE1   . TYR G  1 100 ? -56.168 -50.786 25.922  1.00 0.00 ? 106 TYR G CE1   1 
ATOM 6603  C CE2   . TYR G  1 100 ? -55.919 -49.613 23.850  1.00 0.00 ? 106 TYR G CE2   1 
ATOM 6604  C CZ    . TYR G  1 100 ? -55.725 -49.678 25.208  1.00 0.00 ? 106 TYR G CZ    1 
ATOM 6605  O OH    . TYR G  1 100 ? -55.091 -48.639 25.858  1.00 0.00 ? 106 TYR G OH    1 
ATOM 6606  N N     . TYR G  1 101 ? -60.160 -51.554 22.194  1.00 0.00 ? 107 TYR G N     1 
ATOM 6607  C CA    . TYR G  1 101 ? -60.972 -50.364 21.992  1.00 0.00 ? 107 TYR G CA    1 
ATOM 6608  C C     . TYR G  1 101 ? -62.447 -50.563 22.227  1.00 0.00 ? 107 TYR G C     1 
ATOM 6609  O O     . TYR G  1 101 ? -63.102 -49.704 22.819  1.00 0.00 ? 107 TYR G O     1 
ATOM 6610  C CB    . TYR G  1 101 ? -60.748 -49.812 20.607  1.00 0.00 ? 107 TYR G CB    1 
ATOM 6611  C CG    . TYR G  1 101 ? -59.624 -48.841 20.552  1.00 0.00 ? 107 TYR G CG    1 
ATOM 6612  C CD1   . TYR G  1 101 ? -58.335 -49.267 20.325  1.00 0.00 ? 107 TYR G CD1   1 
ATOM 6613  C CD2   . TYR G  1 101 ? -59.894 -47.501 20.733  1.00 0.00 ? 107 TYR G CD2   1 
ATOM 6614  C CE1   . TYR G  1 101 ? -57.310 -48.347 20.286  1.00 0.00 ? 107 TYR G CE1   1 
ATOM 6615  C CE2   . TYR G  1 101 ? -58.876 -46.583 20.693  1.00 0.00 ? 107 TYR G CE2   1 
ATOM 6616  C CZ    . TYR G  1 101 ? -57.590 -47.002 20.473  1.00 0.00 ? 107 TYR G CZ    1 
ATOM 6617  O OH    . TYR G  1 101 ? -56.579 -46.083 20.435  1.00 0.00 ? 107 TYR G OH    1 
ATOM 6618  N N     . ILE G  1 102 ? -62.970 -51.697 21.815  1.00 0.00 ? 108 ILE G N     1 
ATOM 6619  C CA    . ILE G  1 102 ? -64.378 -51.948 21.964  1.00 0.00 ? 108 ILE G CA    1 
ATOM 6620  C C     . ILE G  1 102 ? -64.791 -51.955 23.402  1.00 0.00 ? 108 ILE G C     1 
ATOM 6621  O O     . ILE G  1 102 ? -65.803 -51.368 23.762  1.00 0.00 ? 108 ILE G O     1 
ATOM 6622  C CB    . ILE G  1 102 ? -64.781 -53.281 21.341  1.00 0.00 ? 108 ILE G CB    1 
ATOM 6623  C CG1   . ILE G  1 102 ? -64.643 -53.221 19.833  1.00 0.00 ? 108 ILE G CG1   1 
ATOM 6624  C CG2   . ILE G  1 102 ? -66.208 -53.614 21.726  1.00 0.00 ? 108 ILE G CG2   1 
ATOM 6625  C CD1   . ILE G  1 102 ? -64.737 -54.567 19.155  1.00 0.00 ? 108 ILE G CD1   1 
ATOM 6626  N N     . SER G  1 103 ? -64.042 -52.651 24.229  1.00 0.00 ? 109 SER G N     1 
ATOM 6627  C CA    . SER G  1 103 ? -64.437 -52.803 25.607  1.00 0.00 ? 109 SER G CA    1 
ATOM 6628  C C     . SER G  1 103 ? -63.812 -51.794 26.560  1.00 0.00 ? 109 SER G C     1 
ATOM 6629  O O     . SER G  1 103 ? -64.404 -51.478 27.588  1.00 0.00 ? 109 SER G O     1 
ATOM 6630  C CB    . SER G  1 103 ? -64.116 -54.194 26.054  1.00 0.00 ? 109 SER G CB    1 
ATOM 6631  O OG    . SER G  1 103 ? -62.747 -54.428 25.983  1.00 0.00 ? 109 SER G OG    1 
ATOM 6632  N N     . ALA G  1 104 ? -62.630 -51.274 26.238  1.00 0.00 ? 110 ALA G N     1 
ATOM 6633  C CA    . ALA G  1 104 ? -62.009 -50.311 27.143  1.00 0.00 ? 110 ALA G CA    1 
ATOM 6634  C C     . ALA G  1 104 ? -62.525 -48.928 26.913  1.00 0.00 ? 110 ALA G C     1 
ATOM 6635  O O     . ALA G  1 104 ? -62.662 -48.169 27.864  1.00 0.00 ? 110 ALA G O     1 
ATOM 6636  C CB    . ALA G  1 104 ? -60.490 -50.301 27.012  1.00 0.00 ? 110 ALA G CB    1 
ATOM 6637  N N     . PHE G  1 105 ? -62.803 -48.580 25.651  1.00 0.00 ? 111 PHE G N     1 
ATOM 6638  C CA    . PHE G  1 105 ? -63.233 -47.230 25.323  1.00 0.00 ? 111 PHE G CA    1 
ATOM 6639  C C     . PHE G  1 105 ? -64.617 -47.186 24.738  1.00 0.00 ? 111 PHE G C     1 
ATOM 6640  O O     . PHE G  1 105 ? -65.081 -46.126 24.324  1.00 0.00 ? 111 PHE G O     1 
ATOM 6641  C CB    . PHE G  1 105 ? -62.268 -46.602 24.345  1.00 0.00 ? 111 PHE G CB    1 
ATOM 6642  C CG    . PHE G  1 105 ? -60.887 -46.519 24.878  1.00 0.00 ? 111 PHE G CG    1 
ATOM 6643  C CD1   . PHE G  1 105 ? -59.877 -47.271 24.328  1.00 0.00 ? 111 PHE G CD1   1 
ATOM 6644  C CD2   . PHE G  1 105 ? -60.602 -45.708 25.953  1.00 0.00 ? 111 PHE G CD2   1 
ATOM 6645  C CE1   . PHE G  1 105 ? -58.604 -47.209 24.826  1.00 0.00 ? 111 PHE G CE1   1 
ATOM 6646  C CE2   . PHE G  1 105 ? -59.328 -45.642 26.459  1.00 0.00 ? 111 PHE G CE2   1 
ATOM 6647  C CZ    . PHE G  1 105 ? -58.325 -46.394 25.894  1.00 0.00 ? 111 PHE G CZ    1 
ATOM 6648  N N     . ASN G  1 106 ? -65.278 -48.333 24.692  1.00 0.00 ? 112 ASN G N     1 
ATOM 6649  C CA    . ASN G  1 106 ? -66.629 -48.418 24.159  1.00 0.00 ? 112 ASN G CA    1 
ATOM 6650  C C     . ASN G  1 106 ? -66.694 -47.980 22.709  1.00 0.00 ? 112 ASN G C     1 
ATOM 6651  O O     . ASN G  1 106 ? -67.658 -47.339 22.296  1.00 0.00 ? 112 ASN G O     1 
ATOM 6652  C CB    . ASN G  1 106 ? -67.587 -47.613 25.000  1.00 0.00 ? 112 ASN G CB    1 
ATOM 6653  C CG    . ASN G  1 106 ? -67.678 -48.140 26.395  1.00 0.00 ? 112 ASN G CG    1 
ATOM 6654  O OD1   . ASN G  1 106 ? -67.626 -49.353 26.614  1.00 0.00 ? 112 ASN G OD1   1 
ATOM 6655  N ND2   . ASN G  1 106 ? -67.817 -47.256 27.347  1.00 0.00 ? 112 ASN G ND2   1 
ATOM 6656  N N     . ALA G  1 107 ? -65.673 -48.324 21.935  1.00 0.00 ? 113 ALA G N     1 
ATOM 6657  C CA    . ALA G  1 107 ? -65.667 -47.994 20.522  1.00 0.00 ? 113 ALA G CA    1 
ATOM 6658  C C     . ALA G  1 107 ? -66.632 -48.906 19.784  1.00 0.00 ? 113 ALA G C     1 
ATOM 6659  O O     . ALA G  1 107 ? -66.824 -50.055 20.174  1.00 0.00 ? 113 ALA G O     1 
ATOM 6660  C CB    . ALA G  1 107 ? -64.275 -48.112 19.959  1.00 0.00 ? 113 ALA G CB    1 
ATOM 6661  N N     . ASN G  1 108 ? -67.256 -48.385 18.729  1.00 0.00 ? 114 ASN G N     1 
ATOM 6662  C CA    . ASN G  1 108 ? -68.256 -49.137 17.978  1.00 0.00 ? 114 ASN G CA    1 
ATOM 6663  C C     . ASN G  1 108 ? -67.634 -50.103 16.968  1.00 0.00 ? 114 ASN G C     1 
ATOM 6664  O O     . ASN G  1 108 ? -67.239 -49.679 15.884  1.00 0.00 ? 114 ASN G O     1 
ATOM 6665  C CB    . ASN G  1 108 ? -69.186 -48.206 17.264  1.00 0.00 ? 114 ASN G CB    1 
ATOM 6666  C CG    . ASN G  1 108 ? -70.238 -48.950 16.515  1.00 0.00 ? 114 ASN G CG    1 
ATOM 6667  O OD1   . ASN G  1 108 ? -70.012 -50.082 16.075  1.00 0.00 ? 114 ASN G OD1   1 
ATOM 6668  N ND2   . ASN G  1 108 ? -71.387 -48.345 16.361  1.00 0.00 ? 114 ASN G ND2   1 
ATOM 6669  N N     . PRO G  1 109 ? -67.569 -51.405 17.311  1.00 0.00 ? 115 PRO G N     1 
ATOM 6670  C CA    . PRO G  1 109 ? -67.063 -52.517 16.484  1.00 0.00 ? 115 PRO G CA    1 
ATOM 6671  C C     . PRO G  1 109 ? -67.248 -52.304 14.989  1.00 0.00 ? 115 PRO G C     1 
ATOM 6672  O O     . PRO G  1 109 ? -66.333 -52.557 14.205  1.00 0.00 ? 115 PRO G O     1 
ATOM 6673  C CB    . PRO G  1 109 ? -67.923 -53.705 16.923  1.00 0.00 ? 115 PRO G CB    1 
ATOM 6674  C CG    . PRO G  1 109 ? -68.320 -53.380 18.296  1.00 0.00 ? 115 PRO G CG    1 
ATOM 6675  C CD    . PRO G  1 109 ? -68.600 -51.917 18.241  1.00 0.00 ? 115 PRO G CD    1 
ATOM 6676  N N     . GLN G  1 110 ? -68.441 -51.882 14.592  1.00 0.00 ? 116 GLN G N     1 
ATOM 6677  C CA    . GLN G  1 110 ? -68.759 -51.732 13.188  1.00 0.00 ? 116 GLN G CA    1 
ATOM 6678  C C     . GLN G  1 110 ? -67.912 -50.648 12.539  1.00 0.00 ? 116 GLN G C     1 
ATOM 6679  O O     . GLN G  1 110 ? -67.402 -50.823 11.429  1.00 0.00 ? 116 GLN G O     1 
ATOM 6680  C CB    . GLN G  1 110 ? -70.232 -51.412 13.013  1.00 0.00 ? 116 GLN G CB    1 
ATOM 6681  C CG    . GLN G  1 110 ? -70.700 -51.492 11.586  1.00 0.00 ? 116 GLN G CG    1 
ATOM 6682  C CD    . GLN G  1 110 ? -70.371 -50.244 10.816  1.00 0.00 ? 116 GLN G CD    1 
ATOM 6683  O OE1   . GLN G  1 110 ? -70.406 -49.137 11.357  1.00 0.00 ? 116 GLN G OE1   1 
ATOM 6684  N NE2   . GLN G  1 110 ? -70.035 -50.413 9.542   1.00 0.00 ? 116 GLN G NE2   1 
ATOM 6685  N N     . VAL G  1 111 ? -67.753 -49.537 13.228  1.00 0.00 ? 117 VAL G N     1 
ATOM 6686  C CA    . VAL G  1 111 ? -66.954 -48.462 12.713  1.00 0.00 ? 117 VAL G CA    1 
ATOM 6687  C C     . VAL G  1 111 ? -65.507 -48.863 12.714  1.00 0.00 ? 117 VAL G C     1 
ATOM 6688  O O     . VAL G  1 111 ? -64.766 -48.523 11.801  1.00 0.00 ? 117 VAL G O     1 
ATOM 6689  C CB    . VAL G  1 111 ? -67.144 -47.193 13.531  1.00 0.00 ? 117 VAL G CB    1 
ATOM 6690  C CG1   . VAL G  1 111 ? -66.178 -46.122 13.051  1.00 0.00 ? 117 VAL G CG1   1 
ATOM 6691  C CG2   . VAL G  1 111 ? -68.578 -46.720 13.409  1.00 0.00 ? 117 VAL G CG2   1 
ATOM 6692  N N     . LEU G  1 112 ? -65.106 -49.604 13.739  1.00 0.00 ? 118 LEU G N     1 
ATOM 6693  C CA    . LEU G  1 112 ? -63.734 -50.067 13.842  1.00 0.00 ? 118 LEU G CA    1 
ATOM 6694  C C     . LEU G  1 112 ? -63.372 -50.927 12.658  1.00 0.00 ? 118 LEU G C     1 
ATOM 6695  O O     . LEU G  1 112 ? -62.277 -50.815 12.113  1.00 0.00 ? 118 LEU G O     1 
ATOM 6696  C CB    . LEU G  1 112 ? -63.545 -50.867 15.118  1.00 0.00 ? 118 LEU G CB    1 
ATOM 6697  C CG    . LEU G  1 112 ? -63.637 -50.075 16.404  1.00 0.00 ? 118 LEU G CG    1 
ATOM 6698  C CD1   . LEU G  1 112 ? -63.613 -51.018 17.562  1.00 0.00 ? 118 LEU G CD1   1 
ATOM 6699  C CD2   . LEU G  1 112 ? -62.485 -49.127 16.484  1.00 0.00 ? 118 LEU G CD2   1 
ATOM 6700  N N     . ASP G  1 113 ? -64.309 -51.757 12.232  1.00 0.00 ? 119 ASP G N     1 
ATOM 6701  C CA    . ASP G  1 113 ? -64.102 -52.583 11.071  1.00 0.00 ? 119 ASP G CA    1 
ATOM 6702  C C     . ASP G  1 113 ? -64.011 -51.756 9.822   1.00 0.00 ? 119 ASP G C     1 
ATOM 6703  O O     . ASP G  1 113 ? -63.232 -52.072 8.929   1.00 0.00 ? 119 ASP G O     1 
ATOM 6704  C CB    . ASP G  1 113 ? -65.197 -53.604 10.958  1.00 0.00 ? 119 ASP G CB    1 
ATOM 6705  C CG    . ASP G  1 113 ? -65.024 -54.693 11.982  1.00 0.00 ? 119 ASP G CG    1 
ATOM 6706  O OD1   . ASP G  1 113 ? -63.918 -54.859 12.444  1.00 0.00 ? 119 ASP G OD1   1 
ATOM 6707  O OD2   . ASP G  1 113 ? -65.983 -55.345 12.314  1.00 0.00 ? 119 ASP G OD2   1 
ATOM 6708  N N     . ALA G  1 114 ? -64.771 -50.664 9.770   1.00 0.00 ? 120 ALA G N     1 
ATOM 6709  C CA    . ALA G  1 114 ? -64.679 -49.745 8.650   1.00 0.00 ? 120 ALA G CA    1 
ATOM 6710  C C     . ALA G  1 114 ? -63.284 -49.142 8.562   1.00 0.00 ? 120 ALA G C     1 
ATOM 6711  O O     . ALA G  1 114 ? -62.743 -48.986 7.474   1.00 0.00 ? 120 ALA G O     1 
ATOM 6712  C CB    . ALA G  1 114 ? -65.719 -48.649 8.770   1.00 0.00 ? 120 ALA G CB    1 
ATOM 6713  N N     . VAL G  1 115 ? -62.685 -48.838 9.712   1.00 0.00 ? 121 VAL G N     1 
ATOM 6714  C CA    . VAL G  1 115 ? -61.329 -48.310 9.731   1.00 0.00 ? 121 VAL G CA    1 
ATOM 6715  C C     . VAL G  1 115 ? -60.345 -49.332 9.206   1.00 0.00 ? 121 VAL G C     1 
ATOM 6716  O O     . VAL G  1 115 ? -59.521 -49.018 8.348   1.00 0.00 ? 121 VAL G O     1 
ATOM 6717  C CB    . VAL G  1 115 ? -60.914 -47.898 11.146  1.00 0.00 ? 121 VAL G CB    1 
ATOM 6718  C CG1   . VAL G  1 115 ? -59.442 -47.551 11.163  1.00 0.00 ? 121 VAL G CG1   1 
ATOM 6719  C CG2   . VAL G  1 115 ? -61.745 -46.714 11.609  1.00 0.00 ? 121 VAL G CG2   1 
ATOM 6720  N N     . VAL G  1 116 ? -60.459 -50.565 9.685   1.00 0.00 ? 122 VAL G N     1 
ATOM 6721  C CA    . VAL G  1 116 ? -59.586 -51.643 9.240   1.00 0.00 ? 122 VAL G CA    1 
ATOM 6722  C C     . VAL G  1 116 ? -59.748 -51.870 7.736   1.00 0.00 ? 122 VAL G C     1 
ATOM 6723  O O     . VAL G  1 116 ? -58.767 -52.037 7.006   1.00 0.00 ? 122 VAL G O     1 
ATOM 6724  C CB    . VAL G  1 116 ? -59.900 -52.942 10.005  1.00 0.00 ? 122 VAL G CB    1 
ATOM 6725  C CG1   . VAL G  1 116 ? -59.133 -54.095 9.418   1.00 0.00 ? 122 VAL G CG1   1 
ATOM 6726  C CG2   . VAL G  1 116 ? -59.549 -52.776 11.459  1.00 0.00 ? 122 VAL G CG2   1 
ATOM 6727  N N     . ASN G  1 117 ? -60.994 -51.789 7.266   1.00 0.00 ? 123 ASN G N     1 
ATOM 6728  C CA    . ASN G  1 117 ? -61.320 -51.941 5.854   1.00 0.00 ? 123 ASN G CA    1 
ATOM 6729  C C     . ASN G  1 117 ? -60.600 -50.952 4.944   1.00 0.00 ? 123 ASN G C     1 
ATOM 6730  O O     . ASN G  1 117 ? -60.595 -51.123 3.729   1.00 0.00 ? 123 ASN G O     1 
ATOM 6731  C CB    . ASN G  1 117 ? -62.802 -51.823 5.631   1.00 0.00 ? 123 ASN G CB    1 
ATOM 6732  C CG    . ASN G  1 117 ? -63.176 -52.141 4.213   1.00 0.00 ? 123 ASN G CG    1 
ATOM 6733  O OD1   . ASN G  1 117 ? -63.113 -53.295 3.784   1.00 0.00 ? 123 ASN G OD1   1 
ATOM 6734  N ND2   . ASN G  1 117 ? -63.548 -51.131 3.467   1.00 0.00 ? 123 ASN G ND2   1 
ATOM 6735  N N     . ILE G  1 118 ? -60.034 -49.903 5.511   1.00 0.00 ? 124 ILE G N     1 
ATOM 6736  C CA    . ILE G  1 118 ? -59.302 -48.955 4.731   1.00 0.00 ? 124 ILE G CA    1 
ATOM 6737  C C     . ILE G  1 118 ? -57.836 -49.217 4.802   1.00 0.00 ? 124 ILE G C     1 
ATOM 6738  O O     . ILE G  1 118 ? -57.158 -49.299 3.782   1.00 0.00 ? 124 ILE G O     1 
ATOM 6739  C CB    . ILE G  1 118 ? -59.564 -47.561 5.211   1.00 0.00 ? 124 ILE G CB    1 
ATOM 6740  C CG1   . ILE G  1 118 ? -61.029 -47.260 5.111   1.00 0.00 ? 124 ILE G CG1   1 
ATOM 6741  C CG2   . ILE G  1 118 ? -58.753 -46.575 4.426   1.00 0.00 ? 124 ILE G CG2   1 
ATOM 6742  C CD1   . ILE G  1 118 ? -61.582 -47.407 3.718   1.00 0.00 ? 124 ILE G CD1   1 
ATOM 6743  N N     . ILE G  1 119 ? -57.337 -49.332 6.014   1.00 0.00 ? 125 ILE G N     1 
ATOM 6744  C CA    . ILE G  1 119 ? -55.918 -49.505 6.236   1.00 0.00 ? 125 ILE G CA    1 
ATOM 6745  C C     . ILE G  1 119 ? -55.421 -50.819 5.674   1.00 0.00 ? 125 ILE G C     1 
ATOM 6746  O O     . ILE G  1 119 ? -54.387 -50.865 5.009   1.00 0.00 ? 125 ILE G O     1 
ATOM 6747  C CB    . ILE G  1 119 ? -55.605 -49.429 7.713   1.00 0.00 ? 125 ILE G CB    1 
ATOM 6748  C CG1   . ILE G  1 119 ? -55.880 -48.030 8.216   1.00 0.00 ? 125 ILE G CG1   1 
ATOM 6749  C CG2   . ILE G  1 119 ? -54.158 -49.803 7.957   1.00 0.00 ? 125 ILE G CG2   1 
ATOM 6750  C CD1   . ILE G  1 119 ? -55.880 -47.934 9.704   1.00 0.00 ? 125 ILE G CD1   1 
ATOM 6751  N N     . THR G  1 120 ? -56.150 -51.888 5.943   1.00 0.00 ? 126 THR G N     1 
ATOM 6752  C CA    . THR G  1 120 ? -55.780 -53.195 5.439   1.00 0.00 ? 126 THR G CA    1 
ATOM 6753  C C     . THR G  1 120 ? -56.477 -53.471 4.141   1.00 0.00 ? 126 THR G C     1 
ATOM 6754  O O     . THR G  1 120 ? -55.958 -54.177 3.280   1.00 0.00 ? 126 THR G O     1 
ATOM 6755  C CB    . THR G  1 120 ? -56.181 -54.274 6.399   1.00 0.00 ? 126 THR G CB    1 
ATOM 6756  O OG1   . THR G  1 120 ? -57.603 -54.270 6.492   1.00 0.00 ? 126 THR G OG1   1 
ATOM 6757  C CG2   . THR G  1 120 ? -55.582 -54.022 7.772   1.00 0.00 ? 126 THR G CG2   1 
ATOM 6758  N N     . GLY G  1 121 ? -57.660 -52.897 3.992   1.00 0.00 ? 127 GLY G N     1 
ATOM 6759  C CA    . GLY G  1 121 ? -58.449 -53.087 2.788   1.00 0.00 ? 127 GLY G CA    1 
ATOM 6760  C C     . GLY G  1 121 ? -59.629 -53.993 3.061   1.00 0.00 ? 127 GLY G C     1 
ATOM 6761  O O     . GLY G  1 121 ? -60.541 -54.100 2.241   1.00 0.00 ? 127 GLY G O     1 
ATOM 6762  N N     . SER G  1 122 ? -59.614 -54.640 4.219   1.00 0.00 ? 128 SER G N     1 
ATOM 6763  C CA    . SER G  1 122 ? -60.691 -55.520 4.624   1.00 0.00 ? 128 SER G CA    1 
ATOM 6764  C C     . SER G  1 122 ? -60.596 -55.777 6.104   1.00 0.00 ? 128 SER G C     1 
ATOM 6765  O O     . SER G  1 122 ? -59.523 -55.645 6.685   1.00 0.00 ? 128 SER G O     1 
ATOM 6766  C CB    . SER G  1 122 ? -60.595 -56.836 3.890   1.00 0.00 ? 128 SER G CB    1 
ATOM 6767  O OG    . SER G  1 122 ? -59.484 -57.565 4.334   1.00 0.00 ? 128 SER G OG    1 
ATOM 6768  N N     . PRO G  1 123 ? -61.678 -56.221 6.718   1.00 0.00 ? 129 PRO G N     1 
ATOM 6769  C CA    . PRO G  1 123 ? -61.749 -56.644 8.094   1.00 0.00 ? 129 PRO G CA    1 
ATOM 6770  C C     . PRO G  1 123 ? -60.795 -57.800 8.281   1.00 0.00 ? 129 PRO G C     1 
ATOM 6771  O O     . PRO G  1 123 ? -60.418 -58.462 7.314   1.00 0.00 ? 129 PRO G O     1 
ATOM 6772  C CB    . PRO G  1 123 ? -63.209 -56.997 8.283   1.00 0.00 ? 129 PRO G CB    1 
ATOM 6773  C CG    . PRO G  1 123 ? -63.927 -56.048 7.372   1.00 0.00 ? 129 PRO G CG    1 
ATOM 6774  C CD    . PRO G  1 123 ? -62.989 -55.800 6.218   1.00 0.00 ? 129 PRO G CD    1 
ATOM 6775  N N     . THR G  1 124 ? -60.368 -58.029 9.504   1.00 0.00 ? 130 THR G N     1 
ATOM 6776  C CA    . THR G  1 124 ? -59.330 -59.006 9.723   1.00 0.00 ? 130 THR G CA    1 
ATOM 6777  C C     . THR G  1 124 ? -59.882 -60.400 9.902   1.00 0.00 ? 130 THR G C     1 
ATOM 6778  O O     . THR G  1 124 ? -60.849 -60.777 9.245   1.00 0.00 ? 130 THR G O     1 
ATOM 6779  C CB    . THR G  1 124 ? -58.487 -58.615 10.942  1.00 0.00 ? 130 THR G CB    1 
ATOM 6780  O OG1   . THR G  1 124 ? -57.419 -59.550 11.098  1.00 0.00 ? 130 THR G OG1   1 
ATOM 6781  C CG2   . THR G  1 124 ? -59.337 -58.566 12.218  1.00 0.00 ? 130 THR G CG2   1 
ATOM 6782  N N     . GLY G  1 125 ? -59.252 -61.193 10.767  1.00 0.00 ? 131 GLY G N     1 
ATOM 6783  C CA    . GLY G  1 125 ? -59.663 -62.585 10.960  1.00 0.00 ? 131 GLY G CA    1 
ATOM 6784  C C     . GLY G  1 125 ? -59.076 -63.454 9.850   1.00 0.00 ? 131 GLY G C     1 
ATOM 6785  O O     . GLY G  1 125 ? -58.255 -64.337 10.095  1.00 0.00 ? 131 GLY G O     1 
ATOM 6786  N N     . TYR G  1 126 ? -59.493 -63.172 8.627   1.00 0.00 ? 132 TYR G N     1 
ATOM 6787  C CA    . TYR G  1 126 ? -58.988 -63.839 7.463   1.00 0.00 ? 132 TYR G CA    1 
ATOM 6788  C C     . TYR G  1 126 ? -58.015 -62.923 6.754   1.00 0.00 ? 132 TYR G C     1 
ATOM 6789  O O     . TYR G  1 126 ? -58.195 -61.707 6.744   1.00 0.00 ? 132 TYR G O     1 
ATOM 6790  C CB    . TYR G  1 126 ? -60.139 -64.202 6.542   1.00 0.00 ? 132 TYR G CB    1 
ATOM 6791  C CG    . TYR G  1 126 ? -61.144 -65.108 7.201   1.00 0.00 ? 132 TYR G CG    1 
ATOM 6792  C CD1   . TYR G  1 126 ? -62.189 -64.549 7.921   1.00 0.00 ? 132 TYR G CD1   1 
ATOM 6793  C CD2   . TYR G  1 126 ? -61.022 -66.482 7.105   1.00 0.00 ? 132 TYR G CD2   1 
ATOM 6794  C CE1   . TYR G  1 126 ? -63.110 -65.361 8.541   1.00 0.00 ? 132 TYR G CE1   1 
ATOM 6795  C CE2   . TYR G  1 126 ? -61.947 -67.296 7.727   1.00 0.00 ? 132 TYR G CE2   1 
ATOM 6796  C CZ    . TYR G  1 126 ? -62.987 -66.738 8.442   1.00 0.00 ? 132 TYR G CZ    1 
ATOM 6797  O OH    . TYR G  1 126 ? -63.909 -67.545 9.060   1.00 0.00 ? 132 TYR G OH    1 
ATOM 6798  N N     . VAL G  1 127 ? -56.992 -63.495 6.159   1.00 0.00 ? 133 VAL G N     1 
ATOM 6799  C CA    . VAL G  1 127 ? -56.024 -62.699 5.432   1.00 0.00 ? 133 VAL G CA    1 
ATOM 6800  C C     . VAL G  1 127 ? -56.459 -62.525 3.990   1.00 0.00 ? 133 VAL G C     1 
ATOM 6801  O O     . VAL G  1 127 ? -56.536 -63.493 3.234   1.00 0.00 ? 133 VAL G O     1 
ATOM 6802  C CB    . VAL G  1 127 ? -54.628 -63.356 5.480   1.00 0.00 ? 133 VAL G CB    1 
ATOM 6803  C CG1   . VAL G  1 127 ? -53.633 -62.535 4.672   1.00 0.00 ? 133 VAL G CG1   1 
ATOM 6804  C CG2   . VAL G  1 127 ? -54.167 -63.477 6.925   1.00 0.00 ? 133 VAL G CG2   1 
ATOM 6805  N N     . SER G  1 128 ? -56.746 -61.293 3.612   1.00 0.00 ? 134 SER G N     1 
ATOM 6806  C CA    . SER G  1 128 ? -57.170 -61.000 2.257   1.00 0.00 ? 134 SER G CA    1 
ATOM 6807  C C     . SER G  1 128 ? -57.191 -59.495 2.013   1.00 0.00 ? 134 SER G C     1 
ATOM 6808  O O     . SER G  1 128 ? -56.272 -58.949 1.400   1.00 0.00 ? 134 SER G O     1 
ATOM 6809  C CB    . SER G  1 128 ? -58.549 -61.598 1.999   1.00 0.00 ? 134 SER G CB    1 
ATOM 6810  O OG    . SER G  1 128 ? -58.987 -61.322 0.697   1.00 0.00 ? 134 SER G OG    1 
ATOM 6811  O OXT   . SER G  1 128 ? -58.039 -58.806 2.577   1.00 0.00 ? 134 SER G OXT   1 
ATOM 6812  N N     . SER H  1 1   ? -56.069 -29.218 11.070  1.00 0.00 ? 7   SER H N     1 
ATOM 6813  C CA    . SER H  1 1   ? -56.115 -29.692 9.690   1.00 0.00 ? 7   SER H CA    1 
ATOM 6814  C C     . SER H  1 1   ? -54.818 -29.404 8.961   1.00 0.00 ? 7   SER H C     1 
ATOM 6815  O O     . SER H  1 1   ? -54.596 -28.285 8.500   1.00 0.00 ? 7   SER H O     1 
ATOM 6816  C CB    . SER H  1 1   ? -57.253 -29.047 8.957   1.00 0.00 ? 7   SER H CB    1 
ATOM 6817  O OG    . SER H  1 1   ? -57.256 -29.439 7.618   1.00 0.00 ? 7   SER H OG    1 
ATOM 6818  N N     . ARG H  1 2   ? -53.959 -30.416 8.856   1.00 0.00 ? 8   ARG H N     1 
ATOM 6819  C CA    . ARG H  1 2   ? -52.662 -30.251 8.187   1.00 0.00 ? 8   ARG H CA    1 
ATOM 6820  C C     . ARG H  1 2   ? -52.255 -31.488 7.400   1.00 0.00 ? 8   ARG H C     1 
ATOM 6821  O O     . ARG H  1 2   ? -52.488 -32.613 7.839   1.00 0.00 ? 8   ARG H O     1 
ATOM 6822  C CB    . ARG H  1 2   ? -51.568 -29.977 9.201   1.00 0.00 ? 8   ARG H CB    1 
ATOM 6823  C CG    . ARG H  1 2   ? -51.709 -28.705 10.027  1.00 0.00 ? 8   ARG H CG    1 
ATOM 6824  C CD    . ARG H  1 2   ? -51.491 -27.477 9.240   1.00 0.00 ? 8   ARG H CD    1 
ATOM 6825  N NE    . ARG H  1 2   ? -51.490 -26.308 10.098  1.00 0.00 ? 8   ARG H NE    1 
ATOM 6826  C CZ    . ARG H  1 2   ? -52.588 -25.653 10.503  1.00 0.00 ? 8   ARG H CZ    1 
ATOM 6827  N NH1   . ARG H  1 2   ? -53.774 -26.050 10.107  1.00 0.00 ? 8   ARG H NH1   1 
ATOM 6828  N NH2   . ARG H  1 2   ? -52.481 -24.604 11.309  1.00 0.00 ? 8   ARG H NH2   1 
ATOM 6829  N N     . SER H  1 3   ? -51.597 -31.273 6.267   1.00 0.00 ? 9   SER H N     1 
ATOM 6830  C CA    . SER H  1 3   ? -51.014 -32.354 5.477   1.00 0.00 ? 9   SER H CA    1 
ATOM 6831  C C     . SER H  1 3   ? -49.731 -32.778 6.114   1.00 0.00 ? 9   SER H C     1 
ATOM 6832  O O     . SER H  1 3   ? -49.240 -32.099 7.007   1.00 0.00 ? 9   SER H O     1 
ATOM 6833  C CB    . SER H  1 3   ? -50.735 -31.892 4.082   1.00 0.00 ? 9   SER H CB    1 
ATOM 6834  O OG    . SER H  1 3   ? -49.729 -30.913 4.087   1.00 0.00 ? 9   SER H OG    1 
ATOM 6835  N N     . TYR H  1 4   ? -49.132 -33.861 5.637   1.00 0.00 ? 10  TYR H N     1 
ATOM 6836  C CA    . TYR H  1 4   ? -47.900 -34.287 6.260   1.00 0.00 ? 10  TYR H CA    1 
ATOM 6837  C C     . TYR H  1 4   ? -46.822 -33.305 5.932   1.00 0.00 ? 10  TYR H C     1 
ATOM 6838  O O     . TYR H  1 4   ? -45.869 -33.156 6.682   1.00 0.00 ? 10  TYR H O     1 
ATOM 6839  C CB    . TYR H  1 4   ? -47.415 -35.648 5.791   1.00 0.00 ? 10  TYR H CB    1 
ATOM 6840  C CG    . TYR H  1 4   ? -46.189 -35.525 4.942   1.00 0.00 ? 10  TYR H CG    1 
ATOM 6841  C CD1   . TYR H  1 4   ? -44.965 -35.336 5.573   1.00 0.00 ? 10  TYR H CD1   1 
ATOM 6842  C CD2   . TYR H  1 4   ? -46.260 -35.564 3.568   1.00 0.00 ? 10  TYR H CD2   1 
ATOM 6843  C CE1   . TYR H  1 4   ? -43.822 -35.166 4.831   1.00 0.00 ? 10  TYR H CE1   1 
ATOM 6844  C CE2   . TYR H  1 4   ? -45.114 -35.398 2.820   1.00 0.00 ? 10  TYR H CE2   1 
ATOM 6845  C CZ    . TYR H  1 4   ? -43.896 -35.192 3.448   1.00 0.00 ? 10  TYR H CZ    1 
ATOM 6846  O OH    . TYR H  1 4   ? -42.751 -35.012 2.699   1.00 0.00 ? 10  TYR H OH    1 
ATOM 6847  N N     . SER H  1 5   ? -46.946 -32.646 4.784   1.00 0.00 ? 11  SER H N     1 
ATOM 6848  C CA    . SER H  1 5   ? -45.934 -31.722 4.363   1.00 0.00 ? 11  SER H CA    1 
ATOM 6849  C C     . SER H  1 5   ? -45.890 -30.550 5.290   1.00 0.00 ? 11  SER H C     1 
ATOM 6850  O O     . SER H  1 5   ? -44.821 -30.025 5.590   1.00 0.00 ? 11  SER H O     1 
ATOM 6851  C CB    . SER H  1 5   ? -46.216 -31.254 2.968   1.00 0.00 ? 11  SER H CB    1 
ATOM 6852  O OG    . SER H  1 5   ? -47.363 -30.451 2.934   1.00 0.00 ? 11  SER H OG    1 
ATOM 6853  N N     . GLN H  1 6   ? -47.047 -30.181 5.806   1.00 0.00 ? 12  GLN H N     1 
ATOM 6854  C CA    . GLN H  1 6   ? -47.140 -29.125 6.779   1.00 0.00 ? 12  GLN H CA    1 
ATOM 6855  C C     . GLN H  1 6   ? -46.664 -29.594 8.127   1.00 0.00 ? 12  GLN H C     1 
ATOM 6856  O O     . GLN H  1 6   ? -45.959 -28.868 8.826   1.00 0.00 ? 12  GLN H O     1 
ATOM 6857  C CB    . GLN H  1 6   ? -48.552 -28.632 6.858   1.00 0.00 ? 12  GLN H CB    1 
ATOM 6858  C CG    . GLN H  1 6   ? -48.980 -27.873 5.632   1.00 0.00 ? 12  GLN H CG    1 
ATOM 6859  C CD    . GLN H  1 6   ? -50.464 -27.692 5.562   1.00 0.00 ? 12  GLN H CD    1 
ATOM 6860  O OE1   . GLN H  1 6   ? -51.184 -28.658 5.294   1.00 0.00 ? 12  GLN H OE1   1 
ATOM 6861  N NE2   . GLN H  1 6   ? -50.942 -26.476 5.806   1.00 0.00 ? 12  GLN H NE2   1 
ATOM 6862  N N     . ARG H  1 7   ? -47.011 -30.827 8.477   1.00 0.00 ? 13  ARG H N     1 
ATOM 6863  C CA    . ARG H  1 7   ? -46.583 -31.398 9.736   1.00 0.00 ? 13  ARG H CA    1 
ATOM 6864  C C     . ARG H  1 7   ? -45.086 -31.424 9.805   1.00 0.00 ? 13  ARG H C     1 
ATOM 6865  O O     . ARG H  1 7   ? -44.493 -30.994 10.792  1.00 0.00 ? 13  ARG H O     1 
ATOM 6866  C CB    . ARG H  1 7   ? -47.107 -32.816 9.884   1.00 0.00 ? 13  ARG H CB    1 
ATOM 6867  C CG    . ARG H  1 7   ? -48.605 -32.921 10.075  1.00 0.00 ? 13  ARG H CG    1 
ATOM 6868  C CD    . ARG H  1 7   ? -49.070 -34.332 10.090  1.00 0.00 ? 13  ARG H CD    1 
ATOM 6869  N NE    . ARG H  1 7   ? -48.642 -35.024 11.289  1.00 0.00 ? 13  ARG H NE    1 
ATOM 6870  C CZ    . ARG H  1 7   ? -48.656 -36.357 11.460  1.00 0.00 ? 13  ARG H CZ    1 
ATOM 6871  N NH1   . ARG H  1 7   ? -49.060 -37.153 10.495  1.00 0.00 ? 13  ARG H NH1   1 
ATOM 6872  N NH2   . ARG H  1 7   ? -48.261 -36.872 12.608  1.00 0.00 ? 13  ARG H NH2   1 
ATOM 6873  N N     . TYR H  1 8   ? -44.475 -31.896 8.737   1.00 0.00 ? 14  TYR H N     1 
ATOM 6874  C CA    . TYR H  1 8   ? -43.046 -31.954 8.630   1.00 0.00 ? 14  TYR H CA    1 
ATOM 6875  C C     . TYR H  1 8   ? -42.428 -30.608 8.620   1.00 0.00 ? 14  TYR H C     1 
ATOM 6876  O O     . TYR H  1 8   ? -41.478 -30.369 9.350   1.00 0.00 ? 14  TYR H O     1 
ATOM 6877  C CB    . TYR H  1 8   ? -42.627 -32.705 7.400   1.00 0.00 ? 14  TYR H CB    1 
ATOM 6878  C CG    . TYR H  1 8   ? -41.165 -32.582 7.147   1.00 0.00 ? 14  TYR H CG    1 
ATOM 6879  C CD1   . TYR H  1 8   ? -40.263 -33.033 8.080   1.00 0.00 ? 14  TYR H CD1   1 
ATOM 6880  C CD2   . TYR H  1 8   ? -40.725 -31.998 5.979   1.00 0.00 ? 14  TYR H CD2   1 
ATOM 6881  C CE1   . TYR H  1 8   ? -38.919 -32.891 7.856   1.00 0.00 ? 14  TYR H CE1   1 
ATOM 6882  C CE2   . TYR H  1 8   ? -39.378 -31.856 5.751   1.00 0.00 ? 14  TYR H CE2   1 
ATOM 6883  C CZ    . TYR H  1 8   ? -38.478 -32.293 6.688   1.00 0.00 ? 14  TYR H CZ    1 
ATOM 6884  O OH    . TYR H  1 8   ? -37.135 -32.124 6.476   1.00 0.00 ? 14  TYR H OH    1 
ATOM 6885  N N     . ALA H  1 9   ? -42.926 -29.723 7.776   1.00 0.00 ? 15  ALA H N     1 
ATOM 6886  C CA    . ALA H  1 9   ? -42.356 -28.398 7.653   1.00 0.00 ? 15  ALA H CA    1 
ATOM 6887  C C     . ALA H  1 9   ? -42.179 -27.749 9.004   1.00 0.00 ? 15  ALA H C     1 
ATOM 6888  O O     . ALA H  1 9   ? -41.084 -27.291 9.340   1.00 0.00 ? 15  ALA H O     1 
ATOM 6889  C CB    . ALA H  1 9   ? -43.230 -27.528 6.780   1.00 0.00 ? 15  ALA H CB    1 
ATOM 6890  N N     . LYS H  1 10  ? -43.245 -27.708 9.785   1.00 0.00 ? 16  LYS H N     1 
ATOM 6891  C CA    . LYS H  1 10  ? -43.171 -27.067 11.067  1.00 0.00 ? 16  LYS H CA    1 
ATOM 6892  C C     . LYS H  1 10  ? -42.315 -27.854 12.023  1.00 0.00 ? 16  LYS H C     1 
ATOM 6893  O O     . LYS H  1 10  ? -41.544 -27.274 12.779  1.00 0.00 ? 16  LYS H O     1 
ATOM 6894  C CB    . LYS H  1 10  ? -44.532 -26.855 11.660  1.00 0.00 ? 16  LYS H CB    1 
ATOM 6895  C CG    . LYS H  1 10  ? -44.483 -26.017 12.908  1.00 0.00 ? 16  LYS H CG    1 
ATOM 6896  C CD    . LYS H  1 10  ? -45.854 -25.721 13.449  1.00 0.00 ? 16  LYS H CD    1 
ATOM 6897  C CE    . LYS H  1 10  ? -45.746 -24.780 14.628  1.00 0.00 ? 16  LYS H CE    1 
ATOM 6898  N NZ    . LYS H  1 10  ? -47.038 -24.590 15.328  1.00 0.00 ? 16  LYS H NZ    1 
ATOM 6899  N N     . TRP H  1 11  ? -42.431 -29.177 11.987  1.00 0.00 ? 17  TRP H N     1 
ATOM 6900  C CA    . TRP H  1 11  ? -41.612 -30.019 12.839  1.00 0.00 ? 17  TRP H CA    1 
ATOM 6901  C C     . TRP H  1 11  ? -40.158 -29.753 12.621  1.00 0.00 ? 17  TRP H C     1 
ATOM 6902  O O     . TRP H  1 11  ? -39.380 -29.725 13.567  1.00 0.00 ? 17  TRP H O     1 
ATOM 6903  C CB    . TRP H  1 11  ? -41.877 -31.484 12.589  1.00 0.00 ? 17  TRP H CB    1 
ATOM 6904  C CG    . TRP H  1 11  ? -40.959 -32.360 13.366  1.00 0.00 ? 17  TRP H CG    1 
ATOM 6905  C CD1   . TRP H  1 11  ? -41.130 -32.784 14.644  1.00 0.00 ? 17  TRP H CD1   1 
ATOM 6906  C CD2   . TRP H  1 11  ? -39.705 -32.928 12.922  1.00 0.00 ? 17  TRP H CD2   1 
ATOM 6907  N NE1   . TRP H  1 11  ? -40.077 -33.573 15.027  1.00 0.00 ? 17  TRP H NE1   1 
ATOM 6908  C CE2   . TRP H  1 11  ? -39.197 -33.672 13.983  1.00 0.00 ? 17  TRP H CE2   1 
ATOM 6909  C CE3   . TRP H  1 11  ? -38.992 -32.869 11.725  1.00 0.00 ? 17  TRP H CE3   1 
ATOM 6910  C CZ2   . TRP H  1 11  ? -37.999 -34.361 13.889  1.00 0.00 ? 17  TRP H CZ2   1 
ATOM 6911  C CZ3   . TRP H  1 11  ? -37.793 -33.562 11.628  1.00 0.00 ? 17  TRP H CZ3   1 
ATOM 6912  C CH2   . TRP H  1 11  ? -37.310 -34.289 12.682  1.00 0.00 ? 17  TRP H CH2   1 
ATOM 6913  N N     . GLN H  1 12  ? -39.780 -29.592 11.369  1.00 0.00 ? 18  GLN H N     1 
ATOM 6914  C CA    . GLN H  1 12  ? -38.417 -29.336 11.025  1.00 0.00 ? 18  GLN H CA    1 
ATOM 6915  C C     . GLN H  1 12  ? -37.953 -28.038 11.594  1.00 0.00 ? 18  GLN H C     1 
ATOM 6916  O O     . GLN H  1 12  ? -36.877 -27.960 12.178  1.00 0.00 ? 18  GLN H O     1 
ATOM 6917  C CB    . GLN H  1 12  ? -38.257 -29.293 9.526   1.00 0.00 ? 18  GLN H CB    1 
ATOM 6918  C CG    . GLN H  1 12  ? -36.837 -29.121 9.091   1.00 0.00 ? 18  GLN H CG    1 
ATOM 6919  C CD    . GLN H  1 12  ? -36.030 -30.319 9.429   1.00 0.00 ? 18  GLN H CD    1 
ATOM 6920  O OE1   . GLN H  1 12  ? -36.293 -31.396 8.895   1.00 0.00 ? 18  GLN H OE1   1 
ATOM 6921  N NE2   . GLN H  1 12  ? -35.051 -30.173 10.311  1.00 0.00 ? 18  GLN H NE2   1 
ATOM 6922  N N     . ALA H  1 13  ? -38.772 -27.011 11.452  1.00 0.00 ? 19  ALA H N     1 
ATOM 6923  C CA    . ALA H  1 13  ? -38.423 -25.698 11.945  1.00 0.00 ? 19  ALA H CA    1 
ATOM 6924  C C     . ALA H  1 13  ? -38.219 -25.709 13.437  1.00 0.00 ? 19  ALA H C     1 
ATOM 6925  O O     . ALA H  1 13  ? -37.291 -25.083 13.946  1.00 0.00 ? 19  ALA H O     1 
ATOM 6926  C CB    . ALA H  1 13  ? -39.496 -24.707 11.576  1.00 0.00 ? 19  ALA H CB    1 
ATOM 6927  N N     . LYS H  1 14  ? -39.066 -26.435 14.143  1.00 0.00 ? 20  LYS H N     1 
ATOM 6928  C CA    . LYS H  1 14  ? -38.981 -26.480 15.578  1.00 0.00 ? 20  LYS H CA    1 
ATOM 6929  C C     . LYS H  1 14  ? -37.855 -27.335 16.047  1.00 0.00 ? 20  LYS H C     1 
ATOM 6930  O O     . LYS H  1 14  ? -37.223 -27.025 17.053  1.00 0.00 ? 20  LYS H O     1 
ATOM 6931  C CB    . LYS H  1 14  ? -40.276 -26.967 16.162  1.00 0.00 ? 20  LYS H CB    1 
ATOM 6932  C CG    . LYS H  1 14  ? -41.417 -26.015 15.936  1.00 0.00 ? 20  LYS H CG    1 
ATOM 6933  C CD    . LYS H  1 14  ? -41.124 -24.692 16.601  1.00 0.00 ? 20  LYS H CD    1 
ATOM 6934  C CE    . LYS H  1 14  ? -41.267 -24.777 18.107  1.00 0.00 ? 20  LYS H CE    1 
ATOM 6935  N NZ    . LYS H  1 14  ? -42.685 -24.671 18.527  1.00 0.00 ? 20  LYS H NZ    1 
ATOM 6936  N N     . PHE H  1 15  ? -37.562 -28.393 15.312  1.00 0.00 ? 21  PHE H N     1 
ATOM 6937  C CA    . PHE H  1 15  ? -36.439 -29.226 15.656  1.00 0.00 ? 21  PHE H CA    1 
ATOM 6938  C C     . PHE H  1 15  ? -35.167 -28.425 15.533  1.00 0.00 ? 21  PHE H C     1 
ATOM 6939  O O     . PHE H  1 15  ? -34.310 -28.466 16.415  1.00 0.00 ? 21  PHE H O     1 
ATOM 6940  C CB    . PHE H  1 15  ? -36.358 -30.448 14.768  1.00 0.00 ? 21  PHE H CB    1 
ATOM 6941  C CG    . PHE H  1 15  ? -35.281 -31.377 15.199  1.00 0.00 ? 21  PHE H CG    1 
ATOM 6942  C CD1   . PHE H  1 15  ? -35.527 -32.336 16.164  1.00 0.00 ? 21  PHE H CD1   1 
ATOM 6943  C CD2   . PHE H  1 15  ? -34.007 -31.268 14.688  1.00 0.00 ? 21  PHE H CD2   1 
ATOM 6944  C CE1   . PHE H  1 15  ? -34.522 -33.178 16.600  1.00 0.00 ? 21  PHE H CE1   1 
ATOM 6945  C CE2   . PHE H  1 15  ? -32.999 -32.104 15.126  1.00 0.00 ? 21  PHE H CE2   1 
ATOM 6946  C CZ    . PHE H  1 15  ? -33.258 -33.061 16.081  1.00 0.00 ? 21  PHE H CZ    1 
ATOM 6947  N N     . ASN H  1 16  ? -35.052 -27.684 14.435  1.00 0.00 ? 22  ASN H N     1 
ATOM 6948  C CA    . ASN H  1 16  ? -33.899 -26.850 14.192  1.00 0.00 ? 22  ASN H CA    1 
ATOM 6949  C C     . ASN H  1 16  ? -33.713 -25.870 15.313  1.00 0.00 ? 22  ASN H C     1 
ATOM 6950  O O     . ASN H  1 16  ? -32.620 -25.738 15.862  1.00 0.00 ? 22  ASN H O     1 
ATOM 6951  C CB    . ASN H  1 16  ? -34.057 -26.091 12.902  1.00 0.00 ? 22  ASN H CB    1 
ATOM 6952  C CG    . ASN H  1 16  ? -34.011 -26.966 11.708  1.00 0.00 ? 22  ASN H CG    1 
ATOM 6953  O OD1   . ASN H  1 16  ? -33.658 -28.144 11.794  1.00 0.00 ? 22  ASN H OD1   1 
ATOM 6954  N ND2   . ASN H  1 16  ? -34.362 -26.417 10.578  1.00 0.00 ? 22  ASN H ND2   1 
ATOM 6955  N N     . ALA H  1 17  ? -34.800 -25.202 15.685  1.00 0.00 ? 23  ALA H N     1 
ATOM 6956  C CA    . ALA H  1 17  ? -34.758 -24.223 16.740  1.00 0.00 ? 23  ALA H CA    1 
ATOM 6957  C C     . ALA H  1 17  ? -34.229 -24.823 18.012  1.00 0.00 ? 23  ALA H C     1 
ATOM 6958  O O     . ALA H  1 17  ? -33.291 -24.302 18.608  1.00 0.00 ? 23  ALA H O     1 
ATOM 6959  C CB    . ALA H  1 17  ? -36.142 -23.649 16.974  1.00 0.00 ? 23  ALA H CB    1 
ATOM 6960  N N     . PHE H  1 18  ? -34.807 -25.941 18.419  1.00 0.00 ? 24  PHE H N     1 
ATOM 6961  C CA    . PHE H  1 18  ? -34.419 -26.584 19.648  1.00 0.00 ? 24  PHE H CA    1 
ATOM 6962  C C     . PHE H  1 18  ? -32.970 -26.974 19.673  1.00 0.00 ? 24  PHE H C     1 
ATOM 6963  O O     . PHE H  1 18  ? -32.327 -26.877 20.708  1.00 0.00 ? 24  PHE H O     1 
ATOM 6964  C CB    . PHE H  1 18  ? -35.276 -27.783 19.931  1.00 0.00 ? 24  PHE H CB    1 
ATOM 6965  C CG    . PHE H  1 18  ? -34.924 -28.444 21.225  1.00 0.00 ? 24  PHE H CG    1 
ATOM 6966  C CD1   . PHE H  1 18  ? -35.013 -27.745 22.418  1.00 0.00 ? 24  PHE H CD1   1 
ATOM 6967  C CD2   . PHE H  1 18  ? -34.532 -29.773 21.265  1.00 0.00 ? 24  PHE H CD2   1 
ATOM 6968  C CE1   . PHE H  1 18  ? -34.710 -28.358 23.617  1.00 0.00 ? 24  PHE H CE1   1 
ATOM 6969  C CE2   . PHE H  1 18  ? -34.237 -30.387 22.463  1.00 0.00 ? 24  PHE H CE2   1 
ATOM 6970  C CZ    . PHE H  1 18  ? -34.324 -29.679 23.639  1.00 0.00 ? 24  PHE H CZ    1 
ATOM 6971  N N     . SER H  1 19  ? -32.435 -27.415 18.535  1.00 0.00 ? 25  SER H N     1 
ATOM 6972  C CA    . SER H  1 19  ? -31.048 -27.878 18.482  1.00 0.00 ? 25  SER H CA    1 
ATOM 6973  C C     . SER H  1 19  ? -30.027 -26.768 18.776  1.00 0.00 ? 25  SER H C     1 
ATOM 6974  O O     . SER H  1 19  ? -28.859 -27.053 19.026  1.00 0.00 ? 25  SER H O     1 
ATOM 6975  C CB    . SER H  1 19  ? -30.745 -28.458 17.130  1.00 0.00 ? 25  SER H CB    1 
ATOM 6976  O OG    . SER H  1 19  ? -30.644 -27.448 16.160  1.00 0.00 ? 25  SER H OG    1 
ATOM 6977  N N     . ASN H  1 20  ? -30.463 -25.510 18.723  1.00 0.00 ? 26  ASN H N     1 
ATOM 6978  C CA    . ASN H  1 20  ? -29.584 -24.378 18.988  1.00 0.00 ? 26  ASN H CA    1 
ATOM 6979  C C     . ASN H  1 20  ? -29.145 -24.353 20.448  1.00 0.00 ? 26  ASN H C     1 
ATOM 6980  O O     . ASN H  1 20  ? -29.983 -24.211 21.326  1.00 0.00 ? 26  ASN H O     1 
ATOM 6981  C CB    . ASN H  1 20  ? -30.296 -23.091 18.639  1.00 0.00 ? 26  ASN H CB    1 
ATOM 6982  C CG    . ASN H  1 20  ? -29.452 -21.873 18.833  1.00 0.00 ? 26  ASN H CG    1 
ATOM 6983  O OD1   . ASN H  1 20  ? -28.844 -21.676 19.895  1.00 0.00 ? 26  ASN H OD1   1 
ATOM 6984  N ND2   . ASN H  1 20  ? -29.399 -21.043 17.828  1.00 0.00 ? 26  ASN H ND2   1 
ATOM 6985  N N     . PRO H  1 21  ? -27.827 -24.510 20.717  1.00 0.00 ? 27  PRO H N     1 
ATOM 6986  C CA    . PRO H  1 21  ? -27.199 -24.501 22.056  1.00 0.00 ? 27  PRO H CA    1 
ATOM 6987  C C     . PRO H  1 21  ? -27.949 -23.656 23.066  1.00 0.00 ? 27  PRO H C     1 
ATOM 6988  O O     . PRO H  1 21  ? -28.198 -24.092 24.195  1.00 0.00 ? 27  PRO H O     1 
ATOM 6989  C CB    . PRO H  1 21  ? -25.831 -23.853 21.804  1.00 0.00 ? 27  PRO H CB    1 
ATOM 6990  C CG    . PRO H  1 21  ? -25.526 -24.155 20.400  1.00 0.00 ? 27  PRO H CG    1 
ATOM 6991  C CD    . PRO H  1 21  ? -26.849 -24.038 19.705  1.00 0.00 ? 27  PRO H CD    1 
ATOM 6992  N N     . THR H  1 22  ? -28.271 -22.431 22.674  1.00 0.00 ? 28  THR H N     1 
ATOM 6993  C CA    . THR H  1 22  ? -28.908 -21.503 23.566  1.00 0.00 ? 28  THR H CA    1 
ATOM 6994  C C     . THR H  1 22  ? -30.316 -21.896 23.846  1.00 0.00 ? 28  THR H C     1 
ATOM 6995  O O     . THR H  1 22  ? -30.746 -21.883 24.992  1.00 0.00 ? 28  THR H O     1 
ATOM 6996  C CB    . THR H  1 22  ? -28.880 -20.094 22.999  1.00 0.00 ? 28  THR H CB    1 
ATOM 6997  O OG1   . THR H  1 22  ? -27.522 -19.677 22.829  1.00 0.00 ? 28  THR H OG1   1 
ATOM 6998  C CG2   . THR H  1 22  ? -29.581 -19.144 23.939  1.00 0.00 ? 28  THR H CG2   1 
ATOM 6999  N N     . VAL H  1 23  ? -31.045 -22.252 22.809  1.00 0.00 ? 29  VAL H N     1 
ATOM 7000  C CA    . VAL H  1 23  ? -32.426 -22.626 22.962  1.00 0.00 ? 29  VAL H CA    1 
ATOM 7001  C C     . VAL H  1 23  ? -32.565 -23.878 23.767  1.00 0.00 ? 29  VAL H C     1 
ATOM 7002  O O     . VAL H  1 23  ? -33.406 -23.961 24.662  1.00 0.00 ? 29  VAL H O     1 
ATOM 7003  C CB    . VAL H  1 23  ? -33.069 -22.836 21.607  1.00 0.00 ? 29  VAL H CB    1 
ATOM 7004  C CG1   . VAL H  1 23  ? -34.461 -23.399 21.775  1.00 0.00 ? 29  VAL H CG1   1 
ATOM 7005  C CG2   . VAL H  1 23  ? -33.115 -21.531 20.871  1.00 0.00 ? 29  VAL H CG2   1 
ATOM 7006  N N     . ALA H  1 24  ? -31.742 -24.856 23.461  1.00 0.00 ? 30  ALA H N     1 
ATOM 7007  C CA    . ALA H  1 24  ? -31.788 -26.114 24.158  1.00 0.00 ? 30  ALA H CA    1 
ATOM 7008  C C     . ALA H  1 24  ? -31.545 -25.923 25.628  1.00 0.00 ? 30  ALA H C     1 
ATOM 7009  O O     . ALA H  1 24  ? -32.328 -26.375 26.457  1.00 0.00 ? 30  ALA H O     1 
ATOM 7010  C CB    . ALA H  1 24  ? -30.760 -27.073 23.591  1.00 0.00 ? 30  ALA H CB    1 
ATOM 7011  N N     . SER H  1 25  ? -30.466 -25.233 25.961  1.00 0.00 ? 31  SER H N     1 
ATOM 7012  C CA    . SER H  1 25  ? -30.110 -25.056 27.340  1.00 0.00 ? 31  SER H CA    1 
ATOM 7013  C C     . SER H  1 25  ? -31.038 -24.135 28.067  1.00 0.00 ? 31  SER H C     1 
ATOM 7014  O O     . SER H  1 25  ? -31.299 -24.329 29.247  1.00 0.00 ? 31  SER H O     1 
ATOM 7015  C CB    . SER H  1 25  ? -28.734 -24.529 27.429  1.00 0.00 ? 31  SER H CB    1 
ATOM 7016  O OG    . SER H  1 25  ? -28.641 -23.286 26.804  1.00 0.00 ? 31  SER H OG    1 
ATOM 7017  N N     . THR H  1 26  ? -31.585 -23.154 27.371  1.00 0.00 ? 32  THR H N     1 
ATOM 7018  C CA    . THR H  1 26  ? -32.517 -22.251 28.003  1.00 0.00 ? 32  THR H CA    1 
ATOM 7019  C C     . THR H  1 26  ? -33.718 -22.988 28.479  1.00 0.00 ? 32  THR H C     1 
ATOM 7020  O O     . THR H  1 26  ? -34.092 -22.898 29.644  1.00 0.00 ? 32  THR H O     1 
ATOM 7021  C CB    . THR H  1 26  ? -32.954 -21.139 27.063  1.00 0.00 ? 32  THR H CB    1 
ATOM 7022  O OG1   . THR H  1 26  ? -31.827 -20.344 26.703  1.00 0.00 ? 32  THR H OG1   1 
ATOM 7023  C CG2   . THR H  1 26  ? -33.983 -20.275 27.743  1.00 0.00 ? 32  THR H CG2   1 
ATOM 7024  N N     . ILE H  1 27  ? -34.320 -23.739 27.587  1.00 0.00 ? 33  ILE H N     1 
ATOM 7025  C CA    . ILE H  1 27  ? -35.507 -24.461 27.927  1.00 0.00 ? 33  ILE H CA    1 
ATOM 7026  C C     . ILE H  1 27  ? -35.232 -25.518 28.956  1.00 0.00 ? 33  ILE H C     1 
ATOM 7027  O O     . ILE H  1 27  ? -35.919 -25.594 29.972  1.00 0.00 ? 33  ILE H O     1 
ATOM 7028  C CB    . ILE H  1 27  ? -36.103 -25.117 26.701  1.00 0.00 ? 33  ILE H CB    1 
ATOM 7029  C CG1   . ILE H  1 27  ? -36.615 -24.066 25.740  1.00 0.00 ? 33  ILE H CG1   1 
ATOM 7030  C CG2   . ILE H  1 27  ? -37.219 -26.042 27.111  1.00 0.00 ? 33  ILE H CG2   1 
ATOM 7031  C CD1   . ILE H  1 27  ? -36.963 -24.618 24.389  1.00 0.00 ? 33  ILE H CD1   1 
ATOM 7032  N N     . LEU H  1 28  ? -34.230 -26.336 28.700  1.00 0.00 ? 34  LEU H N     1 
ATOM 7033  C CA    . LEU H  1 28  ? -33.947 -27.474 29.536  1.00 0.00 ? 34  LEU H CA    1 
ATOM 7034  C C     . LEU H  1 28  ? -33.510 -27.087 30.925  1.00 0.00 ? 34  LEU H C     1 
ATOM 7035  O O     . LEU H  1 28  ? -33.894 -27.732 31.899  1.00 0.00 ? 34  LEU H O     1 
ATOM 7036  C CB    . LEU H  1 28  ? -32.887 -28.322 28.881  1.00 0.00 ? 34  LEU H CB    1 
ATOM 7037  C CG    . LEU H  1 28  ? -33.328 -29.013 27.593  1.00 0.00 ? 34  LEU H CG    1 
ATOM 7038  C CD1   . LEU H  1 28  ? -32.124 -29.650 26.931  1.00 0.00 ? 34  LEU H CD1   1 
ATOM 7039  C CD2   . LEU H  1 28  ? -34.389 -30.049 27.914  1.00 0.00 ? 34  LEU H CD2   1 
ATOM 7040  N N     . SER H  1 29  ? -32.729 -26.023 31.039  1.00 0.00 ? 35  SER H N     1 
ATOM 7041  C CA    . SER H  1 29  ? -32.296 -25.586 32.345  1.00 0.00 ? 35  SER H CA    1 
ATOM 7042  C C     . SER H  1 29  ? -33.430 -24.949 33.116  1.00 0.00 ? 35  SER H C     1 
ATOM 7043  O O     . SER H  1 29  ? -33.464 -25.024 34.343  1.00 0.00 ? 35  SER H O     1 
ATOM 7044  C CB    . SER H  1 29  ? -31.158 -24.617 32.229  1.00 0.00 ? 35  SER H CB    1 
ATOM 7045  O OG    . SER H  1 29  ? -31.578 -23.427 31.627  1.00 0.00 ? 35  SER H OG    1 
ATOM 7046  N N     . ASN H  1 30  ? -34.393 -24.361 32.406  1.00 0.00 ? 36  ASN H N     1 
ATOM 7047  C CA    . ASN H  1 30  ? -35.534 -23.773 33.073  1.00 0.00 ? 36  ASN H CA    1 
ATOM 7048  C C     . ASN H  1 30  ? -36.499 -24.813 33.571  1.00 0.00 ? 36  ASN H C     1 
ATOM 7049  O O     . ASN H  1 30  ? -37.078 -24.656 34.641  1.00 0.00 ? 36  ASN H O     1 
ATOM 7050  C CB    . ASN H  1 30  ? -36.231 -22.789 32.182  1.00 0.00 ? 36  ASN H CB    1 
ATOM 7051  C CG    . ASN H  1 30  ? -35.453 -21.523 32.048  1.00 0.00 ? 36  ASN H CG    1 
ATOM 7052  O OD1   . ASN H  1 30  ? -34.492 -21.300 32.792  1.00 0.00 ? 36  ASN H OD1   1 
ATOM 7053  N ND2   . ASN H  1 30  ? -35.850 -20.676 31.140  1.00 0.00 ? 36  ASN H ND2   1 
ATOM 7054  N N     . VAL H  1 31  ? -36.654 -25.905 32.827  1.00 0.00 ? 37  VAL H N     1 
ATOM 7055  C CA    . VAL H  1 31  ? -37.595 -26.940 33.231  1.00 0.00 ? 37  VAL H CA    1 
ATOM 7056  C C     . VAL H  1 31  ? -36.933 -28.024 34.021  1.00 0.00 ? 37  VAL H C     1 
ATOM 7057  O O     . VAL H  1 31  ? -37.581 -28.998 34.376  1.00 0.00 ? 37  VAL H O     1 
ATOM 7058  C CB    . VAL H  1 31  ? -38.275 -27.585 32.026  1.00 0.00 ? 37  VAL H CB    1 
ATOM 7059  C CG1   . VAL H  1 31  ? -38.988 -26.543 31.194  1.00 0.00 ? 37  VAL H CG1   1 
ATOM 7060  C CG2   . VAL H  1 31  ? -37.255 -28.343 31.212  1.00 0.00 ? 37  VAL H CG2   1 
ATOM 7061  N N     . SER H  1 32  ? -35.639 -27.873 34.286  1.00 0.00 ? 38  SER H N     1 
ATOM 7062  C CA    . SER H  1 32  ? -34.906 -28.846 35.073  1.00 0.00 ? 38  SER H CA    1 
ATOM 7063  C C     . SER H  1 32  ? -35.632 -29.230 36.377  1.00 0.00 ? 38  SER H C     1 
ATOM 7064  O O     . SER H  1 32  ? -36.171 -30.329 36.464  1.00 0.00 ? 38  SER H O     1 
ATOM 7065  C CB    . SER H  1 32  ? -33.491 -28.363 35.345  1.00 0.00 ? 38  SER H CB    1 
ATOM 7066  O OG    . SER H  1 32  ? -32.727 -28.362 34.172  1.00 0.00 ? 38  SER H OG    1 
ATOM 7067  N N     . PRO H  1 33  ? -35.600 -28.368 37.419  1.00 0.00 ? 39  PRO H N     1 
ATOM 7068  C CA    . PRO H  1 33  ? -36.200 -28.659 38.722  1.00 0.00 ? 39  PRO H CA    1 
ATOM 7069  C C     . PRO H  1 33  ? -37.684 -29.072 38.616  1.00 0.00 ? 39  PRO H C     1 
ATOM 7070  O O     . PRO H  1 33  ? -38.185 -29.821 39.456  1.00 0.00 ? 39  PRO H O     1 
ATOM 7071  C CB    . PRO H  1 33  ? -36.090 -27.340 39.450  1.00 0.00 ? 39  PRO H CB    1 
ATOM 7072  C CG    . PRO H  1 33  ? -36.273 -26.317 38.386  1.00 0.00 ? 39  PRO H CG    1 
ATOM 7073  C CD    . PRO H  1 33  ? -35.711 -26.917 37.136  1.00 0.00 ? 39  PRO H CD    1 
ATOM 7074  N N     . VAL H  1 34  ? -38.366 -28.609 37.569  1.00 0.00 ? 40  VAL H N     1 
ATOM 7075  C CA    . VAL H  1 34  ? -39.747 -28.953 37.353  1.00 0.00 ? 40  VAL H CA    1 
ATOM 7076  C C     . VAL H  1 34  ? -39.850 -30.396 36.961  1.00 0.00 ? 40  VAL H C     1 
ATOM 7077  O O     . VAL H  1 34  ? -40.643 -31.151 37.524  1.00 0.00 ? 40  VAL H O     1 
ATOM 7078  C CB    . VAL H  1 34  ? -40.341 -28.085 36.251  1.00 0.00 ? 40  VAL H CB    1 
ATOM 7079  C CG1   . VAL H  1 34  ? -41.747 -28.548 35.928  1.00 0.00 ? 40  VAL H CG1   1 
ATOM 7080  C CG2   . VAL H  1 34  ? -40.326 -26.631 36.681  1.00 0.00 ? 40  VAL H CG2   1 
ATOM 7081  N N     . ALA H  1 35  ? -39.016 -30.786 36.012  1.00 0.00 ? 41  ALA H N     1 
ATOM 7082  C CA    . ALA H  1 35  ? -38.950 -32.148 35.548  1.00 0.00 ? 41  ALA H CA    1 
ATOM 7083  C C     . ALA H  1 35  ? -38.617 -33.070 36.671  1.00 0.00 ? 41  ALA H C     1 
ATOM 7084  O O     . ALA H  1 35  ? -39.172 -34.158 36.773  1.00 0.00 ? 41  ALA H O     1 
ATOM 7085  C CB    . ALA H  1 35  ? -37.905 -32.280 34.459  1.00 0.00 ? 41  ALA H CB    1 
ATOM 7086  N N     . GLN H  1 36  ? -37.723 -32.627 37.538  1.00 0.00 ? 42  GLN H N     1 
ATOM 7087  C CA    . GLN H  1 36  ? -37.295 -33.426 38.652  1.00 0.00 ? 42  GLN H CA    1 
ATOM 7088  C C     . GLN H  1 36  ? -38.448 -33.744 39.534  1.00 0.00 ? 42  GLN H C     1 
ATOM 7089  O O     . GLN H  1 36  ? -38.619 -34.881 39.950  1.00 0.00 ? 42  GLN H O     1 
ATOM 7090  C CB    . GLN H  1 36  ? -36.237 -32.698 39.438  1.00 0.00 ? 42  GLN H CB    1 
ATOM 7091  C CG    . GLN H  1 36  ? -34.957 -32.519 38.676  1.00 0.00 ? 42  GLN H CG    1 
ATOM 7092  C CD    . GLN H  1 36  ? -33.904 -31.789 39.462  1.00 0.00 ? 42  GLN H CD    1 
ATOM 7093  O OE1   . GLN H  1 36  ? -33.738 -32.011 40.664  1.00 0.00 ? 42  GLN H OE1   1 
ATOM 7094  N NE2   . GLN H  1 36  ? -33.180 -30.907 38.788  1.00 0.00 ? 42  GLN H NE2   1 
ATOM 7095  N N     . GLN H  1 37  ? -39.280 -32.750 39.790  1.00 0.00 ? 43  GLN H N     1 
ATOM 7096  C CA    . GLN H  1 37  ? -40.449 -32.956 40.604  1.00 0.00 ? 43  GLN H CA    1 
ATOM 7097  C C     . GLN H  1 37  ? -41.389 -33.949 39.987  1.00 0.00 ? 43  GLN H C     1 
ATOM 7098  O O     . GLN H  1 37  ? -41.899 -34.837 40.670  1.00 0.00 ? 43  GLN H O     1 
ATOM 7099  C CB    . GLN H  1 37  ? -41.183 -31.651 40.817  1.00 0.00 ? 43  GLN H CB    1 
ATOM 7100  C CG    . GLN H  1 37  ? -42.404 -31.789 41.683  1.00 0.00 ? 43  GLN H CG    1 
ATOM 7101  C CD    . GLN H  1 37  ? -42.053 -32.189 43.088  1.00 0.00 ? 43  GLN H CD    1 
ATOM 7102  O OE1   . GLN H  1 37  ? -41.244 -31.525 43.742  1.00 0.00 ? 43  GLN H OE1   1 
ATOM 7103  N NE2   . GLN H  1 37  ? -42.650 -33.274 43.571  1.00 0.00 ? 43  GLN H NE2   1 
ATOM 7104  N N     . ASN H  1 38  ? -41.612 -33.811 38.691  1.00 0.00 ? 44  ASN H N     1 
ATOM 7105  C CA    . ASN H  1 38  ? -42.546 -34.665 37.998  1.00 0.00 ? 44  ASN H CA    1 
ATOM 7106  C C     . ASN H  1 38  ? -42.062 -36.094 37.948  1.00 0.00 ? 44  ASN H C     1 
ATOM 7107  O O     . ASN H  1 38  ? -42.841 -37.028 38.142  1.00 0.00 ? 44  ASN H O     1 
ATOM 7108  C CB    . ASN H  1 38  ? -42.803 -34.126 36.621  1.00 0.00 ? 44  ASN H CB    1 
ATOM 7109  C CG    . ASN H  1 38  ? -43.631 -32.879 36.677  1.00 0.00 ? 44  ASN H CG    1 
ATOM 7110  O OD1   . ASN H  1 38  ? -44.294 -32.624 37.688  1.00 0.00 ? 44  ASN H OD1   1 
ATOM 7111  N ND2   . ASN H  1 38  ? -43.614 -32.098 35.627  1.00 0.00 ? 44  ASN H ND2   1 
ATOM 7112  N N     . PHE H  1 39  ? -40.770 -36.265 37.721  1.00 0.00 ? 45  PHE H N     1 
ATOM 7113  C CA    . PHE H  1 39  ? -40.170 -37.577 37.689  1.00 0.00 ? 45  PHE H CA    1 
ATOM 7114  C C     . PHE H  1 39  ? -40.267 -38.224 39.047  1.00 0.00 ? 45  PHE H C     1 
ATOM 7115  O O     . PHE H  1 39  ? -40.695 -39.364 39.173  1.00 0.00 ? 45  PHE H O     1 
ATOM 7116  C CB    . PHE H  1 39  ? -38.720 -37.496 37.295  1.00 0.00 ? 45  PHE H CB    1 
ATOM 7117  C CG    . PHE H  1 39  ? -38.094 -38.833 37.137  1.00 0.00 ? 45  PHE H CG    1 
ATOM 7118  C CD1   . PHE H  1 39  ? -37.898 -39.368 35.880  1.00 0.00 ? 45  PHE H CD1   1 
ATOM 7119  C CD2   . PHE H  1 39  ? -37.745 -39.589 38.237  1.00 0.00 ? 45  PHE H CD2   1 
ATOM 7120  C CE1   . PHE H  1 39  ? -37.329 -40.616 35.721  1.00 0.00 ? 45  PHE H CE1   1 
ATOM 7121  C CE2   . PHE H  1 39  ? -37.185 -40.843 38.084  1.00 0.00 ? 45  PHE H CE2   1 
ATOM 7122  C CZ    . PHE H  1 39  ? -36.966 -41.351 36.825  1.00 0.00 ? 45  PHE H CZ    1 
ATOM 7123  N N     . GLN H  1 40  ? -39.884 -37.486 40.072  1.00 0.00 ? 46  GLN H N     1 
ATOM 7124  C CA    . GLN H  1 40  ? -39.915 -38.001 41.420  1.00 0.00 ? 46  GLN H CA    1 
ATOM 7125  C C     . GLN H  1 40  ? -41.302 -38.382 41.848  1.00 0.00 ? 46  GLN H C     1 
ATOM 7126  O O     . GLN H  1 40  ? -41.488 -39.343 42.587  1.00 0.00 ? 46  GLN H O     1 
ATOM 7127  C CB    . GLN H  1 40  ? -39.382 -36.978 42.398  1.00 0.00 ? 46  GLN H CB    1 
ATOM 7128  C CG    . GLN H  1 40  ? -37.899 -36.730 42.332  1.00 0.00 ? 46  GLN H CG    1 
ATOM 7129  C CD    . GLN H  1 40  ? -37.517 -35.601 43.247  1.00 0.00 ? 46  GLN H CD    1 
ATOM 7130  O OE1   . GLN H  1 40  ? -38.243 -35.308 44.198  1.00 0.00 ? 46  GLN H OE1   1 
ATOM 7131  N NE2   . GLN H  1 40  ? -36.394 -34.949 42.977  1.00 0.00 ? 46  GLN H NE2   1 
ATOM 7132  N N     . THR H  1 41  ? -42.280 -37.603 41.422  1.00 0.00 ? 47  THR H N     1 
ATOM 7133  C CA    . THR H  1 41  ? -43.636 -37.825 41.836  1.00 0.00 ? 47  THR H CA    1 
ATOM 7134  C C     . THR H  1 41  ? -44.250 -39.088 41.245  1.00 0.00 ? 47  THR H C     1 
ATOM 7135  O O     . THR H  1 41  ? -44.818 -39.898 41.970  1.00 0.00 ? 47  THR H O     1 
ATOM 7136  C CB    . THR H  1 41  ? -44.505 -36.630 41.460  1.00 0.00 ? 47  THR H CB    1 
ATOM 7137  O OG1   . THR H  1 41  ? -44.002 -35.453 42.100  1.00 0.00 ? 47  THR H OG1   1 
ATOM 7138  C CG2   . THR H  1 41  ? -45.940 -36.863 41.893  1.00 0.00 ? 47  THR H CG2   1 
ATOM 7139  N N     . ASN H  1 42  ? -44.171 -39.246 39.930  1.00 0.00 ? 48  ASN H N     1 
ATOM 7140  C CA    . ASN H  1 42  ? -44.877 -40.345 39.295  1.00 0.00 ? 48  ASN H CA    1 
ATOM 7141  C C     . ASN H  1 42  ? -44.079 -41.611 39.059  1.00 0.00 ? 48  ASN H C     1 
ATOM 7142  O O     . ASN H  1 42  ? -44.668 -42.660 38.847  1.00 0.00 ? 48  ASN H O     1 
ATOM 7143  C CB    . ASN H  1 42  ? -45.495 -39.893 37.996  1.00 0.00 ? 48  ASN H CB    1 
ATOM 7144  C CG    . ASN H  1 42  ? -46.680 -38.991 38.203  1.00 0.00 ? 48  ASN H CG    1 
ATOM 7145  O OD1   . ASN H  1 42  ? -47.340 -39.040 39.250  1.00 0.00 ? 48  ASN H OD1   1 
ATOM 7146  N ND2   . ASN H  1 42  ? -46.984 -38.188 37.219  1.00 0.00 ? 48  ASN H ND2   1 
ATOM 7147  N N     . VAL H  1 43  ? -42.758 -41.548 39.099  1.00 0.00 ? 49  VAL H N     1 
ATOM 7148  C CA    . VAL H  1 43  ? -41.979 -42.744 38.773  1.00 0.00 ? 49  VAL H CA    1 
ATOM 7149  C C     . VAL H  1 43  ? -41.933 -43.865 39.842  1.00 0.00 ? 49  VAL H C     1 
ATOM 7150  O O     . VAL H  1 43  ? -42.191 -45.021 39.501  1.00 0.00 ? 49  VAL H O     1 
ATOM 7151  C CB    . VAL H  1 43  ? -40.581 -42.362 38.389  1.00 0.00 ? 49  VAL H CB    1 
ATOM 7152  C CG1   . VAL H  1 43  ? -39.721 -43.599 38.241  1.00 0.00 ? 49  VAL H CG1   1 
ATOM 7153  C CG2   . VAL H  1 43  ? -40.655 -41.619 37.076  1.00 0.00 ? 49  VAL H CG2   1 
ATOM 7154  N N     . PRO H  1 44  ? -41.582 -43.568 41.111  1.00 0.00 ? 50  PRO H N     1 
ATOM 7155  C CA    . PRO H  1 44  ? -41.476 -44.568 42.177  1.00 0.00 ? 50  PRO H CA    1 
ATOM 7156  C C     . PRO H  1 44  ? -42.767 -45.387 42.323  1.00 0.00 ? 50  PRO H C     1 
ATOM 7157  O O     . PRO H  1 44  ? -42.738 -46.524 42.796  1.00 0.00 ? 50  PRO H O     1 
ATOM 7158  C CB    . PRO H  1 44  ? -41.243 -43.729 43.416  1.00 0.00 ? 50  PRO H CB    1 
ATOM 7159  C CG    . PRO H  1 44  ? -41.993 -42.476 43.165  1.00 0.00 ? 50  PRO H CG    1 
ATOM 7160  C CD    . PRO H  1 44  ? -41.984 -42.270 41.680  1.00 0.00 ? 50  PRO H CD    1 
ATOM 7161  N N     . LYS H  1 45  ? -43.883 -44.822 41.863  1.00 0.00 ? 51  LYS H N     1 
ATOM 7162  C CA    . LYS H  1 45  ? -45.165 -45.492 41.863  1.00 0.00 ? 51  LYS H CA    1 
ATOM 7163  C C     . LYS H  1 45  ? -45.122 -46.752 41.026  1.00 0.00 ? 51  LYS H C     1 
ATOM 7164  O O     . LYS H  1 45  ? -45.724 -47.762 41.378  1.00 0.00 ? 51  LYS H O     1 
ATOM 7165  C CB    . LYS H  1 45  ? -46.223 -44.564 41.296  1.00 0.00 ? 51  LYS H CB    1 
ATOM 7166  C CG    . LYS H  1 45  ? -46.561 -43.373 42.167  1.00 0.00 ? 51  LYS H CG    1 
ATOM 7167  C CD    . LYS H  1 45  ? -47.540 -42.450 41.455  1.00 0.00 ? 51  LYS H CD    1 
ATOM 7168  C CE    . LYS H  1 45  ? -47.887 -41.241 42.301  1.00 0.00 ? 51  LYS H CE    1 
ATOM 7169  N NZ    . LYS H  1 45  ? -48.720 -40.266 41.555  1.00 0.00 ? 51  LYS H NZ    1 
ATOM 7170  N N     . PHE H  1 46  ? -44.410 -46.686 39.911  1.00 0.00 ? 52  PHE H N     1 
ATOM 7171  C CA    . PHE H  1 46  ? -44.318 -47.799 38.996  1.00 0.00 ? 52  PHE H CA    1 
ATOM 7172  C C     . PHE H  1 46  ? -43.165 -48.695 39.343  1.00 0.00 ? 52  PHE H C     1 
ATOM 7173  O O     . PHE H  1 46  ? -43.191 -49.887 39.051  1.00 0.00 ? 52  PHE H O     1 
ATOM 7174  C CB    . PHE H  1 46  ? -44.168 -47.288 37.585  1.00 0.00 ? 52  PHE H CB    1 
ATOM 7175  C CG    . PHE H  1 46  ? -45.391 -46.605 37.100  1.00 0.00 ? 52  PHE H CG    1 
ATOM 7176  C CD1   . PHE H  1 46  ? -45.573 -45.270 37.358  1.00 0.00 ? 52  PHE H CD1   1 
ATOM 7177  C CD2   . PHE H  1 46  ? -46.360 -47.283 36.391  1.00 0.00 ? 52  PHE H CD2   1 
ATOM 7178  C CE1   . PHE H  1 46  ? -46.703 -44.614 36.928  1.00 0.00 ? 52  PHE H CE1   1 
ATOM 7179  C CE2   . PHE H  1 46  ? -47.487 -46.634 35.948  1.00 0.00 ? 52  PHE H CE2   1 
ATOM 7180  C CZ    . PHE H  1 46  ? -47.663 -45.299 36.221  1.00 0.00 ? 52  PHE H CZ    1 
ATOM 7181  N N     . THR H  1 47  ? -42.156 -48.141 39.994  1.00 0.00 ? 53  THR H N     1 
ATOM 7182  C CA    . THR H  1 47  ? -41.044 -48.955 40.427  1.00 0.00 ? 53  THR H CA    1 
ATOM 7183  C C     . THR H  1 47  ? -41.510 -49.990 41.425  1.00 0.00 ? 53  THR H C     1 
ATOM 7184  O O     . THR H  1 47  ? -41.111 -51.152 41.357  1.00 0.00 ? 53  THR H O     1 
ATOM 7185  C CB    . THR H  1 47  ? -39.938 -48.129 41.044  1.00 0.00 ? 53  THR H CB    1 
ATOM 7186  O OG1   . THR H  1 47  ? -39.430 -47.200 40.081  1.00 0.00 ? 53  THR H OG1   1 
ATOM 7187  C CG2   . THR H  1 47  ? -38.827 -49.047 41.495  1.00 0.00 ? 53  THR H CG2   1 
ATOM 7188  N N     . SER H  1 48  ? -42.374 -49.573 42.350  1.00 0.00 ? 54  SER H N     1 
ATOM 7189  C CA    . SER H  1 48  ? -42.913 -50.493 43.337  1.00 0.00 ? 54  SER H CA    1 
ATOM 7190  C C     . SER H  1 48  ? -43.732 -51.586 42.674  1.00 0.00 ? 54  SER H C     1 
ATOM 7191  O O     . SER H  1 48  ? -43.736 -52.732 43.130  1.00 0.00 ? 54  SER H O     1 
ATOM 7192  C CB    . SER H  1 48  ? -43.787 -49.750 44.314  1.00 0.00 ? 54  SER H CB    1 
ATOM 7193  O OG    . SER H  1 48  ? -44.950 -49.284 43.689  1.00 0.00 ? 54  SER H OG    1 
ATOM 7194  N N     . VAL H  1 49  ? -44.372 -51.247 41.560  1.00 0.00 ? 55  VAL H N     1 
ATOM 7195  C CA    . VAL H  1 49  ? -45.123 -52.217 40.800  1.00 0.00 ? 55  VAL H CA    1 
ATOM 7196  C C     . VAL H  1 49  ? -44.203 -53.245 40.240  1.00 0.00 ? 55  VAL H C     1 
ATOM 7197  O O     . VAL H  1 49  ? -44.463 -54.436 40.338  1.00 0.00 ? 55  VAL H O     1 
ATOM 7198  C CB    . VAL H  1 49  ? -45.893 -51.546 39.648  1.00 0.00 ? 55  VAL H CB    1 
ATOM 7199  C CG1   . VAL H  1 49  ? -46.499 -52.595 38.741  1.00 0.00 ? 55  VAL H CG1   1 
ATOM 7200  C CG2   . VAL H  1 49  ? -46.972 -50.654 40.210  1.00 0.00 ? 55  VAL H CG2   1 
ATOM 7201  N N     . ASN H  1 50  ? -43.096 -52.790 39.681  1.00 0.00 ? 56  ASN H N     1 
ATOM 7202  C CA    . ASN H  1 50  ? -42.137 -53.682 39.085  1.00 0.00 ? 56  ASN H CA    1 
ATOM 7203  C C     . ASN H  1 50  ? -41.606 -54.682 40.075  1.00 0.00 ? 56  ASN H C     1 
ATOM 7204  O O     . ASN H  1 50  ? -41.457 -55.849 39.742  1.00 0.00 ? 56  ASN H O     1 
ATOM 7205  C CB    . ASN H  1 50  ? -41.015 -52.907 38.472  1.00 0.00 ? 56  ASN H CB    1 
ATOM 7206  C CG    . ASN H  1 50  ? -41.439 -52.226 37.224  1.00 0.00 ? 56  ASN H CG    1 
ATOM 7207  O OD1   . ASN H  1 50  ? -42.437 -52.624 36.617  1.00 0.00 ? 56  ASN H OD1   1 
ATOM 7208  N ND2   . ASN H  1 50  ? -40.716 -51.214 36.823  1.00 0.00 ? 56  ASN H ND2   1 
ATOM 7209  N N     . GLU H  1 51  ? -41.338 -54.247 41.306  1.00 0.00 ? 57  GLU H N     1 
ATOM 7210  C CA    . GLU H  1 51  ? -40.837 -55.178 42.313  1.00 0.00 ? 57  GLU H CA    1 
ATOM 7211  C C     . GLU H  1 51  ? -41.850 -56.270 42.607  1.00 0.00 ? 57  GLU H C     1 
ATOM 7212  O O     . GLU H  1 51  ? -41.520 -57.455 42.552  1.00 0.00 ? 57  GLU H O     1 
ATOM 7213  C CB    . GLU H  1 51  ? -40.452 -54.463 43.624  1.00 0.00 ? 57  GLU H CB    1 
ATOM 7214  C CG    . GLU H  1 51  ? -39.852 -55.410 44.687  1.00 0.00 ? 57  GLU H CG    1 
ATOM 7215  C CD    . GLU H  1 51  ? -39.369 -54.728 45.965  1.00 0.00 ? 57  GLU H CD    1 
ATOM 7216  O OE1   . GLU H  1 51  ? -39.579 -53.550 46.121  1.00 0.00 ? 57  GLU H OE1   1 
ATOM 7217  O OE2   . GLU H  1 51  ? -38.767 -55.400 46.771  1.00 0.00 ? 57  GLU H OE2   1 
ATOM 7218  N N     . ASN H  1 52  ? -43.079 -55.878 42.926  1.00 0.00 ? 58  ASN H N     1 
ATOM 7219  C CA    . ASN H  1 52  ? -44.089 -56.860 43.287  1.00 0.00 ? 58  ASN H CA    1 
ATOM 7220  C C     . ASN H  1 52  ? -44.476 -57.750 42.124  1.00 0.00 ? 58  ASN H C     1 
ATOM 7221  O O     . ASN H  1 52  ? -44.582 -58.962 42.283  1.00 0.00 ? 58  ASN H O     1 
ATOM 7222  C CB    . ASN H  1 52  ? -45.312 -56.196 43.862  1.00 0.00 ? 58  ASN H CB    1 
ATOM 7223  C CG    . ASN H  1 52  ? -45.109 -55.705 45.265  1.00 0.00 ? 58  ASN H CG    1 
ATOM 7224  O OD1   . ASN H  1 52  ? -44.132 -56.063 45.929  1.00 0.00 ? 58  ASN H OD1   1 
ATOM 7225  N ND2   . ASN H  1 52  ? -46.031 -54.907 45.741  1.00 0.00 ? 58  ASN H ND2   1 
ATOM 7226  N N     . VAL H  1 53  ? -44.665 -57.159 40.953  1.00 0.00 ? 59  VAL H N     1 
ATOM 7227  C CA    . VAL H  1 53  ? -45.036 -57.927 39.782  1.00 0.00 ? 59  VAL H CA    1 
ATOM 7228  C C     . VAL H  1 53  ? -43.966 -58.908 39.423  1.00 0.00 ? 59  VAL H C     1 
ATOM 7229  O O     . VAL H  1 53  ? -44.256 -60.052 39.091  1.00 0.00 ? 59  VAL H O     1 
ATOM 7230  C CB    . VAL H  1 53  ? -45.310 -57.011 38.586  1.00 0.00 ? 59  VAL H CB    1 
ATOM 7231  C CG1   . VAL H  1 53  ? -45.461 -57.838 37.321  1.00 0.00 ? 59  VAL H CG1   1 
ATOM 7232  C CG2   . VAL H  1 53  ? -46.579 -56.218 38.839  1.00 0.00 ? 59  VAL H CG2   1 
ATOM 7233  N N     . SER H  1 54  ? -42.722 -58.468 39.487  1.00 0.00 ? 60  SER H N     1 
ATOM 7234  C CA    . SER H  1 54  ? -41.612 -59.328 39.183  1.00 0.00 ? 60  SER H CA    1 
ATOM 7235  C C     . SER H  1 54  ? -41.605 -60.515 40.114  1.00 0.00 ? 60  SER H C     1 
ATOM 7236  O O     . SER H  1 54  ? -41.419 -61.647 39.678  1.00 0.00 ? 60  SER H O     1 
ATOM 7237  C CB    . SER H  1 54  ? -40.321 -58.567 39.300  1.00 0.00 ? 60  SER H CB    1 
ATOM 7238  O OG    . SER H  1 54  ? -39.235 -59.349 38.903  1.00 0.00 ? 60  SER H OG    1 
ATOM 7239  N N     . ALA H  1 55  ? -41.825 -60.263 41.401  1.00 0.00 ? 61  ALA H N     1 
ATOM 7240  C CA    . ALA H  1 55  ? -41.858 -61.333 42.384  1.00 0.00 ? 61  ALA H CA    1 
ATOM 7241  C C     . ALA H  1 55  ? -42.887 -62.373 42.011  1.00 0.00 ? 61  ALA H C     1 
ATOM 7242  O O     . ALA H  1 55  ? -42.609 -63.572 42.052  1.00 0.00 ? 61  ALA H O     1 
ATOM 7243  C CB    . ALA H  1 55  ? -42.158 -60.776 43.759  1.00 0.00 ? 61  ALA H CB    1 
ATOM 7244  N N     . VAL H  1 56  ? -44.063 -61.916 41.609  1.00 0.00 ? 62  VAL H N     1 
ATOM 7245  C CA    . VAL H  1 56  ? -45.119 -62.809 41.184  1.00 0.00 ? 62  VAL H CA    1 
ATOM 7246  C C     . VAL H  1 56  ? -44.703 -63.651 40.021  1.00 0.00 ? 62  VAL H C     1 
ATOM 7247  O O     . VAL H  1 56  ? -44.915 -64.860 40.017  1.00 0.00 ? 62  VAL H O     1 
ATOM 7248  C CB    . VAL H  1 56  ? -46.355 -62.017 40.798  1.00 0.00 ? 62  VAL H CB    1 
ATOM 7249  C CG1   . VAL H  1 56  ? -47.364 -62.912 40.124  1.00 0.00 ? 62  VAL H CG1   1 
ATOM 7250  C CG2   . VAL H  1 56  ? -46.947 -61.408 42.034  1.00 0.00 ? 62  VAL H CG2   1 
ATOM 7251  N N     . LEU H  1 57  ? -44.090 -63.024 39.041  1.00 0.00 ? 63  LEU H N     1 
ATOM 7252  C CA    . LEU H  1 57  ? -43.676 -63.716 37.851  1.00 0.00 ? 63  LEU H CA    1 
ATOM 7253  C C     . LEU H  1 57  ? -42.681 -64.806 38.171  1.00 0.00 ? 63  LEU H C     1 
ATOM 7254  O O     . LEU H  1 57  ? -42.722 -65.881 37.579  1.00 0.00 ? 63  LEU H O     1 
ATOM 7255  C CB    . LEU H  1 57  ? -43.100 -62.720 36.873  1.00 0.00 ? 63  LEU H CB    1 
ATOM 7256  C CG    . LEU H  1 57  ? -44.129 -61.753 36.300  1.00 0.00 ? 63  LEU H CG    1 
ATOM 7257  C CD1   . LEU H  1 57  ? -43.434 -60.693 35.472  1.00 0.00 ? 63  LEU H CD1   1 
ATOM 7258  C CD2   . LEU H  1 57  ? -45.125 -62.532 35.478  1.00 0.00 ? 63  LEU H CD2   1 
ATOM 7259  N N     . THR H  1 58  ? -41.822 -64.561 39.149  1.00 0.00 ? 64  THR H N     1 
ATOM 7260  C CA    . THR H  1 58  ? -40.899 -65.586 39.596  1.00 0.00 ? 64  THR H CA    1 
ATOM 7261  C C     . THR H  1 58  ? -41.643 -66.753 40.221  1.00 0.00 ? 64  THR H C     1 
ATOM 7262  O O     . THR H  1 58  ? -41.327 -67.910 39.954  1.00 0.00 ? 64  THR H O     1 
ATOM 7263  C CB    . THR H  1 58  ? -39.862 -65.016 40.555  1.00 0.00 ? 64  THR H CB    1 
ATOM 7264  O OG1   . THR H  1 58  ? -39.078 -64.041 39.852  1.00 0.00 ? 64  THR H OG1   1 
ATOM 7265  C CG2   . THR H  1 58  ? -38.957 -66.119 41.081  1.00 0.00 ? 64  THR H CG2   1 
ATOM 7266  N N     . GLN H  1 59  ? -42.669 -66.457 41.006  1.00 0.00 ? 65  GLN H N     1 
ATOM 7267  C CA    . GLN H  1 59  ? -43.492 -67.511 41.596  1.00 0.00 ? 65  GLN H CA    1 
ATOM 7268  C C     . GLN H  1 59  ? -44.270 -68.303 40.530  1.00 0.00 ? 65  GLN H C     1 
ATOM 7269  O O     . GLN H  1 59  ? -44.550 -69.485 40.714  1.00 0.00 ? 65  GLN H O     1 
ATOM 7270  C CB    . GLN H  1 59  ? -44.454 -66.931 42.615  1.00 0.00 ? 65  GLN H CB    1 
ATOM 7271  C CG    . GLN H  1 59  ? -43.785 -66.423 43.878  1.00 0.00 ? 65  GLN H CG    1 
ATOM 7272  C CD    . GLN H  1 59  ? -43.121 -67.539 44.673  1.00 0.00 ? 65  GLN H CD    1 
ATOM 7273  O OE1   . GLN H  1 59  ? -43.634 -68.660 44.732  1.00 0.00 ? 65  GLN H OE1   1 
ATOM 7274  N NE2   . GLN H  1 59  ? -41.989 -67.238 45.301  1.00 0.00 ? 65  GLN H NE2   1 
ATOM 7275  N N     . TYR H  1 60  ? -44.593 -67.658 39.410  1.00 0.00 ? 66  TYR H N     1 
ATOM 7276  C CA    . TYR H  1 60  ? -45.240 -68.349 38.295  1.00 0.00 ? 66  TYR H CA    1 
ATOM 7277  C C     . TYR H  1 60  ? -44.265 -68.982 37.309  1.00 0.00 ? 66  TYR H C     1 
ATOM 7278  O O     . TYR H  1 60  ? -44.689 -69.551 36.308  1.00 0.00 ? 66  TYR H O     1 
ATOM 7279  C CB    . TYR H  1 60  ? -46.172 -67.421 37.548  1.00 0.00 ? 66  TYR H CB    1 
ATOM 7280  C CG    . TYR H  1 60  ? -47.530 -67.302 38.167  1.00 0.00 ? 66  TYR H CG    1 
ATOM 7281  C CD1   . TYR H  1 60  ? -47.793 -66.339 39.106  1.00 0.00 ? 66  TYR H CD1   1 
ATOM 7282  C CD2   . TYR H  1 60  ? -48.530 -68.166 37.761  1.00 0.00 ? 66  TYR H CD2   1 
ATOM 7283  C CE1   . TYR H  1 60  ? -49.056 -66.233 39.647  1.00 0.00 ? 66  TYR H CE1   1 
ATOM 7284  C CE2   . TYR H  1 60  ? -49.795 -68.060 38.293  1.00 0.00 ? 66  TYR H CE2   1 
ATOM 7285  C CZ    . TYR H  1 60  ? -50.061 -67.096 39.232  1.00 0.00 ? 66  TYR H CZ    1 
ATOM 7286  O OH    . TYR H  1 60  ? -51.322 -66.984 39.764  1.00 0.00 ? 66  TYR H OH    1 
ATOM 7287  N N     . GLY H  1 61  ? -42.970 -68.880 37.568  1.00 0.00 ? 67  GLY H N     1 
ATOM 7288  C CA    . GLY H  1 61  ? -41.993 -69.532 36.709  1.00 0.00 ? 67  GLY H CA    1 
ATOM 7289  C C     . GLY H  1 61  ? -41.769 -68.808 35.384  1.00 0.00 ? 67  GLY H C     1 
ATOM 7290  O O     . GLY H  1 61  ? -41.233 -69.391 34.440  1.00 0.00 ? 67  GLY H O     1 
ATOM 7291  N N     . ILE H  1 62  ? -42.152 -67.540 35.320  1.00 0.00 ? 68  ILE H N     1 
ATOM 7292  C CA    . ILE H  1 62  ? -42.057 -66.776 34.088  1.00 0.00 ? 68  ILE H CA    1 
ATOM 7293  C C     . ILE H  1 62  ? -40.662 -66.213 33.913  1.00 0.00 ? 68  ILE H C     1 
ATOM 7294  O O     . ILE H  1 62  ? -40.129 -65.580 34.820  1.00 0.00 ? 68  ILE H O     1 
ATOM 7295  C CB    . ILE H  1 62  ? -43.070 -65.627 34.087  1.00 0.00 ? 68  ILE H CB    1 
ATOM 7296  C CG1   . ILE H  1 62  ? -44.477 -66.158 34.327  1.00 0.00 ? 68  ILE H CG1   1 
ATOM 7297  C CG2   . ILE H  1 62  ? -43.015 -64.894 32.773  1.00 0.00 ? 68  ILE H CG2   1 
ATOM 7298  C CD1   . ILE H  1 62  ? -44.937 -67.145 33.290  1.00 0.00 ? 68  ILE H CD1   1 
ATOM 7299  N N     . THR H  1 63  ? -40.061 -66.459 32.756  1.00 0.00 ? 69  THR H N     1 
ATOM 7300  C CA    . THR H  1 63  ? -38.700 -65.998 32.500  1.00 0.00 ? 69  THR H CA    1 
ATOM 7301  C C     . THR H  1 63  ? -38.576 -65.228 31.198  1.00 0.00 ? 69  THR H C     1 
ATOM 7302  O O     . THR H  1 63  ? -39.420 -65.340 30.311  1.00 0.00 ? 69  THR H O     1 
ATOM 7303  C CB    . THR H  1 63  ? -37.746 -67.163 32.423  1.00 0.00 ? 69  THR H CB    1 
ATOM 7304  O OG1   . THR H  1 63  ? -38.130 -67.963 31.312  1.00 0.00 ? 69  THR H OG1   1 
ATOM 7305  C CG2   . THR H  1 63  ? -37.779 -67.999 33.690  1.00 0.00 ? 69  THR H CG2   1 
ATOM 7306  N N     . GLY H  1 64  ? -37.482 -64.502 31.071  1.00 0.00 ? 70  GLY H N     1 
ATOM 7307  C CA    . GLY H  1 64  ? -37.165 -63.797 29.848  1.00 0.00 ? 70  GLY H CA    1 
ATOM 7308  C C     . GLY H  1 64  ? -38.201 -62.754 29.505  1.00 0.00 ? 70  GLY H C     1 
ATOM 7309  O O     . GLY H  1 64  ? -38.852 -62.186 30.382  1.00 0.00 ? 70  GLY H O     1 
ATOM 7310  N N     . PRO H  1 65  ? -38.386 -62.526 28.218  1.00 0.00 ? 71  PRO H N     1 
ATOM 7311  C CA    . PRO H  1 65  ? -39.295 -61.576 27.621  1.00 0.00 ? 71  PRO H CA    1 
ATOM 7312  C C     . PRO H  1 65  ? -40.718 -61.850 28.003  1.00 0.00 ? 71  PRO H C     1 
ATOM 7313  O O     . PRO H  1 65  ? -41.565 -60.969 27.899  1.00 0.00 ? 71  PRO H O     1 
ATOM 7314  C CB    . PRO H  1 65  ? -39.031 -61.723 26.143  1.00 0.00 ? 71  PRO H CB    1 
ATOM 7315  C CG    . PRO H  1 65  ? -37.573 -62.064 26.067  1.00 0.00 ? 71  PRO H CG    1 
ATOM 7316  C CD    . PRO H  1 65  ? -37.293 -62.876 27.296  1.00 0.00 ? 71  PRO H CD    1 
ATOM 7317  N N     . ASN H  1 66  ? -40.999 -63.056 28.466  1.00 0.00 ? 72  ASN H N     1 
ATOM 7318  C CA    . ASN H  1 66  ? -42.328 -63.363 28.893  1.00 0.00 ? 72  ASN H CA    1 
ATOM 7319  C C     . ASN H  1 66  ? -42.660 -62.566 30.125  1.00 0.00 ? 72  ASN H C     1 
ATOM 7320  O O     . ASN H  1 66  ? -43.804 -62.163 30.318  1.00 0.00 ? 72  ASN H O     1 
ATOM 7321  C CB    . ASN H  1 66  ? -42.473 -64.829 29.132  1.00 0.00 ? 72  ASN H CB    1 
ATOM 7322  C CG    . ASN H  1 66  ? -42.470 -65.587 27.852  1.00 0.00 ? 72  ASN H CG    1 
ATOM 7323  O OD1   . ASN H  1 66  ? -42.991 -65.110 26.841  1.00 0.00 ? 72  ASN H OD1   1 
ATOM 7324  N ND2   . ASN H  1 66  ? -41.870 -66.745 27.858  1.00 0.00 ? 72  ASN H ND2   1 
ATOM 7325  N N     . ARG H  1 67  ? -41.647 -62.291 30.943  1.00 0.00 ? 73  ARG H N     1 
ATOM 7326  C CA    . ARG H  1 67  ? -41.850 -61.478 32.114  1.00 0.00 ? 73  ARG H CA    1 
ATOM 7327  C C     . ARG H  1 67  ? -42.180 -60.103 31.672  1.00 0.00 ? 73  ARG H C     1 
ATOM 7328  O O     . ARG H  1 67  ? -43.100 -59.480 32.191  1.00 0.00 ? 73  ARG H O     1 
ATOM 7329  C CB    . ARG H  1 67  ? -40.610 -61.425 32.973  1.00 0.00 ? 73  ARG H CB    1 
ATOM 7330  C CG    . ARG H  1 67  ? -40.214 -62.729 33.597  1.00 0.00 ? 73  ARG H CG    1 
ATOM 7331  C CD    . ARG H  1 67  ? -38.954 -62.606 34.342  1.00 0.00 ? 73  ARG H CD    1 
ATOM 7332  N NE    . ARG H  1 67  ? -39.123 -61.927 35.613  1.00 0.00 ? 73  ARG H NE    1 
ATOM 7333  C CZ    . ARG H  1 67  ? -39.321 -62.562 36.786  1.00 0.00 ? 73  ARG H CZ    1 
ATOM 7334  N NH1   . ARG H  1 67  ? -39.402 -63.863 36.842  1.00 0.00 ? 73  ARG H NH1   1 
ATOM 7335  N NH2   . ARG H  1 67  ? -39.417 -61.892 37.910  1.00 0.00 ? 73  ARG H NH2   1 
ATOM 7336  N N     . ALA H  1 68  ? -41.454 -59.644 30.653  1.00 0.00 ? 74  ALA H N     1 
ATOM 7337  C CA    . ALA H  1 68  ? -41.647 -58.312 30.101  1.00 0.00 ? 74  ALA H CA    1 
ATOM 7338  C C     . ALA H  1 68  ? -43.052 -58.114 29.578  1.00 0.00 ? 74  ALA H C     1 
ATOM 7339  O O     . ALA H  1 68  ? -43.599 -57.021 29.686  1.00 0.00 ? 74  ALA H O     1 
ATOM 7340  C CB    . ALA H  1 68  ? -40.652 -58.046 29.009  1.00 0.00 ? 74  ALA H CB    1 
ATOM 7341  N N     . ILE H  1 69  ? -43.653 -59.168 29.036  1.00 0.00 ? 75  ILE H N     1 
ATOM 7342  C CA    . ILE H  1 69  ? -45.030 -59.073 28.587  1.00 0.00 ? 75  ILE H CA    1 
ATOM 7343  C C     . ILE H  1 69  ? -45.923 -58.674 29.725  1.00 0.00 ? 75  ILE H C     1 
ATOM 7344  O O     . ILE H  1 69  ? -46.748 -57.765 29.598  1.00 0.00 ? 75  ILE H O     1 
ATOM 7345  C CB    . ILE H  1 69  ? -45.542 -60.403 28.027  1.00 0.00 ? 75  ILE H CB    1 
ATOM 7346  C CG1   . ILE H  1 69  ? -44.838 -60.736 26.732  1.00 0.00 ? 75  ILE H CG1   1 
ATOM 7347  C CG2   . ILE H  1 69  ? -47.043 -60.338 27.824  1.00 0.00 ? 75  ILE H CG2   1 
ATOM 7348  C CD1   . ILE H  1 69  ? -45.080 -62.141 26.254  1.00 0.00 ? 75  ILE H CD1   1 
ATOM 7349  N N     . TYR H  1 70  ? -45.754 -59.344 30.846  1.00 0.00 ? 76  TYR H N     1 
ATOM 7350  C CA    . TYR H  1 70  ? -46.586 -59.093 31.990  1.00 0.00 ? 76  TYR H CA    1 
ATOM 7351  C C     . TYR H  1 70  ? -46.213 -57.801 32.682  1.00 0.00 ? 76  TYR H C     1 
ATOM 7352  O O     . TYR H  1 70  ? -47.071 -57.136 33.254  1.00 0.00 ? 76  TYR H O     1 
ATOM 7353  C CB    . TYR H  1 70  ? -46.507 -60.257 32.930  1.00 0.00 ? 76  TYR H CB    1 
ATOM 7354  C CG    . TYR H  1 70  ? -47.034 -61.503 32.296  1.00 0.00 ? 76  TYR H CG    1 
ATOM 7355  C CD1   . TYR H  1 70  ? -46.185 -62.555 32.058  1.00 0.00 ? 76  TYR H CD1   1 
ATOM 7356  C CD2   . TYR H  1 70  ? -48.352 -61.574 31.904  1.00 0.00 ? 76  TYR H CD2   1 
ATOM 7357  C CE1   . TYR H  1 70  ? -46.646 -63.683 31.428  1.00 0.00 ? 76  TYR H CE1   1 
ATOM 7358  C CE2   . TYR H  1 70  ? -48.822 -62.702 31.272  1.00 0.00 ? 76  TYR H CE2   1 
ATOM 7359  C CZ    . TYR H  1 70  ? -47.967 -63.752 31.031  1.00 0.00 ? 76  TYR H CZ    1 
ATOM 7360  O OH    . TYR H  1 70  ? -48.416 -64.874 30.385  1.00 0.00 ? 76  TYR H OH    1 
ATOM 7361  N N     . GLN H  1 71  ? -44.947 -57.413 32.590  1.00 0.00 ? 77  GLN H N     1 
ATOM 7362  C CA    . GLN H  1 71  ? -44.525 -56.147 33.149  1.00 0.00 ? 77  GLN H CA    1 
ATOM 7363  C C     . GLN H  1 71  ? -45.182 -55.017 32.410  1.00 0.00 ? 77  GLN H C     1 
ATOM 7364  O O     . GLN H  1 71  ? -45.681 -54.080 33.023  1.00 0.00 ? 77  GLN H O     1 
ATOM 7365  C CB    . GLN H  1 71  ? -43.006 -55.993 33.080  1.00 0.00 ? 77  GLN H CB    1 
ATOM 7366  C CG    . GLN H  1 71  ? -42.234 -56.896 34.020  1.00 0.00 ? 77  GLN H CG    1 
ATOM 7367  C CD    . GLN H  1 71  ? -42.522 -56.577 35.454  1.00 0.00 ? 77  GLN H CD    1 
ATOM 7368  O OE1   . GLN H  1 71  ? -43.436 -55.802 35.740  1.00 0.00 ? 77  GLN H OE1   1 
ATOM 7369  N NE2   . GLN H  1 71  ? -41.750 -57.149 36.371  1.00 0.00 ? 77  GLN H NE2   1 
ATOM 7370  N N     . GLY H  1 72  ? -45.235 -55.125 31.085  1.00 0.00 ? 78  GLY H N     1 
ATOM 7371  C CA    . GLY H  1 72  ? -45.882 -54.116 30.261  1.00 0.00 ? 78  GLY H CA    1 
ATOM 7372  C C     . GLY H  1 72  ? -47.344 -54.003 30.625  1.00 0.00 ? 78  GLY H C     1 
ATOM 7373  O O     . GLY H  1 72  ? -47.866 -52.902 30.806  1.00 0.00 ? 78  GLY H O     1 
ATOM 7374  N N     . PHE H  1 73  ? -47.994 -55.145 30.757  1.00 0.00 ? 79  PHE H N     1 
ATOM 7375  C CA    . PHE H  1 73  ? -49.376 -55.188 31.150  1.00 0.00 ? 79  PHE H CA    1 
ATOM 7376  C C     . PHE H  1 73  ? -49.600 -54.515 32.485  1.00 0.00 ? 79  PHE H C     1 
ATOM 7377  O O     . PHE H  1 73  ? -50.451 -53.640 32.603  1.00 0.00 ? 79  PHE H O     1 
ATOM 7378  C CB    . PHE H  1 73  ? -49.843 -56.622 31.213  1.00 0.00 ? 79  PHE H CB    1 
ATOM 7379  C CG    . PHE H  1 73  ? -51.191 -56.794 31.821  1.00 0.00 ? 79  PHE H CG    1 
ATOM 7380  C CD1   . PHE H  1 73  ? -52.338 -56.486 31.123  1.00 0.00 ? 79  PHE H CD1   1 
ATOM 7381  C CD2   . PHE H  1 73  ? -51.308 -57.292 33.101  1.00 0.00 ? 79  PHE H CD2   1 
ATOM 7382  C CE1   . PHE H  1 73  ? -53.578 -56.677 31.696  1.00 0.00 ? 79  PHE H CE1   1 
ATOM 7383  C CE2   . PHE H  1 73  ? -52.538 -57.480 33.676  1.00 0.00 ? 79  PHE H CE2   1 
ATOM 7384  C CZ    . PHE H  1 73  ? -53.676 -57.172 32.972  1.00 0.00 ? 79  PHE H CZ    1 
ATOM 7385  N N     . GLY H  1 74  ? -48.836 -54.923 33.489  1.00 0.00 ? 80  GLY H N     1 
ATOM 7386  C CA    . GLY H  1 74  ? -48.978 -54.389 34.832  1.00 0.00 ? 80  GLY H CA    1 
ATOM 7387  C C     . GLY H  1 74  ? -48.763 -52.899 34.872  1.00 0.00 ? 80  GLY H C     1 
ATOM 7388  O O     . GLY H  1 74  ? -49.538 -52.169 35.482  1.00 0.00 ? 80  GLY H O     1 
ATOM 7389  N N     . LEU H  1 75  ? -47.729 -52.440 34.208  1.00 0.00 ? 81  LEU H N     1 
ATOM 7390  C CA    . LEU H  1 75  ? -47.427 -51.034 34.181  1.00 0.00 ? 81  LEU H CA    1 
ATOM 7391  C C     . LEU H  1 75  ? -48.558 -50.242 33.561  1.00 0.00 ? 81  LEU H C     1 
ATOM 7392  O O     . LEU H  1 75  ? -48.902 -49.163 34.038  1.00 0.00 ? 81  LEU H O     1 
ATOM 7393  C CB    . LEU H  1 75  ? -46.150 -50.809 33.402  1.00 0.00 ? 81  LEU H CB    1 
ATOM 7394  C CG    . LEU H  1 75  ? -44.880 -51.299 34.074  1.00 0.00 ? 81  LEU H CG    1 
ATOM 7395  C CD1   . LEU H  1 75  ? -43.733 -51.221 33.084  1.00 0.00 ? 81  LEU H CD1   1 
ATOM 7396  C CD2   . LEU H  1 75  ? -44.608 -50.442 35.291  1.00 0.00 ? 81  LEU H CD2   1 
ATOM 7397  N N     . LYS H  1 76  ? -49.155 -50.793 32.516  1.00 0.00 ? 82  LYS H N     1 
ATOM 7398  C CA    . LYS H  1 76  ? -50.255 -50.142 31.846  1.00 0.00 ? 82  LYS H CA    1 
ATOM 7399  C C     . LYS H  1 76  ? -51.484 -50.091 32.737  1.00 0.00 ? 82  LYS H C     1 
ATOM 7400  O O     . LYS H  1 76  ? -52.208 -49.096 32.743  1.00 0.00 ? 82  LYS H O     1 
ATOM 7401  C CB    . LYS H  1 76  ? -50.538 -50.841 30.532  1.00 0.00 ? 82  LYS H CB    1 
ATOM 7402  C CG    . LYS H  1 76  ? -51.571 -50.166 29.661  1.00 0.00 ? 82  LYS H CG    1 
ATOM 7403  C CD    . LYS H  1 76  ? -51.510 -50.721 28.251  1.00 0.00 ? 82  LYS H CD    1 
ATOM 7404  C CE    . LYS H  1 76  ? -52.660 -50.224 27.408  1.00 0.00 ? 82  LYS H CE    1 
ATOM 7405  N NZ    . LYS H  1 76  ? -52.541 -48.794 27.086  1.00 0.00 ? 82  LYS H NZ    1 
ATOM 7406  N N     . VAL H  1 77  ? -51.698 -51.141 33.527  1.00 0.00 ? 83  VAL H N     1 
ATOM 7407  C CA    . VAL H  1 77  ? -52.783 -51.137 34.496  1.00 0.00 ? 83  VAL H CA    1 
ATOM 7408  C C     . VAL H  1 77  ? -52.603 -50.006 35.483  1.00 0.00 ? 83  VAL H C     1 
ATOM 7409  O O     . VAL H  1 77  ? -53.536 -49.256 35.764  1.00 0.00 ? 83  VAL H O     1 
ATOM 7410  C CB    . VAL H  1 77  ? -52.851 -52.474 35.265  1.00 0.00 ? 83  VAL H CB    1 
ATOM 7411  C CG1   . VAL H  1 77  ? -53.823 -52.358 36.421  1.00 0.00 ? 83  VAL H CG1   1 
ATOM 7412  C CG2   . VAL H  1 77  ? -53.281 -53.591 34.337  1.00 0.00 ? 83  VAL H CG2   1 
ATOM 7413  N N     . ALA H  1 78  ? -51.387 -49.882 36.003  1.00 0.00 ? 84  ALA H N     1 
ATOM 7414  C CA    . ALA H  1 78  ? -51.063 -48.848 36.963  1.00 0.00 ? 84  ALA H CA    1 
ATOM 7415  C C     . ALA H  1 78  ? -51.227 -47.460 36.357  1.00 0.00 ? 84  ALA H C     1 
ATOM 7416  O O     . ALA H  1 78  ? -51.713 -46.548 37.018  1.00 0.00 ? 84  ALA H O     1 
ATOM 7417  C CB    . ALA H  1 78  ? -49.656 -49.042 37.475  1.00 0.00 ? 84  ALA H CB    1 
ATOM 7418  N N     . ARG H  1 79  ? -50.835 -47.308 35.096  1.00 0.00 ? 85  ARG H N     1 
ATOM 7419  C CA    . ARG H  1 79  ? -51.025 -46.049 34.399  1.00 0.00 ? 85  ARG H CA    1 
ATOM 7420  C C     . ARG H  1 79  ? -52.451 -45.597 34.445  1.00 0.00 ? 85  ARG H C     1 
ATOM 7421  O O     . ARG H  1 79  ? -52.740 -44.458 34.815  1.00 0.00 ? 85  ARG H O     1 
ATOM 7422  C CB    . ARG H  1 79  ? -50.629 -46.158 32.960  1.00 0.00 ? 85  ARG H CB    1 
ATOM 7423  C CG    . ARG H  1 79  ? -50.967 -44.924 32.157  1.00 0.00 ? 85  ARG H CG    1 
ATOM 7424  C CD    . ARG H  1 79  ? -50.716 -45.111 30.721  1.00 0.00 ? 85  ARG H CD    1 
ATOM 7425  N NE    . ARG H  1 79  ? -51.306 -44.048 29.943  1.00 0.00 ? 85  ARG H NE    1 
ATOM 7426  C CZ    . ARG H  1 79  ? -51.547 -44.107 28.623  1.00 0.00 ? 85  ARG H CZ    1 
ATOM 7427  N NH1   . ARG H  1 79  ? -51.227 -45.174 27.932  1.00 0.00 ? 85  ARG H NH1   1 
ATOM 7428  N NH2   . ARG H  1 79  ? -52.120 -43.088 28.014  1.00 0.00 ? 85  ARG H NH2   1 
ATOM 7429  N N     . ALA H  1 80  ? -53.348 -46.486 34.048  1.00 0.00 ? 86  ALA H N     1 
ATOM 7430  C CA    . ALA H  1 80  ? -54.760 -46.184 34.029  1.00 0.00 ? 86  ALA H CA    1 
ATOM 7431  C C     . ALA H  1 80  ? -55.243 -45.826 35.411  1.00 0.00 ? 86  ALA H C     1 
ATOM 7432  O O     . ALA H  1 80  ? -56.023 -44.896 35.583  1.00 0.00 ? 86  ALA H O     1 
ATOM 7433  C CB    . ALA H  1 80  ? -55.534 -47.359 33.493  1.00 0.00 ? 86  ALA H CB    1 
ATOM 7434  N N     . LEU H  1 81  ? -54.751 -46.535 36.408  1.00 0.00 ? 87  LEU H N     1 
ATOM 7435  C CA    . LEU H  1 81  ? -55.110 -46.229 37.761  1.00 0.00 ? 87  LEU H CA    1 
ATOM 7436  C C     . LEU H  1 81  ? -54.777 -44.789 38.088  1.00 0.00 ? 87  LEU H C     1 
ATOM 7437  O O     . LEU H  1 81  ? -55.612 -44.066 38.614  1.00 0.00 ? 87  LEU H O     1 
ATOM 7438  C CB    . LEU H  1 81  ? -54.407 -47.168 38.724  1.00 0.00 ? 87  LEU H CB    1 
ATOM 7439  C CG    . LEU H  1 81  ? -54.666 -46.906 40.198  1.00 0.00 ? 87  LEU H CG    1 
ATOM 7440  C CD1   . LEU H  1 81  ? -56.147 -47.046 40.481  1.00 0.00 ? 87  LEU H CD1   1 
ATOM 7441  C CD2   . LEU H  1 81  ? -53.859 -47.893 41.024  1.00 0.00 ? 87  LEU H CD2   1 
ATOM 7442  N N     . ASN H  1 82  ? -53.577 -44.348 37.738  1.00 0.00 ? 88  ASN H N     1 
ATOM 7443  C CA    . ASN H  1 82  ? -53.191 -42.967 38.017  1.00 0.00 ? 88  ASN H CA    1 
ATOM 7444  C C     . ASN H  1 82  ? -54.039 -41.932 37.275  1.00 0.00 ? 88  ASN H C     1 
ATOM 7445  O O     . ASN H  1 82  ? -54.438 -40.924 37.854  1.00 0.00 ? 88  ASN H O     1 
ATOM 7446  C CB    . ASN H  1 82  ? -51.734 -42.734 37.687  1.00 0.00 ? 88  ASN H CB    1 
ATOM 7447  C CG    . ASN H  1 82  ? -50.808 -43.317 38.694  1.00 0.00 ? 88  ASN H CG    1 
ATOM 7448  O OD1   . ASN H  1 82  ? -51.223 -43.728 39.780  1.00 0.00 ? 88  ASN H OD1   1 
ATOM 7449  N ND2   . ASN H  1 82  ? -49.549 -43.338 38.371  1.00 0.00 ? 88  ASN H ND2   1 
ATOM 7450  N N     . ARG H  1 83  ? -54.290 -42.165 35.993  1.00 0.00 ? 89  ARG H N     1 
ATOM 7451  C CA    . ARG H  1 83  ? -54.980 -41.171 35.173  1.00 0.00 ? 89  ARG H CA    1 
ATOM 7452  C C     . ARG H  1 83  ? -56.506 -41.233 35.296  1.00 0.00 ? 89  ARG H C     1 
ATOM 7453  O O     . ARG H  1 83  ? -57.188 -40.237 35.072  1.00 0.00 ? 89  ARG H O     1 
ATOM 7454  C CB    . ARG H  1 83  ? -54.563 -41.318 33.717  1.00 0.00 ? 89  ARG H CB    1 
ATOM 7455  C CG    . ARG H  1 83  ? -53.101 -40.936 33.434  1.00 0.00 ? 89  ARG H CG    1 
ATOM 7456  C CD    . ARG H  1 83  ? -52.736 -41.138 32.002  1.00 0.00 ? 89  ARG H CD    1 
ATOM 7457  N NE    . ARG H  1 83  ? -51.302 -40.926 31.747  1.00 0.00 ? 89  ARG H NE    1 
ATOM 7458  C CZ    . ARG H  1 83  ? -50.734 -39.754 31.400  1.00 0.00 ? 89  ARG H CZ    1 
ATOM 7459  N NH1   . ARG H  1 83  ? -51.467 -38.676 31.262  1.00 0.00 ? 89  ARG H NH1   1 
ATOM 7460  N NH2   . ARG H  1 83  ? -49.435 -39.694 31.190  1.00 0.00 ? 89  ARG H NH2   1 
ATOM 7461  N N     . ILE H  1 84  ? -57.034 -42.393 35.659  1.00 0.00 ? 90  ILE H N     1 
ATOM 7462  C CA    . ILE H  1 84  ? -58.478 -42.573 35.830  1.00 0.00 ? 90  ILE H CA    1 
ATOM 7463  C C     . ILE H  1 84  ? -58.876 -42.635 37.296  1.00 0.00 ? 90  ILE H C     1 
ATOM 7464  O O     . ILE H  1 84  ? -59.840 -41.995 37.722  1.00 0.00 ? 90  ILE H O     1 
ATOM 7465  C CB    . ILE H  1 84  ? -58.974 -43.858 35.138  1.00 0.00 ? 90  ILE H CB    1 
ATOM 7466  C CG1   . ILE H  1 84  ? -58.779 -43.777 33.631  1.00 0.00 ? 90  ILE H CG1   1 
ATOM 7467  C CG2   . ILE H  1 84  ? -60.422 -44.104 35.466  1.00 0.00 ? 90  ILE H CG2   1 
ATOM 7468  C CD1   . ILE H  1 84  ? -59.063 -45.079 32.924  1.00 0.00 ? 90  ILE H CD1   1 
ATOM 7469  N N     . GLY H  1 85  ? -58.185 -43.473 38.048  1.00 0.00 ? 91  GLY H N     1 
ATOM 7470  C CA    . GLY H  1 85  ? -58.534 -43.704 39.442  1.00 0.00 ? 91  GLY H CA    1 
ATOM 7471  C C     . GLY H  1 85  ? -59.360 -44.960 39.539  1.00 0.00 ? 91  GLY H C     1 
ATOM 7472  O O     . GLY H  1 85  ? -59.912 -45.412 38.545  1.00 0.00 ? 91  GLY H O     1 
ATOM 7473  N N     . SER H  1 86  ? -59.442 -45.535 40.729  1.00 0.00 ? 92  SER H N     1 
ATOM 7474  C CA    . SER H  1 86  ? -60.173 -46.786 40.894  1.00 0.00 ? 92  SER H CA    1 
ATOM 7475  C C     . SER H  1 86  ? -61.658 -46.582 40.725  1.00 0.00 ? 92  SER H C     1 
ATOM 7476  O O     . SER H  1 86  ? -62.161 -45.467 40.862  1.00 0.00 ? 92  SER H O     1 
ATOM 7477  C CB    . SER H  1 86  ? -59.901 -47.382 42.247  1.00 0.00 ? 92  SER H CB    1 
ATOM 7478  O OG    . SER H  1 86  ? -60.473 -46.602 43.256  1.00 0.00 ? 92  SER H OG    1 
ATOM 7479  N N     . GLY H  1 87  ? -62.365 -47.671 40.453  1.00 0.00 ? 93  GLY H N     1 
ATOM 7480  C CA    . GLY H  1 87  ? -63.799 -47.616 40.252  1.00 0.00 ? 93  GLY H CA    1 
ATOM 7481  C C     . GLY H  1 87  ? -64.168 -48.047 38.841  1.00 0.00 ? 93  GLY H C     1 
ATOM 7482  O O     . GLY H  1 87  ? -63.299 -48.418 38.054  1.00 0.00 ? 93  GLY H O     1 
ATOM 7483  N N     . PRO H  1 88  ? -65.461 -48.005 38.541  1.00 0.00 ? 94  PRO H N     1 
ATOM 7484  C CA    . PRO H  1 88  ? -66.113 -48.373 37.271  1.00 0.00 ? 94  PRO H CA    1 
ATOM 7485  C C     . PRO H  1 88  ? -65.209 -48.228 36.050  1.00 0.00 ? 94  PRO H C     1 
ATOM 7486  O O     . PRO H  1 88  ? -64.929 -49.211 35.364  1.00 0.00 ? 94  PRO H O     1 
ATOM 7487  C CB    . PRO H  1 88  ? -67.285 -47.388 37.180  1.00 0.00 ? 94  PRO H CB    1 
ATOM 7488  C CG    . PRO H  1 88  ? -67.576 -47.051 38.583  1.00 0.00 ? 94  PRO H CG    1 
ATOM 7489  C CD    . PRO H  1 88  ? -66.226 -46.936 39.198  1.00 0.00 ? 94  PRO H CD    1 
ATOM 7490  N N     . ALA H  1 89  ? -64.786 -47.001 35.761  1.00 0.00 ? 95  ALA H N     1 
ATOM 7491  C CA    . ALA H  1 89  ? -64.007 -46.727 34.564  1.00 0.00 ? 95  ALA H CA    1 
ATOM 7492  C C     . ALA H  1 89  ? -62.737 -47.536 34.510  1.00 0.00 ? 95  ALA H C     1 
ATOM 7493  O O     . ALA H  1 89  ? -62.324 -47.968 33.433  1.00 0.00 ? 95  ALA H O     1 
ATOM 7494  C CB    . ALA H  1 89  ? -63.685 -45.257 34.486  1.00 0.00 ? 95  ALA H CB    1 
ATOM 7495  N N     . LEU H  1 90  ? -62.102 -47.741 35.655  1.00 0.00 ? 96  LEU H N     1 
ATOM 7496  C CA    . LEU H  1 90  ? -60.878 -48.503 35.686  1.00 0.00 ? 96  LEU H CA    1 
ATOM 7497  C C     . LEU H  1 90  ? -61.155 -49.916 35.323  1.00 0.00 ? 96  LEU H C     1 
ATOM 7498  O O     . LEU H  1 90  ? -60.405 -50.530 34.575  1.00 0.00 ? 96  LEU H O     1 
ATOM 7499  C CB    . LEU H  1 90  ? -60.229 -48.465 37.043  1.00 0.00 ? 96  LEU H CB    1 
ATOM 7500  C CG    . LEU H  1 90  ? -58.903 -49.203 37.117  1.00 0.00 ? 96  LEU H CG    1 
ATOM 7501  C CD1   . LEU H  1 90  ? -57.922 -48.557 36.152  1.00 0.00 ? 96  LEU H CD1   1 
ATOM 7502  C CD2   . LEU H  1 90  ? -58.379 -49.172 38.529  1.00 0.00 ? 96  LEU H CD2   1 
ATOM 7503  N N     . VAL H  1 91  ? -62.235 -50.450 35.866  1.00 0.00 ? 97  VAL H N     1 
ATOM 7504  C CA    . VAL H  1 91  ? -62.627 -51.807 35.561  1.00 0.00 ? 97  VAL H CA    1 
ATOM 7505  C C     . VAL H  1 91  ? -62.881 -51.964 34.076  1.00 0.00 ? 97  VAL H C     1 
ATOM 7506  O O     . VAL H  1 91  ? -62.431 -52.932 33.464  1.00 0.00 ? 97  VAL H O     1 
ATOM 7507  C CB    . VAL H  1 91  ? -63.872 -52.203 36.355  1.00 0.00 ? 97  VAL H CB    1 
ATOM 7508  C CG1   . VAL H  1 91  ? -64.403 -53.540 35.870  1.00 0.00 ? 97  VAL H CG1   1 
ATOM 7509  C CG2   . VAL H  1 91  ? -63.521 -52.268 37.829  1.00 0.00 ? 97  VAL H CG2   1 
ATOM 7510  N N     . ASN H  1 92  ? -63.575 -50.987 33.488  1.00 0.00 ? 98  ASN H N     1 
ATOM 7511  C CA    . ASN H  1 92  ? -63.835 -51.001 32.061  1.00 0.00 ? 98  ASN H CA    1 
ATOM 7512  C C     . ASN H  1 92  ? -62.531 -51.062 31.292  1.00 0.00 ? 98  ASN H C     1 
ATOM 7513  O O     . ASN H  1 92  ? -62.378 -51.867 30.366  1.00 0.00 ? 98  ASN H O     1 
ATOM 7514  C CB    . ASN H  1 92  ? -64.634 -49.774 31.656  1.00 0.00 ? 98  ASN H CB    1 
ATOM 7515  C CG    . ASN H  1 92  ? -66.044 -49.852 32.127  1.00 0.00 ? 98  ASN H CG    1 
ATOM 7516  O OD1   . ASN H  1 92  ? -66.503 -50.937 32.498  1.00 0.00 ? 98  ASN H OD1   1 
ATOM 7517  N ND2   . ASN H  1 92  ? -66.753 -48.747 32.120  1.00 0.00 ? 98  ASN H ND2   1 
ATOM 7518  N N     . MET H  1 93  ? -61.573 -50.254 31.720  1.00 0.00 ? 99  MET H N     1 
ATOM 7519  C CA    . MET H  1 93  ? -60.270 -50.230 31.117  1.00 0.00 ? 99  MET H CA    1 
ATOM 7520  C C     . MET H  1 93  ? -59.573 -51.554 31.210  1.00 0.00 ? 99  MET H C     1 
ATOM 7521  O O     . MET H  1 93  ? -59.069 -52.065 30.209  1.00 0.00 ? 99  MET H O     1 
ATOM 7522  C CB    . MET H  1 93  ? -59.415 -49.173 31.770  1.00 0.00 ? 99  MET H CB    1 
ATOM 7523  C CG    . MET H  1 93  ? -58.004 -49.152 31.260  1.00 0.00 ? 99  MET H CG    1 
ATOM 7524  S SD    . MET H  1 93  ? -57.905 -48.659 29.560  1.00 0.00 ? 99  MET H SD    1 
ATOM 7525  C CE    . MET H  1 93  ? -58.065 -46.888 29.758  1.00 0.00 ? 99  MET H CE    1 
ATOM 7526  N N     . ILE H  1 94  ? -59.519 -52.104 32.413  1.00 0.00 ? 100 ILE H N     1 
ATOM 7527  C CA    . ILE H  1 94  ? -58.787 -53.323 32.645  1.00 0.00 ? 100 ILE H CA    1 
ATOM 7528  C C     . ILE H  1 94  ? -59.353 -54.461 31.857  1.00 0.00 ? 100 ILE H C     1 
ATOM 7529  O O     . ILE H  1 94  ? -58.605 -55.278 31.337  1.00 0.00 ? 100 ILE H O     1 
ATOM 7530  C CB    . ILE H  1 94  ? -58.757 -53.695 34.114  1.00 0.00 ? 100 ILE H CB    1 
ATOM 7531  C CG1   . ILE H  1 94  ? -57.939 -52.676 34.896  1.00 0.00 ? 100 ILE H CG1   1 
ATOM 7532  C CG2   . ILE H  1 94  ? -58.135 -55.068 34.265  1.00 0.00 ? 100 ILE H CG2   1 
ATOM 7533  C CD1   . ILE H  1 94  ? -58.082 -52.815 36.390  1.00 0.00 ? 100 ILE H CD1   1 
ATOM 7534  N N     . ASN H  1 95  ? -60.676 -54.538 31.773  1.00 0.00 ? 101 ASN H N     1 
ATOM 7535  C CA    . ASN H  1 95  ? -61.307 -55.603 31.012  1.00 0.00 ? 101 ASN H CA    1 
ATOM 7536  C C     . ASN H  1 95  ? -60.818 -55.612 29.578  1.00 0.00 ? 101 ASN H C     1 
ATOM 7537  O O     . ASN H  1 95  ? -60.462 -56.668 29.045  1.00 0.00 ? 101 ASN H O     1 
ATOM 7538  C CB    . ASN H  1 95  ? -62.813 -55.472 31.042  1.00 0.00 ? 101 ASN H CB    1 
ATOM 7539  C CG    . ASN H  1 95  ? -63.389 -55.850 32.360  1.00 0.00 ? 101 ASN H CG    1 
ATOM 7540  O OD1   . ASN H  1 95  ? -62.677 -56.409 33.201  1.00 0.00 ? 101 ASN H OD1   1 
ATOM 7541  N ND2   . ASN H  1 95  ? -64.660 -55.580 32.556  1.00 0.00 ? 101 ASN H ND2   1 
ATOM 7542  N N     . GLY H  1 96  ? -60.771 -54.430 28.959  1.00 0.00 ? 102 GLY H N     1 
ATOM 7543  C CA    . GLY H  1 96  ? -60.307 -54.326 27.587  1.00 0.00 ? 102 GLY H CA    1 
ATOM 7544  C C     . GLY H  1 96  ? -58.831 -54.592 27.480  1.00 0.00 ? 102 GLY H C     1 
ATOM 7545  O O     . GLY H  1 96  ? -58.385 -55.270 26.558  1.00 0.00 ? 102 GLY H O     1 
ATOM 7546  N N     . LEU H  1 97  ? -58.075 -54.078 28.432  1.00 0.00 ? 103 LEU H N     1 
ATOM 7547  C CA    . LEU H  1 97  ? -56.645 -54.265 28.458  1.00 0.00 ? 103 LEU H CA    1 
ATOM 7548  C C     . LEU H  1 97  ? -56.258 -55.718 28.593  1.00 0.00 ? 103 LEU H C     1 
ATOM 7549  O O     . LEU H  1 97  ? -55.352 -56.195 27.910  1.00 0.00 ? 103 LEU H O     1 
ATOM 7550  C CB    . LEU H  1 97  ? -56.040 -53.472 29.582  1.00 0.00 ? 103 LEU H CB    1 
ATOM 7551  C CG    . LEU H  1 97  ? -54.562 -53.673 29.743  1.00 0.00 ? 103 LEU H CG    1 
ATOM 7552  C CD1   . LEU H  1 97  ? -53.901 -53.344 28.446  1.00 0.00 ? 103 LEU H CD1   1 
ATOM 7553  C CD2   . LEU H  1 97  ? -54.052 -52.787 30.860  1.00 0.00 ? 103 LEU H CD2   1 
ATOM 7554  N N     . LYS H  1 98  ? -56.898 -56.405 29.508  1.00 0.00 ? 104 LYS H N     1 
ATOM 7555  C CA    . LYS H  1 98  ? -56.645 -57.803 29.703  1.00 0.00 ? 104 LYS H CA    1 
ATOM 7556  C C     . LYS H  1 98  ? -56.882 -58.577 28.430  1.00 0.00 ? 104 LYS H C     1 
ATOM 7557  O O     . LYS H  1 98  ? -55.997 -59.292 27.965  1.00 0.00 ? 104 LYS H O     1 
ATOM 7558  C CB    . LYS H  1 98  ? -57.509 -58.343 30.821  1.00 0.00 ? 104 LYS H CB    1 
ATOM 7559  C CG    . LYS H  1 98  ? -57.333 -59.823 31.066  1.00 0.00 ? 104 LYS H CG    1 
ATOM 7560  C CD    . LYS H  1 98  ? -58.196 -60.300 32.214  1.00 0.00 ? 104 LYS H CD    1 
ATOM 7561  C CE    . LYS H  1 98  ? -58.202 -61.817 32.300  1.00 0.00 ? 104 LYS H CE    1 
ATOM 7562  N NZ    . LYS H  1 98  ? -59.035 -62.300 33.427  1.00 0.00 ? 104 LYS H NZ    1 
ATOM 7563  N N     . GLY H  1 99  ? -58.072 -58.417 27.846  1.00 0.00 ? 105 GLY H N     1 
ATOM 7564  C CA    . GLY H  1 99  ? -58.418 -59.116 26.612  1.00 0.00 ? 105 GLY H CA    1 
ATOM 7565  C C     . GLY H  1 99  ? -57.416 -58.806 25.518  1.00 0.00 ? 105 GLY H C     1 
ATOM 7566  O O     . GLY H  1 99  ? -56.993 -59.698 24.777  1.00 0.00 ? 105 GLY H O     1 
ATOM 7567  N N     . TYR H  1 100 ? -57.023 -57.539 25.442  1.00 0.00 ? 106 TYR H N     1 
ATOM 7568  C CA    . TYR H  1 100 ? -56.032 -57.076 24.498  1.00 0.00 ? 106 TYR H CA    1 
ATOM 7569  C C     . TYR H  1 100 ? -54.771 -57.889 24.569  1.00 0.00 ? 106 TYR H C     1 
ATOM 7570  O O     . TYR H  1 100 ? -54.350 -58.454 23.575  1.00 0.00 ? 106 TYR H O     1 
ATOM 7571  C CB    . TYR H  1 100 ? -55.744 -55.610 24.768  1.00 0.00 ? 106 TYR H CB    1 
ATOM 7572  C CG    . TYR H  1 100 ? -54.568 -55.023 24.039  1.00 0.00 ? 106 TYR H CG    1 
ATOM 7573  C CD1   . TYR H  1 100 ? -54.595 -54.836 22.676  1.00 0.00 ? 106 TYR H CD1   1 
ATOM 7574  C CD2   . TYR H  1 100 ? -53.470 -54.625 24.766  1.00 0.00 ? 106 TYR H CD2   1 
ATOM 7575  C CE1   . TYR H  1 100 ? -53.512 -54.268 22.039  1.00 0.00 ? 106 TYR H CE1   1 
ATOM 7576  C CE2   . TYR H  1 100 ? -52.394 -54.054 24.140  1.00 0.00 ? 106 TYR H CE2   1 
ATOM 7577  C CZ    . TYR H  1 100 ? -52.409 -53.877 22.782  1.00 0.00 ? 106 TYR H CZ    1 
ATOM 7578  O OH    . TYR H  1 100 ? -51.326 -53.306 22.158  1.00 0.00 ? 106 TYR H OH    1 
ATOM 7579  N N     . TYR H  1 101 ? -54.185 -57.989 25.746  1.00 0.00 ? 107 TYR H N     1 
ATOM 7580  C CA    . TYR H  1 101 ? -52.968 -58.763 25.903  1.00 0.00 ? 107 TYR H CA    1 
ATOM 7581  C C     . TYR H  1 101 ? -53.151 -60.242 25.661  1.00 0.00 ? 107 TYR H C     1 
ATOM 7582  O O     . TYR H  1 101 ? -52.285 -60.884 25.061  1.00 0.00 ? 107 TYR H O     1 
ATOM 7583  C CB    . TYR H  1 101 ? -52.373 -58.538 27.274  1.00 0.00 ? 107 TYR H CB    1 
ATOM 7584  C CG    . TYR H  1 101 ? -51.345 -57.458 27.292  1.00 0.00 ? 107 TYR H CG    1 
ATOM 7585  C CD1   . TYR H  1 101 ? -51.702 -56.144 27.472  1.00 0.00 ? 107 TYR H CD1   1 
ATOM 7586  C CD2   . TYR H  1 101 ? -50.021 -57.803 27.129  1.00 0.00 ? 107 TYR H CD2   1 
ATOM 7587  C CE1   . TYR H  1 101 ? -50.730 -55.167 27.476  1.00 0.00 ? 107 TYR H CE1   1 
ATOM 7588  C CE2   . TYR H  1 101 ? -49.051 -56.833 27.134  1.00 0.00 ? 107 TYR H CE2   1 
ATOM 7589  C CZ    . TYR H  1 101 ? -49.401 -55.522 27.305  1.00 0.00 ? 107 TYR H CZ    1 
ATOM 7590  O OH    . TYR H  1 101 ? -48.429 -54.557 27.309  1.00 0.00 ? 107 TYR H OH    1 
ATOM 7591  N N     . ILE H  1 102 ? -54.281 -60.785 26.076  1.00 0.00 ? 108 ILE H N     1 
ATOM 7592  C CA    . ILE H  1 102 ? -54.513 -62.197 25.903  1.00 0.00 ? 108 ILE H CA    1 
ATOM 7593  C C     . ILE H  1 102 ? -54.476 -62.595 24.461  1.00 0.00 ? 108 ILE H C     1 
ATOM 7594  O O     . ILE H  1 102 ? -53.854 -63.586 24.104  1.00 0.00 ? 108 ILE H O     1 
ATOM 7595  C CB    . ILE H  1 102 ? -55.859 -62.620 26.472  1.00 0.00 ? 108 ILE H CB    1 
ATOM 7596  C CG1   . ILE H  1 102 ? -55.860 -62.506 27.975  1.00 0.00 ? 108 ILE H CG1   1 
ATOM 7597  C CG2   . ILE H  1 102 ? -56.163 -64.044 26.057  1.00 0.00 ? 108 ILE H CG2   1 
ATOM 7598  C CD1   . ILE H  1 102 ? -57.228 -62.631 28.589  1.00 0.00 ? 108 ILE H CD1   1 
ATOM 7599  N N     . SER H  1 103 ? -55.169 -61.853 23.625  1.00 0.00 ? 109 SER H N     1 
ATOM 7600  C CA    . SER H  1 103 ? -55.276 -62.232 22.236  1.00 0.00 ? 109 SER H CA    1 
ATOM 7601  C C     . SER H  1 103 ? -54.249 -61.573 21.331  1.00 0.00 ? 109 SER H C     1 
ATOM 7602  O O     . SER H  1 103 ? -53.860 -62.150 20.320  1.00 0.00 ? 109 SER H O     1 
ATOM 7603  C CB    . SER H  1 103 ? -56.656 -61.917 21.750  1.00 0.00 ? 109 SER H CB    1 
ATOM 7604  O OG    . SER H  1 103 ? -56.904 -60.548 21.832  1.00 0.00 ? 109 SER H OG    1 
ATOM 7605  N N     . ALA H  1 104 ? -53.797 -60.379 21.682  1.00 0.00 ? 110 ALA H N     1 
ATOM 7606  C CA    . ALA H  1 104 ? -52.818 -59.704 20.844  1.00 0.00 ? 110 ALA H CA    1 
ATOM 7607  C C     . ALA H  1 104 ? -51.453 -60.283 21.023  1.00 0.00 ? 110 ALA H C     1 
ATOM 7608  O O     . ALA H  1 104 ? -50.713 -60.402 20.054  1.00 0.00 ? 110 ALA H O     1 
ATOM 7609  C CB    . ALA H  1 104 ? -52.766 -58.210 21.135  1.00 0.00 ? 110 ALA H CB    1 
ATOM 7610  N N     . PHE H  1 105 ? -51.097 -60.625 22.268  1.00 0.00 ? 111 PHE H N     1 
ATOM 7611  C CA    . PHE H  1 105 ? -49.759 -61.099 22.562  1.00 0.00 ? 111 PHE H CA    1 
ATOM 7612  C C     . PHE H  1 105 ? -49.737 -62.483 23.141  1.00 0.00 ? 111 PHE H C     1 
ATOM 7613  O O     . PHE H  1 105 ? -48.692 -62.945 23.592  1.00 0.00 ? 111 PHE H O     1 
ATOM 7614  C CB    . PHE H  1 105 ? -49.094 -60.158 23.530  1.00 0.00 ? 111 PHE H CB    1 
ATOM 7615  C CG    . PHE H  1 105 ? -49.018 -58.781 23.000  1.00 0.00 ? 111 PHE H CG    1 
ATOM 7616  C CD1   . PHE H  1 105 ? -49.768 -57.775 23.561  1.00 0.00 ? 111 PHE H CD1   1 
ATOM 7617  C CD2   . PHE H  1 105 ? -48.232 -58.499 21.910  1.00 0.00 ? 111 PHE H CD2   1 
ATOM 7618  C CE1   . PHE H  1 105 ? -49.723 -56.502 23.054  1.00 0.00 ? 111 PHE H CE1   1 
ATOM 7619  C CE2   . PHE H  1 105 ? -48.185 -57.232 21.394  1.00 0.00 ? 111 PHE H CE2   1 
ATOM 7620  C CZ    . PHE H  1 105 ? -48.932 -56.229 21.968  1.00 0.00 ? 111 PHE H CZ    1 
ATOM 7621  N N     . ASN H  1 106 ? -50.884 -63.144 23.152  1.00 0.00 ? 112 ASN H N     1 
ATOM 7622  C CA    . ASN H  1 106 ? -50.977 -64.489 23.702  1.00 0.00 ? 112 ASN H CA    1 
ATOM 7623  C C     . ASN H  1 106 ? -50.568 -64.524 25.162  1.00 0.00 ? 112 ASN H C     1 
ATOM 7624  O O     . ASN H  1 106 ? -49.925 -65.475 25.607  1.00 0.00 ? 112 ASN H O     1 
ATOM 7625  C CB    . ASN H  1 106 ? -50.148 -65.461 22.899  1.00 0.00 ? 112 ASN H CB    1 
ATOM 7626  C CG    . ASN H  1 106 ? -50.641 -65.585 21.496  1.00 0.00 ? 112 ASN H CG    1 
ATOM 7627  O OD1   . ASN H  1 106 ? -51.845 -65.501 21.244  1.00 0.00 ? 112 ASN H OD1   1 
ATOM 7628  N ND2   . ASN H  1 106 ? -49.737 -65.787 20.576  1.00 0.00 ? 112 ASN H ND2   1 
ATOM 7629  N N     . ALA H  1 107 ? -50.933 -63.490 25.912  1.00 0.00 ? 113 ALA H N     1 
ATOM 7630  C CA    . ALA H  1 107 ? -50.625 -63.460 27.325  1.00 0.00 ? 113 ALA H CA    1 
ATOM 7631  C C     . ALA H  1 107 ? -51.544 -64.415 28.064  1.00 0.00 ? 113 ALA H C     1 
ATOM 7632  O O     . ALA H  1 107 ? -52.700 -64.589 27.686  1.00 0.00 ? 113 ALA H O     1 
ATOM 7633  C CB    . ALA H  1 107 ? -50.753 -62.060 27.864  1.00 0.00 ? 113 ALA H CB    1 
ATOM 7634  N N     . ASN H  1 108 ? -51.018 -65.055 29.101  1.00 0.00 ? 114 ASN H N     1 
ATOM 7635  C CA    . ASN H  1 108 ? -51.769 -66.059 29.841  1.00 0.00 ? 114 ASN H CA    1 
ATOM 7636  C C     . ASN H  1 108 ? -52.663 -65.447 30.924  1.00 0.00 ? 114 ASN H C     1 
ATOM 7637  O O     . ASN H  1 108 ? -52.159 -65.040 31.970  1.00 0.00 ? 114 ASN H O     1 
ATOM 7638  C CB    . ASN H  1 108 ? -50.830 -67.052 30.463  1.00 0.00 ? 114 ASN H CB    1 
ATOM 7639  C CG    . ASN H  1 108 ? -51.556 -68.133 31.184  1.00 0.00 ? 114 ASN H CG    1 
ATOM 7640  O OD1   . ASN H  1 108 ? -52.649 -67.916 31.714  1.00 0.00 ? 114 ASN H OD1   1 
ATOM 7641  N ND2   . ASN H  1 108 ? -50.974 -69.301 31.216  1.00 0.00 ? 114 ASN H ND2   1 
ATOM 7642  N N     . PRO H  1 109 ? -53.992 -65.397 30.684  1.00 0.00 ? 115 PRO H N     1 
ATOM 7643  C CA    . PRO H  1 109 ? -55.049 -64.929 31.603  1.00 0.00 ? 115 PRO H CA    1 
ATOM 7644  C C     . PRO H  1 109 ? -54.718 -65.142 33.073  1.00 0.00 ? 115 PRO H C     1 
ATOM 7645  O O     . PRO H  1 109 ? -54.955 -64.261 33.894  1.00 0.00 ? 115 PRO H O     1 
ATOM 7646  C CB    . PRO H  1 109 ? -56.250 -65.797 31.228  1.00 0.00 ? 115 PRO H CB    1 
ATOM 7647  C CG    . PRO H  1 109 ? -56.028 -66.139 29.819  1.00 0.00 ? 115 PRO H CG    1 
ATOM 7648  C CD    . PRO H  1 109 ? -54.559 -66.383 29.740  1.00 0.00 ? 115 PRO H CD    1 
ATOM 7649  N N     . GLN H  1 110 ? -54.202 -66.317 33.410  1.00 0.00 ? 116 GLN H N     1 
ATOM 7650  C CA    . GLN H  1 110 ? -53.900 -66.646 34.790  1.00 0.00 ? 116 GLN H CA    1 
ATOM 7651  C C     . GLN H  1 110 ? -52.869 -65.726 35.382  1.00 0.00 ? 116 GLN H C     1 
ATOM 7652  O O     . GLN H  1 110 ? -53.030 -65.230 36.499  1.00 0.00 ? 116 GLN H O     1 
ATOM 7653  C CB    . GLN H  1 110 ? -53.411 -68.074 34.897  1.00 0.00 ? 116 GLN H CB    1 
ATOM 7654  C CG    . GLN H  1 110 ? -53.053 -68.482 36.300  1.00 0.00 ? 116 GLN H CG    1 
ATOM 7655  C CD    . GLN H  1 110 ? -54.238 -68.425 37.216  1.00 0.00 ? 116 GLN H CD    1 
ATOM 7656  O OE1   . GLN H  1 110 ? -55.352 -68.771 36.818  1.00 0.00 ? 116 GLN H OE1   1 
ATOM 7657  N NE2   . GLN H  1 110 ? -54.018 -67.985 38.451  1.00 0.00 ? 116 GLN H NE2   1 
ATOM 7658  N N     . VAL H  1 111 ? -51.807 -65.499 34.650  1.00 0.00 ? 117 VAL H N     1 
ATOM 7659  C CA    . VAL H  1 111 ? -50.771 -64.650 35.139  1.00 0.00 ? 117 VAL H CA    1 
ATOM 7660  C C     . VAL H  1 111 ? -51.245 -63.228 35.114  1.00 0.00 ? 117 VAL H C     1 
ATOM 7661  O O     . VAL H  1 111 ? -50.939 -62.456 36.014  1.00 0.00 ? 117 VAL H O     1 
ATOM 7662  C CB    . VAL H  1 111 ? -49.506 -64.799 34.318  1.00 0.00 ? 117 VAL H CB    1 
ATOM 7663  C CG1   . VAL H  1 111 ? -48.472 -63.801 34.798  1.00 0.00 ? 117 VAL H CG1   1 
ATOM 7664  C CG2   . VAL H  1 111 ? -48.986 -66.214 34.431  1.00 0.00 ? 117 VAL H CG2   1 
ATOM 7665  N N     . LEU H  1 112 ? -52.016 -62.878 34.087  1.00 0.00 ? 118 LEU H N     1 
ATOM 7666  C CA    . LEU H  1 112 ? -52.538 -61.529 33.958  1.00 0.00 ? 118 LEU H CA    1 
ATOM 7667  C C     . LEU H  1 112 ? -53.376 -61.171 35.153  1.00 0.00 ? 118 LEU H C     1 
ATOM 7668  O O     . LEU H  1 112 ? -53.292 -60.058 35.670  1.00 0.00 ? 118 LEU H O     1 
ATOM 7669  C CB    . LEU H  1 112 ? -53.386 -61.407 32.705  1.00 0.00 ? 118 LEU H CB    1 
ATOM 7670  C CG    . LEU H  1 112 ? -52.641 -61.495 31.390  1.00 0.00 ? 118 LEU H CG    1 
ATOM 7671  C CD1   . LEU H  1 112 ? -53.636 -61.545 30.271  1.00 0.00 ? 118 LEU H CD1   1 
ATOM 7672  C CD2   . LEU H  1 112 ? -51.745 -60.296 31.242  1.00 0.00 ? 118 LEU H CD2   1 
ATOM 7673  N N     . ASP H  1 113 ? -54.164 -62.126 35.617  1.00 0.00 ? 119 ASP H N     1 
ATOM 7674  C CA    . ASP H  1 113 ? -54.971 -61.921 36.788  1.00 0.00 ? 119 ASP H CA    1 
ATOM 7675  C C     . ASP H  1 113 ? -54.120 -61.739 37.994  1.00 0.00 ? 119 ASP H C     1 
ATOM 7676  O O     . ASP H  1 113 ? -54.392 -60.872 38.816  1.00 0.00 ? 119 ASP H O     1 
ATOM 7677  C CB    . ASP H  1 113 ? -55.914 -63.074 36.983  1.00 0.00 ? 119 ASP H CB    1 
ATOM 7678  C CG    . ASP H  1 113 ? -57.030 -63.037 35.978  1.00 0.00 ? 119 ASP H CG    1 
ATOM 7679  O OD1   . ASP H  1 113 ? -57.277 -61.978 35.452  1.00 0.00 ? 119 ASP H OD1   1 
ATOM 7680  O OD2   . ASP H  1 113 ? -57.623 -64.055 35.723  1.00 0.00 ? 119 ASP H OD2   1 
ATOM 7681  N N     . ALA H  1 114 ? -53.050 -62.521 38.090  1.00 0.00 ? 120 ALA H N     1 
ATOM 7682  C CA    . ALA H  1 114 ? -52.135 -62.393 39.201  1.00 0.00 ? 120 ALA H CA    1 
ATOM 7683  C C     . ALA H  1 114 ? -51.553 -60.998 39.264  1.00 0.00 ? 120 ALA H C     1 
ATOM 7684  O O     . ALA H  1 114 ? -51.455 -60.418 40.338  1.00 0.00 ? 120 ALA H O     1 
ATOM 7685  C CB    . ALA H  1 114 ? -51.031 -63.415 39.095  1.00 0.00 ? 120 ALA H CB    1 
ATOM 7686  N N     . VAL H  1 115 ? -51.206 -60.440 38.108  1.00 0.00 ? 121 VAL H N     1 
ATOM 7687  C CA    . VAL H  1 115 ? -50.667 -59.091 38.060  1.00 0.00 ? 121 VAL H CA    1 
ATOM 7688  C C     . VAL H  1 115 ? -51.680 -58.088 38.571  1.00 0.00 ? 121 VAL H C     1 
ATOM 7689  O O     . VAL H  1 115 ? -51.352 -57.238 39.400  1.00 0.00 ? 121 VAL H O     1 
ATOM 7690  C CB    . VAL H  1 115 ? -50.257 -58.713 36.639  1.00 0.00 ? 121 VAL H CB    1 
ATOM 7691  C CG1   . VAL H  1 115 ? -49.900 -57.248 36.590  1.00 0.00 ? 121 VAL H CG1   1 
ATOM 7692  C CG2   . VAL H  1 115 ? -49.078 -59.562 36.194  1.00 0.00 ? 121 VAL H CG2   1 
ATOM 7693  N N     . VAL H  1 116 ? -52.919 -58.215 38.115  1.00 0.00 ? 122 VAL H N     1 
ATOM 7694  C CA    . VAL H  1 116 ? -53.985 -57.333 38.565  1.00 0.00 ? 122 VAL H CA    1 
ATOM 7695  C C     . VAL H  1 116 ? -54.219 -57.487 40.064  1.00 0.00 ? 122 VAL H C     1 
ATOM 7696  O O     . VAL H  1 116 ? -54.454 -56.510 40.772  1.00 0.00 ? 122 VAL H O     1 
ATOM 7697  C CB    . VAL H  1 116 ? -55.282 -57.624 37.800  1.00 0.00 ? 122 VAL H CB    1 
ATOM 7698  C CG1   . VAL H  1 116 ? -56.427 -56.850 38.398  1.00 0.00 ? 122 VAL H CG1   1 
ATOM 7699  C CG2   . VAL H  1 116 ? -55.108 -57.252 36.351  1.00 0.00 ? 122 VAL H CG2   1 
ATOM 7700  N N     . ASN H  1 117 ? -54.079 -58.717 40.556  1.00 0.00 ? 123 ASN H N     1 
ATOM 7701  C CA    . ASN H  1 117 ? -54.265 -59.016 41.966  1.00 0.00 ? 123 ASN H CA    1 
ATOM 7702  C C     . ASN H  1 117 ? -53.181 -58.418 42.859  1.00 0.00 ? 123 ASN H C     1 
ATOM 7703  O O     . ASN H  1 117 ? -53.257 -58.522 44.079  1.00 0.00 ? 123 ASN H O     1 
ATOM 7704  C CB    . ASN H  1 117 ? -54.345 -60.498 42.180  1.00 0.00 ? 123 ASN H CB    1 
ATOM 7705  C CG    . ASN H  1 117 ? -55.598 -61.064 41.622  1.00 0.00 ? 123 ASN H CG    1 
ATOM 7706  O OD1   . ASN H  1 117 ? -56.545 -60.324 41.346  1.00 0.00 ? 123 ASN H OD1   1 
ATOM 7707  N ND2   . ASN H  1 117 ? -55.633 -62.361 41.448  1.00 0.00 ? 123 ASN H ND2   1 
ATOM 7708  N N     . ILE H  1 118 ? -52.181 -57.796 42.261  1.00 0.00 ? 124 ILE H N     1 
ATOM 7709  C CA    . ILE H  1 118 ? -51.179 -57.093 43.004  1.00 0.00 ? 124 ILE H CA    1 
ATOM 7710  C C     . ILE H  1 118 ? -51.461 -55.636 42.986  1.00 0.00 ? 124 ILE H C     1 
ATOM 7711  O O     . ILE H  1 118 ? -51.499 -54.984 44.026  1.00 0.00 ? 124 ILE H O     1 
ATOM 7712  C CB    . ILE H  1 118 ? -49.807 -57.316 42.420  1.00 0.00 ? 124 ILE H CB    1 
ATOM 7713  C CG1   . ILE H  1 118 ? -49.460 -58.775 42.456  1.00 0.00 ? 124 ILE H CG1   1 
ATOM 7714  C CG2   . ILE H  1 118 ? -48.787 -56.491 43.152  1.00 0.00 ? 124 ILE H CG2   1 
ATOM 7715  C CD1   . ILE H  1 118 ? -49.467 -59.359 43.843  1.00 0.00 ? 124 ILE H CD1   1 
ATOM 7716  N N     . ILE H  1 119 ? -51.643 -55.116 41.792  1.00 0.00 ? 125 ILE H N     1 
ATOM 7717  C CA    . ILE H  1 119 ? -51.851 -53.701 41.596  1.00 0.00 ? 125 ILE H CA    1 
ATOM 7718  C C     . ILE H  1 119 ? -53.166 -53.239 42.182  1.00 0.00 ? 125 ILE H C     1 
ATOM 7719  O O     . ILE H  1 119 ? -53.217 -52.244 42.901  1.00 0.00 ? 125 ILE H O     1 
ATOM 7720  C CB    . ILE H  1 119 ? -51.806 -53.376 40.120  1.00 0.00 ? 125 ILE H CB    1 
ATOM 7721  C CG1   . ILE H  1 119 ? -50.410 -53.629 39.595  1.00 0.00 ? 125 ILE H CG1   1 
ATOM 7722  C CG2   . ILE H  1 119 ? -52.207 -51.933 39.890  1.00 0.00 ? 125 ILE H CG2   1 
ATOM 7723  C CD1   . ILE H  1 119 ? -50.335 -53.627 38.104  1.00 0.00 ? 125 ILE H CD1   1 
ATOM 7724  N N     . THR H  1 120 ? -54.235 -53.956 41.875  1.00 0.00 ? 126 THR H N     1 
ATOM 7725  C CA    . THR H  1 120 ? -55.540 -53.603 42.386  1.00 0.00 ? 126 THR H CA    1 
ATOM 7726  C C     . THR H  1 120 ? -55.833 -54.377 43.630  1.00 0.00 ? 126 THR H C     1 
ATOM 7727  O O     . THR H  1 120 ? -56.482 -53.879 44.550  1.00 0.00 ? 126 THR H O     1 
ATOM 7728  C CB    . THR H  1 120 ? -56.617 -53.944 41.391  1.00 0.00 ? 126 THR H CB    1 
ATOM 7729  O OG1   . THR H  1 120 ? -56.636 -55.365 41.229  1.00 0.00 ? 126 THR H OG1   1 
ATOM 7730  C CG2   . THR H  1 120 ? -56.333 -53.286 40.053  1.00 0.00 ? 126 THR H CG2   1 
ATOM 7731  N N     . GLY H  1 121 ? -55.347 -55.605 43.669  1.00 0.00 ? 127 GLY H N     1 
ATOM 7732  C CA    . GLY H  1 121 ? -55.580 -56.468 44.805  1.00 0.00 ? 127 GLY H CA    1 
ATOM 7733  C C     . GLY H  1 121 ? -56.692 -57.460 44.514  1.00 0.00 ? 127 GLY H C     1 
ATOM 7734  O O     . GLY H  1 121 ? -56.882 -58.425 45.250  1.00 0.00 ? 127 GLY H O     1 
ATOM 7735  N N     . SER H  1 122 ? -57.428 -57.225 43.436  1.00 0.00 ? 128 SER H N     1 
ATOM 7736  C CA    . SER H  1 122 ? -58.538 -58.082 43.088  1.00 0.00 ? 128 SER H CA    1 
ATOM 7737  C C     . SER H  1 122 ? -58.704 -58.139 41.586  1.00 0.00 ? 128 SER H C     1 
ATOM 7738  O O     . SER H  1 122 ? -58.335 -57.197 40.889  1.00 0.00 ? 128 SER H O     1 
ATOM 7739  C CB    . SER H  1 122 ? -59.820 -57.552 43.703  1.00 0.00 ? 128 SER H CB    1 
ATOM 7740  O OG    . SER H  1 122 ? -60.186 -56.336 43.109  1.00 0.00 ? 128 SER H OG    1 
ATOM 7741  N N     . PRO H  1 123 ? -59.309 -59.213 41.076  1.00 0.00 ? 129 PRO H N     1 
ATOM 7742  C CA    . PRO H  1 123 ? -59.640 -59.463 39.691  1.00 0.00 ? 129 PRO H CA    1 
ATOM 7743  C C     . PRO H  1 123 ? -60.569 -58.394 39.169  1.00 0.00 ? 129 PRO H C     1 
ATOM 7744  O O     . PRO H  1 123 ? -61.240 -57.704 39.933  1.00 0.00 ? 129 PRO H O     1 
ATOM 7745  C CB    . PRO H  1 123 ? -60.305 -60.837 39.720  1.00 0.00 ? 129 PRO H CB    1 
ATOM 7746  C CG    . PRO H  1 123 ? -59.724 -61.515 40.913  1.00 0.00 ? 129 PRO H CG    1 
ATOM 7747  C CD    . PRO H  1 123 ? -59.506 -60.422 41.912  1.00 0.00 ? 129 PRO H CD    1 
ATOM 7748  N N     . THR H  1 124 ? -60.597 -58.252 37.862  1.00 0.00 ? 130 THR H N     1 
ATOM 7749  C CA    . THR H  1 124 ? -61.443 -57.272 37.226  1.00 0.00 ? 130 THR H CA    1 
ATOM 7750  C C     . THR H  1 124 ? -62.815 -57.850 36.916  1.00 0.00 ? 130 THR H C     1 
ATOM 7751  O O     . THR H  1 124 ? -63.375 -58.589 37.723  1.00 0.00 ? 130 THR H O     1 
ATOM 7752  C CB    . THR H  1 124 ? -60.776 -56.739 35.952  1.00 0.00 ? 130 THR H CB    1 
ATOM 7753  O OG1   . THR H  1 124 ? -61.621 -55.752 35.351  1.00 0.00 ? 130 THR H OG1   1 
ATOM 7754  C CG2   . THR H  1 124 ? -60.474 -57.871 34.953  1.00 0.00 ? 130 THR H CG2   1 
ATOM 7755  N N     . GLY H  1 125 ? -63.380 -57.498 35.762  1.00 0.00 ? 131 GLY H N     1 
ATOM 7756  C CA    . GLY H  1 125 ? -64.693 -58.000 35.381  1.00 0.00 ? 131 GLY H CA    1 
ATOM 7757  C C     . GLY H  1 125 ? -65.790 -57.168 36.020  1.00 0.00 ? 131 GLY H C     1 
ATOM 7758  O O     . GLY H  1 125 ? -66.523 -56.463 35.326  1.00 0.00 ? 131 GLY H O     1 
ATOM 7759  N N     . TYR H  1 126 ? -65.857 -57.216 37.352  1.00 0.00 ? 132 TYR H N     1 
ATOM 7760  C CA    . TYR H  1 126 ? -66.831 -56.462 38.115  1.00 0.00 ? 132 TYR H CA    1 
ATOM 7761  C C     . TYR H  1 126 ? -66.131 -55.600 39.160  1.00 0.00 ? 132 TYR H C     1 
ATOM 7762  O O     . TYR H  1 126 ? -65.046 -55.937 39.630  1.00 0.00 ? 132 TYR H O     1 
ATOM 7763  C CB    . TYR H  1 126 ? -67.809 -57.414 38.788  1.00 0.00 ? 132 TYR H CB    1 
ATOM 7764  C CG    . TYR H  1 126 ? -68.515 -58.324 37.815  1.00 0.00 ? 132 TYR H CG    1 
ATOM 7765  C CD1   . TYR H  1 126 ? -68.031 -59.606 37.603  1.00 0.00 ? 132 TYR H CD1   1 
ATOM 7766  C CD2   . TYR H  1 126 ? -69.624 -57.876 37.116  1.00 0.00 ? 132 TYR H CD2   1 
ATOM 7767  C CE1   . TYR H  1 126 ? -68.659 -60.439 36.704  1.00 0.00 ? 132 TYR H CE1   1 
ATOM 7768  C CE2   . TYR H  1 126 ? -70.250 -58.708 36.215  1.00 0.00 ? 132 TYR H CE2   1 
ATOM 7769  C CZ    . TYR H  1 126 ? -69.773 -59.988 36.010  1.00 0.00 ? 132 TYR H CZ    1 
ATOM 7770  O OH    . TYR H  1 126 ? -70.400 -60.822 35.114  1.00 0.00 ? 132 TYR H OH    1 
ATOM 7771  N N     . VAL H  1 127 ? -66.762 -54.490 39.525  1.00 0.00 ? 133 VAL H N     1 
ATOM 7772  C CA    . VAL H  1 127 ? -66.181 -53.567 40.495  1.00 0.00 ? 133 VAL H CA    1 
ATOM 7773  C C     . VAL H  1 127 ? -66.120 -54.201 41.871  1.00 0.00 ? 133 VAL H C     1 
ATOM 7774  O O     . VAL H  1 127 ? -67.146 -54.612 42.417  1.00 0.00 ? 133 VAL H O     1 
ATOM 7775  C CB    . VAL H  1 127 ? -67.018 -52.261 40.570  1.00 0.00 ? 133 VAL H CB    1 
ATOM 7776  C CG1   . VAL H  1 127 ? -66.466 -51.345 41.650  1.00 0.00 ? 133 VAL H CG1   1 
ATOM 7777  C CG2   . VAL H  1 127 ? -67.017 -51.555 39.221  1.00 0.00 ? 133 VAL H CG2   1 
ATOM 7778  N N     . SER H  1 128 ? -64.914 -54.278 42.439  1.00 0.00 ? 134 SER H N     1 
ATOM 7779  C CA    . SER H  1 128 ? -64.731 -54.878 43.757  1.00 0.00 ? 134 SER H CA    1 
ATOM 7780  C C     . SER H  1 128 ? -63.378 -54.519 44.365  1.00 0.00 ? 134 SER H C     1 
ATOM 7781  O O     . SER H  1 128 ? -63.318 -53.850 45.399  1.00 0.00 ? 134 SER H O     1 
ATOM 7782  C CB    . SER H  1 128 ? -64.864 -56.385 43.657  1.00 0.00 ? 134 SER H CB    1 
ATOM 7783  O OG    . SER H  1 128 ? -64.677 -56.993 44.903  1.00 0.00 ? 134 SER H OG    1 
ATOM 7784  O OXT   . SER H  1 128 ? -62.374 -55.108 43.967  1.00 0.00 ? 134 SER H OXT   1 
ATOM 7785  N N     . SER I  1 1   ? -50.735 -37.438 35.069  1.00 0.00 ? 7   SER I N     1 
ATOM 7786  C CA    . SER I  1 1   ? -51.639 -36.395 35.529  1.00 0.00 ? 7   SER I CA    1 
ATOM 7787  C C     . SER I  1 1   ? -50.887 -35.261 36.207  1.00 0.00 ? 7   SER I C     1 
ATOM 7788  O O     . SER I  1 1   ? -49.787 -35.457 36.725  1.00 0.00 ? 7   SER I O     1 
ATOM 7789  C CB    . SER I  1 1   ? -52.660 -36.946 36.462  1.00 0.00 ? 7   SER I CB    1 
ATOM 7790  O OG    . SER I  1 1   ? -53.476 -35.917 36.938  1.00 0.00 ? 7   SER I OG    1 
ATOM 7791  N N     . ARG I  1 2   ? -51.461 -34.062 36.157  1.00 0.00 ? 8   ARG I N     1 
ATOM 7792  C CA    . ARG I  1 2   ? -50.803 -32.876 36.698  1.00 0.00 ? 8   ARG I CA    1 
ATOM 7793  C C     . ARG I  1 2   ? -51.731 -32.003 37.519  1.00 0.00 ? 8   ARG I C     1 
ATOM 7794  O O     . ARG I  1 2   ? -52.801 -31.608 37.058  1.00 0.00 ? 8   ARG I O     1 
ATOM 7795  C CB    . ARG I  1 2   ? -50.264 -32.045 35.580  1.00 0.00 ? 8   ARG I CB    1 
ATOM 7796  C CG    . ARG I  1 2   ? -49.178 -32.690 34.751  1.00 0.00 ? 8   ARG I CG    1 
ATOM 7797  C CD    . ARG I  1 2   ? -47.909 -32.774 35.474  1.00 0.00 ? 8   ARG I CD    1 
ATOM 7798  N NE    . ARG I  1 2   ? -46.866 -33.307 34.636  1.00 0.00 ? 8   ARG I NE    1 
ATOM 7799  C CZ    . ARG I  1 2   ? -46.591 -34.607 34.499  1.00 0.00 ? 8   ARG I CZ    1 
ATOM 7800  N NH1   . ARG I  1 2   ? -47.279 -35.507 35.159  1.00 0.00 ? 8   ARG I NH1   1 
ATOM 7801  N NH2   . ARG I  1 2   ? -45.615 -35.009 33.707  1.00 0.00 ? 8   ARG I NH2   1 
ATOM 7802  N N     . SER I  1 3   ? -51.291 -31.665 38.722  1.00 0.00 ? 9   SER I N     1 
ATOM 7803  C CA    . SER I  1 3   ? -52.009 -30.751 39.602  1.00 0.00 ? 9   SER I CA    1 
ATOM 7804  C C     . SER I  1 3   ? -51.771 -29.331 39.177  1.00 0.00 ? 9   SER I C     1 
ATOM 7805  O O     . SER I  1 3   ? -50.865 -29.072 38.401  1.00 0.00 ? 9   SER I O     1 
ATOM 7806  C CB    . SER I  1 3   ? -51.518 -30.915 41.009  1.00 0.00 ? 9   SER I CB    1 
ATOM 7807  O OG    . SER I  1 3   ? -50.175 -30.507 41.108  1.00 0.00 ? 9   SER I OG    1 
ATOM 7808  N N     . TYR I  1 4   ? -52.532 -28.399 39.729  1.00 0.00 ? 10  TYR I N     1 
ATOM 7809  C CA    . TYR I  1 4   ? -52.326 -26.995 39.414  1.00 0.00 ? 10  TYR I CA    1 
ATOM 7810  C C     . TYR I  1 4   ? -50.913 -26.569 39.646  1.00 0.00 ? 10  TYR I C     1 
ATOM 7811  O O     . TYR I  1 4   ? -50.329 -25.878 38.818  1.00 0.00 ? 10  TYR I O     1 
ATOM 7812  C CB    . TYR I  1 4   ? -53.229 -26.091 40.207  1.00 0.00 ? 10  TYR I CB    1 
ATOM 7813  C CG    . TYR I  1 4   ? -52.814 -24.658 40.045  1.00 0.00 ? 10  TYR I CG    1 
ATOM 7814  C CD1   . TYR I  1 4   ? -53.084 -23.977 38.874  1.00 0.00 ? 10  TYR I CD1   1 
ATOM 7815  C CD2   . TYR I  1 4   ? -52.116 -24.039 41.057  1.00 0.00 ? 10  TYR I CD2   1 
ATOM 7816  C CE1   . TYR I  1 4   ? -52.655 -22.676 38.721  1.00 0.00 ? 10  TYR I CE1   1 
ATOM 7817  C CE2   . TYR I  1 4   ? -51.687 -22.745 40.905  1.00 0.00 ? 10  TYR I CE2   1 
ATOM 7818  C CZ    . TYR I  1 4   ? -51.952 -22.066 39.746  1.00 0.00 ? 10  TYR I CZ    1 
ATOM 7819  O OH    . TYR I  1 4   ? -51.509 -20.777 39.602  1.00 0.00 ? 10  TYR I OH    1 
ATOM 7820  N N     . SER I  1 5   ? -50.365 -26.932 40.801  1.00 0.00 ? 11  SER I N     1 
ATOM 7821  C CA    . SER I  1 5   ? -48.997 -26.577 41.117  1.00 0.00 ? 11  SER I CA    1 
ATOM 7822  C C     . SER I  1 5   ? -48.080 -26.972 39.983  1.00 0.00 ? 11  SER I C     1 
ATOM 7823  O O     . SER I  1 5   ? -47.237 -26.185 39.555  1.00 0.00 ? 11  SER I O     1 
ATOM 7824  C CB    . SER I  1 5   ? -48.548 -27.260 42.407  1.00 0.00 ? 11  SER I CB    1 
ATOM 7825  O OG    . SER I  1 5   ? -49.244 -26.765 43.516  1.00 0.00 ? 11  SER I OG    1 
ATOM 7826  N N     . GLN I  1 6   ? -48.265 -28.182 39.478  1.00 0.00 ? 12  GLN I N     1 
ATOM 7827  C CA    . GLN I  1 6   ? -47.463 -28.682 38.385  1.00 0.00 ? 12  GLN I CA    1 
ATOM 7828  C C     . GLN I  1 6   ? -47.758 -27.976 37.079  1.00 0.00 ? 12  GLN I C     1 
ATOM 7829  O O     . GLN I  1 6   ? -46.842 -27.667 36.322  1.00 0.00 ? 12  GLN I O     1 
ATOM 7830  C CB    . GLN I  1 6   ? -47.687 -30.156 38.234  1.00 0.00 ? 12  GLN I CB    1 
ATOM 7831  C CG    . GLN I  1 6   ? -47.108 -30.966 39.362  1.00 0.00 ? 12  GLN I CG    1 
ATOM 7832  C CD    . GLN I  1 6   ? -47.597 -32.384 39.354  1.00 0.00 ? 12  GLN I CD    1 
ATOM 7833  O OE1   . GLN I  1 6   ? -48.775 -32.627 39.632  1.00 0.00 ? 12  GLN I OE1   1 
ATOM 7834  N NE2   . GLN I  1 6   ? -46.717 -33.327 39.033  1.00 0.00 ? 12  GLN I NE2   1 
ATOM 7835  N N     . ARG I  1 7   ? -49.035 -27.703 36.819  1.00 0.00 ? 13  ARG I N     1 
ATOM 7836  C CA    . ARG I  1 7   ? -49.429 -27.043 35.584  1.00 0.00 ? 13  ARG I CA    1 
ATOM 7837  C C     . ARG I  1 7   ? -48.732 -25.732 35.453  1.00 0.00 ? 13  ARG I C     1 
ATOM 7838  O O     . ARG I  1 7   ? -48.103 -25.441 34.436  1.00 0.00 ? 13  ARG I O     1 
ATOM 7839  C CB    . ARG I  1 7   ? -50.928 -26.771 35.556  1.00 0.00 ? 13  ARG I CB    1 
ATOM 7840  C CG    . ARG I  1 7   ? -51.815 -27.984 35.465  1.00 0.00 ? 13  ARG I CG    1 
ATOM 7841  C CD    . ARG I  1 7   ? -53.226 -27.611 35.246  1.00 0.00 ? 13  ARG I CD    1 
ATOM 7842  N NE    . ARG I  1 7   ? -53.428 -27.057 33.918  1.00 0.00 ? 13  ARG I NE    1 
ATOM 7843  C CZ    . ARG I  1 7   ? -54.547 -26.437 33.507  1.00 0.00 ? 13  ARG I CZ    1 
ATOM 7844  N NH1   . ARG I  1 7   ? -55.555 -26.286 34.336  1.00 0.00 ? 13  ARG I NH1   1 
ATOM 7845  N NH2   . ARG I  1 7   ? -54.641 -25.975 32.267  1.00 0.00 ? 13  ARG I NH2   1 
ATOM 7846  N N     . TYR I  1 8   ? -48.842 -24.940 36.494  1.00 0.00 ? 14  TYR I N     1 
ATOM 7847  C CA    . TYR I  1 8   ? -48.264 -23.637 36.526  1.00 0.00 ? 14  TYR I CA    1 
ATOM 7848  C C     . TYR I  1 8   ? -46.775 -23.678 36.512  1.00 0.00 ? 14  TYR I C     1 
ATOM 7849  O O     . TYR I  1 8   ? -46.152 -22.923 35.778  1.00 0.00 ? 14  TYR I O     1 
ATOM 7850  C CB    . TYR I  1 8   ? -48.749 -22.880 37.728  1.00 0.00 ? 14  TYR I CB    1 
ATOM 7851  C CG    . TYR I  1 8   ? -48.066 -21.571 37.876  1.00 0.00 ? 14  TYR I CG    1 
ATOM 7852  C CD1   . TYR I  1 8   ? -47.955 -20.737 36.794  1.00 0.00 ? 14  TYR I CD1   1 
ATOM 7853  C CD2   . TYR I  1 8   ? -47.548 -21.202 39.096  1.00 0.00 ? 14  TYR I CD2   1 
ATOM 7854  C CE1   . TYR I  1 8   ? -47.315 -19.538 36.920  1.00 0.00 ? 14  TYR I CE1   1 
ATOM 7855  C CE2   . TYR I  1 8   ? -46.906 -19.999 39.228  1.00 0.00 ? 14  TYR I CE2   1 
ATOM 7856  C CZ    . TYR I  1 8   ? -46.784 -19.172 38.139  1.00 0.00 ? 14  TYR I CZ    1 
ATOM 7857  O OH    . TYR I  1 8   ? -46.126 -17.979 38.256  1.00 0.00 ? 14  TYR I OH    1 
ATOM 7858  N N     . ALA I  1 9   ? -46.190 -24.529 37.340  1.00 0.00 ? 15  ALA I N     1 
ATOM 7859  C CA    . ALA I  1 9   ? -44.743 -24.610 37.430  1.00 0.00 ? 15  ALA I CA    1 
ATOM 7860  C C     . ALA I  1 9   ? -44.105 -24.740 36.066  1.00 0.00 ? 15  ALA I C     1 
ATOM 7861  O O     . ALA I  1 9   ? -43.211 -23.963 35.715  1.00 0.00 ? 15  ALA I O     1 
ATOM 7862  C CB    . ALA I  1 9   ? -44.339 -25.786 38.296  1.00 0.00 ? 15  ALA I CB    1 
ATOM 7863  N N     . LYS I  1 10  ? -44.555 -25.714 35.290  1.00 0.00 ? 16  LYS I N     1 
ATOM 7864  C CA    . LYS I  1 10  ? -43.962 -25.940 34.000  1.00 0.00 ? 16  LYS I CA    1 
ATOM 7865  C C     . LYS I  1 10  ? -44.291 -24.833 33.038  1.00 0.00 ? 16  LYS I C     1 
ATOM 7866  O O     . LYS I  1 10  ? -43.444 -24.431 32.246  1.00 0.00 ? 16  LYS I O     1 
ATOM 7867  C CB    . LYS I  1 10  ? -44.382 -27.254 33.425  1.00 0.00 ? 16  LYS I CB    1 
ATOM 7868  C CG    . LYS I  1 10  ? -43.624 -27.603 32.171  1.00 0.00 ? 16  LYS I CG    1 
ATOM 7869  C CD    . LYS I  1 10  ? -43.960 -28.983 31.683  1.00 0.00 ? 16  LYS I CD    1 
ATOM 7870  C CE    . LYS I  1 10  ? -43.095 -29.345 30.497  1.00 0.00 ? 16  LYS I CE    1 
ATOM 7871  N NZ    . LYS I  1 10  ? -43.446 -30.668 29.925  1.00 0.00 ? 16  LYS I NZ    1 
ATOM 7872  N N     . TRP I  1 11  ? -45.517 -24.316 33.106  1.00 0.00 ? 17  TRP I N     1 
ATOM 7873  C CA    . TRP I  1 11  ? -45.901 -23.206 32.254  1.00 0.00 ? 17  TRP I CA    1 
ATOM 7874  C C     . TRP I  1 11  ? -44.978 -22.052 32.442  1.00 0.00 ? 17  TRP I C     1 
ATOM 7875  O O     . TRP I  1 11  ? -44.599 -21.390 31.479  1.00 0.00 ? 17  TRP I O     1 
ATOM 7876  C CB    . TRP I  1 11  ? -47.308 -22.745 32.552  1.00 0.00 ? 17  TRP I CB    1 
ATOM 7877  C CG    . TRP I  1 11  ? -47.703 -21.554 31.743  1.00 0.00 ? 17  TRP I CG    1 
ATOM 7878  C CD1   . TRP I  1 11  ? -48.262 -21.564 30.506  1.00 0.00 ? 17  TRP I CD1   1 
ATOM 7879  C CD2   . TRP I  1 11  ? -47.575 -20.162 32.111  1.00 0.00 ? 17  TRP I CD2   1 
ATOM 7880  N NE1   . TRP I  1 11  ? -48.496 -20.282 30.084  1.00 0.00 ? 17  TRP I NE1   1 
ATOM 7881  C CE2   . TRP I  1 11  ? -48.079 -19.411 31.051  1.00 0.00 ? 17  TRP I CE2   1 
ATOM 7882  C CE3   . TRP I  1 11  ? -47.089 -19.503 33.236  1.00 0.00 ? 17  TRP I CE3   1 
ATOM 7883  C CZ2   . TRP I  1 11  ? -48.113 -18.030 31.080  1.00 0.00 ? 17  TRP I CZ2   1 
ATOM 7884  C CZ3   . TRP I  1 11  ? -47.125 -18.117 33.269  1.00 0.00 ? 17  TRP I CZ3   1 
ATOM 7885  C CH2   . TRP I  1 11  ? -47.624 -17.400 32.219  1.00 0.00 ? 17  TRP I CH2   1 
ATOM 7886  N N     . GLN I  1 12  ? -44.632 -21.782 33.683  1.00 0.00 ? 18  GLN I N     1 
ATOM 7887  C CA    . GLN I  1 12  ? -43.774 -20.684 33.997  1.00 0.00 ? 18  GLN I CA    1 
ATOM 7888  C C     . GLN I  1 12  ? -42.412 -20.880 33.422  1.00 0.00 ? 18  GLN I C     1 
ATOM 7889  O O     . GLN I  1 12  ? -41.842 -19.963 32.839  1.00 0.00 ? 18  GLN I O     1 
ATOM 7890  C CB    . GLN I  1 12  ? -43.656 -20.526 35.489  1.00 0.00 ? 18  GLN I CB    1 
ATOM 7891  C CG    . GLN I  1 12  ? -42.898 -19.303 35.887  1.00 0.00 ? 18  GLN I CG    1 
ATOM 7892  C CD    . GLN I  1 12  ? -43.646 -18.081 35.500  1.00 0.00 ? 18  GLN I CD    1 
ATOM 7893  O OE1   . GLN I  1 12  ? -44.778 -17.902 35.945  1.00 0.00 ? 18  GLN I OE1   1 
ATOM 7894  N NE2   . GLN I  1 12  ? -43.055 -17.229 34.674  1.00 0.00 ? 18  GLN I NE2   1 
ATOM 7895  N N     . ALA I  1 13  ? -41.887 -22.085 33.559  1.00 0.00 ? 19  ALA I N     1 
ATOM 7896  C CA    . ALA I  1 13  ? -40.560 -22.389 33.064  1.00 0.00 ? 19  ALA I CA    1 
ATOM 7897  C C     . ALA I  1 13  ? -40.472 -22.190 31.571  1.00 0.00 ? 19  ALA I C     1 
ATOM 7898  O O     . ALA I  1 13  ? -39.495 -21.632 31.071  1.00 0.00 ? 19  ALA I O     1 
ATOM 7899  C CB    . ALA I  1 13  ? -40.188 -23.806 33.423  1.00 0.00 ? 19  ALA I CB    1 
ATOM 7900  N N     . LYS I  1 14  ? -41.498 -22.619 30.858  1.00 0.00 ? 20  LYS I N     1 
ATOM 7901  C CA    . LYS I  1 14  ? -41.495 -22.507 29.421  1.00 0.00 ? 20  LYS I CA    1 
ATOM 7902  C C     . LYS I  1 14  ? -41.731 -21.106 28.972  1.00 0.00 ? 20  LYS I C     1 
ATOM 7903  O O     . LYS I  1 14  ? -41.141 -20.666 27.989  1.00 0.00 ? 20  LYS I O     1 
ATOM 7904  C CB    . LYS I  1 14  ? -42.535 -23.424 28.824  1.00 0.00 ? 20  LYS I CB    1 
ATOM 7905  C CG    . LYS I  1 14  ? -42.227 -24.884 29.034  1.00 0.00 ? 20  LYS I CG    1 
ATOM 7906  C CD    . LYS I  1 14  ? -40.964 -25.270 28.293  1.00 0.00 ? 20  LYS I CD    1 
ATOM 7907  C CE    . LYS I  1 14  ? -41.225 -25.500 26.814  1.00 0.00 ? 20  LYS I CE    1 
ATOM 7908  N NZ    . LYS I  1 14  ? -41.811 -26.840 26.572  1.00 0.00 ? 20  LYS I NZ    1 
ATOM 7909  N N     . PHE I  1 15  ? -42.552 -20.374 29.706  1.00 0.00 ? 21  PHE I N     1 
ATOM 7910  C CA    . PHE I  1 15  ? -42.786 -18.990 29.380  1.00 0.00 ? 21  PHE I CA    1 
ATOM 7911  C C     . PHE I  1 15  ? -41.496 -18.211 29.499  1.00 0.00 ? 21  PHE I C     1 
ATOM 7912  O O     . PHE I  1 15  ? -41.150 -17.428 28.614  1.00 0.00 ? 21  PHE I O     1 
ATOM 7913  C CB    . PHE I  1 15  ? -43.831 -18.378 30.283  1.00 0.00 ? 21  PHE I CB    1 
ATOM 7914  C CG    . PHE I  1 15  ? -44.146 -16.980 29.895  1.00 0.00 ? 21  PHE I CG    1 
ATOM 7915  C CD1   . PHE I  1 15  ? -45.115 -16.718 28.943  1.00 0.00 ? 21  PHE I CD1   1 
ATOM 7916  C CD2   . PHE I  1 15  ? -43.444 -15.924 30.430  1.00 0.00 ? 21  PHE I CD2   1 
ATOM 7917  C CE1   . PHE I  1 15  ? -45.386 -15.424 28.547  1.00 0.00 ? 21  PHE I CE1   1 
ATOM 7918  C CE2   . PHE I  1 15  ? -43.707 -14.632 30.031  1.00 0.00 ? 21  PHE I CE2   1 
ATOM 7919  C CZ    . PHE I  1 15  ? -44.681 -14.380 29.090  1.00 0.00 ? 21  PHE I CZ    1 
ATOM 7920  N N     . ASN I  1 16  ? -40.785 -18.434 30.599  1.00 0.00 ? 22  ASN I N     1 
ATOM 7921  C CA    . ASN I  1 16  ? -39.528 -17.769 30.845  1.00 0.00 ? 22  ASN I CA    1 
ATOM 7922  C C     . ASN I  1 16  ? -38.552 -18.047 29.738  1.00 0.00 ? 22  ASN I C     1 
ATOM 7923  O O     . ASN I  1 16  ? -37.927 -17.133 29.203  1.00 0.00 ? 22  ASN I O     1 
ATOM 7924  C CB    . ASN I  1 16  ? -38.935 -18.230 32.150  1.00 0.00 ? 22  ASN I CB    1 
ATOM 7925  C CG    . ASN I  1 16  ? -39.707 -17.766 33.333  1.00 0.00 ? 22  ASN I CG    1 
ATOM 7926  O OD1   . ASN I  1 16  ? -40.581 -16.904 33.227  1.00 0.00 ? 22  ASN I OD1   1 
ATOM 7927  N ND2   . ASN I  1 16  ? -39.401 -18.320 34.474  1.00 0.00 ? 22  ASN I ND2   1 
ATOM 7928  N N     . ALA I  1 17  ? -38.446 -19.319 29.358  1.00 0.00 ? 23  ALA I N     1 
ATOM 7929  C CA    . ALA I  1 17  ? -37.540 -19.721 28.309  1.00 0.00 ? 23  ALA I CA    1 
ATOM 7930  C C     . ALA I  1 17  ? -37.824 -18.978 27.034  1.00 0.00 ? 23  ALA I C     1 
ATOM 7931  O O     . ALA I  1 17  ? -36.927 -18.383 26.441  1.00 0.00 ? 23  ALA I O     1 
ATOM 7932  C CB    . ALA I  1 17  ? -37.645 -21.213 28.069  1.00 0.00 ? 23  ALA I CB    1 
ATOM 7933  N N     . PHE I  1 18  ? -39.081 -18.982 26.623  1.00 0.00 ? 24  PHE I N     1 
ATOM 7934  C CA    . PHE I  1 18  ? -39.479 -18.335 25.397  1.00 0.00 ? 24  PHE I CA    1 
ATOM 7935  C C     . PHE I  1 18  ? -39.155 -16.866 25.377  1.00 0.00 ? 24  PHE I C     1 
ATOM 7936  O O     . PHE I  1 18  ? -38.757 -16.340 24.347  1.00 0.00 ? 24  PHE I O     1 
ATOM 7937  C CB    . PHE I  1 18  ? -40.944 -18.539 25.128  1.00 0.00 ? 24  PHE I CB    1 
ATOM 7938  C CG    . PHE I  1 18  ? -41.395 -17.883 23.861  1.00 0.00 ? 24  PHE I CG    1 
ATOM 7939  C CD1   . PHE I  1 18  ? -40.834 -18.238 22.646  1.00 0.00 ? 24  PHE I CD1   1 
ATOM 7940  C CD2   . PHE I  1 18  ? -42.403 -16.935 23.871  1.00 0.00 ? 24  PHE I CD2   1 
ATOM 7941  C CE1   . PHE I  1 18  ? -41.263 -17.647 21.474  1.00 0.00 ? 24  PHE I CE1   1 
ATOM 7942  C CE2   . PHE I  1 18  ? -42.837 -16.352 22.700  1.00 0.00 ? 24  PHE I CE2   1 
ATOM 7943  C CZ    . PHE I  1 18  ? -42.266 -16.706 21.504  1.00 0.00 ? 24  PHE I CZ    1 
ATOM 7944  N N     . SER I  1 19  ? -39.310 -16.189 26.513  1.00 0.00 ? 25  SER I N     1 
ATOM 7945  C CA    . SER I  1 19  ? -39.091 -14.744 26.565  1.00 0.00 ? 25  SER I CA    1 
ATOM 7946  C C     . SER I  1 19  ? -37.647 -14.339 26.244  1.00 0.00 ? 25  SER I C     1 
ATOM 7947  O O     . SER I  1 19  ? -37.381 -13.172 25.970  1.00 0.00 ? 25  SER I O     1 
ATOM 7948  C CB    . SER I  1 19  ? -39.441 -14.215 27.927  1.00 0.00 ? 25  SER I CB    1 
ATOM 7949  O OG    . SER I  1 19  ? -38.475 -14.584 28.874  1.00 0.00 ? 25  SER I OG    1 
ATOM 7950  N N     . ASN I  1 20  ? -36.721 -15.294 26.296  1.00 0.00 ? 26  ASN I N     1 
ATOM 7951  C CA    . ASN I  1 20  ? -35.321 -15.032 25.985  1.00 0.00 ? 26  ASN I CA    1 
ATOM 7952  C C     . ASN I  1 20  ? -35.138 -14.620 24.524  1.00 0.00 ? 26  ASN I C     1 
ATOM 7953  O O     . ASN I  1 20  ? -35.430 -15.407 23.633  1.00 0.00 ? 26  ASN I O     1 
ATOM 7954  C CB    . ASN I  1 20  ? -34.498 -16.262 26.285  1.00 0.00 ? 26  ASN I CB    1 
ATOM 7955  C CG    . ASN I  1 20  ? -33.044 -16.086 26.001  1.00 0.00 ? 26  ASN I CG    1 
ATOM 7956  O OD1   . ASN I  1 20  ? -32.657 -15.647 24.906  1.00 0.00 ? 26  ASN I OD1   1 
ATOM 7957  N ND2   . ASN I  1 20  ? -32.223 -16.419 26.961  1.00 0.00 ? 26  ASN I ND2   1 
ATOM 7958  N N     . PRO I  1 21  ? -34.670 -13.378 24.271  1.00 0.00 ? 27  PRO I N     1 
ATOM 7959  C CA    . PRO I  1 21  ? -34.414 -12.787 22.940  1.00 0.00 ? 27  PRO I CA    1 
ATOM 7960  C C     . PRO I  1 21  ? -34.041 -13.800 21.875  1.00 0.00 ? 27  PRO I C     1 
ATOM 7961  O O     . PRO I  1 21  ? -34.575 -13.772 20.760  1.00 0.00 ? 27  PRO I O     1 
ATOM 7962  C CB    . PRO I  1 21  ? -33.203 -11.880 23.183  1.00 0.00 ? 27  PRO I CB    1 
ATOM 7963  C CG    . PRO I  1 21  ? -33.288 -11.513 24.599  1.00 0.00 ? 27  PRO I CG    1 
ATOM 7964  C CD    . PRO I  1 21  ? -33.764 -12.761 25.270  1.00 0.00 ? 27  PRO I CD    1 
ATOM 7965  N N     . THR I  1 22  ? -33.094 -14.667 22.198  1.00 0.00 ? 28  THR I N     1 
ATOM 7966  C CA    . THR I  1 22  ? -32.548 -15.569 21.221  1.00 0.00 ? 28  THR I CA    1 
ATOM 7967  C C     . THR I  1 22  ? -33.419 -16.757 21.019  1.00 0.00 ? 28  THR I C     1 
ATOM 7968  O O     . THR I  1 22  ? -33.450 -17.326 19.938  1.00 0.00 ? 28  THR I O     1 
ATOM 7969  C CB    . THR I  1 22  ? -31.184 -16.047 21.649  1.00 0.00 ? 28  THR I CB    1 
ATOM 7970  O OG1   . THR I  1 22  ? -31.312 -16.771 22.873  1.00 0.00 ? 28  THR I OG1   1 
ATOM 7971  C CG2   . THR I  1 22  ? -30.256 -14.868 21.855  1.00 0.00 ? 28  THR I CG2   1 
ATOM 7972  N N     . VAL I  1 23  ? -34.149 -17.127 22.040  1.00 0.00 ? 29  VAL I N     1 
ATOM 7973  C CA    . VAL I  1 23  ? -35.021 -18.256 21.942  1.00 0.00 ? 29  VAL I CA    1 
ATOM 7974  C C     . VAL I  1 23  ? -36.232 -17.897 21.157  1.00 0.00 ? 29  VAL I C     1 
ATOM 7975  O O     . VAL I  1 23  ? -36.649 -18.636 20.265  1.00 0.00 ? 29  VAL I O     1 
ATOM 7976  C CB    . VAL I  1 23  ? -35.416 -18.741 23.316  1.00 0.00 ? 29  VAL I CB    1 
ATOM 7977  C CG1   . VAL I  1 23  ? -36.443 -19.842 23.207  1.00 0.00 ? 29  VAL I CG1   1 
ATOM 7978  C CG2   . VAL I  1 23  ? -34.191 -19.223 24.033  1.00 0.00 ? 29  VAL I CG2   1 
ATOM 7979  N N     . ALA I  1 24  ? -36.801 -16.753 21.473  1.00 0.00 ? 30  ALA I N     1 
ATOM 7980  C CA    . ALA I  1 24  ? -37.961 -16.284 20.770  1.00 0.00 ? 30  ALA I CA    1 
ATOM 7981  C C     . ALA I  1 24  ? -37.661 -16.103 19.310  1.00 0.00 ? 30  ALA I C     1 
ATOM 7982  O O     . ALA I  1 24  ? -38.401 -16.576 18.458  1.00 0.00 ? 30  ALA I O     1 
ATOM 7983  C CB    . ALA I  1 24  ? -38.447 -14.976 21.359  1.00 0.00 ? 30  ALA I CB    1 
ATOM 7984  N N     . SER I  1 25  ? -36.556 -15.436 19.012  1.00 0.00 ? 31  SER I N     1 
ATOM 7985  C CA    . SER I  1 25  ? -36.224 -15.162 17.641  1.00 0.00 ? 31  SER I CA    1 
ATOM 7986  C C     . SER I  1 25  ? -35.809 -16.386 16.888  1.00 0.00 ? 31  SER I C     1 
ATOM 7987  O O     . SER I  1 25  ? -36.123 -16.521 15.712  1.00 0.00 ? 31  SER I O     1 
ATOM 7988  C CB    . SER I  1 25  ? -35.140 -14.163 17.588  1.00 0.00 ? 31  SER I CB    1 
ATOM 7989  O OG    . SER I  1 25  ? -33.996 -14.652 18.218  1.00 0.00 ? 31  SER I OG    1 
ATOM 7990  N N     . THR I  1 26  ? -35.159 -17.322 17.562  1.00 0.00 ? 32  THR I N     1 
ATOM 7991  C CA    . THR I  1 26  ? -34.790 -18.560 16.911  1.00 0.00 ? 32  THR I CA    1 
ATOM 7992  C C     . THR I  1 26  ? -36.005 -19.286 16.448  1.00 0.00 ? 32  THR I C     1 
ATOM 7993  O O     . THR I  1 26  ? -36.119 -19.639 15.278  1.00 0.00 ? 32  THR I O     1 
ATOM 7994  C CB    . THR I  1 26  ? -33.994 -19.471 17.836  1.00 0.00 ? 32  THR I CB    1 
ATOM 7995  O OG1   . THR I  1 26  ? -32.755 -18.848 18.170  1.00 0.00 ? 32  THR I OG1   1 
ATOM 7996  C CG2   . THR I  1 26  ? -33.728 -20.785 17.158  1.00 0.00 ? 32  THR I CG2   1 
ATOM 7997  N N     . ILE I  1 27  ? -36.927 -19.499 17.356  1.00 0.00 ? 33  ILE I N     1 
ATOM 7998  C CA    . ILE I  1 27  ? -38.112 -20.233 17.040  1.00 0.00 ? 33  ILE I CA    1 
ATOM 7999  C C     . ILE I  1 27  ? -38.952 -19.525 16.017  1.00 0.00 ? 33  ILE I C     1 
ATOM 8000  O O     . ILE I  1 27  ? -39.338 -20.114 15.012  1.00 0.00 ? 33  ILE I O     1 
ATOM 8001  C CB    . ILE I  1 27  ? -38.940 -20.457 18.284  1.00 0.00 ? 33  ILE I CB    1 
ATOM 8002  C CG1   . ILE I  1 27  ? -38.210 -21.379 19.235  1.00 0.00 ? 33  ILE I CG1   1 
ATOM 8003  C CG2   . ILE I  1 27  ? -40.278 -21.033 17.907  1.00 0.00 ? 33  ILE I CG2   1 
ATOM 8004  C CD1   . ILE I  1 27  ? -38.823 -21.425 20.602  1.00 0.00 ? 33  ILE I CD1   1 
ATOM 8005  N N     . LEU I  1 28  ? -39.240 -18.262 16.272  1.00 0.00 ? 34  LEU I N     1 
ATOM 8006  C CA    . LEU I  1 28  ? -40.145 -17.508 15.442  1.00 0.00 ? 34  LEU I CA    1 
ATOM 8007  C C     . LEU I  1 28  ? -39.614 -17.289 14.050  1.00 0.00 ? 34  LEU I C     1 
ATOM 8008  O O     . LEU I  1 28  ? -40.372 -17.353 13.083  1.00 0.00 ? 34  LEU I O     1 
ATOM 8009  C CB    . LEU I  1 28  ? -40.432 -16.177 16.099  1.00 0.00 ? 34  LEU I CB    1 
ATOM 8010  C CG    . LEU I  1 28  ? -41.239 -16.259 17.391  1.00 0.00 ? 34  LEU I CG    1 
ATOM 8011  C CD1   . LEU I  1 28  ? -41.271 -14.896 18.050  1.00 0.00 ? 34  LEU I CD1   1 
ATOM 8012  C CD2   . LEU I  1 28  ? -42.638 -16.746 17.076  1.00 0.00 ? 34  LEU I CD2   1 
ATOM 8013  N N     . SER I  1 29  ? -38.316 -17.060 13.925  1.00 0.00 ? 35  SER I N     1 
ATOM 8014  C CA    . SER I  1 29  ? -37.744 -16.871 12.612  1.00 0.00 ? 35  SER I CA    1 
ATOM 8015  C C     . SER I  1 29  ? -37.682 -18.176 11.848  1.00 0.00 ? 35  SER I C     1 
ATOM 8016  O O     . SER I  1 29  ? -37.788 -18.183 10.622  1.00 0.00 ? 35  SER I O     1 
ATOM 8017  C CB    . SER I  1 29  ? -36.371 -16.282 12.716  1.00 0.00 ? 35  SER I CB    1 
ATOM 8018  O OG    . SER I  1 29  ? -35.488 -17.184 13.313  1.00 0.00 ? 35  SER I OG    1 
ATOM 8019  N N     . ASN I  1 30  ? -37.564 -19.294 12.564  1.00 0.00 ? 36  ASN I N     1 
ATOM 8020  C CA    . ASN I  1 30  ? -37.545 -20.582 11.905  1.00 0.00 ? 36  ASN I CA    1 
ATOM 8021  C C     . ASN I  1 30  ? -38.907 -20.984 11.403  1.00 0.00 ? 36  ASN I C     1 
ATOM 8022  O O     . ASN I  1 30  ? -39.023 -21.572 10.335  1.00 0.00 ? 36  ASN I O     1 
ATOM 8023  C CB    . ASN I  1 30  ? -36.983 -21.643 12.807  1.00 0.00 ? 36  ASN I CB    1 
ATOM 8024  C CG    . ASN I  1 30  ? -35.502 -21.515 12.953  1.00 0.00 ? 36  ASN I CG    1 
ATOM 8025  O OD1   . ASN I  1 30  ? -34.868 -20.737 12.233  1.00 0.00 ? 36  ASN I OD1   1 
ATOM 8026  N ND2   . ASN I  1 30  ? -34.931 -22.272 13.849  1.00 0.00 ? 36  ASN I ND2   1 
ATOM 8027  N N     . VAL I  1 31  ? -39.953 -20.637 12.149  1.00 0.00 ? 37  VAL I N     1 
ATOM 8028  C CA    . VAL I  1 31  ? -41.298 -21.019 11.744  1.00 0.00 ? 37  VAL I CA    1 
ATOM 8029  C C     . VAL I  1 31  ? -41.986 -19.938 10.975  1.00 0.00 ? 37  VAL I C     1 
ATOM 8030  O O     . VAL I  1 31  ? -43.153 -20.083 10.635  1.00 0.00 ? 37  VAL I O     1 
ATOM 8031  C CB    . VAL I  1 31  ? -42.168 -21.361 12.945  1.00 0.00 ? 37  VAL I CB    1 
ATOM 8032  C CG1   . VAL I  1 31  ? -41.541 -22.472 13.753  1.00 0.00 ? 37  VAL I CG1   1 
ATOM 8033  C CG2   . VAL I  1 31  ? -42.392 -20.121 13.779  1.00 0.00 ? 37  VAL I CG2   1 
ATOM 8034  N N     . SER I  1 32  ? -41.280 -18.842 10.710  1.00 0.00 ? 38  SER I N     1 
ATOM 8035  C CA    . SER I  1 32  ? -41.835 -17.751 9.935   1.00 0.00 ? 38  SER I CA    1 
ATOM 8036  C C     . SER I  1 32  ? -42.508 -18.231 8.642   1.00 0.00 ? 38  SER I C     1 
ATOM 8037  O O     . SER I  1 32  ? -43.735 -18.260 8.578   1.00 0.00 ? 38  SER I O     1 
ATOM 8038  C CB    . SER I  1 32  ? -40.780 -16.693 9.651   1.00 0.00 ? 38  SER I CB    1 
ATOM 8039  O OG    . SER I  1 32  ? -40.426 -16.013 10.821  1.00 0.00 ? 38  SER I OG    1 
ATOM 8040  N N     . PRO I  1 33  ? -41.729 -18.566 7.590   1.00 0.00 ? 39  PRO I N     1 
ATOM 8041  C CA    . PRO I  1 33  ? -42.262 -18.960 6.285   1.00 0.00 ? 39  PRO I CA    1 
ATOM 8042  C C     . PRO I  1 33  ? -43.293 -20.099 6.378   1.00 0.00 ? 39  PRO I C     1 
ATOM 8043  O O     . PRO I  1 33  ? -44.183 -20.207 5.533   1.00 0.00 ? 39  PRO I O     1 
ATOM 8044  C CB    . PRO I  1 33  ? -41.035 -19.445 5.547   1.00 0.00 ? 39  PRO I CB    1 
ATOM 8045  C CG    . PRO I  1 33  ? -40.204 -20.083 6.597   1.00 0.00 ? 39  PRO I CG    1 
ATOM 8046  C CD    . PRO I  1 33  ? -40.480 -19.324 7.858   1.00 0.00 ? 39  PRO I CD    1 
ATOM 8047  N N     . VAL I  1 34  ? -43.191 -20.922 7.418   1.00 0.00 ? 40  VAL I N     1 
ATOM 8048  C CA    . VAL I  1 34  ? -44.111 -22.008 7.613   1.00 0.00 ? 40  VAL I CA    1 
ATOM 8049  C C     . VAL I  1 34  ? -45.455 -21.470 8.009   1.00 0.00 ? 40  VAL I C     1 
ATOM 8050  O O     . VAL I  1 34  ? -46.477 -21.820 7.420   1.00 0.00 ? 40  VAL I O     1 
ATOM 8051  C CB    . VAL I  1 34  ? -43.600 -22.946 8.703   1.00 0.00 ? 40  VAL I CB    1 
ATOM 8052  C CG1   . VAL I  1 34  ? -44.636 -24.009 9.003   1.00 0.00 ? 40  VAL I CG1   1 
ATOM 8053  C CG2   . VAL I  1 34  ? -42.286 -23.566 8.272   1.00 0.00 ? 40  VAL I CG2   1 
ATOM 8054  N N     . ALA I  1 35  ? -45.449 -20.587 8.995   1.00 0.00 ? 41  ALA I N     1 
ATOM 8055  C CA    . ALA I  1 35  ? -46.653 -19.954 9.459   1.00 0.00 ? 41  ALA I CA    1 
ATOM 8056  C C     . ALA I  1 35  ? -47.295 -19.172 8.355   1.00 0.00 ? 41  ALA I C     1 
ATOM 8057  O O     . ALA I  1 35  ? -48.516 -19.167 8.222   1.00 0.00 ? 41  ALA I O     1 
ATOM 8058  C CB    . ALA I  1 35  ? -46.352 -19.043 10.633  1.00 0.00 ? 41  ALA I CB    1 
ATOM 8059  N N     . GLN I  1 36  ? -46.470 -18.529 7.539   1.00 0.00 ? 42  GLN I N     1 
ATOM 8060  C CA    . GLN I  1 36  ? -46.958 -17.732 6.439   1.00 0.00 ? 42  GLN I CA    1 
ATOM 8061  C C     . GLN I  1 36  ? -47.762 -18.567 5.509   1.00 0.00 ? 42  GLN I C     1 
ATOM 8062  O O     . GLN I  1 36  ? -48.848 -18.176 5.096   1.00 0.00 ? 42  GLN I O     1 
ATOM 8063  C CB    . GLN I  1 36  ? -45.806 -17.115 5.689   1.00 0.00 ? 42  GLN I CB    1 
ATOM 8064  C CG    . GLN I  1 36  ? -45.055 -16.088 6.483   1.00 0.00 ? 42  GLN I CG    1 
ATOM 8065  C CD    . GLN I  1 36  ? -43.889 -15.517 5.725   1.00 0.00 ? 42  GLN I CD    1 
ATOM 8066  O OE1   . GLN I  1 36  ? -43.961 -15.311 4.511   1.00 0.00 ? 42  GLN I OE1   1 
ATOM 8067  N NE2   . GLN I  1 36  ? -42.800 -15.257 6.432   1.00 0.00 ? 42  GLN I NE2   1 
ATOM 8068  N N     . GLN I  1 37  ? -47.251 -19.747 5.204   1.00 0.00 ? 43  GLN I N     1 
ATOM 8069  C CA    . GLN I  1 37  ? -47.955 -20.670 4.355   1.00 0.00 ? 43  GLN I CA    1 
ATOM 8070  C C     . GLN I  1 37  ? -49.295 -21.025 4.920   1.00 0.00 ? 43  GLN I C     1 
ATOM 8071  O O     . GLN I  1 37  ? -50.301 -21.008 4.210   1.00 0.00 ? 43  GLN I O     1 
ATOM 8072  C CB    . GLN I  1 37  ? -47.145 -21.939 4.171   1.00 0.00 ? 43  GLN I CB    1 
ATOM 8073  C CG    . GLN I  1 37  ? -47.814 -22.956 3.291   1.00 0.00 ? 43  GLN I CG    1 
ATOM 8074  C CD    . GLN I  1 37  ? -47.916 -22.489 1.868   1.00 0.00 ? 43  GLN I CD    1 
ATOM 8075  O OE1   . GLN I  1 37  ? -46.913 -22.111 1.262   1.00 0.00 ? 43  GLN I OE1   1 
ATOM 8076  N NE2   . GLN I  1 37  ? -49.125 -22.506 1.318   1.00 0.00 ? 43  GLN I NE2   1 
ATOM 8077  N N     . ASN I  1 38  ? -49.319 -21.346 6.202   1.00 0.00 ? 44  ASN I N     1 
ATOM 8078  C CA    . ASN I  1 38  ? -50.532 -21.782 6.850   1.00 0.00 ? 44  ASN I CA    1 
ATOM 8079  C C     . ASN I  1 38  ? -51.564 -20.685 6.913   1.00 0.00 ? 44  ASN I C     1 
ATOM 8080  O O     . ASN I  1 38  ? -52.752 -20.929 6.694   1.00 0.00 ? 44  ASN I O     1 
ATOM 8081  C CB    . ASN I  1 38  ? -50.211 -22.301 8.216   1.00 0.00 ? 44  ASN I CB    1 
ATOM 8082  C CG    . ASN I  1 38  ? -49.500 -23.613 8.139   1.00 0.00 ? 44  ASN I CG    1 
ATOM 8083  O OD1   . ASN I  1 38  ? -49.624 -24.325 7.136   1.00 0.00 ? 44  ASN I OD1   1 
ATOM 8084  N ND2   . ASN I  1 38  ? -48.751 -23.947 9.158   1.00 0.00 ? 44  ASN I ND2   1 
ATOM 8085  N N     . PHE I  1 39  ? -51.114 -19.473 7.186   1.00 0.00 ? 45  PHE I N     1 
ATOM 8086  C CA    . PHE I  1 39  ? -52.001 -18.336 7.254   1.00 0.00 ? 45  PHE I CA    1 
ATOM 8087  C C     . PHE I  1 39  ? -52.615 -18.079 5.906   1.00 0.00 ? 45  PHE I C     1 
ATOM 8088  O O     . PHE I  1 39  ? -53.824 -17.929 5.779   1.00 0.00 ? 45  PHE I O     1 
ATOM 8089  C CB    . PHE I  1 39  ? -51.253 -17.102 7.688   1.00 0.00 ? 45  PHE I CB    1 
ATOM 8090  C CG    . PHE I  1 39  ? -52.143 -15.934 7.920   1.00 0.00 ? 45  PHE I CG    1 
ATOM 8091  C CD1   . PHE I  1 39  ? -52.484 -15.562 9.205   1.00 0.00 ? 45  PHE I CD1   1 
ATOM 8092  C CD2   . PHE I  1 39  ? -52.677 -15.225 6.865   1.00 0.00 ? 45  PHE I CD2   1 
ATOM 8093  C CE1   . PHE I  1 39  ? -53.307 -14.478 9.436   1.00 0.00 ? 45  PHE I CE1   1 
ATOM 8094  C CE2   . PHE I  1 39  ? -53.510 -14.144 7.090   1.00 0.00 ? 45  PHE I CE2   1 
ATOM 8095  C CZ    . PHE I  1 39  ? -53.817 -13.764 8.377   1.00 0.00 ? 45  PHE I CZ    1 
ATOM 8096  N N     . GLN I  1 40  ? -51.780 -18.051 4.884   1.00 0.00 ? 46  GLN I N     1 
ATOM 8097  C CA    . GLN I  1 40  ? -52.241 -17.813 3.534   1.00 0.00 ? 46  GLN I CA    1 
ATOM 8098  C C     . GLN I  1 40  ? -53.150 -18.906 3.047   1.00 0.00 ? 46  GLN I C     1 
ATOM 8099  O O     . GLN I  1 40  ? -54.093 -18.650 2.305   1.00 0.00 ? 46  GLN I O     1 
ATOM 8100  C CB    . GLN I  1 40  ? -51.069 -17.697 2.593   1.00 0.00 ? 46  GLN I CB    1 
ATOM 8101  C CG    . GLN I  1 40  ? -50.260 -16.444 2.759   1.00 0.00 ? 46  GLN I CG    1 
ATOM 8102  C CD    . GLN I  1 40  ? -49.028 -16.475 1.907   1.00 0.00 ? 46  GLN I CD    1 
ATOM 8103  O OE1   . GLN I  1 40  ? -48.295 -17.468 1.900   1.00 0.00 ? 46  GLN I OE1   1 
ATOM 8104  N NE2   . GLN I  1 40  ? -48.792 -15.401 1.168   1.00 0.00 ? 46  GLN I NE2   1 
ATOM 8105  N N     . THR I  1 41  ? -52.858 -20.131 3.431   1.00 0.00 ? 47  THR I N     1 
ATOM 8106  C CA    . THR I  1 41  ? -53.627 -21.256 2.966   1.00 0.00 ? 47  THR I CA    1 
ATOM 8107  C C     . THR I  1 41  ? -55.053 -21.260 3.488   1.00 0.00 ? 47  THR I C     1 
ATOM 8108  O O     . THR I  1 41  ? -55.986 -21.498 2.728   1.00 0.00 ? 47  THR I O     1 
ATOM 8109  C CB    . THR I  1 41  ? -52.951 -22.568 3.355   1.00 0.00 ? 47  THR I CB    1 
ATOM 8110  O OG1   . THR I  1 41  ? -51.657 -22.636 2.746   1.00 0.00 ? 47  THR I OG1   1 
ATOM 8111  C CG2   . THR I  1 41  ? -53.787 -23.746 2.897   1.00 0.00 ? 47  THR I CG2   1 
ATOM 8112  N N     . ASN I  1 42  ? -55.230 -21.034 4.780   1.00 0.00 ? 48  ASN I N     1 
ATOM 8113  C CA    . ASN I  1 42  ? -56.555 -21.161 5.354   1.00 0.00 ? 48  ASN I CA    1 
ATOM 8114  C C     . ASN I  1 42  ? -57.326 -19.863 5.540   1.00 0.00 ? 48  ASN I C     1 
ATOM 8115  O O     . ASN I  1 42  ? -58.542 -19.864 5.431   1.00 0.00 ? 48  ASN I O     1 
ATOM 8116  C CB    . ASN I  1 42  ? -56.487 -21.911 6.659   1.00 0.00 ? 48  ASN I CB    1 
ATOM 8117  C CG    . ASN I  1 42  ? -56.193 -23.375 6.460   1.00 0.00 ? 48  ASN I CG    1 
ATOM 8118  O OD1   . ASN I  1 42  ? -56.522 -23.948 5.411   1.00 0.00 ? 48  ASN I OD1   1 
ATOM 8119  N ND2   . ASN I  1 42  ? -55.599 -24.001 7.446   1.00 0.00 ? 48  ASN I ND2   1 
ATOM 8120  N N     . VAL I  1 43  ? -56.650 -18.759 5.811   1.00 0.00 ? 49  VAL I N     1 
ATOM 8121  C CA    . VAL I  1 43  ? -57.380 -17.534 6.160   1.00 0.00 ? 49  VAL I CA    1 
ATOM 8122  C C     . VAL I  1 43  ? -58.372 -17.012 5.106   1.00 0.00 ? 49  VAL I C     1 
ATOM 8123  O O     . VAL I  1 43  ? -59.494 -16.658 5.469   1.00 0.00 ? 49  VAL I O     1 
ATOM 8124  C CB    . VAL I  1 43  ? -56.420 -16.429 6.562   1.00 0.00 ? 49  VAL I CB    1 
ATOM 8125  C CG1   . VAL I  1 43  ? -57.156 -15.110 6.673   1.00 0.00 ? 49  VAL I CG1   1 
ATOM 8126  C CG2   . VAL I  1 43  ? -55.831 -16.802 7.885   1.00 0.00 ? 49  VAL I CG2   1 
ATOM 8127  N N     . PRO I  1 44  ? -58.003 -16.957 3.814   1.00 0.00 ? 50  PRO I N     1 
ATOM 8128  C CA    . PRO I  1 44  ? -58.815 -16.526 2.689   1.00 0.00 ? 50  PRO I CA    1 
ATOM 8129  C C     . PRO I  1 44  ? -60.138 -17.273 2.647   1.00 0.00 ? 50  PRO I C     1 
ATOM 8130  O O     . PRO I  1 44  ? -61.144 -16.741 2.174   1.00 0.00 ? 50  PRO I O     1 
ATOM 8131  C CB    . PRO I  1 44  ? -57.951 -16.861 1.486   1.00 0.00 ? 50  PRO I CB    1 
ATOM 8132  C CG    . PRO I  1 44  ? -56.567 -16.778 1.996   1.00 0.00 ? 50  PRO I CG    1 
ATOM 8133  C CD    . PRO I  1 44  ? -56.647 -17.336 3.379   1.00 0.00 ? 50  PRO I CD    1 
ATOM 8134  N N     . LYS I  1 45  ? -60.134 -18.511 3.143   1.00 0.00 ? 51  LYS I N     1 
ATOM 8135  C CA    . LYS I  1 45  ? -61.316 -19.346 3.146   1.00 0.00 ? 51  LYS I CA    1 
ATOM 8136  C C     . LYS I  1 45  ? -62.372 -18.772 4.056   1.00 0.00 ? 51  LYS I C     1 
ATOM 8137  O O     . LYS I  1 45  ? -63.563 -18.903 3.796   1.00 0.00 ? 51  LYS I O     1 
ATOM 8138  C CB    . LYS I  1 45  ? -60.962 -20.744 3.618   1.00 0.00 ? 51  LYS I CB    1 
ATOM 8139  C CG    . LYS I  1 45  ? -60.059 -21.520 2.680   1.00 0.00 ? 51  LYS I CG    1 
ATOM 8140  C CD    . LYS I  1 45  ? -59.626 -22.834 3.309   1.00 0.00 ? 51  LYS I CD    1 
ATOM 8141  C CE    . LYS I  1 45  ? -58.680 -23.599 2.401   1.00 0.00 ? 51  LYS I CE    1 
ATOM 8142  N NZ    . LYS I  1 45  ? -58.112 -24.795 3.076   1.00 0.00 ? 51  LYS I NZ    1 
ATOM 8143  N N     . PHE I  1 46  ? -61.930 -18.139 5.134   1.00 0.00 ? 52  PHE I N     1 
ATOM 8144  C CA    . PHE I  1 46  ? -62.830 -17.580 6.109   1.00 0.00 ? 52  PHE I CA    1 
ATOM 8145  C C     . PHE I  1 46  ? -63.150 -16.146 5.804   1.00 0.00 ? 52  PHE I C     1 
ATOM 8146  O O     . PHE I  1 46  ? -64.213 -15.656 6.170   1.00 0.00 ? 52  PHE I O     1 
ATOM 8147  C CB    . PHE I  1 46  ? -62.234 -17.709 7.486   1.00 0.00 ? 52  PHE I CB    1 
ATOM 8148  C CG    . PHE I  1 46  ? -62.178 -19.120 7.936   1.00 0.00 ? 52  PHE I CG    1 
ATOM 8149  C CD1   . PHE I  1 46  ? -61.088 -19.903 7.632   1.00 0.00 ? 52  PHE I CD1   1 
ATOM 8150  C CD2   . PHE I  1 46  ? -63.218 -19.676 8.656   1.00 0.00 ? 52  PHE I CD2   1 
ATOM 8151  C CE1   . PHE I  1 46  ? -61.036 -21.216 8.033   1.00 0.00 ? 52  PHE I CE1   1 
ATOM 8152  C CE2   . PHE I  1 46  ? -63.166 -20.985 9.068   1.00 0.00 ? 52  PHE I CE2   1 
ATOM 8153  C CZ    . PHE I  1 46  ? -62.076 -21.758 8.755   1.00 0.00 ? 52  PHE I CZ    1 
ATOM 8154  N N     . THR I  1 47  ? -62.255 -15.471 5.104   1.00 0.00 ? 53  THR I N     1 
ATOM 8155  C CA    . THR I  1 47  ? -62.540 -14.119 4.691   1.00 0.00 ? 53  THR I CA    1 
ATOM 8156  C C     . THR I  1 47  ? -63.709 -14.096 3.748   1.00 0.00 ? 53  THR I C     1 
ATOM 8157  O O     . THR I  1 47  ? -64.590 -13.248 3.868   1.00 0.00 ? 53  THR I O     1 
ATOM 8158  C CB    . THR I  1 47  ? -61.354 -13.463 4.025   1.00 0.00 ? 53  THR I CB    1 
ATOM 8159  O OG1   . THR I  1 47  ? -60.270 -13.370 4.955   1.00 0.00 ? 53  THR I OG1   1 
ATOM 8160  C CG2   . THR I  1 47  ? -61.744 -12.079 3.554   1.00 0.00 ? 53  THR I CG2   1 
ATOM 8161  N N     . SER I  1 48  ? -63.737 -15.044 2.816   1.00 0.00 ? 54  SER I N     1 
ATOM 8162  C CA    . SER I  1 48  ? -64.840 -15.127 1.879   1.00 0.00 ? 54  SER I CA    1 
ATOM 8163  C C     . SER I  1 48  ? -66.155 -15.392 2.600   1.00 0.00 ? 54  SER I C     1 
ATOM 8164  O O     . SER I  1 48  ? -67.207 -14.920 2.174   1.00 0.00 ? 54  SER I O     1 
ATOM 8165  C CB    . SER I  1 48  ? -64.587 -16.222 0.878   1.00 0.00 ? 54  SER I CB    1 
ATOM 8166  O OG    . SER I  1 48  ? -64.628 -17.480 1.492   1.00 0.00 ? 54  SER I OG    1 
ATOM 8167  N N     . VAL I  1 49  ? -66.082 -16.097 3.725   1.00 0.00 ? 55  VAL I N     1 
ATOM 8168  C CA    . VAL I  1 49  ? -67.252 -16.347 4.542   1.00 0.00 ? 55  VAL I CA    1 
ATOM 8169  C C     . VAL I  1 49  ? -67.727 -15.075 5.169   1.00 0.00 ? 55  VAL I C     1 
ATOM 8170  O O     . VAL I  1 49  ? -68.905 -14.753 5.110   1.00 0.00 ? 55  VAL I O     1 
ATOM 8171  C CB    . VAL I  1 49  ? -66.945 -17.363 5.643   1.00 0.00 ? 55  VAL I CB    1 
ATOM 8172  C CG1   . VAL I  1 49  ? -68.108 -17.460 6.606   1.00 0.00 ? 55  VAL I CG1   1 
ATOM 8173  C CG2   . VAL I  1 49  ? -66.664 -18.706 5.023   1.00 0.00 ? 55  VAL I CG2   1 
ATOM 8174  N N     . ASN I  1 50  ? -66.802 -14.319 5.734   1.00 0.00 ? 56  ASN I N     1 
ATOM 8175  C CA    . ASN I  1 50  ? -67.137 -13.059 6.355   1.00 0.00 ? 56  ASN I CA    1 
ATOM 8176  C C     . ASN I  1 50  ? -67.810 -12.151 5.380   1.00 0.00 ? 56  ASN I C     1 
ATOM 8177  O O     . ASN I  1 50  ? -68.763 -11.464 5.724   1.00 0.00 ? 56  ASN I O     1 
ATOM 8178  C CB    . ASN I  1 50  ? -65.905 -12.398 6.904   1.00 0.00 ? 56  ASN I CB    1 
ATOM 8179  C CG    . ASN I  1 50  ? -65.407 -13.068 8.123   1.00 0.00 ? 56  ASN I CG    1 
ATOM 8180  O OD1   . ASN I  1 50  ? -66.165 -13.768 8.797   1.00 0.00 ? 56  ASN I OD1   1 
ATOM 8181  N ND2   . ASN I  1 50  ? -64.151 -12.878 8.428   1.00 0.00 ? 56  ASN I ND2   1 
ATOM 8182  N N     . GLU I  1 51  ? -67.335 -12.165 4.149   1.00 0.00 ? 57  GLU I N     1 
ATOM 8183  C CA    . GLU I  1 51  ? -67.888 -11.332 3.112   1.00 0.00 ? 57  GLU I CA    1 
ATOM 8184  C C     . GLU I  1 51  ? -69.289 -11.731 2.734   1.00 0.00 ? 57  GLU I C     1 
ATOM 8185  O O     . GLU I  1 51  ? -70.191 -10.893 2.703   1.00 0.00 ? 57  GLU I O     1 
ATOM 8186  C CB    . GLU I  1 51  ? -67.021 -11.391 1.879   1.00 0.00 ? 57  GLU I CB    1 
ATOM 8187  C CG    . GLU I  1 51  ? -67.562 -10.581 0.732   1.00 0.00 ? 57  GLU I CG    1 
ATOM 8188  C CD    . GLU I  1 51  ? -67.576 -9.127  1.038   1.00 0.00 ? 57  GLU I CD    1 
ATOM 8189  O OE1   . GLU I  1 51  ? -66.768 -8.705  1.829   1.00 0.00 ? 57  GLU I OE1   1 
ATOM 8190  O OE2   . GLU I  1 51  ? -68.406 -8.433  0.503   1.00 0.00 ? 57  GLU I OE2   1 
ATOM 8191  N N     . ASN I  1 52  ? -69.472 -12.996 2.417   1.00 0.00 ? 58  ASN I N     1 
ATOM 8192  C CA    . ASN I  1 52  ? -70.755 -13.458 1.954   1.00 0.00 ? 58  ASN I CA    1 
ATOM 8193  C C     . ASN I  1 52  ? -71.792 -13.400 3.050   1.00 0.00 ? 58  ASN I C     1 
ATOM 8194  O O     . ASN I  1 52  ? -72.932 -13.015 2.806   1.00 0.00 ? 58  ASN I O     1 
ATOM 8195  C CB    . ASN I  1 52  ? -70.635 -14.834 1.394   1.00 0.00 ? 58  ASN I CB    1 
ATOM 8196  C CG    . ASN I  1 52  ? -69.892 -14.853 0.094   1.00 0.00 ? 58  ASN I CG    1 
ATOM 8197  O OD1   . ASN I  1 52  ? -69.726 -13.815 -0.556  1.00 0.00 ? 58  ASN I OD1   1 
ATOM 8198  N ND2   . ASN I  1 52  ? -69.446 -16.015 -0.305  1.00 0.00 ? 58  ASN I ND2   1 
ATOM 8199  N N     . VAL I  1 53  ? -71.393 -13.740 4.266   1.00 0.00 ? 59  VAL I N     1 
ATOM 8200  C CA    . VAL I  1 53  ? -72.290 -13.664 5.395   1.00 0.00 ? 59  VAL I CA    1 
ATOM 8201  C C     . VAL I  1 53  ? -72.663 -12.234 5.670   1.00 0.00 ? 59  VAL I C     1 
ATOM 8202  O O     . VAL I  1 53  ? -73.811 -11.940 5.981   1.00 0.00 ? 59  VAL I O     1 
ATOM 8203  C CB    . VAL I  1 53  ? -71.664 -14.291 6.640   1.00 0.00 ? 59  VAL I CB    1 
ATOM 8204  C CG1   . VAL I  1 53  ? -72.533 -14.010 7.854   1.00 0.00 ? 59  VAL I CG1   1 
ATOM 8205  C CG2   . VAL I  1 53  ? -71.525 -15.788 6.435   1.00 0.00 ? 59  VAL I CG2   1 
ATOM 8206  N N     . SER I  1 54  ? -71.699 -11.334 5.548   1.00 0.00 ? 60  SER I N     1 
ATOM 8207  C CA    . SER I  1 54  ? -71.971 -9.933  5.725   1.00 0.00 ? 60  SER I CA    1 
ATOM 8208  C C     . SER I  1 54  ? -73.037 -9.477  4.767   1.00 0.00 ? 60  SER I C     1 
ATOM 8209  O O     . SER I  1 54  ? -73.965 -8.774  5.161   1.00 0.00 ? 60  SER I O     1 
ATOM 8210  C CB    . SER I  1 54  ? -70.723 -9.124  5.518   1.00 0.00 ? 60  SER I CB    1 
ATOM 8211  O OG    . SER I  1 54  ? -70.980 -7.761  5.690   1.00 0.00 ? 60  SER I OG    1 
ATOM 8212  N N     . ALA I  1 55  ? -72.919 -9.883  3.506   1.00 0.00 ? 61  ALA I N     1 
ATOM 8213  C CA    . ALA I  1 55  ? -73.905 -9.517  2.504   1.00 0.00 ? 61  ALA I CA    1 
ATOM 8214  C C     . ALA I  1 55  ? -75.287 -9.930  2.946   1.00 0.00 ? 61  ALA I C     1 
ATOM 8215  O O     . ALA I  1 55  ? -76.227 -9.138  2.882   1.00 0.00 ? 61  ALA I O     1 
ATOM 8216  C CB    . ALA I  1 55  ? -73.569 -10.154 1.173   1.00 0.00 ? 61  ALA I CB    1 
ATOM 8217  N N     . VAL I  1 56  ? -75.398 -11.154 3.434   1.00 0.00 ? 62  VAL I N     1 
ATOM 8218  C CA    . VAL I  1 56  ? -76.654 -11.668 3.936   1.00 0.00 ? 62  VAL I CA    1 
ATOM 8219  C C     . VAL I  1 56  ? -77.202 -10.821 5.044   1.00 0.00 ? 62  VAL I C     1 
ATOM 8220  O O     . VAL I  1 56  ? -78.370 -10.443 5.028   1.00 0.00 ? 62  VAL I O     1 
ATOM 8221  C CB    . VAL I  1 56  ? -76.464 -13.090 4.453   1.00 0.00 ? 62  VAL I CB    1 
ATOM 8222  C CG1   . VAL I  1 56  ? -77.685 -13.556 5.199   1.00 0.00 ? 62  VAL I CG1   1 
ATOM 8223  C CG2   . VAL I  1 56  ? -76.189 -13.998 3.299   1.00 0.00 ? 62  VAL I CG2   1 
ATOM 8224  N N     . LEU I  1 57  ? -76.359 -10.508 6.001   1.00 0.00 ? 63  LEU I N     1 
ATOM 8225  C CA    . LEU I  1 57  ? -76.775 -9.773  7.165   1.00 0.00 ? 63  LEU I CA    1 
ATOM 8226  C C     . LEU I  1 57  ? -77.277 -8.399  6.809   1.00 0.00 ? 63  LEU I C     1 
ATOM 8227  O O     . LEU I  1 57  ? -78.234 -7.910  7.404   1.00 0.00 ? 63  LEU I O     1 
ATOM 8228  C CB    . LEU I  1 57  ? -75.625 -9.701  8.133   1.00 0.00 ? 63  LEU I CB    1 
ATOM 8229  C CG    . LEU I  1 57  ? -75.259 -11.047 8.740   1.00 0.00 ? 63  LEU I CG    1 
ATOM 8230  C CD1   . LEU I  1 57  ? -74.006 -10.910 9.574   1.00 0.00 ? 63  LEU I CD1   1 
ATOM 8231  C CD2   . LEU I  1 57  ? -76.424 -11.547 9.560   1.00 0.00 ? 63  LEU I CD2   1 
ATOM 8232  N N     . THR I  1 58  ? -76.679 -7.790  5.802   1.00 0.00 ? 64  THR I N     1 
ATOM 8233  C CA    . THR I  1 58  ? -77.154 -6.510  5.332   1.00 0.00 ? 64  THR I CA    1 
ATOM 8234  C C     . THR I  1 58  ? -78.542 -6.643  4.727   1.00 0.00 ? 64  THR I C     1 
ATOM 8235  O O     . THR I  1 58  ? -79.414 -5.810  4.970   1.00 0.00 ? 64  THR I O     1 
ATOM 8236  C CB    . THR I  1 58  ? -76.175 -5.886  4.351   1.00 0.00 ? 64  THR I CB    1 
ATOM 8237  O OG1   . THR I  1 58  ? -74.930 -5.657  5.033   1.00 0.00 ? 64  THR I OG1   1 
ATOM 8238  C CG2   . THR I  1 58  ? -76.718 -4.566  3.827   1.00 0.00 ? 64  THR I CG2   1 
ATOM 8239  N N     . GLN I  1 59  ? -78.772 -7.722  3.982   1.00 0.00 ? 65  GLN I N     1 
ATOM 8240  C CA    . GLN I  1 59  ? -80.100 -7.990  3.426   1.00 0.00 ? 65  GLN I CA    1 
ATOM 8241  C C     . GLN I  1 59  ? -81.147 -8.208  4.526   1.00 0.00 ? 65  GLN I C     1 
ATOM 8242  O O     . GLN I  1 59  ? -82.314 -7.867  4.352   1.00 0.00 ? 65  GLN I O     1 
ATOM 8243  C CB    . GLN I  1 59  ? -80.077 -9.206  2.509   1.00 0.00 ? 65  GLN I CB    1 
ATOM 8244  C CG    . GLN I  1 59  ? -79.325 -9.000  1.217   1.00 0.00 ? 65  GLN I CG    1 
ATOM 8245  C CD    . GLN I  1 59  ? -79.321 -10.247 0.351   1.00 0.00 ? 65  GLN I CD    1 
ATOM 8246  O OE1   . GLN I  1 59  ? -79.941 -11.262 0.686   1.00 0.00 ? 65  GLN I OE1   1 
ATOM 8247  N NE2   . GLN I  1 59  ? -78.620 -10.180 -0.775  1.00 0.00 ? 65  GLN I NE2   1 
ATOM 8248  N N     . TYR I  1 60  ? -80.728 -8.776  5.655   1.00 0.00 ? 66  TYR I N     1 
ATOM 8249  C CA    . TYR I  1 60  ? -81.640 -8.985  6.777   1.00 0.00 ? 66  TYR I CA    1 
ATOM 8250  C C     . TYR I  1 60  ? -81.714 -7.816  7.744   1.00 0.00 ? 66  TYR I C     1 
ATOM 8251  O O     . TYR I  1 60  ? -82.403 -7.901  8.755   1.00 0.00 ? 66  TYR I O     1 
ATOM 8252  C CB    . TYR I  1 60  ? -81.279 -10.243 7.531   1.00 0.00 ? 66  TYR I CB    1 
ATOM 8253  C CG    . TYR I  1 60  ? -81.748 -11.479 6.843   1.00 0.00 ? 66  TYR I CG    1 
ATOM 8254  C CD1   . TYR I  1 60  ? -80.889 -12.211 6.069   1.00 0.00 ? 66  TYR I CD1   1 
ATOM 8255  C CD2   . TYR I  1 60  ? -83.060 -11.878 6.988   1.00 0.00 ? 66  TYR I CD2   1 
ATOM 8256  C CE1   . TYR I  1 60  ? -81.334 -13.341 5.428   1.00 0.00 ? 66  TYR I CE1   1 
ATOM 8257  C CE2   . TYR I  1 60  ? -83.507 -13.011 6.354   1.00 0.00 ? 66  TYR I CE2   1 
ATOM 8258  C CZ    . TYR I  1 60  ? -82.646 -13.741 5.575   1.00 0.00 ? 66  TYR I CZ    1 
ATOM 8259  O OH    . TYR I  1 60  ? -83.088 -14.871 4.938   1.00 0.00 ? 66  TYR I OH    1 
ATOM 8260  N N     . GLY I  1 61  ? -81.010 -6.734  7.458   1.00 0.00 ? 67  GLY I N     1 
ATOM 8261  C CA    . GLY I  1 61  ? -81.111 -5.555  8.299   1.00 0.00 ? 67  GLY I CA    1 
ATOM 8262  C C     . GLY I  1 61  ? -80.368 -5.691  9.621   1.00 0.00 ? 67  GLY I C     1 
ATOM 8263  O O     . GLY I  1 61  ? -80.643 -4.954  10.569  1.00 0.00 ? 67  GLY I O     1 
ATOM 8264  N N     . ILE I  1 62  ? -79.421 -6.612  9.682   1.00 0.00 ? 68  ILE I N     1 
ATOM 8265  C CA    . ILE I  1 62  ? -78.700 -6.875  10.912  1.00 0.00 ? 68  ILE I CA    1 
ATOM 8266  C C     . ILE I  1 62  ? -77.559 -5.899  11.078  1.00 0.00 ? 68  ILE I C     1 
ATOM 8267  O O     . ILE I  1 62  ? -76.745 -5.729  10.171  1.00 0.00 ? 68  ILE I O     1 
ATOM 8268  C CB    . ILE I  1 62  ? -78.156 -8.300  10.919  1.00 0.00 ? 68  ILE I CB    1 
ATOM 8269  C CG1   . ILE I  1 62  ? -79.285 -9.299  10.688  1.00 0.00 ? 68  ILE I CG1   1 
ATOM 8270  C CG2   . ILE I  1 62  ? -77.479 -8.585  12.231  1.00 0.00 ? 68  ILE I CG2   1 
ATOM 8271  C CD1   . ILE I  1 62  ? -80.376 -9.232  11.722  1.00 0.00 ? 68  ILE I CD1   1 
ATOM 8272  N N     . THR I  1 63  ? -77.506 -5.234  12.225  1.00 0.00 ? 69  THR I N     1 
ATOM 8273  C CA    . THR I  1 63  ? -76.471 -4.232  12.480  1.00 0.00 ? 69  THR I CA    1 
ATOM 8274  C C     . THR I  1 63  ? -75.741 -4.469  13.788  1.00 0.00 ? 69  THR I C     1 
ATOM 8275  O O     . THR I  1 63  ? -76.228 -5.176  14.669  1.00 0.00 ? 69  THR I O     1 
ATOM 8276  C CB    . THR I  1 63  ? -77.072 -2.844  12.543  1.00 0.00 ? 69  THR I CB    1 
ATOM 8277  O OG1   . THR I  1 63  ? -77.956 -2.803  13.657  1.00 0.00 ? 69  THR I OG1   1 
ATOM 8278  C CG2   . THR I  1 63  ? -77.834 -2.507  11.274  1.00 0.00 ? 69  THR I CG2   1 
ATOM 8279  N N     . GLY I  1 64  ? -74.600 -3.823  13.928  1.00 0.00 ? 70  GLY I N     1 
ATOM 8280  C CA    . GLY I  1 64  ? -73.838 -3.869  15.154  1.00 0.00 ? 70  GLY I CA    1 
ATOM 8281  C C     . GLY I  1 64  ? -73.387 -5.272  15.494  1.00 0.00 ? 70  GLY I C     1 
ATOM 8282  O O     . GLY I  1 64  ? -73.169 -6.104  14.614  1.00 0.00 ? 70  GLY I O     1 
ATOM 8283  N N     . PRO I  1 65  ? -73.277 -5.548  16.782  1.00 0.00 ? 71  PRO I N     1 
ATOM 8284  C CA    . PRO I  1 65  ? -72.859 -6.791  17.384  1.00 0.00 ? 71  PRO I CA    1 
ATOM 8285  C C     . PRO I  1 65  ? -73.748 -7.934  16.984  1.00 0.00 ? 71  PRO I C     1 
ATOM 8286  O O     . PRO I  1 65  ? -73.357 -9.090  17.088  1.00 0.00 ? 71  PRO I O     1 
ATOM 8287  C CB    . PRO I  1 65  ? -72.903 -6.493  18.865  1.00 0.00 ? 71  PRO I CB    1 
ATOM 8288  C CG    . PRO I  1 65  ? -72.566 -5.040  18.955  1.00 0.00 ? 71  PRO I CG    1 
ATOM 8289  C CD    . PRO I  1 65  ? -73.157 -4.423  17.723  1.00 0.00 ? 71  PRO I CD    1 
ATOM 8290  N N     . ASN I  1 66  ? -74.946 -7.629  16.509  1.00 0.00 ? 72  ASN I N     1 
ATOM 8291  C CA    . ASN I  1 66  ? -75.825 -8.671  16.076  1.00 0.00 ? 72  ASN I CA    1 
ATOM 8292  C C     . ASN I  1 66  ? -75.269 -9.330  14.844  1.00 0.00 ? 72  ASN I C     1 
ATOM 8293  O O     . ASN I  1 66  ? -75.459 -10.527 14.635  1.00 0.00 ? 72  ASN I O     1 
ATOM 8294  C CB    . ASN I  1 66  ? -77.192 -8.130  15.837  1.00 0.00 ? 72  ASN I CB    1 
ATOM 8295  C CG    . ASN I  1 66  ? -77.869 -7.788  17.118  1.00 0.00 ? 72  ASN I CG    1 
ATOM 8296  O OD1   . ASN I  1 66  ? -77.678 -8.469  18.128  1.00 0.00 ? 72  ASN I OD1   1 
ATOM 8297  N ND2   . ASN I  1 66  ? -78.632 -6.730  17.114  1.00 0.00 ? 72  ASN I ND2   1 
ATOM 8298  N N     . ARG I  1 67  ? -74.541 -8.561  14.038  1.00 0.00 ? 73  ARG I N     1 
ATOM 8299  C CA    . ARG I  1 67  ? -73.908 -9.116  12.873  1.00 0.00 ? 73  ARG I CA    1 
ATOM 8300  C C     . ARG I  1 67  ? -72.837 -10.037 13.325  1.00 0.00 ? 73  ARG I C     1 
ATOM 8301  O O     . ARG I  1 67  ? -72.699 -11.141 12.807  1.00 0.00 ? 73  ARG I O     1 
ATOM 8302  C CB    . ARG I  1 67  ? -73.292 -8.038  12.006  1.00 0.00 ? 73  ARG I CB    1 
ATOM 8303  C CG    . ARG I  1 67  ? -74.277 -7.103  11.363  1.00 0.00 ? 73  ARG I CG    1 
ATOM 8304  C CD    . ARG I  1 67  ? -73.601 -6.041  10.604  1.00 0.00 ? 73  ARG I CD    1 
ATOM 8305  N NE    . ARG I  1 67  ? -73.043 -6.518  9.351   1.00 0.00 ? 73  ARG I NE    1 
ATOM 8306  C CZ    . ARG I  1 67  ? -73.685 -6.458  8.165   1.00 0.00 ? 73  ARG I CZ    1 
ATOM 8307  N NH1   . ARG I  1 67  ? -74.899 -5.981  8.079   1.00 0.00 ? 73  ARG I NH1   1 
ATOM 8308  N NH2   . ARG I  1 67  ? -73.101 -6.857  7.057   1.00 0.00 ? 73  ARG I NH2   1 
ATOM 8309  N N     . ALA I  1 68  ? -72.111 -9.606  14.354  1.00 0.00 ? 74  ALA I N     1 
ATOM 8310  C CA    . ALA I  1 68  ? -71.021 -10.392 14.917  1.00 0.00 ? 74  ALA I CA    1 
ATOM 8311  C C     . ALA I  1 68  ? -71.502 -11.747 15.407  1.00 0.00 ? 74  ALA I C     1 
ATOM 8312  O O     . ALA I  1 68  ? -70.796 -12.741 15.264  1.00 0.00 ? 74  ALA I O     1 
ATOM 8313  C CB    . ALA I  1 68  ? -70.352 -9.634  16.047  1.00 0.00 ? 74  ALA I CB    1 
ATOM 8314  N N     . ILE I  1 69  ? -72.717 -11.798 15.947  1.00 0.00 ? 75  ILE I N     1 
ATOM 8315  C CA    . ILE I  1 69  ? -73.284 -13.067 16.385  1.00 0.00 ? 75  ILE I CA    1 
ATOM 8316  C C     . ILE I  1 69  ? -73.365 -14.041 15.247  1.00 0.00 ? 75  ILE I C     1 
ATOM 8317  O O     . ILE I  1 69  ? -72.915 -15.185 15.353  1.00 0.00 ? 75  ILE I O     1 
ATOM 8318  C CB    . ILE I  1 69  ? -74.697 -12.889 16.954  1.00 0.00 ? 75  ILE I CB    1 
ATOM 8319  C CG1   . ILE I  1 69  ? -74.653 -12.119 18.250  1.00 0.00 ? 75  ILE I CG1   1 
ATOM 8320  C CG2   . ILE I  1 69  ? -75.352 -14.244 17.152  1.00 0.00 ? 75  ILE I CG2   1 
ATOM 8321  C CD1   . ILE I  1 69  ? -76.004 -11.665 18.734  1.00 0.00 ? 75  ILE I CD1   1 
ATOM 8322  N N     . TYR I  1 70  ? -73.942 -13.591 14.149  1.00 0.00 ? 76  TYR I N     1 
ATOM 8323  C CA    . TYR I  1 70  ? -74.142 -14.452 13.013  1.00 0.00 ? 76  TYR I CA    1 
ATOM 8324  C C     . TYR I  1 70  ? -72.841 -14.756 12.304  1.00 0.00 ? 76  TYR I C     1 
ATOM 8325  O O     . TYR I  1 70  ? -72.662 -15.853 11.780  1.00 0.00 ? 76  TYR I O     1 
ATOM 8326  C CB    . TYR I  1 70  ? -75.133 -13.825 12.077  1.00 0.00 ? 76  TYR I CB    1 
ATOM 8327  C CG    . TYR I  1 70  ? -76.500 -13.742 12.684  1.00 0.00 ? 76  TYR I CG    1 
ATOM 8328  C CD1   . TYR I  1 70  ? -77.059 -12.513 12.952  1.00 0.00 ? 76  TYR I CD1   1 
ATOM 8329  C CD2   . TYR I  1 70  ? -77.176 -14.896 13.006  1.00 0.00 ? 76  TYR I CD2   1 
ATOM 8330  C CE1   . TYR I  1 70  ? -78.296 -12.438 13.545  1.00 0.00 ? 76  TYR I CE1   1 
ATOM 8331  C CE2   . TYR I  1 70  ? -78.415 -14.827 13.601  1.00 0.00 ? 76  TYR I CE2   1 
ATOM 8332  C CZ    . TYR I  1 70  ? -78.972 -13.600 13.874  1.00 0.00 ? 76  TYR I CZ    1 
ATOM 8333  O OH    . TYR I  1 70  ? -80.198 -13.520 14.481  1.00 0.00 ? 76  TYR I OH    1 
ATOM 8334  N N     . GLN I  1 71  ? -71.915 -13.807 12.324  1.00 0.00 ? 77  GLN I N     1 
ATOM 8335  C CA    . GLN I  1 71  ? -70.619 -14.022 11.730  1.00 0.00 ? 77  GLN I CA    1 
ATOM 8336  C C     . GLN I  1 71  ? -69.890 -15.125 12.449  1.00 0.00 ? 77  GLN I C     1 
ATOM 8337  O O     . GLN I  1 71  ? -69.298 -15.991 11.815  1.00 0.00 ? 77  GLN I O     1 
ATOM 8338  C CB    . GLN I  1 71  ? -69.800 -12.742 11.768  1.00 0.00 ? 77  GLN I CB    1 
ATOM 8339  C CG    . GLN I  1 71  ? -70.282 -11.668 10.815  1.00 0.00 ? 77  GLN I CG    1 
ATOM 8340  C CD    . GLN I  1 71  ? -69.969 -12.006 9.391   1.00 0.00 ? 77  GLN I CD    1 
ATOM 8341  O OE1   . GLN I  1 71  ? -69.644 -13.152 9.083   1.00 0.00 ? 77  GLN I OE1   1 
ATOM 8342  N NE2   . GLN I  1 71  ? -70.039 -11.014 8.509   1.00 0.00 ? 77  GLN I NE2   1 
ATOM 8343  N N     . GLY I  1 72  ? -69.977 -15.126 13.777  1.00 0.00 ? 78  GLY I N     1 
ATOM 8344  C CA    . GLY I  1 72  ? -69.349 -16.166 14.581  1.00 0.00 ? 78  GLY I CA    1 
ATOM 8345  C C     . GLY I  1 72  ? -69.912 -17.521 14.227  1.00 0.00 ? 78  GLY I C     1 
ATOM 8346  O O     . GLY I  1 72  ? -69.165 -18.484 14.040  1.00 0.00 ? 78  GLY I O     1 
ATOM 8347  N N     . PHE I  1 73  ? -71.225 -17.589 14.114  1.00 0.00 ? 79  PHE I N     1 
ATOM 8348  C CA    . PHE I  1 73  ? -71.892 -18.805 13.720  1.00 0.00 ? 79  PHE I CA    1 
ATOM 8349  C C     . PHE I  1 73  ? -71.388 -19.303 12.381  1.00 0.00 ? 79  PHE I C     1 
ATOM 8350  O O     . PHE I  1 73  ? -71.038 -20.473 12.244  1.00 0.00 ? 79  PHE I O     1 
ATOM 8351  C CB    . PHE I  1 73  ? -73.382 -18.567 13.661  1.00 0.00 ? 79  PHE I CB    1 
ATOM 8352  C CG    . PHE I  1 73  ? -74.154 -19.687 13.064  1.00 0.00 ? 79  PHE I CG    1 
ATOM 8353  C CD1   . PHE I  1 73  ? -74.486 -20.806 13.797  1.00 0.00 ? 79  PHE I CD1   1 
ATOM 8354  C CD2   . PHE I  1 73  ? -74.578 -19.604 11.757  1.00 0.00 ? 79  PHE I CD2   1 
ATOM 8355  C CE1   . PHE I  1 73  ? -75.228 -21.821 13.231  1.00 0.00 ? 79  PHE I CE1   1 
ATOM 8356  C CE2   . PHE I  1 73  ? -75.312 -20.610 11.187  1.00 0.00 ? 79  PHE I CE2   1 
ATOM 8357  C CZ    . PHE I  1 73  ? -75.639 -21.722 11.924  1.00 0.00 ? 79  PHE I CZ    1 
ATOM 8358  N N     . GLY I  1 74  ? -71.358 -18.419 11.390  1.00 0.00 ? 80  GLY I N     1 
ATOM 8359  C CA    . GLY I  1 74  ? -70.907 -18.773 10.055  1.00 0.00 ? 80  GLY I CA    1 
ATOM 8360  C C     . GLY I  1 74  ? -69.481 -19.288 10.063  1.00 0.00 ? 80  GLY I C     1 
ATOM 8361  O O     . GLY I  1 74  ? -69.176 -20.305 9.446   1.00 0.00 ? 80  GLY I O     1 
ATOM 8362  N N     . LEU I  1 75  ? -68.620 -18.603 10.782  1.00 0.00 ? 81  LEU I N     1 
ATOM 8363  C CA    . LEU I  1 75  ? -67.234 -18.990 10.869  1.00 0.00 ? 81  LEU I CA    1 
ATOM 8364  C C     . LEU I  1 75  ? -67.081 -20.372 11.463  1.00 0.00 ? 81  LEU I C     1 
ATOM 8365  O O     . LEU I  1 75  ? -66.258 -21.162 11.002  1.00 0.00 ? 81  LEU I O     1 
ATOM 8366  C CB    . LEU I  1 75  ? -66.485 -17.977 11.704  1.00 0.00 ? 81  LEU I CB    1 
ATOM 8367  C CG    . LEU I  1 75  ? -66.295 -16.619 11.052  1.00 0.00 ? 81  LEU I CG    1 
ATOM 8368  C CD1   . LEU I  1 75  ? -65.745 -15.643 12.072  1.00 0.00 ? 81  LEU I CD1   1 
ATOM 8369  C CD2   . LEU I  1 75  ? -65.350 -16.775 9.878   1.00 0.00 ? 81  LEU I CD2   1 
ATOM 8370  N N     . LYS I  1 76  ? -67.902 -20.678 12.453  1.00 0.00 ? 82  LYS I N     1 
ATOM 8371  C CA    . LYS I  1 76  ? -67.888 -21.986 13.068  1.00 0.00 ? 82  LYS I CA    1 
ATOM 8372  C C     . LYS I  1 76  ? -68.284 -23.064 12.095  1.00 0.00 ? 82  LYS I C     1 
ATOM 8373  O O     . LYS I  1 76  ? -67.674 -24.132 12.069  1.00 0.00 ? 82  LYS I O     1 
ATOM 8374  C CB    . LYS I  1 76  ? -68.806 -22.007 14.261  1.00 0.00 ? 82  LYS I CB    1 
ATOM 8375  C CG    . LYS I  1 76  ? -68.933 -23.356 14.920  1.00 0.00 ? 82  LYS I CG    1 
ATOM 8376  C CD    . LYS I  1 76  ? -67.642 -23.809 15.501  1.00 0.00 ? 82  LYS I CD    1 
ATOM 8377  C CE    . LYS I  1 76  ? -67.822 -25.061 16.324  1.00 0.00 ? 82  LYS I CE    1 
ATOM 8378  N NZ    . LYS I  1 76  ? -68.525 -24.770 17.597  1.00 0.00 ? 82  LYS I NZ    1 
ATOM 8379  N N     . VAL I  1 77  ? -69.288 -22.782 11.272  1.00 0.00 ? 83  VAL I N     1 
ATOM 8380  C CA    . VAL I  1 77  ? -69.715 -23.737 10.265  1.00 0.00 ? 83  VAL I CA    1 
ATOM 8381  C C     . VAL I  1 77  ? -68.568 -24.067 9.337   1.00 0.00 ? 83  VAL I C     1 
ATOM 8382  O O     . VAL I  1 77  ? -68.304 -25.235 9.050   1.00 0.00 ? 83  VAL I O     1 
ATOM 8383  C CB    . VAL I  1 77  ? -70.892 -23.180 9.440   1.00 0.00 ? 83  VAL I CB    1 
ATOM 8384  C CG1   . VAL I  1 77  ? -71.179 -24.088 8.262   1.00 0.00 ? 83  VAL I CG1   1 
ATOM 8385  C CG2   . VAL I  1 77  ? -72.125 -23.049 10.315  1.00 0.00 ? 83  VAL I CG2   1 
ATOM 8386  N N     . ALA I  1 78  ? -67.881 -23.029 8.880   1.00 0.00 ? 84  ALA I N     1 
ATOM 8387  C CA    . ALA I  1 78  ? -66.755 -23.186 7.984   1.00 0.00 ? 84  ALA I CA    1 
ATOM 8388  C C     . ALA I  1 78  ? -65.615 -23.948 8.644   1.00 0.00 ? 84  ALA I C     1 
ATOM 8389  O O     . ALA I  1 78  ? -64.962 -24.763 7.998   1.00 0.00 ? 84  ALA I O     1 
ATOM 8390  C CB    . ALA I  1 78  ? -66.280 -21.831 7.517   1.00 0.00 ? 84  ALA I CB    1 
ATOM 8391  N N     . ARG I  1 79  ? -65.382 -23.689 9.925   1.00 0.00 ? 85  ARG I N     1 
ATOM 8392  C CA    . ARG I  1 79  ? -64.331 -24.380 10.655  1.00 0.00 ? 85  ARG I CA    1 
ATOM 8393  C C     . ARG I  1 79  ? -64.536 -25.862 10.635  1.00 0.00 ? 85  ARG I C     1 
ATOM 8394  O O     . ARG I  1 79  ? -63.622 -26.621 10.307  1.00 0.00 ? 85  ARG I O     1 
ATOM 8395  C CB    . ARG I  1 79  ? -64.286 -23.921 12.084  1.00 0.00 ? 85  ARG I CB    1 
ATOM 8396  C CG    . ARG I  1 79  ? -63.221 -24.591 12.934  1.00 0.00 ? 85  ARG I CG    1 
ATOM 8397  C CD    . ARG I  1 79  ? -63.207 -24.031 14.300  1.00 0.00 ? 85  ARG I CD    1 
ATOM 8398  N NE    . ARG I  1 79  ? -62.001 -24.352 15.036  1.00 0.00 ? 85  ARG I NE    1 
ATOM 8399  C CZ    . ARG I  1 79  ? -61.811 -25.469 15.763  1.00 0.00 ? 85  ARG I CZ    1 
ATOM 8400  N NH1   . ARG I  1 79  ? -62.754 -26.382 15.818  1.00 0.00 ? 85  ARG I NH1   1 
ATOM 8401  N NH2   . ARG I  1 79  ? -60.674 -25.640 16.421  1.00 0.00 ? 85  ARG I NH2   1 
ATOM 8402  N N     . ALA I  1 80  ? -65.739 -26.280 10.983  1.00 0.00 ? 86  ALA I N     1 
ATOM 8403  C CA    . ALA I  1 80  ? -66.081 -27.680 10.993  1.00 0.00 ? 86  ALA I CA    1 
ATOM 8404  C C     . ALA I  1 80  ? -65.927 -28.268 9.615   1.00 0.00 ? 86  ALA I C     1 
ATOM 8405  O O     . ALA I  1 80  ? -65.404 -29.366 9.455   1.00 0.00 ? 86  ALA I O     1 
ATOM 8406  C CB    . ALA I  1 80  ? -67.490 -27.865 11.487  1.00 0.00 ? 86  ALA I CB    1 
ATOM 8407  N N     . LEU I  1 81  ? -66.346 -27.524 8.612   1.00 0.00 ? 87  LEU I N     1 
ATOM 8408  C CA    . LEU I  1 81  ? -66.211 -27.977 7.261   1.00 0.00 ? 87  LEU I CA    1 
ATOM 8409  C C     . LEU I  1 81  ? -64.765 -28.291 6.946   1.00 0.00 ? 87  LEU I C     1 
ATOM 8410  O O     . LEU I  1 81  ? -64.461 -29.357 6.427   1.00 0.00 ? 87  LEU I O     1 
ATOM 8411  C CB    . LEU I  1 81  ? -66.746 -26.935 6.301   1.00 0.00 ? 87  LEU I CB    1 
ATOM 8412  C CG    . LEU I  1 81  ? -66.646 -27.292 4.831   1.00 0.00 ? 87  LEU I CG    1 
ATOM 8413  C CD1   . LEU I  1 81  ? -67.461 -28.543 4.569   1.00 0.00 ? 87  LEU I CD1   1 
ATOM 8414  C CD2   . LEU I  1 81  ? -67.151 -26.126 4.001   1.00 0.00 ? 87  LEU I CD2   1 
ATOM 8415  N N     . ASN I  1 82  ? -63.862 -27.393 7.299   1.00 0.00 ? 88  ASN I N     1 
ATOM 8416  C CA    . ASN I  1 82  ? -62.446 -27.626 7.032   1.00 0.00 ? 88  ASN I CA    1 
ATOM 8417  C C     . ASN I  1 82  ? -61.866 -28.815 7.798   1.00 0.00 ? 88  ASN I C     1 
ATOM 8418  O O     . ASN I  1 82  ? -61.050 -29.560 7.260   1.00 0.00 ? 88  ASN I O     1 
ATOM 8419  C CB    . ASN I  1 82  ? -61.631 -26.393 7.332   1.00 0.00 ? 88  ASN I CB    1 
ATOM 8420  C CG    . ASN I  1 82  ? -61.783 -25.339 6.292   1.00 0.00 ? 88  ASN I CG    1 
ATOM 8421  O OD1   . ASN I  1 82  ? -62.354 -25.577 5.227   1.00 0.00 ? 88  ASN I OD1   1 
ATOM 8422  N ND2   . ASN I  1 82  ? -61.256 -24.183 6.563   1.00 0.00 ? 88  ASN I ND2   1 
ATOM 8423  N N     . ARG I  1 83  ? -62.276 -28.991 9.048   1.00 0.00 ? 89  ARG I N     1 
ATOM 8424  C CA    . ARG I  1 83  ? -61.684 -30.035 9.884   1.00 0.00 ? 89  ARG I CA    1 
ATOM 8425  C C     . ARG I  1 83  ? -62.439 -31.367 9.815   1.00 0.00 ? 89  ARG I C     1 
ATOM 8426  O O     . ARG I  1 83  ? -61.916 -32.395 10.239  1.00 0.00 ? 89  ARG I O     1 
ATOM 8427  C CB    . ARG I  1 83  ? -61.610 -29.561 11.328  1.00 0.00 ? 89  ARG I CB    1 
ATOM 8428  C CG    . ARG I  1 83  ? -60.627 -28.410 11.571  1.00 0.00 ? 89  ARG I CG    1 
ATOM 8429  C CD    . ARG I  1 83  ? -60.671 -27.928 12.981  1.00 0.00 ? 89  ARG I CD    1 
ATOM 8430  N NE    . ARG I  1 83  ? -59.825 -26.751 13.200  1.00 0.00 ? 89  ARG I NE    1 
ATOM 8431  C CZ    . ARG I  1 83  ? -58.541 -26.778 13.603  1.00 0.00 ? 89  ARG I CZ    1 
ATOM 8432  N NH1   . ARG I  1 83  ? -57.942 -27.920 13.839  1.00 0.00 ? 89  ARG I NH1   1 
ATOM 8433  N NH2   . ARG I  1 83  ? -57.887 -25.649 13.771  1.00 0.00 ? 89  ARG I NH2   1 
ATOM 8434  N N     . ILE I  1 84  ? -63.649 -31.350 9.273   1.00 0.00 ? 90  ILE I N     1 
ATOM 8435  C CA    . ILE I  1 84  ? -64.456 -32.565 9.136   1.00 0.00 ? 90  ILE I CA    1 
ATOM 8436  C C     . ILE I  1 84  ? -64.741 -32.906 7.687   1.00 0.00 ? 90  ILE I C     1 
ATOM 8437  O O     . ILE I  1 84  ? -64.639 -34.063 7.271   1.00 0.00 ? 90  ILE I O     1 
ATOM 8438  C CB    . ILE I  1 84  ? -65.802 -32.431 9.867   1.00 0.00 ? 90  ILE I CB    1 
ATOM 8439  C CG1   . ILE I  1 84  ? -65.600 -32.285 11.367  1.00 0.00 ? 90  ILE I CG1   1 
ATOM 8440  C CG2   . ILE I  1 84  ? -66.678 -33.611 9.562   1.00 0.00 ? 90  ILE I CG2   1 
ATOM 8441  C CD1   . ILE I  1 84  ? -66.875 -31.975 12.112  1.00 0.00 ? 90  ILE I CD1   1 
ATOM 8442  N N     . GLY I  1 85  ? -65.165 -31.911 6.934   1.00 0.00 ? 91  GLY I N     1 
ATOM 8443  C CA    . GLY I  1 85  ? -65.566 -32.125 5.553   1.00 0.00 ? 91  GLY I CA    1 
ATOM 8444  C C     . GLY I  1 85  ? -67.070 -32.248 5.482   1.00 0.00 ? 91  GLY I C     1 
ATOM 8445  O O     . GLY I  1 85  ? -67.722 -32.472 6.496   1.00 0.00 ? 91  GLY I O     1 
ATOM 8446  N N     . SER I  1 86  ? -67.626 -32.090 4.290   1.00 0.00 ? 92  SER I N     1 
ATOM 8447  C CA    . SER I  1 86  ? -69.072 -32.138 4.127   1.00 0.00 ? 92  SER I CA    1 
ATOM 8448  C C     . SER I  1 86  ? -69.604 -33.540 4.307   1.00 0.00 ? 92  SER I C     1 
ATOM 8449  O O     . SER I  1 86  ? -68.855 -34.512 4.207   1.00 0.00 ? 92  SER I O     1 
ATOM 8450  C CB    . SER I  1 86  ? -69.464 -31.634 2.764   1.00 0.00 ? 92  SER I CB    1 
ATOM 8451  O OG    . SER I  1 86  ? -69.052 -32.527 1.769   1.00 0.00 ? 92  SER I OG    1 
ATOM 8452  N N     . GLY I  1 87  ? -70.905 -33.646 4.534   1.00 0.00 ? 93  GLY I N     1 
ATOM 8453  C CA    . GLY I  1 87  ? -71.541 -34.937 4.722   1.00 0.00 ? 93  GLY I CA    1 
ATOM 8454  C C     . GLY I  1 87  ? -72.070 -35.090 6.141   1.00 0.00 ? 93  GLY I C     1 
ATOM 8455  O O     . GLY I  1 87  ? -72.016 -34.149 6.929   1.00 0.00 ? 93  GLY I O     1 
ATOM 8456  N N     . PRO I  1 88  ? -72.599 -36.271 6.440   1.00 0.00 ? 94  PRO I N     1 
ATOM 8457  C CA    . PRO I  1 88  ? -73.195 -36.708 7.718   1.00 0.00 ? 94  PRO I CA    1 
ATOM 8458  C C     . PRO I  1 88  ? -72.648 -35.969 8.936   1.00 0.00 ? 94  PRO I C     1 
ATOM 8459  O O     . PRO I  1 88  ? -73.400 -35.329 9.665   1.00 0.00 ? 94  PRO I O     1 
ATOM 8460  C CB    . PRO I  1 88  ? -72.825 -38.189 7.790   1.00 0.00 ? 94  PRO I CB    1 
ATOM 8461  C CG    . PRO I  1 88  ? -72.680 -38.587 6.381   1.00 0.00 ? 94  PRO I CG    1 
ATOM 8462  C CD    . PRO I  1 88  ? -71.991 -37.423 5.761   1.00 0.00 ? 94  PRO I CD    1 
ATOM 8463  N N     . ALA I  1 89  ? -71.351 -36.098 9.180   1.00 0.00 ? 95  ALA I N     1 
ATOM 8464  C CA    . ALA I  1 89  ? -70.748 -35.507 10.365  1.00 0.00 ? 95  ALA I CA    1 
ATOM 8465  C C     . ALA I  1 89  ? -70.962 -34.006 10.428  1.00 0.00 ? 95  ALA I C     1 
ATOM 8466  O O     . ALA I  1 89  ? -71.183 -33.458 11.508  1.00 0.00 ? 95  ALA I O     1 
ATOM 8467  C CB    . ALA I  1 89  ? -69.277 -35.831 10.402  1.00 0.00 ? 95  ALA I CB    1 
ATOM 8468  N N     . LEU I  1 90  ? -70.904 -33.338 9.282   1.00 0.00 ? 96  LEU I N     1 
ATOM 8469  C CA    . LEU I  1 90  ? -71.117 -31.907 9.249   1.00 0.00 ? 96  LEU I CA    1 
ATOM 8470  C C     . LEU I  1 90  ? -72.528 -31.600 9.622   1.00 0.00 ? 96  LEU I C     1 
ATOM 8471  O O     . LEU I  1 90  ? -72.789 -30.657 10.361  1.00 0.00 ? 96  LEU I O     1 
ATOM 8472  C CB    . LEU I  1 90  ? -70.829 -31.329 7.881   1.00 0.00 ? 96  LEU I CB    1 
ATOM 8473  C CG    . LEU I  1 90  ? -70.972 -29.811 7.797   1.00 0.00 ? 96  LEU I CG    1 
ATOM 8474  C CD1   . LEU I  1 90  ? -69.985 -29.164 8.757   1.00 0.00 ? 96  LEU I CD1   1 
ATOM 8475  C CD2   . LEU I  1 90  ? -70.730 -29.355 6.376   1.00 0.00 ? 96  LEU I CD2   1 
ATOM 8476  N N     . VAL I  1 91  ? -73.448 -32.395 9.104   1.00 0.00 ? 97  VAL I N     1 
ATOM 8477  C CA    . VAL I  1 91  ? -74.852 -32.231 9.422   1.00 0.00 ? 97  VAL I CA    1 
ATOM 8478  C C     . VAL I  1 91  ? -75.075 -32.321 10.914  1.00 0.00 ? 97  VAL I C     1 
ATOM 8479  O O     . VAL I  1 91  ? -75.767 -31.486 11.499  1.00 0.00 ? 97  VAL I O     1 
ATOM 8480  C CB    . VAL I  1 91  ? -75.694 -33.302 8.716   1.00 0.00 ? 97  VAL I CB    1 
ATOM 8481  C CG1   . VAL I  1 91  ? -77.117 -33.269 9.230   1.00 0.00 ? 97  VAL I CG1   1 
ATOM 8482  C CG2   . VAL I  1 91  ? -75.651 -33.071 7.217   1.00 0.00 ? 97  VAL I CG2   1 
ATOM 8483  N N     . ASN I  1 92  ? -74.460 -33.323 11.536  1.00 0.00 ? 98  ASN I N     1 
ATOM 8484  C CA    . ASN I  1 92  ? -74.569 -33.509 12.966  1.00 0.00 ? 98  ASN I CA    1 
ATOM 8485  C C     . ASN I  1 92  ? -74.053 -32.290 13.698  1.00 0.00 ? 98  ASN I C     1 
ATOM 8486  O O     . ASN I  1 92  ? -74.683 -31.807 14.644  1.00 0.00 ? 98  ASN I O     1 
ATOM 8487  C CB    . ASN I  1 92  ? -73.811 -34.748 13.387  1.00 0.00 ? 98  ASN I CB    1 
ATOM 8488  C CG    . ASN I  1 92  ? -74.502 -35.991 12.941  1.00 0.00 ? 98  ASN I CG    1 
ATOM 8489  O OD1   . ASN I  1 92  ? -75.687 -35.937 12.596  1.00 0.00 ? 98  ASN I OD1   1 
ATOM 8490  N ND2   . ASN I  1 92  ? -73.810 -37.106 12.935  1.00 0.00 ? 98  ASN I ND2   1 
ATOM 8491  N N     . MET I  1 93  ? -72.936 -31.764 13.219  1.00 0.00 ? 99  MET I N     1 
ATOM 8492  C CA    . MET I  1 93  ? -72.335 -30.596 13.801  1.00 0.00 ? 99  MET I CA    1 
ATOM 8493  C C     . MET I  1 93  ? -73.228 -29.391 13.734  1.00 0.00 ? 99  MET I C     1 
ATOM 8494  O O     . MET I  1 93  ? -73.433 -28.712 14.739  1.00 0.00 ? 99  MET I O     1 
ATOM 8495  C CB    . MET I  1 93  ? -71.034 -30.286 13.111  1.00 0.00 ? 99  MET I CB    1 
ATOM 8496  C CG    . MET I  1 93  ? -70.360 -29.054 13.639  1.00 0.00 ? 99  MET I CG    1 
ATOM 8497  S SD    . MET I  1 93  ? -69.820 -29.251 15.321  1.00 0.00 ? 99  MET I SD    1 
ATOM 8498  C CE    . MET I  1 93  ? -68.346 -30.227 15.054  1.00 0.00 ? 99  MET I CE    1 
ATOM 8499  N N     . ILE I  1 94  ? -73.744 -29.104 12.545  1.00 0.00 ? 100 ILE I N     1 
ATOM 8500  C CA    . ILE I  1 94  ? -74.527 -27.907 12.341  1.00 0.00 ? 100 ILE I CA    1 
ATOM 8501  C C     . ILE I  1 94  ? -75.773 -27.913 13.170  1.00 0.00 ? 100 ILE I C     1 
ATOM 8502  O O     . ILE I  1 94  ? -76.159 -26.883 13.710  1.00 0.00 ? 100 ILE I O     1 
ATOM 8503  C CB    . ILE I  1 94  ? -74.890 -27.709 10.881  1.00 0.00 ? 100 ILE I CB    1 
ATOM 8504  C CG1   . ILE I  1 94  ? -73.634 -27.421 10.067  1.00 0.00 ? 100 ILE I CG1   1 
ATOM 8505  C CG2   . ILE I  1 94  ? -75.858 -26.544 10.763  1.00 0.00 ? 100 ILE I CG2   1 
ATOM 8506  C CD1   . ILE I  1 94  ? -73.858 -27.473 8.578   1.00 0.00 ? 100 ILE I CD1   1 
ATOM 8507  N N     . ASN I  1 95  ? -76.422 -29.067 13.269  1.00 0.00 ? 101 ASN I N     1 
ATOM 8508  C CA    . ASN I  1 95  ? -77.620 -29.175 14.084  1.00 0.00 ? 101 ASN I CA    1 
ATOM 8509  C C     . ASN I  1 95  ? -77.352 -28.738 15.508  1.00 0.00 ? 101 ASN I C     1 
ATOM 8510  O O     . ASN I  1 95  ? -78.104 -27.937 16.071  1.00 0.00 ? 101 ASN I O     1 
ATOM 8511  C CB    . ASN I  1 95  ? -78.147 -30.588 14.075  1.00 0.00 ? 101 ASN I CB    1 
ATOM 8512  C CG    . ASN I  1 95  ? -78.824 -30.942 12.803  1.00 0.00 ? 101 ASN I CG    1 
ATOM 8513  O OD1   . ASN I  1 95  ? -79.288 -30.063 12.069  1.00 0.00 ? 101 ASN I OD1   1 
ATOM 8514  N ND2   . ASN I  1 95  ? -78.897 -32.215 12.521  1.00 0.00 ? 101 ASN I ND2   1 
ATOM 8515  N N     . GLY I  1 96  ? -76.264 -29.247 16.086  1.00 0.00 ? 102 GLY I N     1 
ATOM 8516  C CA    . GLY I  1 96  ? -75.908 -28.889 17.443  1.00 0.00 ? 102 GLY I CA    1 
ATOM 8517  C C     . GLY I  1 96  ? -75.518 -27.440 17.537  1.00 0.00 ? 102 GLY I C     1 
ATOM 8518  O O     . GLY I  1 96  ? -75.902 -26.749 18.482  1.00 0.00 ? 102 GLY I O     1 
ATOM 8519  N N     . LEU I  1 97  ? -74.768 -26.972 16.550  1.00 0.00 ? 103 LEU I N     1 
ATOM 8520  C CA    . LEU I  1 97  ? -74.321 -25.602 16.505  1.00 0.00 ? 103 LEU I CA    1 
ATOM 8521  C C     . LEU I  1 97  ? -75.467 -24.627 16.500  1.00 0.00 ? 103 LEU I C     1 
ATOM 8522  O O     . LEU I  1 97  ? -75.431 -23.614 17.192  1.00 0.00 ? 103 LEU I O     1 
ATOM 8523  C CB    . LEU I  1 97  ? -73.477 -25.370 15.291  1.00 0.00 ? 103 LEU I CB    1 
ATOM 8524  C CG    . LEU I  1 97  ? -73.007 -23.952 15.139  1.00 0.00 ? 103 LEU I CG    1 
ATOM 8525  C CD1   . LEU I  1 97  ? -72.194 -23.586 16.356  1.00 0.00 ? 103 LEU I CD1   1 
ATOM 8526  C CD2   . LEU I  1 97  ? -72.206 -23.827 13.864  1.00 0.00 ? 103 LEU I CD2   1 
ATOM 8527  N N     . LYS I  1 98  ? -76.464 -24.896 15.683  1.00 0.00 ? 104 LYS I N     1 
ATOM 8528  C CA    . LYS I  1 98  ? -77.626 -24.058 15.650  1.00 0.00 ? 104 LYS I CA    1 
ATOM 8529  C C     . LYS I  1 98  ? -78.288 -24.020 17.002  1.00 0.00 ? 104 LYS I C     1 
ATOM 8530  O O     . LYS I  1 98  ? -78.623 -22.954 17.497  1.00 0.00 ? 104 LYS I O     1 
ATOM 8531  C CB    . LYS I  1 98  ? -78.598 -24.531 14.601  1.00 0.00 ? 104 LYS I CB    1 
ATOM 8532  C CG    . LYS I  1 98  ? -78.205 -24.182 13.182  1.00 0.00 ? 104 LYS I CG    1 
ATOM 8533  C CD    . LYS I  1 98  ? -79.161 -24.811 12.190  1.00 0.00 ? 104 LYS I CD    1 
ATOM 8534  C CE    . LYS I  1 98  ? -80.595 -24.433 12.516  1.00 0.00 ? 104 LYS I CE    1 
ATOM 8535  N NZ    . LYS I  1 98  ? -81.545 -24.928 11.494  1.00 0.00 ? 104 LYS I NZ    1 
ATOM 8536  N N     . GLY I  1 99  ? -78.426 -25.182 17.632  1.00 0.00 ? 105 GLY I N     1 
ATOM 8537  C CA    . GLY I  1 99  ? -79.011 -25.238 18.961  1.00 0.00 ? 105 GLY I CA    1 
ATOM 8538  C C     . GLY I  1 99  ? -78.236 -24.349 19.922  1.00 0.00 ? 105 GLY I C     1 
ATOM 8539  O O     . GLY I  1 99  ? -78.824 -23.612 20.716  1.00 0.00 ? 105 GLY I O     1 
ATOM 8540  N N     . TYR I  1 100 ? -76.915 -24.403 19.819  1.00 0.00 ? 106 TYR I N     1 
ATOM 8541  C CA    . TYR I  1 100 ? -76.037 -23.600 20.641  1.00 0.00 ? 106 TYR I CA    1 
ATOM 8542  C C     . TYR I  1 100 ? -76.359 -22.133 20.511  1.00 0.00 ? 106 TYR I C     1 
ATOM 8543  O O     . TYR I  1 100 ? -76.660 -21.480 21.494  1.00 0.00 ? 106 TYR I O     1 
ATOM 8544  C CB    . TYR I  1 100 ? -74.585 -23.863 20.241  1.00 0.00 ? 106 TYR I CB    1 
ATOM 8545  C CG    . TYR I  1 100 ? -73.540 -23.100 20.997  1.00 0.00 ? 106 TYR I CG    1 
ATOM 8546  C CD1   . TYR I  1 100 ? -73.389 -23.264 22.360  1.00 0.00 ? 106 TYR I CD1   1 
ATOM 8547  C CD2   . TYR I  1 100 ? -72.675 -22.287 20.299  1.00 0.00 ? 106 TYR I CD2   1 
ATOM 8548  C CE1   . TYR I  1 100 ? -72.383 -22.583 23.025  1.00 0.00 ? 106 TYR I CE1   1 
ATOM 8549  C CE2   . TYR I  1 100 ? -71.670 -21.618 20.953  1.00 0.00 ? 106 TYR I CE2   1 
ATOM 8550  C CZ    . TYR I  1 100 ? -71.521 -21.758 22.310  1.00 0.00 ? 106 TYR I CZ    1 
ATOM 8551  O OH    . TYR I  1 100 ? -70.511 -21.077 22.960  1.00 0.00 ? 106 TYR I OH    1 
ATOM 8552  N N     . TYR I  1 101 ? -76.334 -21.617 19.298  1.00 0.00 ? 107 TYR I N     1 
ATOM 8553  C CA    . TYR I  1 101 ? -76.578 -20.197 19.097  1.00 0.00 ? 107 TYR I CA    1 
ATOM 8554  C C     . TYR I  1 101 ? -78.002 -19.765 19.333  1.00 0.00 ? 107 TYR I C     1 
ATOM 8555  O O     . TYR I  1 101 ? -78.240 -18.711 19.926  1.00 0.00 ? 107 TYR I O     1 
ATOM 8556  C CB    . TYR I  1 101 ? -76.145 -19.787 17.712  1.00 0.00 ? 107 TYR I CB    1 
ATOM 8557  C CG    . TYR I  1 101 ? -74.719 -19.372 17.657  1.00 0.00 ? 107 TYR I CG    1 
ATOM 8558  C CD1   . TYR I  1 101 ? -73.724 -20.296 17.428  1.00 0.00 ? 107 TYR I CD1   1 
ATOM 8559  C CD2   . TYR I  1 101 ? -74.407 -18.043 17.839  1.00 0.00 ? 107 TYR I CD2   1 
ATOM 8560  C CE1   . TYR I  1 101 ? -72.409 -19.885 17.390  1.00 0.00 ? 107 TYR I CE1   1 
ATOM 8561  C CE2   . TYR I  1 101 ? -73.099 -17.631 17.798  1.00 0.00 ? 107 TYR I CE2   1 
ATOM 8562  C CZ    . TYR I  1 101 ? -72.104 -18.547 17.578  1.00 0.00 ? 107 TYR I CZ    1 
ATOM 8563  O OH    . TYR I  1 101 ? -70.802 -18.131 17.538  1.00 0.00 ? 107 TYR I OH    1 
ATOM 8564  N N     . ILE I  1 102 ? -78.950 -20.577 18.920  1.00 0.00 ? 108 ILE I N     1 
ATOM 8565  C CA    . ILE I  1 102 ? -80.335 -20.219 19.071  1.00 0.00 ? 108 ILE I CA    1 
ATOM 8566  C C     . ILE I  1 102 ? -80.713 -20.055 20.508  1.00 0.00 ? 108 ILE I C     1 
ATOM 8567  O O     . ILE I  1 102 ? -81.387 -19.100 20.868  1.00 0.00 ? 108 ILE I O     1 
ATOM 8568  C CB    . ILE I  1 102 ? -81.255 -21.264 18.447  1.00 0.00 ? 108 ILE I CB    1 
ATOM 8569  C CG1   . ILE I  1 102 ? -81.105 -21.266 16.939  1.00 0.00 ? 108 ILE I CG1   1 
ATOM 8570  C CG2   . ILE I  1 102 ? -82.691 -20.972 18.832  1.00 0.00 ? 108 ILE I CG2   1 
ATOM 8571  C CD1   . ILE I  1 102 ? -81.752 -22.451 16.261  1.00 0.00 ? 108 ILE I CD1   1 
ATOM 8572  N N     . SER I  1 103 ? -80.320 -21.000 21.335  1.00 0.00 ? 109 SER I N     1 
ATOM 8573  C CA    . SER I  1 103 ? -80.742 -20.975 22.712  1.00 0.00 ? 109 SER I CA    1 
ATOM 8574  C C     . SER I  1 103 ? -79.753 -20.317 23.665  1.00 0.00 ? 109 SER I C     1 
ATOM 8575  O O     . SER I  1 103 ? -80.160 -19.785 24.694  1.00 0.00 ? 109 SER I O     1 
ATOM 8576  C CB    . SER I  1 103 ? -81.029 -22.374 23.159  1.00 0.00 ? 109 SER I CB    1 
ATOM 8577  O OG    . SER I  1 103 ? -79.881 -23.156 23.087  1.00 0.00 ? 109 SER I OG    1 
ATOM 8578  N N     . ALA I  1 104 ? -78.463 -20.337 23.343  1.00 0.00 ? 110 ALA I N     1 
ATOM 8579  C CA    . ALA I  1 104 ? -77.498 -19.720 24.248  1.00 0.00 ? 110 ALA I CA    1 
ATOM 8580  C C     . ALA I  1 104 ? -77.391 -18.247 24.020  1.00 0.00 ? 110 ALA I C     1 
ATOM 8581  O O     . ALA I  1 104 ? -77.200 -17.501 24.970  1.00 0.00 ? 110 ALA I O     1 
ATOM 8582  C CB    . ALA I  1 104 ? -76.112 -20.343 24.117  1.00 0.00 ? 110 ALA I CB    1 
ATOM 8583  N N     . PHE I  1 105 ? -77.499 -17.815 22.758  1.00 0.00 ? 111 PHE I N     1 
ATOM 8584  C CA    . PHE I  1 105 ? -77.328 -16.409 22.430  1.00 0.00 ? 111 PHE I CA    1 
ATOM 8585  C C     . PHE I  1 105 ? -78.568 -15.792 21.846  1.00 0.00 ? 111 PHE I C     1 
ATOM 8586  O O     . PHE I  1 105 ? -78.549 -14.635 21.434  1.00 0.00 ? 111 PHE I O     1 
ATOM 8587  C CB    . PHE I  1 105 ? -76.190 -16.239 21.452  1.00 0.00 ? 111 PHE I CB    1 
ATOM 8588  C CG    . PHE I  1 105 ? -74.900 -16.736 21.985  1.00 0.00 ? 111 PHE I CG    1 
ATOM 8589  C CD1   . PHE I  1 105 ? -74.295 -17.841 21.434  1.00 0.00 ? 111 PHE I CD1   1 
ATOM 8590  C CD2   . PHE I  1 105 ? -74.302 -16.120 23.058  1.00 0.00 ? 111 PHE I CD2   1 
ATOM 8591  C CE1   . PHE I  1 105 ? -73.111 -18.315 21.932  1.00 0.00 ? 111 PHE I CE1   1 
ATOM 8592  C CE2   . PHE I  1 105 ? -73.115 -16.589 23.564  1.00 0.00 ? 111 PHE I CE2   1 
ATOM 8593  C CZ    . PHE I  1 105 ? -72.518 -17.691 22.999  1.00 0.00 ? 111 PHE I CZ    1 
ATOM 8594  N N     . ASN I  1 106 ? -79.648 -16.560 21.801  1.00 0.00 ? 112 ASN I N     1 
ATOM 8595  C CA    . ASN I  1 106 ? -80.911 -16.075 21.268  1.00 0.00 ? 112 ASN I CA    1 
ATOM 8596  C C     . ASN I  1 106 ? -80.789 -15.648 19.818  1.00 0.00 ? 112 ASN I C     1 
ATOM 8597  O O     . ASN I  1 106 ? -81.399 -14.665 19.405  1.00 0.00 ? 112 ASN I O     1 
ATOM 8598  C CB    . ASN I  1 106 ? -81.447 -14.945 22.110  1.00 0.00 ? 112 ASN I CB    1 
ATOM 8599  C CG    . ASN I  1 106 ? -81.748 -15.386 23.504  1.00 0.00 ? 112 ASN I CG    1 
ATOM 8600  O OD1   . ASN I  1 106 ? -82.206 -16.512 23.722  1.00 0.00 ? 112 ASN I OD1   1 
ATOM 8601  N ND2   . ASN I  1 106 ? -81.507 -14.525 24.457  1.00 0.00 ? 112 ASN I ND2   1 
ATOM 8602  N N     . ALA I  1 107 ? -80.003 -16.386 19.043  1.00 0.00 ? 113 ALA I N     1 
ATOM 8603  C CA    . ALA I  1 107 ? -79.862 -16.088 17.630  1.00 0.00 ? 113 ALA I CA    1 
ATOM 8604  C C     . ALA I  1 107 ? -81.118 -16.515 16.892  1.00 0.00 ? 113 ALA I C     1 
ATOM 8605  O O     . ALA I  1 107 ? -81.771 -17.481 17.282  1.00 0.00 ? 113 ALA I O     1 
ATOM 8606  C CB    . ALA I  1 107 ? -78.645 -16.773 17.067  1.00 0.00 ? 113 ALA I CB    1 
ATOM 8607  N N     . ASN I  1 108 ? -81.469 -15.781 15.837  1.00 0.00 ? 114 ASN I N     1 
ATOM 8608  C CA    . ASN I  1 108 ? -82.691 -16.049 15.087  1.00 0.00 ? 114 ASN I CA    1 
ATOM 8609  C C     . ASN I  1 108 ? -82.529 -17.185 14.077  1.00 0.00 ? 114 ASN I C     1 
ATOM 8610  O O     . ASN I  1 108 ? -81.994 -16.963 12.992  1.00 0.00 ? 114 ASN I O     1 
ATOM 8611  C CB    . ASN I  1 108 ? -83.152 -14.814 14.373  1.00 0.00 ? 114 ASN I CB    1 
ATOM 8612  C CG    . ASN I  1 108 ? -84.417 -15.052 13.626  1.00 0.00 ? 114 ASN I CG    1 
ATOM 8613  O OD1   . ASN I  1 108 ? -84.683 -16.176 13.184  1.00 0.00 ? 114 ASN I OD1   1 
ATOM 8614  N ND2   . ASN I  1 108 ? -85.210 -14.025 13.471  1.00 0.00 ? 114 ASN I ND2   1 
ATOM 8615  N N     . PRO I  1 109 ? -83.012 -18.396 14.419  1.00 0.00 ? 115 PRO I N     1 
ATOM 8616  C CA    . PRO I  1 109 ? -83.015 -19.618 13.591  1.00 0.00 ? 115 PRO I CA    1 
ATOM 8617  C C     . PRO I  1 109 ? -83.094 -19.345 12.097  1.00 0.00 ? 115 PRO I C     1 
ATOM 8618  O O     . PRO I  1 109 ? -82.368 -19.957 11.312  1.00 0.00 ? 115 PRO I O     1 
ATOM 8619  C CB    . PRO I  1 109 ? -84.291 -20.340 14.030  1.00 0.00 ? 115 PRO I CB    1 
ATOM 8620  C CG    . PRO I  1 109 ? -84.516 -19.879 15.404  1.00 0.00 ? 115 PRO I CG    1 
ATOM 8621  C CD    . PRO I  1 109 ? -84.161 -18.433 15.350  1.00 0.00 ? 115 PRO I CD    1 
ATOM 8622  N N     . GLN I  1 110 ? -84.004 -18.466 11.701  1.00 0.00 ? 116 GLN I N     1 
ATOM 8623  C CA    . GLN I  1 110 ? -84.231 -18.196 10.296  1.00 0.00 ? 116 GLN I CA    1 
ATOM 8624  C C     . GLN I  1 110 ? -83.010 -17.563 9.647   1.00 0.00 ? 116 GLN I C     1 
ATOM 8625  O O     . GLN I  1 110 ? -82.620 -17.933 8.537   1.00 0.00 ? 116 GLN I O     1 
ATOM 8626  C CB    . GLN I  1 110 ? -85.436 -17.292 10.123  1.00 0.00 ? 116 GLN I CB    1 
ATOM 8627  C CG    . GLN I  1 110 ? -85.897 -17.169 8.696   1.00 0.00 ? 116 GLN I CG    1 
ATOM 8628  C CD    . GLN I  1 110 ? -85.079 -16.171 7.925   1.00 0.00 ? 116 GLN I CD    1 
ATOM 8629  O OE1   . GLN I  1 110 ? -84.649 -15.151 8.468   1.00 0.00 ? 116 GLN I OE1   1 
ATOM 8630  N NE2   . GLN I  1 110 ? -84.844 -16.464 6.652   1.00 0.00 ? 116 GLN I NE2   1 
ATOM 8631  N N     . VAL I  1 111 ? -82.403 -16.618 10.337  1.00 0.00 ? 117 VAL I N     1 
ATOM 8632  C CA    . VAL I  1 111 ? -81.229 -15.973 9.822   1.00 0.00 ? 117 VAL I CA    1 
ATOM 8633  C C     . VAL I  1 111 ? -80.080 -16.941 9.821   1.00 0.00 ? 117 VAL I C     1 
ATOM 8634  O O     . VAL I  1 111 ? -79.264 -16.939 8.908   1.00 0.00 ? 117 VAL I O     1 
ATOM 8635  C CB    . VAL I  1 111 ? -80.873 -14.741 10.640  1.00 0.00 ? 117 VAL I CB    1 
ATOM 8636  C CG1   . VAL I  1 111 ? -79.549 -14.168 10.161  1.00 0.00 ? 117 VAL I CG1   1 
ATOM 8637  C CG2   . VAL I  1 111 ? -81.981 -13.714 10.519  1.00 0.00 ? 117 VAL I CG2   1 
ATOM 8638  N N     . LEU I  1 112 ? -80.023 -17.782 10.847  1.00 0.00 ? 118 LEU I N     1 
ATOM 8639  C CA    . LEU I  1 112 ? -78.968 -18.774 10.949  1.00 0.00 ? 118 LEU I CA    1 
ATOM 8640  C C     . LEU I  1 112 ? -78.998 -19.705 9.764   1.00 0.00 ? 118 LEU I C     1 
ATOM 8641  O O     . LEU I  1 112 ? -77.955 -20.059 9.218   1.00 0.00 ? 118 LEU I O     1 
ATOM 8642  C CB    . LEU I  1 112 ? -79.128 -19.581 12.224  1.00 0.00 ? 118 LEU I CB    1 
ATOM 8643  C CG    . LEU I  1 112 ? -78.883 -18.822 13.511  1.00 0.00 ? 118 LEU I CG    1 
ATOM 8644  C CD1   . LEU I  1 112 ? -79.254 -19.691 14.668  1.00 0.00 ? 118 LEU I CD1   1 
ATOM 8645  C CD2   . LEU I  1 112 ? -77.440 -18.440 13.589  1.00 0.00 ? 118 LEU I CD2   1 
ATOM 8646  N N     . ASP I  1 113 ? -80.195 -20.070 9.339   1.00 0.00 ? 119 ASP I N     1 
ATOM 8647  C CA    . ASP I  1 113 ? -80.352 -20.906 8.177   1.00 0.00 ? 119 ASP I CA    1 
ATOM 8648  C C     . ASP I  1 113 ? -79.924 -20.192 6.928   1.00 0.00 ? 119 ASP I C     1 
ATOM 8649  O O     . ASP I  1 113 ? -79.349 -20.803 6.035   1.00 0.00 ? 119 ASP I O     1 
ATOM 8650  C CB    . ASP I  1 113 ? -81.772 -21.379 8.064   1.00 0.00 ? 119 ASP I CB    1 
ATOM 8651  C CG    . ASP I  1 113 ? -82.067 -22.442 9.088   1.00 0.00 ? 119 ASP I CG    1 
ATOM 8652  O OD1   . ASP I  1 113 ? -81.131 -23.053 9.550   1.00 0.00 ? 119 ASP I OD1   1 
ATOM 8653  O OD2   . ASP I  1 113 ? -83.210 -22.637 9.420   1.00 0.00 ? 119 ASP I OD2   1 
ATOM 8654  N N     . ALA I  1 114 ? -80.161 -18.883 6.878   1.00 0.00 ? 120 ALA I N     1 
ATOM 8655  C CA    . ALA I  1 114 ? -79.696 -18.084 5.757   1.00 0.00 ? 120 ALA I CA    1 
ATOM 8656  C C     . ALA I  1 114 ? -78.176 -18.117 5.669   1.00 0.00 ? 120 ALA I C     1 
ATOM 8657  O O     . ALA I  1 114 ? -77.620 -18.201 4.580   1.00 0.00 ? 120 ALA I O     1 
ATOM 8658  C CB    . ALA I  1 114 ? -80.185 -16.657 5.878   1.00 0.00 ? 120 ALA I CB    1 
ATOM 8659  N N     . VAL I  1 115 ? -77.505 -18.090 6.818   1.00 0.00 ? 121 VAL I N     1 
ATOM 8660  C CA    . VAL I  1 115 ? -76.052 -18.176 6.838   1.00 0.00 ? 121 VAL I CA    1 
ATOM 8661  C C     . VAL I  1 115 ? -75.583 -19.513 6.311   1.00 0.00 ? 121 VAL I C     1 
ATOM 8662  O O     . VAL I  1 115 ? -74.703 -19.570 5.453   1.00 0.00 ? 121 VAL I O     1 
ATOM 8663  C CB    . VAL I  1 115 ? -75.502 -17.975 8.251   1.00 0.00 ? 121 VAL I CB    1 
ATOM 8664  C CG1   . VAL I  1 115 ? -74.020 -18.271 8.268   1.00 0.00 ? 121 VAL I CG1   1 
ATOM 8665  C CG2   . VAL I  1 115 ? -75.765 -16.552 8.716   1.00 0.00 ? 121 VAL I CG2   1 
ATOM 8666  N N     . VAL I  1 116 ? -76.199 -20.587 6.791   1.00 0.00 ? 122 VAL I N     1 
ATOM 8667  C CA    . VAL I  1 116 ? -75.854 -21.931 6.344   1.00 0.00 ? 122 VAL I CA    1 
ATOM 8668  C C     . VAL I  1 116 ? -76.096 -22.068 4.840   1.00 0.00 ? 122 VAL I C     1 
ATOM 8669  O O     . VAL I  1 116 ? -75.273 -22.628 4.110   1.00 0.00 ? 122 VAL I O     1 
ATOM 8670  C CB    . VAL I  1 116 ? -76.680 -22.982 7.108   1.00 0.00 ? 122 VAL I CB    1 
ATOM 8671  C CG1   . VAL I  1 116 ? -76.463 -24.349 6.521   1.00 0.00 ? 122 VAL I CG1   1 
ATOM 8672  C CG2   . VAL I  1 116 ? -76.292 -22.976 8.564   1.00 0.00 ? 122 VAL I CG2   1 
ATOM 8673  N N     . ASN I  1 117 ? -77.196 -21.477 4.371   1.00 0.00 ? 123 ASN I N     1 
ATOM 8674  C CA    . ASN I  1 117 ? -77.557 -21.478 2.959   1.00 0.00 ? 123 ASN I CA    1 
ATOM 8675  C C     . ASN I  1 117 ? -76.490 -20.878 2.049   1.00 0.00 ? 123 ASN I C     1 
ATOM 8676  O O     . ASN I  1 117 ? -76.557 -21.036 0.833   1.00 0.00 ? 123 ASN I O     1 
ATOM 8677  C CB    . ASN I  1 117 ? -78.854 -20.754 2.736   1.00 0.00 ? 123 ASN I CB    1 
ATOM 8678  C CG    . ASN I  1 117 ? -79.327 -20.886 1.319   1.00 0.00 ? 123 ASN I CG    1 
ATOM 8679  O OD1   . ASN I  1 117 ? -79.751 -21.962 0.889   1.00 0.00 ? 123 ASN I OD1   1 
ATOM 8680  N ND2   . ASN I  1 117 ? -79.246 -19.814 0.573   1.00 0.00 ? 123 ASN I ND2   1 
ATOM 8681  N N     . ILE I  1 118 ? -75.539 -20.161 2.616   1.00 0.00 ? 124 ILE I N     1 
ATOM 8682  C CA    . ILE I  1 118 ? -74.479 -19.602 1.835   1.00 0.00 ? 124 ILE I CA    1 
ATOM 8683  C C     . ILE I  1 118 ? -73.255 -20.450 1.907   1.00 0.00 ? 124 ILE I C     1 
ATOM 8684  O O     . ILE I  1 118 ? -72.673 -20.807 0.885   1.00 0.00 ? 124 ILE I O     1 
ATOM 8685  C CB    . ILE I  1 118 ? -74.136 -18.226 2.316   1.00 0.00 ? 124 ILE I CB    1 
ATOM 8686  C CG1   . ILE I  1 118 ? -75.344 -17.342 2.217   1.00 0.00 ? 124 ILE I CG1   1 
ATOM 8687  C CG2   . ILE I  1 118 ? -72.990 -17.666 1.531   1.00 0.00 ? 124 ILE I CG2   1 
ATOM 8688  C CD1   . ILE I  1 118 ? -75.908 -17.246 0.824   1.00 0.00 ? 124 ILE I CD1   1 
ATOM 8689  N N     . ILE I  1 119 ? -72.848 -20.764 3.117   1.00 0.00 ? 125 ILE I N     1 
ATOM 8690  C CA    . ILE I  1 119 ? -71.631 -21.511 3.339   1.00 0.00 ? 125 ILE I CA    1 
ATOM 8691  C C     . ILE I  1 119 ? -71.725 -22.912 2.776   1.00 0.00 ? 125 ILE I C     1 
ATOM 8692  O O     . ILE I  1 119 ? -70.805 -23.385 2.111   1.00 0.00 ? 125 ILE I O     1 
ATOM 8693  C CB    . ILE I  1 119 ? -71.313 -21.573 4.815   1.00 0.00 ? 125 ILE I CB    1 
ATOM 8694  C CG1   . ILE I  1 119 ? -70.982 -20.187 5.319   1.00 0.00 ? 125 ILE I CG1   1 
ATOM 8695  C CG2   . ILE I  1 119 ? -70.153 -22.516 5.058   1.00 0.00 ? 125 ILE I CG2   1 
ATOM 8696  C CD1   . ILE I  1 119 ? -70.941 -20.100 6.807   1.00 0.00 ? 125 ILE I CD1   1 
ATOM 8697  N N     . THR I  1 120 ? -72.833 -23.583 3.045   1.00 0.00 ? 126 THR I N     1 
ATOM 8698  C CA    . THR I  1 120 ? -73.040 -24.924 2.540   1.00 0.00 ? 126 THR I CA    1 
ATOM 8699  C C     . THR I  1 120 ? -73.790 -24.885 1.243   1.00 0.00 ? 126 THR I C     1 
ATOM 8700  O O     . THR I  1 120 ? -73.612 -25.742 0.381   1.00 0.00 ? 126 THR I O     1 
ATOM 8701  C CB    . THR I  1 120 ? -73.855 -25.739 3.500   1.00 0.00 ? 126 THR I CB    1 
ATOM 8702  O OG1   . THR I  1 120 ? -75.145 -25.143 3.594   1.00 0.00 ? 126 THR I OG1   1 
ATOM 8703  C CG2   . THR I  1 120 ? -73.205 -25.760 4.873   1.00 0.00 ? 126 THR I CG2   1 
ATOM 8704  N N     . GLY I  1 121 ? -74.626 -23.870 1.095   1.00 0.00 ? 127 GLY I N     1 
ATOM 8705  C CA    . GLY I  1 121 ? -75.423 -23.715 -0.110  1.00 0.00 ? 127 GLY I CA    1 
ATOM 8706  C C     . GLY I  1 121 ? -76.873 -24.045 0.164   1.00 0.00 ? 127 GLY I C     1 
ATOM 8707  O O     . GLY I  1 121 ? -77.747 -23.764 -0.655  1.00 0.00 ? 127 GLY I O     1 
ATOM 8708  N N     . SER I  1 122 ? -77.128 -24.642 1.322   1.00 0.00 ? 128 SER I N     1 
ATOM 8709  C CA    . SER I  1 122 ? -78.474 -24.993 1.727   1.00 0.00 ? 128 SER I CA    1 
ATOM 8710  C C     . SER I  1 122 ? -78.493 -25.268 3.208   1.00 0.00 ? 128 SER I C     1 
ATOM 8711  O O     . SER I  1 122 ? -77.463 -25.595 3.788   1.00 0.00 ? 128 SER I O     1 
ATOM 8712  C CB    . SER I  1 122 ? -78.935 -26.229 0.992   1.00 0.00 ? 128 SER I CB    1 
ATOM 8713  O OG    . SER I  1 122 ? -78.226 -27.356 1.436   1.00 0.00 ? 128 SER I OG    1 
ATOM 8714  N N     . PRO I  1 123 ? -79.662 -25.222 3.822   1.00 0.00 ? 129 PRO I N     1 
ATOM 8715  C CA    . PRO I  1 123 ? -79.903 -25.578 5.197   1.00 0.00 ? 129 PRO I CA    1 
ATOM 8716  C C     . PRO I  1 123 ? -79.516 -27.026 5.384   1.00 0.00 ? 129 PRO I C     1 
ATOM 8717  O O     . PRO I  1 123 ? -79.449 -27.784 4.416   1.00 0.00 ? 129 PRO I O     1 
ATOM 8718  C CB    . PRO I  1 123 ? -81.376 -25.291 5.388   1.00 0.00 ? 129 PRO I CB    1 
ATOM 8719  C CG    . PRO I  1 123 ? -81.635 -24.129 4.476   1.00 0.00 ? 129 PRO I CG    1 
ATOM 8720  C CD    . PRO I  1 123 ? -80.679 -24.293 3.322   1.00 0.00 ? 129 PRO I CD    1 
ATOM 8721  N N     . THR I  1 124 ? -79.222 -27.412 6.606   1.00 0.00 ? 130 THR I N     1 
ATOM 8722  C CA    . THR I  1 124 ? -78.686 -28.733 6.825   1.00 0.00 ? 130 THR I CA    1 
ATOM 8723  C C     . THR I  1 124 ? -79.767 -29.771 7.004   1.00 0.00 ? 130 THR I C     1 
ATOM 8724  O O     . THR I  1 124 ? -80.803 -29.711 6.347   1.00 0.00 ? 130 THR I O     1 
ATOM 8725  C CB    . THR I  1 124 ? -77.756 -28.729 8.043   1.00 0.00 ? 130 THR I CB    1 
ATOM 8726  O OG1   . THR I  1 124 ? -77.173 -30.022 8.198   1.00 0.00 ? 130 THR I OG1   1 
ATOM 8727  C CG2   . THR I  1 124 ? -78.507 -28.331 9.320   1.00 0.00 ? 130 THR I CG2   1 
ATOM 8728  N N     . GLY I  1 125 ? -79.524 -30.755 7.868   1.00 0.00 ? 131 GLY I N     1 
ATOM 8729  C CA    . GLY I  1 125 ? -80.476 -31.849 8.059   1.00 0.00 ? 131 GLY I CA    1 
ATOM 8730  C C     . GLY I  1 125 ? -80.305 -32.883 6.949   1.00 0.00 ? 131 GLY I C     1 
ATOM 8731  O O     . GLY I  1 125 ? -79.926 -34.028 7.195   1.00 0.00 ? 131 GLY I O     1 
ATOM 8732  N N     . TYR I  1 126 ? -80.567 -32.452 5.727   1.00 0.00 ? 132 TYR I N     1 
ATOM 8733  C CA    . TYR I  1 126 ? -80.385 -33.268 4.563   1.00 0.00 ? 132 TYR I CA    1 
ATOM 8734  C C     . TYR I  1 126 ? -79.121 -32.840 3.854   1.00 0.00 ? 132 TYR I C     1 
ATOM 8735  O O     . TYR I  1 126 ? -78.779 -31.660 3.844   1.00 0.00 ? 132 TYR I O     1 
ATOM 8736  C CB    . TYR I  1 126 ? -81.584 -33.120 3.642   1.00 0.00 ? 132 TYR I CB    1 
ATOM 8737  C CG    . TYR I  1 126 ? -82.875 -33.524 4.302   1.00 0.00 ? 132 TYR I CG    1 
ATOM 8738  C CD1   . TYR I  1 126 ? -83.591 -32.582 5.023   1.00 0.00 ? 132 TYR I CD1   1 
ATOM 8739  C CD2   . TYR I  1 126 ? -83.336 -34.825 4.206   1.00 0.00 ? 132 TYR I CD2   1 
ATOM 8740  C CE1   . TYR I  1 126 ? -84.767 -32.938 5.643   1.00 0.00 ? 132 TYR I CE1   1 
ATOM 8741  C CE2   . TYR I  1 126 ? -84.516 -35.181 4.827   1.00 0.00 ? 132 TYR I CE2   1 
ATOM 8742  C CZ    . TYR I  1 126 ? -85.229 -34.240 5.543   1.00 0.00 ? 132 TYR I CZ    1 
ATOM 8743  O OH    . TYR I  1 126 ? -86.403 -34.592 6.162   1.00 0.00 ? 132 TYR I OH    1 
ATOM 8744  N N     . VAL I  1 127 ? -78.427 -33.786 3.258   1.00 0.00 ? 133 VAL I N     1 
ATOM 8745  C CA    . VAL I  1 127 ? -77.217 -33.464 2.531   1.00 0.00 ? 133 VAL I CA    1 
ATOM 8746  C C     . VAL I  1 127 ? -77.542 -33.124 1.089   1.00 0.00 ? 133 VAL I C     1 
ATOM 8747  O O     . VAL I  1 127 ? -78.013 -33.972 0.333   1.00 0.00 ? 133 VAL I O     1 
ATOM 8748  C CB    . VAL I  1 127 ? -76.222 -34.642 2.579   1.00 0.00 ? 133 VAL I CB    1 
ATOM 8749  C CG1   . VAL I  1 127 ? -74.975 -34.310 1.769   1.00 0.00 ? 133 VAL I CG1   1 
ATOM 8750  C CG2   . VAL I  1 127 ? -75.852 -34.945 4.023   1.00 0.00 ? 133 VAL I CG2   1 
ATOM 8751  N N     . SER I  1 128 ? -77.289 -31.884 0.712   1.00 0.00 ? 134 SER I N     1 
ATOM 8752  C CA    . SER I  1 128 ? -77.554 -31.441 -0.643  1.00 0.00 ? 134 SER I CA    1 
ATOM 8753  C C     . SER I  1 128 ? -76.946 -30.063 -0.886  1.00 0.00 ? 134 SER I C     1 
ATOM 8754  O O     . SER I  1 128 ? -75.884 -29.948 -1.499  1.00 0.00 ? 134 SER I O     1 
ATOM 8755  C CB    . SER I  1 128 ? -79.057 -31.410 -0.900  1.00 0.00 ? 134 SER I CB    1 
ATOM 8756  O OG    . SER I  1 128 ? -79.340 -30.977 -2.203  1.00 0.00 ? 134 SER I OG    1 
ATOM 8757  O OXT   . SER I  1 128 ? -77.430 -29.085 -0.323  1.00 0.00 ? 134 SER I OXT   1 
ATOM 8758  N N     . SER J  1 1   ? -63.323 -3.004  8.179   1.00 0.00 ? 7   SER J N     1 
ATOM 8759  C CA    . SER J  1 1   ? -63.564 -3.415  6.800   1.00 0.00 ? 7   SER J CA    1 
ATOM 8760  C C     . SER J  1 1   ? -62.264 -3.693  6.069   1.00 0.00 ? 7   SER J C     1 
ATOM 8761  O O     . SER J  1 1   ? -61.597 -2.767  5.609   1.00 0.00 ? 7   SER J O     1 
ATOM 8762  C CB    . SER J  1 1   ? -64.330 -2.355  6.067   1.00 0.00 ? 7   SER J CB    1 
ATOM 8763  O OG    . SER J  1 1   ? -64.497 -2.709  4.728   1.00 0.00 ? 7   SER J OG    1 
ATOM 8764  N N     . ARG J  1 2   ? -61.904 -4.970  5.964   1.00 0.00 ? 8   ARG J N     1 
ATOM 8765  C CA    . ARG J  1 2   ? -60.657 -5.359  5.294   1.00 0.00 ? 8   ARG J CA    1 
ATOM 8766  C C     . ARG J  1 2   ? -60.802 -6.653  4.507   1.00 0.00 ? 8   ARG J C     1 
ATOM 8767  O O     . ARG J  1 2   ? -61.481 -7.580  4.945   1.00 0.00 ? 8   ARG J O     1 
ATOM 8768  C CB    . ARG J  1 2   ? -59.547 -5.566  6.307   1.00 0.00 ? 8   ARG J CB    1 
ATOM 8769  C CG    . ARG J  1 2   ? -59.145 -4.352  7.134   1.00 0.00 ? 8   ARG J CG    1 
ATOM 8770  C CD    . ARG J  1 2   ? -58.437 -3.325  6.347   1.00 0.00 ? 8   ARG J CD    1 
ATOM 8771  N NE    . ARG J  1 2   ? -57.949 -2.262  7.205   1.00 0.00 ? 8   ARG J NE    1 
ATOM 8772  C CZ    . ARG J  1 2   ? -58.675 -1.211  7.611   1.00 0.00 ? 8   ARG J CZ    1 
ATOM 8773  N NH1   . ARG J  1 2   ? -59.919 -1.078  7.215   1.00 0.00 ? 8   ARG J NH1   1 
ATOM 8774  N NH2   . ARG J  1 2   ? -58.142 -0.302  8.417   1.00 0.00 ? 8   ARG J NH2   1 
ATOM 8775  N N     . SER J  1 3   ? -60.114 -6.730  3.373   1.00 0.00 ? 9   SER J N     1 
ATOM 8776  C CA    . SER J  1 3   ? -60.034 -7.957  2.582   1.00 0.00 ? 9   SER J CA    1 
ATOM 8777  C C     . SER J  1 3   ? -59.043 -8.876  3.219   1.00 0.00 ? 9   SER J C     1 
ATOM 8778  O O     . SER J  1 3   ? -58.314 -8.464  4.112   1.00 0.00 ? 9   SER J O     1 
ATOM 8779  C CB    . SER J  1 3   ? -59.589 -7.652  1.187   1.00 0.00 ? 9   SER J CB    1 
ATOM 8780  O OG    . SER J  1 3   ? -58.267 -7.180  1.192   1.00 0.00 ? 9   SER J OG    1 
ATOM 8781  N N     . TYR J  1 4   ? -58.951 -10.110 2.741   1.00 0.00 ? 10  TYR J N     1 
ATOM 8782  C CA    . TYR J  1 4   ? -58.006 -11.010 3.362   1.00 0.00 ? 10  TYR J CA    1 
ATOM 8783  C C     . TYR J  1 4   ? -56.619 -10.566 3.035   1.00 0.00 ? 10  TYR J C     1 
ATOM 8784  O O     . TYR J  1 4   ? -55.689 -10.826 3.785   1.00 0.00 ? 10  TYR J O     1 
ATOM 8785  C CB    . TYR J  1 4   ? -58.132 -12.450 2.894   1.00 0.00 ? 10  TYR J CB    1 
ATOM 8786  C CG    . TYR J  1 4   ? -56.966 -12.847 2.044   1.00 0.00 ? 10  TYR J CG    1 
ATOM 8787  C CD1   . TYR J  1 4   ? -55.775 -13.184 2.675   1.00 0.00 ? 10  TYR J CD1   1 
ATOM 8788  C CD2   . TYR J  1 4   ? -57.049 -12.852 0.669   1.00 0.00 ? 10  TYR J CD2   1 
ATOM 8789  C CE1   . TYR J  1 4   ? -54.665 -13.505 1.933   1.00 0.00 ? 10  TYR J CE1   1 
ATOM 8790  C CE2   . TYR J  1 4   ? -55.936 -13.178 -0.079  1.00 0.00 ? 10  TYR J CE2   1 
ATOM 8791  C CZ    . TYR J  1 4   ? -54.744 -13.498 0.549   1.00 0.00 ? 10  TYR J CZ    1 
ATOM 8792  O OH    . TYR J  1 4   ? -53.628 -13.811 -0.201  1.00 0.00 ? 10  TYR J OH    1 
ATOM 8793  N N     . SER J  1 5   ? -56.456 -9.915  1.887   1.00 0.00 ? 11  SER J N     1 
ATOM 8794  C CA    . SER J  1 5   ? -55.152 -9.494  1.467   1.00 0.00 ? 11  SER J CA    1 
ATOM 8795  C C     . SER J  1 5   ? -54.625 -8.448  2.392   1.00 0.00 ? 11  SER J C     1 
ATOM 8796  O O     . SER J  1 5   ? -53.434 -8.416  2.693   1.00 0.00 ? 11  SER J O     1 
ATOM 8797  C CB    . SER J  1 5   ? -55.215 -8.952  0.072   1.00 0.00 ? 11  SER J CB    1 
ATOM 8798  O OG    . SER J  1 5   ? -55.923 -7.743  0.037   1.00 0.00 ? 11  SER J OG    1 
ATOM 8799  N N     . GLN J  1 6   ? -55.523 -7.632  2.910   1.00 0.00 ? 12  GLN J N     1 
ATOM 8800  C CA    . GLN J  1 6   ? -55.167 -6.633  3.884   1.00 0.00 ? 12  GLN J CA    1 
ATOM 8801  C C     . GLN J  1 6   ? -54.929 -7.258  5.230   1.00 0.00 ? 12  GLN J C     1 
ATOM 8802  O O     . GLN J  1 6   ? -53.986 -6.892  5.930   1.00 0.00 ? 12  GLN J O     1 
ATOM 8803  C CB    . GLN J  1 6   ? -56.246 -5.597  3.963   1.00 0.00 ? 12  GLN J CB    1 
ATOM 8804  C CG    . GLN J  1 6   ? -56.320 -4.728  2.738   1.00 0.00 ? 12  GLN J CG    1 
ATOM 8805  C CD    . GLN J  1 6   ? -57.594 -3.946  2.668   1.00 0.00 ? 12  GLN J CD    1 
ATOM 8806  O OE1   . GLN J  1 6   ? -58.650 -4.525  2.401   1.00 0.00 ? 12  GLN J OE1   1 
ATOM 8807  N NE2   . GLN J  1 6   ? -57.524 -2.642  2.913   1.00 0.00 ? 12  GLN J NE2   1 
ATOM 8808  N N     . ARG J  1 7   ? -55.758 -8.235  5.580   1.00 0.00 ? 13  ARG J N     1 
ATOM 8809  C CA    . ARG J  1 7   ? -55.606 -8.933  6.838   1.00 0.00 ? 13  ARG J CA    1 
ATOM 8810  C C     . ARG J  1 7   ? -54.254 -9.579  6.908   1.00 0.00 ? 13  ARG J C     1 
ATOM 8811  O O     . ARG J  1 7   ? -53.537 -9.435  7.895   1.00 0.00 ? 13  ARG J O     1 
ATOM 8812  C CB    . ARG J  1 7   ? -56.672 -10.004 6.987   1.00 0.00 ? 13  ARG J CB    1 
ATOM 8813  C CG    . ARG J  1 7   ? -58.078 -9.476  7.180   1.00 0.00 ? 13  ARG J CG    1 
ATOM 8814  C CD    . ARG J  1 7   ? -59.088 -10.567 7.194   1.00 0.00 ? 13  ARG J CD    1 
ATOM 8815  N NE    . ARG J  1 7   ? -58.986 -11.374 8.391   1.00 0.00 ? 13  ARG J NE    1 
ATOM 8816  C CZ    . ARG J  1 7   ? -59.554 -12.580 8.563   1.00 0.00 ? 13  ARG J CZ    1 
ATOM 8817  N NH1   . ARG J  1 7   ? -60.253 -13.135 7.598   1.00 0.00 ? 13  ARG J NH1   1 
ATOM 8818  N NH2   . ARG J  1 7   ? -59.408 -13.214 9.711   1.00 0.00 ? 13  ARG J NH2   1 
ATOM 8819  N N     . TYR J  1 8   ? -53.897 -10.263 5.839   1.00 0.00 ? 14  TYR J N     1 
ATOM 8820  C CA    . TYR J  1 8   ? -52.621 -10.910 5.732   1.00 0.00 ? 14  TYR J CA    1 
ATOM 8821  C C     . TYR J  1 8   ? -51.499 -9.943  5.722   1.00 0.00 ? 14  TYR J C     1 
ATOM 8822  O O     . TYR J  1 8   ? -50.535 -10.121 6.451   1.00 0.00 ? 14  TYR J O     1 
ATOM 8823  C CB    . TYR J  1 8   ? -52.553 -11.767 4.501   1.00 0.00 ? 14  TYR J CB    1 
ATOM 8824  C CG    . TYR J  1 8   ? -51.173 -12.263 4.246   1.00 0.00 ? 14  TYR J CG    1 
ATOM 8825  C CD1   . TYR J  1 8   ? -50.540 -13.049 5.179   1.00 0.00 ? 14  TYR J CD1   1 
ATOM 8826  C CD2   . TYR J  1 8   ? -50.529 -11.915 3.079   1.00 0.00 ? 14  TYR J CD2   1 
ATOM 8827  C CE1   . TYR J  1 8   ? -49.258 -13.479 4.955   1.00 0.00 ? 14  TYR J CE1   1 
ATOM 8828  C CE2   . TYR J  1 8   ? -49.247 -12.345 2.850   1.00 0.00 ? 14  TYR J CE2   1 
ATOM 8829  C CZ    . TYR J  1 8   ? -48.609 -13.118 3.787   1.00 0.00 ? 14  TYR J CZ    1 
ATOM 8830  O OH    . TYR J  1 8   ? -47.318 -13.522 3.575   1.00 0.00 ? 14  TYR J OH    1 
ATOM 8831  N N     . ALA J  1 9   ? -51.585 -8.931  4.878   1.00 0.00 ? 15  ALA J N     1 
ATOM 8832  C CA    . ALA J  1 9   ? -50.514 -7.963  4.756   1.00 0.00 ? 15  ALA J CA    1 
ATOM 8833  C C     . ALA J  1 9   ? -50.082 -7.447  6.105   1.00 0.00 ? 15  ALA J C     1 
ATOM 8834  O O     . ALA J  1 9   ? -48.896 -7.487  6.441   1.00 0.00 ? 15  ALA J O     1 
ATOM 8835  C CB    . ALA J  1 9   ? -50.947 -6.807  3.882   1.00 0.00 ? 15  ALA J CB    1 
ATOM 8836  N N     . LYS J  1 10  ? -51.035 -6.967  6.888   1.00 0.00 ? 16  LYS J N     1 
ATOM 8837  C CA    . LYS J  1 10  ? -50.700 -6.416  8.169   1.00 0.00 ? 16  LYS J CA    1 
ATOM 8838  C C     . LYS J  1 10  ? -50.249 -7.487  9.125   1.00 0.00 ? 16  LYS J C     1 
ATOM 8839  O O     . LYS J  1 10  ? -49.306 -7.282  9.882   1.00 0.00 ? 16  LYS J O     1 
ATOM 8840  C CB    . LYS J  1 10  ? -51.850 -5.657  8.763   1.00 0.00 ? 16  LYS J CB    1 
ATOM 8841  C CG    . LYS J  1 10  ? -51.455 -4.916  10.012  1.00 0.00 ? 16  LYS J CG    1 
ATOM 8842  C CD    . LYS J  1 10  ? -52.579 -4.076  10.554  1.00 0.00 ? 16  LYS J CD    1 
ATOM 8843  C CE    . LYS J  1 10  ? -52.089 -3.267  11.733  1.00 0.00 ? 16  LYS J CE    1 
ATOM 8844  N NZ    . LYS J  1 10  ? -53.184 -2.556  12.434  1.00 0.00 ? 16  LYS J NZ    1 
ATOM 8845  N N     . TRP J  1 11  ? -50.905 -8.643  9.089   1.00 0.00 ? 17  TRP J N     1 
ATOM 8846  C CA    . TRP J  1 11  ? -50.511 -9.749  9.940   1.00 0.00 ? 17  TRP J CA    1 
ATOM 8847  C C     . TRP J  1 11  ? -49.078 -10.112 9.721   1.00 0.00 ? 17  TRP J C     1 
ATOM 8848  O O     . TRP J  1 11  ? -48.358 -10.410 10.667  1.00 0.00 ? 17  TRP J O     1 
ATOM 8849  C CB    . TRP J  1 11  ? -51.361 -10.970 9.690   1.00 0.00 ? 17  TRP J CB    1 
ATOM 8850  C CG    . TRP J  1 11  ? -50.891 -12.150 10.466  1.00 0.00 ? 17  TRP J CG    1 
ATOM 8851  C CD1   . TRP J  1 11  ? -51.223 -12.464 11.743  1.00 0.00 ? 17  TRP J CD1   1 
ATOM 8852  C CD2   . TRP J  1 11  ? -49.988 -13.188 10.021  1.00 0.00 ? 17  TRP J CD2   1 
ATOM 8853  N NE1   . TRP J  1 11  ? -50.593 -13.620 12.126  1.00 0.00 ? 17  TRP J NE1   1 
ATOM 8854  C CE2   . TRP J  1 11  ? -49.834 -14.076 11.082  1.00 0.00 ? 17  TRP J CE2   1 
ATOM 8855  C CE3   . TRP J  1 11  ? -49.315 -13.431 8.824   1.00 0.00 ? 17  TRP J CE3   1 
ATOM 8856  C CZ2   . TRP J  1 11  ? -49.032 -15.202 10.986  1.00 0.00 ? 17  TRP J CZ2   1 
ATOM 8857  C CZ3   . TRP J  1 11  ? -48.513 -14.559 8.726   1.00 0.00 ? 17  TRP J CZ3   1 
ATOM 8858  C CH2   . TRP J  1 11  ? -48.375 -15.422 9.780   1.00 0.00 ? 17  TRP J CH2   1 
ATOM 8859  N N     . GLN J  1 12  ? -48.668 -10.123 8.470   1.00 0.00 ? 18  GLN J N     1 
ATOM 8860  C CA    . GLN J  1 12  ? -47.323 -10.456 8.125   1.00 0.00 ? 18  GLN J CA    1 
ATOM 8861  C C     . GLN J  1 12  ? -46.358 -9.470  8.694   1.00 0.00 ? 18  GLN J C     1 
ATOM 8862  O O     . GLN J  1 12  ? -45.349 -9.847  9.277   1.00 0.00 ? 18  GLN J O     1 
ATOM 8863  C CB    . GLN J  1 12  ? -47.159 -10.484 6.625   1.00 0.00 ? 18  GLN J CB    1 
ATOM 8864  C CG    . GLN J  1 12  ? -45.797 -10.917 6.190   1.00 0.00 ? 18  GLN J CG    1 
ATOM 8865  C CD    . GLN J  1 12  ? -45.561 -12.343 6.527   1.00 0.00 ? 18  GLN J CD    1 
ATOM 8866  O OE1   . GLN J  1 12  ? -46.248 -13.213 5.993   1.00 0.00 ? 18  GLN J OE1   1 
ATOM 8867  N NE2   . GLN J  1 12  ? -44.610 -12.618 7.409   1.00 0.00 ? 18  GLN J NE2   1 
ATOM 8868  N N     . ALA J  1 13  ? -46.677 -8.195  8.552   1.00 0.00 ? 19  ALA J N     1 
ATOM 8869  C CA    . ALA J  1 13  ? -45.813 -7.146  9.046   1.00 0.00 ? 19  ALA J CA    1 
ATOM 8870  C C     . ALA J  1 13  ? -45.632 -7.242  10.538  1.00 0.00 ? 19  ALA J C     1 
ATOM 8871  O O     . ALA J  1 13  ? -44.527 -7.060  11.047  1.00 0.00 ? 19  ALA J O     1 
ATOM 8872  C CB    . ALA J  1 13  ? -46.376 -5.799  8.678   1.00 0.00 ? 19  ALA J CB    1 
ATOM 8873  N N     . LYS J  1 14  ? -46.704 -7.550  11.245  1.00 0.00 ? 20  LYS J N     1 
ATOM 8874  C CA    . LYS J  1 14  ? -46.644 -7.627  12.680  1.00 0.00 ? 20  LYS J CA    1 
ATOM 8875  C C     . LYS J  1 14  ? -45.976 -8.873  13.147  1.00 0.00 ? 20  LYS J C     1 
ATOM 8876  O O     . LYS J  1 14  ? -45.273 -8.855  14.153  1.00 0.00 ? 20  LYS J O     1 
ATOM 8877  C CB    . LYS J  1 14  ? -48.024 -7.532  13.263  1.00 0.00 ? 20  LYS J CB    1 
ATOM 8878  C CG    . LYS J  1 14  ? -48.666 -6.191  13.038  1.00 0.00 ? 20  LYS J CG    1 
ATOM 8879  C CD    . LYS J  1 14  ? -47.849 -5.111  13.703  1.00 0.00 ? 20  LYS J CD    1 
ATOM 8880  C CE    . LYS J  1 14  ? -48.014 -5.128  15.209  1.00 0.00 ? 20  LYS J CE    1 
ATOM 8881  N NZ    . LYS J  1 14  ? -49.259 -4.443  15.630  1.00 0.00 ? 20  LYS J NZ    1 
ATOM 8882  N N     . PHE J  1 15  ? -46.150 -9.957  12.411  1.00 0.00 ? 21  PHE J N     1 
ATOM 8883  C CA    . PHE J  1 15  ? -45.476 -11.182 12.754  1.00 0.00 ? 21  PHE J CA    1 
ATOM 8884  C C     . PHE J  1 15  ? -43.986 -10.982 12.632  1.00 0.00 ? 21  PHE J C     1 
ATOM 8885  O O     . PHE J  1 15  ? -43.222 -11.378 13.513  1.00 0.00 ? 21  PHE J O     1 
ATOM 8886  C CB    . PHE J  1 15  ? -45.911 -12.326 11.867  1.00 0.00 ? 21  PHE J CB    1 
ATOM 8887  C CG    . PHE J  1 15  ? -45.318 -13.620 12.296  1.00 0.00 ? 21  PHE J CG    1 
ATOM 8888  C CD1   . PHE J  1 15  ? -45.941 -14.390 13.262  1.00 0.00 ? 21  PHE J CD1   1 
ATOM 8889  C CD2   . PHE J  1 15  ? -44.114 -14.050 11.785  1.00 0.00 ? 21  PHE J CD2   1 
ATOM 8890  C CE1   . PHE J  1 15  ? -45.377 -15.574 13.697  1.00 0.00 ? 21  PHE J CE1   1 
ATOM 8891  C CE2   . PHE J  1 15  ? -43.546 -15.231 12.223  1.00 0.00 ? 21  PHE J CE2   1 
ATOM 8892  C CZ    . PHE J  1 15  ? -44.179 -15.993 13.177  1.00 0.00 ? 21  PHE J CZ    1 
ATOM 8893  N N     . ASN J  1 16  ? -43.574 -10.356 11.533  1.00 0.00 ? 22  ASN J N     1 
ATOM 8894  C CA    . ASN J  1 16  ? -42.178 -10.078 11.290  1.00 0.00 ? 22  ASN J CA    1 
ATOM 8895  C C     . ASN J  1 16  ? -41.601 -9.264  12.411  1.00 0.00 ? 22  ASN J C     1 
ATOM 8896  O O     . ASN J  1 16  ? -40.552 -9.600  12.960  1.00 0.00 ? 22  ASN J O     1 
ATOM 8897  C CB    . ASN J  1 16  ? -42.006 -9.321  10.001  1.00 0.00 ? 22  ASN J CB    1 
ATOM 8898  C CG    . ASN J  1 16  ? -42.329 -10.135 8.806   1.00 0.00 ? 22  ASN J CG    1 
ATOM 8899  O OD1   . ASN J  1 16  ? -42.498 -11.354 8.892   1.00 0.00 ? 22  ASN J OD1   1 
ATOM 8900  N ND2   . ASN J  1 16  ? -42.420 -9.490  7.676   1.00 0.00 ? 22  ASN J ND2   1 
ATOM 8901  N N     . ALA J  1 17  ? -42.311 -8.205  12.784  1.00 0.00 ? 23  ALA J N     1 
ATOM 8902  C CA    . ALA J  1 17  ? -41.865 -7.333  13.839  1.00 0.00 ? 23  ALA J CA    1 
ATOM 8903  C C     . ALA J  1 17  ? -41.633 -8.099  15.111  1.00 0.00 ? 23  ALA J C     1 
ATOM 8904  O O     . ALA J  1 17  ? -40.563 -8.017  15.705  1.00 0.00 ? 23  ALA J O     1 
ATOM 8905  C CB    . ALA J  1 17  ? -42.884 -6.235  14.074  1.00 0.00 ? 23  ALA J CB    1 
ATOM 8906  N N     . PHE J  1 18  ? -42.624 -8.876  15.517  1.00 0.00 ? 24  PHE J N     1 
ATOM 8907  C CA    . PHE J  1 18  ? -42.538 -9.623  16.746  1.00 0.00 ? 24  PHE J CA    1 
ATOM 8908  C C     . PHE J  1 18  ? -41.384 -10.580 16.770  1.00 0.00 ? 24  PHE J C     1 
ATOM 8909  O O     . PHE J  1 18  ? -40.757 -10.759 17.805  1.00 0.00 ? 24  PHE J O     1 
ATOM 8910  C CB    . PHE J  1 18  ? -43.816 -10.356 17.029  1.00 0.00 ? 24  PHE J CB    1 
ATOM 8911  C CG    . PHE J  1 18  ? -43.770 -11.104 18.324  1.00 0.00 ? 24  PHE J CG    1 
ATOM 8912  C CD1   . PHE J  1 18  ? -43.560 -10.432 19.516  1.00 0.00 ? 24  PHE J CD1   1 
ATOM 8913  C CD2   . PHE J  1 18  ? -43.968 -12.475 18.362  1.00 0.00 ? 24  PHE J CD2   1 
ATOM 8914  C CE1   . PHE J  1 18  ? -43.540 -11.116 20.714  1.00 0.00 ? 24  PHE J CE1   1 
ATOM 8915  C CE2   . PHE J  1 18  ? -43.955 -13.157 19.561  1.00 0.00 ? 24  PHE J CE2   1 
ATOM 8916  C CZ    . PHE J  1 18  ? -43.739 -12.478 20.736  1.00 0.00 ? 24  PHE J CZ    1 
ATOM 8917  N N     . SER J  1 19  ? -41.080 -11.203 15.633  1.00 0.00 ? 25  SER J N     1 
ATOM 8918  C CA    . SER J  1 19  ? -40.012 -12.201 15.578  1.00 0.00 ? 25  SER J CA    1 
ATOM 8919  C C     . SER J  1 19  ? -38.621 -11.617 15.872  1.00 0.00 ? 25  SER J C     1 
ATOM 8920  O O     . SER J  1 19  ? -37.678 -12.362 16.121  1.00 0.00 ? 25  SER J O     1 
ATOM 8921  C CB    . SER J  1 19  ? -39.978 -12.853 14.226  1.00 0.00 ? 25  SER J CB    1 
ATOM 8922  O OG    . SER J  1 19  ? -39.467 -11.977 13.256  1.00 0.00 ? 25  SER J OG    1 
ATOM 8923  N N     . ASN J  1 20  ? -38.494 -10.292 15.820  1.00 0.00 ? 26  ASN J N     1 
ATOM 8924  C CA    . ASN J  1 20  ? -37.225 -9.628  16.085  1.00 0.00 ? 26  ASN J CA    1 
ATOM 8925  C C     . ASN J  1 20  ? -36.814 -9.789  17.543  1.00 0.00 ? 26  ASN J C     1 
ATOM 8926  O O     . ASN J  1 20  ? -37.517 -9.311  18.423  1.00 0.00 ? 26  ASN J O     1 
ATOM 8927  C CB    . ASN J  1 20  ? -37.337 -8.161  15.737  1.00 0.00 ? 26  ASN J CB    1 
ATOM 8928  C CG    . ASN J  1 20  ? -36.062 -7.405  15.931  1.00 0.00 ? 26  ASN J CG    1 
ATOM 8929  O OD1   . ASN J  1 20  ? -35.426 -7.480  16.992  1.00 0.00 ? 26  ASN J OD1   1 
ATOM 8930  N ND2   . ASN J  1 20  ? -35.669 -6.671  14.925  1.00 0.00 ? 26  ASN J ND2   1 
ATOM 8931  N N     . PRO J  1 21  ? -35.681 -10.479 17.812  1.00 0.00 ? 27  PRO J N     1 
ATOM 8932  C CA    . PRO J  1 21  ? -35.106 -10.734 19.151  1.00 0.00 ? 27  PRO J CA    1 
ATOM 8933  C C     . PRO J  1 21  ? -35.435 -9.654  20.162  1.00 0.00 ? 27  PRO J C     1 
ATOM 8934  O O     . PRO J  1 21  ? -35.843 -9.948  21.290  1.00 0.00 ? 27  PRO J O     1 
ATOM 8935  C CB    . PRO J  1 21  ? -33.593 -10.714 18.898  1.00 0.00 ? 27  PRO J CB    1 
ATOM 8936  C CG    . PRO J  1 21  ? -33.441 -11.114 17.495  1.00 0.00 ? 27  PRO J CG    1 
ATOM 8937  C CD    . PRO J  1 21  ? -34.595 -10.457 16.800  1.00 0.00 ? 27  PRO J CD    1 
ATOM 8938  N N     . THR J  1 22  ? -35.219 -8.405  19.771  1.00 0.00 ? 28  THR J N     1 
ATOM 8939  C CA    . THR J  1 22  ? -35.412 -7.297  20.663  1.00 0.00 ? 28  THR J CA    1 
ATOM 8940  C C     . THR J  1 22  ? -36.855 -7.068  20.944  1.00 0.00 ? 28  THR J C     1 
ATOM 8941  O O     . THR J  1 22  ? -37.240 -6.879  22.090  1.00 0.00 ? 28  THR J O     1 
ATOM 8942  C CB    . THR J  1 22  ? -34.799 -6.027  20.097  1.00 0.00 ? 28  THR J CB    1 
ATOM 8943  O OG1   . THR J  1 22  ? -33.391 -6.213  19.926  1.00 0.00 ? 28  THR J OG1   1 
ATOM 8944  C CG2   . THR J  1 22  ? -35.041 -4.872  21.037  1.00 0.00 ? 28  THR J CG2   1 
ATOM 8945  N N     . VAL J  1 23  ? -37.666 -7.089  19.907  1.00 0.00 ? 29  VAL J N     1 
ATOM 8946  C CA    . VAL J  1 23  ? -39.078 -6.854  20.060  1.00 0.00 ? 29  VAL J CA    1 
ATOM 8947  C C     . VAL J  1 23  ? -39.724 -7.935  20.866  1.00 0.00 ? 29  VAL J C     1 
ATOM 8948  O O     . VAL J  1 23  ? -40.524 -7.661  21.761  1.00 0.00 ? 29  VAL J O     1 
ATOM 8949  C CB    . VAL J  1 23  ? -39.751 -6.776  18.707  1.00 0.00 ? 29  VAL J CB    1 
ATOM 8950  C CG1   . VAL J  1 23  ? -41.250 -6.710  18.874  1.00 0.00 ? 29  VAL J CG1   1 
ATOM 8951  C CG2   . VAL J  1 23  ? -39.249 -5.571  17.971  1.00 0.00 ? 29  VAL J CG2   1 
ATOM 8952  N N     . ALA J  1 24  ? -39.384 -9.168  20.558  1.00 0.00 ? 30  ALA J N     1 
ATOM 8953  C CA    . ALA J  1 24  ? -39.948 -10.292 21.256  1.00 0.00 ? 30  ALA J CA    1 
ATOM 8954  C C     . ALA J  1 24  ? -39.647 -10.220 22.726  1.00 0.00 ? 30  ALA J C     1 
ATOM 8955  O O     . ALA J  1 24  ? -40.547 -10.305 23.554  1.00 0.00 ? 30  ALA J O     1 
ATOM 8956  C CB    . ALA J  1 24  ? -39.414 -11.592 20.687  1.00 0.00 ? 30  ALA J CB    1 
ATOM 8957  N N     . SER J  1 25  ? -38.379 -10.042 23.058  1.00 0.00 ? 31  SER J N     1 
ATOM 8958  C CA    . SER J  1 25  ? -37.982 -10.030 24.437  1.00 0.00 ? 31  SER J CA    1 
ATOM 8959  C C     . SER J  1 25  ? -38.441 -8.806  25.164  1.00 0.00 ? 31  SER J C     1 
ATOM 8960  O O     . SER J  1 25  ? -38.759 -8.875  26.344  1.00 0.00 ? 31  SER J O     1 
ATOM 8961  C CB    . SER J  1 25  ? -36.511 -10.124 24.526  1.00 0.00 ? 31  SER J CB    1 
ATOM 8962  O OG    . SER J  1 25  ? -35.909 -9.031  23.900  1.00 0.00 ? 31  SER J OG    1 
ATOM 8963  N N     . THR J  1 26  ? -38.532 -7.687  24.469  1.00 0.00 ? 32  THR J N     1 
ATOM 8964  C CA    . THR J  1 26  ? -39.003 -6.477  25.103  1.00 0.00 ? 32  THR J CA    1 
ATOM 8965  C C     . THR J  1 26  ? -40.401 -6.649  25.577  1.00 0.00 ? 32  THR J C     1 
ATOM 8966  O O     . THR J  1 26  ? -40.704 -6.411  26.744  1.00 0.00 ? 32  THR J O     1 
ATOM 8967  C CB    . THR J  1 26  ? -38.938 -5.284  24.163  1.00 0.00 ? 32  THR J CB    1 
ATOM 8968  O OG1   . THR J  1 26  ? -37.582 -5.030  23.802  1.00 0.00 ? 32  THR J OG1   1 
ATOM 8969  C CG2   . THR J  1 26  ? -39.513 -4.070  24.844  1.00 0.00 ? 32  THR J CG2   1 
ATOM 8970  N N     . ILE J  1 27  ? -41.262 -7.080  24.686  1.00 0.00 ? 33  ILE J N     1 
ATOM 8971  C CA    . ILE J  1 27  ? -42.641 -7.243  25.027  1.00 0.00 ? 33  ILE J CA    1 
ATOM 8972  C C     . ILE J  1 27  ? -42.830 -8.320  26.055  1.00 0.00 ? 33  ILE J C     1 
ATOM 8973  O O     . ILE J  1 27  ? -43.486 -8.102  27.071  1.00 0.00 ? 33  ILE J O     1 
ATOM 8974  C CB    . ILE J  1 27  ? -43.457 -7.591  23.801  1.00 0.00 ? 33  ILE J CB    1 
ATOM 8975  C CG1   . ILE J  1 27  ? -43.485 -6.422  22.841  1.00 0.00 ? 33  ILE J CG1   1 
ATOM 8976  C CG2   . ILE J  1 27  ? -44.856 -7.968  24.211  1.00 0.00 ? 33  ILE J CG2   1 
ATOM 8977  C CD1   . ILE J  1 27  ? -44.032 -6.778  21.489  1.00 0.00 ? 33  ILE J CD1   1 
ATOM 8978  N N     . LEU J  1 28  ? -42.260 -9.480  25.798  1.00 0.00 ? 34  LEU J N     1 
ATOM 8979  C CA    . LEU J  1 28  ? -42.477 -10.632 26.634  1.00 0.00 ? 34  LEU J CA    1 
ATOM 8980  C C     . LEU J  1 28  ? -41.917 -10.463 28.023  1.00 0.00 ? 34  LEU J C     1 
ATOM 8981  O O     . LEU J  1 28  ? -42.534 -10.891 28.996  1.00 0.00 ? 34  LEU J O     1 
ATOM 8982  C CB    . LEU J  1 28  ? -41.866 -11.845 25.978  1.00 0.00 ? 34  LEU J CB    1 
ATOM 8983  C CG    . LEU J  1 28  ? -42.555 -12.290 24.690  1.00 0.00 ? 34  LEU J CG    1 
ATOM 8984  C CD1   . LEU J  1 28  ? -41.725 -13.369 24.027  1.00 0.00 ? 34  LEU J CD1   1 
ATOM 8985  C CD2   . LEU J  1 28  ? -43.949 -12.789 25.011  1.00 0.00 ? 34  LEU J CD2   1 
ATOM 8986  N N     . SER J  1 29  ? -40.764 -9.822  28.137  1.00 0.00 ? 35  SER J N     1 
ATOM 8987  C CA    . SER J  1 29  ? -40.187 -9.605  29.443  1.00 0.00 ? 35  SER J CA    1 
ATOM 8988  C C     . SER J  1 29  ? -40.954 -8.554  30.215  1.00 0.00 ? 35  SER J C     1 
ATOM 8989  O O     . SER J  1 29  ? -41.016 -8.608  31.442  1.00 0.00 ? 35  SER J O     1 
ATOM 8990  C CB    . SER J  1 29  ? -38.750 -9.196  29.326  1.00 0.00 ? 35  SER J CB    1 
ATOM 8991  O OG    . SER J  1 29  ? -38.637 -7.940  28.724  1.00 0.00 ? 35  SER J OG    1 
ATOM 8992  N N     . ASN J  1 30  ? -41.585 -7.618  29.505  1.00 0.00 ? 36  ASN J N     1 
ATOM 8993  C CA    . ASN J  1 30  ? -42.378 -6.608  30.173  1.00 0.00 ? 36  ASN J CA    1 
ATOM 8994  C C     . ASN J  1 30  ? -43.687 -7.153  30.672  1.00 0.00 ? 36  ASN J C     1 
ATOM 8995  O O     . ASN J  1 30  ? -44.149 -6.769  31.741  1.00 0.00 ? 36  ASN J O     1 
ATOM 8996  C CB    . ASN J  1 30  ? -42.603 -5.423  29.282  1.00 0.00 ? 36  ASN J CB    1 
ATOM 8997  C CG    . ASN J  1 30  ? -41.368 -4.596  29.148  1.00 0.00 ? 36  ASN J CG    1 
ATOM 8998  O OD1   . ASN J  1 30  ? -40.402 -4.794  29.892  1.00 0.00 ? 36  ASN J OD1   1 
ATOM 8999  N ND2   . ASN J  1 30  ? -41.378 -3.660  28.241  1.00 0.00 ? 36  ASN J ND2   1 
ATOM 9000  N N     . VAL J  1 31  ? -44.283 -8.080  29.927  1.00 0.00 ? 37  VAL J N     1 
ATOM 9001  C CA    . VAL J  1 31  ? -45.569 -8.631  30.331  1.00 0.00 ? 37  VAL J CA    1 
ATOM 9002  C C     . VAL J  1 31  ? -45.419 -9.892  31.120  1.00 0.00 ? 37  VAL J C     1 
ATOM 9003  O O     . VAL J  1 31  ? -46.413 -10.508 31.475  1.00 0.00 ? 37  VAL J O     1 
ATOM 9004  C CB    . VAL J  1 31  ? -46.457 -8.934  29.125  1.00 0.00 ? 37  VAL J CB    1 
ATOM 9005  C CG1   . VAL J  1 31  ? -46.672 -7.689  28.296  1.00 0.00 ? 37  VAL J CG1   1 
ATOM 9006  C CG2   . VAL J  1 31  ? -45.845 -10.046 28.312  1.00 0.00 ? 37  VAL J CG2   1 
ATOM 9007  N N     . SER J  1 32  ? -44.179 -10.294 31.385  1.00 0.00 ? 38  SER J N     1 
ATOM 9008  C CA    . SER J  1 32  ? -43.918 -11.484 32.171  1.00 0.00 ? 38  SER J CA    1 
ATOM 9009  C C     . SER J  1 32  ? -44.736 -11.531 33.475  1.00 0.00 ? 38  SER J C     1 
ATOM 9010  O O     . SER J  1 32  ? -45.684 -12.306 33.562  1.00 0.00 ? 38  SER J O     1 
ATOM 9011  C CB    . SER J  1 32  ? -42.429 -11.634 32.442  1.00 0.00 ? 38  SER J CB    1 
ATOM 9012  O OG    . SER J  1 32  ? -41.734 -11.950 31.268  1.00 0.00 ? 38  SER J OG    1 
ATOM 9013  N N     . PRO J  1 33  ? -44.349 -10.761 34.517  1.00 0.00 ? 39  PRO J N     1 
ATOM 9014  C CA    . PRO J  1 33  ? -45.015 -10.777 35.821  1.00 0.00 ? 39  PRO J CA    1 
ATOM 9015  C C     . PRO J  1 33  ? -46.536 -10.535 35.715  1.00 0.00 ? 39  PRO J C     1 
ATOM 9016  O O     . PRO J  1 33  ? -47.303 -11.008 36.555  1.00 0.00 ? 39  PRO J O     1 
ATOM 9017  C CB    . PRO J  1 33  ? -44.366 -9.624  36.548  1.00 0.00 ? 39  PRO J CB    1 
ATOM 9018  C CG    . PRO J  1 33  ? -44.107 -8.616  35.486  1.00 0.00 ? 39  PRO J CG    1 
ATOM 9019  C CD    . PRO J  1 33  ? -43.845 -9.395  34.235  1.00 0.00 ? 39  PRO J CD    1 
ATOM 9020  N N     . VAL J  1 34  ? -46.963 -9.830  34.669  1.00 0.00 ? 40  VAL J N     1 
ATOM 9021  C CA    . VAL J  1 34  ? -48.362 -9.568  34.453  1.00 0.00 ? 40  VAL J CA    1 
ATOM 9022  C C     . VAL J  1 34  ? -49.057 -10.837 34.061  1.00 0.00 ? 40  VAL J C     1 
ATOM 9023  O O     . VAL J  1 34  ? -50.092 -11.193 34.625  1.00 0.00 ? 40  VAL J O     1 
ATOM 9024  C CB    . VAL J  1 34  ? -48.542 -8.532  33.352  1.00 0.00 ? 40  VAL J CB    1 
ATOM 9025  C CG1   . VAL J  1 34  ? -50.014 -8.367  33.029  1.00 0.00 ? 40  VAL J CG1   1 
ATOM 9026  C CG2   . VAL J  1 34  ? -47.923 -7.214  33.783  1.00 0.00 ? 40  VAL J CG2   1 
ATOM 9027  N N     . ALA J  1 35  ? -48.461 -11.538 33.110  1.00 0.00 ? 41  ALA J N     1 
ATOM 9028  C CA    . ALA J  1 35  ? -48.967 -12.804 32.647  1.00 0.00 ? 41  ALA J CA    1 
ATOM 9029  C C     . ALA J  1 35  ? -49.048 -13.781 33.770  1.00 0.00 ? 41  ALA J C     1 
ATOM 9030  O O     . ALA J  1 35  ? -50.006 -14.539 33.872  1.00 0.00 ? 41  ALA J O     1 
ATOM 9031  C CB    . ALA J  1 35  ? -48.074 -13.359 31.557  1.00 0.00 ? 41  ALA J CB    1 
ATOM 9032  N N     . GLN J  1 36  ? -48.051 -13.751 34.636  1.00 0.00 ? 42  GLN J N     1 
ATOM 9033  C CA    . GLN J  1 36  ? -47.995 -14.657 35.750  1.00 0.00 ? 42  GLN J CA    1 
ATOM 9034  C C     . GLN J  1 36  ? -49.174 -14.465 36.633  1.00 0.00 ? 42  GLN J C     1 
ATOM 9035  O O     . GLN J  1 36  ? -49.804 -15.428 37.049  1.00 0.00 ? 42  GLN J O     1 
ATOM 9036  C CB    . GLN J  1 36  ? -46.728 -14.434 36.536  1.00 0.00 ? 42  GLN J CB    1 
ATOM 9037  C CG    . GLN J  1 36  ? -45.491 -14.804 35.772  1.00 0.00 ? 42  GLN J CG    1 
ATOM 9038  C CD    . GLN J  1 36  ? -44.229 -14.579 36.559  1.00 0.00 ? 42  GLN J CD    1 
ATOM 9039  O OE1   . GLN J  1 36  ? -44.171 -14.852 37.761  1.00 0.00 ? 42  GLN J OE1   1 
ATOM 9040  N NE2   . GLN J  1 36  ? -43.203 -14.078 35.886  1.00 0.00 ? 42  GLN J NE2   1 
ATOM 9041  N N     . GLN J  1 37  ? -49.518 -13.215 36.889  1.00 0.00 ? 43  GLN J N     1 
ATOM 9042  C CA    . GLN J  1 37  ? -50.666 -12.917 37.705  1.00 0.00 ? 43  GLN J CA    1 
ATOM 9043  C C     . GLN J  1 37  ? -51.934 -13.427 37.087  1.00 0.00 ? 43  GLN J C     1 
ATOM 9044  O O     . GLN J  1 37  ? -52.767 -14.023 37.770  1.00 0.00 ? 43  GLN J O     1 
ATOM 9045  C CB    . GLN J  1 37  ? -50.791 -11.425 37.917  1.00 0.00 ? 43  GLN J CB    1 
ATOM 9046  C CG    . GLN J  1 37  ? -51.957 -11.043 38.784  1.00 0.00 ? 43  GLN J CG    1 
ATOM 9047  C CD    . GLN J  1 37  ? -51.803 -11.553 40.189  1.00 0.00 ? 43  GLN J CD    1 
ATOM 9048  O OE1   . GLN J  1 37  ? -50.792 -11.286 40.842  1.00 0.00 ? 43  GLN J OE1   1 
ATOM 9049  N NE2   . GLN J  1 37  ? -52.798 -12.291 40.672  1.00 0.00 ? 43  GLN J NE2   1 
ATOM 9050  N N     . ASN J  1 38  ? -52.080 -13.209 35.790  1.00 0.00 ? 44  ASN J N     1 
ATOM 9051  C CA    . ASN J  1 38  ? -53.285 -13.598 35.098  1.00 0.00 ? 44  ASN J CA    1 
ATOM 9052  C C     . ASN J  1 38  ? -53.439 -15.098 35.047  1.00 0.00 ? 44  ASN J C     1 
ATOM 9053  O O     . ASN J  1 38  ? -54.536 -15.623 35.242  1.00 0.00 ? 44  ASN J O     1 
ATOM 9054  C CB    . ASN J  1 38  ? -53.295 -12.999 33.721  1.00 0.00 ? 44  ASN J CB    1 
ATOM 9055  C CG    . ASN J  1 38  ? -53.528 -11.521 33.778  1.00 0.00 ? 44  ASN J CG    1 
ATOM 9056  O OD1   . ASN J  1 38  ? -54.025 -11.015 34.789  1.00 0.00 ? 44  ASN J OD1   1 
ATOM 9057  N ND2   . ASN J  1 38  ? -53.188 -10.818 32.728  1.00 0.00 ? 44  ASN J ND2   1 
ATOM 9058  N N     . PHE J  1 39  ? -52.336 -15.791 34.820  1.00 0.00 ? 45  PHE J N     1 
ATOM 9059  C CA    . PHE J  1 39  ? -52.336 -17.233 34.788  1.00 0.00 ? 45  PHE J CA    1 
ATOM 9060  C C     . PHE J  1 39  ? -52.693 -17.783 36.145  1.00 0.00 ? 45  PHE J C     1 
ATOM 9061  O O     . PHE J  1 39  ? -53.556 -18.640 36.271  1.00 0.00 ? 45  PHE J O     1 
ATOM 9062  C CB    . PHE J  1 39  ? -50.984 -17.764 34.393  1.00 0.00 ? 45  PHE J CB    1 
ATOM 9063  C CG    . PHE J  1 39  ? -50.971 -19.240 34.233  1.00 0.00 ? 45  PHE J CG    1 
ATOM 9064  C CD1   . PHE J  1 39  ? -51.017 -19.807 32.977  1.00 0.00 ? 45  PHE J CD1   1 
ATOM 9065  C CD2   . PHE J  1 39  ? -50.968 -20.072 35.333  1.00 0.00 ? 45  PHE J CD2   1 
ATOM 9066  C CE1   . PHE J  1 39  ? -51.018 -21.179 32.816  1.00 0.00 ? 45  PHE J CE1   1 
ATOM 9067  C CE2   . PHE J  1 39  ? -50.981 -21.445 35.179  1.00 0.00 ? 45  PHE J CE2   1 
ATOM 9068  C CZ    . PHE J  1 39  ? -50.993 -21.998 33.920  1.00 0.00 ? 45  PHE J CZ    1 
ATOM 9069  N N     . GLN J  1 40  ? -52.037 -17.270 37.171  1.00 0.00 ? 46  GLN J N     1 
ATOM 9070  C CA    . GLN J  1 40  ? -52.280 -17.726 38.517  1.00 0.00 ? 46  GLN J CA    1 
ATOM 9071  C C     . GLN J  1 40  ? -53.699 -17.496 38.946  1.00 0.00 ? 46  GLN J C     1 
ATOM 9072  O O     . GLN J  1 40  ? -54.268 -18.293 39.685  1.00 0.00 ? 46  GLN J O     1 
ATOM 9073  C CB    . GLN J  1 40  ? -51.370 -17.019 39.496  1.00 0.00 ? 46  GLN J CB    1 
ATOM 9074  C CG    . GLN J  1 40  ? -49.917 -17.411 39.429  1.00 0.00 ? 46  GLN J CG    1 
ATOM 9075  C CD    . GLN J  1 40  ? -49.099 -16.544 40.344  1.00 0.00 ? 46  GLN J CD    1 
ATOM 9076  O OE1   . GLN J  1 40  ? -49.638 -15.976 41.296  1.00 0.00 ? 46  GLN J OE1   1 
ATOM 9077  N NE2   . GLN J  1 40  ? -47.807 -16.418 40.074  1.00 0.00 ? 46  GLN J NE2   1 
ATOM 9078  N N     . THR J  1 41  ? -54.264 -16.381 38.521  1.00 0.00 ? 47  THR J N     1 
ATOM 9079  C CA    . THR J  1 41  ? -55.589 -16.019 38.937  1.00 0.00 ? 47  THR J CA    1 
ATOM 9080  C C     . THR J  1 41  ? -56.673 -16.912 38.345  1.00 0.00 ? 47  THR J C     1 
ATOM 9081  O O     . THR J  1 41  ? -57.526 -17.412 39.069  1.00 0.00 ? 47  THR J O     1 
ATOM 9082  C CB    . THR J  1 41  ? -55.883 -14.570 38.561  1.00 0.00 ? 47  THR J CB    1 
ATOM 9083  O OG1   . THR J  1 41  ? -54.935 -13.710 39.201  1.00 0.00 ? 47  THR J OG1   1 
ATOM 9084  C CG2   . THR J  1 41  ? -57.284 -14.185 38.994  1.00 0.00 ? 47  THR J CG2   1 
ATOM 9085  N N     . ASN J  1 42  ? -56.668 -17.087 37.030  1.00 0.00 ? 48  ASN J N     1 
ATOM 9086  C CA    . ASN J  1 42  ? -57.768 -17.793 36.395  1.00 0.00 ? 48  ASN J CA    1 
ATOM 9087  C C     . ASN J  1 42  ? -57.569 -19.275 36.158  1.00 0.00 ? 48  ASN J C     1 
ATOM 9088  O O     . ASN J  1 42  ? -58.541 -19.985 35.945  1.00 0.00 ? 48  ASN J O     1 
ATOM 9089  C CB    . ASN J  1 42  ? -58.142 -17.124 35.096  1.00 0.00 ? 48  ASN J CB    1 
ATOM 9090  C CG    . ASN J  1 42  ? -58.844 -15.811 35.304  1.00 0.00 ? 48  ASN J CG    1 
ATOM 9091  O OD1   . ASN J  1 42  ? -59.464 -15.581 36.352  1.00 0.00 ? 48  ASN J OD1   1 
ATOM 9092  N ND2   . ASN J  1 42  ? -58.786 -14.954 34.320  1.00 0.00 ? 48  ASN J ND2   1 
ATOM 9093  N N     . VAL J  1 43  ? -56.341 -19.768 36.197  1.00 0.00 ? 49  VAL J N     1 
ATOM 9094  C CA    . VAL J  1 43  ? -56.131 -21.180 35.871  1.00 0.00 ? 49  VAL J CA    1 
ATOM 9095  C C     . VAL J  1 43  ? -56.555 -22.218 36.939  1.00 0.00 ? 49  VAL J C     1 
ATOM 9096  O O     . VAL J  1 43  ? -57.271 -23.162 36.598  1.00 0.00 ? 49  VAL J O     1 
ATOM 9097  C CB    . VAL J  1 43  ? -54.700 -21.415 35.486  1.00 0.00 ? 49  VAL J CB    1 
ATOM 9098  C CG1   . VAL J  1 43  ? -54.433 -22.897 35.337  1.00 0.00 ? 49  VAL J CG1   1 
ATOM 9099  C CG2   . VAL J  1 43  ? -54.460 -20.707 34.173  1.00 0.00 ? 49  VAL J CG2   1 
ATOM 9100  N N     . PRO J  1 44  ? -56.111 -22.096 38.209  1.00 0.00 ? 50  PRO J N     1 
ATOM 9101  C CA    . PRO J  1 44  ? -56.432 -23.049 39.273  1.00 0.00 ? 50  PRO J CA    1 
ATOM 9102  C C     . PRO J  1 44  ? -57.946 -23.257 39.420  1.00 0.00 ? 50  PRO J C     1 
ATOM 9103  O O     . PRO J  1 44  ? -58.393 -24.303 39.893  1.00 0.00 ? 50  PRO J O     1 
ATOM 9104  C CB    . PRO J  1 44  ? -55.870 -22.384 40.513  1.00 0.00 ? 50  PRO J CB    1 
ATOM 9105  C CG    . PRO J  1 44  ? -56.030 -20.932 40.264  1.00 0.00 ? 50  PRO J CG    1 
ATOM 9106  C CD    . PRO J  1 44  ? -55.936 -20.748 38.778  1.00 0.00 ? 50  PRO J CD    1 
ATOM 9107  N N     . LYS J  1 45  ? -58.726 -22.279 38.961  1.00 0.00 ? 51  LYS J N     1 
ATOM 9108  C CA    . LYS J  1 45  ? -60.170 -22.354 38.961  1.00 0.00 ? 51  LYS J CA    1 
ATOM 9109  C C     . LYS J  1 45  ? -60.656 -23.517 38.124  1.00 0.00 ? 51  LYS J C     1 
ATOM 9110  O O     . LYS J  1 45  ? -61.623 -24.185 38.476  1.00 0.00 ? 51  LYS J O     1 
ATOM 9111  C CB    . LYS J  1 45  ? -60.746 -21.070 38.396  1.00 0.00 ? 51  LYS J CB    1 
ATOM 9112  C CG    . LYS J  1 45  ? -60.557 -19.846 39.266  1.00 0.00 ? 51  LYS J CG    1 
ATOM 9113  C CD    . LYS J  1 45  ? -61.064 -18.599 38.555  1.00 0.00 ? 51  LYS J CD    1 
ATOM 9114  C CE    . LYS J  1 45  ? -60.876 -17.357 39.402  1.00 0.00 ? 51  LYS J CE    1 
ATOM 9115  N NZ    . LYS J  1 45  ? -61.228 -16.122 38.656  1.00 0.00 ? 51  LYS J NZ    1 
ATOM 9116  N N     . PHE J  1 46  ? -59.982 -23.754 37.009  1.00 0.00 ? 52  PHE J N     1 
ATOM 9117  C CA    . PHE J  1 46  ? -60.361 -24.803 36.093  1.00 0.00 ? 52  PHE J CA    1 
ATOM 9118  C C     . PHE J  1 46  ? -59.685 -26.098 36.440  1.00 0.00 ? 52  PHE J C     1 
ATOM 9119  O O     . PHE J  1 46  ? -60.205 -27.172 36.146  1.00 0.00 ? 52  PHE J O     1 
ATOM 9120  C CB    . PHE J  1 46  ? -60.013 -24.400 34.682  1.00 0.00 ? 52  PHE J CB    1 
ATOM 9121  C CG    . PHE J  1 46  ? -60.840 -23.269 34.198  1.00 0.00 ? 52  PHE J CG    1 
ATOM 9122  C CD1   . PHE J  1 46  ? -60.450 -21.979 34.457  1.00 0.00 ? 52  PHE J CD1   1 
ATOM 9123  C CD2   . PHE J  1 46  ? -62.004 -23.483 33.490  1.00 0.00 ? 52  PHE J CD2   1 
ATOM 9124  C CE1   . PHE J  1 46  ? -61.206 -20.914 34.027  1.00 0.00 ? 52  PHE J CE1   1 
ATOM 9125  C CE2   . PHE J  1 46  ? -62.760 -22.423 33.047  1.00 0.00 ? 52  PHE J CE2   1 
ATOM 9126  C CZ    . PHE J  1 46  ? -62.363 -21.136 33.320  1.00 0.00 ? 52  PHE J CZ    1 
ATOM 9127  N N     . THR J  1 47  ? -58.537 -26.014 37.090  1.00 0.00 ? 53  THR J N     1 
ATOM 9128  C CA    . THR J  1 47  ? -57.866 -27.217 37.522  1.00 0.00 ? 53  THR J CA    1 
ATOM 9129  C C     . THR J  1 47  ? -58.719 -27.965 38.520  1.00 0.00 ? 53  THR J C     1 
ATOM 9130  O O     . THR J  1 47  ? -58.839 -29.188 38.452  1.00 0.00 ? 53  THR J O     1 
ATOM 9131  C CB    . THR J  1 47  ? -56.515 -26.927 38.139  1.00 0.00 ? 53  THR J CB    1 
ATOM 9132  O OG1   . THR J  1 47  ? -55.667 -26.293 37.176  1.00 0.00 ? 53  THR J OG1   1 
ATOM 9133  C CG2   . THR J  1 47  ? -55.886 -28.224 38.589  1.00 0.00 ? 53  THR J CG2   1 
ATOM 9134  N N     . SER J  1 48  ? -59.331 -27.226 39.446  1.00 0.00 ? 54  SER J N     1 
ATOM 9135  C CA    . SER J  1 48  ? -60.203 -27.839 40.432  1.00 0.00 ? 54  SER J CA    1 
ATOM 9136  C C     . SER J  1 48  ? -61.403 -28.491 39.770  1.00 0.00 ? 54  SER J C     1 
ATOM 9137  O O     . SER J  1 48  ? -61.883 -29.533 40.226  1.00 0.00 ? 54  SER J O     1 
ATOM 9138  C CB    . SER J  1 48  ? -60.688 -26.801 41.411  1.00 0.00 ? 54  SER J CB    1 
ATOM 9139  O OG    . SER J  1 48  ? -61.552 -25.893 40.786  1.00 0.00 ? 54  SER J OG    1 
ATOM 9140  N N     . VAL J  1 49  ? -61.843 -27.917 38.656  1.00 0.00 ? 55  VAL J N     1 
ATOM 9141  C CA    . VAL J  1 49  ? -62.931 -28.486 37.896  1.00 0.00 ? 55  VAL J CA    1 
ATOM 9142  C C     . VAL J  1 49  ? -62.522 -29.804 37.336  1.00 0.00 ? 55  VAL J C     1 
ATOM 9143  O O     . VAL J  1 49  ? -63.254 -30.779 37.433  1.00 0.00 ? 55  VAL J O     1 
ATOM 9144  C CB    . VAL J  1 49  ? -63.352 -27.555 36.745  1.00 0.00 ? 55  VAL J CB    1 
ATOM 9145  C CG1   . VAL J  1 49  ? -64.341 -28.257 35.839  1.00 0.00 ? 55  VAL J CG1   1 
ATOM 9146  C CG2   . VAL J  1 49  ? -63.962 -26.295 37.307  1.00 0.00 ? 55  VAL J CG2   1 
ATOM 9147  N N     . ASN J  1 50  ? -61.327 -29.851 36.775  1.00 0.00 ? 56  ASN J N     1 
ATOM 9148  C CA    . ASN J  1 50  ? -60.827 -31.060 36.179  1.00 0.00 ? 56  ASN J CA    1 
ATOM 9149  C C     . ASN J  1 50  ? -60.760 -32.191 37.169  1.00 0.00 ? 56  ASN J C     1 
ATOM 9150  O O     . ASN J  1 50  ? -61.109 -33.314 36.835  1.00 0.00 ? 56  ASN J O     1 
ATOM 9151  C CB    . ASN J  1 50  ? -59.482 -30.822 35.565  1.00 0.00 ? 56  ASN J CB    1 
ATOM 9152  C CG    . ASN J  1 50  ? -59.586 -30.026 34.319  1.00 0.00 ? 56  ASN J CG    1 
ATOM 9153  O OD1   . ASN J  1 50  ? -60.658 -29.973 33.713  1.00 0.00 ? 56  ASN J OD1   1 
ATOM 9154  N ND2   . ASN J  1 50  ? -58.508 -29.406 33.918  1.00 0.00 ? 56  ASN J ND2   1 
ATOM 9155  N N     . GLU J  1 51  ? -60.334 -31.907 38.399  1.00 0.00 ? 57  GLU J N     1 
ATOM 9156  C CA    . GLU J  1 51  ? -60.264 -32.963 39.406  1.00 0.00 ? 57  GLU J CA    1 
ATOM 9157  C C     . GLU J  1 51  ? -61.640 -33.534 39.700  1.00 0.00 ? 57  GLU J C     1 
ATOM 9158  O O     . GLU J  1 51  ? -61.834 -34.750 39.645  1.00 0.00 ? 57  GLU J O     1 
ATOM 9159  C CB    . GLU J  1 51  ? -59.617 -32.473 40.717  1.00 0.00 ? 57  GLU J CB    1 
ATOM 9160  C CG    . GLU J  1 51  ? -59.466 -33.585 41.780  1.00 0.00 ? 57  GLU J CG    1 
ATOM 9161  C CD    . GLU J  1 51  ? -58.742 -33.167 43.058  1.00 0.00 ? 57  GLU J CD    1 
ATOM 9162  O OE1   . GLU J  1 51  ? -58.443 -32.008 43.214  1.00 0.00 ? 57  GLU J OE1   1 
ATOM 9163  O OE2   . GLU J  1 51  ? -58.474 -34.029 43.863  1.00 0.00 ? 57  GLU J OE2   1 
ATOM 9164  N N     . ASN J  1 52  ? -62.595 -32.666 40.021  1.00 0.00 ? 58  ASN J N     1 
ATOM 9165  C CA    . ASN J  1 52  ? -63.922 -33.139 40.381  1.00 0.00 ? 58  ASN J CA    1 
ATOM 9166  C C     . ASN J  1 52  ? -64.645 -33.787 39.218  1.00 0.00 ? 58  ASN J C     1 
ATOM 9167  O O     . ASN J  1 52  ? -65.246 -34.846 39.377  1.00 0.00 ? 58  ASN J O     1 
ATOM 9168  C CB    . ASN J  1 52  ? -64.757 -32.027 40.958  1.00 0.00 ? 58  ASN J CB    1 
ATOM 9169  C CG    . ASN J  1 52  ? -64.367 -31.665 42.361  1.00 0.00 ? 58  ASN J CG    1 
ATOM 9170  O OD1   . ASN J  1 52  ? -63.629 -32.399 43.024  1.00 0.00 ? 58  ASN J OD1   1 
ATOM 9171  N ND2   . ASN J  1 52  ? -64.874 -30.558 42.836  1.00 0.00 ? 58  ASN J ND2   1 
ATOM 9172  N N     . VAL J  1 53  ? -64.571 -33.171 38.049  1.00 0.00 ? 59  VAL J N     1 
ATOM 9173  C CA    . VAL J  1 53  ? -65.227 -33.714 36.877  1.00 0.00 ? 59  VAL J CA    1 
ATOM 9174  C C     . VAL J  1 53  ? -64.662 -35.051 36.517  1.00 0.00 ? 59  VAL J C     1 
ATOM 9175  O O     . VAL J  1 53  ? -65.404 -35.971 36.185  1.00 0.00 ? 59  VAL J O     1 
ATOM 9176  C CB    . VAL J  1 53  ? -65.096 -32.767 35.680  1.00 0.00 ? 59  VAL J CB    1 
ATOM 9177  C CG1   . VAL J  1 53  ? -65.579 -33.455 34.417  1.00 0.00 ? 59  VAL J CG1   1 
ATOM 9178  C CG2   . VAL J  1 53  ? -65.921 -31.518 35.935  1.00 0.00 ? 59  VAL J CG2   1 
ATOM 9179  N N     . SER J  1 54  ? -63.349 -35.169 36.580  1.00 0.00 ? 60  SER J N     1 
ATOM 9180  C CA    . SER J  1 54  ? -62.698 -36.412 36.274  1.00 0.00 ? 60  SER J CA    1 
ATOM 9181  C C     . SER J  1 54  ? -63.186 -37.496 37.206  1.00 0.00 ? 60  SER J C     1 
ATOM 9182  O O     . SER J  1 54  ? -63.488 -38.603 36.770  1.00 0.00 ? 60  SER J O     1 
ATOM 9183  C CB    . SER J  1 54  ? -61.208 -36.258 36.393  1.00 0.00 ? 60  SER J CB    1 
ATOM 9184  O OG    . SER J  1 54  ? -60.545 -37.420 35.994  1.00 0.00 ? 60  SER J OG    1 
ATOM 9185  N N     . ALA J  1 55  ? -63.281 -37.175 38.493  1.00 0.00 ? 61  ALA J N     1 
ATOM 9186  C CA    . ALA J  1 55  ? -63.755 -38.135 39.476  1.00 0.00 ? 61  ALA J CA    1 
ATOM 9187  C C     . ALA J  1 55  ? -65.124 -38.652 39.103  1.00 0.00 ? 61  ALA J C     1 
ATOM 9188  O O     . ALA J  1 55  ? -65.370 -39.857 39.143  1.00 0.00 ? 61  ALA J O     1 
ATOM 9189  C CB    . ALA J  1 55  ? -63.794 -37.505 40.851  1.00 0.00 ? 61  ALA J CB    1 
ATOM 9190  N N     . VAL J  1 56  ? -66.003 -37.747 38.702  1.00 0.00 ? 62  VAL J N     1 
ATOM 9191  C CA    . VAL J  1 56  ? -67.335 -38.119 38.277  1.00 0.00 ? 62  VAL J CA    1 
ATOM 9192  C C     . VAL J  1 56  ? -67.307 -39.058 37.114  1.00 0.00 ? 62  VAL J C     1 
ATOM 9193  O O     . VAL J  1 56  ? -68.003 -40.069 37.110  1.00 0.00 ? 62  VAL J O     1 
ATOM 9194  C CB    . VAL J  1 56  ? -68.129 -36.885 37.893  1.00 0.00 ? 62  VAL J CB    1 
ATOM 9195  C CG1   . VAL J  1 56  ? -69.419 -37.278 37.217  1.00 0.00 ? 62  VAL J CG1   1 
ATOM 9196  C CG2   . VAL J  1 56  ? -68.414 -36.085 39.129  1.00 0.00 ? 62  VAL J CG2   1 
ATOM 9197  N N     . LEU J  1 57  ? -66.489 -38.743 36.134  1.00 0.00 ? 63  LEU J N     1 
ATOM 9198  C CA    . LEU J  1 57  ? -66.401 -39.543 34.943  1.00 0.00 ? 63  LEU J CA    1 
ATOM 9199  C C     . LEU J  1 57  ? -65.950 -40.948 35.262  1.00 0.00 ? 63  LEU J C     1 
ATOM 9200  O O     . LEU J  1 57  ? -66.435 -41.908 34.670  1.00 0.00 ? 63  LEU J O     1 
ATOM 9201  C CB    . LEU J  1 57  ? -65.463 -38.877 33.965  1.00 0.00 ? 63  LEU J CB    1 
ATOM 9202  C CG    . LEU J  1 57  ? -65.997 -37.569 33.394  1.00 0.00 ? 63  LEU J CG    1 
ATOM 9203  C CD1   . LEU J  1 57  ? -64.924 -36.894 32.566  1.00 0.00 ? 63  LEU J CD1   1 
ATOM 9204  C CD2   . LEU J  1 57  ? -67.228 -37.863 32.571  1.00 0.00 ? 63  LEU J CD2   1 
ATOM 9205  N N     . THR J  1 58  ? -65.067 -41.084 36.240  1.00 0.00 ? 64  THR J N     1 
ATOM 9206  C CA    . THR J  1 58  ? -64.654 -42.400 36.686  1.00 0.00 ? 64  THR J CA    1 
ATOM 9207  C C     . THR J  1 58  ? -65.815 -43.152 37.311  1.00 0.00 ? 64  THR J C     1 
ATOM 9208  O O     . THR J  1 58  ? -66.010 -44.336 37.044  1.00 0.00 ? 64  THR J O     1 
ATOM 9209  C CB    . THR J  1 58  ? -63.474 -42.314 37.645  1.00 0.00 ? 64  THR J CB    1 
ATOM 9210  O OG1   . THR J  1 58  ? -62.354 -41.753 36.942  1.00 0.00 ? 64  THR J OG1   1 
ATOM 9211  C CG2   . THR J  1 58  ? -63.110 -43.693 38.169  1.00 0.00 ? 64  THR J CG2   1 
ATOM 9212  N N     . GLN J  1 59  ? -66.624 -42.456 38.097  1.00 0.00 ? 65  GLN J N     1 
ATOM 9213  C CA    . GLN J  1 59  ? -67.812 -43.072 38.687  1.00 0.00 ? 65  GLN J CA    1 
ATOM 9214  C C     . GLN J  1 59  ? -68.850 -43.469 37.621  1.00 0.00 ? 65  GLN J C     1 
ATOM 9215  O O     . GLN J  1 59  ? -69.596 -44.427 37.805  1.00 0.00 ? 65  GLN J O     1 
ATOM 9216  C CB    . GLN J  1 59  ? -68.445 -42.146 39.707  1.00 0.00 ? 65  GLN J CB    1 
ATOM 9217  C CG    . GLN J  1 59  ? -67.624 -41.962 40.969  1.00 0.00 ? 65  GLN J CG    1 
ATOM 9218  C CD    . GLN J  1 59  ? -67.485 -43.254 41.764  1.00 0.00 ? 65  GLN J CD    1 
ATOM 9219  O OE1   . GLN J  1 59  ? -68.418 -44.059 41.823  1.00 0.00 ? 65  GLN J OE1   1 
ATOM 9220  N NE2   . GLN J  1 59  ? -66.330 -43.451 42.392  1.00 0.00 ? 65  GLN J NE2   1 
ATOM 9221  N N     . TYR J  1 60  ? -68.875 -42.747 36.501  1.00 0.00 ? 66  TYR J N     1 
ATOM 9222  C CA    . TYR J  1 60  ? -69.751 -43.106 35.386  1.00 0.00 ? 66  TYR J CA    1 
ATOM 9223  C C     . TYR J  1 60  ? -69.129 -44.086 34.400  1.00 0.00 ? 66  TYR J C     1 
ATOM 9224  O O     . TYR J  1 60  ? -69.751 -44.427 33.398  1.00 0.00 ? 66  TYR J O     1 
ATOM 9225  C CB    . TYR J  1 60  ? -70.213 -41.873 34.641  1.00 0.00 ? 66  TYR J CB    1 
ATOM 9226  C CG    . TYR J  1 60  ? -71.398 -41.201 35.260  1.00 0.00 ? 66  TYR J CG    1 
ATOM 9227  C CD1   . TYR J  1 60  ? -71.236 -40.215 36.200  1.00 0.00 ? 66  TYR J CD1   1 
ATOM 9228  C CD2   . TYR J  1 60  ? -72.667 -41.569 34.854  1.00 0.00 ? 66  TYR J CD2   1 
ATOM 9229  C CE1   . TYR J  1 60  ? -72.340 -39.594 36.741  1.00 0.00 ? 66  TYR J CE1   1 
ATOM 9230  C CE2   . TYR J  1 60  ? -73.773 -40.947 35.388  1.00 0.00 ? 66  TYR J CE2   1 
ATOM 9231  C CZ    . TYR J  1 60  ? -73.612 -39.960 36.327  1.00 0.00 ? 66  TYR J CZ    1 
ATOM 9232  O OH    . TYR J  1 60  ? -74.713 -39.333 36.859  1.00 0.00 ? 66  TYR J OH    1 
ATOM 9233  N N     . GLY J  1 61  ? -67.908 -44.532 34.658  1.00 0.00 ? 67  GLY J N     1 
ATOM 9234  C CA    . GLY J  1 61  ? -67.292 -45.531 33.798  1.00 0.00 ? 67  GLY J CA    1 
ATOM 9235  C C     . GLY J  1 61  ? -66.787 -44.966 32.474  1.00 0.00 ? 67  GLY J C     1 
ATOM 9236  O O     . GLY J  1 61  ? -66.542 -45.719 31.530  1.00 0.00 ? 67  GLY J O     1 
ATOM 9237  N N     . ILE J  1 62  ? -66.608 -43.653 32.411  1.00 0.00 ? 68  ILE J N     1 
ATOM 9238  C CA    . ILE J  1 62  ? -66.204 -42.997 31.178  1.00 0.00 ? 68  ILE J CA    1 
ATOM 9239  C C     . ILE J  1 62  ? -64.701 -43.066 31.003  1.00 0.00 ? 68  ILE J C     1 
ATOM 9240  O O     . ILE J  1 62  ? -63.952 -42.713 31.910  1.00 0.00 ? 68  ILE J O     1 
ATOM 9241  C CB    . ILE J  1 62  ? -66.645 -41.531 31.178  1.00 0.00 ? 68  ILE J CB    1 
ATOM 9242  C CG1   . ILE J  1 62  ? -68.146 -41.428 31.419  1.00 0.00 ? 68  ILE J CG1   1 
ATOM 9243  C CG2   . ILE J  1 62  ? -66.292 -40.886 29.865  1.00 0.00 ? 68  ILE J CG2   1 
ATOM 9244  C CD1   . ILE J  1 62  ? -68.977 -42.135 30.383  1.00 0.00 ? 68  ILE J CD1   1 
ATOM 9245  N N     . THR J  1 63  ? -64.258 -43.539 29.846  1.00 0.00 ? 69  THR J N     1 
ATOM 9246  C CA    . THR J  1 63  ? -62.828 -43.687 29.588  1.00 0.00 ? 69  THR J CA    1 
ATOM 9247  C C     . THR J  1 63  ? -62.395 -43.037 28.287  1.00 0.00 ? 69  THR J C     1 
ATOM 9248  O O     . THR J  1 63  ? -63.209 -42.786 27.399  1.00 0.00 ? 69  THR J O     1 
ATOM 9249  C CB    . THR J  1 63  ? -62.446 -45.142 29.510  1.00 0.00 ? 69  THR J CB    1 
ATOM 9250  O OG1   . THR J  1 63  ? -63.128 -45.710 28.399  1.00 0.00 ? 69  THR J OG1   1 
ATOM 9251  C CG2   . THR J  1 63  ? -62.823 -45.889 30.778  1.00 0.00 ? 69  THR J CG2   1 
ATOM 9252  N N     . GLY J  1 64  ? -61.097 -42.832 28.159  1.00 0.00 ? 70  GLY J N     1 
ATOM 9253  C CA    . GLY J  1 64  ? -60.517 -42.322 26.937  1.00 0.00 ? 70  GLY J CA    1 
ATOM 9254  C C     . GLY J  1 64  ? -61.026 -40.942 26.594  1.00 0.00 ? 70  GLY J C     1 
ATOM 9255  O O     . GLY J  1 64  ? -61.381 -40.156 27.472  1.00 0.00 ? 70  GLY J O     1 
ATOM 9256  N N     . PRO J  1 65  ? -61.099 -40.657 25.307  1.00 0.00 ? 71  PRO J N     1 
ATOM 9257  C CA    . PRO J  1 65  ? -61.530 -39.416 24.711  1.00 0.00 ? 71  PRO J CA    1 
ATOM 9258  C C     . PRO J  1 65  ? -62.938 -39.072 25.093  1.00 0.00 ? 71  PRO J C     1 
ATOM 9259  O O     . PRO J  1 65  ? -63.342 -37.919 24.991  1.00 0.00 ? 71  PRO J O     1 
ATOM 9260  C CB    . PRO J  1 65  ? -61.353 -39.658 23.234  1.00 0.00 ? 71  PRO J CB    1 
ATOM 9261  C CG    . PRO J  1 65  ? -60.169 -40.574 23.156  1.00 0.00 ? 71  PRO J CG    1 
ATOM 9262  C CD    . PRO J  1 65  ? -60.251 -41.431 24.384  1.00 0.00 ? 71  PRO J CD    1 
ATOM 9263  N N     . ASN J  1 66  ? -63.695 -40.053 25.557  1.00 0.00 ? 72  ASN J N     1 
ATOM 9264  C CA    . ASN J  1 66  ? -65.032 -39.778 25.985  1.00 0.00 ? 72  ASN J CA    1 
ATOM 9265  C C     . ASN J  1 66  ? -65.001 -38.916 27.217  1.00 0.00 ? 72  ASN J C     1 
ATOM 9266  O O     . ASN J  1 66  ? -65.874 -38.074 27.411  1.00 0.00 ? 72  ASN J O     1 
ATOM 9267  C CB    . ASN J  1 66  ? -65.774 -41.051 26.223  1.00 0.00 ? 72  ASN J CB    1 
ATOM 9268  C CG    . ASN J  1 66  ? -66.087 -41.741 24.943  1.00 0.00 ? 72  ASN J CG    1 
ATOM 9269  O OD1   . ASN J  1 66  ? -66.362 -41.090 23.933  1.00 0.00 ? 72  ASN J OD1   1 
ATOM 9270  N ND2   . ASN J  1 66  ? -66.023 -43.043 24.949  1.00 0.00 ? 72  ASN J ND2   1 
ATOM 9271  N N     . ARG J  1 67  ? -63.966 -39.088 28.035  1.00 0.00 ? 73  ARG J N     1 
ATOM 9272  C CA    . ARG J  1 67  ? -63.811 -38.265 29.206  1.00 0.00 ? 73  ARG J CA    1 
ATOM 9273  C C     . ARG J  1 67  ? -63.539 -36.877 28.764  1.00 0.00 ? 73  ARG J C     1 
ATOM 9274  O O     . ARG J  1 67  ? -64.117 -35.927 29.284  1.00 0.00 ? 73  ARG J O     1 
ATOM 9275  C CB    . ARG J  1 67  ? -62.661 -38.733 30.063  1.00 0.00 ? 73  ARG J CB    1 
ATOM 9276  C CG    . ARG J  1 67  ? -62.843 -40.086 30.687  1.00 0.00 ? 73  ARG J CG    1 
ATOM 9277  C CD    . ARG J  1 67  ? -61.647 -40.497 31.432  1.00 0.00 ? 73  ARG J CD    1 
ATOM 9278  N NE    . ARG J  1 67  ? -61.518 -39.810 32.704  1.00 0.00 ? 73  ARG J NE    1 
ATOM 9279  C CZ    . ARG J  1 67  ? -61.962 -40.305 33.876  1.00 0.00 ? 73  ARG J CZ    1 
ATOM 9280  N NH1   . ARG J  1 67  ? -62.577 -41.455 33.933  1.00 0.00 ? 73  ARG J NH1   1 
ATOM 9281  N NH2   . ARG J  1 67  ? -61.769 -39.657 35.000  1.00 0.00 ? 73  ARG J NH2   1 
ATOM 9282  N N     . ALA J  1 68  ? -62.689 -36.762 27.745  1.00 0.00 ? 74  ALA J N     1 
ATOM 9283  C CA    . ALA J  1 68  ? -62.310 -35.469 27.194  1.00 0.00 ? 74  ALA J CA    1 
ATOM 9284  C C     . ALA J  1 68  ? -63.505 -34.705 26.671  1.00 0.00 ? 74  ALA J C     1 
ATOM 9285  O O     . ALA J  1 68  ? -63.549 -33.484 26.781  1.00 0.00 ? 74  ALA J O     1 
ATOM 9286  C CB    . ALA J  1 68  ? -61.296 -35.642 26.101  1.00 0.00 ? 74  ALA J CB    1 
ATOM 9287  N N     . ILE J  1 69  ? -64.491 -35.412 26.130  1.00 0.00 ? 75  ILE J N     1 
ATOM 9288  C CA    . ILE J  1 69  ? -65.705 -34.754 25.682  1.00 0.00 ? 75  ILE J CA    1 
ATOM 9289  C C     . ILE J  1 69  ? -66.349 -34.020 26.820  1.00 0.00 ? 75  ILE J C     1 
ATOM 9290  O O     . ILE J  1 69  ? -66.721 -32.850 26.694  1.00 0.00 ? 75  ILE J O     1 
ATOM 9291  C CB    . ILE J  1 69  ? -66.723 -35.749 25.122  1.00 0.00 ? 75  ILE J CB    1 
ATOM 9292  C CG1   . ILE J  1 69  ? -66.222 -36.345 23.826  1.00 0.00 ? 75  ILE J CG1   1 
ATOM 9293  C CG2   . ILE J  1 69  ? -68.061 -35.065 24.919  1.00 0.00 ? 75  ILE J CG2   1 
ATOM 9294  C CD1   . ILE J  1 69  ? -67.027 -37.521 23.348  1.00 0.00 ? 75  ILE J CD1   1 
ATOM 9295  N N     . TYR J  1 70  ? -66.473 -34.700 27.940  1.00 0.00 ? 76  TYR J N     1 
ATOM 9296  C CA    . TYR J  1 70  ? -67.126 -34.126 29.085  1.00 0.00 ? 76  TYR J CA    1 
ATOM 9297  C C     . TYR J  1 70  ? -66.249 -33.106 29.777  1.00 0.00 ? 76  TYR J C     1 
ATOM 9298  O O     . TYR J  1 70  ? -66.752 -32.145 30.350  1.00 0.00 ? 76  TYR J O     1 
ATOM 9299  C CB    . TYR J  1 70  ? -67.538 -35.217 30.025  1.00 0.00 ? 76  TYR J CB    1 
ATOM 9300  C CG    . TYR J  1 70  ? -68.535 -36.131 29.392  1.00 0.00 ? 76  TYR J CG    1 
ATOM 9301  C CD1   . TYR J  1 70  ? -68.201 -37.440 29.152  1.00 0.00 ? 76  TYR J CD1   1 
ATOM 9302  C CD2   . TYR J  1 70  ? -69.764 -35.646 29.000  1.00 0.00 ? 76  TYR J CD2   1 
ATOM 9303  C CE1   . TYR J  1 70  ? -69.090 -38.274 28.521  1.00 0.00 ? 76  TYR J CE1   1 
ATOM 9304  C CE2   . TYR J  1 70  ? -70.661 -36.476 28.367  1.00 0.00 ? 76  TYR J CE2   1 
ATOM 9305  C CZ    . TYR J  1 70  ? -70.321 -37.787 28.124  1.00 0.00 ? 76  TYR J CZ    1 
ATOM 9306  O OH    . TYR J  1 70  ? -71.196 -38.619 27.479  1.00 0.00 ? 76  TYR J OH    1 
ATOM 9307  N N     . GLN J  1 71  ? -64.936 -33.279 29.685  1.00 0.00 ? 77  GLN J N     1 
ATOM 9308  C CA    . GLN J  1 71  ? -64.026 -32.305 30.243  1.00 0.00 ? 77  GLN J CA    1 
ATOM 9309  C C     . GLN J  1 71  ? -64.152 -31.003 29.505  1.00 0.00 ? 77  GLN J C     1 
ATOM 9310  O O     . GLN J  1 71  ? -64.216 -29.945 30.118  1.00 0.00 ? 77  GLN J O     1 
ATOM 9311  C CB    . GLN J  1 71  ? -62.580 -32.797 30.175  1.00 0.00 ? 77  GLN J CB    1 
ATOM 9312  C CG    . GLN J  1 71  ? -62.254 -33.939 31.113  1.00 0.00 ? 77  GLN J CG    1 
ATOM 9313  C CD    . GLN J  1 71  ? -62.382 -33.530 32.548  1.00 0.00 ? 77  GLN J CD    1 
ATOM 9314  O OE1   . GLN J  1 71  ? -62.890 -32.445 32.835  1.00 0.00 ? 77  GLN J OE1   1 
ATOM 9315  N NE2   . GLN J  1 71  ? -61.917 -34.372 33.465  1.00 0.00 ? 77  GLN J NE2   1 
ATOM 9316  N N     . GLY J  1 72  ? -64.246 -31.079 28.180  1.00 0.00 ? 78  GLY J N     1 
ATOM 9317  C CA    . GLY J  1 72  ? -64.416 -29.892 27.357  1.00 0.00 ? 78  GLY J CA    1 
ATOM 9318  C C     . GLY J  1 72  ? -65.697 -29.181 27.722  1.00 0.00 ? 78  GLY J C     1 
ATOM 9319  O O     . GLY J  1 72  ? -65.713 -27.963 27.903  1.00 0.00 ? 78  GLY J O     1 
ATOM 9320  N N     . PHE J  1 73  ? -66.763 -29.948 27.854  1.00 0.00 ? 79  PHE J N     1 
ATOM 9321  C CA    . PHE J  1 73  ? -68.039 -29.413 28.248  1.00 0.00 ? 79  PHE J CA    1 
ATOM 9322  C C     . PHE J  1 73  ? -67.961 -28.709 29.583  1.00 0.00 ? 79  PHE J C     1 
ATOM 9323  O O     . PHE J  1 73  ? -68.371 -27.559 29.701  1.00 0.00 ? 79  PHE J O     1 
ATOM 9324  C CB    . PHE J  1 73  ? -69.060 -30.523 28.311  1.00 0.00 ? 79  PHE J CB    1 
ATOM 9325  C CG    . PHE J  1 73  ? -70.357 -30.119 28.919  1.00 0.00 ? 79  PHE J CG    1 
ATOM 9326  C CD1   . PHE J  1 73  ? -71.272 -29.361 28.221  1.00 0.00 ? 79  PHE J CD1   1 
ATOM 9327  C CD2   . PHE J  1 73  ? -70.669 -30.522 30.199  1.00 0.00 ? 79  PHE J CD2   1 
ATOM 9328  C CE1   . PHE J  1 73  ? -72.478 -29.019 28.795  1.00 0.00 ? 79  PHE J CE1   1 
ATOM 9329  C CE2   . PHE J  1 73  ? -71.866 -30.183 30.774  1.00 0.00 ? 79  PHE J CE2   1 
ATOM 9330  C CZ    . PHE J  1 73  ? -72.773 -29.429 30.070  1.00 0.00 ? 79  PHE J CZ    1 
ATOM 9331  N N     . GLY J  1 74  ? -67.435 -29.398 30.586  1.00 0.00 ? 80  GLY J N     1 
ATOM 9332  C CA    . GLY J  1 74  ? -67.342 -28.855 31.929  1.00 0.00 ? 80  GLY J CA    1 
ATOM 9333  C C     . GLY J  1 74  ? -66.526 -27.590 31.970  1.00 0.00 ? 80  GLY J C     1 
ATOM 9334  O O     . GLY J  1 74  ? -66.927 -26.603 32.581  1.00 0.00 ? 80  GLY J O     1 
ATOM 9335  N N     . LEU J  1 75  ? -65.396 -27.601 31.306  1.00 0.00 ? 81  LEU J N     1 
ATOM 9336  C CA    . LEU J  1 75  ? -64.536 -26.448 31.279  1.00 0.00 ? 81  LEU J CA    1 
ATOM 9337  C C     . LEU J  1 75  ? -65.235 -25.258 30.660  1.00 0.00 ? 81  LEU J C     1 
ATOM 9338  O O     . LEU J  1 75  ? -65.100 -24.134 31.137  1.00 0.00 ? 81  LEU J O     1 
ATOM 9339  C CB    . LEU J  1 75  ? -63.281 -26.774 30.499  1.00 0.00 ? 81  LEU J CB    1 
ATOM 9340  C CG    . LEU J  1 75  ? -62.330 -27.749 31.171  1.00 0.00 ? 81  LEU J CG    1 
ATOM 9341  C CD1   . LEU J  1 75  ? -61.255 -28.156 30.181  1.00 0.00 ? 81  LEU J CD1   1 
ATOM 9342  C CD2   . LEU J  1 75  ? -61.726 -27.084 32.388  1.00 0.00 ? 81  LEU J CD2   1 
ATOM 9343  N N     . LYS J  1 76  ? -66.007 -25.509 29.615  1.00 0.00 ? 82  LYS J N     1 
ATOM 9344  C CA    . LYS J  1 76  ? -66.738 -24.460 28.946  1.00 0.00 ? 82  LYS J CA    1 
ATOM 9345  C C     . LYS J  1 76  ? -67.834 -23.901 29.838  1.00 0.00 ? 82  LYS J C     1 
ATOM 9346  O O     . LYS J  1 76  ? -68.077 -22.697 29.843  1.00 0.00 ? 82  LYS J O     1 
ATOM 9347  C CB    . LYS J  1 76  ? -67.285 -24.976 27.632  1.00 0.00 ? 82  LYS J CB    1 
ATOM 9348  C CG    . LYS J  1 76  ? -67.945 -23.933 26.762  1.00 0.00 ? 82  LYS J CG    1 
ATOM 9349  C CD    . LYS J  1 76  ? -68.120 -24.462 25.351  1.00 0.00 ? 82  LYS J CD    1 
ATOM 9350  C CE    . LYS J  1 76  ? -68.960 -23.530 24.509  1.00 0.00 ? 82  LYS J CE    1 
ATOM 9351  N NZ    . LYS J  1 76  ? -68.256 -22.279 24.187  1.00 0.00 ? 82  LYS J NZ    1 
ATOM 9352  N N     . VAL J  1 77  ? -68.465 -24.769 30.627  1.00 0.00 ? 83  VAL J N     1 
ATOM 9353  C CA    . VAL J  1 77  ? -69.449 -24.314 31.596  1.00 0.00 ? 83  VAL J CA    1 
ATOM 9354  C C     . VAL J  1 77  ? -68.814 -23.361 32.584  1.00 0.00 ? 83  VAL J C     1 
ATOM 9355  O O     . VAL J  1 77  ? -69.351 -22.290 32.866  1.00 0.00 ? 83  VAL J O     1 
ATOM 9356  C CB    . VAL J  1 77  ? -70.067 -25.501 32.365  1.00 0.00 ? 83  VAL J CB    1 
ATOM 9357  C CG1   . VAL J  1 77  ? -70.903 -24.993 33.521  1.00 0.00 ? 83  VAL J CG1   1 
ATOM 9358  C CG2   . VAL J  1 77  ? -70.923 -26.338 31.437  1.00 0.00 ? 83  VAL J CG2   1 
ATOM 9359  N N     . ALA J  1 78  ? -67.657 -23.755 33.103  1.00 0.00 ? 84  ALA J N     1 
ATOM 9360  C CA    . ALA J  1 78  ? -66.932 -22.949 34.063  1.00 0.00 ? 84  ALA J CA    1 
ATOM 9361  C C     . ALA J  1 78  ? -66.504 -21.619 33.458  1.00 0.00 ? 84  ALA J C     1 
ATOM 9362  O O     . ALA J  1 78  ? -66.566 -20.587 34.119  1.00 0.00 ? 84  ALA J O     1 
ATOM 9363  C CB    . ALA J  1 78  ? -65.732 -23.711 34.575  1.00 0.00 ? 84  ALA J CB    1 
ATOM 9364  N N     . ARG J  1 79  ? -66.084 -21.643 32.196  1.00 0.00 ? 85  ARG J N     1 
ATOM 9365  C CA    . ARG J  1 79  ? -65.733 -20.419 31.500  1.00 0.00 ? 85  ARG J CA    1 
ATOM 9366  C C     . ARG J  1 79  ? -66.842 -19.414 31.546  1.00 0.00 ? 85  ARG J C     1 
ATOM 9367  O O     . ARG J  1 79  ? -66.631 -18.258 31.917  1.00 0.00 ? 85  ARG J O     1 
ATOM 9368  C CB    . ARG J  1 79  ? -65.418 -20.682 30.060  1.00 0.00 ? 85  ARG J CB    1 
ATOM 9369  C CG    . ARG J  1 79  ? -65.213 -19.419 29.258  1.00 0.00 ? 85  ARG J CG    1 
ATOM 9370  C CD    . ARG J  1 79  ? -65.063 -19.693 27.822  1.00 0.00 ? 85  ARG J CD    1 
ATOM 9371  N NE    . ARG J  1 79  ? -65.157 -18.480 27.044  1.00 0.00 ? 85  ARG J NE    1 
ATOM 9372  C CZ    . ARG J  1 79  ? -65.403 -18.433 25.725  1.00 0.00 ? 85  ARG J CZ    1 
ATOM 9373  N NH1   . ARG J  1 79  ? -65.555 -19.536 25.034  1.00 0.00 ? 85  ARG J NH1   1 
ATOM 9374  N NH2   . ARG J  1 79  ? -65.498 -17.267 25.117  1.00 0.00 ? 85  ARG J NH2   1 
ATOM 9375  N N     . ALA J  1 80  ? -68.028 -19.850 31.150  1.00 0.00 ? 86  ALA J N     1 
ATOM 9376  C CA    . ALA J  1 80  ? -69.185 -18.987 31.132  1.00 0.00 ? 86  ALA J CA    1 
ATOM 9377  C C     . ALA J  1 80  ? -69.476 -18.461 32.514  1.00 0.00 ? 86  ALA J C     1 
ATOM 9378  O O     . ALA J  1 80  ? -69.798 -17.291 32.686  1.00 0.00 ? 86  ALA J O     1 
ATOM 9379  C CB    . ALA J  1 80  ? -70.378 -19.733 30.597  1.00 0.00 ? 86  ALA J CB    1 
ATOM 9380  N N     . LEU J  1 81  ? -69.323 -19.311 33.511  1.00 0.00 ? 87  LEU J N     1 
ATOM 9381  C CA    . LEU J  1 81  ? -69.520 -18.884 34.865  1.00 0.00 ? 87  LEU J CA    1 
ATOM 9382  C C     . LEU J  1 81  ? -68.620 -17.713 35.191  1.00 0.00 ? 87  LEU J C     1 
ATOM 9383  O O     . LEU J  1 81  ? -69.078 -16.709 35.718  1.00 0.00 ? 87  LEU J O     1 
ATOM 9384  C CB    . LEU J  1 81  ? -69.273 -20.030 35.828  1.00 0.00 ? 87  LEU J CB    1 
ATOM 9385  C CG    . LEU J  1 81  ? -69.398 -19.686 37.301  1.00 0.00 ? 87  LEU J CG    1 
ATOM 9386  C CD1   . LEU J  1 81  ? -70.803 -19.198 37.584  1.00 0.00 ? 87  LEU J CD1   1 
ATOM 9387  C CD2   . LEU J  1 81  ? -69.076 -20.919 38.127  1.00 0.00 ? 87  LEU J CD2   1 
ATOM 9388  N N     . ASN J  1 82  ? -67.345 -17.811 34.842  1.00 0.00 ? 88  ASN J N     1 
ATOM 9389  C CA    . ASN J  1 82  ? -66.419 -16.716 35.121  1.00 0.00 ? 88  ASN J CA    1 
ATOM 9390  C C     . ASN J  1 82  ? -66.760 -15.423 34.379  1.00 0.00 ? 88  ASN J C     1 
ATOM 9391  O O     . ASN J  1 82  ? -66.703 -14.340 34.958  1.00 0.00 ? 88  ASN J O     1 
ATOM 9392  C CB    . ASN J  1 82  ? -64.997 -17.111 34.789  1.00 0.00 ? 88  ASN J CB    1 
ATOM 9393  C CG    . ASN J  1 82  ? -64.398 -18.026 35.796  1.00 0.00 ? 88  ASN J CG    1 
ATOM 9394  O OD1   . ASN J  1 82  ? -64.946 -18.228 36.882  1.00 0.00 ? 88  ASN J OD1   1 
ATOM 9395  N ND2   . ASN J  1 82  ? -63.261 -18.570 35.472  1.00 0.00 ? 88  ASN J ND2   1 
ATOM 9396  N N     . ARG J  1 83  ? -67.086 -15.529 33.098  1.00 0.00 ? 89  ARG J N     1 
ATOM 9397  C CA    . ARG J  1 83  ? -67.298 -14.337 32.278  1.00 0.00 ? 89  ARG J CA    1 
ATOM 9398  C C     . ARG J  1 83  ? -68.713 -13.758 32.402  1.00 0.00 ? 89  ARG J C     1 
ATOM 9399  O O     . ARG J  1 83  ? -68.918 -12.570 32.178  1.00 0.00 ? 89  ARG J O     1 
ATOM 9400  C CB    . ARG J  1 83  ? -66.982 -14.643 30.822  1.00 0.00 ? 89  ARG J CB    1 
ATOM 9401  C CG    . ARG J  1 83  ? -65.494 -14.906 30.538  1.00 0.00 ? 89  ARG J CG    1 
ATOM 9402  C CD    . ARG J  1 83  ? -65.246 -15.240 29.106  1.00 0.00 ? 89  ARG J CD    1 
ATOM 9403  N NE    . ARG J  1 83  ? -63.855 -15.643 28.850  1.00 0.00 ? 89  ARG J NE    1 
ATOM 9404  C CZ    . ARG J  1 83  ? -62.851 -14.814 28.503  1.00 0.00 ? 89  ARG J CZ    1 
ATOM 9405  N NH1   . ARG J  1 83  ? -63.067 -13.528 28.366  1.00 0.00 ? 89  ARG J NH1   1 
ATOM 9406  N NH2   . ARG J  1 83  ? -61.645 -15.301 28.293  1.00 0.00 ? 89  ARG J NH2   1 
ATOM 9407  N N     . ILE J  1 84  ? -69.676 -14.594 32.764  1.00 0.00 ? 90  ILE J N     1 
ATOM 9408  C CA    . ILE J  1 84  ? -71.064 -14.157 32.936  1.00 0.00 ? 90  ILE J CA    1 
ATOM 9409  C C     . ILE J  1 84  ? -71.450 -14.048 34.402  1.00 0.00 ? 90  ILE J C     1 
ATOM 9410  O O     . ILE J  1 84  ? -72.061 -13.065 34.830  1.00 0.00 ? 90  ILE J O     1 
ATOM 9411  C CB    . ILE J  1 84  ? -72.049 -15.119 32.244  1.00 0.00 ? 90  ILE J CB    1 
ATOM 9412  C CG1   . ILE J  1 84  ? -71.839 -15.124 30.738  1.00 0.00 ? 90  ILE J CG1   1 
ATOM 9413  C CG2   . ILE J  1 84  ? -73.468 -14.740 32.573  1.00 0.00 ? 90  ILE J CG2   1 
ATOM 9414  C CD1   . ILE J  1 84  ? -72.639 -16.191 30.029  1.00 0.00 ? 90  ILE J CD1   1 
ATOM 9415  N N     . GLY J  1 85  ? -71.170 -15.099 35.154  1.00 0.00 ? 91  GLY J N     1 
ATOM 9416  C CA    . GLY J  1 85  ? -71.583 -15.164 36.547  1.00 0.00 ? 91  GLY J CA    1 
ATOM 9417  C C     . GLY J  1 85  ? -72.858 -15.962 36.646  1.00 0.00 ? 91  GLY J C     1 
ATOM 9418  O O     . GLY J  1 85  ? -73.548 -16.143 35.651  1.00 0.00 ? 91  GLY J O     1 
ATOM 9419  N N     . SER J  1 86  ? -73.172 -16.452 37.834  1.00 0.00 ? 92  SER J N     1 
ATOM 9420  C CA    . SER J  1 86  ? -74.356 -17.286 37.999  1.00 0.00 ? 92  SER J CA    1 
ATOM 9421  C C     . SER J  1 86  ? -75.621 -16.482 37.831  1.00 0.00 ? 92  SER J C     1 
ATOM 9422  O O     . SER J  1 86  ? -75.615 -15.259 37.969  1.00 0.00 ? 92  SER J O     1 
ATOM 9423  C CB    . SER J  1 86  ? -74.356 -17.942 39.353  1.00 0.00 ? 92  SER J CB    1 
ATOM 9424  O OG    . SER J  1 86  ? -74.552 -16.995 40.362  1.00 0.00 ? 92  SER J OG    1 
ATOM 9425  N N     . GLY J  1 87  ? -76.718 -17.177 37.560  1.00 0.00 ? 93  GLY J N     1 
ATOM 9426  C CA    . GLY J  1 87  ? -78.000 -16.531 37.359  1.00 0.00 ? 93  GLY J CA    1 
ATOM 9427  C C     . GLY J  1 87  ? -78.513 -16.768 35.948  1.00 0.00 ? 93  GLY J C     1 
ATOM 9428  O O     . GLY J  1 87  ? -77.878 -17.466 35.161  1.00 0.00 ? 93  GLY J O     1 
ATOM 9429  N N     . PRO J  1 88  ? -79.672 -16.191 35.649  1.00 0.00 ? 94  PRO J N     1 
ATOM 9430  C CA    . PRO J  1 88  ? -80.419 -16.255 34.378  1.00 0.00 ? 94  PRO J CA    1 
ATOM 9431  C C     . PRO J  1 88  ? -79.537 -16.499 33.159  1.00 0.00 ? 94  PRO J C     1 
ATOM 9432  O O     . PRO J  1 88  ? -79.691 -17.508 32.473  1.00 0.00 ? 94  PRO J O     1 
ATOM 9433  C CB    . PRO J  1 88  ? -81.074 -14.871 34.289  1.00 0.00 ? 94  PRO J CB    1 
ATOM 9434  C CG    . PRO J  1 88  ? -81.198 -14.445 35.691  1.00 0.00 ? 94  PRO J CG    1 
ATOM 9435  C CD    . PRO J  1 88  ? -79.922 -14.901 36.306  1.00 0.00 ? 94  PRO J CD    1 
ATOM 9436  N N     . ALA J  1 89  ? -78.641 -15.558 32.869  1.00 0.00 ? 95  ALA J N     1 
ATOM 9437  C CA    . ALA J  1 89  ? -77.820 -15.634 31.672  1.00 0.00 ? 95  ALA J CA    1 
ATOM 9438  C C     . ALA J  1 89  ? -77.001 -16.898 31.616  1.00 0.00 ? 95  ALA J C     1 
ATOM 9439  O O     . ALA J  1 89  ? -76.807 -17.460 30.540  1.00 0.00 ? 95  ALA J O     1 
ATOM 9440  C CB    . ALA J  1 89  ? -76.916 -14.431 31.594  1.00 0.00 ? 95  ALA J CB    1 
ATOM 9441  N N     . LEU J  1 90  ? -76.509 -17.348 32.762  1.00 0.00 ? 96  LEU J N     1 
ATOM 9442  C CA    . LEU J  1 90  ? -75.713 -18.551 32.791  1.00 0.00 ? 96  LEU J CA    1 
ATOM 9443  C C     . LEU J  1 90  ? -76.554 -19.720 32.429  1.00 0.00 ? 96  LEU J C     1 
ATOM 9444  O O     . LEU J  1 90  ? -76.128 -20.590 31.681  1.00 0.00 ? 96  LEU J O     1 
ATOM 9445  C CB    . LEU J  1 90  ? -75.107 -18.787 34.149  1.00 0.00 ? 96  LEU J CB    1 
ATOM 9446  C CG    . LEU J  1 90  ? -74.208 -20.010 34.222  1.00 0.00 ? 96  LEU J CG    1 
ATOM 9447  C CD1   . LEU J  1 90  ? -73.048 -19.830 33.255  1.00 0.00 ? 96  LEU J CD1   1 
ATOM 9448  C CD2   . LEU J  1 90  ? -73.718 -20.200 35.632  1.00 0.00 ? 96  LEU J CD2   1 
ATOM 9449  N N     . VAL J  1 91  ? -77.757 -19.757 32.971  1.00 0.00 ? 97  VAL J N     1 
ATOM 9450  C CA    . VAL J  1 91  ? -78.678 -20.828 32.666  1.00 0.00 ? 97  VAL J CA    1 
ATOM 9451  C C     . VAL J  1 91  ? -78.975 -20.863 31.182  1.00 0.00 ? 97  VAL J C     1 
ATOM 9452  O O     . VAL J  1 91  ? -78.969 -21.930 30.570  1.00 0.00 ? 97  VAL J O     1 
ATOM 9453  C CB    . VAL J  1 91  ? -79.976 -20.669 33.461  1.00 0.00 ? 97  VAL J CB    1 
ATOM 9454  C CG1   . VAL J  1 91  ? -81.013 -21.664 32.977  1.00 0.00 ? 97  VAL J CG1   1 
ATOM 9455  C CG2   . VAL J  1 91  ? -79.683 -20.876 34.934  1.00 0.00 ? 97  VAL J CG2   1 
ATOM 9456  N N     . ASN J  1 92  ? -79.199 -19.687 30.594  1.00 0.00 ? 98  ASN J N     1 
ATOM 9457  C CA    . ASN J  1 92  ? -79.443 -19.589 29.167  1.00 0.00 ? 98  ASN J CA    1 
ATOM 9458  C C     . ASN J  1 92  ? -78.283 -20.188 28.397  1.00 0.00 ? 98  ASN J C     1 
ATOM 9459  O O     . ASN J  1 92  ? -78.479 -20.983 27.471  1.00 0.00 ? 98  ASN J O     1 
ATOM 9460  C CB    . ASN J  1 92  ? -79.658 -18.142 28.763  1.00 0.00 ? 98  ASN J CB    1 
ATOM 9461  C CG    . ASN J  1 92  ? -80.973 -17.625 29.234  1.00 0.00 ? 98  ASN J CG    1 
ATOM 9462  O OD1   . ASN J  1 92  ? -81.842 -18.422 29.605  1.00 0.00 ? 98  ASN J OD1   1 
ATOM 9463  N ND2   . ASN J  1 92  ? -81.158 -16.326 29.229  1.00 0.00 ? 98  ASN J ND2   1 
ATOM 9464  N N     . MET J  1 93  ? -77.075 -19.852 28.826  1.00 0.00 ? 99  MET J N     1 
ATOM 9465  C CA    . MET J  1 93  ? -75.880 -20.372 28.221  1.00 0.00 ? 99  MET J CA    1 
ATOM 9466  C C     . MET J  1 93  ? -75.798 -21.867 28.314  1.00 0.00 ? 99  MET J C     1 
ATOM 9467  O O     . MET J  1 93  ? -75.552 -22.539 27.312  1.00 0.00 ? 99  MET J O     1 
ATOM 9468  C CB    . MET J  1 93  ? -74.664 -19.767 28.874  1.00 0.00 ? 99  MET J CB    1 
ATOM 9469  C CG    . MET J  1 93  ? -73.372 -20.335 28.364  1.00 0.00 ? 99  MET J CG    1 
ATOM 9470  S SD    . MET J  1 93  ? -73.076 -19.926 26.664  1.00 0.00 ? 99  MET J SD    1 
ATOM 9471  C CE    . MET J  1 93  ? -72.485 -18.249 26.862  1.00 0.00 ? 99  MET J CE    1 
ATOM 9472  N N     . ILE J  1 94  ? -75.977 -22.389 29.516  1.00 0.00 ? 100 ILE J N     1 
ATOM 9473  C CA    . ILE J  1 94  ? -75.819 -23.802 29.747  1.00 0.00 ? 100 ILE J CA    1 
ATOM 9474  C C     . ILE J  1 94  ? -76.807 -24.600 28.960  1.00 0.00 ? 100 ILE J C     1 
ATOM 9475  O O     . ILE J  1 94  ? -76.467 -25.655 28.440  1.00 0.00 ? 100 ILE J O     1 
ATOM 9476  C CB    . ILE J  1 94  ? -75.945 -24.153 31.217  1.00 0.00 ? 100 ILE J CB    1 
ATOM 9477  C CG1   . ILE J  1 94  ? -74.778 -23.568 31.999  1.00 0.00 ? 100 ILE J CG1   1 
ATOM 9478  C CG2   . ILE J  1 94  ? -75.951 -25.662 31.367  1.00 0.00 ? 100 ILE J CG2   1 
ATOM 9479  C CD1   . ILE J  1 94  ? -74.964 -23.636 33.493  1.00 0.00 ? 100 ILE J CD1   1 
ATOM 9480  N N     . ASN J  1 95  ? -78.042 -24.121 28.877  1.00 0.00 ? 101 ASN J N     1 
ATOM 9481  C CA    . ASN J  1 95  ? -79.059 -24.825 28.115  1.00 0.00 ? 101 ASN J CA    1 
ATOM 9482  C C     . ASN J  1 95  ? -78.618 -25.037 26.681  1.00 0.00 ? 101 ASN J C     1 
ATOM 9483  O O     . ASN J  1 95  ? -78.734 -26.145 26.147  1.00 0.00 ? 101 ASN J O     1 
ATOM 9484  C CB    . ASN J  1 95  ? -80.373 -24.080 28.146  1.00 0.00 ? 101 ASN J CB    1 
ATOM 9485  C CG    . ASN J  1 95  ? -81.055 -24.184 29.466  1.00 0.00 ? 101 ASN J CG    1 
ATOM 9486  O OD1   . ASN J  1 95  ? -80.640 -24.990 30.306  1.00 0.00 ? 101 ASN J OD1   1 
ATOM 9487  N ND2   . ASN J  1 95  ? -82.098 -23.410 29.662  1.00 0.00 ? 101 ASN J ND2   1 
ATOM 9488  N N     . GLY J  1 96  ? -78.085 -23.982 26.063  1.00 0.00 ? 102 GLY J N     1 
ATOM 9489  C CA    . GLY J  1 96  ? -77.620 -24.078 24.690  1.00 0.00 ? 102 GLY J CA    1 
ATOM 9490  C C     . GLY J  1 96  ? -76.389 -24.935 24.583  1.00 0.00 ? 102 GLY J C     1 
ATOM 9491  O O     . GLY J  1 96  ? -76.266 -25.737 23.660  1.00 0.00 ? 102 GLY J O     1 
ATOM 9492  N N     . LEU J  1 97  ? -75.487 -24.783 25.534  1.00 0.00 ? 103 LEU J N     1 
ATOM 9493  C CA    . LEU J  1 97  ? -74.265 -25.548 25.559  1.00 0.00 ? 103 LEU J CA    1 
ATOM 9494  C C     . LEU J  1 97  ? -74.516 -27.030 25.694  1.00 0.00 ? 103 LEU J C     1 
ATOM 9495  O O     . LEU J  1 97  ? -73.892 -27.840 25.011  1.00 0.00 ? 103 LEU J O     1 
ATOM 9496  C CB    . LEU J  1 97  ? -73.384 -25.080 26.683  1.00 0.00 ? 103 LEU J CB    1 
ATOM 9497  C CG    . LEU J  1 97  ? -72.124 -25.877 26.844  1.00 0.00 ? 103 LEU J CG    1 
ATOM 9498  C CD1   . LEU J  1 97  ? -71.386 -25.852 25.547  1.00 0.00 ? 103 LEU J CD1   1 
ATOM 9499  C CD2   . LEU J  1 97  ? -71.292 -25.285 27.960  1.00 0.00 ? 103 LEU J CD2   1 
ATOM 9500  N N     . LYS J  1 98  ? -75.384 -27.390 26.609  1.00 0.00 ? 104 LYS J N     1 
ATOM 9501  C CA    . LYS J  1 98  ? -75.736 -28.765 26.804  1.00 0.00 ? 104 LYS J CA    1 
ATOM 9502  C C     . LYS J  1 98  ? -76.274 -29.369 25.531  1.00 0.00 ? 104 LYS J C     1 
ATOM 9503  O O     . LYS J  1 98  ? -75.767 -30.388 25.066  1.00 0.00 ? 104 LYS J O     1 
ATOM 9504  C CB    . LYS J  1 98  ? -76.746 -28.897 27.922  1.00 0.00 ? 104 LYS J CB    1 
ATOM 9505  C CG    . LYS J  1 98  ? -77.202 -30.317 28.166  1.00 0.00 ? 104 LYS J CG    1 
ATOM 9506  C CD    . LYS J  1 98  ? -78.186 -30.392 29.314  1.00 0.00 ? 104 LYS J CD    1 
ATOM 9507  C CE    . LYS J  1 98  ? -78.821 -31.768 29.400  1.00 0.00 ? 104 LYS J CE    1 
ATOM 9508  N NZ    . LYS J  1 98  ? -79.779 -31.861 30.528  1.00 0.00 ? 104 LYS J NZ    1 
ATOM 9509  N N     . GLY J  1 99  ? -77.290 -28.728 24.947  1.00 0.00 ? 105 GLY J N     1 
ATOM 9510  C CA    . GLY J  1 99  ? -77.895 -29.220 23.713  1.00 0.00 ? 105 GLY J CA    1 
ATOM 9511  C C     . GLY J  1 99  ? -76.857 -29.355 22.619  1.00 0.00 ? 105 GLY J C     1 
ATOM 9512  O O     . GLY J  1 99  ? -76.843 -30.342 21.878  1.00 0.00 ? 105 GLY J O     1 
ATOM 9513  N N     . TYR J  1 100 ? -75.972 -28.367 22.542  1.00 0.00 ? 106 TYR J N     1 
ATOM 9514  C CA    . TYR J  1 100 ? -74.878 -28.357 21.599  1.00 0.00 ? 106 TYR J CA    1 
ATOM 9515  C C     . TYR J  1 100 ? -74.070 -29.621 21.669  1.00 0.00 ? 106 TYR J C     1 
ATOM 9516  O O     . TYR J  1 100 ? -73.922 -30.310 20.674  1.00 0.00 ? 106 TYR J O     1 
ATOM 9517  C CB    . TYR J  1 100 ? -74.006 -27.144 21.869  1.00 0.00 ? 106 TYR J CB    1 
ATOM 9518  C CG    . TYR J  1 100 ? -72.693 -27.100 21.139  1.00 0.00 ? 106 TYR J CG    1 
ATOM 9519  C CD1   . TYR J  1 100 ? -72.640 -26.918 19.777  1.00 0.00 ? 106 TYR J CD1   1 
ATOM 9520  C CD2   . TYR J  1 100 ? -71.528 -27.195 21.866  1.00 0.00 ? 106 TYR J CD2   1 
ATOM 9521  C CE1   . TYR J  1 100 ? -71.419 -26.851 19.139  1.00 0.00 ? 106 TYR J CE1   1 
ATOM 9522  C CE2   . TYR J  1 100 ? -70.313 -27.122 21.239  1.00 0.00 ? 106 TYR J CE2   1 
ATOM 9523  C CZ    . TYR J  1 100 ? -70.254 -26.955 19.881  1.00 0.00 ? 106 TYR J CZ    1 
ATOM 9524  O OH    . TYR J  1 100 ? -69.031 -26.886 19.258  1.00 0.00 ? 106 TYR J OH    1 
ATOM 9525  N N     . TYR J  1 101 ? -73.579 -29.955 22.845  1.00 0.00 ? 107 TYR J N     1 
ATOM 9526  C CA    . TYR J  1 101 ? -72.793 -31.167 23.001  1.00 0.00 ? 107 TYR J CA    1 
ATOM 9527  C C     . TYR J  1 101 ? -73.576 -32.435 22.759  1.00 0.00 ? 107 TYR J C     1 
ATOM 9528  O O     . TYR J  1 101 ? -73.055 -33.380 22.158  1.00 0.00 ? 107 TYR J O     1 
ATOM 9529  C CB    . TYR J  1 101 ? -72.158 -31.211 24.372  1.00 0.00 ? 107 TYR J CB    1 
ATOM 9530  C CG    . TYR J  1 101 ? -70.774 -30.657 24.389  1.00 0.00 ? 107 TYR J CG    1 
ATOM 9531  C CD1   . TYR J  1 101 ? -70.552 -29.313 24.570  1.00 0.00 ? 107 TYR J CD1   1 
ATOM 9532  C CD2   . TYR J  1 101 ? -69.714 -31.521 24.226  1.00 0.00 ? 107 TYR J CD2   1 
ATOM 9533  C CE1   . TYR J  1 101 ? -69.261 -28.829 24.575  1.00 0.00 ? 107 TYR J CE1   1 
ATOM 9534  C CE2   . TYR J  1 101 ? -68.428 -31.043 24.231  1.00 0.00 ? 107 TYR J CE2   1 
ATOM 9535  C CZ    . TYR J  1 101 ? -68.201 -29.705 24.402  1.00 0.00 ? 107 TYR J CZ    1 
ATOM 9536  O OH    . TYR J  1 101 ? -66.916 -29.231 24.406  1.00 0.00 ? 107 TYR J OH    1 
ATOM 9537  N N     . ILE J  1 102 ? -74.829 -32.459 23.174  1.00 0.00 ? 108 ILE J N     1 
ATOM 9538  C CA    . ILE J  1 102 ? -75.627 -33.646 23.002  1.00 0.00 ? 108 ILE J CA    1 
ATOM 9539  C C     . ILE J  1 102 ? -75.759 -34.023 21.558  1.00 0.00 ? 108 ILE J C     1 
ATOM 9540  O O     . ILE J  1 102 ? -75.607 -35.183 21.201  1.00 0.00 ? 108 ILE J O     1 
ATOM 9541  C CB    . ILE J  1 102 ? -77.028 -33.471 23.571  1.00 0.00 ? 108 ILE J CB    1 
ATOM 9542  C CG1   . ILE J  1 102 ? -76.979 -33.367 25.074  1.00 0.00 ? 108 ILE J CG1   1 
ATOM 9543  C CG2   . ILE J  1 102 ? -77.896 -34.639 23.155  1.00 0.00 ? 108 ILE J CG2   1 
ATOM 9544  C CD1   . ILE J  1 102 ? -78.276 -32.913 25.688  1.00 0.00 ? 108 ILE J CD1   1 
ATOM 9545  N N     . SER J  1 103 ? -76.082 -33.060 20.723  1.00 0.00 ? 109 SER J N     1 
ATOM 9546  C CA    . SER J  1 103 ? -76.337 -33.359 19.334  1.00 0.00 ? 109 SER J CA    1 
ATOM 9547  C C     . SER J  1 103 ? -75.129 -33.186 18.430  1.00 0.00 ? 109 SER J C     1 
ATOM 9548  O O     . SER J  1 103 ? -75.016 -33.873 17.417  1.00 0.00 ? 109 SER J O     1 
ATOM 9549  C CB    . SER J  1 103 ? -77.461 -32.497 18.849  1.00 0.00 ? 109 SER J CB    1 
ATOM 9550  O OG    . SER J  1 103 ? -77.117 -31.150 18.932  1.00 0.00 ? 109 SER J OG    1 
ATOM 9551  N N     . ALA J  1 104 ? -74.222 -32.289 18.780  1.00 0.00 ? 110 ALA J N     1 
ATOM 9552  C CA    . ALA J  1 104 ? -73.050 -32.082 17.943  1.00 0.00 ? 110 ALA J CA    1 
ATOM 9553  C C     . ALA J  1 104 ? -72.050 -33.178 18.120  1.00 0.00 ? 110 ALA J C     1 
ATOM 9554  O O     . ALA J  1 104 ? -71.427 -33.593 17.151  1.00 0.00 ? 110 ALA J O     1 
ATOM 9555  C CB    . ALA J  1 104 ? -72.381 -30.746 18.234  1.00 0.00 ? 110 ALA J CB    1 
ATOM 9556  N N     . PHE J  1 105 ? -71.869 -33.637 19.364  1.00 0.00 ? 111 PHE J N     1 
ATOM 9557  C CA    . PHE J  1 105 ? -70.850 -34.624 19.658  1.00 0.00 ? 111 PHE J CA    1 
ATOM 9558  C C     . PHE J  1 105 ? -71.404 -35.892 20.237  1.00 0.00 ? 111 PHE J C     1 
ATOM 9559  O O     . PHE J  1 105 ? -70.646 -36.748 20.686  1.00 0.00 ? 111 PHE J O     1 
ATOM 9560  C CB    . PHE J  1 105 ? -69.851 -34.046 20.625  1.00 0.00 ? 111 PHE J CB    1 
ATOM 9561  C CG    . PHE J  1 105 ? -69.211 -32.826 20.096  1.00 0.00 ? 111 PHE J CG    1 
ATOM 9562  C CD1   . PHE J  1 105 ? -69.472 -31.599 20.658  1.00 0.00 ? 111 PHE J CD1   1 
ATOM 9563  C CD2   . PHE J  1 105 ? -68.378 -32.895 19.006  1.00 0.00 ? 111 PHE J CD2   1 
ATOM 9564  C CE1   . PHE J  1 105 ? -68.903 -30.461 20.151  1.00 0.00 ? 111 PHE J CE1   1 
ATOM 9565  C CE2   . PHE J  1 105 ? -67.809 -31.764 18.490  1.00 0.00 ? 111 PHE J CE2   1 
ATOM 9566  C CZ    . PHE J  1 105 ? -68.070 -30.540 19.064  1.00 0.00 ? 111 PHE J CZ    1 
ATOM 9567  N N     . ASN J  1 106 ? -72.722 -36.017 20.248  1.00 0.00 ? 112 ASN J N     1 
ATOM 9568  C CA    . ASN J  1 106 ? -73.365 -37.201 20.799  1.00 0.00 ? 112 ASN J CA    1 
ATOM 9569  C C     . ASN J  1 106 ? -73.009 -37.404 22.257  1.00 0.00 ? 112 ASN J C     1 
ATOM 9570  O O     . ASN J  1 106 ? -72.820 -38.536 22.702  1.00 0.00 ? 112 ASN J O     1 
ATOM 9571  C CB    . ASN J  1 106 ? -73.018 -38.429 19.994  1.00 0.00 ? 112 ASN J CB    1 
ATOM 9572  C CG    . ASN J  1 106 ? -73.517 -38.336 18.592  1.00 0.00 ? 112 ASN J CG    1 
ATOM 9573  O OD1   . ASN J  1 106 ? -74.577 -37.758 18.340  1.00 0.00 ? 112 ASN J OD1   1 
ATOM 9574  N ND2   . ASN J  1 106 ? -72.781 -38.896 17.670  1.00 0.00 ? 112 ASN J ND2   1 
ATOM 9575  N N     . ALA J  1 107 ? -72.910 -36.312 23.007  1.00 0.00 ? 113 ALA J N     1 
ATOM 9576  C CA    . ALA J  1 107 ? -72.618 -36.413 24.421  1.00 0.00 ? 113 ALA J CA    1 
ATOM 9577  C C     . ALA J  1 107 ? -73.850 -36.901 25.159  1.00 0.00 ? 113 ALA J C     1 
ATOM 9578  O O     . ALA J  1 107 ? -74.974 -36.577 24.782  1.00 0.00 ? 113 ALA J O     1 
ATOM 9579  C CB    . ALA J  1 107 ? -72.151 -35.087 24.959  1.00 0.00 ? 113 ALA J CB    1 
ATOM 9580  N N     . ASN J  1 108 ? -73.638 -37.701 26.197  1.00 0.00 ? 114 ASN J N     1 
ATOM 9581  C CA    . ASN J  1 108 ? -74.738 -38.301 26.937  1.00 0.00 ? 114 ASN J CA    1 
ATOM 9582  C C     . ASN J  1 108 ? -75.295 -37.374 28.021  1.00 0.00 ? 114 ASN J C     1 
ATOM 9583  O O     . ASN J  1 108 ? -74.669 -37.214 29.066  1.00 0.00 ? 114 ASN J O     1 
ATOM 9584  C CB    . ASN J  1 108 ? -74.297 -39.596 27.557  1.00 0.00 ? 114 ASN J CB    1 
ATOM 9585  C CG    . ASN J  1 108 ? -75.406 -40.277 28.278  1.00 0.00 ? 114 ASN J CG    1 
ATOM 9586  O OD1   . ASN J  1 108 ? -76.311 -39.625 28.810  1.00 0.00 ? 114 ASN J OD1   1 
ATOM 9587  N ND2   . ASN J  1 108 ? -75.364 -41.581 28.310  1.00 0.00 ? 114 ASN J ND2   1 
ATOM 9588  N N     . PRO J  1 109 ? -76.484 -36.776 27.781  1.00 0.00 ? 115 PRO J N     1 
ATOM 9589  C CA    . PRO J  1 109 ? -77.250 -35.911 28.701  1.00 0.00 ? 115 PRO J CA    1 
ATOM 9590  C C     . PRO J  1 109 ? -77.037 -36.243 30.170  1.00 0.00 ? 115 PRO J C     1 
ATOM 9591  O O     . PRO J  1 109 ? -76.885 -35.343 30.992  1.00 0.00 ? 115 PRO J O     1 
ATOM 9592  C CB    . PRO J  1 109 ? -78.703 -36.199 28.326  1.00 0.00 ? 115 PRO J CB    1 
ATOM 9593  C CG    . PRO J  1 109 ? -78.643 -36.602 26.917  1.00 0.00 ? 115 PRO J CG    1 
ATOM 9594  C CD    . PRO J  1 109 ? -77.409 -37.435 26.836  1.00 0.00 ? 115 PRO J CD    1 
ATOM 9595  N N     . GLN J  1 110 ? -77.058 -37.526 30.507  1.00 0.00 ? 116 GLN J N     1 
ATOM 9596  C CA    . GLN J  1 110 ? -76.918 -37.951 31.887  1.00 0.00 ? 116 GLN J CA    1 
ATOM 9597  C C     . GLN J  1 110 ? -75.599 -37.544 32.478  1.00 0.00 ? 116 GLN J C     1 
ATOM 9598  O O     . GLN J  1 110 ? -75.538 -37.027 33.595  1.00 0.00 ? 116 GLN J O     1 
ATOM 9599  C CB    . GLN J  1 110 ? -77.068 -39.454 31.992  1.00 0.00 ? 116 GLN J CB    1 
ATOM 9600  C CG    . GLN J  1 110 ? -76.911 -39.974 33.396  1.00 0.00 ? 116 GLN J CG    1 
ATOM 9601  C CD    . GLN J  1 110 ? -77.965 -39.430 34.312  1.00 0.00 ? 116 GLN J CD    1 
ATOM 9602  O OE1   . GLN J  1 110 ? -79.123 -39.281 33.914  1.00 0.00 ? 116 GLN J OE1   1 
ATOM 9603  N NE2   . GLN J  1 110 ? -77.581 -39.122 35.548  1.00 0.00 ? 116 GLN J NE2   1 
ATOM 9604  N N     . VAL J  1 111 ? -74.538 -37.780 31.746  1.00 0.00 ? 117 VAL J N     1 
ATOM 9605  C CA    . VAL J  1 111 ? -73.243 -37.438 32.235  1.00 0.00 ? 117 VAL J CA    1 
ATOM 9606  C C     . VAL J  1 111 ? -73.081 -35.948 32.210  1.00 0.00 ? 117 VAL J C     1 
ATOM 9607  O O     . VAL J  1 111 ? -72.482 -35.375 33.111  1.00 0.00 ? 117 VAL J O     1 
ATOM 9608  C CB    . VAL J  1 111 ? -72.155 -38.099 31.412  1.00 0.00 ? 117 VAL J CB    1 
ATOM 9609  C CG1   . VAL J  1 111 ? -70.799 -37.623 31.893  1.00 0.00 ? 117 VAL J CG1   1 
ATOM 9610  C CG2   . VAL J  1 111 ? -72.270 -39.604 31.525  1.00 0.00 ? 117 VAL J CG2   1 
ATOM 9611  N N     . LEU J  1 112 ? -73.637 -35.309 31.184  1.00 0.00 ? 118 LEU J N     1 
ATOM 9612  C CA    . LEU J  1 112 ? -73.551 -33.865 31.056  1.00 0.00 ? 118 LEU J CA    1 
ATOM 9613  C C     . LEU J  1 112 ? -74.164 -33.191 32.251  1.00 0.00 ? 118 LEU J C     1 
ATOM 9614  O O     . LEU J  1 112 ? -73.624 -32.214 32.767  1.00 0.00 ? 118 LEU J O     1 
ATOM 9615  C CB    . LEU J  1 112 ? -74.271 -33.400 29.803  1.00 0.00 ? 118 LEU J CB    1 
ATOM 9616  C CG    . LEU J  1 112 ? -73.630 -33.789 28.488  1.00 0.00 ? 118 LEU J CG    1 
ATOM 9617  C CD1   . LEU J  1 112 ? -74.557 -33.420 27.369  1.00 0.00 ? 118 LEU J CD1   1 
ATOM 9618  C CD2   . LEU J  1 112 ? -72.317 -33.073 28.340  1.00 0.00 ? 118 LEU J CD2   1 
ATOM 9619  N N     . ASP J  1 113 ? -75.277 -33.731 32.715  1.00 0.00 ? 119 ASP J N     1 
ATOM 9620  C CA    . ASP J  1 113 ? -75.925 -33.210 33.885  1.00 0.00 ? 119 ASP J CA    1 
ATOM 9621  C C     . ASP J  1 113 ? -75.075 -33.400 35.092  1.00 0.00 ? 119 ASP J C     1 
ATOM 9622  O O     . ASP J  1 113 ? -74.962 -32.498 35.915  1.00 0.00 ? 119 ASP J O     1 
ATOM 9623  C CB    . ASP J  1 113 ? -77.264 -33.867 34.081  1.00 0.00 ? 119 ASP J CB    1 
ATOM 9624  C CG    . ASP J  1 113 ? -78.262 -33.368 33.078  1.00 0.00 ? 119 ASP J CG    1 
ATOM 9625  O OD1   . ASP J  1 113 ? -78.047 -32.302 32.552  1.00 0.00 ? 119 ASP J OD1   1 
ATOM 9626  O OD2   . ASP J  1 113 ? -79.224 -34.047 32.823  1.00 0.00 ? 119 ASP J OD2   1 
ATOM 9627  N N     . ALA J  1 114 ? -74.428 -34.556 35.187  1.00 0.00 ? 120 ALA J N     1 
ATOM 9628  C CA    . ALA J  1 114 ? -73.542 -34.820 36.298  1.00 0.00 ? 120 ALA J CA    1 
ATOM 9629  C C     . ALA J  1 114 ? -72.432 -33.796 36.361  1.00 0.00 ? 120 ALA J C     1 
ATOM 9630  O O     . ALA J  1 114 ? -72.101 -33.308 37.434  1.00 0.00 ? 120 ALA J O     1 
ATOM 9631  C CB    . ALA J  1 114 ? -72.964 -36.210 36.190  1.00 0.00 ? 120 ALA J CB    1 
ATOM 9632  N N     . VAL J  1 115 ? -71.885 -33.431 35.204  1.00 0.00 ? 121 VAL J N     1 
ATOM 9633  C CA    . VAL J  1 115 ? -70.835 -32.429 35.157  1.00 0.00 ? 121 VAL J CA    1 
ATOM 9634  C C     . VAL J  1 115 ? -71.337 -31.096 35.669  1.00 0.00 ? 121 VAL J C     1 
ATOM 9635  O O     . VAL J  1 115 ? -70.685 -30.459 36.498  1.00 0.00 ? 121 VAL J O     1 
ATOM 9636  C CB    . VAL J  1 115 ? -70.304 -32.255 33.736  1.00 0.00 ? 121 VAL J CB    1 
ATOM 9637  C CG1   . VAL J  1 115 ? -69.369 -31.070 33.688  1.00 0.00 ? 121 VAL J CG1   1 
ATOM 9638  C CG2   . VAL J  1 115 ? -69.585 -33.517 33.291  1.00 0.00 ? 121 VAL J CG2   1 
ATOM 9639  N N     . VAL J  1 116 ? -72.516 -30.695 35.214  1.00 0.00 ? 122 VAL J N     1 
ATOM 9640  C CA    . VAL J  1 116 ? -73.119 -29.450 35.665  1.00 0.00 ? 122 VAL J CA    1 
ATOM 9641  C C     . VAL J  1 116 ? -73.395 -29.494 37.163  1.00 0.00 ? 122 VAL J C     1 
ATOM 9642  O O     . VAL J  1 116 ? -73.202 -28.507 37.872  1.00 0.00 ? 122 VAL J O     1 
ATOM 9643  C CB    . VAL J  1 116 ? -74.419 -29.174 34.900  1.00 0.00 ? 122 VAL J CB    1 
ATOM 9644  C CG1   . VAL J  1 116 ? -75.139 -27.995 35.498  1.00 0.00 ? 122 VAL J CG1   1 
ATOM 9645  C CG2   . VAL J  1 116 ? -74.107 -28.907 33.451  1.00 0.00 ? 122 VAL J CG2   1 
ATOM 9646  N N     . ASN J  1 117 ? -73.780 -30.669 37.655  1.00 0.00 ? 123 ASN J N     1 
ATOM 9647  C CA    . ASN J  1 117 ? -74.073 -30.864 39.065  1.00 0.00 ? 123 ASN J CA    1 
ATOM 9648  C C     . ASN J  1 117 ? -72.838 -30.773 39.956  1.00 0.00 ? 123 ASN J C     1 
ATOM 9649  O O     . ASN J  1 117 ? -72.949 -30.837 41.178  1.00 0.00 ? 123 ASN J O     1 
ATOM 9650  C CB    . ASN J  1 117 ? -74.762 -32.180 39.278  1.00 0.00 ? 123 ASN J CB    1 
ATOM 9651  C CG    . ASN J  1 117 ? -76.138 -32.173 38.721  1.00 0.00 ? 123 ASN J CG    1 
ATOM 9652  O OD1   . ASN J  1 117 ? -76.689 -31.105 38.445  1.00 0.00 ? 123 ASN J OD1   1 
ATOM 9653  N ND2   . ASN J  1 117 ? -76.709 -33.337 38.547  1.00 0.00 ? 123 ASN J ND2   1 
ATOM 9654  N N     . ILE J  1 118 ? -71.670 -30.623 39.360  1.00 0.00 ? 124 ILE J N     1 
ATOM 9655  C CA    . ILE J  1 118 ? -70.466 -30.400 40.102  1.00 0.00 ? 124 ILE J CA    1 
ATOM 9656  C C     . ILE J  1 118 ? -70.115 -28.959 40.085  1.00 0.00 ? 124 ILE J C     1 
ATOM 9657  O O     . ILE J  1 118 ? -69.879 -28.350 41.125  1.00 0.00 ? 124 ILE J O     1 
ATOM 9658  C CB    . ILE J  1 118 ? -69.312 -31.174 39.518  1.00 0.00 ? 124 ILE J CB    1 
ATOM 9659  C CG1   . ILE J  1 118 ? -69.603 -32.646 39.552  1.00 0.00 ? 124 ILE J CG1   1 
ATOM 9660  C CG2   . ILE J  1 118 ? -68.040 -30.850 40.248  1.00 0.00 ? 124 ILE J CG2   1 
ATOM 9661  C CD1   . ILE J  1 118 ? -69.853 -33.174 40.939  1.00 0.00 ? 124 ILE J CD1   1 
ATOM 9662  N N     . ILE J  1 119 ? -70.066 -28.409 38.892  1.00 0.00 ? 125 ILE J N     1 
ATOM 9663  C CA    . ILE J  1 119 ? -69.665 -27.037 38.696  1.00 0.00 ? 125 ILE J CA    1 
ATOM 9664  C C     . ILE J  1 119 ? -70.670 -26.069 39.282  1.00 0.00 ? 125 ILE J C     1 
ATOM 9665  O O     . ILE J  1 119 ? -70.301 -25.143 40.002  1.00 0.00 ? 125 ILE J O     1 
ATOM 9666  C CB    . ILE J  1 119 ? -69.491 -26.759 37.219  1.00 0.00 ? 125 ILE J CB    1 
ATOM 9667  C CG1   . ILE J  1 119 ? -68.326 -27.570 36.693  1.00 0.00 ? 125 ILE J CG1   1 
ATOM 9668  C CG2   . ILE J  1 119 ? -69.254 -25.280 36.990  1.00 0.00 ? 125 ILE J CG2   1 
ATOM 9669  C CD1   . ILE J  1 119 ? -68.259 -27.599 35.203  1.00 0.00 ? 125 ILE J CD1   1 
ATOM 9670  N N     . THR J  1 120 ? -71.939 -26.276 38.976  1.00 0.00 ? 126 THR J N     1 
ATOM 9671  C CA    . THR J  1 120 ? -72.978 -25.413 39.487  1.00 0.00 ? 126 THR J CA    1 
ATOM 9672  C C     . THR J  1 120 ? -73.568 -25.994 40.731  1.00 0.00 ? 126 THR J C     1 
ATOM 9673  O O     . THR J  1 120 ? -73.950 -25.273 41.651  1.00 0.00 ? 126 THR J O     1 
ATOM 9674  C CB    . THR J  1 120 ? -74.101 -25.274 38.492  1.00 0.00 ? 126 THR J CB    1 
ATOM 9675  O OG1   . THR J  1 120 ? -74.709 -26.559 38.330  1.00 0.00 ? 126 THR J OG1   1 
ATOM 9676  C CG2   . THR J  1 120 ? -73.569 -24.793 37.155  1.00 0.00 ? 126 THR J CG2   1 
ATOM 9677  N N     . GLY J  1 121 ? -73.637 -27.314 40.770  1.00 0.00 ? 127 GLY J N     1 
ATOM 9678  C CA    . GLY J  1 121 ? -74.207 -28.003 41.906  1.00 0.00 ? 127 GLY J CA    1 
ATOM 9679  C C     . GLY J  1 121 ? -75.631 -28.441 41.615  1.00 0.00 ? 127 GLY J C     1 
ATOM 9680  O O     . GLY J  1 121 ? -76.205 -29.240 42.351  1.00 0.00 ? 127 GLY J O     1 
ATOM 9681  N N     . SER J  1 122 ? -76.202 -27.921 40.537  1.00 0.00 ? 128 SER J N     1 
ATOM 9682  C CA    . SER J  1 122 ? -77.569 -28.238 40.191  1.00 0.00 ? 128 SER J CA    1 
ATOM 9683  C C     . SER J  1 122 ? -77.744 -28.220 38.688  1.00 0.00 ? 128 SER J C     1 
ATOM 9684  O O     . SER J  1 122 ? -77.017 -27.516 37.990  1.00 0.00 ? 128 SER J O     1 
ATOM 9685  C CB    . SER J  1 122 ? -78.515 -27.222 40.805  1.00 0.00 ? 128 SER J CB    1 
ATOM 9686  O OG    . SER J  1 122 ? -78.341 -25.965 40.212  1.00 0.00 ? 128 SER J OG    1 
ATOM 9687  N N     . PRO J  1 123 ? -78.741 -28.945 38.178  1.00 0.00 ? 129 PRO J N     1 
ATOM 9688  C CA    . PRO J  1 123 ? -79.147 -29.034 36.793  1.00 0.00 ? 129 PRO J CA    1 
ATOM 9689  C C     . PRO J  1 123 ? -79.547 -27.675 36.271  1.00 0.00 ? 129 PRO J C     1 
ATOM 9690  O O     . PRO J  1 123 ? -79.869 -26.770 37.036  1.00 0.00 ? 129 PRO J O     1 
ATOM 9691  C CB    . PRO J  1 123 ? -80.323 -30.006 36.821  1.00 0.00 ? 129 PRO J CB    1 
ATOM 9692  C CG    . PRO J  1 123 ? -80.077 -30.865 38.014  1.00 0.00 ? 129 PRO J CG    1 
ATOM 9693  C CD    . PRO J  1 123 ? -79.423 -29.963 39.012  1.00 0.00 ? 129 PRO J CD    1 
ATOM 9694  N N     . THR J  1 124 ? -79.513 -27.534 34.965  1.00 0.00 ? 130 THR J N     1 
ATOM 9695  C CA    . THR J  1 124 ? -79.875 -26.290 34.329  1.00 0.00 ? 130 THR J CA    1 
ATOM 9696  C C     . THR J  1 124 ? -81.364 -26.244 34.020  1.00 0.00 ? 130 THR J C     1 
ATOM 9697  O O     . THR J  1 124 ? -82.181 -26.683 34.827  1.00 0.00 ? 130 THR J O     1 
ATOM 9698  C CB    . THR J  1 124 ? -79.048 -26.083 33.055  1.00 0.00 ? 130 THR J CB    1 
ATOM 9699  O OG1   . THR J  1 124 ? -79.406 -24.832 32.455  1.00 0.00 ? 130 THR J OG1   1 
ATOM 9700  C CG2   . THR J  1 124 ? -79.244 -27.237 32.055  1.00 0.00 ? 130 THR J CG2   1 
ATOM 9701  N N     . GLY J  1 125 ? -81.732 -25.689 32.867  1.00 0.00 ? 131 GLY J N     1 
ATOM 9702  C CA    . GLY J  1 125 ? -83.134 -25.598 32.486  1.00 0.00 ? 131 GLY J CA    1 
ATOM 9703  C C     . GLY J  1 125 ? -83.785 -24.385 33.125  1.00 0.00 ? 131 GLY J C     1 
ATOM 9704  O O     . GLY J  1 125 ? -84.159 -23.439 32.432  1.00 0.00 ? 131 GLY J O     1 
ATOM 9705  N N     . TYR J  1 126 ? -83.866 -24.403 34.457  1.00 0.00 ? 132 TYR J N     1 
ATOM 9706  C CA    . TYR J  1 126 ? -84.437 -23.313 35.222  1.00 0.00 ? 132 TYR J CA    1 
ATOM 9707  C C     . TYR J  1 126 ? -83.442 -22.819 36.266  1.00 0.00 ? 132 TYR J C     1 
ATOM 9708  O O     . TYR J  1 126 ? -82.595 -23.577 36.735  1.00 0.00 ? 132 TYR J O     1 
ATOM 9709  C CB    . TYR J  1 126 ? -85.723 -23.770 35.894  1.00 0.00 ? 132 TYR J CB    1 
ATOM 9710  C CG    . TYR J  1 126 ? -86.744 -24.304 34.921  1.00 0.00 ? 132 TYR J CG    1 
ATOM 9711  C CD1   . TYR J  1 126 ? -86.837 -25.671 34.709  1.00 0.00 ? 132 TYR J CD1   1 
ATOM 9712  C CD2   . TYR J  1 126 ? -87.566 -23.434 34.224  1.00 0.00 ? 132 TYR J CD2   1 
ATOM 9713  C CE1   . TYR J  1 126 ? -87.755 -26.167 33.809  1.00 0.00 ? 132 TYR J CE1   1 
ATOM 9714  C CE2   . TYR J  1 126 ? -88.483 -23.930 33.323  1.00 0.00 ? 132 TYR J CE2   1 
ATOM 9715  C CZ    . TYR J  1 126 ? -88.580 -25.292 33.117  1.00 0.00 ? 132 TYR J CZ    1 
ATOM 9716  O OH    . TYR J  1 126 ? -89.498 -25.790 32.221  1.00 0.00 ? 132 TYR J OH    1 
ATOM 9717  N N     . VAL J  1 127 ? -83.554 -21.548 36.631  1.00 0.00 ? 133 VAL J N     1 
ATOM 9718  C CA    . VAL J  1 127 ? -82.641 -20.951 37.601  1.00 0.00 ? 133 VAL J CA    1 
ATOM 9719  C C     . VAL J  1 127 ? -82.849 -21.553 38.978  1.00 0.00 ? 133 VAL J C     1 
ATOM 9720  O O     . VAL J  1 127 ? -83.953 -21.500 39.524  1.00 0.00 ? 133 VAL J O     1 
ATOM 9721  C CB    . VAL J  1 127 ? -82.858 -19.416 37.678  1.00 0.00 ? 133 VAL J CB    1 
ATOM 9722  C CG1   . VAL J  1 127 ? -81.975 -18.813 38.758  1.00 0.00 ? 133 VAL J CG1   1 
ATOM 9723  C CG2   . VAL J  1 127 ? -82.564 -18.772 36.329  1.00 0.00 ? 133 VAL J CG2   1 
ATOM 9724  N N     . SER J  1 128 ? -81.784 -22.125 39.545  1.00 0.00 ? 134 SER J N     1 
ATOM 9725  C CA    . SER J  1 128 ? -81.867 -22.748 40.861  1.00 0.00 ? 134 SER J CA    1 
ATOM 9726  C C     . SER J  1 128 ? -80.488 -22.985 41.470  1.00 0.00 ? 134 SER J C     1 
ATOM 9727  O O     . SER J  1 128 ? -80.154 -22.402 42.505  1.00 0.00 ? 134 SER J O     1 
ATOM 9728  C CB    . SER J  1 128 ? -82.615 -24.063 40.762  1.00 0.00 ? 134 SER J CB    1 
ATOM 9729  O OG    . SER J  1 128 ? -82.698 -24.694 42.008  1.00 0.00 ? 134 SER J OG    1 
ATOM 9730  O OXT   . SER J  1 128 ? -79.820 -23.938 41.071  1.00 0.00 ? 134 SER J OXT   1 
ATOM 9731  N N     . SER K  1 1   ? -61.886 -12.709 32.172  1.00 0.00 ? 7   SER K N     1 
ATOM 9732  C CA    . SER K  1 1   ? -62.274 -11.386 32.634  1.00 0.00 ? 7   SER K CA    1 
ATOM 9733  C C     . SER K  1 1   ? -61.117 -10.668 33.311  1.00 0.00 ? 7   SER K C     1 
ATOM 9734  O O     . SER K  1 1   ? -60.199 -11.304 33.829  1.00 0.00 ? 7   SER K O     1 
ATOM 9735  C CB    . SER K  1 1   ? -63.431 -11.463 33.567  1.00 0.00 ? 7   SER K CB    1 
ATOM 9736  O OG    . SER K  1 1   ? -63.744 -10.187 34.043  1.00 0.00 ? 7   SER K OG    1 
ATOM 9737  N N     . ARG K  1 2   ? -61.140 -9.338  33.263  1.00 0.00 ? 8   ARG K N     1 
ATOM 9738  C CA    . ARG K  1 2   ? -60.049 -8.534  33.803  1.00 0.00 ? 8   ARG K CA    1 
ATOM 9739  C C     . ARG K  1 2   ? -60.530 -7.354  34.624  1.00 0.00 ? 8   ARG K C     1 
ATOM 9740  O O     . ARG K  1 2   ? -61.338 -6.550  34.165  1.00 0.00 ? 8   ARG K O     1 
ATOM 9741  C CB    . ARG K  1 2   ? -59.214 -8.001  32.685  1.00 0.00 ? 8   ARG K CB    1 
ATOM 9742  C CG    . ARG K  1 2   ? -58.495 -9.040  31.855  1.00 0.00 ? 8   ARG K CG    1 
ATOM 9743  C CD    . ARG K  1 2   ? -57.376 -9.645  32.577  1.00 0.00 ? 8   ARG K CD    1 
ATOM 9744  N NE    . ARG K  1 2   ? -56.649 -10.564 31.739  1.00 0.00 ? 8   ARG K NE    1 
ATOM 9745  C CZ    . ARG K  1 2   ? -56.940 -11.860 31.602  1.00 0.00 ? 8   ARG K CZ    1 
ATOM 9746  N NH1   . ARG K  1 2   ? -57.940 -12.393 32.261  1.00 0.00 ? 8   ARG K NH1   1 
ATOM 9747  N NH2   . ARG K  1 2   ? -56.219 -12.632 30.808  1.00 0.00 ? 8   ARG K NH2   1 
ATOM 9748  N N     . SER K  1 3   ? -59.988 -7.231  35.828  1.00 0.00 ? 9   SER K N     1 
ATOM 9749  C CA    . SER K  1 3   ? -60.259 -6.100  36.709  1.00 0.00 ? 9   SER K CA    1 
ATOM 9750  C C     . SER K  1 3   ? -59.454 -4.909  36.283  1.00 0.00 ? 9   SER K C     1 
ATOM 9751  O O     . SER K  1 3   ? -58.521 -5.050  35.507  1.00 0.00 ? 9   SER K O     1 
ATOM 9752  C CB    . SER K  1 3   ? -59.881 -6.456  38.115  1.00 0.00 ? 9   SER K CB    1 
ATOM 9753  O OG    . SER K  1 3   ? -58.490 -6.643  38.213  1.00 0.00 ? 9   SER K OG    1 
ATOM 9754  N N     . TYR K  1 4   ? -59.756 -3.745  36.836  1.00 0.00 ? 10  TYR K N     1 
ATOM 9755  C CA    . TYR K  1 4   ? -58.986 -2.554  36.521  1.00 0.00 ? 10  TYR K CA    1 
ATOM 9756  C C     . TYR K  1 4   ? -57.523 -2.754  36.754  1.00 0.00 ? 10  TYR K C     1 
ATOM 9757  O O     . TYR K  1 4   ? -56.705 -2.368  35.925  1.00 0.00 ? 10  TYR K O     1 
ATOM 9758  C CB    . TYR K  1 4   ? -59.430 -1.356  37.316  1.00 0.00 ? 10  TYR K CB    1 
ATOM 9759  C CG    . TYR K  1 4   ? -58.456 -0.225  37.154  1.00 0.00 ? 10  TYR K CG    1 
ATOM 9760  C CD1   . TYR K  1 4   ? -58.419 0.507   35.983  1.00 0.00 ? 10  TYR K CD1   1 
ATOM 9761  C CD2   . TYR K  1 4   ? -57.564 0.046   38.165  1.00 0.00 ? 10  TYR K CD2   1 
ATOM 9762  C CE1   . TYR K  1 4   ? -57.488 1.511   35.830  1.00 0.00 ? 10  TYR K CE1   1 
ATOM 9763  C CE2   . TYR K  1 4   ? -56.635 1.044   38.014  1.00 0.00 ? 10  TYR K CE2   1 
ATOM 9764  C CZ    . TYR K  1 4   ? -56.594 1.772   36.855  1.00 0.00 ? 10  TYR K CZ    1 
ATOM 9765  O OH    . TYR K  1 4   ? -55.656 2.761   36.711  1.00 0.00 ? 10  TYR K OH    1 
ATOM 9766  N N     . SER K  1 5   ? -57.176 -3.314  37.907  1.00 0.00 ? 11  SER K N     1 
ATOM 9767  C CA    . SER K  1 5   ? -55.784 -3.560  38.223  1.00 0.00 ? 11  SER K CA    1 
ATOM 9768  C C     . SER K  1 5   ? -55.114 -4.300  37.089  1.00 0.00 ? 11  SER K C     1 
ATOM 9769  O O     . SER K  1 5   ? -54.021 -3.935  36.661  1.00 0.00 ? 11  SER K O     1 
ATOM 9770  C CB    . SER K  1 5   ? -55.659 -4.368  39.512  1.00 0.00 ? 11  SER K CB    1 
ATOM 9771  O OG    . SER K  1 5   ? -56.086 -3.628  40.622  1.00 0.00 ? 11  SER K OG    1 
ATOM 9772  N N     . GLN K  1 6   ? -55.786 -5.323  36.583  1.00 0.00 ? 12  GLN K N     1 
ATOM 9773  C CA    . GLN K  1 6   ? -55.265 -6.111  35.490  1.00 0.00 ? 12  GLN K CA    1 
ATOM 9774  C C     . GLN K  1 6   ? -55.241 -5.345  34.184  1.00 0.00 ? 12  GLN K C     1 
ATOM 9775  O O     . GLN K  1 6   ? -54.279 -5.445  33.426  1.00 0.00 ? 12  GLN K O     1 
ATOM 9776  C CB    . GLN K  1 6   ? -56.083 -7.358  35.338  1.00 0.00 ? 12  GLN K CB    1 
ATOM 9777  C CG    . GLN K  1 6   ? -55.893 -8.335  36.465  1.00 0.00 ? 12  GLN K CG    1 
ATOM 9778  C CD    . GLN K  1 6   ? -56.928 -9.422  36.457  1.00 0.00 ? 12  GLN K CD    1 
ATOM 9779  O OE1   . GLN K  1 6   ? -58.101 -9.153  36.736  1.00 0.00 ? 12  GLN K OE1   1 
ATOM 9780  N NE2   . GLN K  1 6   ? -56.520 -10.645 36.136  1.00 0.00 ? 12  GLN K NE2   1 
ATOM 9781  N N     . ARG K  1 7   ? -56.288 -4.566  33.924  1.00 0.00 ? 13  ARG K N     1 
ATOM 9782  C CA    . ARG K  1 7   ? -56.373 -3.800  32.689  1.00 0.00 ? 13  ARG K CA    1 
ATOM 9783  C C     . ARG K  1 7   ? -55.193 -2.899  32.559  1.00 0.00 ? 13  ARG K C     1 
ATOM 9784  O O     . ARG K  1 7   ? -54.501 -2.896  31.541  1.00 0.00 ? 13  ARG K O     1 
ATOM 9785  C CB    . ARG K  1 7   ? -57.623 -2.929  32.664  1.00 0.00 ? 13  ARG K CB    1 
ATOM 9786  C CG    . ARG K  1 7   ? -58.934 -3.664  32.572  1.00 0.00 ? 13  ARG K CG    1 
ATOM 9787  C CD    . ARG K  1 7   ? -60.062 -2.738  32.353  1.00 0.00 ? 13  ARG K CD    1 
ATOM 9788  N NE    . ARG K  1 7   ? -60.015 -2.149  31.025  1.00 0.00 ? 13  ARG K NE    1 
ATOM 9789  C CZ    . ARG K  1 7   ? -60.775 -1.118  30.616  1.00 0.00 ? 13  ARG K CZ    1 
ATOM 9790  N NH1   . ARG K  1 7   ? -61.630 -0.563  31.445  1.00 0.00 ? 13  ARG K NH1   1 
ATOM 9791  N NH2   . ARG K  1 7   ? -60.669 -0.660  29.376  1.00 0.00 ? 13  ARG K NH2   1 
ATOM 9792  N N     . TYR K  1 8   ? -54.963 -2.133  33.600  1.00 0.00 ? 14  TYR K N     1 
ATOM 9793  C CA    . TYR K  1 8   ? -53.896 -1.189  33.633  1.00 0.00 ? 14  TYR K CA    1 
ATOM 9794  C C     . TYR K  1 8   ? -52.559 -1.846  33.618  1.00 0.00 ? 14  TYR K C     1 
ATOM 9795  O O     . TYR K  1 8   ? -51.679 -1.418  32.884  1.00 0.00 ? 14  TYR K O     1 
ATOM 9796  C CB    . TYR K  1 8   ? -54.021 -0.300  34.835  1.00 0.00 ? 14  TYR K CB    1 
ATOM 9797  C CG    . TYR K  1 8   ? -52.856 0.606   34.984  1.00 0.00 ? 14  TYR K CG    1 
ATOM 9798  C CD1   . TYR K  1 8   ? -52.408 1.318   33.900  1.00 0.00 ? 14  TYR K CD1   1 
ATOM 9799  C CD2   . TYR K  1 8   ? -52.230 0.726   36.202  1.00 0.00 ? 14  TYR K CD2   1 
ATOM 9800  C CE1   . TYR K  1 8   ? -51.327 2.143   34.028  1.00 0.00 ? 14  TYR K CE1   1 
ATOM 9801  C CE2   . TYR K  1 8   ? -51.145 1.552   36.335  1.00 0.00 ? 14  TYR K CE2   1 
ATOM 9802  C CZ    . TYR K  1 8   ? -50.691 2.254   35.246  1.00 0.00 ? 14  TYR K CZ    1 
ATOM 9803  O OH    . TYR K  1 8   ? -49.596 3.066   35.364  1.00 0.00 ? 14  TYR K OH    1 
ATOM 9804  N N     . ALA K  1 9   ? -52.381 -2.864  34.445  1.00 0.00 ? 15  ALA K N     1 
ATOM 9805  C CA    . ALA K  1 9   ? -51.098 -3.540  34.535  1.00 0.00 ? 15  ALA K CA    1 
ATOM 9806  C C     . ALA K  1 9   ? -50.573 -3.923  33.169  1.00 0.00 ? 15  ALA K C     1 
ATOM 9807  O O     . ALA K  1 9   ? -49.438 -3.589  32.818  1.00 0.00 ? 15  ALA K O     1 
ATOM 9808  C CB    . ALA K  1 9   ? -51.219 -4.777  35.400  1.00 0.00 ? 15  ALA K CB    1 
ATOM 9809  N N     . LYS K  1 10  ? -51.387 -4.620  32.394  1.00 0.00 ? 16  LYS K N     1 
ATOM 9810  C CA    . LYS K  1 10  ? -50.943 -5.073  31.103  1.00 0.00 ? 16  LYS K CA    1 
ATOM 9811  C C     . LYS K  1 10  ? -50.782 -3.928  30.141  1.00 0.00 ? 16  LYS K C     1 
ATOM 9812  O O     . LYS K  1 10  ? -49.844 -3.915  29.350  1.00 0.00 ? 16  LYS K O     1 
ATOM 9813  C CB    . LYS K  1 10  ? -51.871 -6.092  30.527  1.00 0.00 ? 16  LYS K CB    1 
ATOM 9814  C CG    . LYS K  1 10  ? -51.329 -6.724  29.273  1.00 0.00 ? 16  LYS K CG    1 
ATOM 9815  C CD    . LYS K  1 10  ? -52.208 -7.839  28.786  1.00 0.00 ? 16  LYS K CD    1 
ATOM 9816  C CE    . LYS K  1 10  ? -51.573 -8.527  27.599  1.00 0.00 ? 16  LYS K CE    1 
ATOM 9817  N NZ    . LYS K  1 10  ? -52.441 -9.584  27.027  1.00 0.00 ? 16  LYS K NZ    1 
ATOM 9818  N N     . TRP K  1 11  ? -51.682 -2.948  30.210  1.00 0.00 ? 17  TRP K N     1 
ATOM 9819  C CA    . TRP K  1 11  ? -51.570 -1.779  29.359  1.00 0.00 ? 17  TRP K CA    1 
ATOM 9820  C C     . TRP K  1 11  ? -50.249 -1.113  29.546  1.00 0.00 ? 17  TRP K C     1 
ATOM 9821  O O     . TRP K  1 11  ? -49.630 -0.669  28.583  1.00 0.00 ? 17  TRP K O     1 
ATOM 9822  C CB    . TRP K  1 11  ? -52.656 -0.774  29.658  1.00 0.00 ? 17  TRP K CB    1 
ATOM 9823  C CG    . TRP K  1 11  ? -52.520 0.474   28.850  1.00 0.00 ? 17  TRP K CG    1 
ATOM 9824  C CD1   . TRP K  1 11  ? -53.033 0.697   27.613  1.00 0.00 ? 17  TRP K CD1   1 
ATOM 9825  C CD2   . TRP K  1 11  ? -51.823 1.686   29.218  1.00 0.00 ? 17  TRP K CD2   1 
ATOM 9826  N NE1   . TRP K  1 11  ? -52.712 1.961   27.192  1.00 0.00 ? 17  TRP K NE1   1 
ATOM 9827  C CE2   . TRP K  1 11  ? -51.971 2.579   28.158  1.00 0.00 ? 17  TRP K CE2   1 
ATOM 9828  C CE3   . TRP K  1 11  ? -51.108 2.083   30.343  1.00 0.00 ? 17  TRP K CE3   1 
ATOM 9829  C CZ2   . TRP K  1 11  ? -51.427 3.850   28.189  1.00 0.00 ? 17  TRP K CZ2   1 
ATOM 9830  C CZ3   . TRP K  1 11  ? -50.564 3.357   30.377  1.00 0.00 ? 17  TRP K CZ3   1 
ATOM 9831  C CH2   . TRP K  1 11  ? -50.719 4.218   29.327  1.00 0.00 ? 17  TRP K CH2   1 
ATOM 9832  N N     . GLN K  1 12  ? -49.821 -1.014  30.788  1.00 0.00 ? 18  GLN K N     1 
ATOM 9833  C CA    . GLN K  1 12  ? -48.585 -0.371  31.101  1.00 0.00 ? 18  GLN K CA    1 
ATOM 9834  C C     . GLN K  1 12  ? -47.428 -1.116  30.526  1.00 0.00 ? 18  GLN K C     1 
ATOM 9835  O O     . GLN K  1 12  ? -46.528 -0.520  29.943  1.00 0.00 ? 18  GLN K O     1 
ATOM 9836  C CB    . GLN K  1 12  ? -48.411 -0.278  32.594  1.00 0.00 ? 18  GLN K CB    1 
ATOM 9837  C CG    . GLN K  1 12  ? -47.213 0.519   32.992  1.00 0.00 ? 18  GLN K CG    1 
ATOM 9838  C CD    . GLN K  1 12  ? -47.385 1.941   32.605  1.00 0.00 ? 18  GLN K CD    1 
ATOM 9839  O OE1   . GLN K  1 12  ? -48.339 2.575   33.052  1.00 0.00 ? 18  GLN K OE1   1 
ATOM 9840  N NE2   . GLN K  1 12  ? -46.493 2.470   31.778  1.00 0.00 ? 18  GLN K NE2   1 
ATOM 9841  N N     . ALA K  1 13  ? -47.452 -2.430  30.663  1.00 0.00 ? 19  ALA K N     1 
ATOM 9842  C CA    . ALA K  1 13  ? -46.372 -3.258  30.167  1.00 0.00 ? 19  ALA K CA    1 
ATOM 9843  C C     . ALA K  1 13  ? -46.209 -3.114  28.675  1.00 0.00 ? 19  ALA K C     1 
ATOM 9844  O O     . ALA K  1 13  ? -45.089 -3.012  28.175  1.00 0.00 ? 19  ALA K O     1 
ATOM 9845  C CB    . ALA K  1 13  ? -46.623 -4.703  30.525  1.00 0.00 ? 19  ALA K CB    1 
ATOM 9846  N N     . LYS K  1 14  ? -47.321 -3.075  27.962  1.00 0.00 ? 20  LYS K N     1 
ATOM 9847  C CA    . LYS K  1 14  ? -47.273 -2.974  26.525  1.00 0.00 ? 20  LYS K CA    1 
ATOM 9848  C C     . LYS K  1 14  ? -46.904 -1.603  26.077  1.00 0.00 ? 20  LYS K C     1 
ATOM 9849  O O     . LYS K  1 14  ? -46.185 -1.448  25.093  1.00 0.00 ? 20  LYS K O     1 
ATOM 9850  C CB    . LYS K  1 14  ? -48.600 -3.376  25.927  1.00 0.00 ? 20  LYS K CB    1 
ATOM 9851  C CG    . LYS K  1 14  ? -48.928 -4.832  26.136  1.00 0.00 ? 20  LYS K CG    1 
ATOM 9852  C CD    . LYS K  1 14  ? -47.940 -5.708  25.395  1.00 0.00 ? 20  LYS K CD    1 
ATOM 9853  C CE    . LYS K  1 14  ? -48.273 -5.807  23.917  1.00 0.00 ? 20  LYS K CE    1 
ATOM 9854  N NZ    . LYS K  1 14  ? -49.365 -6.782  23.674  1.00 0.00 ? 20  LYS K NZ    1 
ATOM 9855  N N     . PHE K  1 15  ? -47.347 -0.596  26.811  1.00 0.00 ? 21  PHE K N     1 
ATOM 9856  C CA    . PHE K  1 15  ? -46.983 0.760   26.485  1.00 0.00 ? 21  PHE K CA    1 
ATOM 9857  C C     . PHE K  1 15  ? -45.486 0.931   26.603  1.00 0.00 ? 21  PHE K C     1 
ATOM 9858  O O     . PHE K  1 15  ? -44.844 1.501   25.720  1.00 0.00 ? 21  PHE K O     1 
ATOM 9859  C CB    . PHE K  1 15  ? -47.678 1.751   27.389  1.00 0.00 ? 21  PHE K CB    1 
ATOM 9860  C CG    . PHE K  1 15  ? -47.383 3.153   27.001  1.00 0.00 ? 21  PHE K CG    1 
ATOM 9861  C CD1   . PHE K  1 15  ? -48.156 3.796   26.050  1.00 0.00 ? 21  PHE K CD1   1 
ATOM 9862  C CD2   . PHE K  1 15  ? -46.305 3.821   27.536  1.00 0.00 ? 21  PHE K CD2   1 
ATOM 9863  C CE1   . PHE K  1 15  ? -47.863 5.086   25.654  1.00 0.00 ? 21  PHE K CE1   1 
ATOM 9864  C CE2   . PHE K  1 15  ? -46.006 5.107   27.138  1.00 0.00 ? 21  PHE K CE2   1 
ATOM 9865  C CZ    . PHE K  1 15  ? -46.787 5.740   26.197  1.00 0.00 ? 21  PHE K CZ    1 
ATOM 9866  N N     . ASN K  1 16  ? -44.932 0.433   27.703  1.00 0.00 ? 22  ASN K N     1 
ATOM 9867  C CA    . ASN K  1 16  ? -43.512 0.514   27.949  1.00 0.00 ? 22  ASN K CA    1 
ATOM 9868  C C     . ASN K  1 16  ? -42.741 -0.144  26.841  1.00 0.00 ? 22  ASN K C     1 
ATOM 9869  O O     . ASN K  1 16  ? -41.792 0.427   26.306  1.00 0.00 ? 22  ASN K O     1 
ATOM 9870  C CB    . ASN K  1 16  ? -43.165 -0.153  29.254  1.00 0.00 ? 22  ASN K CB    1 
ATOM 9871  C CG    . ASN K  1 16  ? -43.672 0.589   30.437  1.00 0.00 ? 22  ASN K CG    1 
ATOM 9872  O OD1   . ASN K  1 16  ? -44.110 1.737   30.332  1.00 0.00 ? 22  ASN K OD1   1 
ATOM 9873  N ND2   . ASN K  1 16  ? -43.624 -0.041  31.577  1.00 0.00 ? 22  ASN K ND2   1 
ATOM 9874  N N     . ALA K  1 17  ? -43.174 -1.345  26.460  1.00 0.00 ? 23  ALA K N     1 
ATOM 9875  C CA    . ALA K  1 17  ? -42.517 -2.088  25.411  1.00 0.00 ? 23  ALA K CA    1 
ATOM 9876  C C     . ALA K  1 17  ? -42.467 -1.293  24.136  1.00 0.00 ? 23  ALA K C     1 
ATOM 9877  O O     . ALA K  1 17  ? -41.404 -1.124  23.543  1.00 0.00 ? 23  ALA K O     1 
ATOM 9878  C CB    . ALA K  1 17  ? -43.235 -3.400  25.172  1.00 0.00 ? 23  ALA K CB    1 
ATOM 9879  N N     . PHE K  1 18  ? -43.612 -0.773  23.726  1.00 0.00 ? 24  PHE K N     1 
ATOM 9880  C CA    . PHE K  1 18  ? -43.705 -0.018  22.500  1.00 0.00 ? 24  PHE K CA    1 
ATOM 9881  C C     . PHE K  1 18  ? -42.799 1.182   22.481  1.00 0.00 ? 24  PHE K C     1 
ATOM 9882  O O     . PHE K  1 18  ? -42.218 1.496   21.450  1.00 0.00 ? 24  PHE K O     1 
ATOM 9883  C CB    . PHE K  1 18  ? -45.122 0.407   22.232  1.00 0.00 ? 24  PHE K CB    1 
ATOM 9884  C CG    . PHE K  1 18  ? -45.259 1.191   20.965  1.00 0.00 ? 24  PHE K CG    1 
ATOM 9885  C CD1   . PHE K  1 18  ? -44.896 0.635   19.751  1.00 0.00 ? 24  PHE K CD1   1 
ATOM 9886  C CD2   . PHE K  1 18  ? -45.781 2.472   20.977  1.00 0.00 ? 24  PHE K CD2   1 
ATOM 9887  C CE1   . PHE K  1 18  ? -45.042 1.351   18.578  1.00 0.00 ? 24  PHE K CE1   1 
ATOM 9888  C CE2   . PHE K  1 18  ? -45.934 3.184   19.806  1.00 0.00 ? 24  PHE K CE2   1 
ATOM 9889  C CZ    . PHE K  1 18  ? -45.562 2.625   18.608  1.00 0.00 ? 24  PHE K CZ    1 
ATOM 9890  N N     . SER K  1 19  ? -42.658 1.862   23.617  1.00 0.00 ? 25  SER K N     1 
ATOM 9891  C CA    . SER K  1 19  ? -41.857 3.085   23.670  1.00 0.00 ? 25  SER K CA    1 
ATOM 9892  C C     . SER K  1 19  ? -40.377 2.853   23.348  1.00 0.00 ? 25  SER K C     1 
ATOM 9893  O O     . SER K  1 19  ? -39.647 3.803   23.074  1.00 0.00 ? 25  SER K O     1 
ATOM 9894  C CB    . SER K  1 19  ? -41.954 3.711   25.032  1.00 0.00 ? 25  SER K CB    1 
ATOM 9895  O OG    . SER K  1 19  ? -41.230 2.972   25.978  1.00 0.00 ? 25  SER K OG    1 
ATOM 9896  N N     . ASN K  1 20  ? -39.931 1.599   23.399  1.00 0.00 ? 26  ASN K N     1 
ATOM 9897  C CA    . ASN K  1 20  ? -38.549 1.254   23.088  1.00 0.00 ? 26  ASN K CA    1 
ATOM 9898  C C     . ASN K  1 20  ? -38.212 1.554   21.626  1.00 0.00 ? 26  ASN K C     1 
ATOM 9899  O O     . ASN K  1 20  ? -38.805 0.961   20.735  1.00 0.00 ? 26  ASN K O     1 
ATOM 9900  C CB    . ASN K  1 20  ? -38.312 -0.206  23.387  1.00 0.00 ? 26  ASN K CB    1 
ATOM 9901  C CG    . ASN K  1 20  ? -36.916 -0.652  23.102  1.00 0.00 ? 26  ASN K CG    1 
ATOM 9902  O OD1   . ASN K  1 20  ? -36.383 -0.413  22.007  1.00 0.00 ? 26  ASN K OD1   1 
ATOM 9903  N ND2   . ASN K  1 20  ? -36.309 -1.296  24.061  1.00 0.00 ? 26  ASN K ND2   1 
ATOM 9904  N N     . PRO K  1 21  ? -37.270 2.489   21.374  1.00 0.00 ? 27  PRO K N     1 
ATOM 9905  C CA    . PRO K  1 21  ? -36.791 2.921   20.042  1.00 0.00 ? 27  PRO K CA    1 
ATOM 9906  C C     . PRO K  1 21  ? -36.873 1.844   18.977  1.00 0.00 ? 27  PRO K C     1 
ATOM 9907  O O     . PRO K  1 21  ? -37.348 2.091   17.862  1.00 0.00 ? 27  PRO K O     1 
ATOM 9908  C CB    . PRO K  1 21  ? -35.312 3.241   20.286  1.00 0.00 ? 27  PRO K CB    1 
ATOM 9909  C CG    . PRO K  1 21  ? -35.236 3.609   21.702  1.00 0.00 ? 27  PRO K CG    1 
ATOM 9910  C CD    . PRO K  1 21  ? -36.189 2.671   22.373  1.00 0.00 ? 27  PRO K CD    1 
ATOM 9911  N N     . THR K  1 22  ? -36.374 0.662   19.300  1.00 0.00 ? 28  THR K N     1 
ATOM 9912  C CA    . THR K  1 22  ? -36.253 -0.386  18.321  1.00 0.00 ? 28  THR K CA    1 
ATOM 9913  C C     . THR K  1 22  ? -37.540 -1.102  18.120  1.00 0.00 ? 28  THR K C     1 
ATOM 9914  O O     . THR K  1 22  ? -37.805 -1.608  17.038  1.00 0.00 ? 28  THR K O     1 
ATOM 9915  C CB    . THR K  1 22  ? -35.211 -1.388  18.748  1.00 0.00 ? 28  THR K CB    1 
ATOM 9916  O OG1   . THR K  1 22  ? -35.628 -1.993  19.973  1.00 0.00 ? 28  THR K OG1   1 
ATOM 9917  C CG2   . THR K  1 22  ? -33.877 -0.702  18.955  1.00 0.00 ? 28  THR K CG2   1 
ATOM 9918  N N     . VAL K  1 23  ? -38.357 -1.136  19.141  1.00 0.00 ? 29  VAL K N     1 
ATOM 9919  C CA    . VAL K  1 23  ? -39.619 -1.800  19.044  1.00 0.00 ? 29  VAL K CA    1 
ATOM 9920  C C     . VAL K  1 23  ? -40.571 -0.969  18.260  1.00 0.00 ? 29  VAL K C     1 
ATOM 9921  O O     . VAL K  1 23  ? -41.258 -1.467  17.367  1.00 0.00 ? 29  VAL K O     1 
ATOM 9922  C CB    . VAL K  1 23  ? -40.179 -2.077  20.417  1.00 0.00 ? 29  VAL K CB    1 
ATOM 9923  C CG1   . VAL K  1 23  ? -41.572 -2.652  20.308  1.00 0.00 ? 29  VAL K CG1   1 
ATOM 9924  C CG2   . VAL K  1 23  ? -39.266 -3.026  21.134  1.00 0.00 ? 29  VAL K CG2   1 
ATOM 9925  N N     . ALA K  1 24  ? -40.612 0.308   18.575  1.00 0.00 ? 30  ALA K N     1 
ATOM 9926  C CA    . ALA K  1 24  ? -41.473 1.217   17.873  1.00 0.00 ? 30  ALA K CA    1 
ATOM 9927  C C     . ALA K  1 24  ? -41.124 1.258   16.413  1.00 0.00 ? 30  ALA K C     1 
ATOM 9928  O O     . ALA K  1 24  ? -41.996 1.136   15.562  1.00 0.00 ? 30  ALA K O     1 
ATOM 9929  C CB    . ALA K  1 24  ? -41.370 2.609   18.463  1.00 0.00 ? 30  ALA K CB    1 
ATOM 9930  N N     . SER K  1 25  ? -39.843 1.405   16.115  1.00 0.00 ? 31  SER K N     1 
ATOM 9931  C CA    . SER K  1 25  ? -39.428 1.516   14.744  1.00 0.00 ? 31  SER K CA    1 
ATOM 9932  C C     . SER K  1 25  ? -39.560 0.232   13.989  1.00 0.00 ? 31  SER K C     1 
ATOM 9933  O O     . SER K  1 25  ? -39.901 0.239   12.814  1.00 0.00 ? 31  SER K O     1 
ATOM 9934  C CB    . SER K  1 25  ? -38.025 1.973   14.691  1.00 0.00 ? 31  SER K CB    1 
ATOM 9935  O OG    . SER K  1 25  ? -37.189 1.052   15.320  1.00 0.00 ? 31  SER K OG    1 
ATOM 9936  N N     . THR K  1 26  ? -39.357 -0.891  14.664  1.00 0.00 ? 32  THR K N     1 
ATOM 9937  C CA    . THR K  1 26  ? -39.538 -2.169  14.013  1.00 0.00 ? 32  THR K CA    1 
ATOM 9938  C C     . THR K  1 26  ? -40.945 -2.325  13.549  1.00 0.00 ? 32  THR K C     1 
ATOM 9939  O O     . THR K  1 26  ? -41.195 -2.598  12.379  1.00 0.00 ? 32  THR K O     1 
ATOM 9940  C CB    . THR K  1 26  ? -39.192 -3.331  14.936  1.00 0.00 ? 32  THR K CB    1 
ATOM 9941  O OG1   . THR K  1 26  ? -37.807 -3.280  15.270  1.00 0.00 ? 32  THR K OG1   1 
ATOM 9942  C CG2   . THR K  1 26  ? -39.497 -4.635  14.259  1.00 0.00 ? 32  THR K CG2   1 
ATOM 9943  N N     . ILE K  1 27  ? -41.871 -2.135  14.457  1.00 0.00 ? 33  ILE K N     1 
ATOM 9944  C CA    . ILE K  1 27  ? -43.254 -2.309  14.142  1.00 0.00 ? 33  ILE K CA    1 
ATOM 9945  C C     . ILE K  1 27  ? -43.724 -1.315  13.120  1.00 0.00 ? 33  ILE K C     1 
ATOM 9946  O O     . ILE K  1 27  ? -44.320 -1.690  12.115  1.00 0.00 ? 33  ILE K O     1 
ATOM 9947  C CB    . ILE K  1 27  ? -44.100 -2.169  15.387  1.00 0.00 ? 33  ILE K CB    1 
ATOM 9948  C CG1   . ILE K  1 27  ? -43.819 -3.312  16.337  1.00 0.00 ? 33  ILE K CG1   1 
ATOM 9949  C CG2   . ILE K  1 27  ? -45.557 -2.136  15.011  1.00 0.00 ? 33  ILE K CG2   1 
ATOM 9950  C CD1   . ILE K  1 27  ? -44.395 -3.100  17.704  1.00 0.00 ? 33  ILE K CD1   1 
ATOM 9951  N N     . LEU K  1 28  ? -43.461 -0.046  13.376  1.00 0.00 ? 34  LEU K N     1 
ATOM 9952  C CA    . LEU K  1 28  ? -43.969 1.016   12.546  1.00 0.00 ? 34  LEU K CA    1 
ATOM 9953  C C     . LEU K  1 28  ? -43.397 0.995   11.154  1.00 0.00 ? 34  LEU K C     1 
ATOM 9954  O O     . LEU K  1 28  ? -44.112 1.252   10.187  1.00 0.00 ? 34  LEU K O     1 
ATOM 9955  C CB    . LEU K  1 28  ? -43.676 2.345   13.203  1.00 0.00 ? 34  LEU K CB    1 
ATOM 9956  C CG    . LEU K  1 28  ? -44.444 2.606   14.497  1.00 0.00 ? 34  LEU K CG    1 
ATOM 9957  C CD1   . LEU K  1 28  ? -43.905 3.858   15.156  1.00 0.00 ? 34  LEU K CD1   1 
ATOM 9958  C CD2   . LEU K  1 28  ? -45.919 2.745   14.181  1.00 0.00 ? 34  LEU K CD2   1 
ATOM 9959  N N     . SER K  1 29  ? -42.121 0.662   11.028  1.00 0.00 ? 35  SER K N     1 
ATOM 9960  C CA    . SER K  1 29  ? -41.522 0.598   9.716   1.00 0.00 ? 35  SER K CA    1 
ATOM 9961  C C     . SER K  1 29  ? -42.009 -0.615  8.951   1.00 0.00 ? 35  SER K C     1 
ATOM 9962  O O     . SER K  1 29  ? -42.109 -0.576  7.726   1.00 0.00 ? 35  SER K O     1 
ATOM 9963  C CB    . SER K  1 29  ? -40.029 0.561   9.818   1.00 0.00 ? 35  SER K CB    1 
ATOM 9964  O OG    . SER K  1 29  ? -39.601 -0.627  10.414  1.00 0.00 ? 35  SER K OG    1 
ATOM 9965  N N     . ASN K  1 30  ? -42.366 -1.681  9.667   1.00 0.00 ? 36  ASN K N     1 
ATOM 9966  C CA    . ASN K  1 30  ? -42.886 -2.860  9.007   1.00 0.00 ? 36  ASN K CA    1 
ATOM 9967  C C     . ASN K  1 30  ? -44.291 -2.658  8.506   1.00 0.00 ? 36  ASN K C     1 
ATOM 9968  O O     . ASN K  1 30  ? -44.642 -3.144  7.437   1.00 0.00 ? 36  ASN K O     1 
ATOM 9969  C CB    . ASN K  1 30  ? -42.816 -4.059  9.908   1.00 0.00 ? 36  ASN K CB    1 
ATOM 9970  C CG    . ASN K  1 30  ? -41.416 -4.558  10.054  1.00 0.00 ? 36  ASN K CG    1 
ATOM 9971  O OD1   . ASN K  1 30  ? -40.516 -4.115  9.334   1.00 0.00 ? 36  ASN K OD1   1 
ATOM 9972  N ND2   . ASN K  1 30  ? -41.211 -5.485  10.949  1.00 0.00 ? 36  ASN K ND2   1 
ATOM 9973  N N     . VAL K  1 31  ? -45.098 -1.908  9.252   1.00 0.00 ? 37  VAL K N     1 
ATOM 9974  C CA    . VAL K  1 31  ? -46.481 -1.695  8.848   1.00 0.00 ? 37  VAL K CA    1 
ATOM 9975  C C     . VAL K  1 31  ? -46.656 -0.426  8.079   1.00 0.00 ? 37  VAL K C     1 
ATOM 9976  O O     . VAL K  1 31  ? -47.778 -0.071  7.740   1.00 0.00 ? 37  VAL K O     1 
ATOM 9977  C CB    . VAL K  1 31  ? -47.414 -1.645  10.049  1.00 0.00 ? 37  VAL K CB    1 
ATOM 9978  C CG1   . VAL K  1 31  ? -47.305 -2.916  10.857  1.00 0.00 ? 37  VAL K CG1   1 
ATOM 9979  C CG2   . VAL K  1 31  ? -47.102 -0.426  10.883  1.00 0.00 ? 37  VAL K CG2   1 
ATOM 9980  N N     . SER K  1 32  ? -45.558 0.276   7.814   1.00 0.00 ? 38  SER K N     1 
ATOM 9981  C CA    . SER K  1 32  ? -45.610 1.501   7.040   1.00 0.00 ? 38  SER K CA    1 
ATOM 9982  C C     . SER K  1 32  ? -46.422 1.346   5.747   1.00 0.00 ? 38  SER K C     1 
ATOM 9983  O O     . SER K  1 32  ? -47.549 1.829   5.683   1.00 0.00 ? 38  SER K O     1 
ATOM 9984  C CB    . SER K  1 32  ? -44.211 2.024   6.756   1.00 0.00 ? 38  SER K CB    1 
ATOM 9985  O OG    . SER K  1 32  ? -43.605 2.493   7.925   1.00 0.00 ? 38  SER K OG    1 
ATOM 9986  N N     . PRO K  1 33  ? -45.853 0.716   4.694   1.00 0.00 ? 39  PRO K N     1 
ATOM 9987  C CA    . PRO K  1 33  ? -46.501 0.581   3.389   1.00 0.00 ? 39  PRO K CA    1 
ATOM 9988  C C     . PRO K  1 33  ? -47.914 -0.026  3.483   1.00 0.00 ? 39  PRO K C     1 
ATOM 9989  O O     . PRO K  1 33  ? -48.768 0.246   2.638   1.00 0.00 ? 39  PRO K O     1 
ATOM 9990  C CB    . PRO K  1 33  ? -45.588 -0.371  2.651   1.00 0.00 ? 39  PRO K CB    1 
ATOM 9991  C CG    . PRO K  1 33  ? -45.098 -1.297  3.700   1.00 0.00 ? 39  PRO K CG    1 
ATOM 9992  C CD    . PRO K  1 33  ? -45.033 -0.492  4.962   1.00 0.00 ? 39  PRO K CD    1 
ATOM 9993  N N     . VAL K  1 34  ? -48.162 -0.818  4.524   1.00 0.00 ? 40  VAL K N     1 
ATOM 9994  C CA    . VAL K  1 34  ? -49.451 -1.423  4.718   1.00 0.00 ? 40  VAL K CA    1 
ATOM 9995  C C     . VAL K  1 34  ? -50.448 -0.374  5.115   1.00 0.00 ? 40  VAL K C     1 
ATOM 9996  O O     . VAL K  1 34  ? -51.524 -0.267  4.526   1.00 0.00 ? 40  VAL K O     1 
ATOM 9997  C CB    . VAL K  1 34  ? -49.376 -2.488  5.807   1.00 0.00 ? 40  VAL K CB    1 
ATOM 9998  C CG1   . VAL K  1 34  ? -50.761 -3.024  6.106   1.00 0.00 ? 40  VAL K CG1   1 
ATOM 9999  C CG2   . VAL K  1 34  ? -48.439 -3.599  5.376   1.00 0.00 ? 40  VAL K CG2   1 
ATOM 10000 N N     . ALA K  1 35  ? -50.076 0.426   6.101   1.00 0.00 ? 41  ALA K N     1 
ATOM 10001 C CA    . ALA K  1 35  ? -50.908 1.503   6.566   1.00 0.00 ? 41  ALA K CA    1 
ATOM 10002 C C     . ALA K  1 35  ? -51.167 2.481   5.462   1.00 0.00 ? 41  ALA K C     1 
ATOM 10003 O O     . ALA K  1 35  ? -52.274 2.994   5.329   1.00 0.00 ? 41  ALA K O     1 
ATOM 10004 C CB    . ALA K  1 35  ? -50.254 2.205   7.740   1.00 0.00 ? 41  ALA K CB    1 
ATOM 10005 N N     . GLN K  1 36  ? -50.150 2.723   4.646   1.00 0.00 ? 42  GLN K N     1 
ATOM 10006 C CA    . GLN K  1 36  ? -50.261 3.651   3.546   1.00 0.00 ? 42  GLN K CA    1 
ATOM 10007 C C     . GLN K  1 36  ? -51.340 3.227   2.617   1.00 0.00 ? 42  GLN K C     1 
ATOM 10008 O O     . GLN K  1 36  ? -52.165 4.036   2.203   1.00 0.00 ? 42  GLN K O     1 
ATOM 10009 C CB    . GLN K  1 36  ? -48.957 3.733   2.795   1.00 0.00 ? 42  GLN K CB    1 
ATOM 10010 C CG    . GLN K  1 36  ? -47.847 4.354   3.590   1.00 0.00 ? 42  GLN K CG    1 
ATOM 10011 C CD    . GLN K  1 36  ? -46.548 4.389   2.832   1.00 0.00 ? 42  GLN K CD    1 
ATOM 10012 O OE1   . GLN K  1 36  ? -46.529 4.607   1.618   1.00 0.00 ? 42  GLN K OE1   1 
ATOM 10013 N NE2   . GLN K  1 36  ? -45.450 4.171   3.538   1.00 0.00 ? 42  GLN K NE2   1 
ATOM 10014 N N     . GLN K  1 37  ? -51.366 1.942   2.310   1.00 0.00 ? 43  GLN K N     1 
ATOM 10015 C CA    . GLN K  1 37  ? -52.391 1.396   1.461   1.00 0.00 ? 43  GLN K CA    1 
ATOM 10016 C C     . GLN K  1 37  ? -53.757 1.630   2.028   1.00 0.00 ? 43  GLN K C     1 
ATOM 10017 O O     . GLN K  1 37  ? -54.665 2.064   1.318   1.00 0.00 ? 43  GLN K O     1 
ATOM 10018 C CB    . GLN K  1 37  ? -52.183 -0.095  1.277   1.00 0.00 ? 43  GLN K CB    1 
ATOM 10019 C CG    . GLN K  1 37  ? -53.214 -0.740  0.397   1.00 0.00 ? 43  GLN K CG    1 
ATOM 10020 C CD    . GLN K  1 37  ? -53.113 -0.273  -1.025  1.00 0.00 ? 43  GLN K CD    1 
ATOM 10021 O OE1   . GLN K  1 37  ? -52.044 -0.346  -1.632  1.00 0.00 ? 43  GLN K OE1   1 
ATOM 10022 N NE2   . GLN K  1 37  ? -54.220 0.214   -1.575  1.00 0.00 ? 43  GLN K NE2   1 
ATOM 10023 N N     . ASN K  1 38  ? -53.911 1.347   3.310   1.00 0.00 ? 44  ASN K N     1 
ATOM 10024 C CA    . ASN K  1 38  ? -55.196 1.455   3.959   1.00 0.00 ? 44  ASN K CA    1 
ATOM 10025 C C     . ASN K  1 38  ? -55.678 2.882   4.023   1.00 0.00 ? 44  ASN K C     1 
ATOM 10026 O O     . ASN K  1 38  ? -56.860 3.156   3.803   1.00 0.00 ? 44  ASN K O     1 
ATOM 10027 C CB    . ASN K  1 38  ? -55.120 0.850   5.323   1.00 0.00 ? 44  ASN K CB    1 
ATOM 10028 C CG    . ASN K  1 38  ? -55.020 -0.638  5.246   1.00 0.00 ? 44  ASN K CG    1 
ATOM 10029 O OD1   . ASN K  1 38  ? -55.428 -1.234  4.242   1.00 0.00 ? 44  ASN K OD1   1 
ATOM 10030 N ND2   . ASN K  1 38  ? -54.476 -1.255  6.264   1.00 0.00 ? 44  ASN K ND2   1 
ATOM 10031 N N     . PHE K  1 39  ? -54.764 3.798   4.295   1.00 0.00 ? 45  PHE K N     1 
ATOM 10032 C CA    . PHE K  1 39  ? -55.097 5.201   4.364   1.00 0.00 ? 45  PHE K CA    1 
ATOM 10033 C C     . PHE K  1 39  ? -55.550 5.690   3.017   1.00 0.00 ? 45  PHE K C     1 
ATOM 10034 O O     . PHE K  1 39  ? -56.586 6.329   2.890   1.00 0.00 ? 45  PHE K O     1 
ATOM 10035 C CB    . PHE K  1 39  ? -53.903 6.012   4.797   1.00 0.00 ? 45  PHE K CB    1 
ATOM 10036 C CG    . PHE K  1 39  ? -54.226 7.443   5.031   1.00 0.00 ? 45  PHE K CG    1 
ATOM 10037 C CD1   . PHE K  1 39  ? -54.382 7.923   6.317   1.00 0.00 ? 45  PHE K CD1   1 
ATOM 10038 C CD2   . PHE K  1 39  ? -54.418 8.311   3.976   1.00 0.00 ? 45  PHE K CD2   1 
ATOM 10039 C CE1   . PHE K  1 39  ? -54.680 9.251   6.547   1.00 0.00 ? 45  PHE K CE1   1 
ATOM 10040 C CE2   . PHE K  1 39  ? -54.726 9.640   4.203   1.00 0.00 ? 45  PHE K CE2   1 
ATOM 10041 C CZ    . PHE K  1 39  ? -54.846 10.113  5.489   1.00 0.00 ? 45  PHE K CZ    1 
ATOM 10042 N N     . GLN K  1 40  ? -54.779 5.369   1.993   1.00 0.00 ? 46  GLN K N     1 
ATOM 10043 C CA    . GLN K  1 40  ? -55.100 5.778   0.645   1.00 0.00 ? 46  GLN K CA    1 
ATOM 10044 C C     . GLN K  1 40  ? -56.381 5.163   0.158   1.00 0.00 ? 46  GLN K C     1 
ATOM 10045 O O     . GLN K  1 40  ? -57.133 5.788   -0.584  1.00 0.00 ? 46  GLN K O     1 
ATOM 10046 C CB    . GLN K  1 40  ? -53.986 5.395   -0.298  1.00 0.00 ? 46  GLN K CB    1 
ATOM 10047 C CG    . GLN K  1 40  ? -52.729 6.198   -0.131  1.00 0.00 ? 46  GLN K CG    1 
ATOM 10048 C CD    . GLN K  1 40  ? -51.622 5.658   -0.983  1.00 0.00 ? 46  GLN K CD    1 
ATOM 10049 O OE1   . GLN K  1 40  ? -51.369 4.450   -0.992  1.00 0.00 ? 46  GLN K OE1   1 
ATOM 10050 N NE2   . GLN K  1 40  ? -50.961 6.536   -1.723  1.00 0.00 ? 46  GLN K NE2   1 
ATOM 10051 N N     . THR K  1 41  ? -56.625 3.926   0.540   1.00 0.00 ? 47  THR K N     1 
ATOM 10052 C CA    . THR K  1 41  ? -57.793 3.224   0.076   1.00 0.00 ? 47  THR K CA    1 
ATOM 10053 C C     . THR K  1 41  ? -59.091 3.813   0.599   1.00 0.00 ? 47  THR K C     1 
ATOM 10054 O O     . THR K  1 41  ? -60.039 3.986   -0.160  1.00 0.00 ? 47  THR K O     1 
ATOM 10055 C CB    . THR K  1 41  ? -57.723 1.750   0.464   1.00 0.00 ? 47  T