data_3JCR
# 
_entry.id   3JCR 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.296 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
RCSB  RCSB160537   
PDB   3JCR         
WWPDB D_1000160537 
# 
_pdbx_database_related.db_name        EMDB 
_pdbx_database_related.db_id          EMD-6581 
_pdbx_database_related.content_type   'associated EM volume' 
_pdbx_database_related.details        . 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3JCR 
_pdbx_database_status.recvd_initial_deposition_date   2016-01-21 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  ? 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Agafonov, D.E.' 1 
'Kastner, B.'    2 
'Dybkov, O.'     3 
'Hofele, R.V.'   4 
'Liu, W.T.'      5 
'Urlaub, H.'     6 
'Luhrmann, R.'   7 
'Stark, H.'      8 
# 
_citation.id                        primary 
_citation.title                     'Molecular architecture of the human U4/U6.U5 tri-snRNP.' 
_citation.journal_abbrev            Science 
_citation.journal_volume            351 
_citation.page_first                1416 
_citation.page_last                 1420 
_citation.year                      2016 
_citation.journal_id_ASTM           SCIEAS 
_citation.country                   US 
_citation.journal_id_ISSN           0036-8075 
_citation.journal_id_CSD            0038 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   26912367 
_citation.pdbx_database_id_DOI      10.1126/science.aad2085 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Agafonov, D.E.' 1 
primary 'Kastner, B.'    2 
primary 'Dybkov, O.'     3 
primary 'Hofele, R.V.'   4 
primary 'Liu, W.T.'      5 
primary 'Urlaub, H.'     6 
primary 'Luhrmann, R.'   7 
primary 'Stark, H.'      8 
# 
_cell.entry_id           3JCR 
_cell.length_a           1 
_cell.length_b           1 
_cell.length_c           1 
_cell.angle_alpha        90 
_cell.angle_beta         90 
_cell.angle_gamma        90 
_cell.Z_PDB              1 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3JCR 
_symmetry.space_group_name_H-M             'P 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                1 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1  polymer nat hPrp6      107092.242 1 ?        ? ? ? 
2  polymer nat U5-40K     39359.492  1 ?        ? ? ? 
3  polymer nat hBrr2      244823.422 1 3.6.4.13 ? ? ? 
4  polymer nat hDim1      16807.346  1 ?        ? ? ? 
5  polymer nat hPrp8      273974.250 1 ?        ? ? ? 
6  polymer nat hPrp28     95785.148  1 3.6.4.13 ? ? ? 
7  polymer nat hSnu114    109560.625 1 ?        ? ? ? 
8  polymer nat SmB        24642.131  2 ?        ? ? ? 
9  polymer nat SmD1       13310.653  2 ?        ? ? ? 
10 polymer nat SmD2       13551.928  2 ?        ? ? ? 
11 polymer nat SmD3       13940.308  2 ?        ? ? ? 
12 polymer nat SmE        10817.601  2 ?        ? ? ? 
13 polymer nat SmF        9734.171   2 ?        ? ? ? 
14 polymer nat SmG        8508.084   2 ?        ? ? ? 
15 polymer nat LSm8       10410.589  1 ?        ? ? ? 
16 polymer nat LSm6       9139.571   1 ?        ? ? ? 
17 polymer nat LSm5       9945.448   1 ?        ? ? ? 
18 polymer nat LSm4       15375.775  1 ?        ? ? ? 
19 polymer nat LSm3       11859.390  1 ?        ? ? ? 
20 polymer nat LSm2       10847.495  1 ?        ? ? ? 
21 polymer nat LSm7       11617.363  1 ?        ? ? ? 
22 polymer nat hPrp3      77669.188  1 ?        ? ? ? 
23 polymer nat hPrp4      58407.980  1 ?        ? ? ? 
24 polymer nat hPrp31     55528.969  1 ?        ? ? ? 
25 polymer nat hSnu13     14191.524  1 ?        ? ? ? 
26 polymer nat hSad1      65481.426  1 ?        ? ? ? 
27 polymer nat 'U4 snRNA' 46536.492  1 ?        ? ? ? 
28 polymer nat 'U6 snRNA' 34098.270  1 ?        ? ? ? 
29 polymer nat 'U5 snRNA' 36891.684  1 ?        ? ? ? 
# 
loop_
_entity_name_com.entity_id 
_entity_name_com.name 
1  
;Pre-mRNA-processing factor 6, Androgen receptor N-terminal domain-transactivating protein 1, ANT-1, PRP6 homolog, U5 snRNP-associated 102 kDa protein, U5-102 kDa protein
;
2  
;U5 small nuclear ribonucleoprotein 40 kDa protein, U5 snRNP 40 kDa protein, U5-40K, 38 kDa-splicing factor, Prp8-binding protein, hPRP8BP, U5 snRNP-specific 40 kDa protein, WD repeat-containing protein 57
;
3  
;U5 small nuclear ribonucleoprotein 200 kDa helicase, Activating signal cointegrator 1 complex subunit 3-like 1, BRR2 homolog, U5 snRNP-specific 200 kDa protein, U5-200KD
;
4  
;Thioredoxin-like protein 4A, DIM1 protein homolog, Spliceosomal U5 snRNP-specific 15 kDa protein, Thioredoxin-like U5 snRNP protein U5-15kD
;
5  'Pre-mRNA-processing-splicing factor 8, 220 kDa U5 snRNP-specific protein, PRP8 homolog, Splicing factor Prp8, p220' 
6  'Probable ATP-dependent RNA helicase DDX23, 100 kDa U5 snRNP-specific protein, DEAD box protein 23, PRP28 homolog, U5-100kD' 
7  
;116 kDa U5 small nuclear ribonucleoprotein component, Elongation factor Tu GTP-binding domain-containing protein 2, SNU114 homolog, hSNU114, U5 snRNP-specific protein, 116 kDa, U5-116 kDa
;
8  
;Small nuclear ribonucleoprotein-associated proteins B and B', snRNP-B, Sm protein B/B', Sm-B/B', SmB/B'
;
9  'Small nuclear ribonucleoprotein Sm D1, Sm-D1, Sm-D autoantigen, snRNP core protein D1' 
10 'Small nuclear ribonucleoprotein Sm D2, Sm-D2, snRNP core protein D2' 
11 'Small nuclear ribonucleoprotein Sm D3, Sm-D3, snRNP core protein D3' 
12 'Small nuclear ribonucleoprotein E, snRNP-E, Sm protein E, Sm-E, SmE' 
13 'Small nuclear ribonucleoprotein F, snRNP-F, Sm protein F, Sm-F, SmF' 
14 'Small nuclear ribonucleoprotein G, snRNP-G, Sm protein G, Sm-G, SmG' 
15 'U6 snRNA-associated Sm-like protein LSm8' 
16 'U6 snRNA-associated Sm-like protein LSm6' 
17 'U6 snRNA-associated Sm-like protein LSm5' 
18 'U6 snRNA-associated Sm-like protein LSm4, Glycine-rich protein, GRP' 
19 'U6 snRNA-associated Sm-like protein LSm3' 
20 
;U6 snRNA-associated Sm-like protein LSm2, Protein G7b, Small nuclear ribonuclear protein D homolog, snRNP core Sm-like protein Sm-x5
;
21 'U6 snRNA-associated Sm-like protein LSm7' 
22 'U4/U6 small nuclear ribonucleoprotein Prp3, Pre-mRNA-splicing factor 3, hPrp3, U4/U6 snRNP 90 kDa protein' 
23 '60 kDa U4/U6 snRNP-specific spliceosomal protein, PRP4 pre-mRNA processing factor 4 homolog (Yeast), isoform CRA_b' 
24 
;U4/U6 small nuclear ribonucleoprotein Prp31, Pre-mRNA-processing factor 31, Serologically defined breast cancer antigen NY-BR-99, U4/U6 snRNP 61 kDa protein, Protein 61K, hPrp31
;
25 
;NHP2-like protein 1, High mobility group-like nuclear protein 2 homolog 1, OTK27, SNU13 homolog, hSNU13, U4/U6.U5 small nuclear ribonucleoprotein SNU13, U4/U6.U5 tri-snRNP 15.5 kDa protein, NHP2-like protein 1, N-terminally processed
;
26 
;U4/U6.U5 tri-snRNP-associated protein 2, Inactive ubiquitin-specific peptidase 39, SAD1 homolog, U4/U6.U5 tri-snRNP-associated 65 kDa protein, 65K
;
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1  'polypeptide(L)'   no no 
;MNKKKKPFLGMPAPLGYVPGLGRGATGFTTRSDIGPARDANDPVDDRHAPPGKRTVGDQMKKNQAADDDDEDLNDTNYDE
FNGYAGSLFSSGPYEKDDEEADAIYAALDKRMDERRKERREQREKEEIEKYRMERPKIQQQFSDLKRKLAEVTEEEWLSI
PEVGDARNKRQRNPRYEKLTPVPDSFFAKHLQTGENHTSVDPRQTQFGGLNTPYPGGLNTPYPGGMTPGLMTPGTGELDM
RKIGQARNTLMDMRLSQVSDSVSGQTVVDPKGYLTDLNSMIPTHGGDINDIKKARLLLKSVRETNPHHPPAWIASARLEE
VTGKLQVARNLIMKGTEMCPKSEDVWLEAARLQPGDTAKAVVAQAVRHLPQSVRIYIRAAELETDIRAKKRVLRKALEHV
PNSVRLWKAAVELEEPEDARIMLSRAVECCPTSVELWLALARLETYENARKVLNKARENIPTDRHIWITAAKLEEANGNT
QMVEKIIDRAITSLRANGVEINREQWIQDAEECDRAGSVATCQAVMRAVIGIGIEEEDRKHTWMEDADSCVAHNALECAR
AIYAYALQVFPSKKSVWLRAAYFEKNHGTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPN
SEEIWLAAVKLESENDEYERARRLLAKARSSAPTARVFMKSVKLEWVQDNIRAAQDLCEEALRHYEDFPKLWMMKGQIEE
QKEMMEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGLWLESVRLEYRAGLKNIANTLM
AKALQECPNSGILWSEAIFLEARPQRRTKSVDALKKCEHDPHVLLAVAKLFWSQRKITKAREWFHRTVKIDSDLGDAWAF
FYKFELQHGTEEQQEEVRKRCESAEPRHGELWCAVSKDIANWQKKIGDILRLVAGRIKNTF
;
;MNKKKKPFLGMPAPLGYVPGLGRGATGFTTRSDIGPARDANDPVDDRHAPPGKRTVGDQMKKNQAADDDDEDLNDTNYDE
FNGYAGSLFSSGPYEKDDEEADAIYAALDKRMDERRKERREQREKEEIEKYRMERPKIQQQFSDLKRKLAEVTEEEWLSI
PEVGDARNKRQRNPRYEKLTPVPDSFFAKHLQTGENHTSVDPRQTQFGGLNTPYPGGLNTPYPGGMTPGLMTPGTGELDM
RKIGQARNTLMDMRLSQVSDSVSGQTVVDPKGYLTDLNSMIPTHGGDINDIKKARLLLKSVRETNPHHPPAWIASARLEE
VTGKLQVARNLIMKGTEMCPKSEDVWLEAARLQPGDTAKAVVAQAVRHLPQSVRIYIRAAELETDIRAKKRVLRKALEHV
PNSVRLWKAAVELEEPEDARIMLSRAVECCPTSVELWLALARLETYENARKVLNKARENIPTDRHIWITAAKLEEANGNT
QMVEKIIDRAITSLRANGVEINREQWIQDAEECDRAGSVATCQAVMRAVIGIGIEEEDRKHTWMEDADSCVAHNALECAR
AIYAYALQVFPSKKSVWLRAAYFEKNHGTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPN
SEEIWLAAVKLESENDEYERARRLLAKARSSAPTARVFMKSVKLEWVQDNIRAAQDLCEEALRHYEDFPKLWMMKGQIEE
QKEMMEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGLWLESVRLEYRAGLKNIANTLM
AKALQECPNSGILWSEAIFLEARPQRRTKSVDALKKCEHDPHVLLAVAKLFWSQRKITKAREWFHRTVKIDSDLGDAWAF
FYKFELQHGTEEQQEEVRKRCESAEPRHGELWCAVSKDIANWQKKIGDILRLVAGRIKNTF
;
G   ? 
2  'polypeptide(L)'   no no 
;MIEQQKRKGPELPLVPVKRQRHELLLGAGSGPGAGQQQATPGALLQAGPPRCSSLQAPIMLLSGHEGEVYCCKFHPNGST
LASAGFDRLILLWNVYGDCDNYATLKGHSGAVMELHYNTDGSMLFSASTDKTVAVWDSETGERVKRLKGHTSFVNSCYPA
RRGPQLVCTGSDDGTVKLWDIRKKAAIQTFQNTYQVLAVTFNDTSDQIISGGIDNDIKVWDLRQNKLTYTMRGHADSVTG
LSLSSEGSYLLSNAMDNTVRVWDVRPFAPKERCVKIFQGNVHNFEKNLLRCSWSPDGSKIAAGSADRFVYVWDTTSRRIL
YKLPGHAGSINEVAFHPDEPIIISASSDKRLYMGEIQ
;
;MIEQQKRKGPELPLVPVKRQRHELLLGAGSGPGAGQQQATPGALLQAGPPRCSSLQAPIMLLSGHEGEVYCCKFHPNGST
LASAGFDRLILLWNVYGDCDNYATLKGHSGAVMELHYNTDGSMLFSASTDKTVAVWDSETGERVKRLKGHTSFVNSCYPA
RRGPQLVCTGSDDGTVKLWDIRKKAAIQTFQNTYQVLAVTFNDTSDQIISGGIDNDIKVWDLRQNKLTYTMRGHADSVTG
LSLSSEGSYLLSNAMDNTVRVWDVRPFAPKERCVKIFQGNVHNFEKNLLRCSWSPDGSKIAAGSADRFVYVWDTTSRRIL
YKLPGHAGSINEVAFHPDEPIIISASSDKRLYMGEIQ
;
D   ? 
3  'polypeptide(L)'   no no 
;MADVTARSLQYEYKANSNLVLQADRSLIDRTRRDEPTGEVLSLVGKLEGTRMGDKAQRTKPQMQEERRAKRRKRDEDRHD
INKMKGYTLLSEGIDEMVGIIYKPKTKETRETYEVLLSFIQAALGDQPRDILCGAADEVLAVLKNEKLRDKERRKEIDLL
LGQTDDTRYHVLVNLGKKITDYGGDKEIQNMDDNIDETYGVNVQFESDEEEGDEDVYGEVREEASDDDMEGDEAVVRCTL
SANLVASGELMSSKKKDLHPRDIDAFWLQRQLSRFYDDAIVSQKKADEVLEILKTASDDRECENQLVLLLGFNTFDFIKV
LRQHRMMILYCTLLASAQSEAEKERIMGKMEADPELSKFLYQLHETEKEDLIREERSRRERVRQSRMDTDLETMDLDQGG
EALAPRQVLDLEDLVFTQGSHFMANKRCQLPDGSFRRQRKGYEEVHVPALKPKPFGSEEQLLPVEKLPKYAQAGFEGFKT
LNRIQSKLYRAALETDENLLLCAPTGAGKTNVALMCMLREIGKHINMDGTINVDDFKIIYIAPMRSLVQEMVGSFGKRLA
TYGITVAELTGDHQLCKEEISATQIIVCTPEKWDIITRKGGERTYTQLVRLIILDEIHLLHDDRGPVLEALVARAIRNIE
MTQEDVRLIGLSATLPNYEDVATFLRVDPAKGLFYFDNSFRPVPLEQTYVGITEKKAIKRFQIMNEIVYEKIMEHAGKNQ
VLVFVHSRKETGKTARAIRDMCLEKDTLGLFLREGSASTEVLRTEAEQCKNLELKDLLPYGFAIHHAGMTRVDRTLVEDL
FADKHIQVLVSTATLAWGVNLPAHTVIIKGTQVYSPEKGRWTELGALDILQMLGRAGRPQYDTKGEGILITSHGELQYYL
SLLNQQLPIESQMVSKLPDMLNAEIVLGNVQNAKDAVNWLGYAYLYIRMLRSPTLYGISHDDLKGDPLLDQRRLDLVHTA
ALMLDKNNLVKYDKKTGNFQVTELGRIASHYYITNDTVQTYNQLLKPTLSEIELFRVFSLSSEFKNITVREEEKLELQKL
LERVPIPVKESIEEPSAKINVLLQAFISQLKLEGFALMADMVYVTQSAGRLMRAIFEIVLNRGWAQLTDKTLNLCKMIDK
RMWQSMCPLRQFRKLPEEVVKKIEKKNFPFERLYDLNHNEIGELIRMPKMGKTIHKYVHLFPKLELSVHLQPITRSTLKV
ELTITPDFQWDEKVHGSSEAFWILVEDVDSEVILHHEYFLLKAKYAQDEHLITFFVPVFEPLPPQYFIRVVSDRWLSCET
QLPVSFRHLILPEKYPPPTELLDLQPLPVSALRNSAFESLYQDKFPFFNPIQTQVFNTVYNSDDNVFVGAPTGSGKTICA
EFAILRMLLQSSEGRCVYITPMEALAEQVYMDWYEKFQDRLNKKVVLLTGETSTDLKLLGKGNIIISTPEKWDILSRRWK
QRKNVQNINLFVVDEVHLIGGENGPVLEVICSRMRYISSQIERPIRIVALSSSLSNAKDVAHWLGCSATSTFNFHPNVRP
VPLELHIQGFNISHTQTRLLSMAKPVYHAITKHSPKKPVIVFVPSRKQTRLTAIDILTTCAADIQRQRFLHCTEKDLIPY
LEKLSDSTLKETLLNGVGYLHEGLSPMERRLVEQLFSSGAIQVVVASRSLCWGMNVAAHLVIIMDTQYYNGKIHAYVDYP
IYDVLQMVGHANRPLQDDEGRCVIMCQGSKKDFFKKFLYEPLPVESHLDHCMHDHFNAEIVTKTIENKQDAVDYLTWTFL
YRRMTQNPNYYNLQGISHRHLSDHLSELVEQTLSDLEQSKCISIEDEMDVAPLNLGMIAAYYYINYTTIELFSMSLNAKT
KVRGLIEIISNAAEYENIPIRHHEDNLLRQLAQKVPHKLNNPKFNDPHVKTNLLLQAHLSRMQLSAELQSDTEEILSKAI
RLIQACVDVLSSNGWLSPALAAMELAQMVTQAMWSKDSYLKQLPHFTSEHIKRCTDKGVESVFDIMEMEDEERNALLQLT
DSQIADVARFCNRYPNIELSYEVVDKDSIRSGGPVVVLVQLEREEEVTGPVIAPLFPQKREEGWWVVIGDAKSNSLISIK
RLTLQQKAKVKLDFVAPATGAHNYTLYFMSDAYMGCDQEYKFSVDVKEAETDSDSD
;
;MADVTARSLQYEYKANSNLVLQADRSLIDRTRRDEPTGEVLSLVGKLEGTRMGDKAQRTKPQMQEERRAKRRKRDEDRHD
INKMKGYTLLSEGIDEMVGIIYKPKTKETRETYEVLLSFIQAALGDQPRDILCGAADEVLAVLKNEKLRDKERRKEIDLL
LGQTDDTRYHVLVNLGKKITDYGGDKEIQNMDDNIDETYGVNVQFESDEEEGDEDVYGEVREEASDDDMEGDEAVVRCTL
SANLVASGELMSSKKKDLHPRDIDAFWLQRQLSRFYDDAIVSQKKADEVLEILKTASDDRECENQLVLLLGFNTFDFIKV
LRQHRMMILYCTLLASAQSEAEKERIMGKMEADPELSKFLYQLHETEKEDLIREERSRRERVRQSRMDTDLETMDLDQGG
EALAPRQVLDLEDLVFTQGSHFMANKRCQLPDGSFRRQRKGYEEVHVPALKPKPFGSEEQLLPVEKLPKYAQAGFEGFKT
LNRIQSKLYRAALETDENLLLCAPTGAGKTNVALMCMLREIGKHINMDGTINVDDFKIIYIAPMRSLVQEMVGSFGKRLA
TYGITVAELTGDHQLCKEEISATQIIVCTPEKWDIITRKGGERTYTQLVRLIILDEIHLLHDDRGPVLEALVARAIRNIE
MTQEDVRLIGLSATLPNYEDVATFLRVDPAKGLFYFDNSFRPVPLEQTYVGITEKKAIKRFQIMNEIVYEKIMEHAGKNQ
VLVFVHSRKETGKTARAIRDMCLEKDTLGLFLREGSASTEVLRTEAEQCKNLELKDLLPYGFAIHHAGMTRVDRTLVEDL
FADKHIQVLVSTATLAWGVNLPAHTVIIKGTQVYSPEKGRWTELGALDILQMLGRAGRPQYDTKGEGILITSHGELQYYL
SLLNQQLPIESQMVSKLPDMLNAEIVLGNVQNAKDAVNWLGYAYLYIRMLRSPTLYGISHDDLKGDPLLDQRRLDLVHTA
ALMLDKNNLVKYDKKTGNFQVTELGRIASHYYITNDTVQTYNQLLKPTLSEIELFRVFSLSSEFKNITVREEEKLELQKL
LERVPIPVKESIEEPSAKINVLLQAFISQLKLEGFALMADMVYVTQSAGRLMRAIFEIVLNRGWAQLTDKTLNLCKMIDK
RMWQSMCPLRQFRKLPEEVVKKIEKKNFPFERLYDLNHNEIGELIRMPKMGKTIHKYVHLFPKLELSVHLQPITRSTLKV
ELTITPDFQWDEKVHGSSEAFWILVEDVDSEVILHHEYFLLKAKYAQDEHLITFFVPVFEPLPPQYFIRVVSDRWLSCET
QLPVSFRHLILPEKYPPPTELLDLQPLPVSALRNSAFESLYQDKFPFFNPIQTQVFNTVYNSDDNVFVGAPTGSGKTICA
EFAILRMLLQSSEGRCVYITPMEALAEQVYMDWYEKFQDRLNKKVVLLTGETSTDLKLLGKGNIIISTPEKWDILSRRWK
QRKNVQNINLFVVDEVHLIGGENGPVLEVICSRMRYISSQIERPIRIVALSSSLSNAKDVAHWLGCSATSTFNFHPNVRP
VPLELHIQGFNISHTQTRLLSMAKPVYHAITKHSPKKPVIVFVPSRKQTRLTAIDILTTCAADIQRQRFLHCTEKDLIPY
LEKLSDSTLKETLLNGVGYLHEGLSPMERRLVEQLFSSGAIQVVVASRSLCWGMNVAAHLVIIMDTQYYNGKIHAYVDYP
IYDVLQMVGHANRPLQDDEGRCVIMCQGSKKDFFKKFLYEPLPVESHLDHCMHDHFNAEIVTKTIENKQDAVDYLTWTFL
YRRMTQNPNYYNLQGISHRHLSDHLSELVEQTLSDLEQSKCISIEDEMDVAPLNLGMIAAYYYINYTTIELFSMSLNAKT
KVRGLIEIISNAAEYENIPIRHHEDNLLRQLAQKVPHKLNNPKFNDPHVKTNLLLQAHLSRMQLSAELQSDTEEILSKAI
RLIQACVDVLSSNGWLSPALAAMELAQMVTQAMWSKDSYLKQLPHFTSEHIKRCTDKGVESVFDIMEMEDEERNALLQLT
DSQIADVARFCNRYPNIELSYEVVDKDSIRSGGPVVVLVQLEREEEVTGPVIAPLFPQKREEGWWVVIGDAKSNSLISIK
RLTLQQKAKVKLDFVAPATGAHNYTLYFMSDAYMGCDQEYKFSVDVKEAETDSDSD
;
C   ? 
4  'polypeptide(L)'   no no 
;MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCT
VMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYSTKYRY
;
;MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCT
VMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYSTKYRY
;
E   ? 
5  'polypeptide(L)'   no no 
;MAGVFPYRGPGNPVPGPLAPLPDYMSEEKLQEKARKWQQLQAKRYAEKRKFGFVDAQKEDMPPEHVRKIIRDHGDMTNRK
FRHDKRVYLGALKYMPHAVLKLLENMPMPWEQIRDVPVLYHITGAISFVNEIPWVIEPVYISQWGSMWIMMRREKRDRRH
FKRMRFPPFDDEEPPLDYADNILDVEPLEAIQLELDPEEDAPVLDWFYDHQPLRDSRKYVNGSTYQRWQFTLPMMSTLYR
LANQLLTDLVDDNYFYLFDLKAFFTSKALNMAIPGGPKFEPLVRDINLQDEDWNEFNDINKIIIRQPIRTEYKIAFPYLY
NNLPHHVHLTWYHTPNVVFIKTEDPDLPAFYFDPLINPISHRHSVKSQEPLPDDDEEFELPEFVEPFLKDTPLYTDNTAN
GIALLWAPRPFNLRSGRTRRALDIPLVKNWYREHCPAGQPVKVRVSYQKLLKYYVLNALKHRPPKAQKKRYLFRSFKATK
FFQSTKLDWVEVGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLCREVLRLTKLVVDS
HVQYRLGNVDAFQLADGLQYIFAHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGPVGKGPGCGFWAAGWRVWLFF
MRGITPLLERWLGNLLARQFEGRHSKGVAKTVTKQRVESHFDLELRAAVMHDILDMMPEGIKQNKARTILQHLSEAWRCW
KANIPWKVPGLPTPIENMILRYVKAKADWWTNTAHYNRERIRRGATVDKTVCKKNLGRLTRLYLKAEQERQHNYLKDGPY
ITAEEAVAVYTTTVHWLESRRFSPIPFPPLSYKHDTKLLILALERLKEAYSVKSRLNQSQREELGLIEQAYDNPHEALSR
IKRHLLTQRAFKEVGIEFMDLYSHLVPVYDVEPLEKITDAYLDQYLWYEADKRRLFPPWIKPADTEPPPLLVYKWCQGIN
NLQDVWETSEGECNVMLESRFEKMYEKIDLTLLNRLLRLIVDHNIADYMTAKNNVVINYKDMNHTNSYGIIRGLQFASFI
VQYYGLVMDLLVLGLHRASEMAGPPQMPNDFLSFQDIATEAAHPIRLFCRYIDRIHIFFRFTADEARDLIQRYLTEHPDP
NNENIVGYNNKKCWPRDARMRLMKHDVNLGRAVFWDIKNRLPRSVTTVQWENSFVSVYSKDNPNLLFNMCGFECRILPKC
RTSYEEFTHKDGVWNLQNEVTKERTAQCFLRVDDESMQRFHNRVRQILMASGSTTFTKIVNKWNTALIGLMTYFREAVVN
TQELLDLLVKCENKIQTRIKIGLNSKMPSRFPPVVFYTPKELGGLGMLSMGHVLIPQSDLRWSKQTDVGITHFRSGMSHE
EDQLIPNLYRYIQPWESEFIDSQRVWAEYALKRQEAIAQNRRLTLEDLEDSWDRGIPRINTLFQKDRHTLAYDKGWRVRT
DFKQYQVLKQNPFWWTHQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFKGTYFPTWEGLFWEKASGFEESMKWKKLTN
AQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHESIVMDLCQVFDQE
LDALEIETVQKETIHPRKSYKMNSSCADILLFASYKWNVSRPSLLADSKDVMDSTTTQKYWIDIQLRWGDYDSHDIERYA
RAKFLDYTTDNMSIYPSPTGVLIAIDLAYNLHSAYGNWFPGSKPLIQQAMAKIMKANPALYVLRERIRKGLQLYSSEPTE
PYLSSQNYGELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWK
TAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLY
DDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILADYGKKNNVNVA
SLTQSEIRDIILGMEISAPSQQRQQIAEIEKQTKEQSQLTATQTRTVNKHGDEIITSTTSNYETQTFSSKTEWRVRAISA
ANLHLRTNHIYVSSDDIKETGYTYILPKNVLKKFICISDLRAQIAGYLYGVSPPDNPQVKEIRCIVMVPQWGTHQTVHLP
GQLPQHEYLKEMEPLGWIHTQPNESPQLSPQDVTTHAKIMADNPSWDGEKTIIITCSFTPGSCTLTAYKLTPSGYEWGRQ
NTDKGNNPKGYLPSHYERVQMLLSDRFLGFFMVPAQSSWNYNFMGVRHDPNMKYELQLANPKEFYHEVHRPSHFLNFALL
QEGEVYSADREDLYA
;
;MAGVFPYRGPGNPVPGPLAPLPDYMSEEKLQEKARKWQQLQAKRYAEKRKFGFVDAQKEDMPPEHVRKIIRDHGDMTNRK
FRHDKRVYLGALKYMPHAVLKLLENMPMPWEQIRDVPVLYHITGAISFVNEIPWVIEPVYISQWGSMWIMMRREKRDRRH
FKRMRFPPFDDEEPPLDYADNILDVEPLEAIQLELDPEEDAPVLDWFYDHQPLRDSRKYVNGSTYQRWQFTLPMMSTLYR
LANQLLTDLVDDNYFYLFDLKAFFTSKALNMAIPGGPKFEPLVRDINLQDEDWNEFNDINKIIIRQPIRTEYKIAFPYLY
NNLPHHVHLTWYHTPNVVFIKTEDPDLPAFYFDPLINPISHRHSVKSQEPLPDDDEEFELPEFVEPFLKDTPLYTDNTAN
GIALLWAPRPFNLRSGRTRRALDIPLVKNWYREHCPAGQPVKVRVSYQKLLKYYVLNALKHRPPKAQKKRYLFRSFKATK
FFQSTKLDWVEVGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLCREVLRLTKLVVDS
HVQYRLGNVDAFQLADGLQYIFAHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGPVGKGPGCGFWAAGWRVWLFF
MRGITPLLERWLGNLLARQFEGRHSKGVAKTVTKQRVESHFDLELRAAVMHDILDMMPEGIKQNKARTILQHLSEAWRCW
KANIPWKVPGLPTPIENMILRYVKAKADWWTNTAHYNRERIRRGATVDKTVCKKNLGRLTRLYLKAEQERQHNYLKDGPY
ITAEEAVAVYTTTVHWLESRRFSPIPFPPLSYKHDTKLLILALERLKEAYSVKSRLNQSQREELGLIEQAYDNPHEALSR
IKRHLLTQRAFKEVGIEFMDLYSHLVPVYDVEPLEKITDAYLDQYLWYEADKRRLFPPWIKPADTEPPPLLVYKWCQGIN
NLQDVWETSEGECNVMLESRFEKMYEKIDLTLLNRLLRLIVDHNIADYMTAKNNVVINYKDMNHTNSYGIIRGLQFASFI
VQYYGLVMDLLVLGLHRASEMAGPPQMPNDFLSFQDIATEAAHPIRLFCRYIDRIHIFFRFTADEARDLIQRYLTEHPDP
NNENIVGYNNKKCWPRDARMRLMKHDVNLGRAVFWDIKNRLPRSVTTVQWENSFVSVYSKDNPNLLFNMCGFECRILPKC
RTSYEEFTHKDGVWNLQNEVTKERTAQCFLRVDDESMQRFHNRVRQILMASGSTTFTKIVNKWNTALIGLMTYFREAVVN
TQELLDLLVKCENKIQTRIKIGLNSKMPSRFPPVVFYTPKELGGLGMLSMGHVLIPQSDLRWSKQTDVGITHFRSGMSHE
EDQLIPNLYRYIQPWESEFIDSQRVWAEYALKRQEAIAQNRRLTLEDLEDSWDRGIPRINTLFQKDRHTLAYDKGWRVRT
DFKQYQVLKQNPFWWTHQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFKGTYFPTWEGLFWEKASGFEESMKWKKLTN
AQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHESIVMDLCQVFDQE
LDALEIETVQKETIHPRKSYKMNSSCADILLFASYKWNVSRPSLLADSKDVMDSTTTQKYWIDIQLRWGDYDSHDIERYA
RAKFLDYTTDNMSIYPSPTGVLIAIDLAYNLHSAYGNWFPGSKPLIQQAMAKIMKANPALYVLRERIRKGLQLYSSEPTE
PYLSSQNYGELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWK
TAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLY
DDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILADYGKKNNVNVA
SLTQSEIRDIILGMEISAPSQQRQQIAEIEKQTKEQSQLTATQTRTVNKHGDEIITSTTSNYETQTFSSKTEWRVRAISA
ANLHLRTNHIYVSSDDIKETGYTYILPKNVLKKFICISDLRAQIAGYLYGVSPPDNPQVKEIRCIVMVPQWGTHQTVHLP
GQLPQHEYLKEMEPLGWIHTQPNESPQLSPQDVTTHAKIMADNPSWDGEKTIIITCSFTPGSCTLTAYKLTPSGYEWGRQ
NTDKGNNPKGYLPSHYERVQMLLSDRFLGFFMVPAQSSWNYNFMGVRHDPNMKYELQLANPKEFYHEVHRPSHFLNFALL
QEGEVYSADREDLYA
;
A   ? 
6  'polypeptide(L)'   no no 
;MAGELADKKDRDASPSKEERKRSRTPDRERDRDRDRKSSPSKDRKRHRSRDRRRGGSRSRSRSRSKSAERERRHKERERD
KERDRNKKDRDRDKDGHRRDKDRKRSSLSPGRGKDFKSRKDRDSKKDEEDEHGDKKPKAQPLSLEELLAKKKAEEEAEAK
PKFLSKAEREAEALKRRQQEVEERQRMLEEERKKRKQFQDLGRKMLEDPQERERRERRERMERETNGNEDEEGRQKIREE
KDKSKELHAIKERYLGGIKKRRRTRHLNDRKFVFEWDASEDTSIDYNPLYKERHQVQLLGRGFIAGIDLKQQKREQSRFY
GDLMEKRRTLEEKEQEEARLRKLRKKEAKQRWDDRHWSQKKLDEMTDRDWRIFREDYSITTKGGKIPNPIRSWKDSSLPP
HILEVIDKCGYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLVWITTLPKIDRIEESDQGPYAIILAPTREL
AQQIEEETIKFGKPLGIRTVAVIGGISREDQGFRLRMGCEIVIATPGRLIDVLENRYLVLSRCTYVVLDEADRMIDMGFE
PDVQKILEHMPVSNQKPDTDEAEDPEKMLANFESGKHKYRQTVMFTATMPPAVERLARSYLRRPAVVYIGSAGKPHERVE
QKVFLMSESEKRKKLLAILEQGFDPPIIIFVNQKKGCDVLAKSLEKMGYNACTLHGGKGQEQREFALSNLKAGAKDILVA
TDVAGRGIDIQDVSMVVNYDMAKNIEDYIHRIGRTGRAGKSGVAITFLTKEDSAVFYELKQAILESPVSSCPPELANHPD
AQHKPGTILTKKRREETIFA
;
;MAGELADKKDRDASPSKEERKRSRTPDRERDRDRDRKSSPSKDRKRHRSRDRRRGGSRSRSRSRSKSAERERRHKERERD
KERDRNKKDRDRDKDGHRRDKDRKRSSLSPGRGKDFKSRKDRDSKKDEEDEHGDKKPKAQPLSLEELLAKKKAEEEAEAK
PKFLSKAEREAEALKRRQQEVEERQRMLEEERKKRKQFQDLGRKMLEDPQERERRERRERMERETNGNEDEEGRQKIREE
KDKSKELHAIKERYLGGIKKRRRTRHLNDRKFVFEWDASEDTSIDYNPLYKERHQVQLLGRGFIAGIDLKQQKREQSRFY
GDLMEKRRTLEEKEQEEARLRKLRKKEAKQRWDDRHWSQKKLDEMTDRDWRIFREDYSITTKGGKIPNPIRSWKDSSLPP
HILEVIDKCGYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLVWITTLPKIDRIEESDQGPYAIILAPTREL
AQQIEEETIKFGKPLGIRTVAVIGGISREDQGFRLRMGCEIVIATPGRLIDVLENRYLVLSRCTYVVLDEADRMIDMGFE
PDVQKILEHMPVSNQKPDTDEAEDPEKMLANFESGKHKYRQTVMFTATMPPAVERLARSYLRRPAVVYIGSAGKPHERVE
QKVFLMSESEKRKKLLAILEQGFDPPIIIFVNQKKGCDVLAKSLEKMGYNACTLHGGKGQEQREFALSNLKAGAKDILVA
TDVAGRGIDIQDVSMVVNYDMAKNIEDYIHRIGRTGRAGKSGVAITFLTKEDSAVFYELKQAILESPVSSCPPELANHPD
AQHKPGTILTKKRREETIFA
;
F   ? 
7  'polypeptide(L)'   no no 
;MDTDLYDEFGNYIGPELDSDEDDDELGRETKDLDEMDDDDDDDDVGDHDDDHPGMEVVLHEDKKYYPTAEEVYGPEVETI
VQEEDTQPLTEPIIKPVKTKKFTLMEQTLPVTVYEMDFLADLMDNSELIRNVTLCGHLHHGKTCFVDCLIEQTHPEIRKR
YDQDLCYTDILFTEQERGVGIKSTPVTVVLPDTKGKSYLFNIMDTPGHVNFSDEVTAGLRISDGVVLFIDAAEGVMLNTE
RLIKHAVQERLAVTVCINKIDRLILELKLPPTDAYYKLRHIVDEVNGLISMYSTDENLILSPLLGNVCFSSSQYSICFTL
GSFAKIYADTFGDINYQEFAKRLWGDIYFNPKTRKFTKKAPTSSSQRSFVEFILEPLYKILAQVVGDVDTSLPRTLDELG
IHLTKEELKLNIRPLLRLVCKKFFGEFTGFVDMCVQHIPSPKVGAKPKIEHTYTGGVDSDLGEAMSDCDPDGPLMCHTTK
MYSTDDGVQFHAFGRVLSGTIHAGQPVKVLGENYTLEDEEDSQICTVGRLWISVARYHIEVNRVPAGNWVLIEGVDQPIV
KTATITEPRGNEEAQIFRPLKFNTTSVIKIAVEPVNPSELPKMLDGLRKVNKSYPSLTTKVEESGEHVILGTGELYLDCV
MHDLRKMYSEIDIKVADPVVTFCETVVETSSLKCFAETPNKKNKITMIAEPLEKGLAEDIENEVVQITWNRKKLGEFFQT
KYDWDLLAARSIWAFGPDATGPNILVDDTLPSEVDKALLGSVKDSIVQGFQWGTREGPLCDELIRNVKFKILDAVVAQEP
LHRGGGQIIPTARRVVYSAFLMATPRLMEPYYFVEVQAPADCVSAVYTVLARRRGHVTQDAPIPGSPLYTIKAFIPAIDS
FGFETDLRTHTQGQAFSLSVFHHWQIVPGDPLDKSIVIRPLEPQPAPHLAREFMIKTRRRKGLSEDVSISKFFDDPMLLE
LAKQDVVLNYPM
;
;MDTDLYDEFGNYIGPELDSDEDDDELGRETKDLDEMDDDDDDDDVGDHDDDHPGMEVVLHEDKKYYPTAEEVYGPEVETI
VQEEDTQPLTEPIIKPVKTKKFTLMEQTLPVTVYEMDFLADLMDNSELIRNVTLCGHLHHGKTCFVDCLIEQTHPEIRKR
YDQDLCYTDILFTEQERGVGIKSTPVTVVLPDTKGKSYLFNIMDTPGHVNFSDEVTAGLRISDGVVLFIDAAEGVMLNTE
RLIKHAVQERLAVTVCINKIDRLILELKLPPTDAYYKLRHIVDEVNGLISMYSTDENLILSPLLGNVCFSSSQYSICFTL
GSFAKIYADTFGDINYQEFAKRLWGDIYFNPKTRKFTKKAPTSSSQRSFVEFILEPLYKILAQVVGDVDTSLPRTLDELG
IHLTKEELKLNIRPLLRLVCKKFFGEFTGFVDMCVQHIPSPKVGAKPKIEHTYTGGVDSDLGEAMSDCDPDGPLMCHTTK
MYSTDDGVQFHAFGRVLSGTIHAGQPVKVLGENYTLEDEEDSQICTVGRLWISVARYHIEVNRVPAGNWVLIEGVDQPIV
KTATITEPRGNEEAQIFRPLKFNTTSVIKIAVEPVNPSELPKMLDGLRKVNKSYPSLTTKVEESGEHVILGTGELYLDCV
MHDLRKMYSEIDIKVADPVVTFCETVVETSSLKCFAETPNKKNKITMIAEPLEKGLAEDIENEVVQITWNRKKLGEFFQT
KYDWDLLAARSIWAFGPDATGPNILVDDTLPSEVDKALLGSVKDSIVQGFQWGTREGPLCDELIRNVKFKILDAVVAQEP
LHRGGGQIIPTARRVVYSAFLMATPRLMEPYYFVEVQAPADCVSAVYTVLARRRGHVTQDAPIPGSPLYTIKAFIPAIDS
FGFETDLRTHTQGQAFSLSVFHHWQIVPGDPLDKSIVIRPLEPQPAPHLAREFMIKTRRRKGLSEDVSISKFFDDPMLLE
LAKQDVVLNYPM
;
B   ? 
8  'polypeptide(L)'   no no 
;MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSM
TVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAAAATAS
IAGAPTQYPPGRGGPPPPMGRGAPPPGMMGPPPGMRPPMGPPMGIPPGRGTPMGMPPPGMRPPPPGMRGPPPPGMRPPRP
;
;MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSM
TVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAAAATAS
IAGAPTQYPPGRGGPPPPMGRGAPPPGMMGPPPGMRPPMGPPMGIPPGRGTPMGMPPPGMRPPPPGMRGPPPPGMRPPRP
;
O,o ? 
9  'polypeptide(L)'   no no 
;MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLL
VDVEPKVKSKKREAVAGRGRGRGRGRGRGRGRGRGGPRR
;
;MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLL
VDVEPKVKSKKREAVAGRGRGRGRGRGRGRGRGRGGPRR
;
P,p ? 
10 'polypeptide(L)'   no no 
;MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKS
GKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK
;
;MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKS
GKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK
;
Q,q ? 
11 'polypeptide(L)'   no no 
;MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNA
PMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGNIFQKRR
;
;MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNA
PMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGNIFQKRR
;
R,r ? 
12 'polypeptide(L)'   no no 
;MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLK
GDNITLLQSVSN
;
;MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLK
GDNITLLQSVSN
;
S,s ? 
13 'polypeptide(L)'   no no 
;MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGVEEEEE
DGEMRE
;
;MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGVEEEEE
DGEMRE
;
T,t ? 
14 'polypeptide(L)'   no no MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV 
MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV U,u ? 
15 'polypeptide(L)'   no no 
;MTSALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHERVFSSSQGVEQVVLGLYIVRGDNVAVIGEIDEETDSA
LDLGNIRAEPLNSVAH
;
;MTSALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHERVFSSSQGVEQVVLGLYIVRGDNVAVIGEIDEETDSA
LDLGNIRAEPLNSVAH
;
8   ? 
16 'polypeptide(L)'   no no MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNVLYISTQKRRM 
MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNVLYISTQKRRM 6   ? 
17 'polypeptide(L)'   no no 
;MAANATTNPSQLLPLELVDKCIGSRIHIVMKSDKEIVGTLLGFDDFVNMVLEDVTEFEITPEGRRITKLDQILLNGNNIT
MLVPGGEGPEV
;
;MAANATTNPSQLLPLELVDKCIGSRIHIVMKSDKEIVGTLLGFDDFVNMVLEDVTEFEITPEGRRITKLDQILLNGNNIT
MLVPGGEGPEV
;
5   ? 
18 'polypeptide(L)'   no no 
;MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPDEIIDMVK
EEVVAKGRGRGGLQQQKQQKGRGMGGAGRGVFGGRGRGGIPGTGRGQPEKKPGRQAGKQ
;
;MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPDEIIDMVK
EEVVAKGRGRGGLQQQKQQKGRGMGGAGRGVFGGRGRGGIPGTGRGQPEKKPGRQAGKQ
;
4   ? 
19 'polypeptide(L)'   no no 
;MADDVDQQQTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIEIDEETYEEIYKSTKR
NIPMLFVRGDGVVLVAPPLRVG
;
;MADDVDQQQTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIEIDEETYEEIYKSTKR
NIPMLFVRGDGVVLVAPPLRVG
;
3   ? 
20 'polypeptide(L)'   no no 
;MLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQ
LLQDAARKEALQQKQ
;
;MLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQ
LLQDAARKEALQQKQ
;
2   ? 
21 'polypeptide(L)'   no no 
;MADKEKKKKESILDLSKYIDKTIRVKFQGGREASGILKGFDPLLNLVLDGTIEYMRDPDDQYKLTEDTRQLGLVVCRGTS
VVLICPQDGMEAIPNPFIQQQDA
;
;MADKEKKKKESILDLSKYIDKTIRVKFQGGREASGILKGFDPLLNLVLDGTIEYMRDPDDQYKLTEDTRQLGLVVCRGTS
VVLICPQDGMEAIPNPFIQQQDA
;
7   ? 
22 'polypeptide(L)'   no no 
;MALSKRELDELKPWIEKTVKRVLGFSEPTVVTAALNCVGKGMDKKKAADHLKPFLDDSTLRFVDKLFEAVEEGRSSRHSK
SSSDRSRKRELKEVFGDDSEISKESSGVKKRRIPRFEEVEEEPEVIPGPPSESPGMLTKLQIKQMMEAATRQIEERKKQL
SFISPPTPQPKTPSSSQPERLPIGNTIQPSQAATFMNDAIEKARKAAELQARIQAQLALKPGLIGNANMVGLANLHAMGI
APPKVELKDQTKPTPLILDEQGRTVDATGKEIELTHRMPTLKANIRAVKREQFKQQLKEKPSEDMESNTFFDPRVSIAPS
QRQRRTFKFHDKGKFEKIAQRLRTKAQLEKLQAEISQAARKTGIHTSTRLALIAPKKELKEGDIPEIEWWDSYIIPNGFD
LTEENPKREDYFGITNLVEHPAQLNPPVDNDTPVTLGVYLTKKEQKKLRRQTRREAQKELQEKVRLGLMPPPEPKVRISN
LMRVLGTEAVQDPTKVEAHVRAQMAKRQKAHEEANAARKLTAEQRKVKKIKKLKEDISQGVHISVYRVRNLSNPAKKFKI
EANAGQLYLTGVVVLHKDVNVVVVEGGPKAQKKFKRLMLHRIKWDEQTSNTKGDDDEESDEEAVKKTNKCVLVWEGTAKD
RSFGEMKFKQCPTENMAREHFKKHGAEHYWDLALSESVLESTD
;
;MALSKRELDELKPWIEKTVKRVLGFSEPTVVTAALNCVGKGMDKKKAADHLKPFLDDSTLRFVDKLFEAVEEGRSSRHSK
SSSDRSRKRELKEVFGDDSEISKESSGVKKRRIPRFEEVEEEPEVIPGPPSESPGMLTKLQIKQMMEAATRQIEERKKQL
SFISPPTPQPKTPSSSQPERLPIGNTIQPSQAATFMNDAIEKARKAAELQARIQAQLALKPGLIGNANMVGLANLHAMGI
APPKVELKDQTKPTPLILDEQGRTVDATGKEIELTHRMPTLKANIRAVKREQFKQQLKEKPSEDMESNTFFDPRVSIAPS
QRQRRTFKFHDKGKFEKIAQRLRTKAQLEKLQAEISQAARKTGIHTSTRLALIAPKKELKEGDIPEIEWWDSYIIPNGFD
LTEENPKREDYFGITNLVEHPAQLNPPVDNDTPVTLGVYLTKKEQKKLRRQTRREAQKELQEKVRLGLMPPPEPKVRISN
LMRVLGTEAVQDPTKVEAHVRAQMAKRQKAHEEANAARKLTAEQRKVKKIKKLKEDISQGVHISVYRVRNLSNPAKKFKI
EANAGQLYLTGVVVLHKDVNVVVVEGGPKAQKKFKRLMLHRIKWDEQTSNTKGDDDEESDEEAVKKTNKCVLVWEGTAKD
RSFGEMKFKQCPTENMAREHFKKHGAEHYWDLALSESVLESTD
;
K   ? 
23 'polypeptide(L)'   no no 
;MASSRASSTATKTKAPDDLVAPVVKKPHIYYGSLEEKERERLAKGESGILGKDGLKAGIEAGNINITSGEVFEIEEHISE
RQAEVLAEFERRKRARQINVSTDDSEVKACLRALGEPITLFGEGPAERRERLRNILSVVGTDALKKTKKDDEKSKKSKEE
YQQTWYHEGPNSLKVARLWIANYSLPRAMKRLEEARLHKEIPETTRTSQMQELHKSLRSLNNFCSQIGDDRPISYCHFSP
NSKMLATACWSGLCKLWSVPDCNLLHTLRGHNTNVGAIVFHPKSTVSLDPKDVNLASCAADGSVKLWSLDSDEPVADIEG
HTVRVARVMWHPSGRFLGTTCYDRSWRLWDLEAQEEILHQEGHSMGVYDIAFHQDGSLAGTGGLDAFGRVWDLRTGRCIM
FLEGHLKEIYGINFSPNGYHIATGSGDNTCKVWDLRQRRCVYTIPAHQNLVTGVKFEPIHGNFLLTGAYDNTAKIWTHPG
WSPLKTLAGHEGKVMGLDISSDGQLIATCSYDRTFKLWMAE
;
;MASSRASSTATKTKAPDDLVAPVVKKPHIYYGSLEEKERERLAKGESGILGKDGLKAGIEAGNINITSGEVFEIEEHISE
RQAEVLAEFERRKRARQINVSTDDSEVKACLRALGEPITLFGEGPAERRERLRNILSVVGTDALKKTKKDDEKSKKSKEE
YQQTWYHEGPNSLKVARLWIANYSLPRAMKRLEEARLHKEIPETTRTSQMQELHKSLRSLNNFCSQIGDDRPISYCHFSP
NSKMLATACWSGLCKLWSVPDCNLLHTLRGHNTNVGAIVFHPKSTVSLDPKDVNLASCAADGSVKLWSLDSDEPVADIEG
HTVRVARVMWHPSGRFLGTTCYDRSWRLWDLEAQEEILHQEGHSMGVYDIAFHQDGSLAGTGGLDAFGRVWDLRTGRCIM
FLEGHLKEIYGINFSPNGYHIATGSGDNTCKVWDLRQRRCVYTIPAHQNLVTGVKFEPIHGNFLLTGAYDNTAKIWTHPG
WSPLKTLAGHEGKVMGLDISSDGQLIATCSYDRTFKLWMAE
;
L   ? 
24 'polypeptide(L)'   no no 
;MSLADELLADLEEAAEEEEGGSYGEEEEEPAIEDVQEETQLDLSGDSVKTIAKLWDSKMFAEIMMKIEEYISKQAKASEV
MGPVEAAPEYRVIVDANNLTVEIENELNIIHKFIRDKYSKRFPELESLVPNALDYIRTVKELGNSLDKCKNNENLQQILT
NATIMVVSVTASTTQGQQLSEEELERLEEACDMALELNASKHRIYEYVESRMSFIAPNLSIIIGASTAAKIMGVAGGLTN
LSKMPACNIMLLGAQRKTLSGFSSTSVLPHTGYIYHSDIVQSLPPDLRRKAARLVAAKCTLAARVDSFHESTEGKVGYEL
KDEIERKFDKWQEPPPVKQVKPLPAPLDGQRKKRGGRRYRKMKERLGLTEIRKQANRMSFGEIEEDAYQEDLGFSLGHLG
KSGSGRVRQTQVNEATKARISKTLQRTLQKQSVVYGGKSTIRDRSSGTASSVAFTPLQGLEIVNPQAAEKKVAEANQKYF
SSMAEFLKVKGEKSGLMST
;
;MSLADELLADLEEAAEEEEGGSYGEEEEEPAIEDVQEETQLDLSGDSVKTIAKLWDSKMFAEIMMKIEEYISKQAKASEV
MGPVEAAPEYRVIVDANNLTVEIENELNIIHKFIRDKYSKRFPELESLVPNALDYIRTVKELGNSLDKCKNNENLQQILT
NATIMVVSVTASTTQGQQLSEEELERLEEACDMALELNASKHRIYEYVESRMSFIAPNLSIIIGASTAAKIMGVAGGLTN
LSKMPACNIMLLGAQRKTLSGFSSTSVLPHTGYIYHSDIVQSLPPDLRRKAARLVAAKCTLAARVDSFHESTEGKVGYEL
KDEIERKFDKWQEPPPVKQVKPLPAPLDGQRKKRGGRRYRKMKERLGLTEIRKQANRMSFGEIEEDAYQEDLGFSLGHLG
KSGSGRVRQTQVNEATKARISKTLQRTLQKQSVVYGGKSTIRDRSSGTASSVAFTPLQGLEIVNPQAAEKKVAEANQKYF
SSMAEFLKVKGEKSGLMST
;
J   ? 
25 'polypeptide(L)'   no no 
;MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPY
VFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV
;
;MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPY
VFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV
;
I   ? 
26 'polypeptide(L)'   no no 
;MSGRSKRESRGSTRGKRESESRGSSGRVKRERDREREPEAASSRGSPVRVKREFEPASAREAPASVVPFVRVKREREVDE
DSEPEREVRAKNGRVDSEDRRSRHCPYLDTINRSVLDFDFEKLCSISLSHINAYACLVCGKYFQGRGLKSHAYIHSVQFS
HHVFLNLHTLKFYCLPDNYEIIDSSLEDITYVLKPTFTKQQIANLDKQAKLSRAYDGTTYLPGIVGLNNIKANDYANAVL
QALSNVPPLRNYFLEEDNYKNIKRPPGDIMFLLVQRFGELMRKLWNPRNFKAHVSPHEMLQAVVLCSKKTFQITKQGDGV
DFLSWFLNALHSALGGTKKKKKTIVTDVFQGSMRIFTKKLPHPDLPAEEKEQLLHNDEYQETMVESTFMYLTLDLPTAPL
YKDEKEQLIIPQVPLFNILAKFNGITEKEYKTYKENFLKRFQLTKLPPYLIFCIKRFTKNNFFVEKNPTIVNFPITNVDL
REYLSEEVQAVHKNTTYDLIANIVHDGKPSEGSYRIHVLHHGTGKWYELQDLQVTDILPQMITLSEAYIQIWKRRDNDET
NQQGA
;
;MSGRSKRESRGSTRGKRESESRGSSGRVKRERDREREPEAASSRGSPVRVKREFEPASAREAPASVVPFVRVKREREVDE
DSEPEREVRAKNGRVDSEDRRSRHCPYLDTINRSVLDFDFEKLCSISLSHINAYACLVCGKYFQGRGLKSHAYIHSVQFS
HHVFLNLHTLKFYCLPDNYEIIDSSLEDITYVLKPTFTKQQIANLDKQAKLSRAYDGTTYLPGIVGLNNIKANDYANAVL
QALSNVPPLRNYFLEEDNYKNIKRPPGDIMFLLVQRFGELMRKLWNPRNFKAHVSPHEMLQAVVLCSKKTFQITKQGDGV
DFLSWFLNALHSALGGTKKKKKTIVTDVFQGSMRIFTKKLPHPDLPAEEKEQLLHNDEYQETMVESTFMYLTLDLPTAPL
YKDEKEQLIIPQVPLFNILAKFNGITEKEYKTYKENFLKRFQLTKLPPYLIFCIKRFTKNNFFVEKNPTIVNFPITNVDL
REYLSEEVQAVHKNTTYDLIANIVHDGKPSEGSYRIHVLHHGTGKWYELQDLQVTDILPQMITLSEAYIQIWKRRDNDET
NQQGA
;
V   ? 
27 polyribonucleotide no no 
;AGCUUUGCGCAGUGGCAGUAUCGUAGCCAAUGAGGUUUAUCCGAGGCGCGAUUAUUGCUAAUUGAAAACUUUUCCCAAUA
CCCCGCCAUGACGACUUGAAAUAUAGUCGGCAUUGGCAAUUUUUGACAGUCUCUACGGAGACUGG
;
;AGCUUUGCGCAGUGGCAGUAUCGUAGCCAAUGAGGUUUAUCCGAGGCGCGAUUAUUGCUAAUUGAAAACUUUUCCCAAUA
CCCCGCCAUGACGACUUGAAAUAUAGUCGGCAUUGGCAAUUUUUGACAGUCUCUACGGAGACUGG
;
M   ? 
28 polyribonucleotide no no 
;GUGCUCGCUUCGGCAGCACAUAUACUAAAAUUGGAACGAUACAGAGAAGAUUAGCAUGGCCCCUGCGCAAGGAUGACACG
CAAAUUCGUGAAGCGUUCCAUAUUUU
;
;GUGCUCGCUUCGGCAGCACAUAUACUAAAAUUGGAACGAUACAGAGAAGAUUAGCAUGGCCCCUGCGCAAGGAUGACACG
CAAAUUCGUGAAGCGUUCCAUAUUUU
;
N   ? 
29 polyribonucleotide no no 
;AUACUCUGGUUUCUCUUCAGAUCGCAUAAAUCUUUCGCCUUUUACUAAAGAUUUCCGUGGAGAGGAACAACUCUGAGUCU
UAACCCAAUUUUUUGAGCCUUGCUCCGACAAGGCUA
;
;AUACUCUGGUUUCUCUUCAGAUCGCAUAAAUCUUUCGCCUUUUACUAAAGAUUUCCGUGGAGAGGAACAACUCUGAGUCU
UAACCCAAUUUUUUGAGCCUUGCUCCGACAAGGCUA
;
H   ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1  1    MET n 
1  2    ASN n 
1  3    LYS n 
1  4    LYS n 
1  5    LYS n 
1  6    LYS n 
1  7    PRO n 
1  8    PHE n 
1  9    LEU n 
1  10   GLY n 
1  11   MET n 
1  12   PRO n 
1  13   ALA n 
1  14   PRO n 
1  15   LEU n 
1  16   GLY n 
1  17   TYR n 
1  18   VAL n 
1  19   PRO n 
1  20   GLY n 
1  21   LEU n 
1  22   GLY n 
1  23   ARG n 
1  24   GLY n 
1  25   ALA n 
1  26   THR n 
1  27   GLY n 
1  28   PHE n 
1  29   THR n 
1  30   THR n 
1  31   ARG n 
1  32   SER n 
1  33   ASP n 
1  34   ILE n 
1  35   GLY n 
1  36   PRO n 
1  37   ALA n 
1  38   ARG n 
1  39   ASP n 
1  40   ALA n 
1  41   ASN n 
1  42   ASP n 
1  43   PRO n 
1  44   VAL n 
1  45   ASP n 
1  46   ASP n 
1  47   ARG n 
1  48   HIS n 
1  49   ALA n 
1  50   PRO n 
1  51   PRO n 
1  52   GLY n 
1  53   LYS n 
1  54   ARG n 
1  55   THR n 
1  56   VAL n 
1  57   GLY n 
1  58   ASP n 
1  59   GLN n 
1  60   MET n 
1  61   LYS n 
1  62   LYS n 
1  63   ASN n 
1  64   GLN n 
1  65   ALA n 
1  66   ALA n 
1  67   ASP n 
1  68   ASP n 
1  69   ASP n 
1  70   ASP n 
1  71   GLU n 
1  72   ASP n 
1  73   LEU n 
1  74   ASN n 
1  75   ASP n 
1  76   THR n 
1  77   ASN n 
1  78   TYR n 
1  79   ASP n 
1  80   GLU n 
1  81   PHE n 
1  82   ASN n 
1  83   GLY n 
1  84   TYR n 
1  85   ALA n 
1  86   GLY n 
1  87   SER n 
1  88   LEU n 
1  89   PHE n 
1  90   SER n 
1  91   SER n 
1  92   GLY n 
1  93   PRO n 
1  94   TYR n 
1  95   GLU n 
1  96   LYS n 
1  97   ASP n 
1  98   ASP n 
1  99   GLU n 
1  100  GLU n 
1  101  ALA n 
1  102  ASP n 
1  103  ALA n 
1  104  ILE n 
1  105  TYR n 
1  106  ALA n 
1  107  ALA n 
1  108  LEU n 
1  109  ASP n 
1  110  LYS n 
1  111  ARG n 
1  112  MET n 
1  113  ASP n 
1  114  GLU n 
1  115  ARG n 
1  116  ARG n 
1  117  LYS n 
1  118  GLU n 
1  119  ARG n 
1  120  ARG n 
1  121  GLU n 
1  122  GLN n 
1  123  ARG n 
1  124  GLU n 
1  125  LYS n 
1  126  GLU n 
1  127  GLU n 
1  128  ILE n 
1  129  GLU n 
1  130  LYS n 
1  131  TYR n 
1  132  ARG n 
1  133  MET n 
1  134  GLU n 
1  135  ARG n 
1  136  PRO n 
1  137  LYS n 
1  138  ILE n 
1  139  GLN n 
1  140  GLN n 
1  141  GLN n 
1  142  PHE n 
1  143  SER n 
1  144  ASP n 
1  145  LEU n 
1  146  LYS n 
1  147  ARG n 
1  148  LYS n 
1  149  LEU n 
1  150  ALA n 
1  151  GLU n 
1  152  VAL n 
1  153  THR n 
1  154  GLU n 
1  155  GLU n 
1  156  GLU n 
1  157  TRP n 
1  158  LEU n 
1  159  SER n 
1  160  ILE n 
1  161  PRO n 
1  162  GLU n 
1  163  VAL n 
1  164  GLY n 
1  165  ASP n 
1  166  ALA n 
1  167  ARG n 
1  168  ASN n 
1  169  LYS n 
1  170  ARG n 
1  171  GLN n 
1  172  ARG n 
1  173  ASN n 
1  174  PRO n 
1  175  ARG n 
1  176  TYR n 
1  177  GLU n 
1  178  LYS n 
1  179  LEU n 
1  180  THR n 
1  181  PRO n 
1  182  VAL n 
1  183  PRO n 
1  184  ASP n 
1  185  SER n 
1  186  PHE n 
1  187  PHE n 
1  188  ALA n 
1  189  LYS n 
1  190  HIS n 
1  191  LEU n 
1  192  GLN n 
1  193  THR n 
1  194  GLY n 
1  195  GLU n 
1  196  ASN n 
1  197  HIS n 
1  198  THR n 
1  199  SER n 
1  200  VAL n 
1  201  ASP n 
1  202  PRO n 
1  203  ARG n 
1  204  GLN n 
1  205  THR n 
1  206  GLN n 
1  207  PHE n 
1  208  GLY n 
1  209  GLY n 
1  210  LEU n 
1  211  ASN n 
1  212  THR n 
1  213  PRO n 
1  214  TYR n 
1  215  PRO n 
1  216  GLY n 
1  217  GLY n 
1  218  LEU n 
1  219  ASN n 
1  220  THR n 
1  221  PRO n 
1  222  TYR n 
1  223  PRO n 
1  224  GLY n 
1  225  GLY n 
1  226  MET n 
1  227  THR n 
1  228  PRO n 
1  229  GLY n 
1  230  LEU n 
1  231  MET n 
1  232  THR n 
1  233  PRO n 
1  234  GLY n 
1  235  THR n 
1  236  GLY n 
1  237  GLU n 
1  238  LEU n 
1  239  ASP n 
1  240  MET n 
1  241  ARG n 
1  242  LYS n 
1  243  ILE n 
1  244  GLY n 
1  245  GLN n 
1  246  ALA n 
1  247  ARG n 
1  248  ASN n 
1  249  THR n 
1  250  LEU n 
1  251  MET n 
1  252  ASP n 
1  253  MET n 
1  254  ARG n 
1  255  LEU n 
1  256  SER n 
1  257  GLN n 
1  258  VAL n 
1  259  SER n 
1  260  ASP n 
1  261  SER n 
1  262  VAL n 
1  263  SER n 
1  264  GLY n 
1  265  GLN n 
1  266  THR n 
1  267  VAL n 
1  268  VAL n 
1  269  ASP n 
1  270  PRO n 
1  271  LYS n 
1  272  GLY n 
1  273  TYR n 
1  274  LEU n 
1  275  THR n 
1  276  ASP n 
1  277  LEU n 
1  278  ASN n 
1  279  SER n 
1  280  MET n 
1  281  ILE n 
1  282  PRO n 
1  283  THR n 
1  284  HIS n 
1  285  GLY n 
1  286  GLY n 
1  287  ASP n 
1  288  ILE n 
1  289  ASN n 
1  290  ASP n 
1  291  ILE n 
1  292  LYS n 
1  293  LYS n 
1  294  ALA n 
1  295  ARG n 
1  296  LEU n 
1  297  LEU n 
1  298  LEU n 
1  299  LYS n 
1  300  SER n 
1  301  VAL n 
1  302  ARG n 
1  303  GLU n 
1  304  THR n 
1  305  ASN n 
1  306  PRO n 
1  307  HIS n 
1  308  HIS n 
1  309  PRO n 
1  310  PRO n 
1  311  ALA n 
1  312  TRP n 
1  313  ILE n 
1  314  ALA n 
1  315  SER n 
1  316  ALA n 
1  317  ARG n 
1  318  LEU n 
1  319  GLU n 
1  320  GLU n 
1  321  VAL n 
1  322  THR n 
1  323  GLY n 
1  324  LYS n 
1  325  LEU n 
1  326  GLN n 
1  327  VAL n 
1  328  ALA n 
1  329  ARG n 
1  330  ASN n 
1  331  LEU n 
1  332  ILE n 
1  333  MET n 
1  334  LYS n 
1  335  GLY n 
1  336  THR n 
1  337  GLU n 
1  338  MET n 
1  339  CYS n 
1  340  PRO n 
1  341  LYS n 
1  342  SER n 
1  343  GLU n 
1  344  ASP n 
1  345  VAL n 
1  346  TRP n 
1  347  LEU n 
1  348  GLU n 
1  349  ALA n 
1  350  ALA n 
1  351  ARG n 
1  352  LEU n 
1  353  GLN n 
1  354  PRO n 
1  355  GLY n 
1  356  ASP n 
1  357  THR n 
1  358  ALA n 
1  359  LYS n 
1  360  ALA n 
1  361  VAL n 
1  362  VAL n 
1  363  ALA n 
1  364  GLN n 
1  365  ALA n 
1  366  VAL n 
1  367  ARG n 
1  368  HIS n 
1  369  LEU n 
1  370  PRO n 
1  371  GLN n 
1  372  SER n 
1  373  VAL n 
1  374  ARG n 
1  375  ILE n 
1  376  TYR n 
1  377  ILE n 
1  378  ARG n 
1  379  ALA n 
1  380  ALA n 
1  381  GLU n 
1  382  LEU n 
1  383  GLU n 
1  384  THR n 
1  385  ASP n 
1  386  ILE n 
1  387  ARG n 
1  388  ALA n 
1  389  LYS n 
1  390  LYS n 
1  391  ARG n 
1  392  VAL n 
1  393  LEU n 
1  394  ARG n 
1  395  LYS n 
1  396  ALA n 
1  397  LEU n 
1  398  GLU n 
1  399  HIS n 
1  400  VAL n 
1  401  PRO n 
1  402  ASN n 
1  403  SER n 
1  404  VAL n 
1  405  ARG n 
1  406  LEU n 
1  407  TRP n 
1  408  LYS n 
1  409  ALA n 
1  410  ALA n 
1  411  VAL n 
1  412  GLU n 
1  413  LEU n 
1  414  GLU n 
1  415  GLU n 
1  416  PRO n 
1  417  GLU n 
1  418  ASP n 
1  419  ALA n 
1  420  ARG n 
1  421  ILE n 
1  422  MET n 
1  423  LEU n 
1  424  SER n 
1  425  ARG n 
1  426  ALA n 
1  427  VAL n 
1  428  GLU n 
1  429  CYS n 
1  430  CYS n 
1  431  PRO n 
1  432  THR n 
1  433  SER n 
1  434  VAL n 
1  435  GLU n 
1  436  LEU n 
1  437  TRP n 
1  438  LEU n 
1  439  ALA n 
1  440  LEU n 
1  441  ALA n 
1  442  ARG n 
1  443  LEU n 
1  444  GLU n 
1  445  THR n 
1  446  TYR n 
1  447  GLU n 
1  448  ASN n 
1  449  ALA n 
1  450  ARG n 
1  451  LYS n 
1  452  VAL n 
1  453  LEU n 
1  454  ASN n 
1  455  LYS n 
1  456  ALA n 
1  457  ARG n 
1  458  GLU n 
1  459  ASN n 
1  460  ILE n 
1  461  PRO n 
1  462  THR n 
1  463  ASP n 
1  464  ARG n 
1  465  HIS n 
1  466  ILE n 
1  467  TRP n 
1  468  ILE n 
1  469  THR n 
1  470  ALA n 
1  471  ALA n 
1  472  LYS n 
1  473  LEU n 
1  474  GLU n 
1  475  GLU n 
1  476  ALA n 
1  477  ASN n 
1  478  GLY n 
1  479  ASN n 
1  480  THR n 
1  481  GLN n 
1  482  MET n 
1  483  VAL n 
1  484  GLU n 
1  485  LYS n 
1  486  ILE n 
1  487  ILE n 
1  488  ASP n 
1  489  ARG n 
1  490  ALA n 
1  491  ILE n 
1  492  THR n 
1  493  SER n 
1  494  LEU n 
1  495  ARG n 
1  496  ALA n 
1  497  ASN n 
1  498  GLY n 
1  499  VAL n 
1  500  GLU n 
1  501  ILE n 
1  502  ASN n 
1  503  ARG n 
1  504  GLU n 
1  505  GLN n 
1  506  TRP n 
1  507  ILE n 
1  508  GLN n 
1  509  ASP n 
1  510  ALA n 
1  511  GLU n 
1  512  GLU n 
1  513  CYS n 
1  514  ASP n 
1  515  ARG n 
1  516  ALA n 
1  517  GLY n 
1  518  SER n 
1  519  VAL n 
1  520  ALA n 
1  521  THR n 
1  522  CYS n 
1  523  GLN n 
1  524  ALA n 
1  525  VAL n 
1  526  MET n 
1  527  ARG n 
1  528  ALA n 
1  529  VAL n 
1  530  ILE n 
1  531  GLY n 
1  532  ILE n 
1  533  GLY n 
1  534  ILE n 
1  535  GLU n 
1  536  GLU n 
1  537  GLU n 
1  538  ASP n 
1  539  ARG n 
1  540  LYS n 
1  541  HIS n 
1  542  THR n 
1  543  TRP n 
1  544  MET n 
1  545  GLU n 
1  546  ASP n 
1  547  ALA n 
1  548  ASP n 
1  549  SER n 
1  550  CYS n 
1  551  VAL n 
1  552  ALA n 
1  553  HIS n 
1  554  ASN n 
1  555  ALA n 
1  556  LEU n 
1  557  GLU n 
1  558  CYS n 
1  559  ALA n 
1  560  ARG n 
1  561  ALA n 
1  562  ILE n 
1  563  TYR n 
1  564  ALA n 
1  565  TYR n 
1  566  ALA n 
1  567  LEU n 
1  568  GLN n 
1  569  VAL n 
1  570  PHE n 
1  571  PRO n 
1  572  SER n 
1  573  LYS n 
1  574  LYS n 
1  575  SER n 
1  576  VAL n 
1  577  TRP n 
1  578  LEU n 
1  579  ARG n 
1  580  ALA n 
1  581  ALA n 
1  582  TYR n 
1  583  PHE n 
1  584  GLU n 
1  585  LYS n 
1  586  ASN n 
1  587  HIS n 
1  588  GLY n 
1  589  THR n 
1  590  ARG n 
1  591  GLU n 
1  592  SER n 
1  593  LEU n 
1  594  GLU n 
1  595  ALA n 
1  596  LEU n 
1  597  LEU n 
1  598  GLN n 
1  599  ARG n 
1  600  ALA n 
1  601  VAL n 
1  602  ALA n 
1  603  HIS n 
1  604  CYS n 
1  605  PRO n 
1  606  LYS n 
1  607  ALA n 
1  608  GLU n 
1  609  VAL n 
1  610  LEU n 
1  611  TRP n 
1  612  LEU n 
1  613  MET n 
1  614  GLY n 
1  615  ALA n 
1  616  LYS n 
1  617  SER n 
1  618  LYS n 
1  619  TRP n 
1  620  LEU n 
1  621  ALA n 
1  622  GLY n 
1  623  ASP n 
1  624  VAL n 
1  625  PRO n 
1  626  ALA n 
1  627  ALA n 
1  628  ARG n 
1  629  SER n 
1  630  ILE n 
1  631  LEU n 
1  632  ALA n 
1  633  LEU n 
1  634  ALA n 
1  635  PHE n 
1  636  GLN n 
1  637  ALA n 
1  638  ASN n 
1  639  PRO n 
1  640  ASN n 
1  641  SER n 
1  642  GLU n 
1  643  GLU n 
1  644  ILE n 
1  645  TRP n 
1  646  LEU n 
1  647  ALA n 
1  648  ALA n 
1  649  VAL n 
1  650  LYS n 
1  651  LEU n 
1  652  GLU n 
1  653  SER n 
1  654  GLU n 
1  655  ASN n 
1  656  ASP n 
1  657  GLU n 
1  658  TYR n 
1  659  GLU n 
1  660  ARG n 
1  661  ALA n 
1  662  ARG n 
1  663  ARG n 
1  664  LEU n 
1  665  LEU n 
1  666  ALA n 
1  667  LYS n 
1  668  ALA n 
1  669  ARG n 
1  670  SER n 
1  671  SER n 
1  672  ALA n 
1  673  PRO n 
1  674  THR n 
1  675  ALA n 
1  676  ARG n 
1  677  VAL n 
1  678  PHE n 
1  679  MET n 
1  680  LYS n 
1  681  SER n 
1  682  VAL n 
1  683  LYS n 
1  684  LEU n 
1  685  GLU n 
1  686  TRP n 
1  687  VAL n 
1  688  GLN n 
1  689  ASP n 
1  690  ASN n 
1  691  ILE n 
1  692  ARG n 
1  693  ALA n 
1  694  ALA n 
1  695  GLN n 
1  696  ASP n 
1  697  LEU n 
1  698  CYS n 
1  699  GLU n 
1  700  GLU n 
1  701  ALA n 
1  702  LEU n 
1  703  ARG n 
1  704  HIS n 
1  705  TYR n 
1  706  GLU n 
1  707  ASP n 
1  708  PHE n 
1  709  PRO n 
1  710  LYS n 
1  711  LEU n 
1  712  TRP n 
1  713  MET n 
1  714  MET n 
1  715  LYS n 
1  716  GLY n 
1  717  GLN n 
1  718  ILE n 
1  719  GLU n 
1  720  GLU n 
1  721  GLN n 
1  722  LYS n 
1  723  GLU n 
1  724  MET n 
1  725  MET n 
1  726  GLU n 
1  727  LYS n 
1  728  ALA n 
1  729  ARG n 
1  730  GLU n 
1  731  ALA n 
1  732  TYR n 
1  733  ASN n 
1  734  GLN n 
1  735  GLY n 
1  736  LEU n 
1  737  LYS n 
1  738  LYS n 
1  739  CYS n 
1  740  PRO n 
1  741  HIS n 
1  742  SER n 
1  743  THR n 
1  744  PRO n 
1  745  LEU n 
1  746  TRP n 
1  747  LEU n 
1  748  LEU n 
1  749  LEU n 
1  750  SER n 
1  751  ARG n 
1  752  LEU n 
1  753  GLU n 
1  754  GLU n 
1  755  LYS n 
1  756  ILE n 
1  757  GLY n 
1  758  GLN n 
1  759  LEU n 
1  760  THR n 
1  761  ARG n 
1  762  ALA n 
1  763  ARG n 
1  764  ALA n 
1  765  ILE n 
1  766  LEU n 
1  767  GLU n 
1  768  LYS n 
1  769  SER n 
1  770  ARG n 
1  771  LEU n 
1  772  LYS n 
1  773  ASN n 
1  774  PRO n 
1  775  LYS n 
1  776  ASN n 
1  777  PRO n 
1  778  GLY n 
1  779  LEU n 
1  780  TRP n 
1  781  LEU n 
1  782  GLU n 
1  783  SER n 
1  784  VAL n 
1  785  ARG n 
1  786  LEU n 
1  787  GLU n 
1  788  TYR n 
1  789  ARG n 
1  790  ALA n 
1  791  GLY n 
1  792  LEU n 
1  793  LYS n 
1  794  ASN n 
1  795  ILE n 
1  796  ALA n 
1  797  ASN n 
1  798  THR n 
1  799  LEU n 
1  800  MET n 
1  801  ALA n 
1  802  LYS n 
1  803  ALA n 
1  804  LEU n 
1  805  GLN n 
1  806  GLU n 
1  807  CYS n 
1  808  PRO n 
1  809  ASN n 
1  810  SER n 
1  811  GLY n 
1  812  ILE n 
1  813  LEU n 
1  814  TRP n 
1  815  SER n 
1  816  GLU n 
1  817  ALA n 
1  818  ILE n 
1  819  PHE n 
1  820  LEU n 
1  821  GLU n 
1  822  ALA n 
1  823  ARG n 
1  824  PRO n 
1  825  GLN n 
1  826  ARG n 
1  827  ARG n 
1  828  THR n 
1  829  LYS n 
1  830  SER n 
1  831  VAL n 
1  832  ASP n 
1  833  ALA n 
1  834  LEU n 
1  835  LYS n 
1  836  LYS n 
1  837  CYS n 
1  838  GLU n 
1  839  HIS n 
1  840  ASP n 
1  841  PRO n 
1  842  HIS n 
1  843  VAL n 
1  844  LEU n 
1  845  LEU n 
1  846  ALA n 
1  847  VAL n 
1  848  ALA n 
1  849  LYS n 
1  850  LEU n 
1  851  PHE n 
1  852  TRP n 
1  853  SER n 
1  854  GLN n 
1  855  ARG n 
1  856  LYS n 
1  857  ILE n 
1  858  THR n 
1  859  LYS n 
1  860  ALA n 
1  861  ARG n 
1  862  GLU n 
1  863  TRP n 
1  864  PHE n 
1  865  HIS n 
1  866  ARG n 
1  867  THR n 
1  868  VAL n 
1  869  LYS n 
1  870  ILE n 
1  871  ASP n 
1  872  SER n 
1  873  ASP n 
1  874  LEU n 
1  875  GLY n 
1  876  ASP n 
1  877  ALA n 
1  878  TRP n 
1  879  ALA n 
1  880  PHE n 
1  881  PHE n 
1  882  TYR n 
1  883  LYS n 
1  884  PHE n 
1  885  GLU n 
1  886  LEU n 
1  887  GLN n 
1  888  HIS n 
1  889  GLY n 
1  890  THR n 
1  891  GLU n 
1  892  GLU n 
1  893  GLN n 
1  894  GLN n 
1  895  GLU n 
1  896  GLU n 
1  897  VAL n 
1  898  ARG n 
1  899  LYS n 
1  900  ARG n 
1  901  CYS n 
1  902  GLU n 
1  903  SER n 
1  904  ALA n 
1  905  GLU n 
1  906  PRO n 
1  907  ARG n 
1  908  HIS n 
1  909  GLY n 
1  910  GLU n 
1  911  LEU n 
1  912  TRP n 
1  913  CYS n 
1  914  ALA n 
1  915  VAL n 
1  916  SER n 
1  917  LYS n 
1  918  ASP n 
1  919  ILE n 
1  920  ALA n 
1  921  ASN n 
1  922  TRP n 
1  923  GLN n 
1  924  LYS n 
1  925  LYS n 
1  926  ILE n 
1  927  GLY n 
1  928  ASP n 
1  929  ILE n 
1  930  LEU n 
1  931  ARG n 
1  932  LEU n 
1  933  VAL n 
1  934  ALA n 
1  935  GLY n 
1  936  ARG n 
1  937  ILE n 
1  938  LYS n 
1  939  ASN n 
1  940  THR n 
1  941  PHE n 
2  1    MET n 
2  2    ILE n 
2  3    GLU n 
2  4    GLN n 
2  5    GLN n 
2  6    LYS n 
2  7    ARG n 
2  8    LYS n 
2  9    GLY n 
2  10   PRO n 
2  11   GLU n 
2  12   LEU n 
2  13   PRO n 
2  14   LEU n 
2  15   VAL n 
2  16   PRO n 
2  17   VAL n 
2  18   LYS n 
2  19   ARG n 
2  20   GLN n 
2  21   ARG n 
2  22   HIS n 
2  23   GLU n 
2  24   LEU n 
2  25   LEU n 
2  26   LEU n 
2  27   GLY n 
2  28   ALA n 
2  29   GLY n 
2  30   SER n 
2  31   GLY n 
2  32   PRO n 
2  33   GLY n 
2  34   ALA n 
2  35   GLY n 
2  36   GLN n 
2  37   GLN n 
2  38   GLN n 
2  39   ALA n 
2  40   THR n 
2  41   PRO n 
2  42   GLY n 
2  43   ALA n 
2  44   LEU n 
2  45   LEU n 
2  46   GLN n 
2  47   ALA n 
2  48   GLY n 
2  49   PRO n 
2  50   PRO n 
2  51   ARG n 
2  52   CYS n 
2  53   SER n 
2  54   SER n 
2  55   LEU n 
2  56   GLN n 
2  57   ALA n 
2  58   PRO n 
2  59   ILE n 
2  60   MET n 
2  61   LEU n 
2  62   LEU n 
2  63   SER n 
2  64   GLY n 
2  65   HIS n 
2  66   GLU n 
2  67   GLY n 
2  68   GLU n 
2  69   VAL n 
2  70   TYR n 
2  71   CYS n 
2  72   CYS n 
2  73   LYS n 
2  74   PHE n 
2  75   HIS n 
2  76   PRO n 
2  77   ASN n 
2  78   GLY n 
2  79   SER n 
2  80   THR n 
2  81   LEU n 
2  82   ALA n 
2  83   SER n 
2  84   ALA n 
2  85   GLY n 
2  86   PHE n 
2  87   ASP n 
2  88   ARG n 
2  89   LEU n 
2  90   ILE n 
2  91   LEU n 
2  92   LEU n 
2  93   TRP n 
2  94   ASN n 
2  95   VAL n 
2  96   TYR n 
2  97   GLY n 
2  98   ASP n 
2  99   CYS n 
2  100  ASP n 
2  101  ASN n 
2  102  TYR n 
2  103  ALA n 
2  104  THR n 
2  105  LEU n 
2  106  LYS n 
2  107  GLY n 
2  108  HIS n 
2  109  SER n 
2  110  GLY n 
2  111  ALA n 
2  112  VAL n 
2  113  MET n 
2  114  GLU n 
2  115  LEU n 
2  116  HIS n 
2  117  TYR n 
2  118  ASN n 
2  119  THR n 
2  120  ASP n 
2  121  GLY n 
2  122  SER n 
2  123  MET n 
2  124  LEU n 
2  125  PHE n 
2  126  SER n 
2  127  ALA n 
2  128  SER n 
2  129  THR n 
2  130  ASP n 
2  131  LYS n 
2  132  THR n 
2  133  VAL n 
2  134  ALA n 
2  135  VAL n 
2  136  TRP n 
2  137  ASP n 
2  138  SER n 
2  139  GLU n 
2  140  THR n 
2  141  GLY n 
2  142  GLU n 
2  143  ARG n 
2  144  VAL n 
2  145  LYS n 
2  146  ARG n 
2  147  LEU n 
2  148  LYS n 
2  149  GLY n 
2  150  HIS n 
2  151  THR n 
2  152  SER n 
2  153  PHE n 
2  154  VAL n 
2  155  ASN n 
2  156  SER n 
2  157  CYS n 
2  158  TYR n 
2  159  PRO n 
2  160  ALA n 
2  161  ARG n 
2  162  ARG n 
2  163  GLY n 
2  164  PRO n 
2  165  GLN n 
2  166  LEU n 
2  167  VAL n 
2  168  CYS n 
2  169  THR n 
2  170  GLY n 
2  171  SER n 
2  172  ASP n 
2  173  ASP n 
2  174  GLY n 
2  175  THR n 
2  176  VAL n 
2  177  LYS n 
2  178  LEU n 
2  179  TRP n 
2  180  ASP n 
2  181  ILE n 
2  182  ARG n 
2  183  LYS n 
2  184  LYS n 
2  185  ALA n 
2  186  ALA n 
2  187  ILE n 
2  188  GLN n 
2  189  THR n 
2  190  PHE n 
2  191  GLN n 
2  192  ASN n 
2  193  THR n 
2  194  TYR n 
2  195  GLN n 
2  196  VAL n 
2  197  LEU n 
2  198  ALA n 
2  199  VAL n 
2  200  THR n 
2  201  PHE n 
2  202  ASN n 
2  203  ASP n 
2  204  THR n 
2  205  SER n 
2  206  ASP n 
2  207  GLN n 
2  208  ILE n 
2  209  ILE n 
2  210  SER n 
2  211  GLY n 
2  212  GLY n 
2  213  ILE n 
2  214  ASP n 
2  215  ASN n 
2  216  ASP n 
2  217  ILE n 
2  218  LYS n 
2  219  VAL n 
2  220  TRP n 
2  221  ASP n 
2  222  LEU n 
2  223  ARG n 
2  224  GLN n 
2  225  ASN n 
2  226  LYS n 
2  227  LEU n 
2  228  THR n 
2  229  TYR n 
2  230  THR n 
2  231  MET n 
2  232  ARG n 
2  233  GLY n 
2  234  HIS n 
2  235  ALA n 
2  236  ASP n 
2  237  SER n 
2  238  VAL n 
2  239  THR n 
2  240  GLY n 
2  241  LEU n 
2  242  SER n 
2  243  LEU n 
2  244  SER n 
2  245  SER n 
2  246  GLU n 
2  247  GLY n 
2  248  SER n 
2  249  TYR n 
2  250  LEU n 
2  251  LEU n 
2  252  SER n 
2  253  ASN n 
2  254  ALA n 
2  255  MET n 
2  256  ASP n 
2  257  ASN n 
2  258  THR n 
2  259  VAL n 
2  260  ARG n 
2  261  VAL n 
2  262  TRP n 
2  263  ASP n 
2  264  VAL n 
2  265  ARG n 
2  266  PRO n 
2  267  PHE n 
2  268  ALA n 
2  269  PRO n 
2  270  LYS n 
2  271  GLU n 
2  272  ARG n 
2  273  CYS n 
2  274  VAL n 
2  275  LYS n 
2  276  ILE n 
2  277  PHE n 
2  278  GLN n 
2  279  GLY n 
2  280  ASN n 
2  281  VAL n 
2  282  HIS n 
2  283  ASN n 
2  284  PHE n 
2  285  GLU n 
2  286  LYS n 
2  287  ASN n 
2  288  LEU n 
2  289  LEU n 
2  290  ARG n 
2  291  CYS n 
2  292  SER n 
2  293  TRP n 
2  294  SER n 
2  295  PRO n 
2  296  ASP n 
2  297  GLY n 
2  298  SER n 
2  299  LYS n 
2  300  ILE n 
2  301  ALA n 
2  302  ALA n 
2  303  GLY n 
2  304  SER n 
2  305  ALA n 
2  306  ASP n 
2  307  ARG n 
2  308  PHE n 
2  309  VAL n 
2  310  TYR n 
2  311  VAL n 
2  312  TRP n 
2  313  ASP n 
2  314  THR n 
2  315  THR n 
2  316  SER n 
2  317  ARG n 
2  318  ARG n 
2  319  ILE n 
2  320  LEU n 
2  321  TYR n 
2  322  LYS n 
2  323  LEU n 
2  324  PRO n 
2  325  GLY n 
2  326  HIS n 
2  327  ALA n 
2  328  GLY n 
2  329  SER n 
2  330  ILE n 
2  331  ASN n 
2  332  GLU n 
2  333  VAL n 
2  334  ALA n 
2  335  PHE n 
2  336  HIS n 
2  337  PRO n 
2  338  ASP n 
2  339  GLU n 
2  340  PRO n 
2  341  ILE n 
2  342  ILE n 
2  343  ILE n 
2  344  SER n 
2  345  ALA n 
2  346  SER n 
2  347  SER n 
2  348  ASP n 
2  349  LYS n 
2  350  ARG n 
2  351  LEU n 
2  352  TYR n 
2  353  MET n 
2  354  GLY n 
2  355  GLU n 
2  356  ILE n 
2  357  GLN n 
3  1    MET n 
3  2    ALA n 
3  3    ASP n 
3  4    VAL n 
3  5    THR n 
3  6    ALA n 
3  7    ARG n 
3  8    SER n 
3  9    LEU n 
3  10   GLN n 
3  11   TYR n 
3  12   GLU n 
3  13   TYR n 
3  14   LYS n 
3  15   ALA n 
3  16   ASN n 
3  17   SER n 
3  18   ASN n 
3  19   LEU n 
3  20   VAL n 
3  21   LEU n 
3  22   GLN n 
3  23   ALA n 
3  24   ASP n 
3  25   ARG n 
3  26   SER n 
3  27   LEU n 
3  28   ILE n 
3  29   ASP n 
3  30   ARG n 
3  31   THR n 
3  32   ARG n 
3  33   ARG n 
3  34   ASP n 
3  35   GLU n 
3  36   PRO n 
3  37   THR n 
3  38   GLY n 
3  39   GLU n 
3  40   VAL n 
3  41   LEU n 
3  42   SER n 
3  43   LEU n 
3  44   VAL n 
3  45   GLY n 
3  46   LYS n 
3  47   LEU n 
3  48   GLU n 
3  49   GLY n 
3  50   THR n 
3  51   ARG n 
3  52   MET n 
3  53   GLY n 
3  54   ASP n 
3  55   LYS n 
3  56   ALA n 
3  57   GLN n 
3  58   ARG n 
3  59   THR n 
3  60   LYS n 
3  61   PRO n 
3  62   GLN n 
3  63   MET n 
3  64   GLN n 
3  65   GLU n 
3  66   GLU n 
3  67   ARG n 
3  68   ARG n 
3  69   ALA n 
3  70   LYS n 
3  71   ARG n 
3  72   ARG n 
3  73   LYS n 
3  74   ARG n 
3  75   ASP n 
3  76   GLU n 
3  77   ASP n 
3  78   ARG n 
3  79   HIS n 
3  80   ASP n 
3  81   ILE n 
3  82   ASN n 
3  83   LYS n 
3  84   MET n 
3  85   LYS n 
3  86   GLY n 
3  87   TYR n 
3  88   THR n 
3  89   LEU n 
3  90   LEU n 
3  91   SER n 
3  92   GLU n 
3  93   GLY n 
3  94   ILE n 
3  95   ASP n 
3  96   GLU n 
3  97   MET n 
3  98   VAL n 
3  99   GLY n 
3  100  ILE n 
3  101  ILE n 
3  102  TYR n 
3  103  LYS n 
3  104  PRO n 
3  105  LYS n 
3  106  THR n 
3  107  LYS n 
3  108  GLU n 
3  109  THR n 
3  110  ARG n 
3  111  GLU n 
3  112  THR n 
3  113  TYR n 
3  114  GLU n 
3  115  VAL n 
3  116  LEU n 
3  117  LEU n 
3  118  SER n 
3  119  PHE n 
3  120  ILE n 
3  121  GLN n 
3  122  ALA n 
3  123  ALA n 
3  124  LEU n 
3  125  GLY n 
3  126  ASP n 
3  127  GLN n 
3  128  PRO n 
3  129  ARG n 
3  130  ASP n 
3  131  ILE n 
3  132  LEU n 
3  133  CYS n 
3  134  GLY n 
3  135  ALA n 
3  136  ALA n 
3  137  ASP n 
3  138  GLU n 
3  139  VAL n 
3  140  LEU n 
3  141  ALA n 
3  142  VAL n 
3  143  LEU n 
3  144  LYS n 
3  145  ASN n 
3  146  GLU n 
3  147  LYS n 
3  148  LEU n 
3  149  ARG n 
3  150  ASP n 
3  151  LYS n 
3  152  GLU n 
3  153  ARG n 
3  154  ARG n 
3  155  LYS n 
3  156  GLU n 
3  157  ILE n 
3  158  ASP n 
3  159  LEU n 
3  160  LEU n 
3  161  LEU n 
3  162  GLY n 
3  163  GLN n 
3  164  THR n 
3  165  ASP n 
3  166  ASP n 
3  167  THR n 
3  168  ARG n 
3  169  TYR n 
3  170  HIS n 
3  171  VAL n 
3  172  LEU n 
3  173  VAL n 
3  174  ASN n 
3  175  LEU n 
3  176  GLY n 
3  177  LYS n 
3  178  LYS n 
3  179  ILE n 
3  180  THR n 
3  181  ASP n 
3  182  TYR n 
3  183  GLY n 
3  184  GLY n 
3  185  ASP n 
3  186  LYS n 
3  187  GLU n 
3  188  ILE n 
3  189  GLN n 
3  190  ASN n 
3  191  MET n 
3  192  ASP n 
3  193  ASP n 
3  194  ASN n 
3  195  ILE n 
3  196  ASP n 
3  197  GLU n 
3  198  THR n 
3  199  TYR n 
3  200  GLY n 
3  201  VAL n 
3  202  ASN n 
3  203  VAL n 
3  204  GLN n 
3  205  PHE n 
3  206  GLU n 
3  207  SER n 
3  208  ASP n 
3  209  GLU n 
3  210  GLU n 
3  211  GLU n 
3  212  GLY n 
3  213  ASP n 
3  214  GLU n 
3  215  ASP n 
3  216  VAL n 
3  217  TYR n 
3  218  GLY n 
3  219  GLU n 
3  220  VAL n 
3  221  ARG n 
3  222  GLU n 
3  223  GLU n 
3  224  ALA n 
3  225  SER n 
3  226  ASP n 
3  227  ASP n 
3  228  ASP n 
3  229  MET n 
3  230  GLU n 
3  231  GLY n 
3  232  ASP n 
3  233  GLU n 
3  234  ALA n 
3  235  VAL n 
3  236  VAL n 
3  237  ARG n 
3  238  CYS n 
3  239  THR n 
3  240  LEU n 
3  241  SER n 
3  242  ALA n 
3  243  ASN n 
3  244  LEU n 
3  245  VAL n 
3  246  ALA n 
3  247  SER n 
3  248  GLY n 
3  249  GLU n 
3  250  LEU n 
3  251  MET n 
3  252  SER n 
3  253  SER n 
3  254  LYS n 
3  255  LYS n 
3  256  LYS n 
3  257  ASP n 
3  258  LEU n 
3  259  HIS n 
3  260  PRO n 
3  261  ARG n 
3  262  ASP n 
3  263  ILE n 
3  264  ASP n 
3  265  ALA n 
3  266  PHE n 
3  267  TRP n 
3  268  LEU n 
3  269  GLN n 
3  270  ARG n 
3  271  GLN n 
3  272  LEU n 
3  273  SER n 
3  274  ARG n 
3  275  PHE n 
3  276  TYR n 
3  277  ASP n 
3  278  ASP n 
3  279  ALA n 
3  280  ILE n 
3  281  VAL n 
3  282  SER n 
3  283  GLN n 
3  284  LYS n 
3  285  LYS n 
3  286  ALA n 
3  287  ASP n 
3  288  GLU n 
3  289  VAL n 
3  290  LEU n 
3  291  GLU n 
3  292  ILE n 
3  293  LEU n 
3  294  LYS n 
3  295  THR n 
3  296  ALA n 
3  297  SER n 
3  298  ASP n 
3  299  ASP n 
3  300  ARG n 
3  301  GLU n 
3  302  CYS n 
3  303  GLU n 
3  304  ASN n 
3  305  GLN n 
3  306  LEU n 
3  307  VAL n 
3  308  LEU n 
3  309  LEU n 
3  310  LEU n 
3  311  GLY n 
3  312  PHE n 
3  313  ASN n 
3  314  THR n 
3  315  PHE n 
3  316  ASP n 
3  317  PHE n 
3  318  ILE n 
3  319  LYS n 
3  320  VAL n 
3  321  LEU n 
3  322  ARG n 
3  323  GLN n 
3  324  HIS n 
3  325  ARG n 
3  326  MET n 
3  327  MET n 
3  328  ILE n 
3  329  LEU n 
3  330  TYR n 
3  331  CYS n 
3  332  THR n 
3  333  LEU n 
3  334  LEU n 
3  335  ALA n 
3  336  SER n 
3  337  ALA n 
3  338  GLN n 
3  339  SER n 
3  340  GLU n 
3  341  ALA n 
3  342  GLU n 
3  343  LYS n 
3  344  GLU n 
3  345  ARG n 
3  346  ILE n 
3  347  MET n 
3  348  GLY n 
3  349  LYS n 
3  350  MET n 
3  351  GLU n 
3  352  ALA n 
3  353  ASP n 
3  354  PRO n 
3  355  GLU n 
3  356  LEU n 
3  357  SER n 
3  358  LYS n 
3  359  PHE n 
3  360  LEU n 
3  361  TYR n 
3  362  GLN n 
3  363  LEU n 
3  364  HIS n 
3  365  GLU n 
3  366  THR n 
3  367  GLU n 
3  368  LYS n 
3  369  GLU n 
3  370  ASP n 
3  371  LEU n 
3  372  ILE n 
3  373  ARG n 
3  374  GLU n 
3  375  GLU n 
3  376  ARG n 
3  377  SER n 
3  378  ARG n 
3  379  ARG n 
3  380  GLU n 
3  381  ARG n 
3  382  VAL n 
3  383  ARG n 
3  384  GLN n 
3  385  SER n 
3  386  ARG n 
3  387  MET n 
3  388  ASP n 
3  389  THR n 
3  390  ASP n 
3  391  LEU n 
3  392  GLU n 
3  393  THR n 
3  394  MET n 
3  395  ASP n 
3  396  LEU n 
3  397  ASP n 
3  398  GLN n 
3  399  GLY n 
3  400  GLY n 
3  401  GLU n 
3  402  ALA n 
3  403  LEU n 
3  404  ALA n 
3  405  PRO n 
3  406  ARG n 
3  407  GLN n 
3  408  VAL n 
3  409  LEU n 
3  410  ASP n 
3  411  LEU n 
3  412  GLU n 
3  413  ASP n 
3  414  LEU n 
3  415  VAL n 
3  416  PHE n 
3  417  THR n 
3  418  GLN n 
3  419  GLY n 
3  420  SER n 
3  421  HIS n 
3  422  PHE n 
3  423  MET n 
3  424  ALA n 
3  425  ASN n 
3  426  LYS n 
3  427  ARG n 
3  428  CYS n 
3  429  GLN n 
3  430  LEU n 
3  431  PRO n 
3  432  ASP n 
3  433  GLY n 
3  434  SER n 
3  435  PHE n 
3  436  ARG n 
3  437  ARG n 
3  438  GLN n 
3  439  ARG n 
3  440  LYS n 
3  441  GLY n 
3  442  TYR n 
3  443  GLU n 
3  444  GLU n 
3  445  VAL n 
3  446  HIS n 
3  447  VAL n 
3  448  PRO n 
3  449  ALA n 
3  450  LEU n 
3  451  LYS n 
3  452  PRO n 
3  453  LYS n 
3  454  PRO n 
3  455  PHE n 
3  456  GLY n 
3  457  SER n 
3  458  GLU n 
3  459  GLU n 
3  460  GLN n 
3  461  LEU n 
3  462  LEU n 
3  463  PRO n 
3  464  VAL n 
3  465  GLU n 
3  466  LYS n 
3  467  LEU n 
3  468  PRO n 
3  469  LYS n 
3  470  TYR n 
3  471  ALA n 
3  472  GLN n 
3  473  ALA n 
3  474  GLY n 
3  475  PHE n 
3  476  GLU n 
3  477  GLY n 
3  478  PHE n 
3  479  LYS n 
3  480  THR n 
3  481  LEU n 
3  482  ASN n 
3  483  ARG n 
3  484  ILE n 
3  485  GLN n 
3  486  SER n 
3  487  LYS n 
3  488  LEU n 
3  489  TYR n 
3  490  ARG n 
3  491  ALA n 
3  492  ALA n 
3  493  LEU n 
3  494  GLU n 
3  495  THR n 
3  496  ASP n 
3  497  GLU n 
3  498  ASN n 
3  499  LEU n 
3  500  LEU n 
3  501  LEU n 
3  502  CYS n 
3  503  ALA n 
3  504  PRO n 
3  505  THR n 
3  506  GLY n 
3  507  ALA n 
3  508  GLY n 
3  509  LYS n 
3  510  THR n 
3  511  ASN n 
3  512  VAL n 
3  513  ALA n 
3  514  LEU n 
3  515  MET n 
3  516  CYS n 
3  517  MET n 
3  518  LEU n 
3  519  ARG n 
3  520  GLU n 
3  521  ILE n 
3  522  GLY n 
3  523  LYS n 
3  524  HIS n 
3  525  ILE n 
3  526  ASN n 
3  527  MET n 
3  528  ASP n 
3  529  GLY n 
3  530  THR n 
3  531  ILE n 
3  532  ASN n 
3  533  VAL n 
3  534  ASP n 
3  535  ASP n 
3  536  PHE n 
3  537  LYS n 
3  538  ILE n 
3  539  ILE n 
3  540  TYR n 
3  541  ILE n 
3  542  ALA n 
3  543  PRO n 
3  544  MET n 
3  545  ARG n 
3  546  SER n 
3  547  LEU n 
3  548  VAL n 
3  549  GLN n 
3  550  GLU n 
3  551  MET n 
3  552  VAL n 
3  553  GLY n 
3  554  SER n 
3  555  PHE n 
3  556  GLY n 
3  557  LYS n 
3  558  ARG n 
3  559  LEU n 
3  560  ALA n 
3  561  THR n 
3  562  TYR n 
3  563  GLY n 
3  564  ILE n 
3  565  THR n 
3  566  VAL n 
3  567  ALA n 
3  568  GLU n 
3  569  LEU n 
3  570  THR n 
3  571  GLY n 
3  572  ASP n 
3  573  HIS n 
3  574  GLN n 
3  575  LEU n 
3  576  CYS n 
3  577  LYS n 
3  578  GLU n 
3  579  GLU n 
3  580  ILE n 
3  581  SER n 
3  582  ALA n 
3  583  THR n 
3  584  GLN n 
3  585  ILE n 
3  586  ILE n 
3  587  VAL n 
3  588  CYS n 
3  589  THR n 
3  590  PRO n 
3  591  GLU n 
3  592  LYS n 
3  593  TRP n 
3  594  ASP n 
3  595  ILE n 
3  596  ILE n 
3  597  THR n 
3  598  ARG n 
3  599  LYS n 
3  600  GLY n 
3  601  GLY n 
3  602  GLU n 
3  603  ARG n 
3  604  THR n 
3  605  TYR n 
3  606  THR n 
3  607  GLN n 
3  608  LEU n 
3  609  VAL n 
3  610  ARG n 
3  611  LEU n 
3  612  ILE n 
3  613  ILE n 
3  614  LEU n 
3  615  ASP n 
3  616  GLU n 
3  617  ILE n 
3  618  HIS n 
3  619  LEU n 
3  620  LEU n 
3  621  HIS n 
3  622  ASP n 
3  623  ASP n 
3  624  ARG n 
3  625  GLY n 
3  626  PRO n 
3  627  VAL n 
3  628  LEU n 
3  629  GLU n 
3  630  ALA n 
3  631  LEU n 
3  632  VAL n 
3  633  ALA n 
3  634  ARG n 
3  635  ALA n 
3  636  ILE n 
3  637  ARG n 
3  638  ASN n 
3  639  ILE n 
3  640  GLU n 
3  641  MET n 
3  642  THR n 
3  643  GLN n 
3  644  GLU n 
3  645  ASP n 
3  646  VAL n 
3  647  ARG n 
3  648  LEU n 
3  649  ILE n 
3  650  GLY n 
3  651  LEU n 
3  652  SER n 
3  653  ALA n 
3  654  THR n 
3  655  LEU n 
3  656  PRO n 
3  657  ASN n 
3  658  TYR n 
3  659  GLU n 
3  660  ASP n 
3  661  VAL n 
3  662  ALA n 
3  663  THR n 
3  664  PHE n 
3  665  LEU n 
3  666  ARG n 
3  667  VAL n 
3  668  ASP n 
3  669  PRO n 
3  670  ALA n 
3  671  LYS n 
3  672  GLY n 
3  673  LEU n 
3  674  PHE n 
3  675  TYR n 
3  676  PHE n 
3  677  ASP n 
3  678  ASN n 
3  679  SER n 
3  680  PHE n 
3  681  ARG n 
3  682  PRO n 
3  683  VAL n 
3  684  PRO n 
3  685  LEU n 
3  686  GLU n 
3  687  GLN n 
3  688  THR n 
3  689  TYR n 
3  690  VAL n 
3  691  GLY n 
3  692  ILE n 
3  693  THR n 
3  694  GLU n 
3  695  LYS n 
3  696  LYS n 
3  697  ALA n 
3  698  ILE n 
3  699  LYS n 
3  700  ARG n 
3  701  PHE n 
3  702  GLN n 
3  703  ILE n 
3  704  MET n 
3  705  ASN n 
3  706  GLU n 
3  707  ILE n 
3  708  VAL n 
3  709  TYR n 
3  710  GLU n 
3  711  LYS n 
3  712  ILE n 
3  713  MET n 
3  714  GLU n 
3  715  HIS n 
3  716  ALA n 
3  717  GLY n 
3  718  LYS n 
3  719  ASN n 
3  720  GLN n 
3  721  VAL n 
3  722  LEU n 
3  723  VAL n 
3  724  PHE n 
3  725  VAL n 
3  726  HIS n 
3  727  SER n 
3  728  ARG n 
3  729  LYS n 
3  730  GLU n 
3  731  THR n 
3  732  GLY n 
3  733  LYS n 
3  734  THR n 
3  735  ALA n 
3  736  ARG n 
3  737  ALA n 
3  738  ILE n 
3  739  ARG n 
3  740  ASP n 
3  741  MET n 
3  742  CYS n 
3  743  LEU n 
3  744  GLU n 
3  745  LYS n 
3  746  ASP n 
3  747  THR n 
3  748  LEU n 
3  749  GLY n 
3  750  LEU n 
3  751  PHE n 
3  752  LEU n 
3  753  ARG n 
3  754  GLU n 
3  755  GLY n 
3  756  SER n 
3  757  ALA n 
3  758  SER n 
3  759  THR n 
3  760  GLU n 
3  761  VAL n 
3  762  LEU n 
3  763  ARG n 
3  764  THR n 
3  765  GLU n 
3  766  ALA n 
3  767  GLU n 
3  768  GLN n 
3  769  CYS n 
3  770  LYS n 
3  771  ASN n 
3  772  LEU n 
3  773  GLU n 
3  774  LEU n 
3  775  LYS n 
3  776  ASP n 
3  777  LEU n 
3  778  LEU n 
3  779  PRO n 
3  780  TYR n 
3  781  GLY n 
3  782  PHE n 
3  783  ALA n 
3  784  ILE n 
3  785  HIS n 
3  786  HIS n 
3  787  ALA n 
3  788  GLY n 
3  789  MET n 
3  790  THR n 
3  791  ARG n 
3  792  VAL n 
3  793  ASP n 
3  794  ARG n 
3  795  THR n 
3  796  LEU n 
3  797  VAL n 
3  798  GLU n 
3  799  ASP n 
3  800  LEU n 
3  801  PHE n 
3  802  ALA n 
3  803  ASP n 
3  804  LYS n 
3  805  HIS n 
3  806  ILE n 
3  807  GLN n 
3  808  VAL n 
3  809  LEU n 
3  810  VAL n 
3  811  SER n 
3  812  THR n 
3  813  ALA n 
3  814  THR n 
3  815  LEU n 
3  816  ALA n 
3  817  TRP n 
3  818  GLY n 
3  819  VAL n 
3  820  ASN n 
3  821  LEU n 
3  822  PRO n 
3  823  ALA n 
3  824  HIS n 
3  825  THR n 
3  826  VAL n 
3  827  ILE n 
3  828  ILE n 
3  829  LYS n 
3  830  GLY n 
3  831  THR n 
3  832  GLN n 
3  833  VAL n 
3  834  TYR n 
3  835  SER n 
3  836  PRO n 
3  837  GLU n 
3  838  LYS n 
3  839  GLY n 
3  840  ARG n 
3  841  TRP n 
3  842  THR n 
3  843  GLU n 
3  844  LEU n 
3  845  GLY n 
3  846  ALA n 
3  847  LEU n 
3  848  ASP n 
3  849  ILE n 
3  850  LEU n 
3  851  GLN n 
3  852  MET n 
3  853  LEU n 
3  854  GLY n 
3  855  ARG n 
3  856  ALA n 
3  857  GLY n 
3  858  ARG n 
3  859  PRO n 
3  860  GLN n 
3  861  TYR n 
3  862  ASP n 
3  863  THR n 
3  864  LYS n 
3  865  GLY n 
3  866  GLU n 
3  867  GLY n 
3  868  ILE n 
3  869  LEU n 
3  870  ILE n 
3  871  THR n 
3  872  SER n 
3  873  HIS n 
3  874  GLY n 
3  875  GLU n 
3  876  LEU n 
3  877  GLN n 
3  878  TYR n 
3  879  TYR n 
3  880  LEU n 
3  881  SER n 
3  882  LEU n 
3  883  LEU n 
3  884  ASN n 
3  885  GLN n 
3  886  GLN n 
3  887  LEU n 
3  888  PRO n 
3  889  ILE n 
3  890  GLU n 
3  891  SER n 
3  892  GLN n 
3  893  MET n 
3  894  VAL n 
3  895  SER n 
3  896  LYS n 
3  897  LEU n 
3  898  PRO n 
3  899  ASP n 
3  900  MET n 
3  901  LEU n 
3  902  ASN n 
3  903  ALA n 
3  904  GLU n 
3  905  ILE n 
3  906  VAL n 
3  907  LEU n 
3  908  GLY n 
3  909  ASN n 
3  910  VAL n 
3  911  GLN n 
3  912  ASN n 
3  913  ALA n 
3  914  LYS n 
3  915  ASP n 
3  916  ALA n 
3  917  VAL n 
3  918  ASN n 
3  919  TRP n 
3  920  LEU n 
3  921  GLY n 
3  922  TYR n 
3  923  ALA n 
3  924  TYR n 
3  925  LEU n 
3  926  TYR n 
3  927  ILE n 
3  928  ARG n 
3  929  MET n 
3  930  LEU n 
3  931  ARG n 
3  932  SER n 
3  933  PRO n 
3  934  THR n 
3  935  LEU n 
3  936  TYR n 
3  937  GLY n 
3  938  ILE n 
3  939  SER n 
3  940  HIS n 
3  941  ASP n 
3  942  ASP n 
3  943  LEU n 
3  944  LYS n 
3  945  GLY n 
3  946  ASP n 
3  947  PRO n 
3  948  LEU n 
3  949  LEU n 
3  950  ASP n 
3  951  GLN n 
3  952  ARG n 
3  953  ARG n 
3  954  LEU n 
3  955  ASP n 
3  956  LEU n 
3  957  VAL n 
3  958  HIS n 
3  959  THR n 
3  960  ALA n 
3  961  ALA n 
3  962  LEU n 
3  963  MET n 
3  964  LEU n 
3  965  ASP n 
3  966  LYS n 
3  967  ASN n 
3  968  ASN n 
3  969  LEU n 
3  970  VAL n 
3  971  LYS n 
3  972  TYR n 
3  973  ASP n 
3  974  LYS n 
3  975  LYS n 
3  976  THR n 
3  977  GLY n 
3  978  ASN n 
3  979  PHE n 
3  980  GLN n 
3  981  VAL n 
3  982  THR n 
3  983  GLU n 
3  984  LEU n 
3  985  GLY n 
3  986  ARG n 
3  987  ILE n 
3  988  ALA n 
3  989  SER n 
3  990  HIS n 
3  991  TYR n 
3  992  TYR n 
3  993  ILE n 
3  994  THR n 
3  995  ASN n 
3  996  ASP n 
3  997  THR n 
3  998  VAL n 
3  999  GLN n 
3  1000 THR n 
3  1001 TYR n 
3  1002 ASN n 
3  1003 GLN n 
3  1004 LEU n 
3  1005 LEU n 
3  1006 LYS n 
3  1007 PRO n 
3  1008 THR n 
3  1009 LEU n 
3  1010 SER n 
3  1011 GLU n 
3  1012 ILE n 
3  1013 GLU n 
3  1014 LEU n 
3  1015 PHE n 
3  1016 ARG n 
3  1017 VAL n 
3  1018 PHE n 
3  1019 SER n 
3  1020 LEU n 
3  1021 SER n 
3  1022 SER n 
3  1023 GLU n 
3  1024 PHE n 
3  1025 LYS n 
3  1026 ASN n 
3  1027 ILE n 
3  1028 THR n 
3  1029 VAL n 
3  1030 ARG n 
3  1031 GLU n 
3  1032 GLU n 
3  1033 GLU n 
3  1034 LYS n 
3  1035 LEU n 
3  1036 GLU n 
3  1037 LEU n 
3  1038 GLN n 
3  1039 LYS n 
3  1040 LEU n 
3  1041 LEU n 
3  1042 GLU n 
3  1043 ARG n 
3  1044 VAL n 
3  1045 PRO n 
3  1046 ILE n 
3  1047 PRO n 
3  1048 VAL n 
3  1049 LYS n 
3  1050 GLU n 
3  1051 SER n 
3  1052 ILE n 
3  1053 GLU n 
3  1054 GLU n 
3  1055 PRO n 
3  1056 SER n 
3  1057 ALA n 
3  1058 LYS n 
3  1059 ILE n 
3  1060 ASN n 
3  1061 VAL n 
3  1062 LEU n 
3  1063 LEU n 
3  1064 GLN n 
3  1065 ALA n 
3  1066 PHE n 
3  1067 ILE n 
3  1068 SER n 
3  1069 GLN n 
3  1070 LEU n 
3  1071 LYS n 
3  1072 LEU n 
3  1073 GLU n 
3  1074 GLY n 
3  1075 PHE n 
3  1076 ALA n 
3  1077 LEU n 
3  1078 MET n 
3  1079 ALA n 
3  1080 ASP n 
3  1081 MET n 
3  1082 VAL n 
3  1083 TYR n 
3  1084 VAL n 
3  1085 THR n 
3  1086 GLN n 
3  1087 SER n 
3  1088 ALA n 
3  1089 GLY n 
3  1090 ARG n 
3  1091 LEU n 
3  1092 MET n 
3  1093 ARG n 
3  1094 ALA n 
3  1095 ILE n 
3  1096 PHE n 
3  1097 GLU n 
3  1098 ILE n 
3  1099 VAL n 
3  1100 LEU n 
3  1101 ASN n 
3  1102 ARG n 
3  1103 GLY n 
3  1104 TRP n 
3  1105 ALA n 
3  1106 GLN n 
3  1107 LEU n 
3  1108 THR n 
3  1109 ASP n 
3  1110 LYS n 
3  1111 THR n 
3  1112 LEU n 
3  1113 ASN n 
3  1114 LEU n 
3  1115 CYS n 
3  1116 LYS n 
3  1117 MET n 
3  1118 ILE n 
3  1119 ASP n 
3  1120 LYS n 
3  1121 ARG n 
3  1122 MET n 
3  1123 TRP n 
3  1124 GLN n 
3  1125 SER n 
3  1126 MET n 
3  1127 CYS n 
3  1128 PRO n 
3  1129 LEU n 
3  1130 ARG n 
3  1131 GLN n 
3  1132 PHE n 
3  1133 ARG n 
3  1134 LYS n 
3  1135 LEU n 
3  1136 PRO n 
3  1137 GLU n 
3  1138 GLU n 
3  1139 VAL n 
3  1140 VAL n 
3  1141 LYS n 
3  1142 LYS n 
3  1143 ILE n 
3  1144 GLU n 
3  1145 LYS n 
3  1146 LYS n 
3  1147 ASN n 
3  1148 PHE n 
3  1149 PRO n 
3  1150 PHE n 
3  1151 GLU n 
3  1152 ARG n 
3  1153 LEU n 
3  1154 TYR n 
3  1155 ASP n 
3  1156 LEU n 
3  1157 ASN n 
3  1158 HIS n 
3  1159 ASN n 
3  1160 GLU n 
3  1161 ILE n 
3  1162 GLY n 
3  1163 GLU n 
3  1164 LEU n 
3  1165 ILE n 
3  1166 ARG n 
3  1167 MET n 
3  1168 PRO n 
3  1169 LYS n 
3  1170 MET n 
3  1171 GLY n 
3  1172 LYS n 
3  1173 THR n 
3  1174 ILE n 
3  1175 HIS n 
3  1176 LYS n 
3  1177 TYR n 
3  1178 VAL n 
3  1179 HIS n 
3  1180 LEU n 
3  1181 PHE n 
3  1182 PRO n 
3  1183 LYS n 
3  1184 LEU n 
3  1185 GLU n 
3  1186 LEU n 
3  1187 SER n 
3  1188 VAL n 
3  1189 HIS n 
3  1190 LEU n 
3  1191 GLN n 
3  1192 PRO n 
3  1193 ILE n 
3  1194 THR n 
3  1195 ARG n 
3  1196 SER n 
3  1197 THR n 
3  1198 LEU n 
3  1199 LYS n 
3  1200 VAL n 
3  1201 GLU n 
3  1202 LEU n 
3  1203 THR n 
3  1204 ILE n 
3  1205 THR n 
3  1206 PRO n 
3  1207 ASP n 
3  1208 PHE n 
3  1209 GLN n 
3  1210 TRP n 
3  1211 ASP n 
3  1212 GLU n 
3  1213 LYS n 
3  1214 VAL n 
3  1215 HIS n 
3  1216 GLY n 
3  1217 SER n 
3  1218 SER n 
3  1219 GLU n 
3  1220 ALA n 
3  1221 PHE n 
3  1222 TRP n 
3  1223 ILE n 
3  1224 LEU n 
3  1225 VAL n 
3  1226 GLU n 
3  1227 ASP n 
3  1228 VAL n 
3  1229 ASP n 
3  1230 SER n 
3  1231 GLU n 
3  1232 VAL n 
3  1233 ILE n 
3  1234 LEU n 
3  1235 HIS n 
3  1236 HIS n 
3  1237 GLU n 
3  1238 TYR n 
3  1239 PHE n 
3  1240 LEU n 
3  1241 LEU n 
3  1242 LYS n 
3  1243 ALA n 
3  1244 LYS n 
3  1245 TYR n 
3  1246 ALA n 
3  1247 GLN n 
3  1248 ASP n 
3  1249 GLU n 
3  1250 HIS n 
3  1251 LEU n 
3  1252 ILE n 
3  1253 THR n 
3  1254 PHE n 
3  1255 PHE n 
3  1256 VAL n 
3  1257 PRO n 
3  1258 VAL n 
3  1259 PHE n 
3  1260 GLU n 
3  1261 PRO n 
3  1262 LEU n 
3  1263 PRO n 
3  1264 PRO n 
3  1265 GLN n 
3  1266 TYR n 
3  1267 PHE n 
3  1268 ILE n 
3  1269 ARG n 
3  1270 VAL n 
3  1271 VAL n 
3  1272 SER n 
3  1273 ASP n 
3  1274 ARG n 
3  1275 TRP n 
3  1276 LEU n 
3  1277 SER n 
3  1278 CYS n 
3  1279 GLU n 
3  1280 THR n 
3  1281 GLN n 
3  1282 LEU n 
3  1283 PRO n 
3  1284 VAL n 
3  1285 SER n 
3  1286 PHE n 
3  1287 ARG n 
3  1288 HIS n 
3  1289 LEU n 
3  1290 ILE n 
3  1291 LEU n 
3  1292 PRO n 
3  1293 GLU n 
3  1294 LYS n 
3  1295 TYR n 
3  1296 PRO n 
3  1297 PRO n 
3  1298 PRO n 
3  1299 THR n 
3  1300 GLU n 
3  1301 LEU n 
3  1302 LEU n 
3  1303 ASP n 
3  1304 LEU n 
3  1305 GLN n 
3  1306 PRO n 
3  1307 LEU n 
3  1308 PRO n 
3  1309 VAL n 
3  1310 SER n 
3  1311 ALA n 
3  1312 LEU n 
3  1313 ARG n 
3  1314 ASN n 
3  1315 SER n 
3  1316 ALA n 
3  1317 PHE n 
3  1318 GLU n 
3  1319 SER n 
3  1320 LEU n 
3  1321 TYR n 
3  1322 GLN n 
3  1323 ASP n 
3  1324 LYS n 
3  1325 PHE n 
3  1326 PRO n 
3  1327 PHE n 
3  1328 PHE n 
3  1329 ASN n 
3  1330 PRO n 
3  1331 ILE n 
3  1332 GLN n 
3  1333 THR n 
3  1334 GLN n 
3  1335 VAL n 
3  1336 PHE n 
3  1337 ASN n 
3  1338 THR n 
3  1339 VAL n 
3  1340 TYR n 
3  1341 ASN n 
3  1342 SER n 
3  1343 ASP n 
3  1344 ASP n 
3  1345 ASN n 
3  1346 VAL n 
3  1347 PHE n 
3  1348 VAL n 
3  1349 GLY n 
3  1350 ALA n 
3  1351 PRO n 
3  1352 THR n 
3  1353 GLY n 
3  1354 SER n 
3  1355 GLY n 
3  1356 LYS n 
3  1357 THR n 
3  1358 ILE n 
3  1359 CYS n 
3  1360 ALA n 
3  1361 GLU n 
3  1362 PHE n 
3  1363 ALA n 
3  1364 ILE n 
3  1365 LEU n 
3  1366 ARG n 
3  1367 MET n 
3  1368 LEU n 
3  1369 LEU n 
3  1370 GLN n 
3  1371 SER n 
3  1372 SER n 
3  1373 GLU n 
3  1374 GLY n 
3  1375 ARG n 
3  1376 CYS n 
3  1377 VAL n 
3  1378 TYR n 
3  1379 ILE n 
3  1380 THR n 
3  1381 PRO n 
3  1382 MET n 
3  1383 GLU n 
3  1384 ALA n 
3  1385 LEU n 
3  1386 ALA n 
3  1387 GLU n 
3  1388 GLN n 
3  1389 VAL n 
3  1390 TYR n 
3  1391 MET n 
3  1392 ASP n 
3  1393 TRP n 
3  1394 TYR n 
3  1395 GLU n 
3  1396 LYS n 
3  1397 PHE n 
3  1398 GLN n 
3  1399 ASP n 
3  1400 ARG n 
3  1401 LEU n 
3  1402 ASN n 
3  1403 LYS n 
3  1404 LYS n 
3  1405 VAL n 
3  1406 VAL n 
3  1407 LEU n 
3  1408 LEU n 
3  1409 THR n 
3  1410 GLY n 
3  1411 GLU n 
3  1412 THR n 
3  1413 SER n 
3  1414 THR n 
3  1415 ASP n 
3  1416 LEU n 
3  1417 LYS n 
3  1418 LEU n 
3  1419 LEU n 
3  1420 GLY n 
3  1421 LYS n 
3  1422 GLY n 
3  1423 ASN n 
3  1424 ILE n 
3  1425 ILE n 
3  1426 ILE n 
3  1427 SER n 
3  1428 THR n 
3  1429 PRO n 
3  1430 GLU n 
3  1431 LYS n 
3  1432 TRP n 
3  1433 ASP n 
3  1434 ILE n 
3  1435 LEU n 
3  1436 SER n 
3  1437 ARG n 
3  1438 ARG n 
3  1439 TRP n 
3  1440 LYS n 
3  1441 GLN n 
3  1442 ARG n 
3  1443 LYS n 
3  1444 ASN n 
3  1445 VAL n 
3  1446 GLN n 
3  1447 ASN n 
3  1448 ILE n 
3  1449 ASN n 
3  1450 LEU n 
3  1451 PHE n 
3  1452 VAL n 
3  1453 VAL n 
3  1454 ASP n 
3  1455 GLU n 
3  1456 VAL n 
3  1457 HIS n 
3  1458 LEU n 
3  1459 ILE n 
3  1460 GLY n 
3  1461 GLY n 
3  1462 GLU n 
3  1463 ASN n 
3  1464 GLY n 
3  1465 PRO n 
3  1466 VAL n 
3  1467 LEU n 
3  1468 GLU n 
3  1469 VAL n 
3  1470 ILE n 
3  1471 CYS n 
3  1472 SER n 
3  1473 ARG n 
3  1474 MET n 
3  1475 ARG n 
3  1476 TYR n 
3  1477 ILE n 
3  1478 SER n 
3  1479 SER n 
3  1480 GLN n 
3  1481 ILE n 
3  1482 GLU n 
3  1483 ARG n 
3  1484 PRO n 
3  1485 ILE n 
3  1486 ARG n 
3  1487 ILE n 
3  1488 VAL n 
3  1489 ALA n 
3  1490 LEU n 
3  1491 SER n 
3  1492 SER n 
3  1493 SER n 
3  1494 LEU n 
3  1495 SER n 
3  1496 ASN n 
3  1497 ALA n 
3  1498 LYS n 
3  1499 ASP n 
3  1500 VAL n 
3  1501 ALA n 
3  1502 HIS n 
3  1503 TRP n 
3  1504 LEU n 
3  1505 GLY n 
3  1506 CYS n 
3  1507 SER n 
3  1508 ALA n 
3  1509 THR n 
3  1510 SER n 
3  1511 THR n 
3  1512 PHE n 
3  1513 ASN n 
3  1514 PHE n 
3  1515 HIS n 
3  1516 PRO n 
3  1517 ASN n 
3  1518 VAL n 
3  1519 ARG n 
3  1520 PRO n 
3  1521 VAL n 
3  1522 PRO n 
3  1523 LEU n 
3  1524 GLU n 
3  1525 LEU n 
3  1526 HIS n 
3  1527 ILE n 
3  1528 GLN n 
3  1529 GLY n 
3  1530 PHE n 
3  1531 ASN n 
3  1532 ILE n 
3  1533 SER n 
3  1534 HIS n 
3  1535 THR n 
3  1536 GLN n 
3  1537 THR n 
3  1538 ARG n 
3  1539 LEU n 
3  1540 LEU n 
3  1541 SER n 
3  1542 MET n 
3  1543 ALA n 
3  1544 LYS n 
3  1545 PRO n 
3  1546 VAL n 
3  1547 TYR n 
3  1548 HIS n 
3  1549 ALA n 
3  1550 ILE n 
3  1551 THR n 
3  1552 LYS n 
3  1553 HIS n 
3  1554 SER n 
3  1555 PRO n 
3  1556 LYS n 
3  1557 LYS n 
3  1558 PRO n 
3  1559 VAL n 
3  1560 ILE n 
3  1561 VAL n 
3  1562 PHE n 
3  1563 VAL n 
3  1564 PRO n 
3  1565 SER n 
3  1566 ARG n 
3  1567 LYS n 
3  1568 GLN n 
3  1569 THR n 
3  1570 ARG n 
3  1571 LEU n 
3  1572 THR n 
3  1573 ALA n 
3  1574 ILE n 
3  1575 ASP n 
3  1576 ILE n 
3  1577 LEU n 
3  1578 THR n 
3  1579 THR n 
3  1580 CYS n 
3  1581 ALA n 
3  1582 ALA n 
3  1583 ASP n 
3  1584 ILE n 
3  1585 GLN n 
3  1586 ARG n 
3  1587 GLN n 
3  1588 ARG n 
3  1589 PHE n 
3  1590 LEU n 
3  1591 HIS n 
3  1592 CYS n 
3  1593 THR n 
3  1594 GLU n 
3  1595 LYS n 
3  1596 ASP n 
3  1597 LEU n 
3  1598 ILE n 
3  1599 PRO n 
3  1600 TYR n 
3  1601 LEU n 
3  1602 GLU n 
3  1603 LYS n 
3  1604 LEU n 
3  1605 SER n 
3  1606 ASP n 
3  1607 SER n 
3  1608 THR n 
3  1609 LEU n 
3  1610 LYS n 
3  1611 GLU n 
3  1612 THR n 
3  1613 LEU n 
3  1614 LEU n 
3  1615 ASN n 
3  1616 GLY n 
3  1617 VAL n 
3  1618 GLY n 
3  1619 TYR n 
3  1620 LEU n 
3  1621 HIS n 
3  1622 GLU n 
3  1623 GLY n 
3  1624 LEU n 
3  1625 SER n 
3  1626 PRO n 
3  1627 MET n 
3  1628 GLU n 
3  1629 ARG n 
3  1630 ARG n 
3  1631 LEU n 
3  1632 VAL n 
3  1633 GLU n 
3  1634 GLN n 
3  1635 LEU n 
3  1636 PHE n 
3  1637 SER n 
3  1638 SER n 
3  1639 GLY n 
3  1640 ALA n 
3  1641 ILE n 
3  1642 GLN n 
3  1643 VAL n 
3  1644 VAL n 
3  1645 VAL n 
3  1646 ALA n 
3  1647 SER n 
3  1648 ARG n 
3  1649 SER n 
3  1650 LEU n 
3  1651 CYS n 
3  1652 TRP n 
3  1653 GLY n 
3  1654 MET n 
3  1655 ASN n 
3  1656 VAL n 
3  1657 ALA n 
3  1658 ALA n 
3  1659 HIS n 
3  1660 LEU n 
3  1661 VAL n 
3  1662 ILE n 
3  1663 ILE n 
3  1664 MET n 
3  1665 ASP n 
3  1666 THR n 
3  1667 GLN n 
3  1668 TYR n 
3  1669 TYR n 
3  1670 ASN n 
3  1671 GLY n 
3  1672 LYS n 
3  1673 ILE n 
3  1674 HIS n 
3  1675 ALA n 
3  1676 TYR n 
3  1677 VAL n 
3  1678 ASP n 
3  1679 TYR n 
3  1680 PRO n 
3  1681 ILE n 
3  1682 TYR n 
3  1683 ASP n 
3  1684 VAL n 
3  1685 LEU n 
3  1686 GLN n 
3  1687 MET n 
3  1688 VAL n 
3  1689 GLY n 
3  1690 HIS n 
3  1691 ALA n 
3  1692 ASN n 
3  1693 ARG n 
3  1694 PRO n 
3  1695 LEU n 
3  1696 GLN n 
3  1697 ASP n 
3  1698 ASP n 
3  1699 GLU n 
3  1700 GLY n 
3  1701 ARG n 
3  1702 CYS n 
3  1703 VAL n 
3  1704 ILE n 
3  1705 MET n 
3  1706 CYS n 
3  1707 GLN n 
3  1708 GLY n 
3  1709 SER n 
3  1710 LYS n 
3  1711 LYS n 
3  1712 ASP n 
3  1713 PHE n 
3  1714 PHE n 
3  1715 LYS n 
3  1716 LYS n 
3  1717 PHE n 
3  1718 LEU n 
3  1719 TYR n 
3  1720 GLU n 
3  1721 PRO n 
3  1722 LEU n 
3  1723 PRO n 
3  1724 VAL n 
3  1725 GLU n 
3  1726 SER n 
3  1727 HIS n 
3  1728 LEU n 
3  1729 ASP n 
3  1730 HIS n 
3  1731 CYS n 
3  1732 MET n 
3  1733 HIS n 
3  1734 ASP n 
3  1735 HIS n 
3  1736 PHE n 
3  1737 ASN n 
3  1738 ALA n 
3  1739 GLU n 
3  1740 ILE n 
3  1741 VAL n 
3  1742 THR n 
3  1743 LYS n 
3  1744 THR n 
3  1745 ILE n 
3  1746 GLU n 
3  1747 ASN n 
3  1748 LYS n 
3  1749 GLN n 
3  1750 ASP n 
3  1751 ALA n 
3  1752 VAL n 
3  1753 ASP n 
3  1754 TYR n 
3  1755 LEU n 
3  1756 THR n 
3  1757 TRP n 
3  1758 THR n 
3  1759 PHE n 
3  1760 LEU n 
3  1761 TYR n 
3  1762 ARG n 
3  1763 ARG n 
3  1764 MET n 
3  1765 THR n 
3  1766 GLN n 
3  1767 ASN n 
3  1768 PRO n 
3  1769 ASN n 
3  1770 TYR n 
3  1771 TYR n 
3  1772 ASN n 
3  1773 LEU n 
3  1774 GLN n 
3  1775 GLY n 
3  1776 ILE n 
3  1777 SER n 
3  1778 HIS n 
3  1779 ARG n 
3  1780 HIS n 
3  1781 LEU n 
3  1782 SER n 
3  1783 ASP n 
3  1784 HIS n 
3  1785 LEU n 
3  1786 SER n 
3  1787 GLU n 
3  1788 LEU n 
3  1789 VAL n 
3  1790 GLU n 
3  1791 GLN n 
3  1792 THR n 
3  1793 LEU n 
3  1794 SER n 
3  1795 ASP n 
3  1796 LEU n 
3  1797 GLU n 
3  1798 GLN n 
3  1799 SER n 
3  1800 LYS n 
3  1801 CYS n 
3  1802 ILE n 
3  1803 SER n 
3  1804 ILE n 
3  1805 GLU n 
3  1806 ASP n 
3  1807 GLU n 
3  1808 MET n 
3  1809 ASP n 
3  1810 VAL n 
3  1811 ALA n 
3  1812 PRO n 
3  1813 LEU n 
3  1814 ASN n 
3  1815 LEU n 
3  1816 GLY n 
3  1817 MET n 
3  1818 ILE n 
3  1819 ALA n 
3  1820 ALA n 
3  1821 TYR n 
3  1822 TYR n 
3  1823 TYR n 
3  1824 ILE n 
3  1825 ASN n 
3  1826 TYR n 
3  1827 THR n 
3  1828 THR n 
3  1829 ILE n 
3  1830 GLU n 
3  1831 LEU n 
3  1832 PHE n 
3  1833 SER n 
3  1834 MET n 
3  1835 SER n 
3  1836 LEU n 
3  1837 ASN n 
3  1838 ALA n 
3  1839 LYS n 
3  1840 THR n 
3  1841 LYS n 
3  1842 VAL n 
3  1843 ARG n 
3  1844 GLY n 
3  1845 LEU n 
3  1846 ILE n 
3  1847 GLU n 
3  1848 ILE n 
3  1849 ILE n 
3  1850 SER n 
3  1851 ASN n 
3  1852 ALA n 
3  1853 ALA n 
3  1854 GLU n 
3  1855 TYR n 
3  1856 GLU n 
3  1857 ASN n 
3  1858 ILE n 
3  1859 PRO n 
3  1860 ILE n 
3  1861 ARG n 
3  1862 HIS n 
3  1863 HIS n 
3  1864 GLU n 
3  1865 ASP n 
3  1866 ASN n 
3  1867 LEU n 
3  1868 LEU n 
3  1869 ARG n 
3  1870 GLN n 
3  1871 LEU n 
3  1872 ALA n 
3  1873 GLN n 
3  1874 LYS n 
3  1875 VAL n 
3  1876 PRO n 
3  1877 HIS n 
3  1878 LYS n 
3  1879 LEU n 
3  1880 ASN n 
3  1881 ASN n 
3  1882 PRO n 
3  1883 LYS n 
3  1884 PHE n 
3  1885 ASN n 
3  1886 ASP n 
3  1887 PRO n 
3  1888 HIS n 
3  1889 VAL n 
3  1890 LYS n 
3  1891 THR n 
3  1892 ASN n 
3  1893 LEU n 
3  1894 LEU n 
3  1895 LEU n 
3  1896 GLN n 
3  1897 ALA n 
3  1898 HIS n 
3  1899 LEU n 
3  1900 SER n 
3  1901 ARG n 
3  1902 MET n 
3  1903 GLN n 
3  1904 LEU n 
3  1905 SER n 
3  1906 ALA n 
3  1907 GLU n 
3  1908 LEU n 
3  1909 GLN n 
3  1910 SER n 
3  1911 ASP n 
3  1912 THR n 
3  1913 GLU n 
3  1914 GLU n 
3  1915 ILE n 
3  1916 LEU n 
3  1917 SER n 
3  1918 LYS n 
3  1919 ALA n 
3  1920 ILE n 
3  1921 ARG n 
3  1922 LEU n 
3  1923 ILE n 
3  1924 GLN n 
3  1925 ALA n 
3  1926 CYS n 
3  1927 VAL n 
3  1928 ASP n 
3  1929 VAL n 
3  1930 LEU n 
3  1931 SER n 
3  1932 SER n 
3  1933 ASN n 
3  1934 GLY n 
3  1935 TRP n 
3  1936 LEU n 
3  1937 SER n 
3  1938 PRO n 
3  1939 ALA n 
3  1940 LEU n 
3  1941 ALA n 
3  1942 ALA n 
3  1943 MET n 
3  1944 GLU n 
3  1945 LEU n 
3  1946 ALA n 
3  1947 GLN n 
3  1948 MET n 
3  1949 VAL n 
3  1950 THR n 
3  1951 GLN n 
3  1952 ALA n 
3  1953 MET n 
3  1954 TRP n 
3  1955 SER n 
3  1956 LYS n 
3  1957 ASP n 
3  1958 SER n 
3  1959 TYR n 
3  1960 LEU n 
3  1961 LYS n 
3  1962 GLN n 
3  1963 LEU n 
3  1964 PRO n 
3  1965 HIS n 
3  1966 PHE n 
3  1967 THR n 
3  1968 SER n 
3  1969 GLU n 
3  1970 HIS n 
3  1971 ILE n 
3  1972 LYS n 
3  1973 ARG n 
3  1974 CYS n 
3  1975 THR n 
3  1976 ASP n 
3  1977 LYS n 
3  1978 GLY n 
3  1979 VAL n 
3  1980 GLU n 
3  1981 SER n 
3  1982 VAL n 
3  1983 PHE n 
3  1984 ASP n 
3  1985 ILE n 
3  1986 MET n 
3  1987 GLU n 
3  1988 MET n 
3  1989 GLU n 
3  1990 ASP n 
3  1991 GLU n 
3  1992 GLU n 
3  1993 ARG n 
3  1994 ASN n 
3  1995 ALA n 
3  1996 LEU n 
3  1997 LEU n 
3  1998 GLN n 
3  1999 LEU n 
3  2000 THR n 
3  2001 ASP n 
3  2002 SER n 
3  2003 GLN n 
3  2004 ILE n 
3  2005 ALA n 
3  2006 ASP n 
3  2007 VAL n 
3  2008 ALA n 
3  2009 ARG n 
3  2010 PHE n 
3  2011 CYS n 
3  2012 ASN n 
3  2013 ARG n 
3  2014 TYR n 
3  2015 PRO n 
3  2016 ASN n 
3  2017 ILE n 
3  2018 GLU n 
3  2019 LEU n 
3  2020 SER n 
3  2021 TYR n 
3  2022 GLU n 
3  2023 VAL n 
3  2024 VAL n 
3  2025 ASP n 
3  2026 LYS n 
3  2027 ASP n 
3  2028 SER n 
3  2029 ILE n 
3  2030 ARG n 
3  2031 SER n 
3  2032 GLY n 
3  2033 GLY n 
3  2034 PRO n 
3  2035 VAL n 
3  2036 VAL n 
3  2037 VAL n 
3  2038 LEU n 
3  2039 VAL n 
3  2040 GLN n 
3  2041 LEU n 
3  2042 GLU n 
3  2043 ARG n 
3  2044 GLU n 
3  2045 GLU n 
3  2046 GLU n 
3  2047 VAL n 
3  2048 THR n 
3  2049 GLY n 
3  2050 PRO n 
3  2051 VAL n 
3  2052 ILE n 
3  2053 ALA n 
3  2054 PRO n 
3  2055 LEU n 
3  2056 PHE n 
3  2057 PRO n 
3  2058 GLN n 
3  2059 LYS n 
3  2060 ARG n 
3  2061 GLU n 
3  2062 GLU n 
3  2063 GLY n 
3  2064 TRP n 
3  2065 TRP n 
3  2066 VAL n 
3  2067 VAL n 
3  2068 ILE n 
3  2069 GLY n 
3  2070 ASP n 
3  2071 ALA n 
3  2072 LYS n 
3  2073 SER n 
3  2074 ASN n 
3  2075 SER n 
3  2076 LEU n 
3  2077 ILE n 
3  2078 SER n 
3  2079 ILE n 
3  2080 LYS n 
3  2081 ARG n 
3  2082 LEU n 
3  2083 THR n 
3  2084 LEU n 
3  2085 GLN n 
3  2086 GLN n 
3  2087 LYS n 
3  2088 ALA n 
3  2089 LYS n 
3  2090 VAL n 
3  2091 LYS n 
3  2092 LEU n 
3  2093 ASP n 
3  2094 PHE n 
3  2095 VAL n 
3  2096 ALA n 
3  2097 PRO n 
3  2098 ALA n 
3  2099 THR n 
3  2100 GLY n 
3  2101 ALA n 
3  2102 HIS n 
3  2103 ASN n 
3  2104 TYR n 
3  2105 THR n 
3  2106 LEU n 
3  2107 TYR n 
3  2108 PHE n 
3  2109 MET n 
3  2110 SER n 
3  2111 ASP n 
3  2112 ALA n 
3  2113 TYR n 
3  2114 MET n 
3  2115 GLY n 
3  2116 CYS n 
3  2117 ASP n 
3  2118 GLN n 
3  2119 GLU n 
3  2120 TYR n 
3  2121 LYS n 
3  2122 PHE n 
3  2123 SER n 
3  2124 VAL n 
3  2125 ASP n 
3  2126 VAL n 
3  2127 LYS n 
3  2128 GLU n 
3  2129 ALA n 
3  2130 GLU n 
3  2131 THR n 
3  2132 ASP n 
3  2133 SER n 
3  2134 ASP n 
3  2135 SER n 
3  2136 ASP n 
4  1    MET n 
4  2    SER n 
4  3    TYR n 
4  4    MET n 
4  5    LEU n 
4  6    PRO n 
4  7    HIS n 
4  8    LEU n 
4  9    HIS n 
4  10   ASN n 
4  11   GLY n 
4  12   TRP n 
4  13   GLN n 
4  14   VAL n 
4  15   ASP n 
4  16   GLN n 
4  17   ALA n 
4  18   ILE n 
4  19   LEU n 
4  20   SER n 
4  21   GLU n 
4  22   GLU n 
4  23   ASP n 
4  24   ARG n 
4  25   VAL n 
4  26   VAL n 
4  27   VAL n 
4  28   ILE n 
4  29   ARG n 
4  30   PHE n 
4  31   GLY n 
4  32   HIS n 
4  33   ASP n 
4  34   TRP n 
4  35   ASP n 
4  36   PRO n 
4  37   THR n 
4  38   CYS n 
4  39   MET n 
4  40   LYS n 
4  41   MET n 
4  42   ASP n 
4  43   GLU n 
4  44   VAL n 
4  45   LEU n 
4  46   TYR n 
4  47   SER n 
4  48   ILE n 
4  49   ALA n 
4  50   GLU n 
4  51   LYS n 
4  52   VAL n 
4  53   LYS n 
4  54   ASN n 
4  55   PHE n 
4  56   ALA n 
4  57   VAL n 
4  58   ILE n 
4  59   TYR n 
4  60   LEU n 
4  61   VAL n 
4  62   ASP n 
4  63   ILE n 
4  64   THR n 
4  65   GLU n 
4  66   VAL n 
4  67   PRO n 
4  68   ASP n 
4  69   PHE n 
4  70   ASN n 
4  71   LYS n 
4  72   MET n 
4  73   TYR n 
4  74   GLU n 
4  75   LEU n 
4  76   TYR n 
4  77   ASP n 
4  78   PRO n 
4  79   CYS n 
4  80   THR n 
4  81   VAL n 
4  82   MET n 
4  83   PHE n 
4  84   PHE n 
4  85   PHE n 
4  86   ARG n 
4  87   ASN n 
4  88   LYS n 
4  89   HIS n 
4  90   ILE n 
4  91   MET n 
4  92   ILE n 
4  93   ASP n 
4  94   LEU n 
4  95   GLY n 
4  96   THR n 
4  97   GLY n 
4  98   ASN n 
4  99   ASN n 
4  100  ASN n 
4  101  LYS n 
4  102  ILE n 
4  103  ASN n 
4  104  TRP n 
4  105  ALA n 
4  106  MET n 
4  107  GLU n 
4  108  ASP n 
4  109  LYS n 
4  110  GLN n 
4  111  GLU n 
4  112  MET n 
4  113  VAL n 
4  114  ASP n 
4  115  ILE n 
4  116  ILE n 
4  117  GLU n 
4  118  THR n 
4  119  VAL n 
4  120  TYR n 
4  121  ARG n 
4  122  GLY n 
4  123  ALA n 
4  124  ARG n 
4  125  LYS n 
4  126  GLY n 
4  127  ARG n 
4  128  GLY n 
4  129  LEU n 
4  130  VAL n 
4  131  VAL n 
4  132  SER n 
4  133  PRO n 
4  134  LYS n 
4  135  ASP n 
4  136  TYR n 
4  137  SER n 
4  138  THR n 
4  139  LYS n 
4  140  TYR n 
4  141  ARG n 
4  142  TYR n 
5  1    MET n 
5  2    ALA n 
5  3    GLY n 
5  4    VAL n 
5  5    PHE n 
5  6    PRO n 
5  7    TYR n 
5  8    ARG n 
5  9    GLY n 
5  10   PRO n 
5  11   GLY n 
5  12   ASN n 
5  13   PRO n 
5  14   VAL n 
5  15   PRO n 
5  16   GLY n 
5  17   PRO n 
5  18   LEU n 
5  19   ALA n 
5  20   PRO n 
5  21   LEU n 
5  22   PRO n 
5  23   ASP n 
5  24   TYR n 
5  25   MET n 
5  26   SER n 
5  27   GLU n 
5  28   GLU n 
5  29   LYS n 
5  30   LEU n 
5  31   GLN n 
5  32   GLU n 
5  33   LYS n 
5  34   ALA n 
5  35   ARG n 
5  36   LYS n 
5  37   TRP n 
5  38   GLN n 
5  39   GLN n 
5  40   LEU n 
5  41   GLN n 
5  42   ALA n 
5  43   LYS n 
5  44   ARG n 
5  45   TYR n 
5  46   ALA n 
5  47   GLU n 
5  48   LYS n 
5  49   ARG n 
5  50   LYS n 
5  51   PHE n 
5  52   GLY n 
5  53   PHE n 
5  54   VAL n 
5  55   ASP n 
5  56   ALA n 
5  57   GLN n 
5  58   LYS n 
5  59   GLU n 
5  60   ASP n 
5  61   MET n 
5  62   PRO n 
5  63   PRO n 
5  64   GLU n 
5  65   HIS n 
5  66   VAL n 
5  67   ARG n 
5  68   LYS n 
5  69   ILE n 
5  70   ILE n 
5  71   ARG n 
5  72   ASP n 
5  73   HIS n 
5  74   GLY n 
5  75   ASP n 
5  76   MET n 
5  77   THR n 
5  78   ASN n 
5  79   ARG n 
5  80   LYS n 
5  81   PHE n 
5  82   ARG n 
5  83   HIS n 
5  84   ASP n 
5  85   LYS n 
5  86   ARG n 
5  87   VAL n 
5  88   TYR n 
5  89   LEU n 
5  90   GLY n 
5  91   ALA n 
5  92   LEU n 
5  93   LYS n 
5  94   TYR n 
5  95   MET n 
5  96   PRO n 
5  97   HIS n 
5  98   ALA n 
5  99   VAL n 
5  100  LEU n 
5  101  LYS n 
5  102  LEU n 
5  103  LEU n 
5  104  GLU n 
5  105  ASN n 
5  106  MET n 
5  107  PRO n 
5  108  MET n 
5  109  PRO n 
5  110  TRP n 
5  111  GLU n 
5  112  GLN n 
5  113  ILE n 
5  114  ARG n 
5  115  ASP n 
5  116  VAL n 
5  117  PRO n 
5  118  VAL n 
5  119  LEU n 
5  120  TYR n 
5  121  HIS n 
5  122  ILE n 
5  123  THR n 
5  124  GLY n 
5  125  ALA n 
5  126  ILE n 
5  127  SER n 
5  128  PHE n 
5  129  VAL n 
5  130  ASN n 
5  131  GLU n 
5  132  ILE n 
5  133  PRO n 
5  134  TRP n 
5  135  VAL n 
5  136  ILE n 
5  137  GLU n 
5  138  PRO n 
5  139  VAL n 
5  140  TYR n 
5  141  ILE n 
5  142  SER n 
5  143  GLN n 
5  144  TRP n 
5  145  GLY n 
5  146  SER n 
5  147  MET n 
5  148  TRP n 
5  149  ILE n 
5  150  MET n 
5  151  MET n 
5  152  ARG n 
5  153  ARG n 
5  154  GLU n 
5  155  LYS n 
5  156  ARG n 
5  157  ASP n 
5  158  ARG n 
5  159  ARG n 
5  160  HIS n 
5  161  PHE n 
5  162  LYS n 
5  163  ARG n 
5  164  MET n 
5  165  ARG n 
5  166  PHE n 
5  167  PRO n 
5  168  PRO n 
5  169  PHE n 
5  170  ASP n 
5  171  ASP n 
5  172  GLU n 
5  173  GLU n 
5  174  PRO n 
5  175  PRO n 
5  176  LEU n 
5  177  ASP n 
5  178  TYR n 
5  179  ALA n 
5  180  ASP n 
5  181  ASN n 
5  182  ILE n 
5  183  LEU n 
5  184  ASP n 
5  185  VAL n 
5  186  GLU n 
5  187  PRO n 
5  188  LEU n 
5  189  GLU n 
5  190  ALA n 
5  191  ILE n 
5  192  GLN n 
5  193  LEU n 
5  194  GLU n 
5  195  LEU n 
5  196  ASP n 
5  197  PRO n 
5  198  GLU n 
5  199  GLU n 
5  200  ASP n 
5  201  ALA n 
5  202  PRO n 
5  203  VAL n 
5  204  LEU n 
5  205  ASP n 
5  206  TRP n 
5  207  PHE n 
5  208  TYR n 
5  209  ASP n 
5  210  HIS n 
5  211  GLN n 
5  212  PRO n 
5  213  LEU n 
5  214  ARG n 
5  215  ASP n 
5  216  SER n 
5  217  ARG n 
5  218  LYS n 
5  219  TYR n 
5  220  VAL n 
5  221  ASN n 
5  222  GLY n 
5  223  SER n 
5  224  THR n 
5  225  TYR n 
5  226  GLN n 
5  227  ARG n 
5  228  TRP n 
5  229  GLN n 
5  230  PHE n 
5  231  THR n 
5  232  LEU n 
5  233  PRO n 
5  234  MET n 
5  235  MET n 
5  236  SER n 
5  237  THR n 
5  238  LEU n 
5  239  TYR n 
5  240  ARG n 
5  241  LEU n 
5  242  ALA n 
5  243  ASN n 
5  244  GLN n 
5  245  LEU n 
5  246  LEU n 
5  247  THR n 
5  248  ASP n 
5  249  LEU n 
5  250  VAL n 
5  251  ASP n 
5  252  ASP n 
5  253  ASN n 
5  254  TYR n 
5  255  PHE n 
5  256  TYR n 
5  257  LEU n 
5  258  PHE n 
5  259  ASP n 
5  260  LEU n 
5  261  LYS n 
5  262  ALA n 
5  263  PHE n 
5  264  PHE n 
5  265  THR n 
5  266  SER n 
5  267  LYS n 
5  268  ALA n 
5  269  LEU n 
5  270  ASN n 
5  271  MET n 
5  272  ALA n 
5  273  ILE n 
5  274  PRO n 
5  275  GLY n 
5  276  GLY n 
5  277  PRO n 
5  278  LYS n 
5  279  PHE n 
5  280  GLU n 
5  281  PRO n 
5  282  LEU n 
5  283  VAL n 
5  284  ARG n 
5  285  ASP n 
5  286  ILE n 
5  287  ASN n 
5  288  LEU n 
5  289  GLN n 
5  290  ASP n 
5  291  GLU n 
5  292  ASP n 
5  293  TRP n 
5  294  ASN n 
5  295  GLU n 
5  296  PHE n 
5  297  ASN n 
5  298  ASP n 
5  299  ILE n 
5  300  ASN n 
5  301  LYS n 
5  302  ILE n 
5  303  ILE n 
5  304  ILE n 
5  305  ARG n 
5  306  GLN n 
5  307  PRO n 
5  308  ILE n 
5  309  ARG n 
5  310  THR n 
5  311  GLU n 
5  312  TYR n 
5  313  LYS n 
5  314  ILE n 
5  315  ALA n 
5  316  PHE n 
5  317  PRO n 
5  318  TYR n 
5  319  LEU n 
5  320  TYR n 
5  321  ASN n 
5  322  ASN n 
5  323  LEU n 
5  324  PRO n 
5  325  HIS n 
5  326  HIS n 
5  327  VAL n 
5  328  HIS n 
5  329  LEU n 
5  330  THR n 
5  331  TRP n 
5  332  TYR n 
5  333  HIS n 
5  334  THR n 
5  335  PRO n 
5  336  ASN n 
5  337  VAL n 
5  338  VAL n 
5  339  PHE n 
5  340  ILE n 
5  341  LYS n 
5  342  THR n 
5  343  GLU n 
5  344  ASP n 
5  345  PRO n 
5  346  ASP n 
5  347  LEU n 
5  348  PRO n 
5  349  ALA n 
5  350  PHE n 
5  351  TYR n 
5  352  PHE n 
5  353  ASP n 
5  354  PRO n 
5  355  LEU n 
5  356  ILE n 
5  357  ASN n 
5  358  PRO n 
5  359  ILE n 
5  360  SER n 
5  361  HIS n 
5  362  ARG n 
5  363  HIS n 
5  364  SER n 
5  365  VAL n 
5  366  LYS n 
5  367  SER n 
5  368  GLN n 
5  369  GLU n 
5  370  PRO n 
5  371  LEU n 
5  372  PRO n 
5  373  ASP n 
5  374  ASP n 
5  375  ASP n 
5  376  GLU n 
5  377  GLU n 
5  378  PHE n 
5  379  GLU n 
5  380  LEU n 
5  381  PRO n 
5  382  GLU n 
5  383  PHE n 
5  384  VAL n 
5  385  GLU n 
5  386  PRO n 
5  387  PHE n 
5  388  LEU n 
5  389  LYS n 
5  390  ASP n 
5  391  THR n 
5  392  PRO n 
5  393  LEU n 
5  394  TYR n 
5  395  THR n 
5  396  ASP n 
5  397  ASN n 
5  398  THR n 
5  399  ALA n 
5  400  ASN n 
5  401  GLY n 
5  402  ILE n 
5  403  ALA n 
5  404  LEU n 
5  405  LEU n 
5  406  TRP n 
5  407  ALA n 
5  408  PRO n 
5  409  ARG n 
5  410  PRO n 
5  411  PHE n 
5  412  ASN n 
5  413  LEU n 
5  414  ARG n 
5  415  SER n 
5  416  GLY n 
5  417  ARG n 
5  418  THR n 
5  419  ARG n 
5  420  ARG n 
5  421  ALA n 
5  422  LEU n 
5  423  ASP n 
5  424  ILE n 
5  425  PRO n 
5  426  LEU n 
5  427  VAL n 
5  428  LYS n 
5  429  ASN n 
5  430  TRP n 
5  431  TYR n 
5  432  ARG n 
5  433  GLU n 
5  434  HIS n 
5  435  CYS n 
5  436  PRO n 
5  437  ALA n 
5  438  GLY n 
5  439  GLN n 
5  440  PRO n 
5  441  VAL n 
5  442  LYS n 
5  443  VAL n 
5  444  ARG n 
5  445  VAL n 
5  446  SER n 
5  447  TYR n 
5  448  GLN n 
5  449  LYS n 
5  450  LEU n 
5  451  LEU n 
5  452  LYS n 
5  453  TYR n 
5  454  TYR n 
5  455  VAL n 
5  456  LEU n 
5  457  ASN n 
5  458  ALA n 
5  459  LEU n 
5  460  LYS n 
5  461  HIS n 
5  462  ARG n 
5  463  PRO n 
5  464  PRO n 
5  465  LYS n 
5  466  ALA n 
5  467  GLN n 
5  468  LYS n 
5  469  LYS n 
5  470  ARG n 
5  471  TYR n 
5  472  LEU n 
5  473  PHE n 
5  474  ARG n 
5  475  SER n 
5  476  PHE n 
5  477  LYS n 
5  478  ALA n 
5  479  THR n 
5  480  LYS n 
5  481  PHE n 
5  482  PHE n 
5  483  GLN n 
5  484  SER n 
5  485  THR n 
5  486  LYS n 
5  487  LEU n 
5  488  ASP n 
5  489  TRP n 
5  490  VAL n 
5  491  GLU n 
5  492  VAL n 
5  493  GLY n 
5  494  LEU n 
5  495  GLN n 
5  496  VAL n 
5  497  CYS n 
5  498  ARG n 
5  499  GLN n 
5  500  GLY n 
5  501  TYR n 
5  502  ASN n 
5  503  MET n 
5  504  LEU n 
5  505  ASN n 
5  506  LEU n 
5  507  LEU n 
5  508  ILE n 
5  509  HIS n 
5  510  ARG n 
5  511  LYS n 
5  512  ASN n 
5  513  LEU n 
5  514  ASN n 
5  515  TYR n 
5  516  LEU n 
5  517  HIS n 
5  518  LEU n 
5  519  ASP n 
5  520  TYR n 
5  521  ASN n 
5  522  PHE n 
5  523  ASN n 
5  524  LEU n 
5  525  LYS n 
5  526  PRO n 
5  527  VAL n 
5  528  LYS n 
5  529  THR n 
5  530  LEU n 
5  531  THR n 
5  532  THR n 
5  533  LYS n 
5  534  GLU n 
5  535  ARG n 
5  536  LYS n 
5  537  LYS n 
5  538  SER n 
5  539  ARG n 
5  540  PHE n 
5  541  GLY n 
5  542  ASN n 
5  543  ALA n 
5  544  PHE n 
5  545  HIS n 
5  546  LEU n 
5  547  CYS n 
5  548  ARG n 
5  549  GLU n 
5  550  VAL n 
5  551  LEU n 
5  552  ARG n 
5  553  LEU n 
5  554  THR n 
5  555  LYS n 
5  556  LEU n 
5  557  VAL n 
5  558  VAL n 
5  559  ASP n 
5  560  SER n 
5  561  HIS n 
5  562  VAL n 
5  563  GLN n 
5  564  TYR n 
5  565  ARG n 
5  566  LEU n 
5  567  GLY n 
5  568  ASN n 
5  569  VAL n 
5  570  ASP n 
5  571  ALA n 
5  572  PHE n 
5  573  GLN n 
5  574  LEU n 
5  575  ALA n 
5  576  ASP n 
5  577  GLY n 
5  578  LEU n 
5  579  GLN n 
5  580  TYR n 
5  581  ILE n 
5  582  PHE n 
5  583  ALA n 
5  584  HIS n 
5  585  VAL n 
5  586  GLY n 
5  587  GLN n 
5  588  LEU n 
5  589  THR n 
5  590  GLY n 
5  591  MET n 
5  592  TYR n 
5  593  ARG n 
5  594  TYR n 
5  595  LYS n 
5  596  TYR n 
5  597  LYS n 
5  598  LEU n 
5  599  MET n 
5  600  ARG n 
5  601  GLN n 
5  602  ILE n 
5  603  ARG n 
5  604  MET n 
5  605  CYS n 
5  606  LYS n 
5  607  ASP n 
5  608  LEU n 
5  609  LYS n 
5  610  HIS n 
5  611  LEU n 
5  612  ILE n 
5  613  TYR n 
5  614  TYR n 
5  615  ARG n 
5  616  PHE n 
5  617  ASN n 
5  618  THR n 
5  619  GLY n 
5  620  PRO n 
5  621  VAL n 
5  622  GLY n 
5  623  LYS n 
5  624  GLY n 
5  625  PRO n 
5  626  GLY n 
5  627  CYS n 
5  628  GLY n 
5  629  PHE n 
5  630  TRP n 
5  631  ALA n 
5  632  ALA n 
5  633  GLY n 
5  634  TRP n 
5  635  ARG n 
5  636  VAL n 
5  637  TRP n 
5  638  LEU n 
5  639  PHE n 
5  640  PHE n 
5  641  MET n 
5  642  ARG n 
5  643  GLY n 
5  644  ILE n 
5  645  THR n 
5  646  PRO n 
5  647  LEU n 
5  648  LEU n 
5  649  GLU n 
5  650  ARG n 
5  651  TRP n 
5  652  LEU n 
5  653  GLY n 
5  654  ASN n 
5  655  LEU n 
5  656  LEU n 
5  657  ALA n 
5  658  ARG n 
5  659  GLN n 
5  660  PHE n 
5  661  GLU n 
5  662  GLY n 
5  663  ARG n 
5  664  HIS n 
5  665  SER n 
5  666  LYS n 
5  667  GLY n 
5  668  VAL n 
5  669  ALA n 
5  670  LYS n 
5  671  THR n 
5  672  VAL n 
5  673  THR n 
5  674  LYS n 
5  675  GLN n 
5  676  ARG n 
5  677  VAL n 
5  678  GLU n 
5  679  SER n 
5  680  HIS n 
5  681  PHE n 
5  682  ASP n 
5  683  LEU n 
5  684  GLU n 
5  685  LEU n 
5  686  ARG n 
5  687  ALA n 
5  688  ALA n 
5  689  VAL n 
5  690  MET n 
5  691  HIS n 
5  692  ASP n 
5  693  ILE n 
5  694  LEU n 
5  695  ASP n 
5  696  MET n 
5  697  MET n 
5  698  PRO n 
5  699  GLU n 
5  700  GLY n 
5  701  ILE n 
5  702  LYS n 
5  703  GLN n 
5  704  ASN n 
5  705  LYS n 
5  706  ALA n 
5  707  ARG n 
5  708  THR n 
5  709  ILE n 
5  710  LEU n 
5  711  GLN n 
5  712  HIS n 
5  713  LEU n 
5  714  SER n 
5  715  GLU n 
5  716  ALA n 
5  717  TRP n 
5  718  ARG n 
5  719  CYS n 
5  720  TRP n 
5  721  LYS n 
5  722  ALA n 
5  723  ASN n 
5  724  ILE n 
5  725  PRO n 
5  726  TRP n 
5  727  LYS n 
5  728  VAL n 
5  729  PRO n 
5  730  GLY n 
5  731  LEU n 
5  732  PRO n 
5  733  THR n 
5  734  PRO n 
5  735  ILE n 
5  736  GLU n 
5  737  ASN n 
5  738  MET n 
5  739  ILE n 
5  740  LEU n 
5  741  ARG n 
5  742  TYR n 
5  743  VAL n 
5  744  LYS n 
5  745  ALA n 
5  746  LYS n 
5  747  ALA n 
5  748  ASP n 
5  749  TRP n 
5  750  TRP n 
5  751  THR n 
5  752  ASN n 
5  753  THR n 
5  754  ALA n 
5  755  HIS n 
5  756  TYR n 
5  757  ASN n 
5  758  ARG n 
5  759  GLU n 
5  760  ARG n 
5  761  ILE n 
5  762  ARG n 
5  763  ARG n 
5  764  GLY n 
5  765  ALA n 
5  766  THR n 
5  767  VAL n 
5  768  ASP n 
5  769  LYS n 
5  770  THR n 
5  771  VAL n 
5  772  CYS n 
5  773  LYS n 
5  774  LYS n 
5  775  ASN n 
5  776  LEU n 
5  777  GLY n 
5  778  ARG n 
5  779  LEU n 
5  780  THR n 
5  781  ARG n 
5  782  LEU n 
5  783  TYR n 
5  784  LEU n 
5  785  LYS n 
5  786  ALA n 
5  787  GLU n 
5  788  GLN n 
5  789  GLU n 
5  790  ARG n 
5  791  GLN n 
5  792  HIS n 
5  793  ASN n 
5  794  TYR n 
5  795  LEU n 
5  796  LYS n 
5  797  ASP n 
5  798  GLY n 
5  799  PRO n 
5  800  TYR n 
5  801  ILE n 
5  802  THR n 
5  803  ALA n 
5  804  GLU n 
5  805  GLU n 
5  806  ALA n 
5  807  VAL n 
5  808  ALA n 
5  809  VAL n 
5  810  TYR n 
5  811  THR n 
5  812  THR n 
5  813  THR n 
5  814  VAL n 
5  815  HIS n 
5  816  TRP n 
5  817  LEU n 
5  818  GLU n 
5  819  SER n 
5  820  ARG n 
5  821  ARG n 
5  822  PHE n 
5  823  SER n 
5  824  PRO n 
5  825  ILE n 
5  826  PRO n 
5  827  PHE n 
5  828  PRO n 
5  829  PRO n 
5  830  LEU n 
5  831  SER n 
5  832  TYR n 
5  833  LYS n 
5  834  HIS n 
5  835  ASP n 
5  836  THR n 
5  837  LYS n 
5  838  LEU n 
5  839  LEU n 
5  840  ILE n 
5  841  LEU n 
5  842  ALA n 
5  843  LEU n 
5  844  GLU n 
5  845  ARG n 
5  846  LEU n 
5  847  LYS n 
5  848  GLU n 
5  849  ALA n 
5  850  TYR n 
5  851  SER n 
5  852  VAL n 
5  853  LYS n 
5  854  SER n 
5  855  ARG n 
5  856  LEU n 
5  857  ASN n 
5  858  GLN n 
5  859  SER n 
5  860  GLN n 
5  861  ARG n 
5  862  GLU n 
5  863  GLU n 
5  864  LEU n 
5  865  GLY n 
5  866  LEU n 
5  867  ILE n 
5  868  GLU n 
5  869  GLN n 
5  870  ALA n 
5  871  TYR n 
5  872  ASP n 
5  873  ASN n 
5  874  PRO n 
5  875  HIS n 
5  876  GLU n 
5  877  ALA n 
5  878  LEU n 
5  879  SER n 
5  880  ARG n 
5  881  ILE n 
5  882  LYS n 
5  883  ARG n 
5  884  HIS n 
5  885  LEU n 
5  886  LEU n 
5  887  THR n 
5  888  GLN n 
5  889  ARG n 
5  890  ALA n 
5  891  PHE n 
5  892  LYS n 
5  893  GLU n 
5  894  VAL n 
5  895  GLY n 
5  896  ILE n 
5  897  GLU n 
5  898  PHE n 
5  899  MET n 
5  900  ASP n 
5  901  LEU n 
5  902  TYR n 
5  903  SER n 
5  904  HIS n 
5  905  LEU n 
5  906  VAL n 
5  907  PRO n 
5  908  VAL n 
5  909  TYR n 
5  910  ASP n 
5  911  VAL n 
5  912  GLU n 
5  913  PRO n 
5  914  LEU n 
5  915  GLU n 
5  916  LYS n 
5  917  ILE n 
5  918  THR n 
5  919  ASP n 
5  920  ALA n 
5  921  TYR n 
5  922  LEU n 
5  923  ASP n 
5  924  GLN n 
5  925  TYR n 
5  926  LEU n 
5  927  TRP n 
5  928  TYR n 
5  929  GLU n 
5  930  ALA n 
5  931  ASP n 
5  932  LYS n 
5  933  ARG n 
5  934  ARG n 
5  935  LEU n 
5  936  PHE n 
5  937  PRO n 
5  938  PRO n 
5  939  TRP n 
5  940  ILE n 
5  941  LYS n 
5  942  PRO n 
5  943  ALA n 
5  944  ASP n 
5  945  THR n 
5  946  GLU n 
5  947  PRO n 
5  948  PRO n 
5  949  PRO n 
5  950  LEU n 
5  951  LEU n 
5  952  VAL n 
5  953  TYR n 
5  954  LYS n 
5  955  TRP n 
5  956  CYS n 
5  957  GLN n 
5  958  GLY n 
5  959  ILE n 
5  960  ASN n 
5  961  ASN n 
5  962  LEU n 
5  963  GLN n 
5  964  ASP n 
5  965  VAL n 
5  966  TRP n 
5  967  GLU n 
5  968  THR n 
5  969  SER n 
5  970  GLU n 
5  971  GLY n 
5  972  GLU n 
5  973  CYS n 
5  974  ASN n 
5  975  VAL n 
5  976  MET n 
5  977  LEU n 
5  978  GLU n 
5  979  SER n 
5  980  ARG n 
5  981  PHE n 
5  982  GLU n 
5  983  LYS n 
5  984  MET n 
5  985  TYR n 
5  986  GLU n 
5  987  LYS n 
5  988  ILE n 
5  989  ASP n 
5  990  LEU n 
5  991  THR n 
5  992  LEU n 
5  993  LEU n 
5  994  ASN n 
5  995  ARG n 
5  996  LEU n 
5  997  LEU n 
5  998  ARG n 
5  999  LEU n 
5  1000 ILE n 
5  1001 VAL n 
5  1002 ASP n 
5  1003 HIS n 
5  1004 ASN n 
5  1005 ILE n 
5  1006 ALA n 
5  1007 ASP n 
5  1008 TYR n 
5  1009 MET n 
5  1010 THR n 
5  1011 ALA n 
5  1012 LYS n 
5  1013 ASN n 
5  1014 ASN n 
5  1015 VAL n 
5  1016 VAL n 
5  1017 ILE n 
5  1018 ASN n 
5  1019 TYR n 
5  1020 LYS n 
5  1021 ASP n 
5  1022 MET n 
5  1023 ASN n 
5  1024 HIS n 
5  1025 THR n 
5  1026 ASN n 
5  1027 SER n 
5  1028 TYR n 
5  1029 GLY n 
5  1030 ILE n 
5  1031 ILE n 
5  1032 ARG n 
5  1033 GLY n 
5  1034 LEU n 
5  1035 GLN n 
5  1036 PHE n 
5  1037 ALA n 
5  1038 SER n 
5  1039 PHE n 
5  1040 ILE n 
5  1041 VAL n 
5  1042 GLN n 
5  1043 TYR n 
5  1044 TYR n 
5  1045 GLY n 
5  1046 LEU n 
5  1047 VAL n 
5  1048 MET n 
5  1049 ASP n 
5  1050 LEU n 
5  1051 LEU n 
5  1052 VAL n 
5  1053 LEU n 
5  1054 GLY n 
5  1055 LEU n 
5  1056 HIS n 
5  1057 ARG n 
5  1058 ALA n 
5  1059 SER n 
5  1060 GLU n 
5  1061 MET n 
5  1062 ALA n 
5  1063 GLY n 
5  1064 PRO n 
5  1065 PRO n 
5  1066 GLN n 
5  1067 MET n 
5  1068 PRO n 
5  1069 ASN n 
5  1070 ASP n 
5  1071 PHE n 
5  1072 LEU n 
5  1073 SER n 
5  1074 PHE n 
5  1075 GLN n 
5  1076 ASP n 
5  1077 ILE n 
5  1078 ALA n 
5  1079 THR n 
5  1080 GLU n 
5  1081 ALA n 
5  1082 ALA n 
5  1083 HIS n 
5  1084 PRO n 
5  1085 ILE n 
5  1086 ARG n 
5  1087 LEU n 
5  1088 PHE n 
5  1089 CYS n 
5  1090 ARG n 
5  1091 TYR n 
5  1092 ILE n 
5  1093 ASP n 
5  1094 ARG n 
5  1095 ILE n 
5  1096 HIS n 
5  1097 ILE n 
5  1098 PHE n 
5  1099 PHE n 
5  1100 ARG n 
5  1101 PHE n 
5  1102 THR n 
5  1103 ALA n 
5  1104 ASP n 
5  1105 GLU n 
5  1106 ALA n 
5  1107 ARG n 
5  1108 ASP n 
5  1109 LEU n 
5  1110 ILE n 
5  1111 GLN n 
5  1112 ARG n 
5  1113 TYR n 
5  1114 LEU n 
5  1115 THR n 
5  1116 GLU n 
5  1117 HIS n 
5  1118 PRO n 
5  1119 ASP n 
5  1120 PRO n 
5  1121 ASN n 
5  1122 ASN n 
5  1123 GLU n 
5  1124 ASN n 
5  1125 ILE n 
5  1126 VAL n 
5  1127 GLY n 
5  1128 TYR n 
5  1129 ASN n 
5  1130 ASN n 
5  1131 LYS n 
5  1132 LYS n 
5  1133 CYS n 
5  1134 TRP n 
5  1135 PRO n 
5  1136 ARG n 
5  1137 ASP n 
5  1138 ALA n 
5  1139 ARG n 
5  1140 MET n 
5  1141 ARG n 
5  1142 LEU n 
5  1143 MET n 
5  1144 LYS n 
5  1145 HIS n 
5  1146 ASP n 
5  1147 VAL n 
5  1148 ASN n 
5  1149 LEU n 
5  1150 GLY n 
5  1151 ARG n 
5  1152 ALA n 
5  1153 VAL n 
5  1154 PHE n 
5  1155 TRP n 
5  1156 ASP n 
5  1157 ILE n 
5  1158 LYS n 
5  1159 ASN n 
5  1160 ARG n 
5  1161 LEU n 
5  1162 PRO n 
5  1163 ARG n 
5  1164 SER n 
5  1165 VAL n 
5  1166 THR n 
5  1167 THR n 
5  1168 VAL n 
5  1169 GLN n 
5  1170 TRP n 
5  1171 GLU n 
5  1172 ASN n 
5  1173 SER n 
5  1174 PHE n 
5  1175 VAL n 
5  1176 SER n 
5  1177 VAL n 
5  1178 TYR n 
5  1179 SER n 
5  1180 LYS n 
5  1181 ASP n 
5  1182 ASN n 
5  1183 PRO n 
5  1184 ASN n 
5  1185 LEU n 
5  1186 LEU n 
5  1187 PHE n 
5  1188 ASN n 
5  1189 MET n 
5  1190 CYS n 
5  1191 GLY n 
5  1192 PHE n 
5  1193 GLU n 
5  1194 CYS n 
5  1195 ARG n 
5  1196 ILE n 
5  1197 LEU n 
5  1198 PRO n 
5  1199 LYS n 
5  1200 CYS n 
5  1201 ARG n 
5  1202 THR n 
5  1203 SER n 
5  1204 TYR n 
5  1205 GLU n 
5  1206 GLU n 
5  1207 PHE n 
5  1208 THR n 
5  1209 HIS n 
5  1210 LYS n 
5  1211 ASP n 
5  1212 GLY n 
5  1213 VAL n 
5  1214 TRP n 
5  1215 ASN n 
5  1216 LEU n 
5  1217 GLN n 
5  1218 ASN n 
5  1219 GLU n 
5  1220 VAL n 
5  1221 THR n 
5  1222 LYS n 
5  1223 GLU n 
5  1224 ARG n 
5  1225 THR n 
5  1226 ALA n 
5  1227 GLN n 
5  1228 CYS n 
5  1229 PHE n 
5  1230 LEU n 
5  1231 ARG n 
5  1232 VAL n 
5  1233 ASP n 
5  1234 ASP n 
5  1235 GLU n 
5  1236 SER n 
5  1237 MET n 
5  1238 GLN n 
5  1239 ARG n 
5  1240 PHE n 
5  1241 HIS n 
5  1242 ASN n 
5  1243 ARG n 
5  1244 VAL n 
5  1245 ARG n 
5  1246 GLN n 
5  1247 ILE n 
5  1248 LEU n 
5  1249 MET n 
5  1250 ALA n 
5  1251 SER n 
5  1252 GLY n 
5  1253 SER n 
5  1254 THR n 
5  1255 THR n 
5  1256 PHE n 
5  1257 THR n 
5  1258 LYS n 
5  1259 ILE n 
5  1260 VAL n 
5  1261 ASN n 
5  1262 LYS n 
5  1263 TRP n 
5  1264 ASN n 
5  1265 THR n 
5  1266 ALA n 
5  1267 LEU n 
5  1268 ILE n 
5  1269 GLY n 
5  1270 LEU n 
5  1271 MET n 
5  1272 THR n 
5  1273 TYR n 
5  1274 PHE n 
5  1275 ARG n 
5  1276 GLU n 
5  1277 ALA n 
5  1278 VAL n 
5  1279 VAL n 
5  1280 ASN n 
5  1281 THR n 
5  1282 GLN n 
5  1283 GLU n 
5  1284 LEU n 
5  1285 LEU n 
5  1286 ASP n 
5  1287 LEU n 
5  1288 LEU n 
5  1289 VAL n 
5  1290 LYS n 
5  1291 CYS n 
5  1292 GLU n 
5  1293 ASN n 
5  1294 LYS n 
5  1295 ILE n 
5  1296 GLN n 
5  1297 THR n 
5  1298 ARG n 
5  1299 ILE n 
5  1300 LYS n 
5  1301 ILE n 
5  1302 GLY n 
5  1303 LEU n 
5  1304 ASN n 
5  1305 SER n 
5  1306 LYS n 
5  1307 MET n 
5  1308 PRO n 
5  1309 SER n 
5  1310 ARG n 
5  1311 PHE n 
5  1312 PRO n 
5  1313 PRO n 
5  1314 VAL n 
5  1315 VAL n 
5  1316 PHE n 
5  1317 TYR n 
5  1318 THR n 
5  1319 PRO n 
5  1320 LYS n 
5  1321 GLU n 
5  1322 LEU n 
5  1323 GLY n 
5  1324 GLY n 
5  1325 LEU n 
5  1326 GLY n 
5  1327 MET n 
5  1328 LEU n 
5  1329 SER n 
5  1330 MET n 
5  1331 GLY n 
5  1332 HIS n 
5  1333 VAL n 
5  1334 LEU n 
5  1335 ILE n 
5  1336 PRO n 
5  1337 GLN n 
5  1338 SER n 
5  1339 ASP n 
5  1340 LEU n 
5  1341 ARG n 
5  1342 TRP n 
5  1343 SER n 
5  1344 LYS n 
5  1345 GLN n 
5  1346 THR n 
5  1347 ASP n 
5  1348 VAL n 
5  1349 GLY n 
5  1350 ILE n 
5  1351 THR n 
5  1352 HIS n 
5  1353 PHE n 
5  1354 ARG n 
5  1355 SER n 
5  1356 GLY n 
5  1357 MET n 
5  1358 SER n 
5  1359 HIS n 
5  1360 GLU n 
5  1361 GLU n 
5  1362 ASP n 
5  1363 GLN n 
5  1364 LEU n 
5  1365 ILE n 
5  1366 PRO n 
5  1367 ASN n 
5  1368 LEU n 
5  1369 TYR n 
5  1370 ARG n 
5  1371 TYR n 
5  1372 ILE n 
5  1373 GLN n 
5  1374 PRO n 
5  1375 TRP n 
5  1376 GLU n 
5  1377 SER n 
5  1378 GLU n 
5  1379 PHE n 
5  1380 ILE n 
5  1381 ASP n 
5  1382 SER n 
5  1383 GLN n 
5  1384 ARG n 
5  1385 VAL n 
5  1386 TRP n 
5  1387 ALA n 
5  1388 GLU n 
5  1389 TYR n 
5  1390 ALA n 
5  1391 LEU n 
5  1392 LYS n 
5  1393 ARG n 
5  1394 GLN n 
5  1395 GLU n 
5  1396 ALA n 
5  1397 ILE n 
5  1398 ALA n 
5  1399 GLN n 
5  1400 ASN n 
5  1401 ARG n 
5  1402 ARG n 
5  1403 LEU n 
5  1404 THR n 
5  1405 LEU n 
5  1406 GLU n 
5  1407 ASP n 
5  1408 LEU n 
5  1409 GLU n 
5  1410 ASP n 
5  1411 SER n 
5  1412 TRP n 
5  1413 ASP n 
5  1414 ARG n 
5  1415 GLY n 
5  1416 ILE n 
5  1417 PRO n 
5  1418 ARG n 
5  1419 ILE n 
5  1420 ASN n 
5  1421 THR n 
5  1422 LEU n 
5  1423 PHE n 
5  1424 GLN n 
5  1425 LYS n 
5  1426 ASP n 
5  1427 ARG n 
5  1428 HIS n 
5  1429 THR n 
5  1430 LEU n 
5  1431 ALA n 
5  1432 TYR n 
5  1433 ASP n 
5  1434 LYS n 
5  1435 GLY n 
5  1436 TRP n 
5  1437 ARG n 
5  1438 VAL n 
5  1439 ARG n 
5  1440 THR n 
5  1441 ASP n 
5  1442 PHE n 
5  1443 LYS n 
5  1444 GLN n 
5  1445 TYR n 
5  1446 GLN n 
5  1447 VAL n 
5  1448 LEU n 
5  1449 LYS n 
5  1450 GLN n 
5  1451 ASN n 
5  1452 PRO n 
5  1453 PHE n 
5  1454 TRP n 
5  1455 TRP n 
5  1456 THR n 
5  1457 HIS n 
5  1458 GLN n 
5  1459 ARG n 
5  1460 HIS n 
5  1461 ASP n 
5  1462 GLY n 
5  1463 LYS n 
5  1464 LEU n 
5  1465 TRP n 
5  1466 ASN n 
5  1467 LEU n 
5  1468 ASN n 
5  1469 ASN n 
5  1470 TYR n 
5  1471 ARG n 
5  1472 THR n 
5  1473 ASP n 
5  1474 MET n 
5  1475 ILE n 
5  1476 GLN n 
5  1477 ALA n 
5  1478 LEU n 
5  1479 GLY n 
5  1480 GLY n 
5  1481 VAL n 
5  1482 GLU n 
5  1483 GLY n 
5  1484 ILE n 
5  1485 LEU n 
5  1486 GLU n 
5  1487 HIS n 
5  1488 THR n 
5  1489 LEU n 
5  1490 PHE n 
5  1491 LYS n 
5  1492 GLY n 
5  1493 THR n 
5  1494 TYR n 
5  1495 PHE n 
5  1496 PRO n 
5  1497 THR n 
5  1498 TRP n 
5  1499 GLU n 
5  1500 GLY n 
5  1501 LEU n 
5  1502 PHE n 
5  1503 TRP n 
5  1504 GLU n 
5  1505 LYS n 
5  1506 ALA n 
5  1507 SER n 
5  1508 GLY n 
5  1509 PHE n 
5  1510 GLU n 
5  1511 GLU n 
5  1512 SER n 
5  1513 MET n 
5  1514 LYS n 
5  1515 TRP n 
5  1516 LYS n 
5  1517 LYS n 
5  1518 LEU n 
5  1519 THR n 
5  1520 ASN n 
5  1521 ALA n 
5  1522 GLN n 
5  1523 ARG n 
5  1524 SER n 
5  1525 GLY n 
5  1526 LEU n 
5  1527 ASN n 
5  1528 GLN n 
5  1529 ILE n 
5  1530 PRO n 
5  1531 ASN n 
5  1532 ARG n 
5  1533 ARG n 
5  1534 PHE n 
5  1535 THR n 
5  1536 LEU n 
5  1537 TRP n 
5  1538 TRP n 
5  1539 SER n 
5  1540 PRO n 
5  1541 THR n 
5  1542 ILE n 
5  1543 ASN n 
5  1544 ARG n 
5  1545 ALA n 
5  1546 ASN n 
5  1547 VAL n 
5  1548 TYR n 
5  1549 VAL n 
5  1550 GLY n 
5  1551 PHE n 
5  1552 GLN n 
5  1553 VAL n 
5  1554 GLN n 
5  1555 LEU n 
5  1556 ASP n 
5  1557 LEU n 
5  1558 THR n 
5  1559 GLY n 
5  1560 ILE n 
5  1561 PHE n 
5  1562 MET n 
5  1563 HIS n 
5  1564 GLY n 
5  1565 LYS n 
5  1566 ILE n 
5  1567 PRO n 
5  1568 THR n 
5  1569 LEU n 
5  1570 LYS n 
5  1571 ILE n 
5  1572 SER n 
5  1573 LEU n 
5  1574 ILE n 
5  1575 GLN n 
5  1576 ILE n 
5  1577 PHE n 
5  1578 ARG n 
5  1579 ALA n 
5  1580 HIS n 
5  1581 LEU n 
5  1582 TRP n 
5  1583 GLN n 
5  1584 LYS n 
5  1585 ILE n 
5  1586 HIS n 
5  1587 GLU n 
5  1588 SER n 
5  1589 ILE n 
5  1590 VAL n 
5  1591 MET n 
5  1592 ASP n 
5  1593 LEU n 
5  1594 CYS n 
5  1595 GLN n 
5  1596 VAL n 
5  1597 PHE n 
5  1598 ASP n 
5  1599 GLN n 
5  1600 GLU n 
5  1601 LEU n 
5  1602 ASP n 
5  1603 ALA n 
5  1604 LEU n 
5  1605 GLU n 
5  1606 ILE n 
5  1607 GLU n 
5  1608 THR n 
5  1609 VAL n 
5  1610 GLN n 
5  1611 LYS n 
5  1612 GLU n 
5  1613 THR n 
5  1614 ILE n 
5  1615 HIS n 
5  1616 PRO n 
5  1617 ARG n 
5  1618 LYS n 
5  1619 SER n 
5  1620 TYR n 
5  1621 LYS n 
5  1622 MET n 
5  1623 ASN n 
5  1624 SER n 
5  1625 SER n 
5  1626 CYS n 
5  1627 ALA n 
5  1628 ASP n 
5  1629 ILE n 
5  1630 LEU n 
5  1631 LEU n 
5  1632 PHE n 
5  1633 ALA n 
5  1634 SER n 
5  1635 TYR n 
5  1636 LYS n 
5  1637 TRP n 
5  1638 ASN n 
5  1639 VAL n 
5  1640 SER n 
5  1641 ARG n 
5  1642 PRO n 
5  1643 SER n 
5  1644 LEU n 
5  1645 LEU n 
5  1646 ALA n 
5  1647 ASP n 
5  1648 SER n 
5  1649 LYS n 
5  1650 ASP n 
5  1651 VAL n 
5  1652 MET n 
5  1653 ASP n 
5  1654 SER n 
5  1655 THR n 
5  1656 THR n 
5  1657 THR n 
5  1658 GLN n 
5  1659 LYS n 
5  1660 TYR n 
5  1661 TRP n 
5  1662 ILE n 
5  1663 ASP n 
5  1664 ILE n 
5  1665 GLN n 
5  1666 LEU n 
5  1667 ARG n 
5  1668 TRP n 
5  1669 GLY n 
5  1670 ASP n 
5  1671 TYR n 
5  1672 ASP n 
5  1673 SER n 
5  1674 HIS n 
5  1675 ASP n 
5  1676 ILE n 
5  1677 GLU n 
5  1678 ARG n 
5  1679 TYR n 
5  1680 ALA n 
5  1681 ARG n 
5  1682 ALA n 
5  1683 LYS n 
5  1684 PHE n 
5  1685 LEU n 
5  1686 ASP n 
5  1687 TYR n 
5  1688 THR n 
5  1689 THR n 
5  1690 ASP n 
5  1691 ASN n 
5  1692 MET n 
5  1693 SER n 
5  1694 ILE n 
5  1695 TYR n 
5  1696 PRO n 
5  1697 SER n 
5  1698 PRO n 
5  1699 THR n 
5  1700 GLY n 
5  1701 VAL n 
5  1702 LEU n 
5  1703 ILE n 
5  1704 ALA n 
5  1705 ILE n 
5  1706 ASP n 
5  1707 LEU n 
5  1708 ALA n 
5  1709 TYR n 
5  1710 ASN n 
5  1711 LEU n 
5  1712 HIS n 
5  1713 SER n 
5  1714 ALA n 
5  1715 TYR n 
5  1716 GLY n 
5  1717 ASN n 
5  1718 TRP n 
5  1719 PHE n 
5  1720 PRO n 
5  1721 GLY n 
5  1722 SER n 
5  1723 LYS n 
5  1724 PRO n 
5  1725 LEU n 
5  1726 ILE n 
5  1727 GLN n 
5  1728 GLN n 
5  1729 ALA n 
5  1730 MET n 
5  1731 ALA n 
5  1732 LYS n 
5  1733 ILE n 
5  1734 MET n 
5  1735 LYS n 
5  1736 ALA n 
5  1737 ASN n 
5  1738 PRO n 
5  1739 ALA n 
5  1740 LEU n 
5  1741 TYR n 
5  1742 VAL n 
5  1743 LEU n 
5  1744 ARG n 
5  1745 GLU n 
5  1746 ARG n 
5  1747 ILE n 
5  1748 ARG n 
5  1749 LYS n 
5  1750 GLY n 
5  1751 LEU n 
5  1752 GLN n 
5  1753 LEU n 
5  1754 TYR n 
5  1755 SER n 
5  1756 SER n 
5  1757 GLU n 
5  1758 PRO n 
5  1759 THR n 
5  1760 GLU n 
5  1761 PRO n 
5  1762 TYR n 
5  1763 LEU n 
5  1764 SER n 
5  1765 SER n 
5  1766 GLN n 
5  1767 ASN n 
5  1768 TYR n 
5  1769 GLY n 
5  1770 GLU n 
5  1771 LEU n 
5  1772 PHE n 
5  1773 SER n 
5  1774 ASN n 
5  1775 GLN n 
5  1776 ILE n 
5  1777 ILE n 
5  1778 TRP n 
5  1779 PHE n 
5  1780 VAL n 
5  1781 ASP n 
5  1782 ASP n 
5  1783 THR n 
5  1784 ASN n 
5  1785 VAL n 
5  1786 TYR n 
5  1787 ARG n 
5  1788 VAL n 
5  1789 THR n 
5  1790 ILE n 
5  1791 HIS n 
5  1792 LYS n 
5  1793 THR n 
5  1794 PHE n 
5  1795 GLU n 
5  1796 GLY n 
5  1797 ASN n 
5  1798 LEU n 
5  1799 THR n 
5  1800 THR n 
5  1801 LYS n 
5  1802 PRO n 
5  1803 ILE n 
5  1804 ASN n 
5  1805 GLY n 
5  1806 ALA n 
5  1807 ILE n 
5  1808 PHE n 
5  1809 ILE n 
5  1810 PHE n 
5  1811 ASN n 
5  1812 PRO n 
5  1813 ARG n 
5  1814 THR n 
5  1815 GLY n 
5  1816 GLN n 
5  1817 LEU n 
5  1818 PHE n 
5  1819 LEU n 
5  1820 LYS n 
5  1821 ILE n 
5  1822 ILE n 
5  1823 HIS n 
5  1824 THR n 
5  1825 SER n 
5  1826 VAL n 
5  1827 TRP n 
5  1828 ALA n 
5  1829 GLY n 
5  1830 GLN n 
5  1831 LYS n 
5  1832 ARG n 
5  1833 LEU n 
5  1834 GLY n 
5  1835 GLN n 
5  1836 LEU n 
5  1837 ALA n 
5  1838 LYS n 
5  1839 TRP n 
5  1840 LYS n 
5  1841 THR n 
5  1842 ALA n 
5  1843 GLU n 
5  1844 GLU n 
5  1845 VAL n 
5  1846 ALA n 
5  1847 ALA n 
5  1848 LEU n 
5  1849 ILE n 
5  1850 ARG n 
5  1851 SER n 
5  1852 LEU n 
5  1853 PRO n 
5  1854 VAL n 
5  1855 GLU n 
5  1856 GLU n 
5  1857 GLN n 
5  1858 PRO n 
5  1859 LYS n 
5  1860 GLN n 
5  1861 ILE n 
5  1862 ILE n 
5  1863 VAL n 
5  1864 THR n 
5  1865 ARG n 
5  1866 LYS n 
5  1867 GLY n 
5  1868 MET n 
5  1869 LEU n 
5  1870 ASP n 
5  1871 PRO n 
5  1872 LEU n 
5  1873 GLU n 
5  1874 VAL n 
5  1875 HIS n 
5  1876 LEU n 
5  1877 LEU n 
5  1878 ASP n 
5  1879 PHE n 
5  1880 PRO n 
5  1881 ASN n 
5  1882 ILE n 
5  1883 VAL n 
5  1884 ILE n 
5  1885 LYS n 
5  1886 GLY n 
5  1887 SER n 
5  1888 GLU n 
5  1889 LEU n 
5  1890 GLN n 
5  1891 LEU n 
5  1892 PRO n 
5  1893 PHE n 
5  1894 GLN n 
5  1895 ALA n 
5  1896 CYS n 
5  1897 LEU n 
5  1898 LYS n 
5  1899 VAL n 
5  1900 GLU n 
5  1901 LYS n 
5  1902 PHE n 
5  1903 GLY n 
5  1904 ASP n 
5  1905 LEU n 
5  1906 ILE n 
5  1907 LEU n 
5  1908 LYS n 
5  1909 ALA n 
5  1910 THR n 
5  1911 GLU n 
5  1912 PRO n 
5  1913 GLN n 
5  1914 MET n 
5  1915 VAL n 
5  1916 LEU n 
5  1917 PHE n 
5  1918 ASN n 
5  1919 LEU n 
5  1920 TYR n 
5  1921 ASP n 
5  1922 ASP n 
5  1923 TRP n 
5  1924 LEU n 
5  1925 LYS n 
5  1926 THR n 
5  1927 ILE n 
5  1928 SER n 
5  1929 SER n 
5  1930 TYR n 
5  1931 THR n 
5  1932 ALA n 
5  1933 PHE n 
5  1934 SER n 
5  1935 ARG n 
5  1936 LEU n 
5  1937 ILE n 
5  1938 LEU n 
5  1939 ILE n 
5  1940 LEU n 
5  1941 ARG n 
5  1942 ALA n 
5  1943 LEU n 
5  1944 HIS n 
5  1945 VAL n 
5  1946 ASN n 
5  1947 ASN n 
5  1948 ASP n 
5  1949 ARG n 
5  1950 ALA n 
5  1951 LYS n 
5  1952 VAL n 
5  1953 ILE n 
5  1954 LEU n 
5  1955 LYS n 
5  1956 PRO n 
5  1957 ASP n 
5  1958 LYS n 
5  1959 THR n 
5  1960 THR n 
5  1961 ILE n 
5  1962 THR n 
5  1963 GLU n 
5  1964 PRO n 
5  1965 HIS n 
5  1966 HIS n 
5  1967 ILE n 
5  1968 TRP n 
5  1969 PRO n 
5  1970 THR n 
5  1971 LEU n 
5  1972 THR n 
5  1973 ASP n 
5  1974 GLU n 
5  1975 GLU n 
5  1976 TRP n 
5  1977 ILE n 
5  1978 LYS n 
5  1979 VAL n 
5  1980 GLU n 
5  1981 VAL n 
5  1982 GLN n 
5  1983 LEU n 
5  1984 LYS n 
5  1985 ASP n 
5  1986 LEU n 
5  1987 ILE n 
5  1988 LEU n 
5  1989 ALA n 
5  1990 ASP n 
5  1991 TYR n 
5  1992 GLY n 
5  1993 LYS n 
5  1994 LYS n 
5  1995 ASN n 
5  1996 ASN n 
5  1997 VAL n 
5  1998 ASN n 
5  1999 VAL n 
5  2000 ALA n 
5  2001 SER n 
5  2002 LEU n 
5  2003 THR n 
5  2004 GLN n 
5  2005 SER n 
5  2006 GLU n 
5  2007 ILE n 
5  2008 ARG n 
5  2009 ASP n 
5  2010 ILE n 
5  2011 ILE n 
5  2012 LEU n 
5  2013 GLY n 
5  2014 MET n 
5  2015 GLU n 
5  2016 ILE n 
5  2017 SER n 
5  2018 ALA n 
5  2019 PRO n 
5  2020 SER n 
5  2021 GLN n 
5  2022 GLN n 
5  2023 ARG n 
5  2024 GLN n 
5  2025 GLN n 
5  2026 ILE n 
5  2027 ALA n 
5  2028 GLU n 
5  2029 ILE n 
5  2030 GLU n 
5  2031 LYS n 
5  2032 GLN n 
5  2033 THR n 
5  2034 LYS n 
5  2035 GLU n 
5  2036 GLN n 
5  2037 SER n 
5  2038 GLN n 
5  2039 LEU n 
5  2040 THR n 
5  2041 ALA n 
5  2042 THR n 
5  2043 GLN n 
5  2044 THR n 
5  2045 ARG n 
5  2046 THR n 
5  2047 VAL n 
5  2048 ASN n 
5  2049 LYS n 
5  2050 HIS n 
5  2051 GLY n 
5  2052 ASP n 
5  2053 GLU n 
5  2054 ILE n 
5  2055 ILE n 
5  2056 THR n 
5  2057 SER n 
5  2058 THR n 
5  2059 THR n 
5  2060 SER n 
5  2061 ASN n 
5  2062 TYR n 
5  2063 GLU n 
5  2064 THR n 
5  2065 GLN n 
5  2066 THR n 
5  2067 PHE n 
5  2068 SER n 
5  2069 SER n 
5  2070 LYS n 
5  2071 THR n 
5  2072 GLU n 
5  2073 TRP n 
5  2074 ARG n 
5  2075 VAL n 
5  2076 ARG n 
5  2077 ALA n 
5  2078 ILE n 
5  2079 SER n 
5  2080 ALA n 
5  2081 ALA n 
5  2082 ASN n 
5  2083 LEU n 
5  2084 HIS n 
5  2085 LEU n 
5  2086 ARG n 
5  2087 THR n 
5  2088 ASN n 
5  2089 HIS n 
5  2090 ILE n 
5  2091 TYR n 
5  2092 VAL n 
5  2093 SER n 
5  2094 SER n 
5  2095 ASP n 
5  2096 ASP n 
5  2097 ILE n 
5  2098 LYS n 
5  2099 GLU n 
5  2100 THR n 
5  2101 GLY n 
5  2102 TYR n 
5  2103 THR n 
5  2104 TYR n 
5  2105 ILE n 
5  2106 LEU n 
5  2107 PRO n 
5  2108 LYS n 
5  2109 ASN n 
5  2110 VAL n 
5  2111 LEU n 
5  2112 LYS n 
5  2113 LYS n 
5  2114 PHE n 
5  2115 ILE n 
5  2116 CYS n 
5  2117 ILE n 
5  2118 SER n 
5  2119 ASP n 
5  2120 LEU n 
5  2121 ARG n 
5  2122 ALA n 
5  2123 GLN n 
5  2124 ILE n 
5  2125 ALA n 
5  2126 GLY n 
5  2127 TYR n 
5  2128 LEU n 
5  2129 TYR n 
5  2130 GLY n 
5  2131 VAL n 
5  2132 SER n 
5  2133 PRO n 
5  2134 PRO n 
5  2135 ASP n 
5  2136 ASN n 
5  2137 PRO n 
5  2138 GLN n 
5  2139 VAL n 
5  2140 LYS n 
5  2141 GLU n 
5  2142 ILE n 
5  2143 ARG n 
5  2144 CYS n 
5  2145 ILE n 
5  2146 VAL n 
5  2147 MET n 
5  2148 VAL n 
5  2149 PRO n 
5  2150 GLN n 
5  2151 TRP n 
5  2152 GLY n 
5  2153 THR n 
5  2154 HIS n 
5  2155 GLN n 
5  2156 THR n 
5  2157 VAL n 
5  2158 HIS n 
5  2159 LEU n 
5  2160 PRO n 
5  2161 GLY n 
5  2162 GLN n 
5  2163 LEU n 
5  2164 PRO n 
5  2165 GLN n 
5  2166 HIS n 
5  2167 GLU n 
5  2168 TYR n 
5  2169 LEU n 
5  2170 LYS n 
5  2171 GLU n 
5  2172 MET n 
5  2173 GLU n 
5  2174 PRO n 
5  2175 LEU n 
5  2176 GLY n 
5  2177 TRP n 
5  2178 ILE n 
5  2179 HIS n 
5  2180 THR n 
5  2181 GLN n 
5  2182 PRO n 
5  2183 ASN n 
5  2184 GLU n 
5  2185 SER n 
5  2186 PRO n 
5  2187 GLN n 
5  2188 LEU n 
5  2189 SER n 
5  2190 PRO n 
5  2191 GLN n 
5  2192 ASP n 
5  2193 VAL n 
5  2194 THR n 
5  2195 THR n 
5  2196 HIS n 
5  2197 ALA n 
5  2198 LYS n 
5  2199 ILE n 
5  2200 MET n 
5  2201 ALA n 
5  2202 ASP n 
5  2203 ASN n 
5  2204 PRO n 
5  2205 SER n 
5  2206 TRP n 
5  2207 ASP n 
5  2208 GLY n 
5  2209 GLU n 
5  2210 LYS n 
5  2211 THR n 
5  2212 ILE n 
5  2213 ILE n 
5  2214 ILE n 
5  2215 THR n 
5  2216 CYS n 
5  2217 SER n 
5  2218 PHE n 
5  2219 THR n 
5  2220 PRO n 
5  2221 GLY n 
5  2222 SER n 
5  2223 CYS n 
5  2224 THR n 
5  2225 LEU n 
5  2226 THR n 
5  2227 ALA n 
5  2228 TYR n 
5  2229 LYS n 
5  2230 LEU n 
5  2231 THR n 
5  2232 PRO n 
5  2233 SER n 
5  2234 GLY n 
5  2235 TYR n 
5  2236 GLU n 
5  2237 TRP n 
5  2238 GLY n 
5  2239 ARG n 
5  2240 GLN n 
5  2241 ASN n 
5  2242 THR n 
5  2243 ASP n 
5  2244 LYS n 
5  2245 GLY n 
5  2246 ASN n 
5  2247 ASN n 
5  2248 PRO n 
5  2249 LYS n 
5  2250 GLY n 
5  2251 TYR n 
5  2252 LEU n 
5  2253 PRO n 
5  2254 SER n 
5  2255 HIS n 
5  2256 TYR n 
5  2257 GLU n 
5  2258 ARG n 
5  2259 VAL n 
5  2260 GLN n 
5  2261 MET n 
5  2262 LEU n 
5  2263 LEU n 
5  2264 SER n 
5  2265 ASP n 
5  2266 ARG n 
5  2267 PHE n 
5  2268 LEU n 
5  2269 GLY n 
5  2270 PHE n 
5  2271 PHE n 
5  2272 MET n 
5  2273 VAL n 
5  2274 PRO n 
5  2275 ALA n 
5  2276 GLN n 
5  2277 SER n 
5  2278 SER n 
5  2279 TRP n 
5  2280 ASN n 
5  2281 TYR n 
5  2282 ASN n 
5  2283 PHE n 
5  2284 MET n 
5  2285 GLY n 
5  2286 VAL n 
5  2287 ARG n 
5  2288 HIS n 
5  2289 ASP n 
5  2290 PRO n 
5  2291 ASN n 
5  2292 MET n 
5  2293 LYS n 
5  2294 TYR n 
5  2295 GLU n 
5  2296 LEU n 
5  2297 GLN n 
5  2298 LEU n 
5  2299 ALA n 
5  2300 ASN n 
5  2301 PRO n 
5  2302 LYS n 
5  2303 GLU n 
5  2304 PHE n 
5  2305 TYR n 
5  2306 HIS n 
5  2307 GLU n 
5  2308 VAL n 
5  2309 HIS n 
5  2310 ARG n 
5  2311 PRO n 
5  2312 SER n 
5  2313 HIS n 
5  2314 PHE n 
5  2315 LEU n 
5  2316 ASN n 
5  2317 PHE n 
5  2318 ALA n 
5  2319 LEU n 
5  2320 LEU n 
5  2321 GLN n 
5  2322 GLU n 
5  2323 GLY n 
5  2324 GLU n 
5  2325 VAL n 
5  2326 TYR n 
5  2327 SER n 
5  2328 ALA n 
5  2329 ASP n 
5  2330 ARG n 
5  2331 GLU n 
5  2332 ASP n 
5  2333 LEU n 
5  2334 TYR n 
5  2335 ALA n 
6  1    MET n 
6  2    ALA n 
6  3    GLY n 
6  4    GLU n 
6  5    LEU n 
6  6    ALA n 
6  7    ASP n 
6  8    LYS n 
6  9    LYS n 
6  10   ASP n 
6  11   ARG n 
6  12   ASP n 
6  13   ALA n 
6  14   SER n 
6  15   PRO n 
6  16   SER n 
6  17   LYS n 
6  18   GLU n 
6  19   GLU n 
6  20   ARG n 
6  21   LYS n 
6  22   ARG n 
6  23   SER n 
6  24   ARG n 
6  25   THR n 
6  26   PRO n 
6  27   ASP n 
6  28   ARG n 
6  29   GLU n 
6  30   ARG n 
6  31   ASP n 
6  32   ARG n 
6  33   ASP n 
6  34   ARG n 
6  35   ASP n 
6  36   ARG n 
6  37   LYS n 
6  38   SER n 
6  39   SER n 
6  40   PRO n 
6  41   SER n 
6  42   LYS n 
6  43   ASP n 
6  44   ARG n 
6  45   LYS n 
6  46   ARG n 
6  47   HIS n 
6  48   ARG n 
6  49   SER n 
6  50   ARG n 
6  51   ASP n 
6  52   ARG n 
6  53   ARG n 
6  54   ARG n 
6  55   GLY n 
6  56   GLY n 
6  57   SER n 
6  58   ARG n 
6  59   SER n 
6  60   ARG n 
6  61   SER n 
6  62   ARG n 
6  63   SER n 
6  64   ARG n 
6  65   SER n 
6  66   LYS n 
6  67   SER n 
6  68   ALA n 
6  69   GLU n 
6  70   ARG n 
6  71   GLU n 
6  72   ARG n 
6  73   ARG n 
6  74   HIS n 
6  75   LYS n 
6  76   GLU n 
6  77   ARG n 
6  78   GLU n 
6  79   ARG n 
6  80   ASP n 
6  81   LYS n 
6  82   GLU n 
6  83   ARG n 
6  84   ASP n 
6  85   ARG n 
6  86   ASN n 
6  87   LYS n 
6  88   LYS n 
6  89   ASP n 
6  90   ARG n 
6  91   ASP n 
6  92   ARG n 
6  93   ASP n 
6  94   LYS n 
6  95   ASP n 
6  96   GLY n 
6  97   HIS n 
6  98   ARG n 
6  99   ARG n 
6  100  ASP n 
6  101  LYS n 
6  102  ASP n 
6  103  ARG n 
6  104  LYS n 
6  105  ARG n 
6  106  SER n 
6  107  SER n 
6  108  LEU n 
6  109  SER n 
6  110  PRO n 
6  111  GLY n 
6  112  ARG n 
6  113  GLY n 
6  114  LYS n 
6  115  ASP n 
6  116  PHE n 
6  117  LYS n 
6  118  SER n 
6  119  ARG n 
6  120  LYS n 
6  121  ASP n 
6  122  ARG n 
6  123  ASP n 
6  124  SER n 
6  125  LYS n 
6  126  LYS n 
6  127  ASP n 
6  128  GLU n 
6  129  GLU n 
6  130  ASP n 
6  131  GLU n 
6  132  HIS n 
6  133  GLY n 
6  134  ASP n 
6  135  LYS n 
6  136  LYS n 
6  137  PRO n 
6  138  LYS n 
6  139  ALA n 
6  140  GLN n 
6  141  PRO n 
6  142  LEU n 
6  143  SER n 
6  144  LEU n 
6  145  GLU n 
6  146  GLU n 
6  147  LEU n 
6  148  LEU n 
6  149  ALA n 
6  150  LYS n 
6  151  LYS n 
6  152  LYS n 
6  153  ALA n 
6  154  GLU n 
6  155  GLU n 
6  156  GLU n 
6  157  ALA n 
6  158  GLU n 
6  159  ALA n 
6  160  LYS n 
6  161  PRO n 
6  162  LYS n 
6  163  PHE n 
6  164  LEU n 
6  165  SER n 
6  166  LYS n 
6  167  ALA n 
6  168  GLU n 
6  169  ARG n 
6  170  GLU n 
6  171  ALA n 
6  172  GLU n 
6  173  ALA n 
6  174  LEU n 
6  175  LYS n 
6  176  ARG n 
6  177  ARG n 
6  178  GLN n 
6  179  GLN n 
6  180  GLU n 
6  181  VAL n 
6  182  GLU n 
6  183  GLU n 
6  184  ARG n 
6  185  GLN n 
6  186  ARG n 
6  187  MET n 
6  188  LEU n 
6  189  GLU n 
6  190  GLU n 
6  191  GLU n 
6  192  ARG n 
6  193  LYS n 
6  194  LYS n 
6  195  ARG n 
6  196  LYS n 
6  197  GLN n 
6  198  PHE n 
6  199  GLN n 
6  200  ASP n 
6  201  LEU n 
6  202  GLY n 
6  203  ARG n 
6  204  LYS n 
6  205  MET n 
6  206  LEU n 
6  207  GLU n 
6  208  ASP n 
6  209  PRO n 
6  210  GLN n 
6  211  GLU n 
6  212  ARG n 
6  213  GLU n 
6  214  ARG n 
6  215  ARG n 
6  216  GLU n 
6  217  ARG n 
6  218  ARG n 
6  219  GLU n 
6  220  ARG n 
6  221  MET n 
6  222  GLU n 
6  223  ARG n 
6  224  GLU n 
6  225  THR n 
6  226  ASN n 
6  227  GLY n 
6  228  ASN n 
6  229  GLU n 
6  230  ASP n 
6  231  GLU n 
6  232  GLU n 
6  233  GLY n 
6  234  ARG n 
6  235  GLN n 
6  236  LYS n 
6  237  ILE n 
6  238  ARG n 
6  239  GLU n 
6  240  GLU n 
6  241  LYS n 
6  242  ASP n 
6  243  LYS n 
6  244  SER n 
6  245  LYS n 
6  246  GLU n 
6  247  LEU n 
6  248  HIS n 
6  249  ALA n 
6  250  ILE n 
6  251  LYS n 
6  252  GLU n 
6  253  ARG n 
6  254  TYR n 
6  255  LEU n 
6  256  GLY n 
6  257  GLY n 
6  258  ILE n 
6  259  LYS n 
6  260  LYS n 
6  261  ARG n 
6  262  ARG n 
6  263  ARG n 
6  264  THR n 
6  265  ARG n 
6  266  HIS n 
6  267  LEU n 
6  268  ASN n 
6  269  ASP n 
6  270  ARG n 
6  271  LYS n 
6  272  PHE n 
6  273  VAL n 
6  274  PHE n 
6  275  GLU n 
6  276  TRP n 
6  277  ASP n 
6  278  ALA n 
6  279  SER n 
6  280  GLU n 
6  281  ASP n 
6  282  THR n 
6  283  SER n 
6  284  ILE n 
6  285  ASP n 
6  286  TYR n 
6  287  ASN n 
6  288  PRO n 
6  289  LEU n 
6  290  TYR n 
6  291  LYS n 
6  292  GLU n 
6  293  ARG n 
6  294  HIS n 
6  295  GLN n 
6  296  VAL n 
6  297  GLN n 
6  298  LEU n 
6  299  LEU n 
6  300  GLY n 
6  301  ARG n 
6  302  GLY n 
6  303  PHE n 
6  304  ILE n 
6  305  ALA n 
6  306  GLY n 
6  307  ILE n 
6  308  ASP n 
6  309  LEU n 
6  310  LYS n 
6  311  GLN n 
6  312  GLN n 
6  313  LYS n 
6  314  ARG n 
6  315  GLU n 
6  316  GLN n 
6  317  SER n 
6  318  ARG n 
6  319  PHE n 
6  320  TYR n 
6  321  GLY n 
6  322  ASP n 
6  323  LEU n 
6  324  MET n 
6  325  GLU n 
6  326  LYS n 
6  327  ARG n 
6  328  ARG n 
6  329  THR n 
6  330  LEU n 
6  331  GLU n 
6  332  GLU n 
6  333  LYS n 
6  334  GLU n 
6  335  GLN n 
6  336  GLU n 
6  337  GLU n 
6  338  ALA n 
6  339  ARG n 
6  340  LEU n 
6  341  ARG n 
6  342  LYS n 
6  343  LEU n 
6  344  ARG n 
6  345  LYS n 
6  346  LYS n 
6  347  GLU n 
6  348  ALA n 
6  349  LYS n 
6  350  GLN n 
6  351  ARG n 
6  352  TRP n 
6  353  ASP n 
6  354  ASP n 
6  355  ARG n 
6  356  HIS n 
6  357  TRP n 
6  358  SER n 
6  359  GLN n 
6  360  LYS n 
6  361  LYS n 
6  362  LEU n 
6  363  ASP n 
6  364  GLU n 
6  365  MET n 
6  366  THR n 
6  367  ASP n 
6  368  ARG n 
6  369  ASP n 
6  370  TRP n 
6  371  ARG n 
6  372  ILE n 
6  373  PHE n 
6  374  ARG n 
6  375  GLU n 
6  376  ASP n 
6  377  TYR n 
6  378  SER n 
6  379  ILE n 
6  380  THR n 
6  381  THR n 
6  382  LYS n 
6  383  GLY n 
6  384  GLY n 
6  385  LYS n 
6  386  ILE n 
6  387  PRO n 
6  388  ASN n 
6  389  PRO n 
6  390  ILE n 
6  391  ARG n 
6  392  SER n 
6  393  TRP n 
6  394  LYS n 
6  395  ASP n 
6  396  SER n 
6  397  SER n 
6  398  LEU n 
6  399  PRO n 
6  400  PRO n 
6  401  HIS n 
6  402  ILE n 
6  403  LEU n 
6  404  GLU n 
6  405  VAL n 
6  406  ILE n 
6  407  ASP n 
6  408  LYS n 
6  409  CYS n 
6  410  GLY n 
6  411  TYR n 
6  412  LYS n 
6  413  GLU n 
6  414  PRO n 
6  415  THR n 
6  416  PRO n 
6  417  ILE n 
6  418  GLN n 
6  419  ARG n 
6  420  GLN n 
6  421  ALA n 
6  422  ILE n 
6  423  PRO n 
6  424  ILE n 
6  425  GLY n 
6  426  LEU n 
6  427  GLN n 
6  428  ASN n 
6  429  ARG n 
6  430  ASP n 
6  431  ILE n 
6  432  ILE n 
6  433  GLY n 
6  434  VAL n 
6  435  ALA n 
6  436  GLU n 
6  437  THR n 
6  438  GLY n 
6  439  SER n 
6  440  GLY n 
6  441  LYS n 
6  442  THR n 
6  443  ALA n 
6  444  ALA n 
6  445  PHE n 
6  446  LEU n 
6  447  ILE n 
6  448  PRO n 
6  449  LEU n 
6  450  LEU n 
6  451  VAL n 
6  452  TRP n 
6  453  ILE n 
6  454  THR n 
6  455  THR n 
6  456  LEU n 
6  457  PRO n 
6  458  LYS n 
6  459  ILE n 
6  460  ASP n 
6  461  ARG n 
6  462  ILE n 
6  463  GLU n 
6  464  GLU n 
6  465  SER n 
6  466  ASP n 
6  467  GLN n 
6  468  GLY n 
6  469  PRO n 
6  470  TYR n 
6  471  ALA n 
6  472  ILE n 
6  473  ILE n 
6  474  LEU n 
6  475  ALA n 
6  476  PRO n 
6  477  THR n 
6  478  ARG n 
6  479  GLU n 
6  480  LEU n 
6  481  ALA n 
6  482  GLN n 
6  483  GLN n 
6  484  ILE n 
6  485  GLU n 
6  486  GLU n 
6  487  GLU n 
6  488  THR n 
6  489  ILE n 
6  490  LYS n 
6  491  PHE n 
6  492  GLY n 
6  493  LYS n 
6  494  PRO n 
6  495  LEU n 
6  496  GLY n 
6  497  ILE n 
6  498  ARG n 
6  499  THR n 
6  500  VAL n 
6  501  ALA n 
6  502  VAL n 
6  503  ILE n 
6  504  GLY n 
6  505  GLY n 
6  506  ILE n 
6  507  SER n 
6  508  ARG n 
6  509  GLU n 
6  510  ASP n 
6  511  GLN n 
6  512  GLY n 
6  513  PHE n 
6  514  ARG n 
6  515  LEU n 
6  516  ARG n 
6  517  MET n 
6  518  GLY n 
6  519  CYS n 
6  520  GLU n 
6  521  ILE n 
6  522  VAL n 
6  523  ILE n 
6  524  ALA n 
6  525  THR n 
6  526  PRO n 
6  527  GLY n 
6  528  ARG n 
6  529  LEU n 
6  530  ILE n 
6  531  ASP n 
6  532  VAL n 
6  533  LEU n 
6  534  GLU n 
6  535  ASN n 
6  536  ARG n 
6  537  TYR n 
6  538  LEU n 
6  539  VAL n 
6  540  LEU n 
6  541  SER n 
6  542  ARG n 
6  543  CYS n 
6  544  THR n 
6  545  TYR n 
6  546  VAL n 
6  547  VAL n 
6  548  LEU n 
6  549  ASP n 
6  550  GLU n 
6  551  ALA n 
6  552  ASP n 
6  553  ARG n 
6  554  MET n 
6  555  ILE n 
6  556  ASP n 
6  557  MET n 
6  558  GLY n 
6  559  PHE n 
6  560  GLU n 
6  561  PRO n 
6  562  ASP n 
6  563  VAL n 
6  564  GLN n 
6  565  LYS n 
6  566  ILE n 
6  567  LEU n 
6  568  GLU n 
6  569  HIS n 
6  570  MET n 
6  571  PRO n 
6  572  VAL n 
6  573  SER n 
6  574  ASN n 
6  575  GLN n 
6  576  LYS n 
6  577  PRO n 
6  578  ASP n 
6  579  THR n 
6  580  ASP n 
6  581  GLU n 
6  582  ALA n 
6  583  GLU n 
6  584  ASP n 
6  585  PRO n 
6  586  GLU n 
6  587  LYS n 
6  588  MET n 
6  589  LEU n 
6  590  ALA n 
6  591  ASN n 
6  592  PHE n 
6  593  GLU n 
6  594  SER n 
6  595  GLY n 
6  596  LYS n 
6  597  HIS n 
6  598  LYS n 
6  599  TYR n 
6  600  ARG n 
6  601  GLN n 
6  602  THR n 
6  603  VAL n 
6  604  MET n 
6  605  PHE n 
6  606  THR n 
6  607  ALA n 
6  608  THR n 
6  609  MET n 
6  610  PRO n 
6  611  PRO n 
6  612  ALA n 
6  613  VAL n 
6  614  GLU n 
6  615  ARG n 
6  616  LEU n 
6  617  ALA n 
6  618  ARG n 
6  619  SER n 
6  620  TYR n 
6  621  LEU n 
6  622  ARG n 
6  623  ARG n 
6  624  PRO n 
6  625  ALA n 
6  626  VAL n 
6  627  VAL n 
6  628  TYR n 
6  629  ILE n 
6  630  GLY n 
6  631  SER n 
6  632  ALA n 
6  633  GLY n 
6  634  LYS n 
6  635  PRO n 
6  636  HIS n 
6  637  GLU n 
6  638  ARG n 
6  639  VAL n 
6  640  GLU n 
6  641  GLN n 
6  642  LYS n 
6  643  VAL n 
6  644  PHE n 
6  645  LEU n 
6  646  MET n 
6  647  SER n 
6  648  GLU n 
6  649  SER n 
6  650  GLU n 
6  651  LYS n 
6  652  ARG n 
6  653  LYS n 
6  654  LYS n 
6  655  LEU n 
6  656  LEU n 
6  657  ALA n 
6  658  ILE n 
6  659  LEU n 
6  660  GLU n 
6  661  GLN n 
6  662  GLY n 
6  663  PHE n 
6  664  ASP n 
6  665  PRO n 
6  666  PRO n 
6  667  ILE n 
6  668  ILE n 
6  669  ILE n 
6  670  PHE n 
6  671  VAL n 
6  672  ASN n 
6  673  GLN n 
6  674  LYS n 
6  675  LYS n 
6  676  GLY n 
6  677  CYS n 
6  678  ASP n 
6  679  VAL n 
6  680  LEU n 
6  681  ALA n 
6  682  LYS n 
6  683  SER n 
6  684  LEU n 
6  685  GLU n 
6  686  LYS n 
6  687  MET n 
6  688  GLY n 
6  689  TYR n 
6  690  ASN n 
6  691  ALA n 
6  692  CYS n 
6  693  THR n 
6  694  LEU n 
6  695  HIS n 
6  696  GLY n 
6  697  GLY n 
6  698  LYS n 
6  699  GLY n 
6  700  GLN n 
6  701  GLU n 
6  702  GLN n 
6  703  ARG n 
6  704  GLU n 
6  705  PHE n 
6  706  ALA n 
6  707  LEU n 
6  708  SER n 
6  709  ASN n 
6  710  LEU n 
6  711  LYS n 
6  712  ALA n 
6  713  GLY n 
6  714  ALA n 
6  715  LYS n 
6  716  ASP n 
6  717  ILE n 
6  718  LEU n 
6  719  VAL n 
6  720  ALA n 
6  721  THR n 
6  722  ASP n 
6  723  VAL n 
6  724  ALA n 
6  725  GLY n 
6  726  ARG n 
6  727  GLY n 
6  728  ILE n 
6  729  ASP n 
6  730  ILE n 
6  731  GLN n 
6  732  ASP n 
6  733  VAL n 
6  734  SER n 
6  735  MET n 
6  736  VAL n 
6  737  VAL n 
6  738  ASN n 
6  739  TYR n 
6  740  ASP n 
6  741  MET n 
6  742  ALA n 
6  743  LYS n 
6  744  ASN n 
6  745  ILE n 
6  746  GLU n 
6  747  ASP n 
6  748  TYR n 
6  749  ILE n 
6  750  HIS n 
6  751  ARG n 
6  752  ILE n 
6  753  GLY n 
6  754  ARG n 
6  755  THR n 
6  756  GLY n 
6  757  ARG n 
6  758  ALA n 
6  759  GLY n 
6  760  LYS n 
6  761  SER n 
6  762  GLY n 
6  763  VAL n 
6  764  ALA n 
6  765  ILE n 
6  766  THR n 
6  767  PHE n 
6  768  LEU n 
6  769  THR n 
6  770  LYS n 
6  771  GLU n 
6  772  ASP n 
6  773  SER n 
6  774  ALA n 
6  775  VAL n 
6  776  PHE n 
6  777  TYR n 
6  778  GLU n 
6  779  LEU n 
6  780  LYS n 
6  781  GLN n 
6  782  ALA n 
6  783  ILE n 
6  784  LEU n 
6  785  GLU n 
6  786  SER n 
6  787  PRO n 
6  788  VAL n 
6  789  SER n 
6  790  SER n 
6  791  CYS n 
6  792  PRO n 
6  793  PRO n 
6  794  GLU n 
6  795  LEU n 
6  796  ALA n 
6  797  ASN n 
6  798  HIS n 
6  799  PRO n 
6  800  ASP n 
6  801  ALA n 
6  802  GLN n 
6  803  HIS n 
6  804  LYS n 
6  805  PRO n 
6  806  GLY n 
6  807  THR n 
6  808  ILE n 
6  809  LEU n 
6  810  THR n 
6  811  LYS n 
6  812  LYS n 
6  813  ARG n 
6  814  ARG n 
6  815  GLU n 
6  816  GLU n 
6  817  THR n 
6  818  ILE n 
6  819  PHE n 
6  820  ALA n 
7  1    MET n 
7  2    ASP n 
7  3    THR n 
7  4    ASP n 
7  5    LEU n 
7  6    TYR n 
7  7    ASP n 
7  8    GLU n 
7  9    PHE n 
7  10   GLY n 
7  11   ASN n 
7  12   TYR n 
7  13   ILE n 
7  14   GLY n 
7  15   PRO n 
7  16   GLU n 
7  17   LEU n 
7  18   ASP n 
7  19   SER n 
7  20   ASP n 
7  21   GLU n 
7  22   ASP n 
7  23   ASP n 
7  24   ASP n 
7  25   GLU n 
7  26   LEU n 
7  27   GLY n 
7  28   ARG n 
7  29   GLU n 
7  30   THR n 
7  31   LYS n 
7  32   ASP n 
7  33   LEU n 
7  34   ASP n 
7  35   GLU n 
7  36   MET n 
7  37   ASP n 
7  38   ASP n 
7  39   ASP n 
7  40   ASP n 
7  41   ASP n 
7  42   ASP n 
7  43   ASP n 
7  44   ASP n 
7  45   VAL n 
7  46   GLY n 
7  47   ASP n 
7  48   HIS n 
7  49   ASP n 
7  50   ASP n 
7  51   ASP n 
7  52   HIS n 
7  53   PRO n 
7  54   GLY n 
7  55   MET n 
7  56   GLU n 
7  57   VAL n 
7  58   VAL n 
7  59   LEU n 
7  60   HIS n 
7  61   GLU n 
7  62   ASP n 
7  63   LYS n 
7  64   LYS n 
7  65   TYR n 
7  66   TYR n 
7  67   PRO n 
7  68   THR n 
7  69   ALA n 
7  70   GLU n 
7  71   GLU n 
7  72   VAL n 
7  73   TYR n 
7  74   GLY n 
7  75   PRO n 
7  76   GLU n 
7  77   VAL n 
7  78   GLU n 
7  79   THR n 
7  80   ILE n 
7  81   VAL n 
7  82   GLN n 
7  83   GLU n 
7  84   GLU n 
7  85   ASP n 
7  86   THR n 
7  87   GLN n 
7  88   PRO n 
7  89   LEU n 
7  90   THR n 
7  91   GLU n 
7  92   PRO n 
7  93   ILE n 
7  94   ILE n 
7  95   LYS n 
7  96   PRO n 
7  97   VAL n 
7  98   LYS n 
7  99   THR n 
7  100  LYS n 
7  101  LYS n 
7  102  PHE n 
7  103  THR n 
7  104  LEU n 
7  105  MET n 
7  106  GLU n 
7  107  GLN n 
7  108  THR n 
7  109  LEU n 
7  110  PRO n 
7  111  VAL n 
7  112  THR n 
7  113  VAL n 
7  114  TYR n 
7  115  GLU n 
7  116  MET n 
7  117  ASP n 
7  118  PHE n 
7  119  LEU n 
7  120  ALA n 
7  121  ASP n 
7  122  LEU n 
7  123  MET n 
7  124  ASP n 
7  125  ASN n 
7  126  SER n 
7  127  GLU n 
7  128  LEU n 
7  129  ILE n 
7  130  ARG n 
7  131  ASN n 
7  132  VAL n 
7  133  THR n 
7  134  LEU n 
7  135  CYS n 
7  136  GLY n 
7  137  HIS n 
7  138  LEU n 
7  139  HIS n 
7  140  HIS n 
7  141  GLY n 
7  142  LYS n 
7  143  THR n 
7  144  CYS n 
7  145  PHE n 
7  146  VAL n 
7  147  ASP n 
7  148  CYS n 
7  149  LEU n 
7  150  ILE n 
7  151  GLU n 
7  152  GLN n 
7  153  THR n 
7  154  HIS n 
7  155  PRO n 
7  156  GLU n 
7  157  ILE n 
7  158  ARG n 
7  159  LYS n 
7  160  ARG n 
7  161  TYR n 
7  162  ASP n 
7  163  GLN n 
7  164  ASP n 
7  165  LEU n 
7  166  CYS n 
7  167  TYR n 
7  168  THR n 
7  169  ASP n 
7  170  ILE n 
7  171  LEU n 
7  172  PHE n 
7  173  THR n 
7  174  GLU n 
7  175  GLN n 
7  176  GLU n 
7  177  ARG n 
7  178  GLY n 
7  179  VAL n 
7  180  GLY n 
7  181  ILE n 
7  182  LYS n 
7  183  SER n 
7  184  THR n 
7  185  PRO n 
7  186  VAL n 
7  187  THR n 
7  188  VAL n 
7  189  VAL n 
7  190  LEU n 
7  191  PRO n 
7  192  ASP n 
7  193  THR n 
7  194  LYS n 
7  195  GLY n 
7  196  LYS n 
7  197  SER n 
7  198  TYR n 
7  199  LEU n 
7  200  PHE n 
7  201  ASN n 
7  202  ILE n 
7  203  MET n 
7  204  ASP n 
7  205  THR n 
7  206  PRO n 
7  207  GLY n 
7  208  HIS n 
7  209  VAL n 
7  210  ASN n 
7  211  PHE n 
7  212  SER n 
7  213  ASP n 
7  214  GLU n 
7  215  VAL n 
7  216  THR n 
7  217  ALA n 
7  218  GLY n 
7  219  LEU n 
7  220  ARG n 
7  221  ILE n 
7  222  SER n 
7  223  ASP n 
7  224  GLY n 
7  225  VAL n 
7  226  VAL n 
7  227  LEU n 
7  228  PHE n 
7  229  ILE n 
7  230  ASP n 
7  231  ALA n 
7  232  ALA n 
7  233  GLU n 
7  234  GLY n 
7  235  VAL n 
7  236  MET n 
7  237  LEU n 
7  238  ASN n 
7  239  THR n 
7  240  GLU n 
7  241  ARG n 
7  242  LEU n 
7  243  ILE n 
7  244  LYS n 
7  245  HIS n 
7  246  ALA n 
7  247  VAL n 
7  248  GLN n 
7  249  GLU n 
7  250  ARG n 
7  251  LEU n 
7  252  ALA n 
7  253  VAL n 
7  254  THR n 
7  255  VAL n 
7  256  CYS n 
7  257  ILE n 
7  258  ASN n 
7  259  LYS n 
7  260  ILE n 
7  261  ASP n 
7  262  ARG n 
7  263  LEU n 
7  264  ILE n 
7  265  LEU n 
7  266  GLU n 
7  267  LEU n 
7  268  LYS n 
7  269  LEU n 
7  270  PRO n 
7  271  PRO n 
7  272  THR n 
7  273  ASP n 
7  274  ALA n 
7  275  TYR n 
7  276  TYR n 
7  277  LYS n 
7  278  LEU n 
7  279  ARG n 
7  280  HIS n 
7  281  ILE n 
7  282  VAL n 
7  283  ASP n 
7  284  GLU n 
7  285  VAL n 
7  286  ASN n 
7  287  GLY n 
7  288  LEU n 
7  289  ILE n 
7  290  SER n 
7  291  MET n 
7  292  TYR n 
7  293  SER n 
7  294  THR n 
7  295  ASP n 
7  296  GLU n 
7  297  ASN n 
7  298  LEU n 
7  299  ILE n 
7  300  LEU n 
7  301  SER n 
7  302  PRO n 
7  303  LEU n 
7  304  LEU n 
7  305  GLY n 
7  306  ASN n 
7  307  VAL n 
7  308  CYS n 
7  309  PHE n 
7  310  SER n 
7  311  SER n 
7  312  SER n 
7  313  GLN n 
7  314  TYR n 
7  315  SER n 
7  316  ILE n 
7  317  CYS n 
7  318  PHE n 
7  319  THR n 
7  320  LEU n 
7  321  GLY n 
7  322  SER n 
7  323  PHE n 
7  324  ALA n 
7  325  LYS n 
7  326  ILE n 
7  327  TYR n 
7  328  ALA n 
7  329  ASP n 
7  330  THR n 
7  331  PHE n 
7  332  GLY n 
7  333  ASP n 
7  334  ILE n 
7  335  ASN n 
7  336  TYR n 
7  337  GLN n 
7  338  GLU n 
7  339  PHE n 
7  340  ALA n 
7  341  LYS n 
7  342  ARG n 
7  343  LEU n 
7  344  TRP n 
7  345  GLY n 
7  346  ASP n 
7  347  ILE n 
7  348  TYR n 
7  349  PHE n 
7  350  ASN n 
7  351  PRO n 
7  352  LYS n 
7  353  THR n 
7  354  ARG n 
7  355  LYS n 
7  356  PHE n 
7  357  THR n 
7  358  LYS n 
7  359  LYS n 
7  360  ALA n 
7  361  PRO n 
7  362  THR n 
7  363  SER n 
7  364  SER n 
7  365  SER n 
7  366  GLN n 
7  367  ARG n 
7  368  SER n 
7  369  PHE n 
7  370  VAL n 
7  371  GLU n 
7  372  PHE n 
7  373  ILE n 
7  374  LEU n 
7  375  GLU n 
7  376  PRO n 
7  377  LEU n 
7  378  TYR n 
7  379  LYS n 
7  380  ILE n 
7  381  LEU n 
7  382  ALA n 
7  383  GLN n 
7  384  VAL n 
7  385  VAL n 
7  386  GLY n 
7  387  ASP n 
7  388  VAL n 
7  389  ASP n 
7  390  THR n 
7  391  SER n 
7  392  LEU n 
7  393  PRO n 
7  394  ARG n 
7  395  THR n 
7  396  LEU n 
7  397  ASP n 
7  398  GLU n 
7  399  LEU n 
7  400  GLY n 
7  401  ILE n 
7  402  HIS n 
7  403  LEU n 
7  404  THR n 
7  405  LYS n 
7  406  GLU n 
7  407  GLU n 
7  408  LEU n 
7  409  LYS n 
7  410  LEU n 
7  411  ASN n 
7  412  ILE n 
7  413  ARG n 
7  414  PRO n 
7  415  LEU n 
7  416  LEU n 
7  417  ARG n 
7  418  LEU n 
7  419  VAL n 
7  420  CYS n 
7  421  LYS n 
7  422  LYS n 
7  423  PHE n 
7  424  PHE n 
7  425  GLY n 
7  426  GLU n 
7  427  PHE n 
7  428  THR n 
7  429  GLY n 
7  430  PHE n 
7  431  VAL n 
7  432  ASP n 
7  433  MET n 
7  434  CYS n 
7  435  VAL n 
7  436  GLN n 
7  437  HIS n 
7  438  ILE n 
7  439  PRO n 
7  440  SER n 
7  441  PRO n 
7  442  LYS n 
7  443  VAL n 
7  444  GLY n 
7  445  ALA n 
7  446  LYS n 
7  447  PRO n 
7  448  LYS n 
7  449  ILE n 
7  450  GLU n 
7  451  HIS n 
7  452  THR n 
7  453  TYR n 
7  454  THR n 
7  455  GLY n 
7  456  GLY n 
7  457  VAL n 
7  458  ASP n 
7  459  SER n 
7  460  ASP n 
7  461  LEU n 
7  462  GLY n 
7  463  GLU n 
7  464  ALA n 
7  465  MET n 
7  466  SER n 
7  467  ASP n 
7  468  CYS n 
7  469  ASP n 
7  470  PRO n 
7  471  ASP n 
7  472  GLY n 
7  473  PRO n 
7  474  LEU n 
7  475  MET n 
7  476  CYS n 
7  477  HIS n 
7  478  THR n 
7  479  THR n 
7  480  LYS n 
7  481  MET n 
7  482  TYR n 
7  483  SER n 
7  484  THR n 
7  485  ASP n 
7  486  ASP n 
7  487  GLY n 
7  488  VAL n 
7  489  GLN n 
7  490  PHE n 
7  491  HIS n 
7  492  ALA n 
7  493  PHE n 
7  494  GLY n 
7  495  ARG n 
7  496  VAL n 
7  497  LEU n 
7  498  SER n 
7  499  GLY n 
7  500  THR n 
7  501  ILE n 
7  502  HIS n 
7  503  ALA n 
7  504  GLY n 
7  505  GLN n 
7  506  PRO n 
7  507  VAL n 
7  508  LYS n 
7  509  VAL n 
7  510  LEU n 
7  511  GLY n 
7  512  GLU n 
7  513  ASN n 
7  514  TYR n 
7  515  THR n 
7  516  LEU n 
7  517  GLU n 
7  518  ASP n 
7  519  GLU n 
7  520  GLU n 
7  521  ASP n 
7  522  SER n 
7  523  GLN n 
7  524  ILE n 
7  525  CYS n 
7  526  THR n 
7  527  VAL n 
7  528  GLY n 
7  529  ARG n 
7  530  LEU n 
7  531  TRP n 
7  532  ILE n 
7  533  SER n 
7  534  VAL n 
7  535  ALA n 
7  536  ARG n 
7  537  TYR n 
7  538  HIS n 
7  539  ILE n 
7  540  GLU n 
7  541  VAL n 
7  542  ASN n 
7  543  ARG n 
7  544  VAL n 
7  545  PRO n 
7  546  ALA n 
7  547  GLY n 
7  548  ASN n 
7  549  TRP n 
7  550  VAL n 
7  551  LEU n 
7  552  ILE n 
7  553  GLU n 
7  554  GLY n 
7  555  VAL n 
7  556  ASP n 
7  557  GLN n 
7  558  PRO n 
7  559  ILE n 
7  560  VAL n 
7  561  LYS n 
7  562  THR n 
7  563  ALA n 
7  564  THR n 
7  565  ILE n 
7  566  THR n 
7  567  GLU n 
7  568  PRO n 
7  569  ARG n 
7  570  GLY n 
7  571  ASN n 
7  572  GLU n 
7  573  GLU n 
7  574  ALA n 
7  575  GLN n 
7  576  ILE n 
7  577  PHE n 
7  578  ARG n 
7  579  PRO n 
7  580  LEU n 
7  581  LYS n 
7  582  PHE n 
7  583  ASN n 
7  584  THR n 
7  585  THR n 
7  586  SER n 
7  587  VAL n 
7  588  ILE n 
7  589  LYS n 
7  590  ILE n 
7  591  ALA n 
7  592  VAL n 
7  593  GLU n 
7  594  PRO n 
7  595  VAL n 
7  596  ASN n 
7  597  PRO n 
7  598  SER n 
7  599  GLU n 
7  600  LEU n 
7  601  PRO n 
7  602  LYS n 
7  603  MET n 
7  604  LEU n 
7  605  ASP n 
7  606  GLY n 
7  607  LEU n 
7  608  ARG n 
7  609  LYS n 
7  610  VAL n 
7  611  ASN n 
7  612  LYS n 
7  613  SER n 
7  614  TYR n 
7  615  PRO n 
7  616  SER n 
7  617  LEU n 
7  618  THR n 
7  619  THR n 
7  620  LYS n 
7  621  VAL n 
7  622  GLU n 
7  623  GLU n 
7  624  SER n 
7  625  GLY n 
7  626  GLU n 
7  627  HIS n 
7  628  VAL n 
7  629  ILE n 
7  630  LEU n 
7  631  GLY n 
7  632  THR n 
7  633  GLY n 
7  634  GLU n 
7  635  LEU n 
7  636  TYR n 
7  637  LEU n 
7  638  ASP n 
7  639  CYS n 
7  640  VAL n 
7  641  MET n 
7  642  HIS n 
7  643  ASP n 
7  644  LEU n 
7  645  ARG n 
7  646  LYS n 
7  647  MET n 
7  648  TYR n 
7  649  SER n 
7  650  GLU n 
7  651  ILE n 
7  652  ASP n 
7  653  ILE n 
7  654  LYS n 
7  655  VAL n 
7  656  ALA n 
7  657  ASP n 
7  658  PRO n 
7  659  VAL n 
7  660  VAL n 
7  661  THR n 
7  662  PHE n 
7  663  CYS n 
7  664  GLU n 
7  665  THR n 
7  666  VAL n 
7  667  VAL n 
7  668  GLU n 
7  669  THR n 
7  670  SER n 
7  671  SER n 
7  672  LEU n 
7  673  LYS n 
7  674  CYS n 
7  675  PHE n 
7  676  ALA n 
7  677  GLU n 
7  678  THR n 
7  679  PRO n 
7  680  ASN n 
7  681  LYS n 
7  682  LYS n 
7  683  ASN n 
7  684  LYS n 
7  685  ILE n 
7  686  THR n 
7  687  MET n 
7  688  ILE n 
7  689  ALA n 
7  690  GLU n 
7  691  PRO n 
7  692  LEU n 
7  693  GLU n 
7  694  LYS n 
7  695  GLY n 
7  696  LEU n 
7  697  ALA n 
7  698  GLU n 
7  699  ASP n 
7  700  ILE n 
7  701  GLU n 
7  702  ASN n 
7  703  GLU n 
7  704  VAL n 
7  705  VAL n 
7  706  GLN n 
7  707  ILE n 
7  708  THR n 
7  709  TRP n 
7  710  ASN n 
7  711  ARG n 
7  712  LYS n 
7  713  LYS n 
7  714  LEU n 
7  715  GLY n 
7  716  GLU n 
7  717  PHE n 
7  718  PHE n 
7  719  GLN n 
7  720  THR n 
7  721  LYS n 
7  722  TYR n 
7  723  ASP n 
7  724  TRP n 
7  725  ASP n 
7  726  LEU n 
7  727  LEU n 
7  728  ALA n 
7  729  ALA n 
7  730  ARG n 
7  731  SER n 
7  732  ILE n 
7  733  TRP n 
7  734  ALA n 
7  735  PHE n 
7  736  GLY n 
7  737  PRO n 
7  738  ASP n 
7  739  ALA n 
7  740  THR n 
7  741  GLY n 
7  742  PRO n 
7  743  ASN n 
7  744  ILE n 
7  745  LEU n 
7  746  VAL n 
7  747  ASP n 
7  748  ASP n 
7  749  THR n 
7  750  LEU n 
7  751  PRO n 
7  752  SER n 
7  753  GLU n 
7  754  VAL n 
7  755  ASP n 
7  756  LYS n 
7  757  ALA n 
7  758  LEU n 
7  759  LEU n 
7  760  GLY n 
7  761  SER n 
7  762  VAL n 
7  763  LYS n 
7  764  ASP n 
7  765  SER n 
7  766  ILE n 
7  767  VAL n 
7  768  GLN n 
7  769  GLY n 
7  770  PHE n 
7  771  GLN n 
7  772  TRP n 
7  773  GLY n 
7  774  THR n 
7  775  ARG n 
7  776  GLU n 
7  777  GLY n 
7  778  PRO n 
7  779  LEU n 
7  780  CYS n 
7  781  ASP n 
7  782  GLU n 
7  783  LEU n 
7  784  ILE n 
7  785  ARG n 
7  786  ASN n 
7  787  VAL n 
7  788  LYS n 
7  789  PHE n 
7  790  LYS n 
7  791  ILE n 
7  792  LEU n 
7  793  ASP n 
7  794  ALA n 
7  795  VAL n 
7  796  VAL n 
7  797  ALA n 
7  798  GLN n 
7  799  GLU n 
7  800  PRO n 
7  801  LEU n 
7  802  HIS n 
7  803  ARG n 
7  804  GLY n 
7  805  GLY n 
7  806  GLY n 
7  807  GLN n 
7  808  ILE n 
7  809  ILE n 
7  810  PRO n 
7  811  THR n 
7  812  ALA n 
7  813  ARG n 
7  814  ARG n 
7  815  VAL n 
7  816  VAL n 
7  817  TYR n 
7  818  SER n 
7  819  ALA n 
7  820  PHE n 
7  821  LEU n 
7  822  MET n 
7  823  ALA n 
7  824  THR n 
7  825  PRO n 
7  826  ARG n 
7  827  LEU n 
7  828  MET n 
7  829  GLU n 
7  830  PRO n 
7  831  TYR n 
7  832  TYR n 
7  833  PHE n 
7  834  VAL n 
7  835  GLU n 
7  836  VAL n 
7  837  GLN n 
7  838  ALA n 
7  839  PRO n 
7  840  ALA n 
7  841  ASP n 
7  842  CYS n 
7  843  VAL n 
7  844  SER n 
7  845  ALA n 
7  846  VAL n 
7  847  TYR n 
7  848  THR n 
7  849  VAL n 
7  850  LEU n 
7  851  ALA n 
7  852  ARG n 
7  853  ARG n 
7  854  ARG n 
7  855  GLY n 
7  856  HIS n 
7  857  VAL n 
7  858  THR n 
7  859  GLN n 
7  860  ASP n 
7  861  ALA n 
7  862  PRO n 
7  863  ILE n 
7  864  PRO n 
7  865  GLY n 
7  866  SER n 
7  867  PRO n 
7  868  LEU n 
7  869  TYR n 
7  870  THR n 
7  871  ILE n 
7  872  LYS n 
7  873  ALA n 
7  874  PHE n 
7  875  ILE n 
7  876  PRO n 
7  877  ALA n 
7  878  ILE n 
7  879  ASP n 
7  880  SER n 
7  881  PHE n 
7  882  GLY n 
7  883  PHE n 
7  884  GLU n 
7  885  THR n 
7  886  ASP n 
7  887  LEU n 
7  888  ARG n 
7  889  THR n 
7  890  HIS n 
7  891  THR n 
7  892  GLN n 
7  893  GLY n 
7  894  GLN n 
7  895  ALA n 
7  896  PHE n 
7  897  SER n 
7  898  LEU n 
7  899  SER n 
7  900  VAL n 
7  901  PHE n 
7  902  HIS n 
7  903  HIS n 
7  904  TRP n 
7  905  GLN n 
7  906  ILE n 
7  907  VAL n 
7  908  PRO n 
7  909  GLY n 
7  910  ASP n 
7  911  PRO n 
7  912  LEU n 
7  913  ASP n 
7  914  LYS n 
7  915  SER n 
7  916  ILE n 
7  917  VAL n 
7  918  ILE n 
7  919  ARG n 
7  920  PRO n 
7  921  LEU n 
7  922  GLU n 
7  923  PRO n 
7  924  GLN n 
7  925  PRO n 
7  926  ALA n 
7  927  PRO n 
7  928  HIS n 
7  929  LEU n 
7  930  ALA n 
7  931  ARG n 
7  932  GLU n 
7  933  PHE n 
7  934  MET n 
7  935  ILE n 
7  936  LYS n 
7  937  THR n 
7  938  ARG n 
7  939  ARG n 
7  940  ARG n 
7  941  LYS n 
7  942  GLY n 
7  943  LEU n 
7  944  SER n 
7  945  GLU n 
7  946  ASP n 
7  947  VAL n 
7  948  SER n 
7  949  ILE n 
7  950  SER n 
7  951  LYS n 
7  952  PHE n 
7  953  PHE n 
7  954  ASP n 
7  955  ASP n 
7  956  PRO n 
7  957  MET n 
7  958  LEU n 
7  959  LEU n 
7  960  GLU n 
7  961  LEU n 
7  962  ALA n 
7  963  LYS n 
7  964  GLN n 
7  965  ASP n 
7  966  VAL n 
7  967  VAL n 
7  968  LEU n 
7  969  ASN n 
7  970  TYR n 
7  971  PRO n 
7  972  MET n 
8  1    MET n 
8  2    THR n 
8  3    VAL n 
8  4    GLY n 
8  5    LYS n 
8  6    SER n 
8  7    SER n 
8  8    LYS n 
8  9    MET n 
8  10   LEU n 
8  11   GLN n 
8  12   HIS n 
8  13   ILE n 
8  14   ASP n 
8  15   TYR n 
8  16   ARG n 
8  17   MET n 
8  18   ARG n 
8  19   CYS n 
8  20   ILE n 
8  21   LEU n 
8  22   GLN n 
8  23   ASP n 
8  24   GLY n 
8  25   ARG n 
8  26   ILE n 
8  27   PHE n 
8  28   ILE n 
8  29   GLY n 
8  30   THR n 
8  31   PHE n 
8  32   LYS n 
8  33   ALA n 
8  34   PHE n 
8  35   ASP n 
8  36   LYS n 
8  37   HIS n 
8  38   MET n 
8  39   ASN n 
8  40   LEU n 
8  41   ILE n 
8  42   LEU n 
8  43   CYS n 
8  44   ASP n 
8  45   CYS n 
8  46   ASP n 
8  47   GLU n 
8  48   PHE n 
8  49   ARG n 
8  50   LYS n 
8  51   ILE n 
8  52   LYS n 
8  53   PRO n 
8  54   LYS n 
8  55   ASN n 
8  56   SER n 
8  57   LYS n 
8  58   GLN n 
8  59   ALA n 
8  60   GLU n 
8  61   ARG n 
8  62   GLU n 
8  63   GLU n 
8  64   LYS n 
8  65   ARG n 
8  66   VAL n 
8  67   LEU n 
8  68   GLY n 
8  69   LEU n 
8  70   VAL n 
8  71   LEU n 
8  72   LEU n 
8  73   ARG n 
8  74   GLY n 
8  75   GLU n 
8  76   ASN n 
8  77   LEU n 
8  78   VAL n 
8  79   SER n 
8  80   MET n 
8  81   THR n 
8  82   VAL n 
8  83   GLU n 
8  84   GLY n 
8  85   PRO n 
8  86   PRO n 
8  87   PRO n 
8  88   LYS n 
8  89   ASP n 
8  90   THR n 
8  91   GLY n 
8  92   ILE n 
8  93   ALA n 
8  94   ARG n 
8  95   VAL n 
8  96   PRO n 
8  97   LEU n 
8  98   ALA n 
8  99   GLY n 
8  100  ALA n 
8  101  ALA n 
8  102  GLY n 
8  103  GLY n 
8  104  PRO n 
8  105  GLY n 
8  106  ILE n 
8  107  GLY n 
8  108  ARG n 
8  109  ALA n 
8  110  ALA n 
8  111  GLY n 
8  112  ARG n 
8  113  GLY n 
8  114  ILE n 
8  115  PRO n 
8  116  ALA n 
8  117  GLY n 
8  118  VAL n 
8  119  PRO n 
8  120  MET n 
8  121  PRO n 
8  122  GLN n 
8  123  ALA n 
8  124  PRO n 
8  125  ALA n 
8  126  GLY n 
8  127  LEU n 
8  128  ALA n 
8  129  GLY n 
8  130  PRO n 
8  131  VAL n 
8  132  ARG n 
8  133  GLY n 
8  134  VAL n 
8  135  GLY n 
8  136  GLY n 
8  137  PRO n 
8  138  SER n 
8  139  GLN n 
8  140  GLN n 
8  141  VAL n 
8  142  MET n 
8  143  THR n 
8  144  PRO n 
8  145  GLN n 
8  146  GLY n 
8  147  ARG n 
8  148  GLY n 
8  149  THR n 
8  150  VAL n 
8  151  ALA n 
8  152  ALA n 
8  153  ALA n 
8  154  ALA n 
8  155  ALA n 
8  156  ALA n 
8  157  ALA n 
8  158  THR n 
8  159  ALA n 
8  160  SER n 
8  161  ILE n 
8  162  ALA n 
8  163  GLY n 
8  164  ALA n 
8  165  PRO n 
8  166  THR n 
8  167  GLN n 
8  168  TYR n 
8  169  PRO n 
8  170  PRO n 
8  171  GLY n 
8  172  ARG n 
8  173  GLY n 
8  174  GLY n 
8  175  PRO n 
8  176  PRO n 
8  177  PRO n 
8  178  PRO n 
8  179  MET n 
8  180  GLY n 
8  181  ARG n 
8  182  GLY n 
8  183  ALA n 
8  184  PRO n 
8  185  PRO n 
8  186  PRO n 
8  187  GLY n 
8  188  MET n 
8  189  MET n 
8  190  GLY n 
8  191  PRO n 
8  192  PRO n 
8  193  PRO n 
8  194  GLY n 
8  195  MET n 
8  196  ARG n 
8  197  PRO n 
8  198  PRO n 
8  199  MET n 
8  200  GLY n 
8  201  PRO n 
8  202  PRO n 
8  203  MET n 
8  204  GLY n 
8  205  ILE n 
8  206  PRO n 
8  207  PRO n 
8  208  GLY n 
8  209  ARG n 
8  210  GLY n 
8  211  THR n 
8  212  PRO n 
8  213  MET n 
8  214  GLY n 
8  215  MET n 
8  216  PRO n 
8  217  PRO n 
8  218  PRO n 
8  219  GLY n 
8  220  MET n 
8  221  ARG n 
8  222  PRO n 
8  223  PRO n 
8  224  PRO n 
8  225  PRO n 
8  226  GLY n 
8  227  MET n 
8  228  ARG n 
8  229  GLY n 
8  230  PRO n 
8  231  PRO n 
8  232  PRO n 
8  233  PRO n 
8  234  GLY n 
8  235  MET n 
8  236  ARG n 
8  237  PRO n 
8  238  PRO n 
8  239  ARG n 
8  240  PRO n 
9  1    MET n 
9  2    LYS n 
9  3    LEU n 
9  4    VAL n 
9  5    ARG n 
9  6    PHE n 
9  7    LEU n 
9  8    MET n 
9  9    LYS n 
9  10   LEU n 
9  11   SER n 
9  12   HIS n 
9  13   GLU n 
9  14   THR n 
9  15   VAL n 
9  16   THR n 
9  17   ILE n 
9  18   GLU n 
9  19   LEU n 
9  20   LYS n 
9  21   ASN n 
9  22   GLY n 
9  23   THR n 
9  24   GLN n 
9  25   VAL n 
9  26   HIS n 
9  27   GLY n 
9  28   THR n 
9  29   ILE n 
9  30   THR n 
9  31   GLY n 
9  32   VAL n 
9  33   ASP n 
9  34   VAL n 
9  35   SER n 
9  36   MET n 
9  37   ASN n 
9  38   THR n 
9  39   HIS n 
9  40   LEU n 
9  41   LYS n 
9  42   ALA n 
9  43   VAL n 
9  44   LYS n 
9  45   MET n 
9  46   THR n 
9  47   LEU n 
9  48   LYS n 
9  49   ASN n 
9  50   ARG n 
9  51   GLU n 
9  52   PRO n 
9  53   VAL n 
9  54   GLN n 
9  55   LEU n 
9  56   GLU n 
9  57   THR n 
9  58   LEU n 
9  59   SER n 
9  60   ILE n 
9  61   ARG n 
9  62   GLY n 
9  63   ASN n 
9  64   ASN n 
9  65   ILE n 
9  66   ARG n 
9  67   TYR n 
9  68   PHE n 
9  69   ILE n 
9  70   LEU n 
9  71   PRO n 
9  72   ASP n 
9  73   SER n 
9  74   LEU n 
9  75   PRO n 
9  76   LEU n 
9  77   ASP n 
9  78   THR n 
9  79   LEU n 
9  80   LEU n 
9  81   VAL n 
9  82   ASP n 
9  83   VAL n 
9  84   GLU n 
9  85   PRO n 
9  86   LYS n 
9  87   VAL n 
9  88   LYS n 
9  89   SER n 
9  90   LYS n 
9  91   LYS n 
9  92   ARG n 
9  93   GLU n 
9  94   ALA n 
9  95   VAL n 
9  96   ALA n 
9  97   GLY n 
9  98   ARG n 
9  99   GLY n 
9  100  ARG n 
9  101  GLY n 
9  102  ARG n 
9  103  GLY n 
9  104  ARG n 
9  105  GLY n 
9  106  ARG n 
9  107  GLY n 
9  108  ARG n 
9  109  GLY n 
9  110  ARG n 
9  111  GLY n 
9  112  ARG n 
9  113  GLY n 
9  114  ARG n 
9  115  GLY n 
9  116  GLY n 
9  117  PRO n 
9  118  ARG n 
9  119  ARG n 
10 1    MET n 
10 2    SER n 
10 3    LEU n 
10 4    LEU n 
10 5    ASN n 
10 6    LYS n 
10 7    PRO n 
10 8    LYS n 
10 9    SER n 
10 10   GLU n 
10 11   MET n 
10 12   THR n 
10 13   PRO n 
10 14   GLU n 
10 15   GLU n 
10 16   LEU n 
10 17   GLN n 
10 18   LYS n 
10 19   ARG n 
10 20   GLU n 
10 21   GLU n 
10 22   GLU n 
10 23   GLU n 
10 24   PHE n 
10 25   ASN n 
10 26   THR n 
10 27   GLY n 
10 28   PRO n 
10 29   LEU n 
10 30   SER n 
10 31   VAL n 
10 32   LEU n 
10 33   THR n 
10 34   GLN n 
10 35   SER n 
10 36   VAL n 
10 37   LYS n 
10 38   ASN n 
10 39   ASN n 
10 40   THR n 
10 41   GLN n 
10 42   VAL n 
10 43   LEU n 
10 44   ILE n 
10 45   ASN n 
10 46   CYS n 
10 47   ARG n 
10 48   ASN n 
10 49   ASN n 
10 50   LYS n 
10 51   LYS n 
10 52   LEU n 
10 53   LEU n 
10 54   GLY n 
10 55   ARG n 
10 56   VAL n 
10 57   LYS n 
10 58   ALA n 
10 59   PHE n 
10 60   ASP n 
10 61   ARG n 
10 62   HIS n 
10 63   CYS n 
10 64   ASN n 
10 65   MET n 
10 66   VAL n 
10 67   LEU n 
10 68   GLU n 
10 69   ASN n 
10 70   VAL n 
10 71   LYS n 
10 72   GLU n 
10 73   MET n 
10 74   TRP n 
10 75   THR n 
10 76   GLU n 
10 77   VAL n 
10 78   PRO n 
10 79   LYS n 
10 80   SER n 
10 81   GLY n 
10 82   LYS n 
10 83   GLY n 
10 84   LYS n 
10 85   LYS n 
10 86   LYS n 
10 87   SER n 
10 88   LYS n 
10 89   PRO n 
10 90   VAL n 
10 91   ASN n 
10 92   LYS n 
10 93   ASP n 
10 94   ARG n 
10 95   TYR n 
10 96   ILE n 
10 97   SER n 
10 98   LYS n 
10 99   MET n 
10 100  PHE n 
10 101  LEU n 
10 102  ARG n 
10 103  GLY n 
10 104  ASP n 
10 105  SER n 
10 106  VAL n 
10 107  ILE n 
10 108  VAL n 
10 109  VAL n 
10 110  LEU n 
10 111  ARG n 
10 112  ASN n 
10 113  PRO n 
10 114  LEU n 
10 115  ILE n 
10 116  ALA n 
10 117  GLY n 
10 118  LYS n 
11 1    MET n 
11 2    SER n 
11 3    ILE n 
11 4    GLY n 
11 5    VAL n 
11 6    PRO n 
11 7    ILE n 
11 8    LYS n 
11 9    VAL n 
11 10   LEU n 
11 11   HIS n 
11 12   GLU n 
11 13   ALA n 
11 14   GLU n 
11 15   GLY n 
11 16   HIS n 
11 17   ILE n 
11 18   VAL n 
11 19   THR n 
11 20   CYS n 
11 21   GLU n 
11 22   THR n 
11 23   ASN n 
11 24   THR n 
11 25   GLY n 
11 26   GLU n 
11 27   VAL n 
11 28   TYR n 
11 29   ARG n 
11 30   GLY n 
11 31   LYS n 
11 32   LEU n 
11 33   ILE n 
11 34   GLU n 
11 35   ALA n 
11 36   GLU n 
11 37   ASP n 
11 38   ASN n 
11 39   MET n 
11 40   ASN n 
11 41   CYS n 
11 42   GLN n 
11 43   MET n 
11 44   SER n 
11 45   ASN n 
11 46   ILE n 
11 47   THR n 
11 48   VAL n 
11 49   THR n 
11 50   TYR n 
11 51   ARG n 
11 52   ASP n 
11 53   GLY n 
11 54   ARG n 
11 55   VAL n 
11 56   ALA n 
11 57   GLN n 
11 58   LEU n 
11 59   GLU n 
11 60   GLN n 
11 61   VAL n 
11 62   TYR n 
11 63   ILE n 
11 64   ARG n 
11 65   GLY n 
11 66   SER n 
11 67   LYS n 
11 68   ILE n 
11 69   ARG n 
11 70   PHE n 
11 71   LEU n 
11 72   ILE n 
11 73   LEU n 
11 74   PRO n 
11 75   ASP n 
11 76   MET n 
11 77   LEU n 
11 78   LYS n 
11 79   ASN n 
11 80   ALA n 
11 81   PRO n 
11 82   MET n 
11 83   LEU n 
11 84   LYS n 
11 85   SER n 
11 86   MET n 
11 87   LYS n 
11 88   ASN n 
11 89   LYS n 
11 90   ASN n 
11 91   GLN n 
11 92   GLY n 
11 93   SER n 
11 94   GLY n 
11 95   ALA n 
11 96   GLY n 
11 97   ARG n 
11 98   GLY n 
11 99   LYS n 
11 100  ALA n 
11 101  ALA n 
11 102  ILE n 
11 103  LEU n 
11 104  LYS n 
11 105  ALA n 
11 106  GLN n 
11 107  VAL n 
11 108  ALA n 
11 109  ALA n 
11 110  ARG n 
11 111  GLY n 
11 112  ARG n 
11 113  GLY n 
11 114  ARG n 
11 115  GLY n 
11 116  MET n 
11 117  GLY n 
11 118  ARG n 
11 119  GLY n 
11 120  ASN n 
11 121  ILE n 
11 122  PHE n 
11 123  GLN n 
11 124  LYS n 
11 125  ARG n 
11 126  ARG n 
12 1    MET n 
12 2    ALA n 
12 3    TYR n 
12 4    ARG n 
12 5    GLY n 
12 6    GLN n 
12 7    GLY n 
12 8    GLN n 
12 9    LYS n 
12 10   VAL n 
12 11   GLN n 
12 12   LYS n 
12 13   VAL n 
12 14   MET n 
12 15   VAL n 
12 16   GLN n 
12 17   PRO n 
12 18   ILE n 
12 19   ASN n 
12 20   LEU n 
12 21   ILE n 
12 22   PHE n 
12 23   ARG n 
12 24   TYR n 
12 25   LEU n 
12 26   GLN n 
12 27   ASN n 
12 28   ARG n 
12 29   SER n 
12 30   ARG n 
12 31   ILE n 
12 32   GLN n 
12 33   VAL n 
12 34   TRP n 
12 35   LEU n 
12 36   TYR n 
12 37   GLU n 
12 38   GLN n 
12 39   VAL n 
12 40   ASN n 
12 41   MET n 
12 42   ARG n 
12 43   ILE n 
12 44   GLU n 
12 45   GLY n 
12 46   CYS n 
12 47   ILE n 
12 48   ILE n 
12 49   GLY n 
12 50   PHE n 
12 51   ASP n 
12 52   GLU n 
12 53   TYR n 
12 54   MET n 
12 55   ASN n 
12 56   LEU n 
12 57   VAL n 
12 58   LEU n 
12 59   ASP n 
12 60   ASP n 
12 61   ALA n 
12 62   GLU n 
12 63   GLU n 
12 64   ILE n 
12 65   HIS n 
12 66   SER n 
12 67   LYS n 
12 68   THR n 
12 69   LYS n 
12 70   SER n 
12 71   ARG n 
12 72   LYS n 
12 73   GLN n 
12 74   LEU n 
12 75   GLY n 
12 76   ARG n 
12 77   ILE n 
12 78   MET n 
12 79   LEU n 
12 80   LYS n 
12 81   GLY n 
12 82   ASP n 
12 83   ASN n 
12 84   ILE n 
12 85   THR n 
12 86   LEU n 
12 87   LEU n 
12 88   GLN n 
12 89   SER n 
12 90   VAL n 
12 91   SER n 
12 92   ASN n 
13 1    MET n 
13 2    SER n 
13 3    LEU n 
13 4    PRO n 
13 5    LEU n 
13 6    ASN n 
13 7    PRO n 
13 8    LYS n 
13 9    PRO n 
13 10   PHE n 
13 11   LEU n 
13 12   ASN n 
13 13   GLY n 
13 14   LEU n 
13 15   THR n 
13 16   GLY n 
13 17   LYS n 
13 18   PRO n 
13 19   VAL n 
13 20   MET n 
13 21   VAL n 
13 22   LYS n 
13 23   LEU n 
13 24   LYS n 
13 25   TRP n 
13 26   GLY n 
13 27   MET n 
13 28   GLU n 
13 29   TYR n 
13 30   LYS n 
13 31   GLY n 
13 32   TYR n 
13 33   LEU n 
13 34   VAL n 
13 35   SER n 
13 36   VAL n 
13 37   ASP n 
13 38   GLY n 
13 39   TYR n 
13 40   MET n 
13 41   ASN n 
13 42   MET n 
13 43   GLN n 
13 44   LEU n 
13 45   ALA n 
13 46   ASN n 
13 47   THR n 
13 48   GLU n 
13 49   GLU n 
13 50   TYR n 
13 51   ILE n 
13 52   ASP n 
13 53   GLY n 
13 54   ALA n 
13 55   LEU n 
13 56   SER n 
13 57   GLY n 
13 58   HIS n 
13 59   LEU n 
13 60   GLY n 
13 61   GLU n 
13 62   VAL n 
13 63   LEU n 
13 64   ILE n 
13 65   ARG n 
13 66   CYS n 
13 67   ASN n 
13 68   ASN n 
13 69   VAL n 
13 70   LEU n 
13 71   TYR n 
13 72   ILE n 
13 73   ARG n 
13 74   GLY n 
13 75   VAL n 
13 76   GLU n 
13 77   GLU n 
13 78   GLU n 
13 79   GLU n 
13 80   GLU n 
13 81   ASP n 
13 82   GLY n 
13 83   GLU n 
13 84   MET n 
13 85   ARG n 
13 86   GLU n 
14 1    MET n 
14 2    SER n 
14 3    LYS n 
14 4    ALA n 
14 5    HIS n 
14 6    PRO n 
14 7    PRO n 
14 8    GLU n 
14 9    LEU n 
14 10   LYS n 
14 11   LYS n 
14 12   PHE n 
14 13   MET n 
14 14   ASP n 
14 15   LYS n 
14 16   LYS n 
14 17   LEU n 
14 18   SER n 
14 19   LEU n 
14 20   LYS n 
14 21   LEU n 
14 22   ASN n 
14 23   GLY n 
14 24   GLY n 
14 25   ARG n 
14 26   HIS n 
14 27   VAL n 
14 28   GLN n 
14 29   GLY n 
14 30   ILE n 
14 31   LEU n 
14 32   ARG n 
14 33   GLY n 
14 34   PHE n 
14 35   ASP n 
14 36   PRO n 
14 37   PHE n 
14 38   MET n 
14 39   ASN n 
14 40   LEU n 
14 41   VAL n 
14 42   ILE n 
14 43   ASP n 
14 44   GLU n 
14 45   CYS n 
14 46   VAL n 
14 47   GLU n 
14 48   MET n 
14 49   ALA n 
14 50   THR n 
14 51   SER n 
14 52   GLY n 
14 53   GLN n 
14 54   GLN n 
14 55   ASN n 
14 56   ASN n 
14 57   ILE n 
14 58   GLY n 
14 59   MET n 
14 60   VAL n 
14 61   VAL n 
14 62   ILE n 
14 63   ARG n 
14 64   GLY n 
14 65   ASN n 
14 66   SER n 
14 67   ILE n 
14 68   ILE n 
14 69   MET n 
14 70   LEU n 
14 71   GLU n 
14 72   ALA n 
14 73   LEU n 
14 74   GLU n 
14 75   ARG n 
14 76   VAL n 
15 1    MET n 
15 2    THR n 
15 3    SER n 
15 4    ALA n 
15 5    LEU n 
15 6    GLU n 
15 7    ASN n 
15 8    TYR n 
15 9    ILE n 
15 10   ASN n 
15 11   ARG n 
15 12   THR n 
15 13   VAL n 
15 14   ALA n 
15 15   VAL n 
15 16   ILE n 
15 17   THR n 
15 18   SER n 
15 19   ASP n 
15 20   GLY n 
15 21   ARG n 
15 22   MET n 
15 23   ILE n 
15 24   VAL n 
15 25   GLY n 
15 26   THR n 
15 27   LEU n 
15 28   LYS n 
15 29   GLY n 
15 30   PHE n 
15 31   ASP n 
15 32   GLN n 
15 33   THR n 
15 34   ILE n 
15 35   ASN n 
15 36   LEU n 
15 37   ILE n 
15 38   LEU n 
15 39   ASP n 
15 40   GLU n 
15 41   SER n 
15 42   HIS n 
15 43   GLU n 
15 44   ARG n 
15 45   VAL n 
15 46   PHE n 
15 47   SER n 
15 48   SER n 
15 49   SER n 
15 50   GLN n 
15 51   GLY n 
15 52   VAL n 
15 53   GLU n 
15 54   GLN n 
15 55   VAL n 
15 56   VAL n 
15 57   LEU n 
15 58   GLY n 
15 59   LEU n 
15 60   TYR n 
15 61   ILE n 
15 62   VAL n 
15 63   ARG n 
15 64   GLY n 
15 65   ASP n 
15 66   ASN n 
15 67   VAL n 
15 68   ALA n 
15 69   VAL n 
15 70   ILE n 
15 71   GLY n 
15 72   GLU n 
15 73   ILE n 
15 74   ASP n 
15 75   GLU n 
15 76   GLU n 
15 77   THR n 
15 78   ASP n 
15 79   SER n 
15 80   ALA n 
15 81   LEU n 
15 82   ASP n 
15 83   LEU n 
15 84   GLY n 
15 85   ASN n 
15 86   ILE n 
15 87   ARG n 
15 88   ALA n 
15 89   GLU n 
15 90   PRO n 
15 91   LEU n 
15 92   ASN n 
15 93   SER n 
15 94   VAL n 
15 95   ALA n 
15 96   HIS n 
16 1    MET n 
16 2    SER n 
16 3    LEU n 
16 4    ARG n 
16 5    LYS n 
16 6    GLN n 
16 7    THR n 
16 8    PRO n 
16 9    SER n 
16 10   ASP n 
16 11   PHE n 
16 12   LEU n 
16 13   LYS n 
16 14   GLN n 
16 15   ILE n 
16 16   ILE n 
16 17   GLY n 
16 18   ARG n 
16 19   PRO n 
16 20   VAL n 
16 21   VAL n 
16 22   VAL n 
16 23   LYS n 
16 24   LEU n 
16 25   ASN n 
16 26   SER n 
16 27   GLY n 
16 28   VAL n 
16 29   ASP n 
16 30   TYR n 
16 31   ARG n 
16 32   GLY n 
16 33   VAL n 
16 34   LEU n 
16 35   ALA n 
16 36   CYS n 
16 37   LEU n 
16 38   ASP n 
16 39   GLY n 
16 40   TYR n 
16 41   MET n 
16 42   ASN n 
16 43   ILE n 
16 44   ALA n 
16 45   LEU n 
16 46   GLU n 
16 47   GLN n 
16 48   THR n 
16 49   GLU n 
16 50   GLU n 
16 51   TYR n 
16 52   VAL n 
16 53   ASN n 
16 54   GLY n 
16 55   GLN n 
16 56   LEU n 
16 57   LYS n 
16 58   ASN n 
16 59   LYS n 
16 60   TYR n 
16 61   GLY n 
16 62   ASP n 
16 63   ALA n 
16 64   PHE n 
16 65   ILE n 
16 66   ARG n 
16 67   GLY n 
16 68   ASN n 
16 69   ASN n 
16 70   VAL n 
16 71   LEU n 
16 72   TYR n 
16 73   ILE n 
16 74   SER n 
16 75   THR n 
16 76   GLN n 
16 77   LYS n 
16 78   ARG n 
16 79   ARG n 
16 80   MET n 
17 1    MET n 
17 2    ALA n 
17 3    ALA n 
17 4    ASN n 
17 5    ALA n 
17 6    THR n 
17 7    THR n 
17 8    ASN n 
17 9    PRO n 
17 10   SER n 
17 11   GLN n 
17 12   LEU n 
17 13   LEU n 
17 14   PRO n 
17 15   LEU n 
17 16   GLU n 
17 17   LEU n 
17 18   VAL n 
17 19   ASP n 
17 20   LYS n 
17 21   CYS n 
17 22   ILE n 
17 23   GLY n 
17 24   SER n 
17 25   ARG n 
17 26   ILE n 
17 27   HIS n 
17 28   ILE n 
17 29   VAL n 
17 30   MET n 
17 31   LYS n 
17 32   SER n 
17 33   ASP n 
17 34   LYS n 
17 35   GLU n 
17 36   ILE n 
17 37   VAL n 
17 38   GLY n 
17 39   THR n 
17 40   LEU n 
17 41   LEU n 
17 42   GLY n 
17 43   PHE n 
17 44   ASP n 
17 45   ASP n 
17 46   PHE n 
17 47   VAL n 
17 48   ASN n 
17 49   MET n 
17 50   VAL n 
17 51   LEU n 
17 52   GLU n 
17 53   ASP n 
17 54   VAL n 
17 55   THR n 
17 56   GLU n 
17 57   PHE n 
17 58   GLU n 
17 59   ILE n 
17 60   THR n 
17 61   PRO n 
17 62   GLU n 
17 63   GLY n 
17 64   ARG n 
17 65   ARG n 
17 66   ILE n 
17 67   THR n 
17 68   LYS n 
17 69   LEU n 
17 70   ASP n 
17 71   GLN n 
17 72   ILE n 
17 73   LEU n 
17 74   LEU n 
17 75   ASN n 
17 76   GLY n 
17 77   ASN n 
17 78   ASN n 
17 79   ILE n 
17 80   THR n 
17 81   MET n 
17 82   LEU n 
17 83   VAL n 
17 84   PRO n 
17 85   GLY n 
17 86   GLY n 
17 87   GLU n 
17 88   GLY n 
17 89   PRO n 
17 90   GLU n 
17 91   VAL n 
18 1    MET n 
18 2    LEU n 
18 3    PRO n 
18 4    LEU n 
18 5    SER n 
18 6    LEU n 
18 7    LEU n 
18 8    LYS n 
18 9    THR n 
18 10   ALA n 
18 11   GLN n 
18 12   ASN n 
18 13   HIS n 
18 14   PRO n 
18 15   MET n 
18 16   LEU n 
18 17   VAL n 
18 18   GLU n 
18 19   LEU n 
18 20   LYS n 
18 21   ASN n 
18 22   GLY n 
18 23   GLU n 
18 24   THR n 
18 25   TYR n 
18 26   ASN n 
18 27   GLY n 
18 28   HIS n 
18 29   LEU n 
18 30   VAL n 
18 31   SER n 
18 32   CYS n 
18 33   ASP n 
18 34   ASN n 
18 35   TRP n 
18 36   MET n 
18 37   ASN n 
18 38   ILE n 
18 39   ASN n 
18 40   LEU n 
18 41   ARG n 
18 42   GLU n 
18 43   VAL n 
18 44   ILE n 
18 45   CYS n 
18 46   THR n 
18 47   SER n 
18 48   ARG n 
18 49   ASP n 
18 50   GLY n 
18 51   ASP n 
18 52   LYS n 
18 53   PHE n 
18 54   TRP n 
18 55   ARG n 
18 56   MET n 
18 57   PRO n 
18 58   GLU n 
18 59   CYS n 
18 60   TYR n 
18 61   ILE n 
18 62   ARG n 
18 63   GLY n 
18 64   SER n 
18 65   THR n 
18 66   ILE n 
18 67   LYS n 
18 68   TYR n 
18 69   LEU n 
18 70   ARG n 
18 71   ILE n 
18 72   PRO n 
18 73   ASP n 
18 74   GLU n 
18 75   ILE n 
18 76   ILE n 
18 77   ASP n 
18 78   MET n 
18 79   VAL n 
18 80   LYS n 
18 81   GLU n 
18 82   GLU n 
18 83   VAL n 
18 84   VAL n 
18 85   ALA n 
18 86   LYS n 
18 87   GLY n 
18 88   ARG n 
18 89   GLY n 
18 90   ARG n 
18 91   GLY n 
18 92   GLY n 
18 93   LEU n 
18 94   GLN n 
18 95   GLN n 
18 96   GLN n 
18 97   LYS n 
18 98   GLN n 
18 99   GLN n 
18 100  LYS n 
18 101  GLY n 
18 102  ARG n 
18 103  GLY n 
18 104  MET n 
18 105  GLY n 
18 106  GLY n 
18 107  ALA n 
18 108  GLY n 
18 109  ARG n 
18 110  GLY n 
18 111  VAL n 
18 112  PHE n 
18 113  GLY n 
18 114  GLY n 
18 115  ARG n 
18 116  GLY n 
18 117  ARG n 
18 118  GLY n 
18 119  GLY n 
18 120  ILE n 
18 121  PRO n 
18 122  GLY n 
18 123  THR n 
18 124  GLY n 
18 125  ARG n 
18 126  GLY n 
18 127  GLN n 
18 128  PRO n 
18 129  GLU n 
18 130  LYS n 
18 131  LYS n 
18 132  PRO n 
18 133  GLY n 
18 134  ARG n 
18 135  GLN n 
18 136  ALA n 
18 137  GLY n 
18 138  LYS n 
18 139  GLN n 
19 1    MET n 
19 2    ALA n 
19 3    ASP n 
19 4    ASP n 
19 5    VAL n 
19 6    ASP n 
19 7    GLN n 
19 8    GLN n 
19 9    GLN n 
19 10   THR n 
19 11   THR n 
19 12   ASN n 
19 13   THR n 
19 14   VAL n 
19 15   GLU n 
19 16   GLU n 
19 17   PRO n 
19 18   LEU n 
19 19   ASP n 
19 20   LEU n 
19 21   ILE n 
19 22   ARG n 
19 23   LEU n 
19 24   SER n 
19 25   LEU n 
19 26   ASP n 
19 27   GLU n 
19 28   ARG n 
19 29   ILE n 
19 30   TYR n 
19 31   VAL n 
19 32   LYS n 
19 33   MET n 
19 34   ARG n 
19 35   ASN n 
19 36   ASP n 
19 37   ARG n 
19 38   GLU n 
19 39   LEU n 
19 40   ARG n 
19 41   GLY n 
19 42   ARG n 
19 43   LEU n 
19 44   HIS n 
19 45   ALA n 
19 46   TYR n 
19 47   ASP n 
19 48   GLN n 
19 49   HIS n 
19 50   LEU n 
19 51   ASN n 
19 52   MET n 
19 53   ILE n 
19 54   LEU n 
19 55   GLY n 
19 56   ASP n 
19 57   VAL n 
19 58   GLU n 
19 59   GLU n 
19 60   THR n 
19 61   VAL n 
19 62   THR n 
19 63   THR n 
19 64   ILE n 
19 65   GLU n 
19 66   ILE n 
19 67   ASP n 
19 68   GLU n 
19 69   GLU n 
19 70   THR n 
19 71   TYR n 
19 72   GLU n 
19 73   GLU n 
19 74   ILE n 
19 75   TYR n 
19 76   LYS n 
19 77   SER n 
19 78   THR n 
19 79   LYS n 
19 80   ARG n 
19 81   ASN n 
19 82   ILE n 
19 83   PRO n 
19 84   MET n 
19 85   LEU n 
19 86   PHE n 
19 87   VAL n 
19 88   ARG n 
19 89   GLY n 
19 90   ASP n 
19 91   GLY n 
19 92   VAL n 
19 93   VAL n 
19 94   LEU n 
19 95   VAL n 
19 96   ALA n 
19 97   PRO n 
19 98   PRO n 
19 99   LEU n 
19 100  ARG n 
19 101  VAL n 
19 102  GLY n 
20 1    MET n 
20 2    LEU n 
20 3    PHE n 
20 4    TYR n 
20 5    SER n 
20 6    PHE n 
20 7    PHE n 
20 8    LYS n 
20 9    SER n 
20 10   LEU n 
20 11   VAL n 
20 12   GLY n 
20 13   LYS n 
20 14   ASP n 
20 15   VAL n 
20 16   VAL n 
20 17   VAL n 
20 18   GLU n 
20 19   LEU n 
20 20   LYS n 
20 21   ASN n 
20 22   ASP n 
20 23   LEU n 
20 24   SER n 
20 25   ILE n 
20 26   CYS n 
20 27   GLY n 
20 28   THR n 
20 29   LEU n 
20 30   HIS n 
20 31   SER n 
20 32   VAL n 
20 33   ASP n 
20 34   GLN n 
20 35   TYR n 
20 36   LEU n 
20 37   ASN n 
20 38   ILE n 
20 39   LYS n 
20 40   LEU n 
20 41   THR n 
20 42   ASP n 
20 43   ILE n 
20 44   SER n 
20 45   VAL n 
20 46   THR n 
20 47   ASP n 
20 48   PRO n 
20 49   GLU n 
20 50   LYS n 
20 51   TYR n 
20 52   PRO n 
20 53   HIS n 
20 54   MET n 
20 55   LEU n 
20 56   SER n 
20 57   VAL n 
20 58   LYS n 
20 59   ASN n 
20 60   CYS n 
20 61   PHE n 
20 62   ILE n 
20 63   ARG n 
20 64   GLY n 
20 65   SER n 
20 66   VAL n 
20 67   VAL n 
20 68   ARG n 
20 69   TYR n 
20 70   VAL n 
20 71   GLN n 
20 72   LEU n 
20 73   PRO n 
20 74   ALA n 
20 75   ASP n 
20 76   GLU n 
20 77   VAL n 
20 78   ASP n 
20 79   THR n 
20 80   GLN n 
20 81   LEU n 
20 82   LEU n 
20 83   GLN n 
20 84   ASP n 
20 85   ALA n 
20 86   ALA n 
20 87   ARG n 
20 88   LYS n 
20 89   GLU n 
20 90   ALA n 
20 91   LEU n 
20 92   GLN n 
20 93   GLN n 
20 94   LYS n 
20 95   GLN n 
21 1    MET n 
21 2    ALA n 
21 3    ASP n 
21 4    LYS n 
21 5    GLU n 
21 6    LYS n 
21 7    LYS n 
21 8    LYS n 
21 9    LYS n 
21 10   GLU n 
21 11   SER n 
21 12   ILE n 
21 13   LEU n 
21 14   ASP n 
21 15   LEU n 
21 16   SER n 
21 17   LYS n 
21 18   TYR n 
21 19   ILE n 
21 20   ASP n 
21 21   LYS n 
21 22   THR n 
21 23   ILE n 
21 24   ARG n 
21 25   VAL n 
21 26   LYS n 
21 27   PHE n 
21 28   GLN n 
21 29   GLY n 
21 30   GLY n 
21 31   ARG n 
21 32   GLU n 
21 33   ALA n 
21 34   SER n 
21 35   GLY n 
21 36   ILE n 
21 37   LEU n 
21 38   LYS n 
21 39   GLY n 
21 40   PHE n 
21 41   ASP n 
21 42   PRO n 
21 43   LEU n 
21 44   LEU n 
21 45   ASN n 
21 46   LEU n 
21 47   VAL n 
21 48   LEU n 
21 49   ASP n 
21 50   GLY n 
21 51   THR n 
21 52   ILE n 
21 53   GLU n 
21 54   TYR n 
21 55   MET n 
21 56   ARG n 
21 57   ASP n 
21 58   PRO n 
21 59   ASP n 
21 60   ASP n 
21 61   GLN n 
21 62   TYR n 
21 63   LYS n 
21 64   LEU n 
21 65   THR n 
21 66   GLU n 
21 67   ASP n 
21 68   THR n 
21 69   ARG n 
21 70   GLN n 
21 71   LEU n 
21 72   GLY n 
21 73   LEU n 
21 74   VAL n 
21 75   VAL n 
21 76   CYS n 
21 77   ARG n 
21 78   GLY n 
21 79   THR n 
21 80   SER n 
21 81   VAL n 
21 82   VAL n 
21 83   LEU n 
21 84   ILE n 
21 85   CYS n 
21 86   PRO n 
21 87   GLN n 
21 88   ASP n 
21 89   GLY n 
21 90   MET n 
21 91   GLU n 
21 92   ALA n 
21 93   ILE n 
21 94   PRO n 
21 95   ASN n 
21 96   PRO n 
21 97   PHE n 
21 98   ILE n 
21 99   GLN n 
21 100  GLN n 
21 101  GLN n 
21 102  ASP n 
21 103  ALA n 
22 1    MET n 
22 2    ALA n 
22 3    LEU n 
22 4    SER n 
22 5    LYS n 
22 6    ARG n 
22 7    GLU n 
22 8    LEU n 
22 9    ASP n 
22 10   GLU n 
22 11   LEU n 
22 12   LYS n 
22 13   PRO n 
22 14   TRP n 
22 15   ILE n 
22 16   GLU n 
22 17   LYS n 
22 18   THR n 
22 19   VAL n 
22 20   LYS n 
22 21   ARG n 
22 22   VAL n 
22 23   LEU n 
22 24   GLY n 
22 25   PHE n 
22 26   SER n 
22 27   GLU n 
22 28   PRO n 
22 29   THR n 
22 30   VAL n 
22 31   VAL n 
22 32   THR n 
22 33   ALA n 
22 34   ALA n 
22 35   LEU n 
22 36   ASN n 
22 37   CYS n 
22 38   VAL n 
22 39   GLY n 
22 40   LYS n 
22 41   GLY n 
22 42   MET n 
22 43   ASP n 
22 44   LYS n 
22 45   LYS n 
22 46   LYS n 
22 47   ALA n 
22 48   ALA n 
22 49   ASP n 
22 50   HIS n 
22 51   LEU n 
22 52   LYS n 
22 53   PRO n 
22 54   PHE n 
22 55   LEU n 
22 56   ASP n 
22 57   ASP n 
22 58   SER n 
22 59   THR n 
22 60   LEU n 
22 61   ARG n 
22 62   PHE n 
22 63   VAL n 
22 64   ASP n 
22 65   LYS n 
22 66   LEU n 
22 67   PHE n 
22 68   GLU n 
22 69   ALA n 
22 70   VAL n 
22 71   GLU n 
22 72   GLU n 
22 73   GLY n 
22 74   ARG n 
22 75   SER n 
22 76   SER n 
22 77   ARG n 
22 78   HIS n 
22 79   SER n 
22 80   LYS n 
22 81   SER n 
22 82   SER n 
22 83   SER n 
22 84   ASP n 
22 85   ARG n 
22 86   SER n 
22 87   ARG n 
22 88   LYS n 
22 89   ARG n 
22 90   GLU n 
22 91   LEU n 
22 92   LYS n 
22 93   GLU n 
22 94   VAL n 
22 95   PHE n 
22 96   GLY n 
22 97   ASP n 
22 98   ASP n 
22 99   SER n 
22 100  GLU n 
22 101  ILE n 
22 102  SER n 
22 103  LYS n 
22 104  GLU n 
22 105  SER n 
22 106  SER n 
22 107  GLY n 
22 108  VAL n 
22 109  LYS n 
22 110  LYS n 
22 111  ARG n 
22 112  ARG n 
22 113  ILE n 
22 114  PRO n 
22 115  ARG n 
22 116  PHE n 
22 117  GLU n 
22 118  GLU n 
22 119  VAL n 
22 120  GLU n 
22 121  GLU n 
22 122  GLU n 
22 123  PRO n 
22 124  GLU n 
22 125  VAL n 
22 126  ILE n 
22 127  PRO n 
22 128  GLY n 
22 129  PRO n 
22 130  PRO n 
22 131  SER n 
22 132  GLU n 
22 133  SER n 
22 134  PRO n 
22 135  GLY n 
22 136  MET n 
22 137  LEU n 
22 138  THR n 
22 139  LYS n 
22 140  LEU n 
22 141  GLN n 
22 142  ILE n 
22 143  LYS n 
22 144  GLN n 
22 145  MET n 
22 146  MET n 
22 147  GLU n 
22 148  ALA n 
22 149  ALA n 
22 150  THR n 
22 151  ARG n 
22 152  GLN n 
22 153  ILE n 
22 154  GLU n 
22 155  GLU n 
22 156  ARG n 
22 157  LYS n 
22 158  LYS n 
22 159  GLN n 
22 160  LEU n 
22 161  SER n 
22 162  PHE n 
22 163  ILE n 
22 164  SER n 
22 165  PRO n 
22 166  PRO n 
22 167  THR n 
22 168  PRO n 
22 169  GLN n 
22 170  PRO n 
22 171  LYS n 
22 172  THR n 
22 173  PRO n 
22 174  SER n 
22 175  SER n 
22 176  SER n 
22 177  GLN n 
22 178  PRO n 
22 179  GLU n 
22 180  ARG n 
22 181  LEU n 
22 182  PRO n 
22 183  ILE n 
22 184  GLY n 
22 185  ASN n 
22 186  THR n 
22 187  ILE n 
22 188  GLN n 
22 189  PRO n 
22 190  SER n 
22 191  GLN n 
22 192  ALA n 
22 193  ALA n 
22 194  THR n 
22 195  PHE n 
22 196  MET n 
22 197  ASN n 
22 198  ASP n 
22 199  ALA n 
22 200  ILE n 
22 201  GLU n 
22 202  LYS n 
22 203  ALA n 
22 204  ARG n 
22 205  LYS n 
22 206  ALA n 
22 207  ALA n 
22 208  GLU n 
22 209  LEU n 
22 210  GLN n 
22 211  ALA n 
22 212  ARG n 
22 213  ILE n 
22 214  GLN n 
22 215  ALA n 
22 216  GLN n 
22 217  LEU n 
22 218  ALA n 
22 219  LEU n 
22 220  LYS n 
22 221  PRO n 
22 222  GLY n 
22 223  LEU n 
22 224  ILE n 
22 225  GLY n 
22 226  ASN n 
22 227  ALA n 
22 228  ASN n 
22 229  MET n 
22 230  VAL n 
22 231  GLY n 
22 232  LEU n 
22 233  ALA n 
22 234  ASN n 
22 235  LEU n 
22 236  HIS n 
22 237  ALA n 
22 238  MET n 
22 239  GLY n 
22 240  ILE n 
22 241  ALA n 
22 242  PRO n 
22 243  PRO n 
22 244  LYS n 
22 245  VAL n 
22 246  GLU n 
22 247  LEU n 
22 248  LYS n 
22 249  ASP n 
22 250  GLN n 
22 251  THR n 
22 252  LYS n 
22 253  PRO n 
22 254  THR n 
22 255  PRO n 
22 256  LEU n 
22 257  ILE n 
22 258  LEU n 
22 259  ASP n 
22 260  GLU n 
22 261  GLN n 
22 262  GLY n 
22 263  ARG n 
22 264  THR n 
22 265  VAL n 
22 266  ASP n 
22 267  ALA n 
22 268  THR n 
22 269  GLY n 
22 270  LYS n 
22 271  GLU n 
22 272  ILE n 
22 273  GLU n 
22 274  LEU n 
22 275  THR n 
22 276  HIS n 
22 277  ARG n 
22 278  MET n 
22 279  PRO n 
22 280  THR n 
22 281  LEU n 
22 282  LYS n 
22 283  ALA n 
22 284  ASN n 
22 285  ILE n 
22 286  ARG n 
22 287  ALA n 
22 288  VAL n 
22 289  LYS n 
22 290  ARG n 
22 291  GLU n 
22 292  GLN n 
22 293  PHE n 
22 294  LYS n 
22 295  GLN n 
22 296  GLN n 
22 297  LEU n 
22 298  LYS n 
22 299  GLU n 
22 300  LYS n 
22 301  PRO n 
22 302  SER n 
22 303  GLU n 
22 304  ASP n 
22 305  MET n 
22 306  GLU n 
22 307  SER n 
22 308  ASN n 
22 309  THR n 
22 310  PHE n 
22 311  PHE n 
22 312  ASP n 
22 313  PRO n 
22 314  ARG n 
22 315  VAL n 
22 316  SER n 
22 317  ILE n 
22 318  ALA n 
22 319  PRO n 
22 320  SER n 
22 321  GLN n 
22 322  ARG n 
22 323  GLN n 
22 324  ARG n 
22 325  ARG n 
22 326  THR n 
22 327  PHE n 
22 328  LYS n 
22 329  PHE n 
22 330  HIS n 
22 331  ASP n 
22 332  LYS n 
22 333  GLY n 
22 334  LYS n 
22 335  PHE n 
22 336  GLU n 
22 337  LYS n 
22 338  ILE n 
22 339  ALA n 
22 340  GLN n 
22 341  ARG n 
22 342  LEU n 
22 343  ARG n 
22 344  THR n 
22 345  LYS n 
22 346  ALA n 
22 347  GLN n 
22 348  LEU n 
22 349  GLU n 
22 350  LYS n 
22 351  LEU n 
22 352  GLN n 
22 353  ALA n 
22 354  GLU n 
22 355  ILE n 
22 356  SER n 
22 357  GLN n 
22 358  ALA n 
22 359  ALA n 
22 360  ARG n 
22 361  LYS n 
22 362  THR n 
22 363  GLY n 
22 364  ILE n 
22 365  HIS n 
22 366  THR n 
22 367  SER n 
22 368  THR n 
22 369  ARG n 
22 370  LEU n 
22 371  ALA n 
22 372  LEU n 
22 373  ILE n 
22 374  ALA n 
22 375  PRO n 
22 376  LYS n 
22 377  LYS n 
22 378  GLU n 
22 379  LEU n 
22 380  LYS n 
22 381  GLU n 
22 382  GLY n 
22 383  ASP n 
22 384  ILE n 
22 385  PRO n 
22 386  GLU n 
22 387  ILE n 
22 388  GLU n 
22 389  TRP n 
22 390  TRP n 
22 391  ASP n 
22 392  SER n 
22 393  TYR n 
22 394  ILE n 
22 395  ILE n 
22 396  PRO n 
22 397  ASN n 
22 398  GLY n 
22 399  PHE n 
22 400  ASP n 
22 401  LEU n 
22 402  THR n 
22 403  GLU n 
22 404  GLU n 
22 405  ASN n 
22 406  PRO n 
22 407  LYS n 
22 408  ARG n 
22 409  GLU n 
22 410  ASP n 
22 411  TYR n 
22 412  PHE n 
22 413  GLY n 
22 414  ILE n 
22 415  THR n 
22 416  ASN n 
22 417  LEU n 
22 418  VAL n 
22 419  GLU n 
22 420  HIS n 
22 421  PRO n 
22 422  ALA n 
22 423  GLN n 
22 424  LEU n 
22 425  ASN n 
22 426  PRO n 
22 427  PRO n 
22 428  VAL n 
22 429  ASP n 
22 430  ASN n 
22 431  ASP n 
22 432  THR n 
22 433  PRO n 
22 434  VAL n 
22 435  THR n 
22 436  LEU n 
22 437  GLY n 
22 438  VAL n 
22 439  TYR n 
22 440  LEU n 
22 441  THR n 
22 442  LYS n 
22 443  LYS n 
22 444  GLU n 
22 445  GLN n 
22 446  LYS n 
22 447  LYS n 
22 448  LEU n 
22 449  ARG n 
22 450  ARG n 
22 451  GLN n 
22 452  THR n 
22 453  ARG n 
22 454  ARG n 
22 455  GLU n 
22 456  ALA n 
22 457  GLN n 
22 458  LYS n 
22 459  GLU n 
22 460  LEU n 
22 461  GLN n 
22 462  GLU n 
22 463  LYS n 
22 464  VAL n 
22 465  ARG n 
22 466  LEU n 
22 467  GLY n 
22 468  LEU n 
22 469  MET n 
22 470  PRO n 
22 471  PRO n 
22 472  PRO n 
22 473  GLU n 
22 474  PRO n 
22 475  LYS n 
22 476  VAL n 
22 477  ARG n 
22 478  ILE n 
22 479  SER n 
22 480  ASN n 
22 481  LEU n 
22 482  MET n 
22 483  ARG n 
22 484  VAL n 
22 485  LEU n 
22 486  GLY n 
22 487  THR n 
22 488  GLU n 
22 489  ALA n 
22 490  VAL n 
22 491  GLN n 
22 492  ASP n 
22 493  PRO n 
22 494  THR n 
22 495  LYS n 
22 496  VAL n 
22 497  GLU n 
22 498  ALA n 
22 499  HIS n 
22 500  VAL n 
22 501  ARG n 
22 502  ALA n 
22 503  GLN n 
22 504  MET n 
22 505  ALA n 
22 506  LYS n 
22 507  ARG n 
22 508  GLN n 
22 509  LYS n 
22 510  ALA n 
22 511  HIS n 
22 512  GLU n 
22 513  GLU n 
22 514  ALA n 
22 515  ASN n 
22 516  ALA n 
22 517  ALA n 
22 518  ARG n 
22 519  LYS n 
22 520  LEU n 
22 521  THR n 
22 522  ALA n 
22 523  GLU n 
22 524  GLN n 
22 525  ARG n 
22 526  LYS n 
22 527  VAL n 
22 528  LYS n 
22 529  LYS n 
22 530  ILE n 
22 531  LYS n 
22 532  LYS n 
22 533  LEU n 
22 534  LYS n 
22 535  GLU n 
22 536  ASP n 
22 537  ILE n 
22 538  SER n 
22 539  GLN n 
22 540  GLY n 
22 541  VAL n 
22 542  HIS n 
22 543  ILE n 
22 544  SER n 
22 545  VAL n 
22 546  TYR n 
22 547  ARG n 
22 548  VAL n 
22 549  ARG n 
22 550  ASN n 
22 551  LEU n 
22 552  SER n 
22 553  ASN n 
22 554  PRO n 
22 555  ALA n 
22 556  LYS n 
22 557  LYS n 
22 558  PHE n 
22 559  LYS n 
22 560  ILE n 
22 561  GLU n 
22 562  ALA n 
22 563  ASN n 
22 564  ALA n 
22 565  GLY n 
22 566  GLN n 
22 567  LEU n 
22 568  TYR n 
22 569  LEU n 
22 570  THR n 
22 571  GLY n 
22 572  VAL n 
22 573  VAL n 
22 574  VAL n 
22 575  LEU n 
22 576  HIS n 
22 577  LYS n 
22 578  ASP n 
22 579  VAL n 
22 580  ASN n 
22 581  VAL n 
22 582  VAL n 
22 583  VAL n 
22 584  VAL n 
22 585  GLU n 
22 586  GLY n 
22 587  GLY n 
22 588  PRO n 
22 589  LYS n 
22 590  ALA n 
22 591  GLN n 
22 592  LYS n 
22 593  LYS n 
22 594  PHE n 
22 595  LYS n 
22 596  ARG n 
22 597  LEU n 
22 598  MET n 
22 599  LEU n 
22 600  HIS n 
22 601  ARG n 
22 602  ILE n 
22 603  LYS n 
22 604  TRP n 
22 605  ASP n 
22 606  GLU n 
22 607  GLN n 
22 608  THR n 
22 609  SER n 
22 610  ASN n 
22 611  THR n 
22 612  LYS n 
22 613  GLY n 
22 614  ASP n 
22 615  ASP n 
22 616  ASP n 
22 617  GLU n 
22 618  GLU n 
22 619  SER n 
22 620  ASP n 
22 621  GLU n 
22 622  GLU n 
22 623  ALA n 
22 624  VAL n 
22 625  LYS n 
22 626  LYS n 
22 627  THR n 
22 628  ASN n 
22 629  LYS n 
22 630  CYS n 
22 631  VAL n 
22 632  LEU n 
22 633  VAL n 
22 634  TRP n 
22 635  GLU n 
22 636  GLY n 
22 637  THR n 
22 638  ALA n 
22 639  LYS n 
22 640  ASP n 
22 641  ARG n 
22 642  SER n 
22 643  PHE n 
22 644  GLY n 
22 645  GLU n 
22 646  MET n 
22 647  LYS n 
22 648  PHE n 
22 649  LYS n 
22 650  GLN n 
22 651  CYS n 
22 652  PRO n 
22 653  THR n 
22 654  GLU n 
22 655  ASN n 
22 656  MET n 
22 657  ALA n 
22 658  ARG n 
22 659  GLU n 
22 660  HIS n 
22 661  PHE n 
22 662  LYS n 
22 663  LYS n 
22 664  HIS n 
22 665  GLY n 
22 666  ALA n 
22 667  GLU n 
22 668  HIS n 
22 669  TYR n 
22 670  TRP n 
22 671  ASP n 
22 672  LEU n 
22 673  ALA n 
22 674  LEU n 
22 675  SER n 
22 676  GLU n 
22 677  SER n 
22 678  VAL n 
22 679  LEU n 
22 680  GLU n 
22 681  SER n 
22 682  THR n 
22 683  ASP n 
23 1    MET n 
23 2    ALA n 
23 3    SER n 
23 4    SER n 
23 5    ARG n 
23 6    ALA n 
23 7    SER n 
23 8    SER n 
23 9    THR n 
23 10   ALA n 
23 11   THR n 
23 12   LYS n 
23 13   THR n 
23 14   LYS n 
23 15   ALA n 
23 16   PRO n 
23 17   ASP n 
23 18   ASP n 
23 19   LEU n 
23 20   VAL n 
23 21   ALA n 
23 22   PRO n 
23 23   VAL n 
23 24   VAL n 
23 25   LYS n 
23 26   LYS n 
23 27   PRO n 
23 28   HIS n 
23 29   ILE n 
23 30   TYR n 
23 31   TYR n 
23 32   GLY n 
23 33   SER n 
23 34   LEU n 
23 35   GLU n 
23 36   GLU n 
23 37   LYS n 
23 38   GLU n 
23 39   ARG n 
23 40   GLU n 
23 41   ARG n 
23 42   LEU n 
23 43   ALA n 
23 44   LYS n 
23 45   GLY n 
23 46   GLU n 
23 47   SER n 
23 48   GLY n 
23 49   ILE n 
23 50   LEU n 
23 51   GLY n 
23 52   LYS n 
23 53   ASP n 
23 54   GLY n 
23 55   LEU n 
23 56   LYS n 
23 57   ALA n 
23 58   GLY n 
23 59   ILE n 
23 60   GLU n 
23 61   ALA n 
23 62   GLY n 
23 63   ASN n 
23 64   ILE n 
23 65   ASN n 
23 66   ILE n 
23 67   THR n 
23 68   SER n 
23 69   GLY n 
23 70   GLU n 
23 71   VAL n 
23 72   PHE n 
23 73   GLU n 
23 74   ILE n 
23 75   GLU n 
23 76   GLU n 
23 77   HIS n 
23 78   ILE n 
23 79   SER n 
23 80   GLU n 
23 81   ARG n 
23 82   GLN n 
23 83   ALA n 
23 84   GLU n 
23 85   VAL n 
23 86   LEU n 
23 87   ALA n 
23 88   GLU n 
23 89   PHE n 
23 90   GLU n 
23 91   ARG n 
23 92   ARG n 
23 93   LYS n 
23 94   ARG n 
23 95   ALA n 
23 96   ARG n 
23 97   GLN n 
23 98   ILE n 
23 99   ASN n 
23 100  VAL n 
23 101  SER n 
23 102  THR n 
23 103  ASP n 
23 104  ASP n 
23 105  SER n 
23 106  GLU n 
23 107  VAL n 
23 108  LYS n 
23 109  ALA n 
23 110  CYS n 
23 111  LEU n 
23 112  ARG n 
23 113  ALA n 
23 114  LEU n 
23 115  GLY n 
23 116  GLU n 
23 117  PRO n 
23 118  ILE n 
23 119  THR n 
23 120  LEU n 
23 121  PHE n 
23 122  GLY n 
23 123  GLU n 
23 124  GLY n 
23 125  PRO n 
23 126  ALA n 
23 127  GLU n 
23 128  ARG n 
23 129  ARG n 
23 130  GLU n 
23 131  ARG n 
23 132  LEU n 
23 133  ARG n 
23 134  ASN n 
23 135  ILE n 
23 136  LEU n 
23 137  SER n 
23 138  VAL n 
23 139  VAL n 
23 140  GLY n 
23 141  THR n 
23 142  ASP n 
23 143  ALA n 
23 144  LEU n 
23 145  LYS n 
23 146  LYS n 
23 147  THR n 
23 148  LYS n 
23 149  LYS n 
23 150  ASP n 
23 151  ASP n 
23 152  GLU n 
23 153  LYS n 
23 154  SER n 
23 155  LYS n 
23 156  LYS n 
23 157  SER n 
23 158  LYS n 
23 159  GLU n 
23 160  GLU n 
23 161  TYR n 
23 162  GLN n 
23 163  GLN n 
23 164  THR n 
23 165  TRP n 
23 166  TYR n 
23 167  HIS n 
23 168  GLU n 
23 169  GLY n 
23 170  PRO n 
23 171  ASN n 
23 172  SER n 
23 173  LEU n 
23 174  LYS n 
23 175  VAL n 
23 176  ALA n 
23 177  ARG n 
23 178  LEU n 
23 179  TRP n 
23 180  ILE n 
23 181  ALA n 
23 182  ASN n 
23 183  TYR n 
23 184  SER n 
23 185  LEU n 
23 186  PRO n 
23 187  ARG n 
23 188  ALA n 
23 189  MET n 
23 190  LYS n 
23 191  ARG n 
23 192  LEU n 
23 193  GLU n 
23 194  GLU n 
23 195  ALA n 
23 196  ARG n 
23 197  LEU n 
23 198  HIS n 
23 199  LYS n 
23 200  GLU n 
23 201  ILE n 
23 202  PRO n 
23 203  GLU n 
23 204  THR n 
23 205  THR n 
23 206  ARG n 
23 207  THR n 
23 208  SER n 
23 209  GLN n 
23 210  MET n 
23 211  GLN n 
23 212  GLU n 
23 213  LEU n 
23 214  HIS n 
23 215  LYS n 
23 216  SER n 
23 217  LEU n 
23 218  ARG n 
23 219  SER n 
23 220  LEU n 
23 221  ASN n 
23 222  ASN n 
23 223  PHE n 
23 224  CYS n 
23 225  SER n 
23 226  GLN n 
23 227  ILE n 
23 228  GLY n 
23 229  ASP n 
23 230  ASP n 
23 231  ARG n 
23 232  PRO n 
23 233  ILE n 
23 234  SER n 
23 235  TYR n 
23 236  CYS n 
23 237  HIS n 
23 238  PHE n 
23 239  SER n 
23 240  PRO n 
23 241  ASN n 
23 242  SER n 
23 243  LYS n 
23 244  MET n 
23 245  LEU n 
23 246  ALA n 
23 247  THR n 
23 248  ALA n 
23 249  CYS n 
23 250  TRP n 
23 251  SER n 
23 252  GLY n 
23 253  LEU n 
23 254  CYS n 
23 255  LYS n 
23 256  LEU n 
23 257  TRP n 
23 258  SER n 
23 259  VAL n 
23 260  PRO n 
23 261  ASP n 
23 262  CYS n 
23 263  ASN n 
23 264  LEU n 
23 265  LEU n 
23 266  HIS n 
23 267  THR n 
23 268  LEU n 
23 269  ARG n 
23 270  GLY n 
23 271  HIS n 
23 272  ASN n 
23 273  THR n 
23 274  ASN n 
23 275  VAL n 
23 276  GLY n 
23 277  ALA n 
23 278  ILE n 
23 279  VAL n 
23 280  PHE n 
23 281  HIS n 
23 282  PRO n 
23 283  LYS n 
23 284  SER n 
23 285  THR n 
23 286  VAL n 
23 287  SER n 
23 288  LEU n 
23 289  ASP n 
23 290  PRO n 
23 291  LYS n 
23 292  ASP n 
23 293  VAL n 
23 294  ASN n 
23 295  LEU n 
23 296  ALA n 
23 297  SER n 
23 298  CYS n 
23 299  ALA n 
23 300  ALA n 
23 301  ASP n 
23 302  GLY n 
23 303  SER n 
23 304  VAL n 
23 305  LYS n 
23 306  LEU n 
23 307  TRP n 
23 308  SER n 
23 309  LEU n 
23 310  ASP n 
23 311  SER n 
23 312  ASP n 
23 313  GLU n 
23 314  PRO n 
23 315  VAL n 
23 316  ALA n 
23 317  ASP n 
23 318  ILE n 
23 319  GLU n 
23 320  GLY n 
23 321  HIS n 
23 322  THR n 
23 323  VAL n 
23 324  ARG n 
23 325  VAL n 
23 326  ALA n 
23 327  ARG n 
23 328  VAL n 
23 329  MET n 
23 330  TRP n 
23 331  HIS n 
23 332  PRO n 
23 333  SER n 
23 334  GLY n 
23 335  ARG n 
23 336  PHE n 
23 337  LEU n 
23 338  GLY n 
23 339  THR n 
23 340  THR n 
23 341  CYS n 
23 342  TYR n 
23 343  ASP n 
23 344  ARG n 
23 345  SER n 
23 346  TRP n 
23 347  ARG n 
23 348  LEU n 
23 349  TRP n 
23 350  ASP n 
23 351  LEU n 
23 352  GLU n 
23 353  ALA n 
23 354  GLN n 
23 355  GLU n 
23 356  GLU n 
23 357  ILE n 
23 358  LEU n 
23 359  HIS n 
23 360  GLN n 
23 361  GLU n 
23 362  GLY n 
23 363  HIS n 
23 364  SER n 
23 365  MET n 
23 366  GLY n 
23 367  VAL n 
23 368  TYR n 
23 369  ASP n 
23 370  ILE n 
23 371  ALA n 
23 372  PHE n 
23 373  HIS n 
23 374  GLN n 
23 375  ASP n 
23 376  GLY n 
23 377  SER n 
23 378  LEU n 
23 379  ALA n 
23 380  GLY n 
23 381  THR n 
23 382  GLY n 
23 383  GLY n 
23 384  LEU n 
23 385  ASP n 
23 386  ALA n 
23 387  PHE n 
23 388  GLY n 
23 389  ARG n 
23 390  VAL n 
23 391  TRP n 
23 392  ASP n 
23 393  LEU n 
23 394  ARG n 
23 395  THR n 
23 396  GLY n 
23 397  ARG n 
23 398  CYS n 
23 399  ILE n 
23 400  MET n 
23 401  PHE n 
23 402  LEU n 
23 403  GLU n 
23 404  GLY n 
23 405  HIS n 
23 406  LEU n 
23 407  LYS n 
23 408  GLU n 
23 409  ILE n 
23 410  TYR n 
23 411  GLY n 
23 412  ILE n 
23 413  ASN n 
23 414  PHE n 
23 415  SER n 
23 416  PRO n 
23 417  ASN n 
23 418  GLY n 
23 419  TYR n 
23 420  HIS n 
23 421  ILE n 
23 422  ALA n 
23 423  THR n 
23 424  GLY n 
23 425  SER n 
23 426  GLY n 
23 427  ASP n 
23 428  ASN n 
23 429  THR n 
23 430  CYS n 
23 431  LYS n 
23 432  VAL n 
23 433  TRP n 
23 434  ASP n 
23 435  LEU n 
23 436  ARG n 
23 437  GLN n 
23 438  ARG n 
23 439  ARG n 
23 440  CYS n 
23 441  VAL n 
23 442  TYR n 
23 443  THR n 
23 444  ILE n 
23 445  PRO n 
23 446  ALA n 
23 447  HIS n 
23 448  GLN n 
23 449  ASN n 
23 450  LEU n 
23 451  VAL n 
23 452  THR n 
23 453  GLY n 
23 454  VAL n 
23 455  LYS n 
23 456  PHE n 
23 457  GLU n 
23 458  PRO n 
23 459  ILE n 
23 460  HIS n 
23 461  GLY n 
23 462  ASN n 
23 463  PHE n 
23 464  LEU n 
23 465  LEU n 
23 466  THR n 
23 467  GLY n 
23 468  ALA n 
23 469  TYR n 
23 470  ASP n 
23 471  ASN n 
23 472  THR n 
23 473  ALA n 
23 474  LYS n 
23 475  ILE n 
23 476  TRP n 
23 477  THR n 
23 478  HIS n 
23 479  PRO n 
23 480  GLY n 
23 481  TRP n 
23 482  SER n 
23 483  PRO n 
23 484  LEU n 
23 485  LYS n 
23 486  THR n 
23 487  LEU n 
23 488  ALA n 
23 489  GLY n 
23 490  HIS n 
23 491  GLU n 
23 492  GLY n 
23 493  LYS n 
23 494  VAL n 
23 495  MET n 
23 496  GLY n 
23 497  LEU n 
23 498  ASP n 
23 499  ILE n 
23 500  SER n 
23 501  SER n 
23 502  ASP n 
23 503  GLY n 
23 504  GLN n 
23 505  LEU n 
23 506  ILE n 
23 507  ALA n 
23 508  THR n 
23 509  CYS n 
23 510  SER n 
23 511  TYR n 
23 512  ASP n 
23 513  ARG n 
23 514  THR n 
23 515  PHE n 
23 516  LYS n 
23 517  LEU n 
23 518  TRP n 
23 519  MET n 
23 520  ALA n 
23 521  GLU n 
24 1    MET n 
24 2    SER n 
24 3    LEU n 
24 4    ALA n 
24 5    ASP n 
24 6    GLU n 
24 7    LEU n 
24 8    LEU n 
24 9    ALA n 
24 10   ASP n 
24 11   LEU n 
24 12   GLU n 
24 13   GLU n 
24 14   ALA n 
24 15   ALA n 
24 16   GLU n 
24 17   GLU n 
24 18   GLU n 
24 19   GLU n 
24 20   GLY n 
24 21   GLY n 
24 22   SER n 
24 23   TYR n 
24 24   GLY n 
24 25   GLU n 
24 26   GLU n 
24 27   GLU n 
24 28   GLU n 
24 29   GLU n 
24 30   PRO n 
24 31   ALA n 
24 32   ILE n 
24 33   GLU n 
24 34   ASP n 
24 35   VAL n 
24 36   GLN n 
24 37   GLU n 
24 38   GLU n 
24 39   THR n 
24 40   GLN n 
24 41   LEU n 
24 42   ASP n 
24 43   LEU n 
24 44   SER n 
24 45   GLY n 
24 46   ASP n 
24 47   SER n 
24 48   VAL n 
24 49   LYS n 
24 50   THR n 
24 51   ILE n 
24 52   ALA n 
24 53   LYS n 
24 54   LEU n 
24 55   TRP n 
24 56   ASP n 
24 57   SER n 
24 58   LYS n 
24 59   MET n 
24 60   PHE n 
24 61   ALA n 
24 62   GLU n 
24 63   ILE n 
24 64   MET n 
24 65   MET n 
24 66   LYS n 
24 67   ILE n 
24 68   GLU n 
24 69   GLU n 
24 70   TYR n 
24 71   ILE n 
24 72   SER n 
24 73   LYS n 
24 74   GLN n 
24 75   ALA n 
24 76   LYS n 
24 77   ALA n 
24 78   SER n 
24 79   GLU n 
24 80   VAL n 
24 81   MET n 
24 82   GLY n 
24 83   PRO n 
24 84   VAL n 
24 85   GLU n 
24 86   ALA n 
24 87   ALA n 
24 88   PRO n 
24 89   GLU n 
24 90   TYR n 
24 91   ARG n 
24 92   VAL n 
24 93   ILE n 
24 94   VAL n 
24 95   ASP n 
24 96   ALA n 
24 97   ASN n 
24 98   ASN n 
24 99   LEU n 
24 100  THR n 
24 101  VAL n 
24 102  GLU n 
24 103  ILE n 
24 104  GLU n 
24 105  ASN n 
24 106  GLU n 
24 107  LEU n 
24 108  ASN n 
24 109  ILE n 
24 110  ILE n 
24 111  HIS n 
24 112  LYS n 
24 113  PHE n 
24 114  ILE n 
24 115  ARG n 
24 116  ASP n 
24 117  LYS n 
24 118  TYR n 
24 119  SER n 
24 120  LYS n 
24 121  ARG n 
24 122  PHE n 
24 123  PRO n 
24 124  GLU n 
24 125  LEU n 
24 126  GLU n 
24 127  SER n 
24 128  LEU n 
24 129  VAL n 
24 130  PRO n 
24 131  ASN n 
24 132  ALA n 
24 133  LEU n 
24 134  ASP n 
24 135  TYR n 
24 136  ILE n 
24 137  ARG n 
24 138  THR n 
24 139  VAL n 
24 140  LYS n 
24 141  GLU n 
24 142  LEU n 
24 143  GLY n 
24 144  ASN n 
24 145  SER n 
24 146  LEU n 
24 147  ASP n 
24 148  LYS n 
24 149  CYS n 
24 150  LYS n 
24 151  ASN n 
24 152  ASN n 
24 153  GLU n 
24 154  ASN n 
24 155  LEU n 
24 156  GLN n 
24 157  GLN n 
24 158  ILE n 
24 159  LEU n 
24 160  THR n 
24 161  ASN n 
24 162  ALA n 
24 163  THR n 
24 164  ILE n 
24 165  MET n 
24 166  VAL n 
24 167  VAL n 
24 168  SER n 
24 169  VAL n 
24 170  THR n 
24 171  ALA n 
24 172  SER n 
24 173  THR n 
24 174  THR n 
24 175  GLN n 
24 176  GLY n 
24 177  GLN n 
24 178  GLN n 
24 179  LEU n 
24 180  SER n 
24 181  GLU n 
24 182  GLU n 
24 183  GLU n 
24 184  LEU n 
24 185  GLU n 
24 186  ARG n 
24 187  LEU n 
24 188  GLU n 
24 189  GLU n 
24 190  ALA n 
24 191  CYS n 
24 192  ASP n 
24 193  MET n 
24 194  ALA n 
24 195  LEU n 
24 196  GLU n 
24 197  LEU n 
24 198  ASN n 
24 199  ALA n 
24 200  SER n 
24 201  LYS n 
24 202  HIS n 
24 203  ARG n 
24 204  ILE n 
24 205  TYR n 
24 206  GLU n 
24 207  TYR n 
24 208  VAL n 
24 209  GLU n 
24 210  SER n 
24 211  ARG n 
24 212  MET n 
24 213  SER n 
24 214  PHE n 
24 215  ILE n 
24 216  ALA n 
24 217  PRO n 
24 218  ASN n 
24 219  LEU n 
24 220  SER n 
24 221  ILE n 
24 222  ILE n 
24 223  ILE n 
24 224  GLY n 
24 225  ALA n 
24 226  SER n 
24 227  THR n 
24 228  ALA n 
24 229  ALA n 
24 230  LYS n 
24 231  ILE n 
24 232  MET n 
24 233  GLY n 
24 234  VAL n 
24 235  ALA n 
24 236  GLY n 
24 237  GLY n 
24 238  LEU n 
24 239  THR n 
24 240  ASN n 
24 241  LEU n 
24 242  SER n 
24 243  LYS n 
24 244  MET n 
24 245  PRO n 
24 246  ALA n 
24 247  CYS n 
24 248  ASN n 
24 249  ILE n 
24 250  MET n 
24 251  LEU n 
24 252  LEU n 
24 253  GLY n 
24 254  ALA n 
24 255  GLN n 
24 256  ARG n 
24 257  LYS n 
24 258  THR n 
24 259  LEU n 
24 260  SER n 
24 261  GLY n 
24 262  PHE n 
24 263  SER n 
24 264  SER n 
24 265  THR n 
24 266  SER n 
24 267  VAL n 
24 268  LEU n 
24 269  PRO n 
24 270  HIS n 
24 271  THR n 
24 272  GLY n 
24 273  TYR n 
24 274  ILE n 
24 275  TYR n 
24 276  HIS n 
24 277  SER n 
24 278  ASP n 
24 279  ILE n 
24 280  VAL n 
24 281  GLN n 
24 282  SER n 
24 283  LEU n 
24 284  PRO n 
24 285  PRO n 
24 286  ASP n 
24 287  LEU n 
24 288  ARG n 
24 289  ARG n 
24 290  LYS n 
24 291  ALA n 
24 292  ALA n 
24 293  ARG n 
24 294  LEU n 
24 295  VAL n 
24 296  ALA n 
24 297  ALA n 
24 298  LYS n 
24 299  CYS n 
24 300  THR n 
24 301  LEU n 
24 302  ALA n 
24 303  ALA n 
24 304  ARG n 
24 305  VAL n 
24 306  ASP n 
24 307  SER n 
24 308  PHE n 
24 309  HIS n 
24 310  GLU n 
24 311  SER n 
24 312  THR n 
24 313  GLU n 
24 314  GLY n 
24 315  LYS n 
24 316  VAL n 
24 317  GLY n 
24 318  TYR n 
24 319  GLU n 
24 320  LEU n 
24 321  LYS n 
24 322  ASP n 
24 323  GLU n 
24 324  ILE n 
24 325  GLU n 
24 326  ARG n 
24 327  LYS n 
24 328  PHE n 
24 329  ASP n 
24 330  LYS n 
24 331  TRP n 
24 332  GLN n 
24 333  GLU n 
24 334  PRO n 
24 335  PRO n 
24 336  PRO n 
24 337  VAL n 
24 338  LYS n 
24 339  GLN n 
24 340  VAL n 
24 341  LYS n 
24 342  PRO n 
24 343  LEU n 
24 344  PRO n 
24 345  ALA n 
24 346  PRO n 
24 347  LEU n 
24 348  ASP n 
24 349  GLY n 
24 350  GLN n 
24 351  ARG n 
24 352  LYS n 
24 353  LYS n 
24 354  ARG n 
24 355  GLY n 
24 356  GLY n 
24 357  ARG n 
24 358  ARG n 
24 359  TYR n 
24 360  ARG n 
24 361  LYS n 
24 362  MET n 
24 363  LYS n 
24 364  GLU n 
24 365  ARG n 
24 366  LEU n 
24 367  GLY n 
24 368  LEU n 
24 369  THR n 
24 370  GLU n 
24 371  ILE n 
24 372  ARG n 
24 373  LYS n 
24 374  GLN n 
24 375  ALA n 
24 376  ASN n 
24 377  ARG n 
24 378  MET n 
24 379  SER n 
24 380  PHE n 
24 381  GLY n 
24 382  GLU n 
24 383  ILE n 
24 384  GLU n 
24 385  GLU n 
24 386  ASP n 
24 387  ALA n 
24 388  TYR n 
24 389  GLN n 
24 390  GLU n 
24 391  ASP n 
24 392  LEU n 
24 393  GLY n 
24 394  PHE n 
24 395  SER n 
24 396  LEU n 
24 397  GLY n 
24 398  HIS n 
24 399  LEU n 
24 400  GLY n 
24 401  LYS n 
24 402  SER n 
24 403  GLY n 
24 404  SER n 
24 405  GLY n 
24 406  ARG n 
24 407  VAL n 
24 408  ARG n 
24 409  GLN n 
24 410  THR n 
24 411  GLN n 
24 412  VAL n 
24 413  ASN n 
24 414  GLU n 
24 415  ALA n 
24 416  THR n 
24 417  LYS n 
24 418  ALA n 
24 419  ARG n 
24 420  ILE n 
24 421  SER n 
24 422  LYS n 
24 423  THR n 
24 424  LEU n 
24 425  GLN n 
24 426  ARG n 
24 427  THR n 
24 428  LEU n 
24 429  GLN n 
24 430  LYS n 
24 431  GLN n 
24 432  SER n 
24 433  VAL n 
24 434  VAL n 
24 435  TYR n 
24 436  GLY n 
24 437  GLY n 
24 438  LYS n 
24 439  SER n 
24 440  THR n 
24 441  ILE n 
24 442  ARG n 
24 443  ASP n 
24 444  ARG n 
24 445  SER n 
24 446  SER n 
24 447  GLY n 
24 448  THR n 
24 449  ALA n 
24 450  SER n 
24 451  SER n 
24 452  VAL n 
24 453  ALA n 
24 454  PHE n 
24 455  THR n 
24 456  PRO n 
24 457  LEU n 
24 458  GLN n 
24 459  GLY n 
24 460  LEU n 
24 461  GLU n 
24 462  ILE n 
24 463  VAL n 
24 464  ASN n 
24 465  PRO n 
24 466  GLN n 
24 467  ALA n 
24 468  ALA n 
24 469  GLU n 
24 470  LYS n 
24 471  LYS n 
24 472  VAL n 
24 473  ALA n 
24 474  GLU n 
24 475  ALA n 
24 476  ASN n 
24 477  GLN n 
24 478  LYS n 
24 479  TYR n 
24 480  PHE n 
24 481  SER n 
24 482  SER n 
24 483  MET n 
24 484  ALA n 
24 485  GLU n 
24 486  PHE n 
24 487  LEU n 
24 488  LYS n 
24 489  VAL n 
24 490  LYS n 
24 491  GLY n 
24 492  GLU n 
24 493  LYS n 
24 494  SER n 
24 495  GLY n 
24 496  LEU n 
24 497  MET n 
24 498  SER n 
24 499  THR n 
25 1    MET n 
25 2    THR n 
25 3    GLU n 
25 4    ALA n 
25 5    ASP n 
25 6    VAL n 
25 7    ASN n 
25 8    PRO n 
25 9    LYS n 
25 10   ALA n 
25 11   TYR n 
25 12   PRO n 
25 13   LEU n 
25 14   ALA n 
25 15   ASP n 
25 16   ALA n 
25 17   HIS n 
25 18   LEU n 
25 19   THR n 
25 20   LYS n 
25 21   LYS n 
25 22   LEU n 
25 23   LEU n 
25 24   ASP n 
25 25   LEU n 
25 26   VAL n 
25 27   GLN n 
25 28   GLN n 
25 29   SER n 
25 30   CYS n 
25 31   ASN n 
25 32   TYR n 
25 33   LYS n 
25 34   GLN n 
25 35   LEU n 
25 36   ARG n 
25 37   LYS n 
25 38   GLY n 
25 39   ALA n 
25 40   ASN n 
25 41   GLU n 
25 42   ALA n 
25 43   THR n 
25 44   LYS n 
25 45   THR n 
25 46   LEU n 
25 47   ASN n 
25 48   ARG n 
25 49   GLY n 
25 50   ILE n 
25 51   SER n 
25 52   GLU n 
25 53   PHE n 
25 54   ILE n 
25 55   VAL n 
25 56   MET n 
25 57   ALA n 
25 58   ALA n 
25 59   ASP n 
25 60   ALA n 
25 61   GLU n 
25 62   PRO n 
25 63   LEU n 
25 64   GLU n 
25 65   ILE n 
25 66   ILE n 
25 67   LEU n 
25 68   HIS n 
25 69   LEU n 
25 70   PRO n 
25 71   LEU n 
25 72   LEU n 
25 73   CYS n 
25 74   GLU n 
25 75   ASP n 
25 76   LYS n 
25 77   ASN n 
25 78   VAL n 
25 79   PRO n 
25 80   TYR n 
25 81   VAL n 
25 82   PHE n 
25 83   VAL n 
25 84   ARG n 
25 85   SER n 
25 86   LYS n 
25 87   GLN n 
25 88   ALA n 
25 89   LEU n 
25 90   GLY n 
25 91   ARG n 
25 92   ALA n 
25 93   CYS n 
25 94   GLY n 
25 95   VAL n 
25 96   SER n 
25 97   ARG n 
25 98   PRO n 
25 99   VAL n 
25 100  ILE n 
25 101  ALA n 
25 102  CYS n 
25 103  SER n 
25 104  VAL n 
25 105  THR n 
25 106  ILE n 
25 107  LYS n 
25 108  GLU n 
25 109  GLY n 
25 110  SER n 
25 111  GLN n 
25 112  LEU n 
25 113  LYS n 
25 114  GLN n 
25 115  GLN n 
25 116  ILE n 
25 117  GLN n 
25 118  SER n 
25 119  ILE n 
25 120  GLN n 
25 121  GLN n 
25 122  SER n 
25 123  ILE n 
25 124  GLU n 
25 125  ARG n 
25 126  LEU n 
25 127  LEU n 
25 128  VAL n 
26 1    MET n 
26 2    SER n 
26 3    GLY n 
26 4    ARG n 
26 5    SER n 
26 6    LYS n 
26 7    ARG n 
26 8    GLU n 
26 9    SER n 
26 10   ARG n 
26 11   GLY n 
26 12   SER n 
26 13   THR n 
26 14   ARG n 
26 15   GLY n 
26 16   LYS n 
26 17   ARG n 
26 18   GLU n 
26 19   SER n 
26 20   GLU n 
26 21   SER n 
26 22   ARG n 
26 23   GLY n 
26 24   SER n 
26 25   SER n 
26 26   GLY n 
26 27   ARG n 
26 28   VAL n 
26 29   LYS n 
26 30   ARG n 
26 31   GLU n 
26 32   ARG n 
26 33   ASP n 
26 34   ARG n 
26 35   GLU n 
26 36   ARG n 
26 37   GLU n 
26 38   PRO n 
26 39   GLU n 
26 40   ALA n 
26 41   ALA n 
26 42   SER n 
26 43   SER n 
26 44   ARG n 
26 45   GLY n 
26 46   SER n 
26 47   PRO n 
26 48   VAL n 
26 49   ARG n 
26 50   VAL n 
26 51   LYS n 
26 52   ARG n 
26 53   GLU n 
26 54   PHE n 
26 55   GLU n 
26 56   PRO n 
26 57   ALA n 
26 58   SER n 
26 59   ALA n 
26 60   ARG n 
26 61   GLU n 
26 62   ALA n 
26 63   PRO n 
26 64   ALA n 
26 65   SER n 
26 66   VAL n 
26 67   VAL n 
26 68   PRO n 
26 69   PHE n 
26 70   VAL n 
26 71   ARG n 
26 72   VAL n 
26 73   LYS n 
26 74   ARG n 
26 75   GLU n 
26 76   ARG n 
26 77   GLU n 
26 78   VAL n 
26 79   ASP n 
26 80   GLU n 
26 81   ASP n 
26 82   SER n 
26 83   GLU n 
26 84   PRO n 
26 85   GLU n 
26 86   ARG n 
26 87   GLU n 
26 88   VAL n 
26 89   ARG n 
26 90   ALA n 
26 91   LYS n 
26 92   ASN n 
26 93   GLY n 
26 94   ARG n 
26 95   VAL n 
26 96   ASP n 
26 97   SER n 
26 98   GLU n 
26 99   ASP n 
26 100  ARG n 
26 101  ARG n 
26 102  SER n 
26 103  ARG n 
26 104  HIS n 
26 105  CYS n 
26 106  PRO n 
26 107  TYR n 
26 108  LEU n 
26 109  ASP n 
26 110  THR n 
26 111  ILE n 
26 112  ASN n 
26 113  ARG n 
26 114  SER n 
26 115  VAL n 
26 116  LEU n 
26 117  ASP n 
26 118  PHE n 
26 119  ASP n 
26 120  PHE n 
26 121  GLU n 
26 122  LYS n 
26 123  LEU n 
26 124  CYS n 
26 125  SER n 
26 126  ILE n 
26 127  SER n 
26 128  LEU n 
26 129  SER n 
26 130  HIS n 
26 131  ILE n 
26 132  ASN n 
26 133  ALA n 
26 134  TYR n 
26 135  ALA n 
26 136  CYS n 
26 137  LEU n 
26 138  VAL n 
26 139  CYS n 
26 140  GLY n 
26 141  LYS n 
26 142  TYR n 
26 143  PHE n 
26 144  GLN n 
26 145  GLY n 
26 146  ARG n 
26 147  GLY n 
26 148  LEU n 
26 149  LYS n 
26 150  SER n 
26 151  HIS n 
26 152  ALA n 
26 153  TYR n 
26 154  ILE n 
26 155  HIS n 
26 156  SER n 
26 157  VAL n 
26 158  GLN n 
26 159  PHE n 
26 160  SER n 
26 161  HIS n 
26 162  HIS n 
26 163  VAL n 
26 164  PHE n 
26 165  LEU n 
26 166  ASN n 
26 167  LEU n 
26 168  HIS n 
26 169  THR n 
26 170  LEU n 
26 171  LYS n 
26 172  PHE n 
26 173  TYR n 
26 174  CYS n 
26 175  LEU n 
26 176  PRO n 
26 177  ASP n 
26 178  ASN n 
26 179  TYR n 
26 180  GLU n 
26 181  ILE n 
26 182  ILE n 
26 183  ASP n 
26 184  SER n 
26 185  SER n 
26 186  LEU n 
26 187  GLU n 
26 188  ASP n 
26 189  ILE n 
26 190  THR n 
26 191  TYR n 
26 192  VAL n 
26 193  LEU n 
26 194  LYS n 
26 195  PRO n 
26 196  THR n 
26 197  PHE n 
26 198  THR n 
26 199  LYS n 
26 200  GLN n 
26 201  GLN n 
26 202  ILE n 
26 203  ALA n 
26 204  ASN n 
26 205  LEU n 
26 206  ASP n 
26 207  LYS n 
26 208  GLN n 
26 209  ALA n 
26 210  LYS n 
26 211  LEU n 
26 212  SER n 
26 213  ARG n 
26 214  ALA n 
26 215  TYR n 
26 216  ASP n 
26 217  GLY n 
26 218  THR n 
26 219  THR n 
26 220  TYR n 
26 221  LEU n 
26 222  PRO n 
26 223  GLY n 
26 224  ILE n 
26 225  VAL n 
26 226  GLY n 
26 227  LEU n 
26 228  ASN n 
26 229  ASN n 
26 230  ILE n 
26 231  LYS n 
26 232  ALA n 
26 233  ASN n 
26 234  ASP n 
26 235  TYR n 
26 236  ALA n 
26 237  ASN n 
26 238  ALA n 
26 239  VAL n 
26 240  LEU n 
26 241  GLN n 
26 242  ALA n 
26 243  LEU n 
26 244  SER n 
26 245  ASN n 
26 246  VAL n 
26 247  PRO n 
26 248  PRO n 
26 249  LEU n 
26 250  ARG n 
26 251  ASN n 
26 252  TYR n 
26 253  PHE n 
26 254  LEU n 
26 255  GLU n 
26 256  GLU n 
26 257  ASP n 
26 258  ASN n 
26 259  TYR n 
26 260  LYS n 
26 261  ASN n 
26 262  ILE n 
26 263  LYS n 
26 264  ARG n 
26 265  PRO n 
26 266  PRO n 
26 267  GLY n 
26 268  ASP n 
26 269  ILE n 
26 270  MET n 
26 271  PHE n 
26 272  LEU n 
26 273  LEU n 
26 274  VAL n 
26 275  GLN n 
26 276  ARG n 
26 277  PHE n 
26 278  GLY n 
26 279  GLU n 
26 280  LEU n 
26 281  MET n 
26 282  ARG n 
26 283  LYS n 
26 284  LEU n 
26 285  TRP n 
26 286  ASN n 
26 287  PRO n 
26 288  ARG n 
26 289  ASN n 
26 290  PHE n 
26 291  LYS n 
26 292  ALA n 
26 293  HIS n 
26 294  VAL n 
26 295  SER n 
26 296  PRO n 
26 297  HIS n 
26 298  GLU n 
26 299  MET n 
26 300  LEU n 
26 301  GLN n 
26 302  ALA n 
26 303  VAL n 
26 304  VAL n 
26 305  LEU n 
26 306  CYS n 
26 307  SER n 
26 308  LYS n 
26 309  LYS n 
26 310  THR n 
26 311  PHE n 
26 312  GLN n 
26 313  ILE n 
26 314  THR n 
26 315  LYS n 
26 316  GLN n 
26 317  GLY n 
26 318  ASP n 
26 319  GLY n 
26 320  VAL n 
26 321  ASP n 
26 322  PHE n 
26 323  LEU n 
26 324  SER n 
26 325  TRP n 
26 326  PHE n 
26 327  LEU n 
26 328  ASN n 
26 329  ALA n 
26 330  LEU n 
26 331  HIS n 
26 332  SER n 
26 333  ALA n 
26 334  LEU n 
26 335  GLY n 
26 336  GLY n 
26 337  THR n 
26 338  LYS n 
26 339  LYS n 
26 340  LYS n 
26 341  LYS n 
26 342  LYS n 
26 343  THR n 
26 344  ILE n 
26 345  VAL n 
26 346  THR n 
26 347  ASP n 
26 348  VAL n 
26 349  PHE n 
26 350  GLN n 
26 351  GLY n 
26 352  SER n 
26 353  MET n 
26 354  ARG n 
26 355  ILE n 
26 356  PHE n 
26 357  THR n 
26 358  LYS n 
26 359  LYS n 
26 360  LEU n 
26 361  PRO n 
26 362  HIS n 
26 363  PRO n 
26 364  ASP n 
26 365  LEU n 
26 366  PRO n 
26 367  ALA n 
26 368  GLU n 
26 369  GLU n 
26 370  LYS n 
26 371  GLU n 
26 372  GLN n 
26 373  LEU n 
26 374  LEU n 
26 375  HIS n 
26 376  ASN n 
26 377  ASP n 
26 378  GLU n 
26 379  TYR n 
26 380  GLN n 
26 381  GLU n 
26 382  THR n 
26 383  MET n 
26 384  VAL n 
26 385  GLU n 
26 386  SER n 
26 387  THR n 
26 388  PHE n 
26 389  MET n 
26 390  TYR n 
26 391  LEU n 
26 392  THR n 
26 393  LEU n 
26 394  ASP n 
26 395  LEU n 
26 396  PRO n 
26 397  THR n 
26 398  ALA n 
26 399  PRO n 
26 400  LEU n 
26 401  TYR n 
26 402  LYS n 
26 403  ASP n 
26 404  GLU n 
26 405  LYS n 
26 406  GLU n 
26 407  GLN n 
26 408  LEU n 
26 409  ILE n 
26 410  ILE n 
26 411  PRO n 
26 412  GLN n 
26 413  VAL n 
26 414  PRO n 
26 415  LEU n 
26 416  PHE n 
26 417  ASN n 
26 418  ILE n 
26 419  LEU n 
26 420  ALA n 
26 421  LYS n 
26 422  PHE n 
26 423  ASN n 
26 424  GLY n 
26 425  ILE n 
26 426  THR n 
26 427  GLU n 
26 428  LYS n 
26 429  GLU n 
26 430  TYR n 
26 431  LYS n 
26 432  THR n 
26 433  TYR n 
26 434  LYS n 
26 435  GLU n 
26 436  ASN n 
26 437  PHE n 
26 438  LEU n 
26 439  LYS n 
26 440  ARG n 
26 441  PHE n 
26 442  GLN n 
26 443  LEU n 
26 444  THR n 
26 445  LYS n 
26 446  LEU n 
26 447  PRO n 
26 448  PRO n 
26 449  TYR n 
26 450  LEU n 
26 451  ILE n 
26 452  PHE n 
26 453  CYS n 
26 454  ILE n 
26 455  LYS n 
26 456  ARG n 
26 457  PHE n 
26 458  THR n 
26 459  LYS n 
26 460  ASN n 
26 461  ASN n 
26 462  PHE n 
26 463  PHE n 
26 464  VAL n 
26 465  GLU n 
26 466  LYS n 
26 467  ASN n 
26 468  PRO n 
26 469  THR n 
26 470  ILE n 
26 471  VAL n 
26 472  ASN n 
26 473  PHE n 
26 474  PRO n 
26 475  ILE n 
26 476  THR n 
26 477  ASN n 
26 478  VAL n 
26 479  ASP n 
26 480  LEU n 
26 481  ARG n 
26 482  GLU n 
26 483  TYR n 
26 484  LEU n 
26 485  SER n 
26 486  GLU n 
26 487  GLU n 
26 488  VAL n 
26 489  GLN n 
26 490  ALA n 
26 491  VAL n 
26 492  HIS n 
26 493  LYS n 
26 494  ASN n 
26 495  THR n 
26 496  THR n 
26 497  TYR n 
26 498  ASP n 
26 499  LEU n 
26 500  ILE n 
26 501  ALA n 
26 502  ASN n 
26 503  ILE n 
26 504  VAL n 
26 505  HIS n 
26 506  ASP n 
26 507  GLY n 
26 508  LYS n 
26 509  PRO n 
26 510  SER n 
26 511  GLU n 
26 512  GLY n 
26 513  SER n 
26 514  TYR n 
26 515  ARG n 
26 516  ILE n 
26 517  HIS n 
26 518  VAL n 
26 519  LEU n 
26 520  HIS n 
26 521  HIS n 
26 522  GLY n 
26 523  THR n 
26 524  GLY n 
26 525  LYS n 
26 526  TRP n 
26 527  TYR n 
26 528  GLU n 
26 529  LEU n 
26 530  GLN n 
26 531  ASP n 
26 532  LEU n 
26 533  GLN n 
26 534  VAL n 
26 535  THR n 
26 536  ASP n 
26 537  ILE n 
26 538  LEU n 
26 539  PRO n 
26 540  GLN n 
26 541  MET n 
26 542  ILE n 
26 543  THR n 
26 544  LEU n 
26 545  SER n 
26 546  GLU n 
26 547  ALA n 
26 548  TYR n 
26 549  ILE n 
26 550  GLN n 
26 551  ILE n 
26 552  TRP n 
26 553  LYS n 
26 554  ARG n 
26 555  ARG n 
26 556  ASP n 
26 557  ASN n 
26 558  ASP n 
26 559  GLU n 
26 560  THR n 
26 561  ASN n 
26 562  GLN n 
26 563  GLN n 
26 564  GLY n 
26 565  ALA n 
27 1    A   n 
27 2    G   n 
27 3    C   n 
27 4    U   n 
27 5    U   n 
27 6    U   n 
27 7    G   n 
27 8    C   n 
27 9    G   n 
27 10   C   n 
27 11   A   n 
27 12   G   n 
27 13   U   n 
27 14   G   n 
27 15   G   n 
27 16   C   n 
27 17   A   n 
27 18   G   n 
27 19   U   n 
27 20   A   n 
27 21   U   n 
27 22   C   n 
27 23   G   n 
27 24   U   n 
27 25   A   n 
27 26   G   n 
27 27   C   n 
27 28   C   n 
27 29   A   n 
27 30   A   n 
27 31   U   n 
27 32   G   n 
27 33   A   n 
27 34   G   n 
27 35   G   n 
27 36   U   n 
27 37   U   n 
27 38   U   n 
27 39   A   n 
27 40   U   n 
27 41   C   n 
27 42   C   n 
27 43   G   n 
27 44   A   n 
27 45   G   n 
27 46   G   n 
27 47   C   n 
27 48   G   n 
27 49   C   n 
27 50   G   n 
27 51   A   n 
27 52   U   n 
27 53   U   n 
27 54   A   n 
27 55   U   n 
27 56   U   n 
27 57   G   n 
27 58   C   n 
27 59   U   n 
27 60   A   n 
27 61   A   n 
27 62   U   n 
27 63   U   n 
27 64   G   n 
27 65   A   n 
27 66   A   n 
27 67   A   n 
27 68   A   n 
27 69   C   n 
27 70   U   n 
27 71   U   n 
27 72   U   n 
27 73   U   n 
27 74   C   n 
27 75   C   n 
27 76   C   n 
27 77   A   n 
27 78   A   n 
27 79   U   n 
27 80   A   n 
27 81   C   n 
27 82   C   n 
27 83   C   n 
27 84   C   n 
27 85   G   n 
27 86   C   n 
27 87   C   n 
27 88   A   n 
27 89   U   n 
27 90   G   n 
27 91   A   n 
27 92   C   n 
27 93   G   n 
27 94   A   n 
27 95   C   n 
27 96   U   n 
27 97   U   n 
27 98   G   n 
27 99   A   n 
27 100  A   n 
27 101  A   n 
27 102  U   n 
27 103  A   n 
27 104  U   n 
27 105  A   n 
27 106  G   n 
27 107  U   n 
27 108  C   n 
27 109  G   n 
27 110  G   n 
27 111  C   n 
27 112  A   n 
27 113  U   n 
27 114  U   n 
27 115  G   n 
27 116  G   n 
27 117  C   n 
27 118  A   n 
27 119  A   n 
27 120  U   n 
27 121  U   n 
27 122  U   n 
27 123  U   n 
27 124  U   n 
27 125  G   n 
27 126  A   n 
27 127  C   n 
27 128  A   n 
27 129  G   n 
27 130  U   n 
27 131  C   n 
27 132  U   n 
27 133  C   n 
27 134  U   n 
27 135  A   n 
27 136  C   n 
27 137  G   n 
27 138  G   n 
27 139  A   n 
27 140  G   n 
27 141  A   n 
27 142  C   n 
27 143  U   n 
27 144  G   n 
27 145  G   n 
28 1    G   n 
28 2    U   n 
28 3    G   n 
28 4    C   n 
28 5    U   n 
28 6    C   n 
28 7    G   n 
28 8    C   n 
28 9    U   n 
28 10   U   n 
28 11   C   n 
28 12   G   n 
28 13   G   n 
28 14   C   n 
28 15   A   n 
28 16   G   n 
28 17   C   n 
28 18   A   n 
28 19   C   n 
28 20   A   n 
28 21   U   n 
28 22   A   n 
28 23   U   n 
28 24   A   n 
28 25   C   n 
28 26   U   n 
28 27   A   n 
28 28   A   n 
28 29   A   n 
28 30   A   n 
28 31   U   n 
28 32   U   n 
28 33   G   n 
28 34   G   n 
28 35   A   n 
28 36   A   n 
28 37   C   n 
28 38   G   n 
28 39   A   n 
28 40   U   n 
28 41   A   n 
28 42   C   n 
28 43   A   n 
28 44   G   n 
28 45   A   n 
28 46   G   n 
28 47   A   n 
28 48   A   n 
28 49   G   n 
28 50   A   n 
28 51   U   n 
28 52   U   n 
28 53   A   n 
28 54   G   n 
28 55   C   n 
28 56   A   n 
28 57   U   n 
28 58   G   n 
28 59   G   n 
28 60   C   n 
28 61   C   n 
28 62   C   n 
28 63   C   n 
28 64   U   n 
28 65   G   n 
28 66   C   n 
28 67   G   n 
28 68   C   n 
28 69   A   n 
28 70   A   n 
28 71   G   n 
28 72   G   n 
28 73   A   n 
28 74   U   n 
28 75   G   n 
28 76   A   n 
28 77   C   n 
28 78   A   n 
28 79   C   n 
28 80   G   n 
28 81   C   n 
28 82   A   n 
28 83   A   n 
28 84   A   n 
28 85   U   n 
28 86   U   n 
28 87   C   n 
28 88   G   n 
28 89   U   n 
28 90   G   n 
28 91   A   n 
28 92   A   n 
28 93   G   n 
28 94   C   n 
28 95   G   n 
28 96   U   n 
28 97   U   n 
28 98   C   n 
28 99   C   n 
28 100  A   n 
28 101  U   n 
28 102  A   n 
28 103  U   n 
28 104  U   n 
28 105  U   n 
28 106  U   n 
29 1    A   n 
29 2    U   n 
29 3    A   n 
29 4    C   n 
29 5    U   n 
29 6    C   n 
29 7    U   n 
29 8    G   n 
29 9    G   n 
29 10   U   n 
29 11   U   n 
29 12   U   n 
29 13   C   n 
29 14   U   n 
29 15   C   n 
29 16   U   n 
29 17   U   n 
29 18   C   n 
29 19   A   n 
29 20   G   n 
29 21   A   n 
29 22   U   n 
29 23   C   n 
29 24   G   n 
29 25   C   n 
29 26   A   n 
29 27   U   n 
29 28   A   n 
29 29   A   n 
29 30   A   n 
29 31   U   n 
29 32   C   n 
29 33   U   n 
29 34   U   n 
29 35   U   n 
29 36   C   n 
29 37   G   n 
29 38   C   n 
29 39   C   n 
29 40   U   n 
29 41   U   n 
29 42   U   n 
29 43   U   n 
29 44   A   n 
29 45   C   n 
29 46   U   n 
29 47   A   n 
29 48   A   n 
29 49   A   n 
29 50   G   n 
29 51   A   n 
29 52   U   n 
29 53   U   n 
29 54   U   n 
29 55   C   n 
29 56   C   n 
29 57   G   n 
29 58   U   n 
29 59   G   n 
29 60   G   n 
29 61   A   n 
29 62   G   n 
29 63   A   n 
29 64   G   n 
29 65   G   n 
29 66   A   n 
29 67   A   n 
29 68   C   n 
29 69   A   n 
29 70   A   n 
29 71   C   n 
29 72   U   n 
29 73   C   n 
29 74   U   n 
29 75   G   n 
29 76   A   n 
29 77   G   n 
29 78   U   n 
29 79   C   n 
29 80   U   n 
29 81   U   n 
29 82   A   n 
29 83   A   n 
29 84   C   n 
29 85   C   n 
29 86   C   n 
29 87   A   n 
29 88   A   n 
29 89   U   n 
29 90   U   n 
29 91   U   n 
29 92   U   n 
29 93   U   n 
29 94   U   n 
29 95   G   n 
29 96   A   n 
29 97   G   n 
29 98   C   n 
29 99   C   n 
29 100  U   n 
29 101  U   n 
29 102  G   n 
29 103  C   n 
29 104  U   n 
29 105  C   n 
29 106  C   n 
29 107  G   n 
29 108  A   n 
29 109  C   n 
29 110  A   n 
29 111  A   n 
29 112  G   n 
29 113  G   n 
29 114  C   n 
29 115  U   n 
29 116  A   n 
# 
loop_
_entity_src_nat.entity_id 
_entity_src_nat.pdbx_src_id 
_entity_src_nat.pdbx_alt_source_flag 
_entity_src_nat.pdbx_beg_seq_num 
_entity_src_nat.pdbx_end_seq_num 
_entity_src_nat.common_name 
_entity_src_nat.pdbx_organism_scientific 
_entity_src_nat.pdbx_ncbi_taxonomy_id 
_entity_src_nat.genus 
_entity_src_nat.species 
_entity_src_nat.strain 
_entity_src_nat.tissue 
_entity_src_nat.tissue_fraction 
_entity_src_nat.pdbx_secretion 
_entity_src_nat.pdbx_fragment 
_entity_src_nat.pdbx_variant 
_entity_src_nat.pdbx_cell_line 
_entity_src_nat.pdbx_atcc 
_entity_src_nat.pdbx_cellular_location 
_entity_src_nat.pdbx_organ 
_entity_src_nat.pdbx_organelle 
_entity_src_nat.pdbx_cell 
_entity_src_nat.pdbx_plasmid_name 
_entity_src_nat.pdbx_plasmid_details 
_entity_src_nat.details 
1  1 sample ? ? human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
2  1 sample ? ? human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
3  1 sample ? ? human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
4  1 sample ? ? human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
5  1 sample ? ? human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
6  1 sample ? ? human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
7  1 sample ? ? human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
8  1 sample ? ? human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
9  1 sample ? ? human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
10 1 sample ? ? human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
11 1 sample ? ? human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
12 1 sample ? ? human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
13 1 sample ? ? human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
14 1 sample ? ? human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
15 1 sample ? ? human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
16 1 sample ? ? human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
17 1 sample ? ? human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
18 1 sample ? ? human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
19 1 sample ? ? human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
20 1 sample ? ? human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
21 1 sample ? ? human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
22 1 sample ? ? human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
23 1 sample ? ? human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
24 1 sample ? ? human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
25 1 sample ? ? human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
26 1 sample ? ? human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
27 1 sample ? ? human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
28 1 sample ? ? human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
29 1 sample ? ? human 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1  UNP PRP6_HUMAN   O94906 1  
;MNKKKKPFLGMPAPLGYVPGLGRGATGFTTRSDIGPARDANDPVDDRHAPPGKRTVGDQMKKNQAADDDDEDLNDTNYDE
FNGYAGSLFSSGPYEKDDEEADAIYAALDKRMDERRKERREQREKEEIEKYRMERPKIQQQFSDLKRKLAEVTEEEWLSI
PEVGDARNKRQRNPRYEKLTPVPDSFFAKHLQTGENHTSVDPRQTQFGGLNTPYPGGLNTPYPGGMTPGLMTPGTGELDM
RKIGQARNTLMDMRLSQVSDSVSGQTVVDPKGYLTDLNSMIPTHGGDINDIKKARLLLKSVRETNPHHPPAWIASARLEE
VTGKLQVARNLIMKGTEMCPKSEDVWLEAARLQPGDTAKAVVAQAVRHLPQSVRIYIRAAELETDIRAKKRVLRKALEHV
PNSVRLWKAAVELEEPEDARIMLSRAVECCPTSVELWLALARLETYENARKVLNKARENIPTDRHIWITAAKLEEANGNT
QMVEKIIDRAITSLRANGVEINREQWIQDAEECDRAGSVATCQAVMRAVIGIGIEEEDRKHTWMEDADSCVAHNALECAR
AIYAYALQVFPSKKSVWLRAAYFEKNHGTRESLEALLQRAVAHCPKAEVLWLMGAKSKWLAGDVPAARSILALAFQANPN
SEEIWLAAVKLESENDEYERARRLLAKARSSAPTARVFMKSVKLEWVQDNIRAAQDLCEEALRHYEDFPKLWMMKGQIEE
QKEMMEKAREAYNQGLKKCPHSTPLWLLLSRLEEKIGQLTRARAILEKSRLKNPKNPGLWLESVRLEYRAGLKNIANTLM
AKALQECPNSGILWSEAIFLEARPQRRTKSVDALKKCEHDPHVLLAVAKLFWSQRKITKAREWFHRTVKIDSDLGDAWAF
FYKFELQHGTEEQQEEVRKRCESAEPRHGELWCAVSKDIANWQKKIGDILRLVAGRIKNTF
;
1 ? 
2  UNP SNR40_HUMAN  Q96DI7 2  
;MIEQQKRKGPELPLVPVKRQRHELLLGAGSGPGAGQQQATPGALLQAGPPRCSSLQAPIMLLSGHEGEVYCCKFHPNGST
LASAGFDRLILLWNVYGDCDNYATLKGHSGAVMELHYNTDGSMLFSASTDKTVAVWDSETGERVKRLKGHTSFVNSCYPA
RRGPQLVCTGSDDGTVKLWDIRKKAAIQTFQNTYQVLAVTFNDTSDQIISGGIDNDIKVWDLRQNKLTYTMRGHADSVTG
LSLSSEGSYLLSNAMDNTVRVWDVRPFAPKERCVKIFQGNVHNFEKNLLRCSWSPDGSKIAAGSADRFVYVWDTTSRRIL
YKLPGHAGSINEVAFHPDEPIIISASSDKRLYMGEIQ
;
1 ? 
3  UNP U520_HUMAN   O75643 3  
;MADVTARSLQYEYKANSNLVLQADRSLIDRTRRDEPTGEVLSLVGKLEGTRMGDKAQRTKPQMQEERRAKRRKRDEDRHD
INKMKGYTLLSEGIDEMVGIIYKPKTKETRETYEVLLSFIQAALGDQPRDILCGAADEVLAVLKNEKLRDKERRKEIDLL
LGQTDDTRYHVLVNLGKKITDYGGDKEIQNMDDNIDETYGVNVQFESDEEEGDEDVYGEVREEASDDDMEGDEAVVRCTL
SANLVASGELMSSKKKDLHPRDIDAFWLQRQLSRFYDDAIVSQKKADEVLEILKTASDDRECENQLVLLLGFNTFDFIKV
LRQHRMMILYCTLLASAQSEAEKERIMGKMEADPELSKFLYQLHETEKEDLIREERSRRERVRQSRMDTDLETMDLDQGG
EALAPRQVLDLEDLVFTQGSHFMANKRCQLPDGSFRRQRKGYEEVHVPALKPKPFGSEEQLLPVEKLPKYAQAGFEGFKT
LNRIQSKLYRAALETDENLLLCAPTGAGKTNVALMCMLREIGKHINMDGTINVDDFKIIYIAPMRSLVQEMVGSFGKRLA
TYGITVAELTGDHQLCKEEISATQIIVCTPEKWDIITRKGGERTYTQLVRLIILDEIHLLHDDRGPVLEALVARAIRNIE
MTQEDVRLIGLSATLPNYEDVATFLRVDPAKGLFYFDNSFRPVPLEQTYVGITEKKAIKRFQIMNEIVYEKIMEHAGKNQ
VLVFVHSRKETGKTARAIRDMCLEKDTLGLFLREGSASTEVLRTEAEQCKNLELKDLLPYGFAIHHAGMTRVDRTLVEDL
FADKHIQVLVSTATLAWGVNLPAHTVIIKGTQVYSPEKGRWTELGALDILQMLGRAGRPQYDTKGEGILITSHGELQYYL
SLLNQQLPIESQMVSKLPDMLNAEIVLGNVQNAKDAVNWLGYAYLYIRMLRSPTLYGISHDDLKGDPLLDQRRLDLVHTA
ALMLDKNNLVKYDKKTGNFQVTELGRIASHYYITNDTVQTYNQLLKPTLSEIELFRVFSLSSEFKNITVREEEKLELQKL
LERVPIPVKESIEEPSAKINVLLQAFISQLKLEGFALMADMVYVTQSAGRLMRAIFEIVLNRGWAQLTDKTLNLCKMIDK
RMWQSMCPLRQFRKLPEEVVKKIEKKNFPFERLYDLNHNEIGELIRMPKMGKTIHKYVHLFPKLELSVHLQPITRSTLKV
ELTITPDFQWDEKVHGSSEAFWILVEDVDSEVILHHEYFLLKAKYAQDEHLITFFVPVFEPLPPQYFIRVVSDRWLSCET
QLPVSFRHLILPEKYPPPTELLDLQPLPVSALRNSAFESLYQDKFPFFNPIQTQVFNTVYNSDDNVFVGAPTGSGKTICA
EFAILRMLLQSSEGRCVYITPMEALAEQVYMDWYEKFQDRLNKKVVLLTGETSTDLKLLGKGNIIISTPEKWDILSRRWK
QRKNVQNINLFVVDEVHLIGGENGPVLEVICSRMRYISSQIERPIRIVALSSSLSNAKDVAHWLGCSATSTFNFHPNVRP
VPLELHIQGFNISHTQTRLLSMAKPVYHAITKHSPKKPVIVFVPSRKQTRLTAIDILTTCAADIQRQRFLHCTEKDLIPY
LEKLSDSTLKETLLNGVGYLHEGLSPMERRLVEQLFSSGAIQVVVASRSLCWGMNVAAHLVIIMDTQYYNGKIHAYVDYP
IYDVLQMVGHANRPLQDDEGRCVIMCQGSKKDFFKKFLYEPLPVESHLDHCMHDHFNAEIVTKTIENKQDAVDYLTWTFL
YRRMTQNPNYYNLQGISHRHLSDHLSELVEQTLSDLEQSKCISIEDEMDVAPLNLGMIAAYYYINYTTIELFSMSLNAKT
KVRGLIEIISNAAEYENIPIRHHEDNLLRQLAQKVPHKLNNPKFNDPHVKTNLLLQAHLSRMQLSAELQSDTEEILSKAI
RLIQACVDVLSSNGWLSPALAAMELAQMVTQAMWSKDSYLKQLPHFTSEHIKRCTDKGVESVFDIMEMEDEERNALLQLT
DSQIADVARFCNRYPNIELSYEVVDKDSIRSGGPVVVLVQLEREEEVTGPVIAPLFPQKREEGWWVVIGDAKSNSLISIK
RLTLQQKAKVKLDFVAPATGAHNYTLYFMSDAYMGCDQEYKFSVDVKEAETDSDSD
;
1 ? 
4  UNP TXN4A_HUMAN  P83876 4  
;MSYMLPHLHNGWQVDQAILSEEDRVVVIRFGHDWDPTCMKMDEVLYSIAEKVKNFAVIYLVDITEVPDFNKMYELYDPCT
VMFFFRNKHIMIDLGTGNNNKINWAMEDKQEMVDIIETVYRGARKGRGLVVSPKDYSTKYRY
;
1 ? 
5  UNP PRP8_HUMAN   Q6P2Q9 5  
;MAGVFPYRGPGNPVPGPLAPLPDYMSEEKLQEKARKWQQLQAKRYAEKRKFGFVDAQKEDMPPEHVRKIIRDHGDMTNRK
FRHDKRVYLGALKYMPHAVLKLLENMPMPWEQIRDVPVLYHITGAISFVNEIPWVIEPVYISQWGSMWIMMRREKRDRRH
FKRMRFPPFDDEEPPLDYADNILDVEPLEAIQLELDPEEDAPVLDWFYDHQPLRDSRKYVNGSTYQRWQFTLPMMSTLYR
LANQLLTDLVDDNYFYLFDLKAFFTSKALNMAIPGGPKFEPLVRDINLQDEDWNEFNDINKIIIRQPIRTEYKIAFPYLY
NNLPHHVHLTWYHTPNVVFIKTEDPDLPAFYFDPLINPISHRHSVKSQEPLPDDDEEFELPEFVEPFLKDTPLYTDNTAN
GIALLWAPRPFNLRSGRTRRALDIPLVKNWYREHCPAGQPVKVRVSYQKLLKYYVLNALKHRPPKAQKKRYLFRSFKATK
FFQSTKLDWVEVGLQVCRQGYNMLNLLIHRKNLNYLHLDYNFNLKPVKTLTTKERKKSRFGNAFHLCREVLRLTKLVVDS
HVQYRLGNVDAFQLADGLQYIFAHVGQLTGMYRYKYKLMRQIRMCKDLKHLIYYRFNTGPVGKGPGCGFWAAGWRVWLFF
MRGITPLLERWLGNLLARQFEGRHSKGVAKTVTKQRVESHFDLELRAAVMHDILDMMPEGIKQNKARTILQHLSEAWRCW
KANIPWKVPGLPTPIENMILRYVKAKADWWTNTAHYNRERIRRGATVDKTVCKKNLGRLTRLYLKAEQERQHNYLKDGPY
ITAEEAVAVYTTTVHWLESRRFSPIPFPPLSYKHDTKLLILALERLKEAYSVKSRLNQSQREELGLIEQAYDNPHEALSR
IKRHLLTQRAFKEVGIEFMDLYSHLVPVYDVEPLEKITDAYLDQYLWYEADKRRLFPPWIKPADTEPPPLLVYKWCQGIN
NLQDVWETSEGECNVMLESRFEKMYEKIDLTLLNRLLRLIVDHNIADYMTAKNNVVINYKDMNHTNSYGIIRGLQFASFI
VQYYGLVMDLLVLGLHRASEMAGPPQMPNDFLSFQDIATEAAHPIRLFCRYIDRIHIFFRFTADEARDLIQRYLTEHPDP
NNENIVGYNNKKCWPRDARMRLMKHDVNLGRAVFWDIKNRLPRSVTTVQWENSFVSVYSKDNPNLLFNMCGFECRILPKC
RTSYEEFTHKDGVWNLQNEVTKERTAQCFLRVDDESMQRFHNRVRQILMASGSTTFTKIVNKWNTALIGLMTYFREAVVN
TQELLDLLVKCENKIQTRIKIGLNSKMPSRFPPVVFYTPKELGGLGMLSMGHVLIPQSDLRWSKQTDVGITHFRSGMSHE
EDQLIPNLYRYIQPWESEFIDSQRVWAEYALKRQEAIAQNRRLTLEDLEDSWDRGIPRINTLFQKDRHTLAYDKGWRVRT
DFKQYQVLKQNPFWWTHQRHDGKLWNLNNYRTDMIQALGGVEGILEHTLFKGTYFPTWEGLFWEKASGFEESMKWKKLTN
AQRSGLNQIPNRRFTLWWSPTINRANVYVGFQVQLDLTGIFMHGKIPTLKISLIQIFRAHLWQKIHESIVMDLCQVFDQE
LDALEIETVQKETIHPRKSYKMNSSCADILLFASYKWNVSRPSLLADSKDVMDSTTTQKYWIDIQLRWGDYDSHDIERYA
RAKFLDYTTDNMSIYPSPTGVLIAIDLAYNLHSAYGNWFPGSKPLIQQAMAKIMKANPALYVLRERIRKGLQLYSSEPTE
PYLSSQNYGELFSNQIIWFVDDTNVYRVTIHKTFEGNLTTKPINGAIFIFNPRTGQLFLKIIHTSVWAGQKRLGQLAKWK
TAEEVAALIRSLPVEEQPKQIIVTRKGMLDPLEVHLLDFPNIVIKGSELQLPFQACLKVEKFGDLILKATEPQMVLFNLY
DDWLKTISSYTAFSRLILILRALHVNNDRAKVILKPDKTTITEPHHIWPTLTDEEWIKVEVQLKDLILADYGKKNNVNVA
SLTQSEIRDIILGMEISAPSQQRQQIAEIEKQTKEQSQLTATQTRTVNKHGDEIITSTTSNYETQTFSSKTEWRVRAISA
ANLHLRTNHIYVSSDDIKETGYTYILPKNVLKKFICISDLRAQIAGYLYGVSPPDNPQVKEIRCIVMVPQWGTHQTVHLP
GQLPQHEYLKEMEPLGWIHTQPNESPQLSPQDVTTHAKIMADNPSWDGEKTIIITCSFTPGSCTLTAYKLTPSGYEWGRQ
NTDKGNNPKGYLPSHYERVQMLLSDRFLGFFMVPAQSSWNYNFMGVRHDPNMKYELQLANPKEFYHEVHRPSHFLNFALL
QEGEVYSADREDLYA
;
1 ? 
6  UNP DDX23_HUMAN  Q9BUQ8 6  
;MAGELADKKDRDASPSKEERKRSRTPDRERDRDRDRKSSPSKDRKRHRSRDRRRGGSRSRSRSRSKSAERERRHKERERD
KERDRNKKDRDRDKDGHRRDKDRKRSSLSPGRGKDFKSRKDRDSKKDEEDEHGDKKPKAQPLSLEELLAKKKAEEEAEAK
PKFLSKAEREAEALKRRQQEVEERQRMLEEERKKRKQFQDLGRKMLEDPQERERRERRERMERETNGNEDEEGRQKIREE
KDKSKELHAIKERYLGGIKKRRRTRHLNDRKFVFEWDASEDTSIDYNPLYKERHQVQLLGRGFIAGIDLKQQKREQSRFY
GDLMEKRRTLEEKEQEEARLRKLRKKEAKQRWDDRHWSQKKLDEMTDRDWRIFREDYSITTKGGKIPNPIRSWKDSSLPP
HILEVIDKCGYKEPTPIQRQAIPIGLQNRDIIGVAETGSGKTAAFLIPLLVWITTLPKIDRIEESDQGPYAIILAPTREL
AQQIEEETIKFGKPLGIRTVAVIGGISREDQGFRLRMGCEIVIATPGRLIDVLENRYLVLSRCTYVVLDEADRMIDMGFE
PDVQKILEHMPVSNQKPDTDEAEDPEKMLANFESGKHKYRQTVMFTATMPPAVERLARSYLRRPAVVYIGSAGKPHERVE
QKVFLMSESEKRKKLLAILEQGFDPPIIIFVNQKKGCDVLAKSLEKMGYNACTLHGGKGQEQREFALSNLKAGAKDILVA
TDVAGRGIDIQDVSMVVNYDMAKNIEDYIHRIGRTGRAGKSGVAITFLTKEDSAVFYELKQAILESPVSSCPPELANHPD
AQHKPGTILTKKRREETIFA
;
1 ? 
7  UNP U5S1_HUMAN   Q15029 7  
;MDTDLYDEFGNYIGPELDSDEDDDELGRETKDLDEMDDDDDDDDVGDHDDDHPGMEVVLHEDKKYYPTAEEVYGPEVETI
VQEEDTQPLTEPIIKPVKTKKFTLMEQTLPVTVYEMDFLADLMDNSELIRNVTLCGHLHHGKTCFVDCLIEQTHPEIRKR
YDQDLCYTDILFTEQERGVGIKSTPVTVVLPDTKGKSYLFNIMDTPGHVNFSDEVTAGLRISDGVVLFIDAAEGVMLNTE
RLIKHAVQERLAVTVCINKIDRLILELKLPPTDAYYKLRHIVDEVNGLISMYSTDENLILSPLLGNVCFSSSQYSICFTL
GSFAKIYADTFGDINYQEFAKRLWGDIYFNPKTRKFTKKAPTSSSQRSFVEFILEPLYKILAQVVGDVDTSLPRTLDELG
IHLTKEELKLNIRPLLRLVCKKFFGEFTGFVDMCVQHIPSPKVGAKPKIEHTYTGGVDSDLGEAMSDCDPDGPLMCHTTK
MYSTDDGVQFHAFGRVLSGTIHAGQPVKVLGENYTLEDEEDSQICTVGRLWISVARYHIEVNRVPAGNWVLIEGVDQPIV
KTATITEPRGNEEAQIFRPLKFNTTSVIKIAVEPVNPSELPKMLDGLRKVNKSYPSLTTKVEESGEHVILGTGELYLDCV
MHDLRKMYSEIDIKVADPVVTFCETVVETSSLKCFAETPNKKNKITMIAEPLEKGLAEDIENEVVQITWNRKKLGEFFQT
KYDWDLLAARSIWAFGPDATGPNILVDDTLPSEVDKALLGSVKDSIVQGFQWGTREGPLCDELIRNVKFKILDAVVAQEP
LHRGGGQIIPTARRVVYSAFLMATPRLMEPYYFVEVQAPADCVSAVYTVLARRRGHVTQDAPIPGSPLYTIKAFIPAIDS
FGFETDLRTHTQGQAFSLSVFHHWQIVPGDPLDKSIVIRPLEPQPAPHLAREFMIKTRRRKGLSEDVSISKFFDDPMLLE
LAKQDVVLNYPM
;
1 ? 
8  UNP RSMB_HUMAN   P14678 8  
;MTVGKSSKMLQHIDYRMRCILQDGRIFIGTFKAFDKHMNLILCDCDEFRKIKPKNSKQAEREEKRVLGLVLLRGENLVSM
TVEGPPPKDTGIARVPLAGAAGGPGIGRAAGRGIPAGVPMPQAPAGLAGPVRGVGGPSQQVMTPQGRGTVAAAAAAATAS
IAGAPTQYPPGRGGPPPPMGRGAPPPGMMGPPPGMRPPMGPPMGIPPGRGTPMGMPPPGMRPPPPGMRGPPPPGMRPPRP

;
1 ? 
9  UNP SMD1_HUMAN   P62314 9  
;MKLVRFLMKLSHETVTIELKNGTQVHGTITGVDVSMNTHLKAVKMTLKNREPVQLETLSIRGNNIRYFILPDSLPLDTLL
VDVEPKVKSKKREAVAGRGRGRGRGRGRGRGRGRGGPRR
;
1 ? 
10 UNP SMD2_HUMAN   P62316 10 
;MSLLNKPKSEMTPEELQKREEEEFNTGPLSVLTQSVKNNTQVLINCRNNKKLLGRVKAFDRHCNMVLENVKEMWTEVPKS
GKGKKKSKPVNKDRYISKMFLRGDSVIVVLRNPLIAGK
;
1 ? 
11 UNP SMD3_HUMAN   P62318 11 
;MSIGVPIKVLHEAEGHIVTCETNTGEVYRGKLIEAEDNMNCQMSNITVTYRDGRVAQLEQVYIRGSKIRFLILPDMLKNA
PMLKSMKNKNQGSGAGRGKAAILKAQVAARGRGRGMGRGNIFQKRR
;
1 ? 
12 UNP RUXE_HUMAN   P62304 12 
;MAYRGQGQKVQKVMVQPINLIFRYLQNRSRIQVWLYEQVNMRIEGCIIGFDEYMNLVLDDAEEIHSKTKSRKQLGRIMLK
GDNITLLQSVSN
;
1 ? 
13 UNP RUXF_HUMAN   P62306 13 
;MSLPLNPKPFLNGLTGKPVMVKLKWGMEYKGYLVSVDGYMNMQLANTEEYIDGALSGHLGEVLIRCNNVLYIRGVEEEEE
DGEMRE
;
1 ? 
14 UNP RUXG_HUMAN   P62308 14 MSKAHPPELKKFMDKKLSLKLNGGRHVQGILRGFDPFMNLVIDECVEMATSGQQNNIGMVVIRGNSIIMLEALERV 1 ? 
15 UNP LSM8_HUMAN   O95777 15 
;MTSALENYINRTVAVITSDGRMIVGTLKGFDQTINLILDESHERVFSSSQGVEQVVLGLYIVRGDNVAVIGEIDEETDSA
LDLGNIRAEPLNSVAH
;
1 ? 
16 UNP LSM6_HUMAN   P62312 16 
;MSLRKQTPSDFLKQIIGRPVVVKLNSGVDYRGVLACLDGYMNIALEQTEEYVNGQLKNKYGDAFIRGNNVLYISTQKRRM

;
1 ? 
17 UNP LSM5_HUMAN   Q9Y4Y9 17 
;MAANATTNPSQLLPLELVDKCIGSRIHIVMKSDKEIVGTLLGFDDFVNMVLEDVTEFEITPEGRRITKLDQILLNGNNIT
MLVPGGEGPEV
;
1 ? 
18 UNP LSM4_HUMAN   Q9Y4Z0 18 
;MLPLSLLKTAQNHPMLVELKNGETYNGHLVSCDNWMNINLREVICTSRDGDKFWRMPECYIRGSTIKYLRIPDEIIDMVK
EEVVAKGRGRGGLQQQKQQKGRGMGGAGRGVFGGRGRGGIPGTGRGQPEKKPGRQAGKQ
;
1 ? 
19 UNP LSM3_HUMAN   P62310 19 
;MADDVDQQQTTNTVEEPLDLIRLSLDERIYVKMRNDRELRGRLHAYDQHLNMILGDVEETVTTIEIDEETYEEIYKSTKR
NIPMLFVRGDGVVLVAPPLRVG
;
1 ? 
20 UNP LSM2_HUMAN   Q9Y333 20 
;MLFYSFFKSLVGKDVVVELKNDLSICGTLHSVDQYLNIKLTDISVTDPEKYPHMLSVKNCFIRGSVVRYVQLPADEVDTQ
LLQDAARKEALQQKQ
;
1 ? 
21 UNP LSM7_HUMAN   Q9UK45 21 
;MADKEKKKKESILDLSKYIDKTIRVKFQGGREASGILKGFDPLLNLVLDGTIEYMRDPDDQYKLTEDTRQLGLVVCRGTS
VVLICPQDGMEAIPNPFIQQQDA
;
1 ? 
22 UNP PRPF3_HUMAN  O43395 22 
;MALSKRELDELKPWIEKTVKRVLGFSEPTVVTAALNCVGKGMDKKKAADHLKPFLDDSTLRFVDKLFEAVEEGRSSRHSK
SSSDRSRKRELKEVFGDDSEISKESSGVKKRRIPRFEEVEEEPEVIPGPPSESPGMLTKLQIKQMMEAATRQIEERKKQL
SFISPPTPQPKTPSSSQPERLPIGNTIQPSQAATFMNDAIEKARKAAELQARIQAQLALKPGLIGNANMVGLANLHAMGI
APPKVELKDQTKPTPLILDEQGRTVDATGKEIELTHRMPTLKANIRAVKREQFKQQLKEKPSEDMESNTFFDPRVSIAPS
QRQRRTFKFHDKGKFEKIAQRLRTKAQLEKLQAEISQAARKTGIHTSTRLALIAPKKELKEGDIPEIEWWDSYIIPNGFD
LTEENPKREDYFGITNLVEHPAQLNPPVDNDTPVTLGVYLTKKEQKKLRRQTRREAQKELQEKVRLGLMPPPEPKVRISN
LMRVLGTEAVQDPTKVEAHVRAQMAKRQKAHEEANAARKLTAEQRKVKKIKKLKEDISQGVHISVYRVRNLSNPAKKFKI
EANAGQLYLTGVVVLHKDVNVVVVEGGPKAQKKFKRLMLHRIKWDEQTSNTKGDDDEESDEEAVKKTNKCVLVWEGTAKD
RSFGEMKFKQCPTENMAREHFKKHGAEHYWDLALSESVLESTD
;
1 ? 
23 UNP Q5T1M7_HUMAN Q5T1M7 23 
;MASSRASSTATKTKAPDDLVAPVVKKPHIYYGSLEEKERERLAKGESGILGKDGLKAGIEAGNINITSGEVFEIEEHISE
RQAEVLAEFERRKRARQINVSTDDSEVKACLRALGEPITLFGEGPAERRERLRNILSVVGTDALKKTKKDDEKSKKSKEE
YQQTWYHEGPNSLKVARLWIANYSLPRAMKRLEEARLHKEIPETTRTSQMQELHKSLRSLNNFCSQIGDDRPISYCHFSP
NSKMLATACWSGLCKLWSVPDCNLLHTLRGHNTNVGAIVFHPKSTVSLDPKDVNLASCAADGSVKLWSLDSDEPVADIEG
HTVRVARVMWHPSGRFLGTTCYDRSWRLWDLEAQEEILHQEGHSMGVYDIAFHQDGSLAGTGGLDAFGRVWDLRTGRCIM
FLEGHLKEIYGINFSPNGYHIATGSGDNTCKVWDLRQRRCVYTIPAHQNLVTGVKFEPIHGNFLLTGAYDNTAKIWTHPG
WSPLKTLAGHEGKVMGLDISSDGQLIATCSYDRTFKLWMAE
;
1 ? 
24 UNP PRP31_HUMAN  Q8WWY3 24 
;MSLADELLADLEEAAEEEEGGSYGEEEEEPAIEDVQEETQLDLSGDSVKTIAKLWDSKMFAEIMMKIEEYISKQAKASEV
MGPVEAAPEYRVIVDANNLTVEIENELNIIHKFIRDKYSKRFPELESLVPNALDYIRTVKELGNSLDKCKNNENLQQILT
NATIMVVSVTASTTQGQQLSEEELERLEEACDMALELNASKHRIYEYVESRMSFIAPNLSIIIGASTAAKIMGVAGGLTN
LSKMPACNIMLLGAQRKTLSGFSSTSVLPHTGYIYHSDIVQSLPPDLRRKAARLVAAKCTLAARVDSFHESTEGKVGYEL
KDEIERKFDKWQEPPPVKQVKPLPAPLDGQRKKRGGRRYRKMKERLGLTEIRKQANRMSFGEIEEDAYQEDLGFSLGHLG
KSGSGRVRQTQVNEATKARISKTLQRTLQKQSVVYGGKSTIRDRSSGTASSVAFTPLQGLEIVNPQAAEKKVAEANQKYF
SSMAEFLKVKGEKSGLMST
;
1 ? 
25 UNP NH2L1_HUMAN  P55769 25 
;MTEADVNPKAYPLADAHLTKKLLDLVQQSCNYKQLRKGANEATKTLNRGISEFIVMAADAEPLEIILHLPLLCEDKNVPY
VFVRSKQALGRACGVSRPVIACSVTIKEGSQLKQQIQSIQQSIERLLV
;
1 ? 
26 UNP SNUT2_HUMAN  Q53GS9 26 
;MSGRSKRESRGSTRGKRESESRGSSGRVKRERDREREPEAASSRGSPVRVKREFEPASAREAPASVVPFVRVKREREVDE
DSEPEREVRAKNGRVDSEDRRSRHCPYLDTINRSVLDFDFEKLCSISLSHINAYACLVCGKYFQGRGLKSHAYIHSVQFS
HHVFLNLHTLKFYCLPDNYEIIDSSLEDITYVLKPTFTKQQIANLDKQAKLSRAYDGTTYLPGIVGLNNIKANDYANAVL
QALSNVPPLRNYFLEEDNYKNIKRPPGDIMFLLVQRFGELMRKLWNPRNFKAHVSPHEMLQAVVLCSKKTFQITKQGDGV
DFLSWFLNALHSALGGTKKKKKTIVTDVFQGSMRIFTKKLPHPDLPAEEKEQLLHNDEYQETMVESTFMYLTLDLPTAPL
YKDEKEQLIIPQVPLFNILAKFNGITEKEYKTYKENFLKRFQLTKLPPYLIFCIKRFTKNNFFVEKNPTIVNFPITNVDL
REYLSEEVQAVHKNTTYDLIANIVHDGKPSEGSYRIHVLHHGTGKWYELQDLQVTDILPQMITLSEAYIQIWKRRDNDET
NQQGA
;
1 ? 
27 PDB 3JCR         3JCR   27 
;AGCUUUGCGCAGUGGCAGUAUCGUAGCCAAUGAGGUUUAUCCGAGGCGCGAUUAUUGCUAAUUGAAAACUUUUCCCAAUA
CCCCGCCAUGACGACUUGAAAUAUAGUCGGCAUUGGCAAUUUUUGACAGUCUCUACGGAGACUGG
;
1 ? 
28 PDB 3JCR         3JCR   28 
;GUGCUCGCUUCGGCAGCACAUAUACUAAAAUUGGAACGAUACAGAGAAGAUUAGCAUGGCCCCUGCGCAAGGAUGACACG
CAAAUUCGUGAAGCGUUCCAUAUUUU
;
1 ? 
29 PDB 3JCR         3JCR   29 
;AUACUCUGGUUUCUCUUCAGAUCGCAUAAAUCUUUCGCCUUUUACUAAAGAUUUCCGUGGAGAGGAACAACUCUGAGUCU
UAACCCAAUUUUUUGAGCCUUGCUCCGACAAGGCUA
;
1 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1  1  3JCR G 1 ? 941  ? O94906 1 ? 941  ? 1 941  
2  2  3JCR D 1 ? 357  ? Q96DI7 1 ? 357  ? 1 357  
3  3  3JCR C 1 ? 2136 ? O75643 1 ? 2136 ? 1 2136 
4  4  3JCR E 1 ? 142  ? P83876 1 ? 142  ? 1 142  
5  5  3JCR A 1 ? 2335 ? Q6P2Q9 1 ? 2335 ? 1 2335 
6  6  3JCR F 1 ? 820  ? Q9BUQ8 1 ? 820  ? 1 820  
7  7  3JCR B 1 ? 972  ? Q15029 1 ? 972  ? 1 972  
8  8  3JCR O 1 ? 240  ? P14678 1 ? 240  ? 1 240  
9  9  3JCR P 1 ? 119  ? P62314 1 ? 119  ? 1 119  
10 10 3JCR Q 1 ? 118  ? P62316 1 ? 118  ? 1 118  
11 11 3JCR R 1 ? 126  ? P62318 1 ? 126  ? 1 126  
12 12 3JCR S 1 ? 92   ? P62304 1 ? 92   ? 1 92   
13 13 3JCR T 1 ? 86   ? P62306 1 ? 86   ? 1 86   
14 14 3JCR U 1 ? 76   ? P62308 1 ? 76   ? 1 76   
15 15 3JCR 8 1 ? 96   ? O95777 1 ? 96   ? 1 96   
16 16 3JCR 6 1 ? 80   ? P62312 1 ? 80   ? 1 80   
17 17 3JCR 5 1 ? 91   ? Q9Y4Y9 1 ? 91   ? 1 91   
18 18 3JCR 4 1 ? 139  ? Q9Y4Z0 1 ? 139  ? 1 139  
19 19 3JCR 3 1 ? 102  ? P62310 1 ? 102  ? 1 102  
20 20 3JCR 2 1 ? 95   ? Q9Y333 1 ? 95   ? 1 95   
21 21 3JCR 7 1 ? 103  ? Q9UK45 1 ? 103  ? 1 103  
22 22 3JCR K 1 ? 683  ? O43395 1 ? 683  ? 1 683  
23 23 3JCR L 1 ? 521  ? Q5T1M7 1 ? 521  ? 2 522  
24 24 3JCR J 1 ? 499  ? Q8WWY3 1 ? 499  ? 1 499  
25 25 3JCR I 1 ? 128  ? P55769 1 ? 128  ? 1 128  
26 8  3JCR o 1 ? 240  ? P14678 1 ? 240  ? 1 240  
27 9  3JCR p 1 ? 119  ? P62314 1 ? 119  ? 1 119  
28 10 3JCR q 1 ? 118  ? P62316 1 ? 118  ? 1 118  
29 11 3JCR r 1 ? 126  ? P62318 1 ? 126  ? 1 126  
30 12 3JCR s 1 ? 92   ? P62304 1 ? 92   ? 1 92   
31 13 3JCR t 1 ? 86   ? P62306 1 ? 86   ? 1 86   
32 14 3JCR u 1 ? 76   ? P62308 1 ? 76   ? 1 76   
33 26 3JCR V 1 ? 565  ? Q53GS9 1 ? 565  ? 1 565  
34 27 3JCR M 1 ? 145  ? 3JCR   1 ? 145  ? 1 145  
35 28 3JCR N 1 ? 106  ? 3JCR   1 ? 106  ? 1 106  
36 29 3JCR H 1 ? 116  ? 3JCR   1 ? 116  ? 1 116  
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P' 347.221 
ALA 'L-peptide linking' y ALANINE                      ? 'C3 H7 N O2'      89.093  
ARG 'L-peptide linking' y ARGININE                     ? 'C6 H15 N4 O2 1'  175.209 
ASN 'L-peptide linking' y ASPARAGINE                   ? 'C4 H8 N2 O3'     132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'              ? 'C4 H7 N O4'      133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O8 P'  323.197 
CYS 'L-peptide linking' y CYSTEINE                     ? 'C3 H7 N O2 S'    121.158 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O8 P' 363.221 
GLN 'L-peptide linking' y GLUTAMINE                    ? 'C5 H10 N2 O3'    146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'              ? 'C5 H9 N O4'      147.129 
GLY 'peptide linking'   y GLYCINE                      ? 'C2 H5 N O2'      75.067  
HIS 'L-peptide linking' y HISTIDINE                    ? 'C6 H10 N3 O2 1'  156.162 
ILE 'L-peptide linking' y ISOLEUCINE                   ? 'C6 H13 N O2'     131.173 
LEU 'L-peptide linking' y LEUCINE                      ? 'C6 H13 N O2'     131.173 
LYS 'L-peptide linking' y LYSINE                       ? 'C6 H15 N2 O2 1'  147.195 
MET 'L-peptide linking' y METHIONINE                   ? 'C5 H11 N O2 S'   149.211 
PHE 'L-peptide linking' y PHENYLALANINE                ? 'C9 H11 N O2'     165.189 
PRO 'L-peptide linking' y PROLINE                      ? 'C5 H9 N O2'      115.130 
SER 'L-peptide linking' y SERINE                       ? 'C3 H7 N O3'      105.093 
THR 'L-peptide linking' y THREONINE                    ? 'C4 H9 N O3'      119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                   ? 'C11 H12 N2 O2'   204.225 
TYR 'L-peptide linking' y TYROSINE                     ? 'C9 H11 N O3'     181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"   ? 'C9 H13 N2 O9 P'  324.181 
VAL 'L-peptide linking' y VALINE                       ? 'C5 H11 N O2'     117.146 
# 
_exptl.entry_id          3JCR 
_exptl.method            'ELECTRON MICROSCOPY' 
_exptl.crystals_number   ? 
# 
_refine_hist.pdbx_refine_id                   'ELECTRON MICROSCOPY' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        9200 
_refine_hist.pdbx_number_atoms_nucleic_acid   203 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               9403 
_refine_hist.d_res_high                       . 
_refine_hist.d_res_low                        . 
# 
_struct.entry_id                  3JCR 
_struct.title                     '3D structure determination of the human*U4/U6.U5* tri-snRNP complex' 
_struct.pdbx_descriptor           
;hPrp6, U5-40K, hBrr2 (E.C.3.6.4.13), hDim1, hPrp8, hPrp28 (E.C.3.6.4.13), hSnu114, SmB, SmD1, SmD2, SmD3, SmE, SmF, SmG, LSm8, LSm6, LSm5, LSm4, LSm3, LSm2, LSm7, hPrp3, hPrp4, hPrp31, hSnu13, hSad1
;
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3JCR 
_struct_keywords.pdbx_keywords   SPLICING 
_struct_keywords.text            'snRNP, splicing, spliceosome, human' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A  N N 1  ? 
B  N N 2  ? 
C  N N 3  ? 
D  N N 4  ? 
E  N N 5  ? 
F  N N 6  ? 
G  N N 7  ? 
H  N N 8  ? 
I  N N 9  ? 
J  N N 10 ? 
K  N N 11 ? 
L  N N 12 ? 
M  N N 13 ? 
N  N N 14 ? 
O  N N 15 ? 
P  N N 16 ? 
Q  N N 17 ? 
R  N N 18 ? 
S  N N 19 ? 
T  N N 20 ? 
U  N N 21 ? 
V  N N 22 ? 
W  N N 23 ? 
X  N N 24 ? 
Y  N N 25 ? 
Z  N N 8  ? 
AA N N 9  ? 
BA N N 10 ? 
CA N N 11 ? 
DA N N 12 ? 
EA N N 13 ? 
FA N N 14 ? 
GA N N 26 ? 
HA N N 27 ? 
IA N N 28 ? 
JA N N 29 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
_database_PDB_matrix.entry_id          3JCR 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3JCR 
_atom_sites.fract_transf_matrix[1][1]   1.000000 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   1.000000 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   1.000000 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
P 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM 1    C CA . LYS A  1  292  ? 228.966 224.720 256.217 1.00 0.00 ? 292  LYS G CA 1 
ATOM 2    C CA . LYS A  1  293  ? 232.036 226.713 257.248 1.00 0.00 ? 293  LYS G CA 1 
ATOM 3    C CA . ALA A  1  294  ? 231.023 226.290 260.911 1.00 0.00 ? 294  ALA G CA 1 
ATOM 4    C CA . ARG A  1  295  ? 230.740 222.631 260.102 1.00 0.00 ? 295  ARG G CA 1 
ATOM 5    C CA . LEU A  1  296  ? 234.340 222.387 259.021 1.00 0.00 ? 296  LEU G CA 1 
ATOM 6    C CA . LEU A  1  297  ? 235.556 223.701 262.321 1.00 0.00 ? 297  LEU G CA 1 
ATOM 7    C CA . LEU A  1  298  ? 233.294 221.411 264.140 1.00 0.00 ? 298  LEU G CA 1 
ATOM 8    C CA . LYS A  1  299  ? 234.916 218.580 262.194 1.00 0.00 ? 299  LYS G CA 1 
ATOM 9    C CA . SER A  1  300  ? 238.319 219.616 263.479 1.00 0.00 ? 300  SER G CA 1 
ATOM 10   C CA . VAL A  1  301  ? 236.912 219.783 267.054 1.00 0.00 ? 301  VAL G CA 1 
ATOM 11   C CA . ARG A  1  302  ? 235.905 216.178 267.193 1.00 0.00 ? 302  ARG G CA 1 
ATOM 12   C CA . GLU A  1  303  ? 239.007 215.070 265.427 1.00 0.00 ? 303  GLU G CA 1 
ATOM 13   C CA . PRO A  1  310  ? 233.128 216.420 276.517 1.00 0.00 ? 310  PRO G CA 1 
ATOM 14   C CA . ALA A  1  311  ? 234.299 217.048 272.877 1.00 0.00 ? 311  ALA G CA 1 
ATOM 15   C CA . TRP A  1  312  ? 231.077 215.672 271.421 1.00 0.00 ? 312  TRP G CA 1 
ATOM 16   C CA . ILE A  1  313  ? 229.411 218.439 273.384 1.00 0.00 ? 313  ILE G CA 1 
ATOM 17   C CA . ALA A  1  314  ? 232.052 221.066 272.938 1.00 0.00 ? 314  ALA G CA 1 
ATOM 18   C CA . SER A  1  315  ? 231.607 220.618 269.389 1.00 0.00 ? 315  SER G CA 1 
ATOM 19   C CA . ALA A  1  316  ? 227.822 220.499 269.219 1.00 0.00 ? 316  ALA G CA 1 
ATOM 20   C CA . ARG A  1  317  ? 227.756 223.709 271.058 1.00 0.00 ? 317  ARG G CA 1 
ATOM 21   C CA . LEU A  1  318  ? 230.257 225.389 268.797 1.00 0.00 ? 318  LEU G CA 1 
ATOM 22   C CA . GLU A  1  319  ? 227.934 224.313 266.135 1.00 0.00 ? 319  GLU G CA 1 
ATOM 23   C CA . GLU A  1  320  ? 225.066 225.941 267.974 1.00 0.00 ? 320  GLU G CA 1 
ATOM 24   C CA . VAL A  1  321  ? 227.024 229.245 267.785 1.00 0.00 ? 321  VAL G CA 1 
ATOM 25   C CA . GLN A  1  326  ? 217.207 219.533 265.739 1.00 0.00 ? 326  GLN G CA 1 
ATOM 26   C CA . VAL A  1  327  ? 220.967 219.977 265.677 1.00 0.00 ? 327  VAL G CA 1 
ATOM 27   C CA . ALA A  1  328  ? 220.900 220.886 269.387 1.00 0.00 ? 328  ALA G CA 1 
ATOM 28   C CA . ARG A  1  329  ? 218.822 217.786 269.999 1.00 0.00 ? 329  ARG G CA 1 
ATOM 29   C CA . ASN A  1  330  ? 221.065 215.350 268.193 1.00 0.00 ? 330  ASN G CA 1 
ATOM 30   C CA . LEU A  1  331  ? 223.858 217.050 269.894 1.00 0.00 ? 331  LEU G CA 1 
ATOM 31   C CA . ILE A  1  332  ? 222.612 216.704 273.298 1.00 0.00 ? 332  ILE G CA 1 
ATOM 32   C CA . MET A  1  333  ? 221.634 213.156 272.379 1.00 0.00 ? 333  MET G CA 1 
ATOM 33   C CA . LYS A  1  334  ? 225.153 212.358 271.171 1.00 0.00 ? 334  LYS G CA 1 
ATOM 34   C CA . GLY A  1  335  ? 226.405 213.922 274.400 1.00 0.00 ? 335  GLY G CA 1 
ATOM 35   C CA . THR A  1  336  ? 223.937 211.968 276.604 1.00 0.00 ? 336  THR G CA 1 
ATOM 36   C CA . GLU A  1  337  ? 225.210 208.601 275.451 1.00 0.00 ? 337  GLU G CA 1 
ATOM 37   C CA . MET A  1  338  ? 228.829 209.628 275.965 1.00 0.00 ? 338  MET G CA 1 
ATOM 38   C CA . GLU A  1  343  ? 224.070 220.058 282.015 1.00 0.00 ? 343  GLU G CA 1 
ATOM 39   C CA . ASP A  1  344  ? 226.052 223.142 280.816 1.00 0.00 ? 344  ASP G CA 1 
ATOM 40   C CA . VAL A  1  345  ? 225.850 221.393 277.329 1.00 0.00 ? 345  VAL G CA 1 
ATOM 41   C CA . TRP A  1  346  ? 222.221 220.935 277.188 1.00 0.00 ? 346  TRP G CA 1 
ATOM 42   C CA . LEU A  1  347  ? 221.760 224.624 278.356 1.00 0.00 ? 347  LEU G CA 1 
ATOM 43   C CA . GLU A  1  348  ? 223.856 225.665 275.608 1.00 0.00 ? 348  GLU G CA 1 
ATOM 44   C CA . ALA A  1  349  ? 221.864 223.503 273.312 1.00 0.00 ? 349  ALA G CA 1 
ATOM 45   C CA . ASP A  1  356  ? 210.269 220.343 274.354 1.00 0.00 ? 356  ASP G CA 1 
ATOM 46   C CA . THR A  1  357  ? 213.731 218.711 274.557 1.00 0.00 ? 357  THR G CA 1 
ATOM 47   C CA . ALA A  1  358  ? 214.284 220.975 277.561 1.00 0.00 ? 358  ALA G CA 1 
ATOM 48   C CA . LYS A  1  359  ? 211.453 219.080 279.287 1.00 0.00 ? 359  LYS G CA 1 
ATOM 49   C CA . ALA A  1  360  ? 213.175 215.820 278.432 1.00 0.00 ? 360  ALA G CA 1 
ATOM 50   C CA . VAL A  1  361  ? 216.646 217.069 279.426 1.00 0.00 ? 361  VAL G CA 1 
ATOM 51   C CA . VAL A  1  362  ? 215.581 218.226 282.795 1.00 0.00 ? 362  VAL G CA 1 
ATOM 52   C CA . ALA A  1  363  ? 213.872 215.083 283.800 1.00 0.00 ? 363  ALA G CA 1 
ATOM 53   C CA . GLN A  1  364  ? 216.964 213.447 282.390 1.00 0.00 ? 364  GLN G CA 1 
ATOM 54   C CA . ALA A  1  365  ? 219.437 215.405 284.545 1.00 0.00 ? 365  ALA G CA 1 
ATOM 55   C CA . VAL A  1  366  ? 217.454 214.497 287.655 1.00 0.00 ? 366  VAL G CA 1 
ATOM 56   C CA . ARG A  1  367  ? 216.750 211.040 286.603 1.00 0.00 ? 367  ARG G CA 1 
ATOM 57   C CA . HIS A  1  368  ? 220.300 210.296 285.574 1.00 0.00 ? 368  HIS G CA 1 
ATOM 58   C CA . VAL A  1  373  ? 222.264 214.797 294.996 1.00 0.00 ? 373  VAL G CA 1 
ATOM 59   C CA . ARG A  1  374  ? 225.141 217.228 293.963 1.00 0.00 ? 374  ARG G CA 1 
ATOM 60   C CA . ILE A  1  375  ? 222.619 216.700 291.268 1.00 0.00 ? 375  ILE G CA 1 
ATOM 61   C CA . TYR A  1  376  ? 220.022 218.857 293.143 1.00 0.00 ? 376  TYR G CA 1 
ATOM 62   C CA . ILE A  1  377  ? 222.263 221.818 292.436 1.00 0.00 ? 377  ILE G CA 1 
ATOM 63   C CA . ARG A  1  378  ? 222.643 220.744 288.895 1.00 0.00 ? 378  ARG G CA 1 
ATOM 64   C CA . ALA A  1  379  ? 218.968 219.814 288.394 1.00 0.00 ? 379  ALA G CA 1 
ATOM 65   C CA . ALA A  1  380  ? 218.045 223.084 290.090 1.00 0.00 ? 380  ALA G CA 1 
ATOM 66   C CA . GLU A  1  381  ? 220.033 225.285 287.761 1.00 0.00 ? 381  GLU G CA 1 
ATOM 67   C CA . LEU A  1  382  ? 218.767 223.203 284.874 1.00 0.00 ? 382  LEU G CA 1 
ATOM 68   C CA . GLU A  1  383  ? 215.293 223.695 285.580 1.00 0.00 ? 383  GLU G CA 1 
ATOM 69   C CA . ALA A  1  388  ? 206.981 225.292 289.787 1.00 0.00 ? 388  ALA G CA 1 
ATOM 70   C CA . LYS A  1  389  ? 210.351 225.954 291.362 1.00 0.00 ? 389  LYS G CA 1 
ATOM 71   C CA . LYS A  1  390  ? 208.419 226.298 294.646 1.00 0.00 ? 390  LYS G CA 1 
ATOM 72   C CA . ARG A  1  391  ? 207.073 222.725 294.281 1.00 0.00 ? 391  ARG G CA 1 
ATOM 73   C CA . VAL A  1  392  ? 210.463 221.079 293.873 1.00 0.00 ? 392  VAL G CA 1 
ATOM 74   C CA . LEU A  1  393  ? 211.937 223.119 296.668 1.00 0.00 ? 393  LEU G CA 1 
ATOM 75   C CA . ARG A  1  394  ? 209.279 221.833 299.002 1.00 0.00 ? 394  ARG G CA 1 
ATOM 76   C CA . LYS A  1  395  ? 210.096 218.288 297.873 1.00 0.00 ? 395  LYS G CA 1 
ATOM 77   C CA . ALA A  1  396  ? 213.766 218.961 298.260 1.00 0.00 ? 396  ALA G CA 1 
ATOM 78   C CA . LEU A  1  397  ? 212.671 220.061 301.677 1.00 0.00 ? 397  LEU G CA 1 
ATOM 79   C CA . GLU A  1  398  ? 211.031 216.885 302.589 1.00 0.00 ? 398  GLU G CA 1 
ATOM 80   C CA . ARG A  1  405  ? 226.508 221.357 298.529 1.00 0.00 ? 405  ARG G CA 1 
ATOM 81   C CA . LEU A  1  406  ? 222.540 220.935 299.132 1.00 0.00 ? 406  LEU G CA 1 
ATOM 82   C CA . TRP A  1  407  ? 222.194 223.574 301.561 1.00 0.00 ? 407  TRP G CA 1 
ATOM 83   C CA . LYS A  1  408  ? 224.357 225.593 299.267 1.00 0.00 ? 408  LYS G CA 1 
ATOM 84   C CA . ALA A  1  409  ? 222.710 224.868 295.915 1.00 0.00 ? 409  ALA G CA 1 
ATOM 85   C CA . ALA A  1  410  ? 219.446 225.275 297.397 1.00 0.00 ? 410  ALA G CA 1 
ATOM 86   C CA . VAL A  1  411  ? 220.007 228.579 299.372 1.00 0.00 ? 411  VAL G CA 1 
ATOM 87   C CA . PRO A  1  416  ? 209.150 234.885 307.824 1.00 0.00 ? 416  PRO G CA 1 
ATOM 88   C CA . GLU A  1  417  ? 207.839 231.274 308.252 1.00 0.00 ? 417  GLU G CA 1 
ATOM 89   C CA . ASP A  1  418  ? 209.512 229.868 305.139 1.00 0.00 ? 418  ASP G CA 1 
ATOM 90   C CA . ALA A  1  419  ? 212.660 231.755 305.954 1.00 0.00 ? 419  ALA G CA 1 
ATOM 91   C CA . ARG A  1  420  ? 212.901 230.121 309.439 1.00 0.00 ? 420  ARG G CA 1 
ATOM 92   C CA . ILE A  1  421  ? 212.460 226.687 307.950 1.00 0.00 ? 421  ILE G CA 1 
ATOM 93   C CA . MET A  1  422  ? 214.743 227.220 305.007 1.00 0.00 ? 422  MET G CA 1 
ATOM 94   C CA . LEU A  1  423  ? 217.375 228.780 307.203 1.00 0.00 ? 423  LEU G CA 1 
ATOM 95   C CA . SER A  1  424  ? 216.940 226.124 309.870 1.00 0.00 ? 424  SER G CA 1 
ATOM 96   C CA . ARG A  1  425  ? 217.322 223.454 307.150 1.00 0.00 ? 425  ARG G CA 1 
ATOM 97   C CA . ALA A  1  426  ? 220.360 225.317 305.852 1.00 0.00 ? 426  ALA G CA 1 
ATOM 98   C CA . VAL A  1  427  ? 221.851 225.468 309.334 1.00 0.00 ? 427  VAL G CA 1 
ATOM 99   C CA . GLU A  1  428  ? 221.802 221.741 309.673 1.00 0.00 ? 428  GLU G CA 1 
ATOM 100  C CA . CYS A  1  429  ? 223.715 221.236 306.413 1.00 0.00 ? 429  CYS G CA 1 
ATOM 101  C CA . CYS A  1  430  ? 225.814 224.362 306.420 1.00 0.00 ? 430  CYS G CA 1 
ATOM 102  C CA . VAL A  1  434  ? 230.238 231.328 312.747 1.00 0.00 ? 434  VAL G CA 1 
ATOM 103  C CA . GLU A  1  435  ? 231.734 230.484 309.025 1.00 0.00 ? 435  GLU G CA 1 
ATOM 104  C CA . LEU A  1  436  ? 228.962 228.297 308.948 1.00 0.00 ? 436  LEU G CA 1 
ATOM 105  C CA . TRP A  1  437  ? 226.618 230.974 310.307 1.00 0.00 ? 437  TRP G CA 1 
ATOM 106  C CA . LEU A  1  438  ? 227.872 233.549 308.055 1.00 0.00 ? 438  LEU G CA 1 
ATOM 107  C CA . ALA A  1  439  ? 227.615 230.959 305.023 1.00 0.00 ? 439  ALA G CA 1 
ATOM 108  C CA . LEU A  1  440  ? 224.113 230.758 306.079 1.00 0.00 ? 440  LEU G CA 1 
ATOM 109  C CA . ALA A  1  441  ? 224.098 234.472 306.623 1.00 0.00 ? 441  ALA G CA 1 
ATOM 110  C CA . ARG A  1  442  ? 224.502 234.868 302.748 1.00 0.00 ? 442  ARG G CA 1 
ATOM 111  C CA . TYR A  1  446  ? 220.887 242.988 318.706 1.00 0.00 ? 446  TYR G CA 1 
ATOM 112  C CA . GLU A  1  447  ? 221.600 239.947 320.841 1.00 0.00 ? 447  GLU G CA 1 
ATOM 113  C CA . ASN A  1  448  ? 221.425 237.308 318.073 1.00 0.00 ? 448  ASN G CA 1 
ATOM 114  C CA . ALA A  1  449  ? 223.323 239.726 315.919 1.00 0.00 ? 449  ALA G CA 1 
ATOM 115  C CA . ARG A  1  450  ? 226.232 239.914 318.283 1.00 0.00 ? 450  ARG G CA 1 
ATOM 116  C CA . LYS A  1  451  ? 226.358 236.122 318.408 1.00 0.00 ? 451  LYS G CA 1 
ATOM 117  C CA . VAL A  1  452  ? 225.949 235.743 314.603 1.00 0.00 ? 452  VAL G CA 1 
ATOM 118  C CA . LEU A  1  453  ? 228.380 238.223 314.329 1.00 0.00 ? 453  LEU G CA 1 
ATOM 119  C CA . ASN A  1  454  ? 231.168 236.648 316.343 1.00 0.00 ? 454  ASN G CA 1 
ATOM 120  C CA . LYS A  1  455  ? 230.481 233.343 314.590 1.00 0.00 ? 455  LYS G CA 1 
ATOM 121  C CA . ALA A  1  456  ? 230.781 234.838 311.165 1.00 0.00 ? 456  ALA G CA 1 
ATOM 122  C CA . TRP A  1  467  ? 232.956 240.558 303.547 1.00 0.00 ? 467  TRP G CA 1 
ATOM 123  C CA . ILE A  1  468  ? 231.880 240.222 307.120 1.00 0.00 ? 468  ILE G CA 1 
ATOM 124  C CA . THR A  1  469  ? 233.867 243.286 307.987 1.00 0.00 ? 469  THR G CA 1 
ATOM 125  C CA . ALA A  1  470  ? 231.995 245.008 305.233 1.00 0.00 ? 470  ALA G CA 1 
ATOM 126  C CA . ALA A  1  471  ? 228.599 243.805 306.557 1.00 0.00 ? 471  ALA G CA 1 
ATOM 127  C CA . LYS A  1  472  ? 229.916 245.384 309.581 1.00 0.00 ? 472  LYS G CA 1 
ATOM 128  C CA . LEU A  1  473  ? 230.473 248.665 308.543 1.00 0.00 ? 473  LEU G CA 1 
ATOM 129  C CA . GLU A  1  474  ? 227.248 248.314 306.500 1.00 0.00 ? 474  GLU G CA 1 
ATOM 130  C CA . GLU A  1  475  ? 225.382 247.457 309.610 1.00 0.00 ? 475  GLU G CA 1 
ATOM 131  C CA . GLN A  1  481  ? 229.787 252.574 319.058 1.00 0.00 ? 481  GLN G CA 1 
ATOM 132  C CA . MET A  1  482  ? 229.957 249.553 321.894 1.00 0.00 ? 482  MET G CA 1 
ATOM 133  C CA . VAL A  1  483  ? 228.384 247.033 319.807 1.00 0.00 ? 483  VAL G CA 1 
ATOM 134  C CA . GLU A  1  484  ? 230.313 248.132 316.669 1.00 0.00 ? 484  GLU G CA 1 
ATOM 135  C CA . LYS A  1  485  ? 233.356 247.527 318.635 1.00 0.00 ? 485  LYS G CA 1 
ATOM 136  C CA . ILE A  1  486  ? 232.437 244.343 320.188 1.00 0.00 ? 486  ILE G CA 1 
ATOM 137  C CA . ILE A  1  487  ? 231.385 243.566 316.531 1.00 0.00 ? 487  ILE G CA 1 
ATOM 138  C CA . ASP A  1  488  ? 234.631 244.001 315.034 1.00 0.00 ? 488  ASP G CA 1 
ATOM 139  C CA . ARG A  1  489  ? 236.368 242.419 317.976 1.00 0.00 ? 489  ARG G CA 1 
ATOM 140  C CA . ALA A  1  490  ? 234.759 239.194 317.922 1.00 0.00 ? 490  ALA G CA 1 
ATOM 141  C CA . ILE A  1  491  ? 235.439 238.850 314.095 1.00 0.00 ? 491  ILE G CA 1 
ATOM 142  C CA . THR A  1  492  ? 238.923 239.820 314.534 1.00 0.00 ? 492  THR G CA 1 
ATOM 143  C CA . SER A  1  493  ? 239.341 237.404 317.438 1.00 0.00 ? 493  SER G CA 1 
ATOM 144  C CA . ARG A  1  503  ? 242.940 243.249 307.278 1.00 0.00 ? 503  ARG G CA 1 
ATOM 145  C CA . GLU A  1  504  ? 241.211 243.092 303.950 1.00 0.00 ? 504  GLU G CA 1 
ATOM 146  C CA . GLN A  1  505  ? 238.007 243.000 305.562 1.00 0.00 ? 505  GLN G CA 1 
ATOM 147  C CA . TRP A  1  506  ? 238.664 246.459 307.076 1.00 0.00 ? 506  TRP G CA 1 
ATOM 148  C CA . ILE A  1  507  ? 239.771 247.717 303.697 1.00 0.00 ? 507  ILE G CA 1 
ATOM 149  C CA . GLN A  1  508  ? 236.671 246.245 302.137 1.00 0.00 ? 508  GLN G CA 1 
ATOM 150  C CA . ASP A  1  509  ? 234.825 247.962 305.045 1.00 0.00 ? 509  ASP G CA 1 
ATOM 151  C CA . ALA A  1  510  ? 236.411 251.188 304.115 1.00 0.00 ? 510  ALA G CA 1 
ATOM 152  C CA . GLU A  1  511  ? 235.583 250.795 300.341 1.00 0.00 ? 511  GLU G CA 1 
ATOM 153  C CA . GLU A  1  512  ? 232.009 250.239 300.745 1.00 0.00 ? 512  GLU G CA 1 
ATOM 154  C CA . CYS A  1  513  ? 231.993 253.451 303.324 1.00 0.00 ? 513  CYS G CA 1 
ATOM 155  C CA . ASP A  1  514  ? 233.582 255.251 300.503 1.00 0.00 ? 514  ASP G CA 1 
ATOM 156  C CA . ARG A  1  515  ? 230.666 254.148 298.211 1.00 0.00 ? 515  ARG G CA 1 
ATOM 157  C CA . VAL A  1  519  ? 231.325 258.216 303.605 1.00 0.00 ? 519  VAL G CA 1 
ATOM 158  C CA . ALA A  1  520  ? 230.630 258.711 307.340 1.00 0.00 ? 520  ALA G CA 1 
ATOM 159  C CA . THR A  1  521  ? 231.195 254.959 307.719 1.00 0.00 ? 521  THR G CA 1 
ATOM 160  C CA . CYS A  1  522  ? 234.434 255.018 305.687 1.00 0.00 ? 522  CYS G CA 1 
ATOM 161  C CA . GLN A  1  523  ? 235.471 257.924 307.831 1.00 0.00 ? 523  GLN G CA 1 
ATOM 162  C CA . ALA A  1  524  ? 234.648 256.119 311.048 1.00 0.00 ? 524  ALA G CA 1 
ATOM 163  C CA . VAL A  1  525  ? 236.787 253.176 309.992 1.00 0.00 ? 525  VAL G CA 1 
ATOM 164  C CA . MET A  1  526  ? 239.633 255.163 308.734 1.00 0.00 ? 526  MET G CA 1 
ATOM 165  C CA . THR A  1  542  ? 245.378 260.546 303.341 1.00 0.00 ? 542  THR G CA 1 
ATOM 166  C CA . TRP A  1  543  ? 243.266 257.740 303.651 1.00 0.00 ? 543  TRP G CA 1 
ATOM 167  C CA . MET A  1  544  ? 241.141 259.612 306.240 1.00 0.00 ? 544  MET G CA 1 
ATOM 168  C CA . GLU A  1  545  ? 240.343 261.638 303.334 1.00 0.00 ? 545  GLU G CA 1 
ATOM 169  C CA . ASP A  1  546  ? 240.066 258.693 300.963 1.00 0.00 ? 546  ASP G CA 1 
ATOM 170  C CA . ALA A  1  547  ? 236.798 257.821 303.110 1.00 0.00 ? 547  ALA G CA 1 
ATOM 171  C CA . ASP A  1  548  ? 235.927 261.011 303.393 1.00 0.00 ? 548  ASP G CA 1 
ATOM 172  C CA . SER A  1  549  ? 236.566 259.930 299.199 1.00 0.00 ? 549  SER G CA 1 
ATOM 173  C CA . CYS A  1  550  ? 233.884 257.963 299.209 1.00 0.00 ? 550  CYS G CA 1 
ATOM 174  C CA . VAL A  1  551  ? 231.636 259.987 301.491 1.00 0.00 ? 551  VAL G CA 1 
ATOM 175  C CA . ALA A  1  552  ? 232.309 263.059 299.284 1.00 0.00 ? 552  ALA G CA 1 
ATOM 176  C CA . LEU A  1  556  ? 237.788 268.418 299.492 1.00 0.00 ? 556  LEU G CA 1 
ATOM 177  C CA . GLU A  1  557  ? 236.874 266.293 302.469 1.00 0.00 ? 557  GLU G CA 1 
ATOM 178  C CA . CYS A  1  558  ? 240.127 264.363 302.229 1.00 0.00 ? 558  CYS G CA 1 
ATOM 179  C CA . ALA A  1  559  ? 241.846 267.586 302.103 1.00 0.00 ? 559  ALA G CA 1 
ATOM 180  C CA . ARG A  1  560  ? 240.274 269.249 305.048 1.00 0.00 ? 560  ARG G CA 1 
ATOM 181  C CA . ALA A  1  561  ? 241.170 266.258 307.209 1.00 0.00 ? 561  ALA G CA 1 
ATOM 182  C CA . ILE A  1  562  ? 244.829 266.318 306.277 1.00 0.00 ? 562  ILE G CA 1 
ATOM 183  C CA . TYR A  1  563  ? 245.157 269.982 306.619 1.00 0.00 ? 563  TYR G CA 1 
ATOM 184  C CA . ALA A  1  564  ? 243.855 270.283 310.153 1.00 0.00 ? 564  ALA G CA 1 
ATOM 185  C CA . TYR A  1  565  ? 245.919 267.206 310.992 1.00 0.00 ? 565  TYR G CA 1 
ATOM 186  C CA . ALA A  1  566  ? 249.086 268.585 309.393 1.00 0.00 ? 566  ALA G CA 1 
ATOM 187  C CA . LYS A  1  574  ? 238.686 276.053 317.144 1.00 0.00 ? 574  LYS G CA 1 
ATOM 188  C CA . SER A  1  575  ? 241.885 275.600 315.440 1.00 0.00 ? 575  SER G CA 1 
ATOM 189  C CA . VAL A  1  576  ? 240.107 273.123 312.982 1.00 0.00 ? 576  VAL G CA 1 
ATOM 190  C CA . TRP A  1  577  ? 238.272 275.864 311.466 1.00 0.00 ? 577  TRP G CA 1 
ATOM 191  C CA . LEU A  1  578  ? 241.550 277.599 311.014 1.00 0.00 ? 578  LEU G CA 1 
ATOM 192  C CA . ARG A  1  579  ? 243.246 274.533 309.822 1.00 0.00 ? 579  ARG G CA 1 
ATOM 193  C CA . ALA A  1  580  ? 240.592 273.414 307.355 1.00 0.00 ? 580  ALA G CA 1 
ATOM 194  C CA . ALA A  1  581  ? 240.511 277.043 306.086 1.00 0.00 ? 581  ALA G CA 1 
ATOM 195  C CA . TYR A  1  582  ? 244.190 277.090 305.269 1.00 0.00 ? 582  TYR G CA 1 
ATOM 196  C CA . PHE A  1  583  ? 243.825 273.799 303.778 1.00 0.00 ? 583  PHE G CA 1 
ATOM 197  C CA . GLU A  1  584  ? 241.542 275.195 301.141 1.00 0.00 ? 584  GLU G CA 1 
ATOM 198  C CA . LYS A  1  585  ? 243.958 277.935 300.659 1.00 0.00 ? 585  LYS G CA 1 
ATOM 199  C CA . ASN A  1  586  ? 246.378 275.160 299.595 1.00 0.00 ? 586  ASN G CA 1 
ATOM 200  C CA . HIS A  1  587  ? 243.735 274.209 297.019 1.00 0.00 ? 587  HIS G CA 1 
ATOM 201  C CA . SER A  1  592  ? 232.991 280.639 304.120 1.00 0.00 ? 592  SER G CA 1 
ATOM 202  C CA . LEU A  1  593  ? 235.925 280.637 301.966 1.00 0.00 ? 593  LEU G CA 1 
ATOM 203  C CA . GLU A  1  594  ? 236.898 283.955 303.171 1.00 0.00 ? 594  GLU G CA 1 
ATOM 204  C CA . ALA A  1  595  ? 236.355 283.664 306.871 1.00 0.00 ? 595  ALA G CA 1 
ATOM 205  C CA . LEU A  1  596  ? 237.979 280.311 306.342 1.00 0.00 ? 596  LEU G CA 1 
ATOM 206  C CA . LEU A  1  597  ? 240.817 282.011 304.673 1.00 0.00 ? 597  LEU G CA 1 
ATOM 207  C CA . GLN A  1  598  ? 240.349 284.709 307.518 1.00 0.00 ? 598  GLN G CA 1 
ATOM 208  C CA . ARG A  1  599  ? 241.019 282.813 310.423 1.00 0.00 ? 599  ARG G CA 1 
ATOM 209  C CA . ALA A  1  600  ? 243.767 280.719 308.724 1.00 0.00 ? 600  ALA G CA 1 
ATOM 210  C CA . VAL A  1  601  ? 245.926 283.517 308.012 1.00 0.00 ? 601  VAL G CA 1 
ATOM 211  C CA . ALA A  1  602  ? 245.671 284.710 311.739 1.00 0.00 ? 602  ALA G CA 1 
ATOM 212  C CA . HIS A  1  603  ? 247.106 281.483 312.706 1.00 0.00 ? 603  HIS G CA 1 
ATOM 213  C CA . LEU A  1  610  ? 243.953 290.924 309.277 1.00 0.00 ? 610  LEU G CA 1 
ATOM 214  C CA . TRP A  1  611  ? 244.044 291.753 306.081 1.00 0.00 ? 611  TRP G CA 1 
ATOM 215  C CA . LEU A  1  612  ? 244.273 288.253 304.564 1.00 0.00 ? 612  LEU G CA 1 
ATOM 216  C CA . MET A  1  613  ? 240.934 287.749 305.793 1.00 0.00 ? 613  MET G CA 1 
ATOM 217  C CA . GLY A  1  614  ? 240.381 291.217 304.283 1.00 0.00 ? 614  GLY G CA 1 
ATOM 218  C CA . ALA A  1  615  ? 241.567 290.325 300.987 1.00 0.00 ? 615  ALA G CA 1 
ATOM 219  C CA . LYS A  1  616  ? 240.079 286.963 301.313 1.00 0.00 ? 616  LYS G CA 1 
ATOM 220  C CA . SER A  1  617  ? 236.702 289.465 301.595 1.00 0.00 ? 617  SER G CA 1 
ATOM 221  C CA . LYS A  1  618  ? 236.986 291.119 298.417 1.00 0.00 ? 618  LYS G CA 1 
ATOM 222  C CA . TRP A  1  619  ? 238.493 288.057 296.847 1.00 0.00 ? 619  TRP G CA 1 
ATOM 223  C CA . VAL A  1  624  ? 230.418 289.480 305.070 1.00 0.00 ? 624  VAL G CA 1 
ATOM 224  C CA . PRO A  1  625  ? 230.224 292.952 306.260 1.00 0.00 ? 625  PRO G CA 1 
ATOM 225  C CA . ALA A  1  626  ? 233.271 292.545 308.612 1.00 0.00 ? 626  ALA G CA 1 
ATOM 226  C CA . ALA A  1  627  ? 235.472 291.212 305.876 1.00 0.00 ? 627  ALA G CA 1 
ATOM 227  C CA . ARG A  1  628  ? 233.767 294.320 304.294 1.00 0.00 ? 628  ARG G CA 1 
ATOM 228  C CA . SER A  1  629  ? 235.066 296.688 306.637 1.00 0.00 ? 629  SER G CA 1 
ATOM 229  C CA . ILE A  1  630  ? 238.587 295.324 306.958 1.00 0.00 ? 630  ILE G CA 1 
ATOM 230  C CA . LEU A  1  631  ? 239.249 295.440 303.412 1.00 0.00 ? 631  LEU G CA 1 
ATOM 231  C CA . ALA A  1  632  ? 237.838 298.982 302.868 1.00 0.00 ? 632  ALA G CA 1 
ATOM 232  C CA . LEU A  1  633  ? 240.068 300.163 305.718 1.00 0.00 ? 633  LEU G CA 1 
ATOM 233  C CA . ALA A  1  634  ? 243.247 298.792 304.517 1.00 0.00 ? 634  ALA G CA 1 
ATOM 234  C CA . PHE A  1  635  ? 242.782 300.204 301.165 1.00 0.00 ? 635  PHE G CA 1 
ATOM 235  C CA . GLN A  1  636  ? 241.447 303.359 302.458 1.00 0.00 ? 636  GLN G CA 1 
ATOM 236  C CA . GLU A  1  642  ? 251.659 294.071 300.885 1.00 0.00 ? 642  GLU G CA 1 
ATOM 237  C CA . GLU A  1  643  ? 249.428 291.245 300.276 1.00 0.00 ? 643  GLU G CA 1 
ATOM 238  C CA . ILE A  1  644  ? 246.482 292.986 301.345 1.00 0.00 ? 644  ILE G CA 1 
ATOM 239  C CA . TRP A  1  645  ? 248.169 295.823 299.584 1.00 0.00 ? 645  TRP G CA 1 
ATOM 240  C CA . LEU A  1  646  ? 247.808 293.642 296.669 1.00 0.00 ? 646  LEU G CA 1 
ATOM 241  C CA . ALA A  1  647  ? 244.271 292.468 297.056 1.00 0.00 ? 647  ALA G CA 1 
ATOM 242  C CA . ALA A  1  648  ? 243.525 296.282 297.054 1.00 0.00 ? 648  ALA G CA 1 
ATOM 243  C CA . VAL A  1  649  ? 244.531 297.333 294.102 1.00 0.00 ? 649  VAL G CA 1 
ATOM 244  C CA . LYS A  1  650  ? 242.826 294.289 292.550 1.00 0.00 ? 650  LYS G CA 1 
ATOM 245  C CA . LEU A  1  651  ? 239.569 295.197 294.053 1.00 0.00 ? 651  LEU G CA 1 
ATOM 246  C CA . GLU A  1  652  ? 240.579 298.910 293.112 1.00 0.00 ? 652  GLU G CA 1 
ATOM 247  C CA . SER A  1  653  ? 240.823 297.744 289.624 1.00 0.00 ? 653  SER G CA 1 
ATOM 248  C CA . GLU A  1  654  ? 237.629 295.674 289.415 1.00 0.00 ? 654  GLU G CA 1 
ATOM 249  C CA . GLU A  1  659  ? 239.925 305.984 290.554 1.00 0.00 ? 659  GLU G CA 1 
ATOM 250  C CA . ARG A  1  660  ? 239.178 303.917 293.630 1.00 0.00 ? 660  ARG G CA 1 
ATOM 251  C CA . ALA A  1  661  ? 241.271 301.071 292.319 1.00 0.00 ? 661  ALA G CA 1 
ATOM 252  C CA . ARG A  1  662  ? 244.177 303.302 291.831 1.00 0.00 ? 662  ARG G CA 1 
ATOM 253  C CA . ARG A  1  663  ? 244.053 304.797 295.151 1.00 0.00 ? 663  ARG G CA 1 
ATOM 254  C CA . LEU A  1  664  ? 244.053 301.370 296.623 1.00 0.00 ? 664  LEU G CA 1 
ATOM 255  C CA . LEU A  1  665  ? 246.781 300.351 294.370 1.00 0.00 ? 665  LEU G CA 1 
ATOM 256  C CA . ALA A  1  666  ? 249.058 303.236 294.916 1.00 0.00 ? 666  ALA G CA 1 
ATOM 257  C CA . LYS A  1  667  ? 248.656 302.598 298.609 1.00 0.00 ? 667  LYS G CA 1 
ATOM 258  C CA . ALA A  1  668  ? 249.494 298.873 298.235 1.00 0.00 ? 668  ALA G CA 1 
ATOM 259  C CA . ARG A  1  669  ? 252.542 299.862 296.364 1.00 0.00 ? 669  ARG G CA 1 
ATOM 260  C CA . SER A  1  670  ? 253.760 302.294 298.866 1.00 0.00 ? 670  SER G CA 1 
ATOM 261  C CA . SER A  1  671  ? 253.384 299.748 301.626 1.00 0.00 ? 671  SER G CA 1 
ATOM 262  C CA . VAL A  1  677  ? 250.362 295.938 293.736 1.00 0.00 ? 677  VAL G CA 1 
ATOM 263  C CA . PHE A  1  678  ? 251.908 298.707 291.848 1.00 0.00 ? 678  PHE G CA 1 
ATOM 264  C CA . MET A  1  679  ? 250.976 297.200 288.763 1.00 0.00 ? 679  MET G CA 1 
ATOM 265  C CA . LYS A  1  680  ? 247.553 296.278 289.599 1.00 0.00 ? 680  LYS G CA 1 
ATOM 266  C CA . SER A  1  681  ? 246.605 299.615 290.960 1.00 0.00 ? 681  SER G CA 1 
ATOM 267  C CA . VAL A  1  682  ? 248.281 301.633 288.201 1.00 0.00 ? 682  VAL G CA 1 
ATOM 268  C CA . ALA A  1  693  ? 244.795 312.766 287.852 1.00 0.00 ? 693  ALA G CA 1 
ATOM 269  C CA . ALA A  1  694  ? 245.941 309.490 286.190 1.00 0.00 ? 694  ALA G CA 1 
ATOM 270  C CA . GLN A  1  695  ? 249.105 311.187 285.112 1.00 0.00 ? 695  GLN G CA 1 
ATOM 271  C CA . ASP A  1  696  ? 249.734 312.227 288.747 1.00 0.00 ? 696  ASP G CA 1 
ATOM 272  C CA . LEU A  1  697  ? 249.293 308.678 289.780 1.00 0.00 ? 697  LEU G CA 1 
ATOM 273  C CA . CYS A  1  698  ? 251.605 307.456 287.078 1.00 0.00 ? 698  CYS G CA 1 
ATOM 274  C CA . GLU A  1  699  ? 254.073 310.157 287.879 1.00 0.00 ? 699  GLU G CA 1 
ATOM 275  C CA . GLU A  1  700  ? 254.110 309.473 291.599 1.00 0.00 ? 700  GLU G CA 1 
ATOM 276  C CA . ALA A  1  701  ? 254.722 305.704 290.508 1.00 0.00 ? 701  ALA G CA 1 
ATOM 277  C CA . LEU A  1  702  ? 257.335 306.511 288.191 1.00 0.00 ? 702  LEU G CA 1 
ATOM 278  C CA . ARG A  1  703  ? 259.285 307.974 291.117 1.00 0.00 ? 703  ARG G CA 1 
ATOM 279  C CA . HIS A  1  704  ? 259.070 304.981 293.449 1.00 0.00 ? 704  HIS G CA 1 
ATOM 280  C CA . LYS A  1  710  ? 257.516 295.925 285.510 1.00 0.00 ? 710  LYS G CA 1 
ATOM 281  C CA . LEU A  1  711  ? 256.671 299.461 286.638 1.00 0.00 ? 711  LEU G CA 1 
ATOM 282  C CA . TRP A  1  712  ? 256.515 300.922 283.312 1.00 0.00 ? 712  TRP G CA 1 
ATOM 283  C CA . MET A  1  713  ? 254.652 297.962 281.865 1.00 0.00 ? 713  MET G CA 1 
ATOM 284  C CA . MET A  1  714  ? 252.188 298.373 284.487 1.00 0.00 ? 714  MET G CA 1 
ATOM 285  C CA . LYS A  1  715  ? 252.185 302.242 283.674 1.00 0.00 ? 715  LYS G CA 1 
ATOM 286  C CA . GLY A  1  716  ? 251.416 301.687 280.028 1.00 0.00 ? 716  GLY G CA 1 
ATOM 287  C CA . GLN A  1  717  ? 249.080 298.684 280.539 1.00 0.00 ? 717  GLN G CA 1 
ATOM 288  C CA . ILE A  1  718  ? 246.912 300.969 282.548 1.00 0.00 ? 718  ILE G CA 1 
ATOM 289  C CA . GLU A  1  719  ? 247.156 303.335 279.862 1.00 0.00 ? 719  GLU G CA 1 
ATOM 290  C CA . GLU A  1  720  ? 246.515 301.063 277.151 1.00 0.00 ? 720  GLU G CA 1 
ATOM 291  C CA . MET A  1  725  ? 246.742 309.632 273.222 1.00 0.00 ? 725  MET G CA 1 
ATOM 292  C CA . GLU A  1  726  ? 249.989 310.762 275.142 1.00 0.00 ? 726  GLU G CA 1 
ATOM 293  C CA . LYS A  1  727  ? 250.016 308.849 278.376 1.00 0.00 ? 727  LYS G CA 1 
ATOM 294  C CA . ALA A  1  728  ? 249.985 305.622 276.492 1.00 0.00 ? 728  ALA G CA 1 
ATOM 295  C CA . ARG A  1  729  ? 253.063 306.633 274.384 1.00 0.00 ? 729  ARG G CA 1 
ATOM 296  C CA . GLU A  1  730  ? 254.925 307.317 277.426 1.00 0.00 ? 730  GLU G CA 1 
ATOM 297  C CA . ALA A  1  731  ? 254.353 304.101 279.410 1.00 0.00 ? 731  ALA G CA 1 
ATOM 298  C CA . TYR A  1  732  ? 255.600 301.981 276.571 1.00 0.00 ? 732  TYR G CA 1 
ATOM 299  C CA . ASN A  1  733  ? 258.551 303.968 275.734 1.00 0.00 ? 733  ASN G CA 1 
ATOM 300  C CA . GLN A  1  734  ? 259.514 304.020 279.279 1.00 0.00 ? 734  GLN G CA 1 
ATOM 301  C CA . GLY A  1  735  ? 258.985 300.314 279.856 1.00 0.00 ? 735  GLY G CA 1 
ATOM 302  C CA . LEU A  1  736  ? 260.967 299.358 276.739 1.00 0.00 ? 736  LEU G CA 1 
ATOM 303  C CA . PRO A  1  744  ? 256.303 289.582 280.235 1.00 0.00 ? 744  PRO G CA 1 
ATOM 304  C CA . LEU A  1  745  ? 256.125 293.228 279.275 1.00 0.00 ? 745  LEU G CA 1 
ATOM 305  C CA . TRP A  1  746  ? 255.615 292.391 275.646 1.00 0.00 ? 746  TRP G CA 1 
ATOM 306  C CA . LEU A  1  747  ? 252.684 290.397 276.991 1.00 0.00 ? 747  LEU G CA 1 
ATOM 307  C CA . LEU A  1  748  ? 251.664 293.336 279.061 1.00 0.00 ? 748  LEU G CA 1 
ATOM 308  C CA . LEU A  1  749  ? 252.116 295.396 275.831 1.00 0.00 ? 749  LEU G CA 1 
ATOM 309  C CA . SER A  1  750  ? 249.723 293.153 273.964 1.00 0.00 ? 750  SER G CA 1 
ATOM 310  C CA . ARG A  1  751  ? 247.096 293.323 276.694 1.00 0.00 ? 751  ARG G CA 1 
ATOM 311  C CA . LEU A  1  752  ? 246.777 297.048 276.210 1.00 0.00 ? 752  LEU G CA 1 
ATOM 312  C CA . GLU A  1  753  ? 247.137 296.956 272.558 1.00 0.00 ? 753  GLU G CA 1 
ATOM 313  C CA . GLU A  1  754  ? 244.195 294.608 273.150 1.00 0.00 ? 754  GLU G CA 1 
ATOM 314  C CA . LYS A  1  755  ? 242.469 296.876 275.471 1.00 0.00 ? 755  LYS G CA 1 
ATOM 315  C CA . THR A  1  760  ? 248.052 298.533 263.147 1.00 0.00 ? 760  THR G CA 1 
ATOM 316  C CA . ARG A  1  761  ? 249.687 300.074 266.248 1.00 0.00 ? 761  ARG G CA 1 
ATOM 317  C CA . ALA A  1  762  ? 249.624 296.642 267.862 1.00 0.00 ? 762  ALA G CA 1 
ATOM 318  C CA . ARG A  1  763  ? 251.554 295.437 264.731 1.00 0.00 ? 763  ARG G CA 1 
ATOM 319  C CA . ALA A  1  764  ? 254.105 298.024 264.808 1.00 0.00 ? 764  ALA G CA 1 
ATOM 320  C CA . ILE A  1  765  ? 254.832 297.284 268.438 1.00 0.00 ? 765  ILE G CA 1 
ATOM 321  C CA . LEU A  1  766  ? 254.661 293.615 267.953 1.00 0.00 ? 766  LEU G CA 1 
ATOM 322  C CA . GLU A  1  767  ? 257.054 293.608 265.041 1.00 0.00 ? 767  GLU G CA 1 
ATOM 323  C CA . LYS A  1  768  ? 259.541 295.814 266.946 1.00 0.00 ? 768  LYS G CA 1 
ATOM 324  C CA . SER A  1  769  ? 259.375 293.528 270.012 1.00 0.00 ? 769  SER G CA 1 
ATOM 325  C CA . ARG A  1  770  ? 260.271 290.685 267.614 1.00 0.00 ? 770  ARG G CA 1 
ATOM 326  C CA . LEU A  1  771  ? 263.483 292.487 266.675 1.00 0.00 ? 771  LEU G CA 1 
ATOM 327  C CA . GLY A  1  778  ? 256.993 287.075 272.417 1.00 0.00 ? 778  GLY G CA 1 
ATOM 328  C CA . LEU A  1  779  ? 257.160 287.132 268.614 1.00 0.00 ? 779  LEU G CA 1 
ATOM 329  C CA . TRP A  1  780  ? 254.598 284.498 267.953 1.00 0.00 ? 780  TRP G CA 1 
ATOM 330  C CA . LEU A  1  781  ? 252.231 285.896 270.594 1.00 0.00 ? 781  LEU G CA 1 
ATOM 331  C CA . GLU A  1  782  ? 252.699 289.277 269.257 1.00 0.00 ? 782  GLU G CA 1 
ATOM 332  C CA . SER A  1  783  ? 251.970 288.376 265.648 1.00 0.00 ? 783  SER G CA 1 
ATOM 333  C CA . VAL A  1  784  ? 248.879 286.419 266.571 1.00 0.00 ? 784  VAL G CA 1 
ATOM 334  C CA . ARG A  1  785  ? 247.424 289.300 268.642 1.00 0.00 ? 785  ARG G CA 1 
ATOM 335  C CA . LEU A  1  786  ? 247.991 291.959 266.107 1.00 0.00 ? 786  LEU G CA 1 
ATOM 336  C CA . LYS A  1  793  ? 242.761 286.020 258.636 1.00 0.00 ? 793  LYS G CA 1 
ATOM 337  C CA . ASN A  1  794  ? 244.859 284.111 256.527 1.00 0.00 ? 794  ASN G CA 1 
ATOM 338  C CA . ILE A  1  795  ? 248.070 285.858 256.654 1.00 0.00 ? 795  ILE G CA 1 
ATOM 339  C CA . ALA A  1  796  ? 247.569 285.908 260.402 1.00 0.00 ? 796  ALA G CA 1 
ATOM 340  C CA . ASN A  1  797  ? 246.776 282.197 260.427 1.00 0.00 ? 797  ASN G CA 1 
ATOM 341  C CA . THR A  1  798  ? 249.788 281.216 258.367 1.00 0.00 ? 798  THR G CA 1 
ATOM 342  C CA . LEU A  1  799  ? 252.222 283.062 260.649 1.00 0.00 ? 799  LEU G CA 1 
ATOM 343  C CA . MET A  1  800  ? 250.696 281.514 263.675 1.00 0.00 ? 800  MET G CA 1 
ATOM 344  C CA . ALA A  1  801  ? 251.083 278.425 261.829 1.00 0.00 ? 801  ALA G CA 1 
ATOM 345  C CA . LYS A  1  802  ? 254.662 278.837 260.711 1.00 0.00 ? 802  LYS G CA 1 
ATOM 346  C CA . ALA A  1  803  ? 255.256 279.800 264.349 1.00 0.00 ? 803  ALA G CA 1 
ATOM 347  C CA . LEU A  1  804  ? 253.821 276.479 265.726 1.00 0.00 ? 804  LEU G CA 1 
ATOM 348  C CA . GLN A  1  805  ? 256.997 274.615 264.938 1.00 0.00 ? 805  GLN G CA 1 
ATOM 349  C CA . GLU A  1  806  ? 258.645 277.066 267.448 1.00 0.00 ? 806  GLU G CA 1 
ATOM 350  C CA . ILE A  1  812  ? 249.390 278.569 269.238 1.00 0.00 ? 812  ILE G CA 1 
ATOM 351  C CA . LEU A  1  813  ? 248.798 276.482 266.223 1.00 0.00 ? 813  LEU G CA 1 
ATOM 352  C CA . TRP A  1  814  ? 245.221 275.547 267.010 1.00 0.00 ? 814  TRP G CA 1 
ATOM 353  C CA . SER A  1  815  ? 244.303 279.016 268.309 1.00 0.00 ? 815  SER G CA 1 
ATOM 354  C CA . GLU A  1  816  ? 245.565 280.431 265.108 1.00 0.00 ? 816  GLU G CA 1 
ATOM 355  C CA . ALA A  1  817  ? 244.195 277.986 262.844 1.00 0.00 ? 817  ALA G CA 1 
ATOM 356  C CA . ILE A  1  818  ? 240.850 277.882 264.750 1.00 0.00 ? 818  ILE G CA 1 
ATOM 357  C CA . PHE A  1  819  ? 240.482 281.566 264.005 1.00 0.00 ? 819  PHE G CA 1 
ATOM 358  C CA . LEU A  1  820  ? 241.025 281.114 260.272 1.00 0.00 ? 820  LEU G CA 1 
ATOM 359  C CA . ARG A  1  827  ? 231.191 286.119 267.040 1.00 0.00 ? 827  ARG G CA 1 
ATOM 360  C CA . THR A  1  828  ? 229.695 285.201 263.671 1.00 0.00 ? 828  THR G CA 1 
ATOM 361  C CA . LYS A  1  829  ? 232.360 282.920 262.576 1.00 0.00 ? 829  LYS G CA 1 
ATOM 362  C CA . SER A  1  830  ? 232.959 281.454 266.046 1.00 0.00 ? 830  SER G CA 1 
ATOM 363  C CA . VAL A  1  831  ? 229.444 280.128 265.519 1.00 0.00 ? 831  VAL G CA 1 
ATOM 364  C CA . ASP A  1  832  ? 230.106 278.953 262.010 1.00 0.00 ? 832  ASP G CA 1 
ATOM 365  C CA . ALA A  1  833  ? 233.177 277.054 263.140 1.00 0.00 ? 833  ALA G CA 1 
ATOM 366  C CA . LEU A  1  834  ? 231.304 275.038 265.784 1.00 0.00 ? 834  LEU G CA 1 
ATOM 367  C CA . LEU A  1  845  ? 237.820 275.790 275.204 1.00 0.00 ? 845  LEU G CA 1 
ATOM 368  C CA . ALA A  1  846  ? 237.737 278.658 272.729 1.00 0.00 ? 846  ALA G CA 1 
ATOM 369  C CA . VAL A  1  847  ? 237.005 276.106 270.044 1.00 0.00 ? 847  VAL G CA 1 
ATOM 370  C CA . ALA A  1  848  ? 234.455 274.228 272.131 1.00 0.00 ? 848  ALA G CA 1 
ATOM 371  C CA . LYS A  1  849  ? 232.774 277.621 272.880 1.00 0.00 ? 849  LYS G CA 1 
ATOM 372  C CA . LEU A  1  850  ? 232.336 278.229 269.257 1.00 0.00 ? 850  LEU G CA 1 
ATOM 373  C CA . PHE A  1  851  ? 230.983 274.711 268.535 1.00 0.00 ? 851  PHE G CA 1 
ATOM 374  C CA . TRP A  1  852  ? 228.171 274.786 271.056 1.00 0.00 ? 852  TRP G CA 1 
ATOM 375  C CA . SER A  1  853  ? 227.078 278.146 269.642 1.00 0.00 ? 853  SER G CA 1 
ATOM 376  C CA . ILE A  1  857  ? 224.553 271.600 266.979 1.00 0.00 ? 857  ILE G CA 1 
ATOM 377  C CA . THR A  1  858  ? 224.340 268.293 268.741 1.00 0.00 ? 858  THR G CA 1 
ATOM 378  C CA . LYS A  1  859  ? 227.887 267.370 267.721 1.00 0.00 ? 859  LYS G CA 1 
ATOM 379  C CA . ALA A  1  860  ? 229.213 270.802 268.666 1.00 0.00 ? 860  ALA G CA 1 
ATOM 380  C CA . ARG A  1  861  ? 227.510 270.579 271.985 1.00 0.00 ? 861  ARG G CA 1 
ATOM 381  C CA . GLU A  1  862  ? 228.929 267.072 272.715 1.00 0.00 ? 862  GLU G CA 1 
ATOM 382  C CA . TRP A  1  863  ? 232.421 268.252 271.973 1.00 0.00 ? 863  TRP G CA 1 
ATOM 383  C CA . PHE A  1  864  ? 232.039 271.167 274.329 1.00 0.00 ? 864  PHE G CA 1 
ATOM 384  C CA . HIS A  1  865  ? 230.808 268.902 277.021 1.00 0.00 ? 865  HIS G CA 1 
ATOM 385  C CA . ARG A  1  866  ? 233.343 266.265 276.771 1.00 0.00 ? 866  ARG G CA 1 
ATOM 386  C CA . THR A  1  867  ? 236.124 268.916 276.599 1.00 0.00 ? 867  THR G CA 1 
ATOM 387  C CA . VAL A  1  868  ? 234.859 270.450 279.803 1.00 0.00 ? 868  VAL G CA 1 
ATOM 388  C CA . PHE A  1  881  ? 230.799 280.542 276.047 1.00 0.00 ? 881  PHE G CA 1 
ATOM 389  C CA . TYR A  1  882  ? 231.503 283.930 277.550 1.00 0.00 ? 882  TYR G CA 1 
ATOM 390  C CA . LYS A  1  883  ? 233.550 285.107 274.529 1.00 0.00 ? 883  LYS G CA 1 
ATOM 391  C CA . PHE A  1  884  ? 230.585 284.215 272.373 1.00 0.00 ? 884  PHE G CA 1 
ATOM 392  C CA . GLU A  1  885  ? 228.018 286.155 274.261 1.00 0.00 ? 885  GLU G CA 1 
ATOM 393  C CA . LEU A  1  886  ? 230.393 289.122 274.180 1.00 0.00 ? 886  LEU G CA 1 
ATOM 394  C CA . GLU A  1  896  ? 222.548 277.290 276.400 1.00 0.00 ? 896  GLU G CA 1 
ATOM 395  C CA . VAL A  1  897  ? 226.450 278.278 277.096 1.00 0.00 ? 897  VAL G CA 1 
ATOM 396  C CA . ARG A  1  898  ? 225.470 281.395 278.777 1.00 0.00 ? 898  ARG G CA 1 
ATOM 397  C CA . LYS A  1  899  ? 223.289 279.180 281.365 1.00 0.00 ? 899  LYS G CA 1 
ATOM 398  C CA . ARG A  1  900  ? 225.907 276.674 281.431 1.00 0.00 ? 900  ARG G CA 1 
ATOM 399  C CA . CYS A  1  901  ? 228.558 279.286 282.158 1.00 0.00 ? 901  CYS G CA 1 
ATOM 400  C CA . GLU A  1  902  ? 226.706 280.566 285.002 1.00 0.00 ? 902  GLU G CA 1 
ATOM 401  C CA . TRP A  1  912  ? 235.731 283.747 282.008 1.00 0.00 ? 912  TRP G CA 1 
ATOM 402  C CA . CYS A  1  913  ? 238.922 285.405 282.798 1.00 0.00 ? 913  CYS G CA 1 
ATOM 403  C CA . ALA A  1  914  ? 239.506 285.559 279.005 1.00 0.00 ? 914  ALA G CA 1 
ATOM 404  C CA . VAL A  1  915  ? 236.166 287.250 278.428 1.00 0.00 ? 915  VAL G CA 1 
ATOM 405  C CA . SER A  1  916  ? 236.527 289.459 281.472 1.00 0.00 ? 916  SER G CA 1 
ATOM 406  C CA . LYS A  1  917  ? 240.121 290.345 280.374 1.00 0.00 ? 917  LYS G CA 1 
ATOM 407  C CA . ASP A  1  918  ? 238.775 291.082 276.860 1.00 0.00 ? 918  ASP G CA 1 
ATOM 408  C CA . GLY A  1  927  ? 235.834 298.039 285.478 1.00 0.00 ? 927  GLY G CA 1 
ATOM 409  C CA . ASP A  1  928  ? 232.328 297.097 286.769 1.00 0.00 ? 928  ASP G CA 1 
ATOM 410  C CA . ILE A  1  929  ? 232.186 294.026 284.489 1.00 0.00 ? 929  ILE G CA 1 
ATOM 411  C CA . LEU A  1  930  ? 235.473 292.915 285.990 1.00 0.00 ? 930  LEU G CA 1 
ATOM 412  C CA . ARG A  1  931  ? 233.970 292.992 289.386 1.00 0.00 ? 931  ARG G CA 1 
ATOM 413  C CA . LEU A  1  932  ? 230.788 291.355 288.283 1.00 0.00 ? 932  LEU G CA 1 
ATOM 414  C CA . VAL A  1  933  ? 232.833 288.774 286.884 1.00 0.00 ? 933  VAL G CA 1 
ATOM 415  C CA . ALA A  1  934  ? 235.093 288.345 289.936 1.00 0.00 ? 934  ALA G CA 1 
ATOM 416  C CA . GLY A  1  935  ? 231.884 287.988 292.085 1.00 0.00 ? 935  GLY G CA 1 
ATOM 417  C CA . ARG A  1  936  ? 230.792 285.014 290.449 1.00 0.00 ? 936  ARG G CA 1 
ATOM 418  C CA . ILE A  1  937  ? 234.108 283.153 290.182 1.00 0.00 ? 937  ILE G CA 1 
ATOM 419  C CA . GLN B  2  56   ? 217.337 258.211 130.398 1.00 0.00 ? 56   GLN D CA 1 
ATOM 420  C CA . ALA B  2  57   ? 217.320 256.961 133.931 1.00 0.00 ? 57   ALA D CA 1 
ATOM 421  C CA . PRO B  2  58   ? 217.263 253.489 135.249 1.00 0.00 ? 58   PRO D CA 1 
ATOM 422  C CA . ILE B  2  59   ? 213.796 252.267 136.054 1.00 0.00 ? 59   ILE D CA 1 
ATOM 423  C CA . MET B  2  60   ? 213.274 248.634 136.710 1.00 0.00 ? 60   MET D CA 1 
ATOM 424  C CA . LEU B  2  61   ? 215.257 245.501 136.098 1.00 0.00 ? 61   LEU D CA 1 
ATOM 425  C CA . LEU B  2  62   ? 213.511 242.455 134.735 1.00 0.00 ? 62   LEU D CA 1 
ATOM 426  C CA . SER B  2  63   ? 214.878 239.098 135.734 1.00 0.00 ? 63   SER D CA 1 
ATOM 427  C CA . GLY B  2  64   ? 213.576 235.673 134.892 1.00 0.00 ? 64   GLY D CA 1 
ATOM 428  C CA . HIS B  2  65   ? 215.383 234.429 131.825 1.00 0.00 ? 65   HIS D CA 1 
ATOM 429  C CA . GLU B  2  66   ? 217.709 231.549 132.622 1.00 0.00 ? 66   GLU D CA 1 
ATOM 430  C CA . GLY B  2  67   ? 220.127 232.340 129.830 1.00 0.00 ? 67   GLY D CA 1 
ATOM 431  C CA . GLU B  2  68   ? 221.235 235.231 127.681 1.00 0.00 ? 68   GLU D CA 1 
ATOM 432  C CA . VAL B  2  69   ? 218.473 237.428 126.392 1.00 0.00 ? 69   VAL D CA 1 
ATOM 433  C CA . TYR B  2  70   ? 218.401 237.588 122.608 1.00 0.00 ? 70   TYR D CA 1 
ATOM 434  C CA . CYS B  2  71   ? 215.944 240.359 121.856 1.00 0.00 ? 71   CYS D CA 1 
ATOM 435  C CA . CYS B  2  72   ? 213.359 242.701 123.308 1.00 0.00 ? 72   CYS D CA 1 
ATOM 436  C CA . LYS B  2  73   ? 210.555 244.537 121.575 1.00 0.00 ? 73   LYS D CA 1 
ATOM 437  C CA . PHE B  2  74   ? 207.743 246.811 122.654 1.00 0.00 ? 74   PHE D CA 1 
ATOM 438  C CA . HIS B  2  75   ? 204.199 246.051 121.571 1.00 0.00 ? 75   HIS D CA 1 
ATOM 439  C CA . PRO B  2  76   ? 202.872 248.626 119.179 1.00 0.00 ? 76   PRO D CA 1 
ATOM 440  C CA . ASN B  2  77   ? 200.141 249.637 121.584 1.00 0.00 ? 77   ASN D CA 1 
ATOM 441  C CA . GLY B  2  78   ? 202.857 250.283 124.144 1.00 0.00 ? 78   GLY D CA 1 
ATOM 442  C CA . SER B  2  79   ? 201.335 247.979 126.747 1.00 0.00 ? 79   SER D CA 1 
ATOM 443  C CA . THR B  2  80   ? 203.906 245.228 126.770 1.00 0.00 ? 80   THR D CA 1 
ATOM 444  C CA . LEU B  2  81   ? 207.495 244.250 126.197 1.00 0.00 ? 81   LEU D CA 1 
ATOM 445  C CA . ALA B  2  82   ? 208.353 240.875 124.718 1.00 0.00 ? 82   ALA D CA 1 
ATOM 446  C CA . SER B  2  83   ? 211.659 239.191 125.261 1.00 0.00 ? 83   SER D CA 1 
ATOM 447  C CA . ALA B  2  84   ? 213.286 236.148 123.698 1.00 0.00 ? 84   ALA D CA 1 
ATOM 448  C CA . GLY B  2  85   ? 216.197 234.201 125.051 1.00 0.00 ? 85   GLY D CA 1 
ATOM 449  C CA . PHE B  2  86   ? 218.652 231.374 124.690 1.00 0.00 ? 86   PHE D CA 1 
ATOM 450  C CA . ASP B  2  87   ? 216.604 229.646 127.328 1.00 0.00 ? 87   ASP D CA 1 
ATOM 451  C CA . ARG B  2  88   ? 214.115 228.914 124.550 1.00 0.00 ? 88   ARG D CA 1 
ATOM 452  C CA . LEU B  2  89   ? 211.471 231.060 126.189 1.00 0.00 ? 89   LEU D CA 1 
ATOM 453  C CA . ILE B  2  90   ? 209.538 234.175 125.296 1.00 0.00 ? 90   ILE D CA 1 
ATOM 454  C CA . LEU B  2  91   ? 208.458 236.394 128.146 1.00 0.00 ? 91   LEU D CA 1 
ATOM 455  C CA . LEU B  2  92   ? 205.933 239.216 128.307 1.00 0.00 ? 92   LEU D CA 1 
ATOM 456  C CA . TRP B  2  93   ? 206.481 242.116 130.654 1.00 0.00 ? 93   TRP D CA 1 
ATOM 457  C CA . ASN B  2  94   ? 204.573 245.305 131.461 1.00 0.00 ? 94   ASN D CA 1 
ATOM 458  C CA . VAL B  2  95   ? 206.011 248.231 129.497 1.00 0.00 ? 95   VAL D CA 1 
ATOM 459  C CA . TYR B  2  96   ? 205.270 250.963 132.042 1.00 0.00 ? 96   TYR D CA 1 
ATOM 460  C CA . GLY B  2  97   ? 207.106 249.315 134.833 1.00 0.00 ? 97   GLY D CA 1 
ATOM 461  C CA . ASP B  2  98   ? 207.634 245.710 134.298 1.00 0.00 ? 98   ASP D CA 1 
ATOM 462  C CA . CYS B  2  99   ? 207.638 244.666 137.848 1.00 0.00 ? 99   CYS D CA 1 
ATOM 463  C CA . ASP B  2  100  ? 205.047 242.390 136.536 1.00 0.00 ? 100  ASP D CA 1 
ATOM 464  C CA . ASN B  2  101  ? 206.074 239.647 134.264 1.00 0.00 ? 101  ASN D CA 1 
ATOM 465  C CA . TYR B  2  102  ? 202.894 239.020 132.396 1.00 0.00 ? 102  TYR D CA 1 
ATOM 466  C CA . ALA B  2  103  ? 203.633 235.488 131.334 1.00 0.00 ? 103  ALA D CA 1 
ATOM 467  C CA . THR B  2  104  ? 205.911 233.034 129.590 1.00 0.00 ? 104  THR D CA 1 
ATOM 468  C CA . LEU B  2  105  ? 205.371 231.521 126.195 1.00 0.00 ? 105  LEU D CA 1 
ATOM 469  C CA . LYS B  2  106  ? 207.148 228.275 125.498 1.00 0.00 ? 106  LYS D CA 1 
ATOM 470  C CA . GLY B  2  107  ? 207.274 225.662 122.779 1.00 0.00 ? 107  GLY D CA 1 
ATOM 471  C CA . HIS B  2  108  ? 210.557 226.151 120.940 1.00 0.00 ? 108  HIS D CA 1 
ATOM 472  C CA . SER B  2  109  ? 212.958 223.232 121.127 1.00 0.00 ? 109  SER D CA 1 
ATOM 473  C CA . GLY B  2  110  ? 216.068 225.387 121.091 1.00 0.00 ? 110  GLY D CA 1 
ATOM 474  C CA . ALA B  2  111  ? 217.281 228.910 121.772 1.00 0.00 ? 111  ALA D CA 1 
ATOM 475  C CA . VAL B  2  112  ? 215.493 231.838 120.187 1.00 0.00 ? 112  VAL D CA 1 
ATOM 476  C CA . MET B  2  113  ? 217.336 234.575 118.282 1.00 0.00 ? 113  MET D CA 1 
ATOM 477  C CA . GLU B  2  114  ? 214.490 237.004 117.737 1.00 0.00 ? 114  GLU D CA 1 
ATOM 478  C CA . LEU B  2  115  ? 210.847 237.787 118.406 1.00 0.00 ? 115  LEU D CA 1 
ATOM 479  C CA . HIS B  2  116  ? 208.635 240.394 116.836 1.00 0.00 ? 116  HIS D CA 1 
ATOM 480  C CA . TYR B  2  117  ? 205.153 241.812 117.209 1.00 0.00 ? 117  TYR D CA 1 
ATOM 481  C CA . ASN B  2  118  ? 202.402 242.126 114.685 1.00 0.00 ? 118  ASN D CA 1 
ATOM 482  C CA . THR B  2  119  ? 201.194 245.660 114.078 1.00 0.00 ? 119  THR D CA 1 
ATOM 483  C CA . ASP B  2  120  ? 197.980 244.992 115.974 1.00 0.00 ? 120  ASP D CA 1 
ATOM 484  C CA . GLY B  2  121  ? 200.021 243.632 118.865 1.00 0.00 ? 121  GLY D CA 1 
ATOM 485  C CA . SER B  2  122  ? 197.911 240.511 118.836 1.00 0.00 ? 122  SER D CA 1 
ATOM 486  C CA . MET B  2  123  ? 200.585 238.148 117.608 1.00 0.00 ? 123  MET D CA 1 
ATOM 487  C CA . LEU B  2  124  ? 204.259 237.370 117.996 1.00 0.00 ? 124  LEU D CA 1 
ATOM 488  C CA . PHE B  2  125  ? 206.652 235.669 115.604 1.00 0.00 ? 125  PHE D CA 1 
ATOM 489  C CA . SER B  2  126  ? 209.776 233.969 116.911 1.00 0.00 ? 126  SER D CA 1 
ATOM 490  C CA . ALA B  2  127  ? 212.871 232.611 115.163 1.00 0.00 ? 127  ALA D CA 1 
ATOM 491  C CA . SER B  2  128  ? 214.739 229.727 116.705 1.00 0.00 ? 128  SER D CA 1 
ATOM 492  C CA . THR B  2  129  ? 217.724 227.397 116.448 1.00 0.00 ? 129  THR D CA 1 
ATOM 493  C CA . ASP B  2  130  ? 215.159 224.638 116.113 1.00 0.00 ? 130  ASP D CA 1 
ATOM 494  C CA . LYS B  2  131  ? 214.986 225.931 112.549 1.00 0.00 ? 131  LYS D CA 1 
ATOM 495  C CA . THR B  2  132  ? 211.392 226.913 112.846 1.00 0.00 ? 132  THR D CA 1 
ATOM 496  C CA . VAL B  2  133  ? 209.474 230.074 113.415 1.00 0.00 ? 133  VAL D CA 1 
ATOM 497  C CA . ALA B  2  134  ? 206.382 230.134 115.518 1.00 0.00 ? 134  ALA D CA 1 
ATOM 498  C CA . VAL B  2  135  ? 203.424 232.448 115.313 1.00 0.00 ? 135  VAL D CA 1 
ATOM 499  C CA . TRP B  2  136  ? 201.894 232.987 118.689 1.00 0.00 ? 136  TRP D CA 1 
ATOM 500  C CA . ASP B  2  137  ? 198.627 234.409 119.891 1.00 0.00 ? 137  ASP D CA 1 
ATOM 501  C CA . SER B  2  138  ? 199.706 236.600 122.752 1.00 0.00 ? 138  SER D CA 1 
ATOM 502  C CA . GLU B  2  139  ? 196.498 236.546 124.714 1.00 0.00 ? 139  GLU D CA 1 
ATOM 503  C CA . THR B  2  140  ? 195.984 232.799 124.526 1.00 0.00 ? 140  THR D CA 1 
ATOM 504  C CA . GLY B  2  141  ? 199.659 231.926 124.485 1.00 0.00 ? 141  GLY D CA 1 
ATOM 505  C CA . GLU B  2  142  ? 198.790 229.365 121.855 1.00 0.00 ? 142  GLU D CA 1 
ATOM 506  C CA . ARG B  2  143  ? 201.093 228.556 118.993 1.00 0.00 ? 143  ARG D CA 1 
ATOM 507  C CA . VAL B  2  144  ? 199.012 229.260 115.930 1.00 0.00 ? 144  VAL D CA 1 
ATOM 508  C CA . LYS B  2  145  ? 201.476 227.836 113.486 1.00 0.00 ? 145  LYS D CA 1 
ATOM 509  C CA . ARG B  2  146  ? 204.984 226.529 113.228 1.00 0.00 ? 146  ARG D CA 1 
ATOM 510  C CA . LEU B  2  147  ? 206.740 227.590 110.087 1.00 0.00 ? 147  LEU D CA 1 
ATOM 511  C CA . LYS B  2  148  ? 209.028 224.936 108.722 1.00 0.00 ? 148  LYS D CA 1 
ATOM 512  C CA . GLY B  2  149  ? 211.130 225.096 105.615 1.00 0.00 ? 149  GLY D CA 1 
ATOM 513  C CA . HIS B  2  150  ? 214.434 226.623 106.615 1.00 0.00 ? 150  HIS D CA 1 
ATOM 514  C CA . THR B  2  151  ? 217.328 224.208 106.345 1.00 0.00 ? 151  THR D CA 1 
ATOM 515  C CA . SER B  2  152  ? 219.221 225.857 109.170 1.00 0.00 ? 152  SER D CA 1 
ATOM 516  C CA . PHE B  2  153  ? 218.770 228.049 112.221 1.00 0.00 ? 153  PHE D CA 1 
ATOM 517  C CA . VAL B  2  154  ? 216.323 230.905 111.871 1.00 0.00 ? 154  VAL D CA 1 
ATOM 518  C CA . ASN B  2  155  ? 218.033 234.116 113.030 1.00 0.00 ? 155  ASN D CA 1 
ATOM 519  C CA . SER B  2  156  ? 215.610 236.970 112.429 1.00 0.00 ? 156  SER D CA 1 
ATOM 520  C CA . CYS B  2  157  ? 211.985 237.671 111.667 1.00 0.00 ? 157  CYS D CA 1 
ATOM 521  C CA . TYR B  2  158  ? 209.438 240.450 111.215 1.00 0.00 ? 158  TYR D CA 1 
ATOM 522  C CA . PRO B  2  159  ? 205.865 240.850 110.208 1.00 0.00 ? 159  PRO D CA 1 
ATOM 523  C CA . ALA B  2  160  ? 204.924 243.085 107.305 1.00 0.00 ? 160  ALA D CA 1 
ATOM 524  C CA . ARG B  2  161  ? 202.842 246.171 107.955 1.00 0.00 ? 161  ARG D CA 1 
ATOM 525  C CA . ARG B  2  162  ? 199.889 244.061 106.911 1.00 0.00 ? 162  ARG D CA 1 
ATOM 526  C CA . GLY B  2  163  ? 201.116 241.953 109.752 1.00 0.00 ? 163  GLY D CA 1 
ATOM 527  C CA . PRO B  2  164  ? 199.016 238.914 109.811 1.00 0.00 ? 164  PRO D CA 1 
ATOM 528  C CA . GLN B  2  165  ? 199.379 239.039 106.105 1.00 0.00 ? 165  GLN D CA 1 
ATOM 529  C CA . LEU B  2  166  ? 203.039 238.106 105.877 1.00 0.00 ? 166  LEU D CA 1 
ATOM 530  C CA . VAL B  2  167  ? 206.200 237.338 107.773 1.00 0.00 ? 167  VAL D CA 1 
ATOM 531  C CA . CYS B  2  168  ? 209.791 237.499 106.586 1.00 0.00 ? 168  CYS D CA 1 
ATOM 532  C CA . THR B  2  169  ? 212.565 235.427 108.016 1.00 0.00 ? 169  THR D CA 1 
ATOM 533  C CA . GLY B  2  170  ? 216.315 235.137 107.624 1.00 0.00 ? 170  GLY D CA 1 
ATOM 534  C CA . SER B  2  171  ? 218.284 231.987 108.255 1.00 0.00 ? 171  SER D CA 1 
ATOM 535  C CA . ASP B  2  172  ? 221.749 230.498 108.561 1.00 0.00 ? 172  ASP D CA 1 
ATOM 536  C CA . ASP B  2  173  ? 220.725 228.594 105.470 1.00 0.00 ? 173  ASP D CA 1 
ATOM 537  C CA . GLY B  2  174  ? 221.391 231.869 103.724 1.00 0.00 ? 174  GLY D CA 1 
ATOM 538  C CA . THR B  2  175  ? 217.874 232.274 102.495 1.00 0.00 ? 175  THR D CA 1 
ATOM 539  C CA . VAL B  2  176  ? 215.113 234.721 103.200 1.00 0.00 ? 176  VAL D CA 1 
ATOM 540  C CA . LYS B  2  177  ? 211.642 233.301 103.261 1.00 0.00 ? 177  LYS D CA 1 
ATOM 541  C CA . LEU B  2  178  ? 208.267 234.974 102.973 1.00 0.00 ? 178  LEU D CA 1 
ATOM 542  C CA . TRP B  2  179  ? 205.434 233.266 104.778 1.00 0.00 ? 179  TRP D CA 1 
ATOM 543  C CA . ASP B  2  180  ? 201.681 233.678 104.817 1.00 0.00 ? 180  ASP D CA 1 
ATOM 544  C CA . ILE B  2  181  ? 200.670 234.172 108.410 1.00 0.00 ? 181  ILE D CA 1 
ATOM 545  C CA . ARG B  2  182  ? 197.154 232.823 108.237 1.00 0.00 ? 182  ARG D CA 1 
ATOM 546  C CA . LYS B  2  183  ? 198.101 229.735 106.224 1.00 0.00 ? 183  LYS D CA 1 
ATOM 547  C CA . LYS B  2  184  ? 201.613 229.479 107.707 1.00 0.00 ? 184  LYS D CA 1 
ATOM 548  C CA . ALA B  2  185  ? 202.777 228.280 104.315 1.00 0.00 ? 185  ALA D CA 1 
ATOM 549  C CA . ALA B  2  186  ? 205.920 229.604 102.704 1.00 0.00 ? 186  ALA D CA 1 
ATOM 550  C CA . ILE B  2  187  ? 205.109 231.724 99.685  1.00 0.00 ? 187  ILE D CA 1 
ATOM 551  C CA . GLN B  2  188  ? 208.610 232.302 98.427  1.00 0.00 ? 188  GLN D CA 1 
ATOM 552  C CA . THR B  2  189  ? 212.229 231.471 99.086  1.00 0.00 ? 189  THR D CA 1 
ATOM 553  C CA . PHE B  2  190  ? 214.928 233.955 98.167  1.00 0.00 ? 190  PHE D CA 1 
ATOM 554  C CA . GLN B  2  191  ? 218.504 232.891 97.597  1.00 0.00 ? 191  GLN D CA 1 
ATOM 555  C CA . ASN B  2  192  ? 219.876 235.950 99.352  1.00 0.00 ? 192  ASN D CA 1 
ATOM 556  C CA . THR B  2  193  ? 223.668 235.103 99.939  1.00 0.00 ? 193  THR D CA 1 
ATOM 557  C CA . TYR B  2  194  ? 225.306 233.840 103.231 1.00 0.00 ? 194  TYR D CA 1 
ATOM 558  C CA . GLN B  2  195  ? 223.848 233.670 106.786 1.00 0.00 ? 195  GLN D CA 1 
ATOM 559  C CA . VAL B  2  196  ? 221.184 236.348 107.153 1.00 0.00 ? 196  VAL D CA 1 
ATOM 560  C CA . LEU B  2  197  ? 221.473 238.615 110.187 1.00 0.00 ? 197  LEU D CA 1 
ATOM 561  C CA . ALA B  2  198  ? 218.295 240.638 109.799 1.00 0.00 ? 198  ALA D CA 1 
ATOM 562  C CA . VAL B  2  199  ? 215.224 241.152 107.656 1.00 0.00 ? 199  VAL D CA 1 
ATOM 563  C CA . THR B  2  200  ? 212.672 243.933 107.695 1.00 0.00 ? 200  THR D CA 1 
ATOM 564  C CA . PHE B  2  201  ? 209.780 245.227 105.616 1.00 0.00 ? 201  PHE D CA 1 
ATOM 565  C CA . ASN B  2  202  ? 209.486 248.741 104.262 1.00 0.00 ? 202  ASN D CA 1 
ATOM 566  C CA . ASP B  2  203  ? 206.634 250.967 105.406 1.00 0.00 ? 203  ASP D CA 1 
ATOM 567  C CA . THR B  2  204  ? 204.427 249.809 102.503 1.00 0.00 ? 204  THR D CA 1 
ATOM 568  C CA . SER B  2  205  ? 205.691 246.221 102.803 1.00 0.00 ? 205  SER D CA 1 
ATOM 569  C CA . ASP B  2  206  ? 206.505 246.390 99.119  1.00 0.00 ? 206  ASP D CA 1 
ATOM 570  C CA . GLN B  2  207  ? 210.175 245.876 99.839  1.00 0.00 ? 207  GLN D CA 1 
ATOM 571  C CA . ILE B  2  208  ? 212.267 243.745 102.129 1.00 0.00 ? 208  ILE D CA 1 
ATOM 572  C CA . ILE B  2  209  ? 215.761 244.582 103.243 1.00 0.00 ? 209  ILE D CA 1 
ATOM 573  C CA . SER B  2  210  ? 218.123 241.913 104.400 1.00 0.00 ? 210  SER D CA 1 
ATOM 574  C CA . GLY B  2  211  ? 221.617 241.925 105.795 1.00 0.00 ? 211  GLY D CA 1 
ATOM 575  C CA . GLY B  2  212  ? 224.157 239.186 105.992 1.00 0.00 ? 212  GLY D CA 1 
ATOM 576  C CA . ILE B  2  213  ? 227.580 237.899 106.914 1.00 0.00 ? 213  ILE D CA 1 
ATOM 577  C CA . ASP B  2  214  ? 228.249 238.093 103.182 1.00 0.00 ? 214  ASP D CA 1 
ATOM 578  C CA . ASN B  2  215  ? 228.730 241.840 103.894 1.00 0.00 ? 215  ASN D CA 1 
ATOM 579  C CA . ASP B  2  216  ? 225.832 242.899 101.778 1.00 0.00 ? 216  ASP D CA 1 
ATOM 580  C CA . ILE B  2  217  ? 222.551 244.649 102.359 1.00 0.00 ? 217  ILE D CA 1 
ATOM 581  C CA . LYS B  2  218  ? 220.014 243.848 99.744  1.00 0.00 ? 218  LYS D CA 1 
ATOM 582  C CA . VAL B  2  219  ? 216.593 245.103 98.912  1.00 0.00 ? 219  VAL D CA 1 
ATOM 583  C CA . TRP B  2  220  ? 214.090 242.677 97.532  1.00 0.00 ? 220  TRP D CA 1 
ATOM 584  C CA . ASP B  2  221  ? 210.757 243.143 95.831  1.00 0.00 ? 221  ASP D CA 1 
ATOM 585  C CA . LEU B  2  222  ? 208.258 241.350 97.992  1.00 0.00 ? 222  LEU D CA 1 
ATOM 586  C CA . ARG B  2  223  ? 205.998 240.319 95.145  1.00 0.00 ? 223  ARG D CA 1 
ATOM 587  C CA . GLN B  2  224  ? 208.650 239.626 92.515  1.00 0.00 ? 224  GLN D CA 1 
ATOM 588  C CA . ASN B  2  225  ? 211.383 238.343 94.874  1.00 0.00 ? 225  ASN D CA 1 
ATOM 589  C CA . LYS B  2  226  ? 213.849 240.014 92.547  1.00 0.00 ? 226  LYS D CA 1 
ATOM 590  C CA . LEU B  2  227  ? 216.901 241.678 94.009  1.00 0.00 ? 227  LEU D CA 1 
ATOM 591  C CA . THR B  2  228  ? 216.410 245.363 93.454  1.00 0.00 ? 228  THR D CA 1 
ATOM 592  C CA . TYR B  2  229  ? 219.716 246.513 94.829  1.00 0.00 ? 229  TYR D CA 1 
ATOM 593  C CA . THR B  2  230  ? 222.716 245.677 96.897  1.00 0.00 ? 230  THR D CA 1 
ATOM 594  C CA . MET B  2  231  ? 224.422 248.172 99.119  1.00 0.00 ? 231  MET D CA 1 
ATOM 595  C CA . ARG B  2  232  ? 227.945 248.036 100.481 1.00 0.00 ? 232  ARG D CA 1 
ATOM 596  C CA . GLY B  2  233  ? 230.603 250.548 101.457 1.00 0.00 ? 233  GLY D CA 1 
ATOM 597  C CA . HIS B  2  234  ? 234.342 250.293 101.165 1.00 0.00 ? 234  HIS D CA 1 
ATOM 598  C CA . ALA B  2  235  ? 234.648 247.468 103.650 1.00 0.00 ? 235  ALA D CA 1 
ATOM 599  C CA . ASP B  2  236  ? 233.002 244.107 104.043 1.00 0.00 ? 236  ASP D CA 1 
ATOM 600  C CA . SER B  2  237  ? 230.876 243.467 107.192 1.00 0.00 ? 237  SER D CA 1 
ATOM 601  C CA . VAL B  2  238  ? 226.940 243.528 108.004 1.00 0.00 ? 238  VAL D CA 1 
ATOM 602  C CA . THR B  2  239  ? 225.115 242.472 111.267 1.00 0.00 ? 239  THR D CA 1 
ATOM 603  C CA . GLY B  2  240  ? 221.778 244.314 111.443 1.00 0.00 ? 240  GLY D CA 1 
ATOM 604  C CA . LEU B  2  241  ? 219.520 246.306 109.170 1.00 0.00 ? 241  LEU D CA 1 
ATOM 605  C CA . SER B  2  242  ? 216.142 248.014 109.258 1.00 0.00 ? 242  SER D CA 1 
ATOM 606  C CA . LEU B  2  243  ? 214.178 250.686 107.447 1.00 0.00 ? 243  LEU D CA 1 
ATOM 607  C CA . SER B  2  244  ? 213.535 254.060 109.026 1.00 0.00 ? 244  SER D CA 1 
ATOM 608  C CA . SER B  2  245  ? 210.084 254.909 110.263 1.00 0.00 ? 245  SER D CA 1 
ATOM 609  C CA . GLU B  2  246  ? 209.793 257.161 107.238 1.00 0.00 ? 246  GLU D CA 1 
ATOM 610  C CA . GLY B  2  247  ? 210.874 254.284 105.044 1.00 0.00 ? 247  GLY D CA 1 
ATOM 611  C CA . SER B  2  248  ? 213.286 256.616 103.304 1.00 0.00 ? 248  SER D CA 1 
ATOM 612  C CA . TYR B  2  249  ? 216.436 255.216 104.806 1.00 0.00 ? 249  TYR D CA 1 
ATOM 613  C CA . LEU B  2  250  ? 217.990 252.045 106.092 1.00 0.00 ? 250  LEU D CA 1 
ATOM 614  C CA . LEU B  2  251  ? 220.052 251.815 109.238 1.00 0.00 ? 251  LEU D CA 1 
ATOM 615  C CA . SER B  2  252  ? 222.694 249.161 109.079 1.00 0.00 ? 252  SER D CA 1 
ATOM 616  C CA . ASN B  2  253  ? 225.171 247.915 111.602 1.00 0.00 ? 253  ASN D CA 1 
ATOM 617  C CA . ALA B  2  254  ? 228.478 246.387 110.699 1.00 0.00 ? 254  ALA D CA 1 
ATOM 618  C CA . MET B  2  255  ? 231.000 244.297 112.617 1.00 0.00 ? 255  MET D CA 1 
ATOM 619  C CA . ASP B  2  256  ? 233.467 247.119 112.430 1.00 0.00 ? 256  ASP D CA 1 
ATOM 620  C CA . ASN B  2  257  ? 231.915 249.081 115.287 1.00 0.00 ? 257  ASN D CA 1 
ATOM 621  C CA . THR B  2  258  ? 229.886 251.245 112.976 1.00 0.00 ? 258  THR D CA 1 
ATOM 622  C CA . VAL B  2  259  ? 226.269 252.124 112.302 1.00 0.00 ? 259  VAL D CA 1 
ATOM 623  C CA . ARG B  2  260  ? 225.264 253.856 109.125 1.00 0.00 ? 260  ARG D CA 1 
ATOM 624  C CA . VAL B  2  261  ? 222.178 255.487 107.721 1.00 0.00 ? 261  VAL D CA 1 
ATOM 625  C CA . TRP B  2  262  ? 221.764 255.024 104.013 1.00 0.00 ? 262  TRP D CA 1 
ATOM 626  C CA . ASP B  2  263  ? 219.479 256.494 101.419 1.00 0.00 ? 263  ASP D CA 1 
ATOM 627  C CA . VAL B  2  264  ? 218.470 253.336 99.620  1.00 0.00 ? 264  VAL D CA 1 
ATOM 628  C CA . ARG B  2  265  ? 216.410 255.320 97.095  1.00 0.00 ? 265  ARG D CA 1 
ATOM 629  C CA . PRO B  2  266  ? 214.109 253.641 94.732  1.00 0.00 ? 266  PRO D CA 1 
ATOM 630  C CA . PHE B  2  267  ? 214.786 253.791 91.031  1.00 0.00 ? 267  PHE D CA 1 
ATOM 631  C CA . ALA B  2  268  ? 218.439 254.481 90.666  1.00 0.00 ? 268  ALA D CA 1 
ATOM 632  C CA . PRO B  2  269  ? 219.445 253.996 94.196  1.00 0.00 ? 269  PRO D CA 1 
ATOM 633  C CA . LYS B  2  270  ? 220.744 256.871 96.160  1.00 0.00 ? 270  LYS D CA 1 
ATOM 634  C CA . GLU B  2  271  ? 222.845 254.124 97.594  1.00 0.00 ? 271  GLU D CA 1 
ATOM 635  C CA . ARG B  2  272  ? 224.582 256.762 99.601  1.00 0.00 ? 272  ARG D CA 1 
ATOM 636  C CA . CYS B  2  273  ? 225.571 256.799 103.228 1.00 0.00 ? 273  CYS D CA 1 
ATOM 637  C CA . VAL B  2  274  ? 224.010 259.845 104.838 1.00 0.00 ? 274  VAL D CA 1 
ATOM 638  C CA . LYS B  2  275  ? 225.390 259.422 108.323 1.00 0.00 ? 275  LYS D CA 1 
ATOM 639  C CA . ILE B  2  276  ? 227.793 257.301 110.305 1.00 0.00 ? 276  ILE D CA 1 
ATOM 640  C CA . PHE B  2  277  ? 227.485 256.679 114.009 1.00 0.00 ? 277  PHE D CA 1 
ATOM 641  C CA . GLN B  2  278  ? 230.493 255.501 115.938 1.00 0.00 ? 278  GLN D CA 1 
ATOM 642  C CA . GLY B  2  279  ? 232.016 255.600 119.374 1.00 0.00 ? 279  GLY D CA 1 
ATOM 643  C CA . ASN B  2  280  ? 230.500 252.410 120.598 1.00 0.00 ? 280  ASN D CA 1 
ATOM 644  C CA . VAL B  2  281  ? 231.887 249.012 120.443 1.00 0.00 ? 281  VAL D CA 1 
ATOM 645  C CA . HIS B  2  282  ? 228.423 248.283 119.153 1.00 0.00 ? 282  HIS D CA 1 
ATOM 646  C CA . ASN B  2  283  ? 230.049 245.325 117.735 1.00 0.00 ? 283  ASN D CA 1 
ATOM 647  C CA . PHE B  2  284  ? 233.715 245.486 118.042 1.00 0.00 ? 284  PHE D CA 1 
ATOM 648  C CA . GLU B  2  285  ? 233.937 242.268 116.339 1.00 0.00 ? 285  GLU D CA 1 
ATOM 649  C CA . LYS B  2  286  ? 230.810 240.333 116.463 1.00 0.00 ? 286  LYS D CA 1 
ATOM 650  C CA . ASN B  2  287  ? 227.413 240.303 118.021 1.00 0.00 ? 287  ASN D CA 1 
ATOM 651  C CA . LEU B  2  288  ? 224.300 240.925 116.050 1.00 0.00 ? 288  LEU D CA 1 
ATOM 652  C CA . LEU B  2  289  ? 223.167 243.920 118.045 1.00 0.00 ? 289  LEU D CA 1 
ATOM 653  C CA . ARG B  2  290  ? 219.951 245.629 117.118 1.00 0.00 ? 290  ARG D CA 1 
ATOM 654  C CA . CYS B  2  291  ? 219.658 249.344 116.546 1.00 0.00 ? 291  CYS D CA 1 
ATOM 655  C CA . SER B  2  292  ? 216.642 251.567 116.728 1.00 0.00 ? 292  SER D CA 1 
ATOM 656  C CA . TRP B  2  293  ? 215.322 254.949 115.796 1.00 0.00 ? 293  TRP D CA 1 
ATOM 657  C CA . SER B  2  294  ? 213.836 256.773 118.716 1.00 0.00 ? 294  SER D CA 1 
ATOM 658  C CA . PRO B  2  295  ? 210.964 258.867 117.565 1.00 0.00 ? 295  PRO D CA 1 
ATOM 659  C CA . ASP B  2  296  ? 210.427 260.523 120.876 1.00 0.00 ? 296  ASP D CA 1 
ATOM 660  C CA . GLY B  2  297  ? 213.372 262.843 120.037 1.00 0.00 ? 297  GLY D CA 1 
ATOM 661  C CA . SER B  2  298  ? 215.321 261.916 116.970 1.00 0.00 ? 298  SER D CA 1 
ATOM 662  C CA . LYS B  2  299  ? 218.012 259.583 118.140 1.00 0.00 ? 299  LYS D CA 1 
ATOM 663  C CA . ILE B  2  300  ? 219.709 256.353 117.204 1.00 0.00 ? 300  ILE D CA 1 
ATOM 664  C CA . ALA B  2  301  ? 219.959 253.786 119.957 1.00 0.00 ? 301  ALA D CA 1 
ATOM 665  C CA . ALA B  2  302  ? 222.046 250.668 120.128 1.00 0.00 ? 302  ALA D CA 1 
ATOM 666  C CA . GLY B  2  303  ? 223.625 248.219 122.505 1.00 0.00 ? 303  GLY D CA 1 
ATOM 667  C CA . SER B  2  304  ? 227.361 247.810 122.686 1.00 0.00 ? 304  SER D CA 1 
ATOM 668  C CA . ALA B  2  305  ? 230.046 245.239 123.418 1.00 0.00 ? 305  ALA D CA 1 
ATOM 669  C CA . ASP B  2  306  ? 231.264 247.362 126.274 1.00 0.00 ? 306  ASP D CA 1 
ATOM 670  C CA . ARG B  2  307  ? 228.003 246.676 128.106 1.00 0.00 ? 307  ARG D CA 1 
ATOM 671  C CA . PHE B  2  308  ? 226.580 250.131 127.551 1.00 0.00 ? 308  PHE D CA 1 
ATOM 672  C CA . VAL B  2  309  ? 223.610 251.536 125.704 1.00 0.00 ? 309  VAL D CA 1 
ATOM 673  C CA . TYR B  2  310  ? 224.521 254.299 123.304 1.00 0.00 ? 310  TYR D CA 1 
ATOM 674  C CA . VAL B  2  311  ? 222.275 257.085 122.130 1.00 0.00 ? 311  VAL D CA 1 
ATOM 675  C CA . TRP B  2  312  ? 223.225 259.377 119.282 1.00 0.00 ? 312  TRP D CA 1 
ATOM 676  C CA . ASP B  2  313  ? 221.651 262.446 117.805 1.00 0.00 ? 313  ASP D CA 1 
ATOM 677  C CA . THR B  2  314  ? 220.503 261.257 114.434 1.00 0.00 ? 314  THR D CA 1 
ATOM 678  C CA . THR B  2  315  ? 221.356 264.460 112.615 1.00 0.00 ? 315  THR D CA 1 
ATOM 679  C CA . SER B  2  316  ? 224.467 265.546 114.487 1.00 0.00 ? 316  SER D CA 1 
ATOM 680  C CA . ARG B  2  317  ? 225.581 261.956 115.028 1.00 0.00 ? 317  ARG D CA 1 
ATOM 681  C CA . ARG B  2  318  ? 227.052 263.052 118.328 1.00 0.00 ? 318  ARG D CA 1 
ATOM 682  C CA . ILE B  2  319  ? 226.619 260.790 121.318 1.00 0.00 ? 319  ILE D CA 1 
ATOM 683  C CA . LEU B  2  320  ? 223.993 262.246 123.613 1.00 0.00 ? 320  LEU D CA 1 
ATOM 684  C CA . TYR B  2  321  ? 224.151 259.720 126.403 1.00 0.00 ? 321  TYR D CA 1 
ATOM 685  C CA . LYS B  2  322  ? 225.395 256.302 127.491 1.00 0.00 ? 322  LYS D CA 1 
ATOM 686  C CA . LEU B  2  323  ? 223.521 254.031 129.853 1.00 0.00 ? 323  LEU D CA 1 
ATOM 687  C CA . PRO B  2  324  ? 225.550 252.019 132.278 1.00 0.00 ? 324  PRO D CA 1 
ATOM 688  C CA . GLY B  2  325  ? 224.337 249.178 134.468 1.00 0.00 ? 325  GLY D CA 1 
ATOM 689  C CA . HIS B  2  326  ? 224.452 245.925 132.558 1.00 0.00 ? 326  HIS D CA 1 
ATOM 690  C CA . ALA B  2  327  ? 226.976 243.244 133.422 1.00 0.00 ? 327  ALA D CA 1 
ATOM 691  C CA . GLY B  2  328  ? 227.508 242.043 129.881 1.00 0.00 ? 328  GLY D CA 1 
ATOM 692  C CA . SER B  2  329  ? 227.072 242.895 126.235 1.00 0.00 ? 329  SER D CA 1 
ATOM 693  C CA . ILE B  2  330  ? 223.839 244.617 125.446 1.00 0.00 ? 330  ILE D CA 1 
ATOM 694  C CA . ASN B  2  331  ? 222.489 242.617 122.564 1.00 0.00 ? 331  ASN D CA 1 
ATOM 695  C CA . GLU B  2  332  ? 219.176 244.351 122.090 1.00 0.00 ? 332  GLU D CA 1 
ATOM 696  C CA . VAL B  2  333  ? 217.401 247.622 122.708 1.00 0.00 ? 333  VAL D CA 1 
ATOM 697  C CA . ALA B  2  334  ? 213.902 248.818 121.942 1.00 0.00 ? 334  ALA D CA 1 
ATOM 698  C CA . PHE B  2  335  ? 212.161 252.168 122.091 1.00 0.00 ? 335  PHE D CA 1 
ATOM 699  C CA . HIS B  2  336  ? 208.641 252.606 123.422 1.00 0.00 ? 336  HIS D CA 1 
ATOM 700  C CA . PRO B  2  337  ? 206.318 253.974 120.832 1.00 0.00 ? 337  PRO D CA 1 
ATOM 701  C CA . ASP B  2  338  ? 204.595 256.672 122.884 1.00 0.00 ? 338  ASP D CA 1 
ATOM 702  C CA . GLU B  2  339  ? 206.866 257.457 125.786 1.00 0.00 ? 339  GLU D CA 1 
ATOM 703  C CA . PRO B  2  340  ? 210.529 258.037 126.193 1.00 0.00 ? 340  PRO D CA 1 
ATOM 704  C CA . ILE B  2  341  ? 211.315 254.565 127.441 1.00 0.00 ? 341  ILE D CA 1 
ATOM 705  C CA . ILE B  2  342  ? 214.134 252.319 126.379 1.00 0.00 ? 342  ILE D CA 1 
ATOM 706  C CA . ILE B  2  343  ? 214.421 248.622 127.047 1.00 0.00 ? 343  ILE D CA 1 
ATOM 707  C CA . SER B  2  344  ? 217.826 247.010 127.049 1.00 0.00 ? 344  SER D CA 1 
ATOM 708  C CA . ALA B  2  345  ? 218.734 243.360 127.232 1.00 0.00 ? 345  ALA D CA 1 
ATOM 709  C CA . SER B  2  346  ? 222.027 241.731 127.818 1.00 0.00 ? 346  SER D CA 1 
ATOM 710  C CA . SER B  2  347  ? 223.897 238.547 128.317 1.00 0.00 ? 347  SER D CA 1 
ATOM 711  C CA . ASP B  2  348  ? 223.572 239.637 132.075 1.00 0.00 ? 348  ASP D CA 1 
ATOM 712  C CA . LYS B  2  349  ? 220.339 237.838 131.532 1.00 0.00 ? 349  LYS D CA 1 
ATOM 713  C CA . ARG B  2  350  ? 218.465 240.840 132.695 1.00 0.00 ? 350  ARG D CA 1 
ATOM 714  C CA . LEU B  2  351  ? 216.373 243.366 130.852 1.00 0.00 ? 351  LEU D CA 1 
ATOM 715  C CA . TYR B  2  352  ? 216.142 246.855 132.100 1.00 0.00 ? 352  TYR D CA 1 
ATOM 716  C CA . MET B  2  353  ? 213.883 249.774 131.393 1.00 0.00 ? 353  MET D CA 1 
ATOM 717  C CA . GLY B  2  354  ? 215.069 253.330 131.263 1.00 0.00 ? 354  GLY D CA 1 
ATOM 718  C CA . GLU B  2  355  ? 212.752 256.284 131.581 1.00 0.00 ? 355  GLU D CA 1 
ATOM 719  C CA . ILE B  2  356  ? 213.705 259.807 130.890 1.00 0.00 ? 356  ILE D CA 1 
ATOM 720  C CA . GLN B  2  357  ? 211.460 262.477 132.280 1.00 0.00 ? 357  GLN D CA 1 
ATOM 721  C CA . GLY C  3  86   ? 219.950 193.625 280.820 1.00 0.00 ? 86   GLY C CA 1 
ATOM 722  C CA . TYR C  3  87   ? 219.791 196.013 283.772 1.00 0.00 ? 87   TYR C CA 1 
ATOM 723  C CA . THR C  3  88   ? 218.540 193.244 286.051 1.00 0.00 ? 88   THR C CA 1 
ATOM 724  C CA . LEU C  3  89   ? 221.772 191.328 285.573 1.00 0.00 ? 89   LEU C CA 1 
ATOM 725  C CA . LEU C  3  90   ? 223.767 194.559 285.751 1.00 0.00 ? 90   LEU C CA 1 
ATOM 726  C CA . SER C  3  91   ? 222.269 195.274 289.165 1.00 0.00 ? 91   SER C CA 1 
ATOM 727  C CA . GLU C  3  92   ? 222.825 191.743 290.422 1.00 0.00 ? 92   GLU C CA 1 
ATOM 728  C CA . GLY C  3  93   ? 226.466 191.793 289.325 1.00 0.00 ? 93   GLY C CA 1 
ATOM 729  C CA . ILE C  3  94   ? 227.327 195.124 290.948 1.00 0.00 ? 94   ILE C CA 1 
ATOM 730  C CA . ASP C  3  95   ? 225.416 194.067 294.085 1.00 0.00 ? 95   ASP C CA 1 
ATOM 731  C CA . GLU C  3  96   ? 227.501 190.862 294.230 1.00 0.00 ? 96   GLU C CA 1 
ATOM 732  C CA . MET C  3  97   ? 230.610 192.898 293.355 1.00 0.00 ? 97   MET C CA 1 
ATOM 733  C CA . VAL C  3  98   ? 230.672 195.926 295.670 1.00 0.00 ? 98   VAL C CA 1 
ATOM 734  C CA . GLY C  3  99   ? 227.101 196.141 297.028 1.00 0.00 ? 99   GLY C CA 1 
ATOM 735  C CA . ILE C  3  100  ? 225.136 198.415 294.687 1.00 0.00 ? 100  ILE C CA 1 
ATOM 736  C CA . ILE C  3  101  ? 221.397 198.083 294.158 1.00 0.00 ? 101  ILE C CA 1 
ATOM 737  C CA . TYR C  3  102  ? 220.251 199.210 290.715 1.00 0.00 ? 102  TYR C CA 1 
ATOM 738  C CA . LYS C  3  103  ? 216.892 199.387 288.926 1.00 0.00 ? 103  LYS C CA 1 
ATOM 739  C CA . PRO C  3  104  ? 216.067 196.074 287.075 1.00 0.00 ? 104  PRO C CA 1 
ATOM 740  C CA . LYS C  3  105  ? 215.223 195.782 283.382 1.00 0.00 ? 105  LYS C CA 1 
ATOM 741  C CA . THR C  3  106  ? 217.883 196.272 277.878 1.00 0.00 ? 106  THR C CA 1 
ATOM 742  C CA . LYS C  3  107  ? 214.485 195.257 276.435 1.00 0.00 ? 107  LYS C CA 1 
ATOM 743  C CA . GLU C  3  108  ? 214.562 191.810 278.091 1.00 0.00 ? 108  GLU C CA 1 
ATOM 744  C CA . THR C  3  109  ? 216.042 193.209 281.341 1.00 0.00 ? 109  THR C CA 1 
ATOM 745  C CA . ARG C  3  110  ? 213.155 195.722 281.530 1.00 0.00 ? 110  ARG C CA 1 
ATOM 746  C CA . GLU C  3  111  ? 210.639 192.895 280.914 1.00 0.00 ? 111  GLU C CA 1 
ATOM 747  C CA . THR C  3  112  ? 212.059 191.145 284.010 1.00 0.00 ? 112  THR C CA 1 
ATOM 748  C CA . TYR C  3  113  ? 212.157 194.362 286.101 1.00 0.00 ? 113  TYR C CA 1 
ATOM 749  C CA . GLU C  3  114  ? 208.412 194.868 285.468 1.00 0.00 ? 114  GLU C CA 1 
ATOM 750  C CA . VAL C  3  115  ? 207.544 191.332 286.685 1.00 0.00 ? 115  VAL C CA 1 
ATOM 751  C CA . LEU C  3  116  ? 209.926 191.713 289.679 1.00 0.00 ? 116  LEU C CA 1 
ATOM 752  C CA . LEU C  3  117  ? 207.762 194.680 290.736 1.00 0.00 ? 117  LEU C CA 1 
ATOM 753  C CA . SER C  3  118  ? 204.669 192.523 290.110 1.00 0.00 ? 118  SER C CA 1 
ATOM 754  C CA . PHE C  3  119  ? 206.064 190.130 292.752 1.00 0.00 ? 119  PHE C CA 1 
ATOM 755  C CA . ILE C  3  120  ? 206.485 192.954 295.320 1.00 0.00 ? 120  ILE C CA 1 
ATOM 756  C CA . GLN C  3  121  ? 202.901 194.275 294.876 1.00 0.00 ? 121  GLN C CA 1 
ATOM 757  C CA . ALA C  3  122  ? 201.536 190.755 295.541 1.00 0.00 ? 122  ALA C CA 1 
ATOM 758  C CA . ALA C  3  123  ? 203.793 190.458 298.635 1.00 0.00 ? 123  ALA C CA 1 
ATOM 759  C CA . LEU C  3  124  ? 203.376 193.919 300.233 1.00 0.00 ? 124  LEU C CA 1 
ATOM 760  C CA . GLY C  3  125  ? 200.368 195.526 298.498 1.00 0.00 ? 125  GLY C CA 1 
ATOM 761  C CA . ASP C  3  126  ? 201.148 198.959 299.980 1.00 0.00 ? 126  ASP C CA 1 
ATOM 762  C CA . GLN C  3  127  ? 201.742 201.064 296.866 1.00 0.00 ? 127  GLN C CA 1 
ATOM 763  C CA . PRO C  3  128  ? 203.350 204.450 297.008 1.00 0.00 ? 128  PRO C CA 1 
ATOM 764  C CA . ARG C  3  129  ? 204.982 203.990 293.583 1.00 0.00 ? 129  ARG C CA 1 
ATOM 765  C CA . ASP C  3  130  ? 208.294 205.249 295.051 1.00 0.00 ? 130  ASP C CA 1 
ATOM 766  C CA . ILE C  3  131  ? 208.151 202.709 297.935 1.00 0.00 ? 131  ILE C CA 1 
ATOM 767  C CA . LEU C  3  132  ? 207.572 199.739 295.575 1.00 0.00 ? 132  LEU C CA 1 
ATOM 768  C CA . CYS C  3  133  ? 210.749 200.574 293.633 1.00 0.00 ? 133  CYS C CA 1 
ATOM 769  C CA . GLY C  3  134  ? 212.747 201.252 296.860 1.00 0.00 ? 134  GLY C CA 1 
ATOM 770  C CA . ALA C  3  135  ? 211.814 197.728 298.050 1.00 0.00 ? 135  ALA C CA 1 
ATOM 771  C CA . ALA C  3  136  ? 212.459 196.099 294.646 1.00 0.00 ? 136  ALA C CA 1 
ATOM 772  C CA . ASP C  3  137  ? 215.783 197.962 294.370 1.00 0.00 ? 137  ASP C CA 1 
ATOM 773  C CA . GLU C  3  138  ? 216.892 196.731 297.829 1.00 0.00 ? 138  GLU C CA 1 
ATOM 774  C CA . VAL C  3  139  ? 216.031 193.141 296.826 1.00 0.00 ? 139  VAL C CA 1 
ATOM 775  C CA . LEU C  3  140  ? 218.034 193.682 293.603 1.00 0.00 ? 140  LEU C CA 1 
ATOM 776  C CA . ALA C  3  141  ? 220.796 195.060 295.859 1.00 0.00 ? 141  ALA C CA 1 
ATOM 777  C CA . VAL C  3  142  ? 220.828 191.851 297.986 1.00 0.00 ? 142  VAL C CA 1 
ATOM 778  C CA . LEU C  3  143  ? 220.932 189.594 294.908 1.00 0.00 ? 143  LEU C CA 1 
ATOM 779  C CA . LYS C  3  151  ? 224.081 183.860 296.635 1.00 0.00 ? 151  LYS C CA 1 
ATOM 780  C CA . GLU C  3  152  ? 221.973 181.677 299.167 1.00 0.00 ? 152  GLU C CA 1 
ATOM 781  C CA . ARG C  3  153  ? 221.595 185.353 300.565 1.00 0.00 ? 153  ARG C CA 1 
ATOM 782  C CA . ARG C  3  154  ? 218.572 185.868 298.348 1.00 0.00 ? 154  ARG C CA 1 
ATOM 783  C CA . LYS C  3  155  ? 216.241 183.060 299.583 1.00 0.00 ? 155  LYS C CA 1 
ATOM 784  C CA . GLU C  3  156  ? 216.567 184.092 303.272 1.00 0.00 ? 156  GLU C CA 1 
ATOM 785  C CA . ILE C  3  157  ? 216.060 187.827 302.513 1.00 0.00 ? 157  ILE C CA 1 
ATOM 786  C CA . ASP C  3  158  ? 213.650 187.121 299.593 1.00 0.00 ? 158  ASP C CA 1 
ATOM 787  C CA . ASP C  3  166  ? 210.082 183.478 296.377 1.00 0.00 ? 166  ASP C CA 1 
ATOM 788  C CA . THR C  3  167  ? 211.497 180.809 293.917 1.00 0.00 ? 167  THR C CA 1 
ATOM 789  C CA . ARG C  3  168  ? 210.062 182.944 291.173 1.00 0.00 ? 168  ARG C CA 1 
ATOM 790  C CA . TYR C  3  169  ? 212.222 185.719 292.666 1.00 0.00 ? 169  TYR C CA 1 
ATOM 791  C CA . HIS C  3  170  ? 215.354 183.564 292.110 1.00 0.00 ? 170  HIS C CA 1 
ATOM 792  C CA . VAL C  3  171  ? 214.473 182.732 288.465 1.00 0.00 ? 171  VAL C CA 1 
ATOM 793  C CA . LEU C  3  172  ? 213.649 186.398 287.725 1.00 0.00 ? 172  LEU C CA 1 
ATOM 794  C CA . VAL C  3  173  ? 216.548 188.158 289.480 1.00 0.00 ? 173  VAL C CA 1 
ATOM 795  C CA . ASN C  3  174  ? 219.042 185.742 287.875 1.00 0.00 ? 174  ASN C CA 1 
ATOM 796  C CA . LEU C  3  175  ? 217.744 186.819 284.451 1.00 0.00 ? 175  LEU C CA 1 
ATOM 797  C CA . HIS C  3  259  ? 164.481 247.000 217.704 1.00 0.00 ? 259  HIS C CA 1 
ATOM 798  C CA . PRO C  3  260  ? 162.315 248.986 215.181 1.00 0.00 ? 260  PRO C CA 1 
ATOM 799  C CA . ARG C  3  261  ? 164.369 247.650 212.243 1.00 0.00 ? 261  ARG C CA 1 
ATOM 800  C CA . ASP C  3  262  ? 163.267 244.112 213.250 1.00 0.00 ? 262  ASP C CA 1 
ATOM 801  C CA . ILE C  3  263  ? 159.517 244.809 212.773 1.00 0.00 ? 263  ILE C CA 1 
ATOM 802  C CA . ASP C  3  264  ? 158.996 244.076 209.086 1.00 0.00 ? 264  ASP C CA 1 
ATOM 803  C CA . ALA C  3  265  ? 155.516 243.641 207.515 1.00 0.00 ? 265  ALA C CA 1 
ATOM 804  C CA . PHE C  3  266  ? 155.308 240.035 208.832 1.00 0.00 ? 266  PHE C CA 1 
ATOM 805  C CA . TRP C  3  267  ? 157.133 240.329 212.199 1.00 0.00 ? 267  TRP C CA 1 
ATOM 806  C CA . LEU C  3  268  ? 153.902 239.989 214.205 1.00 0.00 ? 268  LEU C CA 1 
ATOM 807  C CA . GLN C  3  269  ? 152.515 237.166 212.062 1.00 0.00 ? 269  GLN C CA 1 
ATOM 808  C CA . ARG C  3  270  ? 155.811 235.248 212.511 1.00 0.00 ? 270  ARG C CA 1 
ATOM 809  C CA . GLN C  3  271  ? 155.631 235.613 216.281 1.00 0.00 ? 271  GLN C CA 1 
ATOM 810  C CA . LEU C  3  272  ? 152.044 234.296 216.281 1.00 0.00 ? 272  LEU C CA 1 
ATOM 811  C CA . SER C  3  273  ? 152.868 231.623 213.673 1.00 0.00 ? 273  SER C CA 1 
ATOM 812  C CA . ARG C  3  274  ? 155.334 229.896 216.039 1.00 0.00 ? 274  ARG C CA 1 
ATOM 813  C CA . PHE C  3  275  ? 152.297 229.092 218.238 1.00 0.00 ? 275  PHE C CA 1 
ATOM 814  C CA . TYR C  3  276  ? 149.677 228.858 215.475 1.00 0.00 ? 276  TYR C CA 1 
ATOM 815  C CA . ASP C  3  277  ? 151.316 227.216 212.448 1.00 0.00 ? 277  ASP C CA 1 
ATOM 816  C CA . ASP C  3  278  ? 148.111 227.207 210.370 1.00 0.00 ? 278  ASP C CA 1 
ATOM 817  C CA . ALA C  3  279  ? 148.205 229.972 207.761 1.00 0.00 ? 279  ALA C CA 1 
ATOM 818  C CA . ILE C  3  280  ? 144.541 231.070 208.063 1.00 0.00 ? 280  ILE C CA 1 
ATOM 819  C CA . VAL C  3  281  ? 144.422 231.064 211.900 1.00 0.00 ? 281  VAL C CA 1 
ATOM 820  C CA . SER C  3  282  ? 147.770 232.882 212.317 1.00 0.00 ? 282  SER C CA 1 
ATOM 821  C CA . GLN C  3  283  ? 146.606 235.582 209.875 1.00 0.00 ? 283  GLN C CA 1 
ATOM 822  C CA . LYS C  3  284  ? 143.269 235.996 211.713 1.00 0.00 ? 284  LYS C CA 1 
ATOM 823  C CA . LYS C  3  285  ? 145.114 236.384 215.029 1.00 0.00 ? 285  LYS C CA 1 
ATOM 824  C CA . ALA C  3  286  ? 147.529 238.903 213.396 1.00 0.00 ? 286  ALA C CA 1 
ATOM 825  C CA . ASP C  3  287  ? 144.601 241.089 212.267 1.00 0.00 ? 287  ASP C CA 1 
ATOM 826  C CA . GLU C  3  288  ? 142.882 240.737 215.671 1.00 0.00 ? 288  GLU C CA 1 
ATOM 827  C CA . VAL C  3  289  ? 146.057 241.446 217.690 1.00 0.00 ? 289  VAL C CA 1 
ATOM 828  C CA . LEU C  3  290  ? 146.753 244.670 215.728 1.00 0.00 ? 290  LEU C CA 1 
ATOM 829  C CA . GLU C  3  291  ? 143.207 245.895 216.400 1.00 0.00 ? 291  GLU C CA 1 
ATOM 830  C CA . ILE C  3  292  ? 143.446 244.992 220.129 1.00 0.00 ? 292  ILE C CA 1 
ATOM 831  C CA . LEU C  3  293  ? 146.939 246.513 220.525 1.00 0.00 ? 293  LEU C CA 1 
ATOM 832  C CA . LYS C  3  294  ? 145.723 249.792 218.926 1.00 0.00 ? 294  LYS C CA 1 
ATOM 833  C CA . THR C  3  295  ? 143.317 250.387 221.747 1.00 0.00 ? 295  THR C CA 1 
ATOM 834  C CA . ALA C  3  296  ? 144.184 251.785 225.171 1.00 0.00 ? 296  ALA C CA 1 
ATOM 835  C CA . SER C  3  297  ? 143.013 250.374 228.503 1.00 0.00 ? 297  SER C CA 1 
ATOM 836  C CA . ASP C  3  298  ? 143.363 251.410 232.167 1.00 0.00 ? 298  ASP C CA 1 
ATOM 837  C CA . ASP C  3  299  ? 144.795 248.017 232.882 1.00 0.00 ? 299  ASP C CA 1 
ATOM 838  C CA . ARG C  3  300  ? 143.154 245.840 231.296 1.00 0.00 ? 300  ARG C CA 1 
ATOM 839  C CA . GLU C  3  301  ? 140.901 245.544 228.265 1.00 0.00 ? 301  GLU C CA 1 
ATOM 840  C CA . CYS C  3  302  ? 143.838 245.165 225.836 1.00 0.00 ? 302  CYS C CA 1 
ATOM 841  C CA . GLU C  3  303  ? 145.378 242.481 228.079 1.00 0.00 ? 303  GLU C CA 1 
ATOM 842  C CA . ASN C  3  304  ? 142.042 240.643 228.537 1.00 0.00 ? 304  ASN C CA 1 
ATOM 843  C CA . GLN C  3  305  ? 141.313 240.559 224.799 1.00 0.00 ? 305  GLN C CA 1 
ATOM 844  C CA . LEU C  3  306  ? 144.882 239.520 223.932 1.00 0.00 ? 306  LEU C CA 1 
ATOM 845  C CA . VAL C  3  307  ? 144.955 236.718 226.543 1.00 0.00 ? 307  VAL C CA 1 
ATOM 846  C CA . LEU C  3  308  ? 141.713 235.296 225.104 1.00 0.00 ? 308  LEU C CA 1 
ATOM 847  C CA . LEU C  3  309  ? 143.177 235.600 221.591 1.00 0.00 ? 309  LEU C CA 1 
ATOM 848  C CA . LEU C  3  310  ? 146.065 233.356 222.719 1.00 0.00 ? 310  LEU C CA 1 
ATOM 849  C CA . GLY C  3  311  ? 143.749 230.781 224.342 1.00 0.00 ? 311  GLY C CA 1 
ATOM 850  C CA . PHE C  3  312  ? 144.860 231.773 227.903 1.00 0.00 ? 312  PHE C CA 1 
ATOM 851  C CA . ASN C  3  313  ? 148.399 230.492 227.251 1.00 0.00 ? 313  ASN C CA 1 
ATOM 852  C CA . THR C  3  314  ? 151.546 232.134 225.850 1.00 0.00 ? 314  THR C CA 1 
ATOM 853  C CA . PHE C  3  315  ? 151.476 234.876 228.523 1.00 0.00 ? 315  PHE C CA 1 
ATOM 854  C CA . ASP C  3  316  ? 155.091 235.796 227.752 1.00 0.00 ? 316  ASP C CA 1 
ATOM 855  C CA . PHE C  3  317  ? 154.182 236.591 224.146 1.00 0.00 ? 317  PHE C CA 1 
ATOM 856  C CA . ILE C  3  318  ? 151.025 238.503 225.191 1.00 0.00 ? 318  ILE C CA 1 
ATOM 857  C CA . LYS C  3  319  ? 153.081 240.702 227.543 1.00 0.00 ? 319  LYS C CA 1 
ATOM 858  C CA . VAL C  3  320  ? 155.843 241.181 224.862 1.00 0.00 ? 320  VAL C CA 1 
ATOM 859  C CA . LEU C  3  321  ? 153.194 242.527 222.498 1.00 0.00 ? 321  LEU C CA 1 
ATOM 860  C CA . ARG C  3  322  ? 151.638 244.813 225.121 1.00 0.00 ? 322  ARG C CA 1 
ATOM 861  C CA . GLN C  3  323  ? 155.033 246.219 226.183 1.00 0.00 ? 323  GLN C CA 1 
ATOM 862  C CA . HIS C  3  324  ? 155.727 247.037 222.505 1.00 0.00 ? 324  HIS C CA 1 
ATOM 863  C CA . ARG C  3  325  ? 152.133 247.951 221.535 1.00 0.00 ? 325  ARG C CA 1 
ATOM 864  C CA . MET C  3  326  ? 153.175 251.273 219.928 1.00 0.00 ? 326  MET C CA 1 
ATOM 865  C CA . MET C  3  327  ? 156.098 249.702 217.986 1.00 0.00 ? 327  MET C CA 1 
ATOM 866  C CA . ILE C  3  328  ? 154.115 246.653 216.823 1.00 0.00 ? 328  ILE C CA 1 
ATOM 867  C CA . LEU C  3  329  ? 151.138 248.615 215.585 1.00 0.00 ? 329  LEU C CA 1 
ATOM 868  C CA . TYR C  3  330  ? 152.850 251.600 213.963 1.00 0.00 ? 330  TYR C CA 1 
ATOM 869  C CA . CYS C  3  331  ? 155.867 249.777 212.529 1.00 0.00 ? 331  CYS C CA 1 
ATOM 870  C CA . THR C  3  332  ? 153.676 246.999 211.025 1.00 0.00 ? 332  THR C CA 1 
ATOM 871  C CA . LEU C  3  333  ? 151.461 249.615 209.370 1.00 0.00 ? 333  LEU C CA 1 
ATOM 872  C CA . LEU C  3  334  ? 154.520 251.655 208.237 1.00 0.00 ? 334  LEU C CA 1 
ATOM 873  C CA . ALA C  3  335  ? 156.286 248.545 206.861 1.00 0.00 ? 335  ALA C CA 1 
ATOM 874  C CA . SER C  3  336  ? 153.169 247.816 204.750 1.00 0.00 ? 336  SER C CA 1 
ATOM 875  C CA . ALA C  3  337  ? 153.009 251.353 203.265 1.00 0.00 ? 337  ALA C CA 1 
ATOM 876  C CA . GLN C  3  338  ? 154.553 251.609 199.792 1.00 0.00 ? 338  GLN C CA 1 
ATOM 877  C CA . SER C  3  339  ? 153.484 255.049 198.500 1.00 0.00 ? 339  SER C CA 1 
ATOM 878  C CA . GLU C  3  340  ? 155.155 258.327 199.517 1.00 0.00 ? 340  GLU C CA 1 
ATOM 879  C CA . ALA C  3  341  ? 151.784 259.797 200.601 1.00 0.00 ? 341  ALA C CA 1 
ATOM 880  C CA . GLU C  3  342  ? 150.925 256.886 202.924 1.00 0.00 ? 342  GLU C CA 1 
ATOM 881  C CA . LYS C  3  343  ? 154.409 256.612 204.501 1.00 0.00 ? 343  LYS C CA 1 
ATOM 882  C CA . GLU C  3  344  ? 154.408 260.392 205.067 1.00 0.00 ? 344  GLU C CA 1 
ATOM 883  C CA . ARG C  3  345  ? 150.915 260.270 206.645 1.00 0.00 ? 345  ARG C CA 1 
ATOM 884  C CA . ILE C  3  346  ? 151.985 257.481 209.039 1.00 0.00 ? 346  ILE C CA 1 
ATOM 885  C CA . MET C  3  347  ? 155.278 259.232 209.938 1.00 0.00 ? 347  MET C CA 1 
ATOM 886  C CA . GLY C  3  348  ? 153.322 262.444 210.673 1.00 0.00 ? 348  GLY C CA 1 
ATOM 887  C CA . LYS C  3  349  ? 150.787 260.526 212.803 1.00 0.00 ? 349  LYS C CA 1 
ATOM 888  C CA . MET C  3  350  ? 153.571 258.773 214.768 1.00 0.00 ? 350  MET C CA 1 
ATOM 889  C CA . GLU C  3  351  ? 155.063 262.236 215.424 1.00 0.00 ? 351  GLU C CA 1 
ATOM 890  C CA . ALA C  3  352  ? 151.642 263.542 216.560 1.00 0.00 ? 352  ALA C CA 1 
ATOM 891  C CA . ASP C  3  353  ? 151.333 260.593 218.950 1.00 0.00 ? 353  ASP C CA 1 
ATOM 892  C CA . PRO C  3  354  ? 152.728 260.702 222.562 1.00 0.00 ? 354  PRO C CA 1 
ATOM 893  C CA . GLU C  3  355  ? 155.641 258.409 221.555 1.00 0.00 ? 355  GLU C CA 1 
ATOM 894  C CA . LEU C  3  356  ? 156.176 260.954 218.732 1.00 0.00 ? 356  LEU C CA 1 
ATOM 895  C CA . SER C  3  357  ? 159.556 260.285 217.353 1.00 0.00 ? 357  SER C CA 1 
ATOM 896  C CA . LYS C  3  358  ? 161.656 257.971 219.527 1.00 0.00 ? 358  LYS C CA 1 
ATOM 897  C CA . PHE C  3  359  ? 160.476 255.067 217.314 1.00 0.00 ? 359  PHE C CA 1 
ATOM 898  C CA . LEU C  3  360  ? 161.230 256.908 214.070 1.00 0.00 ? 360  LEU C CA 1 
ATOM 899  C CA . TYR C  3  361  ? 164.676 257.790 215.474 1.00 0.00 ? 361  TYR C CA 1 
ATOM 900  C CA . GLN C  3  362  ? 165.353 254.126 216.161 1.00 0.00 ? 362  GLN C CA 1 
ATOM 901  C CA . LEU C  3  363  ? 164.060 253.102 212.697 1.00 0.00 ? 363  LEU C CA 1 
ATOM 902  C CA . HIS C  3  364  ? 165.838 255.735 210.603 1.00 0.00 ? 364  HIS C CA 1 
ATOM 903  C CA . GLU C  3  365  ? 168.754 256.757 212.922 1.00 0.00 ? 365  GLU C CA 1 
ATOM 904  C CA . THR C  3  366  ? 169.489 256.853 214.397 1.00 0.00 ? 366  THR C CA 1 
ATOM 905  C CA . ALA C  3  404  ? 183.641 246.429 274.603 1.00 0.00 ? 404  ALA C CA 1 
ATOM 906  C CA . PRO C  3  405  ? 185.023 243.516 272.509 1.00 0.00 ? 405  PRO C CA 1 
ATOM 907  C CA . ARG C  3  406  ? 186.007 240.407 274.516 1.00 0.00 ? 406  ARG C CA 1 
ATOM 908  C CA . GLN C  3  407  ? 189.528 238.959 274.850 1.00 0.00 ? 407  GLN C CA 1 
ATOM 909  C CA . VAL C  3  408  ? 190.618 235.294 274.854 1.00 0.00 ? 408  VAL C CA 1 
ATOM 910  C CA . LEU C  3  409  ? 192.280 233.842 277.956 1.00 0.00 ? 409  LEU C CA 1 
ATOM 911  C CA . ASP C  3  410  ? 194.009 230.610 278.986 1.00 0.00 ? 410  ASP C CA 1 
ATOM 912  C CA . LEU C  3  411  ? 191.905 228.483 281.320 1.00 0.00 ? 411  LEU C CA 1 
ATOM 913  C CA . GLU C  3  412  ? 194.857 226.235 282.117 1.00 0.00 ? 412  GLU C CA 1 
ATOM 914  C CA . ASP C  3  413  ? 196.876 228.489 284.428 1.00 0.00 ? 413  ASP C CA 1 
ATOM 915  C CA . LEU C  3  414  ? 193.556 229.830 285.767 1.00 0.00 ? 414  LEU C CA 1 
ATOM 916  C CA . VAL C  3  415  ? 192.420 226.592 287.470 1.00 0.00 ? 415  VAL C CA 1 
ATOM 917  C CA . PHE C  3  416  ? 193.419 224.879 290.701 1.00 0.00 ? 416  PHE C CA 1 
ATOM 918  C CA . THR C  3  417  ? 195.275 221.580 290.298 1.00 0.00 ? 417  THR C CA 1 
ATOM 919  C CA . GLN C  3  418  ? 194.875 219.000 293.093 1.00 0.00 ? 418  GLN C CA 1 
ATOM 920  C CA . GLY C  3  419  ? 191.410 220.365 293.913 1.00 0.00 ? 419  GLY C CA 1 
ATOM 921  C CA . SER C  3  420  ? 189.833 219.572 297.307 1.00 0.00 ? 420  SER C CA 1 
ATOM 922  C CA . HIS C  3  421  ? 193.434 219.189 298.441 1.00 0.00 ? 421  HIS C CA 1 
ATOM 923  C CA . PHE C  3  422  ? 193.746 222.830 297.428 1.00 0.00 ? 422  PHE C CA 1 
ATOM 924  C CA . MET C  3  423  ? 194.315 224.459 300.832 1.00 0.00 ? 423  MET C CA 1 
ATOM 925  C CA . ALA C  3  424  ? 193.795 228.048 299.659 1.00 0.00 ? 424  ALA C CA 1 
ATOM 926  C CA . ASN C  3  425  ? 195.088 229.461 302.918 1.00 0.00 ? 425  ASN C CA 1 
ATOM 927  C CA . LYS C  3  426  ? 198.821 229.036 303.391 1.00 0.00 ? 426  LYS C CA 1 
ATOM 928  C CA . ARG C  3  427  ? 198.501 229.578 307.162 1.00 0.00 ? 427  ARG C CA 1 
ATOM 929  C CA . CYS C  3  428  ? 196.899 227.363 309.844 1.00 0.00 ? 428  CYS C CA 1 
ATOM 930  C CA . GLN C  3  429  ? 196.098 227.459 313.567 1.00 0.00 ? 429  GLN C CA 1 
ATOM 931  C CA . LEU C  3  430  ? 196.651 225.527 316.781 1.00 0.00 ? 430  LEU C CA 1 
ATOM 932  C CA . PRO C  3  431  ? 193.758 224.388 318.836 1.00 0.00 ? 431  PRO C CA 1 
ATOM 933  C CA . ASP C  3  432  ? 194.084 225.267 322.573 1.00 0.00 ? 432  ASP C CA 1 
ATOM 934  C CA . GLY C  3  433  ? 196.144 222.561 324.284 1.00 0.00 ? 433  GLY C CA 1 
ATOM 935  C CA . SER C  3  434  ? 197.905 221.394 321.131 1.00 0.00 ? 434  SER C CA 1 
ATOM 936  C CA . PHE C  3  435  ? 201.597 220.594 320.757 1.00 0.00 ? 435  PHE C CA 1 
ATOM 937  C CA . ARG C  3  436  ? 204.170 219.711 318.098 1.00 0.00 ? 436  ARG C CA 1 
ATOM 938  C CA . ARG C  3  437  ? 206.561 216.896 318.974 1.00 0.00 ? 437  ARG C CA 1 
ATOM 939  C CA . GLN C  3  438  ? 208.907 215.802 316.216 1.00 0.00 ? 438  GLN C CA 1 
ATOM 940  C CA . ARG C  3  439  ? 210.583 212.378 316.228 1.00 0.00 ? 439  ARG C CA 1 
ATOM 941  C CA . LYS C  3  440  ? 213.111 210.926 313.775 1.00 0.00 ? 440  LYS C CA 1 
ATOM 942  C CA . GLY C  3  441  ? 211.660 210.788 310.291 1.00 0.00 ? 441  GLY C CA 1 
ATOM 943  C CA . TYR C  3  442  ? 208.206 211.907 311.447 1.00 0.00 ? 442  TYR C CA 1 
ATOM 944  C CA . GLU C  3  443  ? 206.670 215.002 313.028 1.00 0.00 ? 443  GLU C CA 1 
ATOM 945  C CA . GLU C  3  444  ? 203.792 214.142 315.343 1.00 0.00 ? 444  GLU C CA 1 
ATOM 946  C CA . VAL C  3  445  ? 201.123 216.679 316.244 1.00 0.00 ? 445  VAL C CA 1 
ATOM 947  C CA . HIS C  3  446  ? 198.680 216.330 319.135 1.00 0.00 ? 446  HIS C CA 1 
ATOM 948  C CA . VAL C  3  447  ? 195.470 218.197 319.868 1.00 0.00 ? 447  VAL C CA 1 
ATOM 949  C CA . PRO C  3  448  ? 193.123 217.421 322.793 1.00 0.00 ? 448  PRO C CA 1 
ATOM 950  C CA . ALA C  3  449  ? 189.332 217.106 322.780 1.00 0.00 ? 449  ALA C CA 1 
ATOM 951  C CA . LEU C  3  450  ? 187.137 220.198 322.502 1.00 0.00 ? 450  LEU C CA 1 
ATOM 952  C CA . LYS C  3  451  ? 185.107 221.664 325.381 1.00 0.00 ? 451  LYS C CA 1 
ATOM 953  C CA . PRO C  3  452  ? 181.299 221.732 324.754 1.00 0.00 ? 452  PRO C CA 1 
ATOM 954  C CA . LYS C  3  453  ? 179.677 225.200 324.945 1.00 0.00 ? 453  LYS C CA 1 
ATOM 955  C CA . PRO C  3  454  ? 177.822 225.543 328.283 1.00 0.00 ? 454  PRO C CA 1 
ATOM 956  C CA . PHE C  3  455  ? 174.018 225.403 327.996 1.00 0.00 ? 455  PHE C CA 1 
ATOM 957  C CA . GLY C  3  456  ? 172.594 228.911 327.557 1.00 0.00 ? 456  GLY C CA 1 
ATOM 958  C CA . SER C  3  457  ? 170.181 230.467 330.040 1.00 0.00 ? 457  SER C CA 1 
ATOM 959  C CA . GLU C  3  458  ? 166.917 228.508 329.948 1.00 0.00 ? 458  GLU C CA 1 
ATOM 960  C CA . GLU C  3  459  ? 167.872 226.371 326.915 1.00 0.00 ? 459  GLU C CA 1 
ATOM 961  C CA . GLN C  3  460  ? 166.488 222.829 326.941 1.00 0.00 ? 460  GLN C CA 1 
ATOM 962  C CA . LEU C  3  461  ? 166.342 219.852 324.578 1.00 0.00 ? 461  LEU C CA 1 
ATOM 963  C CA . LEU C  3  462  ? 163.061 219.264 322.774 1.00 0.00 ? 462  LEU C CA 1 
ATOM 964  C CA . PRO C  3  463  ? 161.347 215.909 323.256 1.00 0.00 ? 463  PRO C CA 1 
ATOM 965  C CA . VAL C  3  464  ? 159.404 214.330 320.386 1.00 0.00 ? 464  VAL C CA 1 
ATOM 966  C CA . GLU C  3  465  ? 156.261 215.463 322.204 1.00 0.00 ? 465  GLU C CA 1 
ATOM 967  C CA . LYS C  3  466  ? 156.377 219.261 322.052 1.00 0.00 ? 466  LYS C CA 1 
ATOM 968  C CA . LEU C  3  467  ? 156.876 219.581 318.283 1.00 0.00 ? 467  LEU C CA 1 
ATOM 969  C CA . PRO C  3  468  ? 153.861 219.555 315.889 1.00 0.00 ? 468  PRO C CA 1 
ATOM 970  C CA . LYS C  3  469  ? 151.422 216.624 315.978 1.00 0.00 ? 469  LYS C CA 1 
ATOM 971  C CA . TYR C  3  470  ? 151.841 215.125 312.486 1.00 0.00 ? 470  TYR C CA 1 
ATOM 972  C CA . ALA C  3  471  ? 155.628 215.210 312.166 1.00 0.00 ? 471  ALA C CA 1 
ATOM 973  C CA . GLN C  3  472  ? 156.040 213.245 315.395 1.00 0.00 ? 472  GLN C CA 1 
ATOM 974  C CA . ALA C  3  473  ? 155.120 210.056 313.562 1.00 0.00 ? 473  ALA C CA 1 
ATOM 975  C CA . GLY C  3  474  ? 158.092 208.042 312.336 1.00 0.00 ? 474  GLY C CA 1 
ATOM 976  C CA . PHE C  3  475  ? 160.449 209.330 315.017 1.00 0.00 ? 475  PHE C CA 1 
ATOM 977  C CA . GLU C  3  476  ? 159.842 206.195 317.113 1.00 0.00 ? 476  GLU C CA 1 
ATOM 978  C CA . GLY C  3  477  ? 162.693 204.680 319.125 1.00 0.00 ? 477  GLY C CA 1 
ATOM 979  C CA . PHE C  3  478  ? 163.987 208.192 319.707 1.00 0.00 ? 478  PHE C CA 1 
ATOM 980  C CA . LYS C  3  479  ? 162.866 210.023 322.871 1.00 0.00 ? 479  LYS C CA 1 
ATOM 981  C CA . THR C  3  480  ? 164.801 213.306 322.566 1.00 0.00 ? 480  THR C CA 1 
ATOM 982  C CA . LEU C  3  481  ? 166.115 215.729 319.897 1.00 0.00 ? 481  LEU C CA 1 
ATOM 983  C CA . ASN C  3  482  ? 169.859 216.434 319.536 1.00 0.00 ? 482  ASN C CA 1 
ATOM 984  C CA . ARG C  3  483  ? 171.111 219.812 320.831 1.00 0.00 ? 483  ARG C CA 1 
ATOM 985  C CA . ILE C  3  484  ? 171.555 221.279 317.327 1.00 0.00 ? 484  ILE C CA 1 
ATOM 986  C CA . GLN C  3  485  ? 168.449 219.603 315.915 1.00 0.00 ? 485  GLN C CA 1 
ATOM 987  C CA . SER C  3  486  ? 166.705 221.191 318.887 1.00 0.00 ? 486  SER C CA 1 
ATOM 988  C CA . LYS C  3  487  ? 168.411 224.493 318.097 1.00 0.00 ? 487  LYS C CA 1 
ATOM 989  C CA . LEU C  3  488  ? 167.052 224.904 314.564 1.00 0.00 ? 488  LEU C CA 1 
ATOM 990  C CA . TYR C  3  489  ? 163.791 222.846 314.512 1.00 0.00 ? 489  TYR C CA 1 
ATOM 991  C CA . ARG C  3  490  ? 161.841 226.134 314.728 1.00 0.00 ? 490  ARG C CA 1 
ATOM 992  C CA . ALA C  3  491  ? 163.221 227.591 311.506 1.00 0.00 ? 491  ALA C CA 1 
ATOM 993  C CA . ALA C  3  492  ? 163.004 224.088 310.020 1.00 0.00 ? 492  ALA C CA 1 
ATOM 994  C CA . LEU C  3  493  ? 159.230 223.638 310.335 1.00 0.00 ? 493  LEU C CA 1 
ATOM 995  C CA . GLU C  3  494  ? 158.068 227.281 310.608 1.00 0.00 ? 494  GLU C CA 1 
ATOM 996  C CA . THR C  3  495  ? 159.720 228.950 307.585 1.00 0.00 ? 495  THR C CA 1 
ATOM 997  C CA . ASP C  3  496  ? 160.273 228.515 303.867 1.00 0.00 ? 496  ASP C CA 1 
ATOM 998  C CA . GLU C  3  497  ? 163.445 230.555 304.311 1.00 0.00 ? 497  GLU C CA 1 
ATOM 999  C CA . ASN C  3  498  ? 166.464 228.723 302.905 1.00 0.00 ? 498  ASN C CA 1 
ATOM 1000 C CA . LEU C  3  499  ? 168.795 226.913 305.270 1.00 0.00 ? 499  LEU C CA 1 
ATOM 1001 C CA . LEU C  3  500  ? 172.519 226.465 305.687 1.00 0.00 ? 500  LEU C CA 1 
ATOM 1002 C CA . LEU C  3  501  ? 173.945 224.520 308.604 1.00 0.00 ? 501  LEU C CA 1 
ATOM 1003 C CA . CYS C  3  502  ? 177.614 223.986 309.329 1.00 0.00 ? 502  CYS C CA 1 
ATOM 1004 C CA . ALA C  3  503  ? 178.053 221.368 312.029 1.00 0.00 ? 503  ALA C CA 1 
ATOM 1005 C CA . PRO C  3  504  ? 180.771 218.786 312.716 1.00 0.00 ? 504  PRO C CA 1 
ATOM 1006 C CA . THR C  3  505  ? 180.544 215.159 311.678 1.00 0.00 ? 505  THR C CA 1 
ATOM 1007 C CA . GLY C  3  506  ? 178.486 213.212 314.193 1.00 0.00 ? 506  GLY C CA 1 
ATOM 1008 C CA . ALA C  3  507  ? 176.109 216.064 315.065 1.00 0.00 ? 507  ALA C CA 1 
ATOM 1009 C CA . GLY C  3  508  ? 173.350 214.110 313.267 1.00 0.00 ? 508  GLY C CA 1 
ATOM 1010 C CA . LYS C  3  509  ? 172.589 216.595 310.496 1.00 0.00 ? 509  LYS C CA 1 
ATOM 1011 C CA . THR C  3  510  ? 170.148 214.368 308.550 1.00 0.00 ? 510  THR C CA 1 
ATOM 1012 C CA . ASN C  3  511  ? 167.366 214.601 311.083 1.00 0.00 ? 511  ASN C CA 1 
ATOM 1013 C CA . VAL C  3  512  ? 167.396 218.357 310.642 1.00 0.00 ? 512  VAL C CA 1 
ATOM 1014 C CA . ALA C  3  513  ? 166.836 218.063 306.898 1.00 0.00 ? 513  ALA C CA 1 
ATOM 1015 C CA . LEU C  3  514  ? 164.281 215.317 307.600 1.00 0.00 ? 514  LEU C CA 1 
ATOM 1016 C CA . MET C  3  515  ? 162.193 217.917 309.404 1.00 0.00 ? 515  MET C CA 1 
ATOM 1017 C CA . CYS C  3  516  ? 162.546 220.285 306.455 1.00 0.00 ? 516  CYS C CA 1 
ATOM 1018 C CA . MET C  3  517  ? 160.963 217.438 304.516 1.00 0.00 ? 517  MET C CA 1 
ATOM 1019 C CA . LEU C  3  518  ? 158.255 216.696 307.098 1.00 0.00 ? 518  LEU C CA 1 
ATOM 1020 C CA . ARG C  3  519  ? 157.177 220.299 306.711 1.00 0.00 ? 519  ARG C CA 1 
ATOM 1021 C CA . GLU C  3  520  ? 156.598 219.910 302.985 1.00 0.00 ? 520  GLU C CA 1 
ATOM 1022 C CA . ILE C  3  521  ? 155.052 216.482 303.521 1.00 0.00 ? 521  ILE C CA 1 
ATOM 1023 C CA . GLY C  3  522  ? 152.732 218.358 305.867 1.00 0.00 ? 522  GLY C CA 1 
ATOM 1024 C CA . LYS C  3  523  ? 152.041 221.233 303.471 1.00 0.00 ? 523  LYS C CA 1 
ATOM 1025 C CA . HIS C  3  524  ? 149.847 218.826 301.547 1.00 0.00 ? 524  HIS C CA 1 
ATOM 1026 C CA . ILE C  3  525  ? 147.516 217.000 303.909 1.00 0.00 ? 525  ILE C CA 1 
ATOM 1027 C CA . ASN C  3  526  ? 143.778 216.309 304.097 1.00 0.00 ? 526  ASN C CA 1 
ATOM 1028 C CA . MET C  3  527  ? 141.386 215.410 306.901 1.00 0.00 ? 527  MET C CA 1 
ATOM 1029 C CA . ASP C  3  528  ? 139.991 212.211 305.379 1.00 0.00 ? 528  ASP C CA 1 
ATOM 1030 C CA . GLY C  3  529  ? 143.239 211.269 303.703 1.00 0.00 ? 529  GLY C CA 1 
ATOM 1031 C CA . THR C  3  530  ? 146.794 211.932 304.689 1.00 0.00 ? 530  THR C CA 1 
ATOM 1032 C CA . ILE C  3  531  ? 149.766 213.203 302.692 1.00 0.00 ? 531  ILE C CA 1 
ATOM 1033 C CA . ASN C  3  532  ? 148.121 212.911 299.243 1.00 0.00 ? 532  ASN C CA 1 
ATOM 1034 C CA . VAL C  3  533  ? 151.186 212.393 297.122 1.00 0.00 ? 533  VAL C CA 1 
ATOM 1035 C CA . ASP C  3  534  ? 150.680 213.805 293.649 1.00 0.00 ? 534  ASP C CA 1 
ATOM 1036 C CA . ASP C  3  535  ? 151.132 217.430 294.750 1.00 0.00 ? 535  ASP C CA 1 
ATOM 1037 C CA . PHE C  3  536  ? 154.816 217.302 295.735 1.00 0.00 ? 536  PHE C CA 1 
ATOM 1038 C CA . LYS C  3  537  ? 158.150 215.552 295.179 1.00 0.00 ? 537  LYS C CA 1 
ATOM 1039 C CA . ILE C  3  538  ? 161.380 216.096 297.160 1.00 0.00 ? 538  ILE C CA 1 
ATOM 1040 C CA . ILE C  3  539  ? 164.957 215.732 295.872 1.00 0.00 ? 539  ILE C CA 1 
ATOM 1041 C CA . TYR C  3  540  ? 167.685 214.619 298.251 1.00 0.00 ? 540  TYR C CA 1 
ATOM 1042 C CA . ILE C  3  541  ? 171.192 215.006 296.849 1.00 0.00 ? 541  ILE C CA 1 
ATOM 1043 C CA . ALA C  3  542  ? 173.837 212.983 298.687 1.00 0.00 ? 542  ALA C CA 1 
ATOM 1044 C CA . PRO C  3  543  ? 177.562 212.832 297.758 1.00 0.00 ? 543  PRO C CA 1 
ATOM 1045 C CA . MET C  3  544  ? 178.154 209.051 297.932 1.00 0.00 ? 544  MET C CA 1 
ATOM 1046 C CA . ARG C  3  545  ? 176.478 205.954 296.503 1.00 0.00 ? 545  ARG C CA 1 
ATOM 1047 C CA . SER C  3  546  ? 176.559 203.655 299.568 1.00 0.00 ? 546  SER C CA 1 
ATOM 1048 C CA . LEU C  3  547  ? 175.129 206.560 301.519 1.00 0.00 ? 547  LEU C CA 1 
ATOM 1049 C CA . VAL C  3  548  ? 172.279 206.976 299.006 1.00 0.00 ? 548  VAL C CA 1 
ATOM 1050 C CA . GLN C  3  549  ? 171.483 203.231 299.111 1.00 0.00 ? 549  GLN C CA 1 
ATOM 1051 C CA . GLU C  3  550  ? 171.432 202.932 302.886 1.00 0.00 ? 550  GLU C CA 1 
ATOM 1052 C CA . MET C  3  551  ? 169.545 206.237 303.162 1.00 0.00 ? 551  MET C CA 1 
ATOM 1053 C CA . VAL C  3  552  ? 166.691 205.079 300.927 1.00 0.00 ? 552  VAL C CA 1 
ATOM 1054 C CA . GLY C  3  553  ? 166.808 201.903 302.991 1.00 0.00 ? 553  GLY C CA 1 
ATOM 1055 C CA . SER C  3  554  ? 166.203 203.598 306.347 1.00 0.00 ? 554  SER C CA 1 
ATOM 1056 C CA . PHE C  3  555  ? 164.107 206.531 305.034 1.00 0.00 ? 555  PHE C CA 1 
ATOM 1057 C CA . GLY C  3  556  ? 161.715 203.954 303.616 1.00 0.00 ? 556  GLY C CA 1 
ATOM 1058 C CA . LYS C  3  557  ? 161.255 202.269 306.992 1.00 0.00 ? 557  LYS C CA 1 
ATOM 1059 C CA . ARG C  3  558  ? 160.909 205.558 308.833 1.00 0.00 ? 558  ARG C CA 1 
ATOM 1060 C CA . LEU C  3  559  ? 158.521 207.419 306.556 1.00 0.00 ? 559  LEU C CA 1 
ATOM 1061 C CA . ALA C  3  560  ? 156.500 204.229 305.849 1.00 0.00 ? 560  ALA C CA 1 
ATOM 1062 C CA . THR C  3  561  ? 154.020 205.210 308.591 1.00 0.00 ? 561  THR C CA 1 
ATOM 1063 C CA . TYR C  3  562  ? 152.910 207.877 306.140 1.00 0.00 ? 562  TYR C CA 1 
ATOM 1064 C CA . GLY C  3  563  ? 152.998 205.351 303.315 1.00 0.00 ? 563  GLY C CA 1 
ATOM 1065 C CA . ILE C  3  564  ? 155.096 207.729 301.229 1.00 0.00 ? 564  ILE C CA 1 
ATOM 1066 C CA . THR C  3  565  ? 157.234 206.017 298.620 1.00 0.00 ? 565  THR C CA 1 
ATOM 1067 C CA . VAL C  3  566  ? 160.936 206.964 298.610 1.00 0.00 ? 566  VAL C CA 1 
ATOM 1068 C CA . ALA C  3  567  ? 163.472 205.426 296.243 1.00 0.00 ? 567  ALA C CA 1 
ATOM 1069 C CA . GLU C  3  568  ? 166.994 205.789 294.849 1.00 0.00 ? 568  GLU C CA 1 
ATOM 1070 C CA . LEU C  3  569  ? 167.242 207.191 291.359 1.00 0.00 ? 569  LEU C CA 1 
ATOM 1071 C CA . THR C  3  570  ? 169.401 204.600 289.580 1.00 0.00 ? 570  THR C CA 1 
ATOM 1072 C CA . GLY C  3  571  ? 166.999 204.570 286.698 1.00 0.00 ? 571  GLY C CA 1 
ATOM 1073 C CA . ASP C  3  572  ? 168.077 204.469 283.145 1.00 0.00 ? 572  ASP C CA 1 
ATOM 1074 C CA . HIS C  3  573  ? 166.037 207.338 281.770 1.00 0.00 ? 573  HIS C CA 1 
ATOM 1075 C CA . GLN C  3  574  ? 163.222 205.726 279.773 1.00 0.00 ? 574  GLN C CA 1 
ATOM 1076 C CA . LEU C  3  575  ? 162.348 202.398 281.445 1.00 0.00 ? 575  LEU C CA 1 
ATOM 1077 C CA . CYS C  3  576  ? 162.060 204.007 284.883 1.00 0.00 ? 576  CYS C CA 1 
ATOM 1078 C CA . LYS C  3  577  ? 160.541 207.481 284.593 1.00 0.00 ? 577  LYS C CA 1 
ATOM 1079 C CA . GLU C  3  578  ? 156.946 206.307 284.529 1.00 0.00 ? 578  GLU C CA 1 
ATOM 1080 C CA . GLU C  3  579  ? 158.180 204.170 287.462 1.00 0.00 ? 579  GLU C CA 1 
ATOM 1081 C CA . ILE C  3  580  ? 159.658 207.069 289.460 1.00 0.00 ? 580  ILE C CA 1 
ATOM 1082 C CA . SER C  3  581  ? 156.669 209.133 288.344 1.00 0.00 ? 581  SER C CA 1 
ATOM 1083 C CA . ALA C  3  582  ? 154.895 207.725 291.354 1.00 0.00 ? 582  ALA C CA 1 
ATOM 1084 C CA . THR C  3  583  ? 157.975 208.171 293.550 1.00 0.00 ? 583  THR C CA 1 
ATOM 1085 C CA . GLN C  3  584  ? 158.510 211.049 296.029 1.00 0.00 ? 584  GLN C CA 1 
ATOM 1086 C CA . ILE C  3  585  ? 161.519 212.198 298.002 1.00 0.00 ? 585  ILE C CA 1 
ATOM 1087 C CA . ILE C  3  586  ? 164.020 210.725 295.549 1.00 0.00 ? 586  ILE C CA 1 
ATOM 1088 C CA . VAL C  3  587  ? 167.646 210.350 296.582 1.00 0.00 ? 587  VAL C CA 1 
ATOM 1089 C CA . CYS C  3  588  ? 170.514 210.719 294.120 1.00 0.00 ? 588  CYS C CA 1 
ATOM 1090 C CA . THR C  3  589  ? 174.117 211.726 293.504 1.00 0.00 ? 589  THR C CA 1 
ATOM 1091 C CA . PRO C  3  590  ? 174.545 215.286 292.110 1.00 0.00 ? 590  PRO C CA 1 
ATOM 1092 C CA . GLU C  3  591  ? 175.842 213.858 288.854 1.00 0.00 ? 591  GLU C CA 1 
ATOM 1093 C CA . LYS C  3  592  ? 172.734 211.672 288.298 1.00 0.00 ? 592  LYS C CA 1 
ATOM 1094 C CA . TRP C  3  593  ? 170.590 214.739 288.799 1.00 0.00 ? 593  TRP C CA 1 
ATOM 1095 C CA . ASP C  3  594  ? 172.696 216.678 286.306 1.00 0.00 ? 594  ASP C CA 1 
ATOM 1096 C CA . ILE C  3  595  ? 172.602 214.193 283.402 1.00 0.00 ? 595  ILE C CA 1 
ATOM 1097 C CA . ILE C  3  596  ? 168.962 213.441 284.045 1.00 0.00 ? 596  ILE C CA 1 
ATOM 1098 C CA . THR C  3  597  ? 168.207 217.161 283.945 1.00 0.00 ? 597  THR C CA 1 
ATOM 1099 C CA . ARG C  3  598  ? 170.260 217.620 280.746 1.00 0.00 ? 598  ARG C CA 1 
ATOM 1100 C CA . LYS C  3  599  ? 168.141 214.970 279.060 1.00 0.00 ? 599  LYS C CA 1 
ATOM 1101 C CA . GLY C  3  600  ? 164.946 216.442 280.507 1.00 0.00 ? 600  GLY C CA 1 
ATOM 1102 C CA . GLY C  3  601  ? 163.832 213.544 282.703 1.00 0.00 ? 601  GLY C CA 1 
ATOM 1103 C CA . GLU C  3  602  ? 163.590 216.260 285.335 1.00 0.00 ? 602  GLU C CA 1 
ATOM 1104 C CA . ARG C  3  603  ? 161.424 218.654 283.324 1.00 0.00 ? 603  ARG C CA 1 
ATOM 1105 C CA . THR C  3  604  ? 158.436 216.345 283.737 1.00 0.00 ? 604  THR C CA 1 
ATOM 1106 C CA . TYR C  3  605  ? 159.150 216.283 287.528 1.00 0.00 ? 605  TYR C CA 1 
ATOM 1107 C CA . THR C  3  606  ? 159.821 219.988 288.159 1.00 0.00 ? 606  THR C CA 1 
ATOM 1108 C CA . GLN C  3  607  ? 157.271 222.570 289.324 1.00 0.00 ? 607  GLN C CA 1 
ATOM 1109 C CA . LEU C  3  608  ? 156.145 219.673 291.499 1.00 0.00 ? 608  LEU C CA 1 
ATOM 1110 C CA . VAL C  3  609  ? 159.408 220.200 293.405 1.00 0.00 ? 609  VAL C CA 1 
ATOM 1111 C CA . ARG C  3  610  ? 159.180 222.506 296.433 1.00 0.00 ? 610  ARG C CA 1 
ATOM 1112 C CA . LEU C  3  611  ? 162.312 221.173 298.165 1.00 0.00 ? 611  LEU C CA 1 
ATOM 1113 C CA . ILE C  3  612  ? 165.882 220.095 297.344 1.00 0.00 ? 612  ILE C CA 1 
ATOM 1114 C CA . ILE C  3  613  ? 168.379 218.893 299.970 1.00 0.00 ? 613  ILE C CA 1 
ATOM 1115 C CA . LEU C  3  614  ? 172.087 219.369 299.375 1.00 0.00 ? 614  LEU C CA 1 
ATOM 1116 C CA . ASP C  3  615  ? 173.736 216.956 301.786 1.00 0.00 ? 615  ASP C CA 1 
ATOM 1117 C CA . GLU C  3  616  ? 177.483 217.272 302.409 1.00 0.00 ? 616  GLU C CA 1 
ATOM 1118 C CA . ILE C  3  617  ? 177.495 220.433 300.280 1.00 0.00 ? 617  ILE C CA 1 
ATOM 1119 C CA . HIS C  3  618  ? 181.190 220.931 301.132 1.00 0.00 ? 618  HIS C CA 1 
ATOM 1120 C CA . LEU C  3  619  ? 181.677 218.701 298.077 1.00 0.00 ? 619  LEU C CA 1 
ATOM 1121 C CA . LEU C  3  620  ? 181.785 222.120 296.415 1.00 0.00 ? 620  LEU C CA 1 
ATOM 1122 C CA . HIS C  3  621  ? 185.534 221.937 297.137 1.00 0.00 ? 621  HIS C CA 1 
ATOM 1123 C CA . ASP C  3  622  ? 185.984 218.606 295.303 1.00 0.00 ? 622  ASP C CA 1 
ATOM 1124 C CA . ASP C  3  623  ? 186.709 218.178 291.573 1.00 0.00 ? 623  ASP C CA 1 
ATOM 1125 C CA . ARG C  3  624  ? 183.105 217.027 291.542 1.00 0.00 ? 624  ARG C CA 1 
ATOM 1126 C CA . GLY C  3  625  ? 182.294 220.497 292.824 1.00 0.00 ? 625  GLY C CA 1 
ATOM 1127 C CA . PRO C  3  626  ? 181.240 222.058 289.474 1.00 0.00 ? 626  PRO C CA 1 
ATOM 1128 C CA . VAL C  3  627  ? 178.311 219.616 289.270 1.00 0.00 ? 627  VAL C CA 1 
ATOM 1129 C CA . LEU C  3  628  ? 176.728 220.779 292.537 1.00 0.00 ? 628  LEU C CA 1 
ATOM 1130 C CA . GLU C  3  629  ? 177.487 224.252 291.292 1.00 0.00 ? 629  GLU C CA 1 
ATOM 1131 C CA . ALA C  3  630  ? 175.692 223.478 288.039 1.00 0.00 ? 630  ALA C CA 1 
ATOM 1132 C CA . LEU C  3  631  ? 172.659 222.006 289.827 1.00 0.00 ? 631  LEU C CA 1 
ATOM 1133 C CA . VAL C  3  632  ? 172.068 224.815 292.273 1.00 0.00 ? 632  VAL C CA 1 
ATOM 1134 C CA . ALA C  3  633  ? 172.840 227.543 289.729 1.00 0.00 ? 633  ALA C CA 1 
ATOM 1135 C CA . ARG C  3  634  ? 170.261 226.071 287.367 1.00 0.00 ? 634  ARG C CA 1 
ATOM 1136 C CA . ALA C  3  635  ? 167.705 225.773 290.171 1.00 0.00 ? 635  ALA C CA 1 
ATOM 1137 C CA . ILE C  3  636  ? 168.146 229.401 291.217 1.00 0.00 ? 636  ILE C CA 1 
ATOM 1138 C CA . ARG C  3  637  ? 168.379 230.898 287.715 1.00 0.00 ? 637  ARG C CA 1 
ATOM 1139 C CA . ASN C  3  638  ? 165.205 228.922 286.908 1.00 0.00 ? 638  ASN C CA 1 
ATOM 1140 C CA . ILE C  3  639  ? 163.236 230.122 289.931 1.00 0.00 ? 639  ILE C CA 1 
ATOM 1141 C CA . GLU C  3  640  ? 163.844 233.708 288.814 1.00 0.00 ? 640  GLU C CA 1 
ATOM 1142 C CA . MET C  3  641  ? 162.016 232.955 285.541 1.00 0.00 ? 641  MET C CA 1 
ATOM 1143 C CA . THR C  3  642  ? 159.142 230.880 286.922 1.00 0.00 ? 642  THR C CA 1 
ATOM 1144 C CA . GLN C  3  643  ? 158.590 233.046 290.025 1.00 0.00 ? 643  GLN C CA 1 
ATOM 1145 C CA . GLU C  3  644  ? 157.645 229.786 291.762 1.00 0.00 ? 644  GLU C CA 1 
ATOM 1146 C CA . ASP C  3  645  ? 160.077 229.192 294.616 1.00 0.00 ? 645  ASP C CA 1 
ATOM 1147 C CA . VAL C  3  646  ? 161.721 226.180 296.248 1.00 0.00 ? 646  VAL C CA 1 
ATOM 1148 C CA . ARG C  3  647  ? 163.253 225.541 299.648 1.00 0.00 ? 647  ARG C CA 1 
ATOM 1149 C CA . LEU C  3  648  ? 166.941 224.713 299.581 1.00 0.00 ? 648  LEU C CA 1 
ATOM 1150 C CA . ILE C  3  649  ? 168.518 222.982 302.581 1.00 0.00 ? 649  ILE C CA 1 
ATOM 1151 C CA . GLY C  3  650  ? 172.325 222.837 302.708 1.00 0.00 ? 650  GLY C CA 1 
ATOM 1152 C CA . LEU C  3  651  ? 174.289 220.536 304.995 1.00 0.00 ? 651  LEU C CA 1 
ATOM 1153 C CA . SER C  3  652  ? 178.033 220.967 305.412 1.00 0.00 ? 652  SER C CA 1 
ATOM 1154 C CA . ALA C  3  653  ? 180.997 219.956 307.526 1.00 0.00 ? 653  ALA C CA 1 
ATOM 1155 C CA . THR C  3  654  ? 182.285 222.781 309.674 1.00 0.00 ? 654  THR C CA 1 
ATOM 1156 C CA . LEU C  3  655  ? 184.439 224.976 307.471 1.00 0.00 ? 655  LEU C CA 1 
ATOM 1157 C CA . PRO C  3  656  ? 184.955 228.682 306.785 1.00 0.00 ? 656  PRO C CA 1 
ATOM 1158 C CA . ASN C  3  657  ? 183.481 230.272 303.650 1.00 0.00 ? 657  ASN C CA 1 
ATOM 1159 C CA . TYR C  3  658  ? 180.092 229.490 305.175 1.00 0.00 ? 658  TYR C CA 1 
ATOM 1160 C CA . GLU C  3  659  ? 178.670 232.921 304.302 1.00 0.00 ? 659  GLU C CA 1 
ATOM 1161 C CA . ASP C  3  660  ? 179.771 232.452 300.696 1.00 0.00 ? 660  ASP C CA 1 
ATOM 1162 C CA . VAL C  3  661  ? 177.899 229.174 300.409 1.00 0.00 ? 661  VAL C CA 1 
ATOM 1163 C CA . ALA C  3  662  ? 175.043 231.055 302.063 1.00 0.00 ? 662  ALA C CA 1 
ATOM 1164 C CA . THR C  3  663  ? 175.104 233.705 299.311 1.00 0.00 ? 663  THR C CA 1 
ATOM 1165 C CA . PHE C  3  664  ? 175.199 230.901 296.775 1.00 0.00 ? 664  PHE C CA 1 
ATOM 1166 C CA . LEU C  3  665  ? 172.124 229.124 298.170 1.00 0.00 ? 665  LEU C CA 1 
ATOM 1167 C CA . ARG C  3  666  ? 170.323 232.464 298.507 1.00 0.00 ? 666  ARG C CA 1 
ATOM 1168 C CA . VAL C  3  667  ? 170.088 231.860 302.258 1.00 0.00 ? 667  VAL C CA 1 
ATOM 1169 C CA . ASP C  3  668  ? 169.208 235.027 304.158 1.00 0.00 ? 668  ASP C CA 1 
ATOM 1170 C CA . PRO C  3  669  ? 172.113 235.273 306.625 1.00 0.00 ? 669  PRO C CA 1 
ATOM 1171 C CA . ALA C  3  670  ? 169.798 236.927 309.141 1.00 0.00 ? 670  ALA C CA 1 
ATOM 1172 C CA . LYS C  3  671  ? 167.172 234.229 309.731 1.00 0.00 ? 671  LYS C CA 1 
ATOM 1173 C CA . GLY C  3  672  ? 168.536 231.472 307.497 1.00 0.00 ? 672  GLY C CA 1 
ATOM 1174 C CA . LEU C  3  673  ? 172.174 230.956 308.464 1.00 0.00 ? 673  LEU C CA 1 
ATOM 1175 C CA . PHE C  3  674  ? 173.348 228.388 311.021 1.00 0.00 ? 674  PHE C CA 1 
ATOM 1176 C CA . TYR C  3  675  ? 176.923 227.851 312.235 1.00 0.00 ? 675  TYR C CA 1 
ATOM 1177 C CA . PHE C  3  676  ? 178.360 225.468 314.829 1.00 0.00 ? 676  PHE C CA 1 
ATOM 1178 C CA . ASP C  3  677  ? 182.064 224.859 315.501 1.00 0.00 ? 677  ASP C CA 1 
ATOM 1179 C CA . ASN C  3  678  ? 183.969 221.646 316.224 1.00 0.00 ? 678  ASN C CA 1 
ATOM 1180 C CA . SER C  3  679  ? 182.968 221.650 319.917 1.00 0.00 ? 679  SER C CA 1 
ATOM 1181 C CA . PHE C  3  680  ? 179.521 220.272 319.007 1.00 0.00 ? 680  PHE C CA 1 
ATOM 1182 C CA . ARG C  3  681  ? 180.751 216.839 317.943 1.00 0.00 ? 681  ARG C CA 1 
ATOM 1183 C CA . PRO C  3  682  ? 178.711 214.502 320.192 1.00 0.00 ? 682  PRO C CA 1 
ATOM 1184 C CA . VAL C  3  683  ? 181.779 212.431 321.029 1.00 0.00 ? 683  VAL C CA 1 
ATOM 1185 C CA . PRO C  3  684  ? 184.719 214.822 321.660 1.00 0.00 ? 684  PRO C CA 1 
ATOM 1186 C CA . LEU C  3  685  ? 187.696 214.155 319.381 1.00 0.00 ? 685  LEU C CA 1 
ATOM 1187 C CA . GLU C  3  686  ? 191.360 213.997 320.380 1.00 0.00 ? 686  GLU C CA 1 
ATOM 1188 C CA . GLN C  3  687  ? 193.312 214.419 317.160 1.00 0.00 ? 687  GLN C CA 1 
ATOM 1189 C CA . THR C  3  688  ? 196.667 212.757 316.437 1.00 0.00 ? 688  THR C CA 1 
ATOM 1190 C CA . TYR C  3  689  ? 198.483 213.524 313.179 1.00 0.00 ? 689  TYR C CA 1 
ATOM 1191 C CA . VAL C  3  690  ? 201.771 211.904 312.256 1.00 0.00 ? 690  VAL C CA 1 
ATOM 1192 C CA . GLY C  3  691  ? 203.443 213.291 309.141 1.00 0.00 ? 691  GLY C CA 1 
ATOM 1193 C CA . ILE C  3  692  ? 206.455 211.376 307.837 1.00 0.00 ? 692  ILE C CA 1 
ATOM 1194 C CA . THR C  3  693  ? 209.610 213.219 306.714 1.00 0.00 ? 693  THR C CA 1 
ATOM 1195 C CA . GLU C  3  694  ? 211.217 210.269 304.936 1.00 0.00 ? 694  GLU C CA 1 
ATOM 1196 C CA . LYS C  3  695  ? 211.840 210.915 301.234 1.00 0.00 ? 695  LYS C CA 1 
ATOM 1197 C CA . LYS C  3  696  ? 212.724 207.302 300.354 1.00 0.00 ? 696  LYS C CA 1 
ATOM 1198 C CA . ALA C  3  697  ? 209.514 205.277 300.102 1.00 0.00 ? 697  ALA C CA 1 
ATOM 1199 C CA . ILE C  3  698  ? 211.329 202.008 300.802 1.00 0.00 ? 698  ILE C CA 1 
ATOM 1200 C CA . LYS C  3  699  ? 212.167 203.051 304.394 1.00 0.00 ? 699  LYS C CA 1 
ATOM 1201 C CA . ARG C  3  700  ? 208.773 204.753 304.757 1.00 0.00 ? 700  ARG C CA 1 
ATOM 1202 C CA . PHE C  3  701  ? 206.911 201.483 304.158 1.00 0.00 ? 701  PHE C CA 1 
ATOM 1203 C CA . GLN C  3  702  ? 208.679 200.269 307.275 1.00 0.00 ? 702  GLN C CA 1 
ATOM 1204 C CA . ILE C  3  703  ? 208.308 203.405 309.426 1.00 0.00 ? 703  ILE C CA 1 
ATOM 1205 C CA . MET C  3  704  ? 204.531 203.560 308.904 1.00 0.00 ? 704  MET C CA 1 
ATOM 1206 C CA . ASN C  3  705  ? 204.199 199.862 309.729 1.00 0.00 ? 705  ASN C CA 1 
ATOM 1207 C CA . GLU C  3  706  ? 205.983 200.479 313.021 1.00 0.00 ? 706  GLU C CA 1 
ATOM 1208 C CA . ILE C  3  707  ? 203.915 203.577 313.859 1.00 0.00 ? 707  ILE C CA 1 
ATOM 1209 C CA . VAL C  3  708  ? 200.867 201.419 313.261 1.00 0.00 ? 708  VAL C CA 1 
ATOM 1210 C CA . TYR C  3  709  ? 202.216 198.776 315.642 1.00 0.00 ? 709  TYR C CA 1 
ATOM 1211 C CA . GLU C  3  710  ? 203.048 201.176 318.480 1.00 0.00 ? 710  GLU C CA 1 
ATOM 1212 C CA . LYS C  3  711  ? 199.769 203.058 318.105 1.00 0.00 ? 711  LYS C CA 1 
ATOM 1213 C CA . ILE C  3  712  ? 197.823 199.794 318.094 1.00 0.00 ? 712  ILE C CA 1 
ATOM 1214 C CA . MET C  3  713  ? 199.651 198.363 321.103 1.00 0.00 ? 713  MET C CA 1 
ATOM 1215 C CA . GLU C  3  714  ? 198.802 201.601 322.907 1.00 0.00 ? 714  GLU C CA 1 
ATOM 1216 C CA . HIS C  3  715  ? 195.134 200.622 322.611 1.00 0.00 ? 715  HIS C CA 1 
ATOM 1217 C CA . ALA C  3  716  ? 195.772 196.861 323.010 1.00 0.00 ? 716  ALA C CA 1 
ATOM 1218 C CA . GLY C  3  717  ? 194.138 197.065 326.446 1.00 0.00 ? 717  GLY C CA 1 
ATOM 1219 C CA . LYS C  3  718  ? 190.421 197.645 326.794 1.00 0.00 ? 718  LYS C CA 1 
ATOM 1220 C CA . ASN C  3  719  ? 189.585 199.769 323.761 1.00 0.00 ? 719  ASN C CA 1 
ATOM 1221 C CA . GLN C  3  720  ? 188.763 199.415 320.050 1.00 0.00 ? 720  GLN C CA 1 
ATOM 1222 C CA . VAL C  3  721  ? 190.828 200.219 316.947 1.00 0.00 ? 721  VAL C CA 1 
ATOM 1223 C CA . LEU C  3  722  ? 189.782 200.575 313.312 1.00 0.00 ? 722  LEU C CA 1 
ATOM 1224 C CA . VAL C  3  723  ? 192.175 200.811 310.363 1.00 0.00 ? 723  VAL C CA 1 
ATOM 1225 C CA . PHE C  3  724  ? 191.193 202.353 307.032 1.00 0.00 ? 724  PHE C CA 1 
ATOM 1226 C CA . VAL C  3  725  ? 193.558 201.204 304.277 1.00 0.00 ? 725  VAL C CA 1 
ATOM 1227 C CA . HIS C  3  726  ? 192.842 202.443 300.771 1.00 0.00 ? 726  HIS C CA 1 
ATOM 1228 C CA . SER C  3  727  ? 193.694 199.088 299.142 1.00 0.00 ? 727  SER C CA 1 
ATOM 1229 C CA . ARG C  3  728  ? 191.278 196.208 298.456 1.00 0.00 ? 728  ARG C CA 1 
ATOM 1230 C CA . LYS C  3  729  ? 193.697 193.371 299.281 1.00 0.00 ? 729  LYS C CA 1 
ATOM 1231 C CA . GLU C  3  730  ? 195.692 195.231 301.901 1.00 0.00 ? 730  GLU C CA 1 
ATOM 1232 C CA . THR C  3  731  ? 192.715 195.089 304.226 1.00 0.00 ? 731  THR C CA 1 
ATOM 1233 C CA . GLY C  3  732  ? 194.068 191.614 304.983 1.00 0.00 ? 732  GLY C CA 1 
ATOM 1234 C CA . LYS C  3  733  ? 197.717 192.400 304.228 1.00 0.00 ? 733  LYS C CA 1 
ATOM 1235 C CA . THR C  3  734  ? 197.686 194.934 307.068 1.00 0.00 ? 734  THR C CA 1 
ATOM 1236 C CA . ALA C  3  735  ? 196.176 192.261 309.273 1.00 0.00 ? 735  ALA C CA 1 
ATOM 1237 C CA . ARG C  3  736  ? 198.462 189.185 309.579 1.00 0.00 ? 736  ARG C CA 1 
ATOM 1238 C CA . ALA C  3  737  ? 201.270 191.727 309.799 1.00 0.00 ? 737  ALA C CA 1 
ATOM 1239 C CA . ILE C  3  738  ? 199.936 192.740 313.192 1.00 0.00 ? 738  ILE C CA 1 
ATOM 1240 C CA . ARG C  3  739  ? 199.377 189.045 313.889 1.00 0.00 ? 739  ARG C CA 1 
ATOM 1241 C CA . ASP C  3  740  ? 202.831 187.809 312.837 1.00 0.00 ? 740  ASP C CA 1 
ATOM 1242 C CA . MET C  3  741  ? 204.297 190.742 314.775 1.00 0.00 ? 741  MET C CA 1 
ATOM 1243 C CA . CYS C  3  742  ? 202.424 189.745 317.943 1.00 0.00 ? 742  CYS C CA 1 
ATOM 1244 C CA . LEU C  3  743  ? 203.768 186.228 317.412 1.00 0.00 ? 743  LEU C CA 1 
ATOM 1245 C CA . GLU C  3  744  ? 207.255 187.648 316.851 1.00 0.00 ? 744  GLU C CA 1 
ATOM 1246 C CA . LYS C  3  745  ? 206.678 189.480 320.139 1.00 0.00 ? 745  LYS C CA 1 
ATOM 1247 C CA . ASP C  3  746  ? 207.005 186.175 322.051 1.00 0.00 ? 746  ASP C CA 1 
ATOM 1248 C CA . THR C  3  747  ? 203.231 186.055 322.598 1.00 0.00 ? 747  THR C CA 1 
ATOM 1249 C CA . LEU C  3  748  ? 203.181 189.656 323.819 1.00 0.00 ? 748  LEU C CA 1 
ATOM 1250 C CA . GLY C  3  749  ? 200.246 191.845 322.881 1.00 0.00 ? 749  GLY C CA 1 
ATOM 1251 C CA . LEU C  3  750  ? 198.150 188.693 322.956 1.00 0.00 ? 750  LEU C CA 1 
ATOM 1252 C CA . PHE C  3  751  ? 195.498 187.933 325.545 1.00 0.00 ? 751  PHE C CA 1 
ATOM 1253 C CA . LEU C  3  752  ? 193.192 190.659 324.211 1.00 0.00 ? 752  LEU C CA 1 
ATOM 1254 C CA . ARG C  3  753  ? 190.702 189.513 326.862 1.00 0.00 ? 753  ARG C CA 1 
ATOM 1255 C CA . GLU C  3  754  ? 190.274 189.675 330.664 1.00 0.00 ? 754  GLU C CA 1 
ATOM 1256 C CA . GLY C  3  755  ? 191.506 186.105 331.074 1.00 0.00 ? 755  GLY C CA 1 
ATOM 1257 C CA . SER C  3  756  ? 191.676 182.822 329.183 1.00 0.00 ? 756  SER C CA 1 
ATOM 1258 C CA . ALA C  3  757  ? 187.934 182.084 328.884 1.00 0.00 ? 757  ALA C CA 1 
ATOM 1259 C CA . SER C  3  758  ? 186.872 185.656 329.729 1.00 0.00 ? 758  SER C CA 1 
ATOM 1260 C CA . THR C  3  759  ? 185.556 188.242 327.244 1.00 0.00 ? 759  THR C CA 1 
ATOM 1261 C CA . GLU C  3  760  ? 184.208 185.461 325.020 1.00 0.00 ? 760  GLU C CA 1 
ATOM 1262 C CA . VAL C  3  761  ? 187.145 183.939 323.154 1.00 0.00 ? 761  VAL C CA 1 
ATOM 1263 C CA . LEU C  3  762  ? 184.709 181.129 322.372 1.00 0.00 ? 762  LEU C CA 1 
ATOM 1264 C CA . ARG C  3  763  ? 182.823 183.816 320.461 1.00 0.00 ? 763  ARG C CA 1 
ATOM 1265 C CA . THR C  3  764  ? 185.824 184.314 318.204 1.00 0.00 ? 764  THR C CA 1 
ATOM 1266 C CA . GLU C  3  765  ? 186.661 180.597 318.090 1.00 0.00 ? 765  GLU C CA 1 
ATOM 1267 C CA . ALA C  3  766  ? 183.172 179.155 317.514 1.00 0.00 ? 766  ALA C CA 1 
ATOM 1268 C CA . GLU C  3  767  ? 182.744 181.460 314.558 1.00 0.00 ? 767  GLU C CA 1 
ATOM 1269 C CA . GLN C  3  768  ? 185.266 179.580 312.505 1.00 0.00 ? 768  GLN C CA 1 
ATOM 1270 C CA . CYS C  3  769  ? 184.135 178.625 309.020 1.00 0.00 ? 769  CYS C CA 1 
ATOM 1271 C CA . LYS C  3  770  ? 183.511 181.725 306.879 1.00 0.00 ? 770  LYS C CA 1 
ATOM 1272 C CA . ASN C  3  771  ? 183.852 182.793 303.229 1.00 0.00 ? 771  ASN C CA 1 
ATOM 1273 C CA . LEU C  3  772  ? 186.825 185.154 303.629 1.00 0.00 ? 772  LEU C CA 1 
ATOM 1274 C CA . GLU C  3  773  ? 190.380 184.742 304.914 1.00 0.00 ? 773  GLU C CA 1 
ATOM 1275 C CA . LEU C  3  774  ? 188.844 185.380 308.352 1.00 0.00 ? 774  LEU C CA 1 
ATOM 1276 C CA . LYS C  3  775  ? 189.387 181.723 309.290 1.00 0.00 ? 775  LYS C CA 1 
ATOM 1277 C CA . ASP C  3  776  ? 193.032 182.632 309.920 1.00 0.00 ? 776  ASP C CA 1 
ATOM 1278 C CA . LEU C  3  777  ? 192.461 185.924 311.771 1.00 0.00 ? 777  LEU C CA 1 
ATOM 1279 C CA . LEU C  3  778  ? 189.297 185.086 313.734 1.00 0.00 ? 778  LEU C CA 1 
ATOM 1280 C CA . PRO C  3  779  ? 190.880 182.606 316.194 1.00 0.00 ? 779  PRO C CA 1 
ATOM 1281 C CA . TYR C  3  780  ? 193.005 185.568 317.305 1.00 0.00 ? 780  TYR C CA 1 
ATOM 1282 C CA . GLY C  3  781  ? 191.801 189.015 318.368 1.00 0.00 ? 781  GLY C CA 1 
ATOM 1283 C CA . PHE C  3  782  ? 191.239 190.643 314.959 1.00 0.00 ? 782  PHE C CA 1 
ATOM 1284 C CA . ALA C  3  783  ? 189.496 190.446 311.566 1.00 0.00 ? 783  ALA C CA 1 
ATOM 1285 C CA . ILE C  3  784  ? 188.946 192.329 308.275 1.00 0.00 ? 784  ILE C CA 1 
ATOM 1286 C CA . HIS C  3  785  ? 186.023 193.970 306.441 1.00 0.00 ? 785  HIS C CA 1 
ATOM 1287 C CA . HIS C  3  786  ? 185.338 195.080 302.848 1.00 0.00 ? 786  HIS C CA 1 
ATOM 1288 C CA . ALA C  3  787  ? 182.905 194.661 299.955 1.00 0.00 ? 787  ALA C CA 1 
ATOM 1289 C CA . GLY C  3  788  ? 185.079 192.282 297.975 1.00 0.00 ? 788  GLY C CA 1 
ATOM 1290 C CA . MET C  3  789  ? 185.438 188.907 299.680 1.00 0.00 ? 789  MET C CA 1 
ATOM 1291 C CA . THR C  3  790  ? 181.887 188.291 300.968 1.00 0.00 ? 790  THR C CA 1 
ATOM 1292 C CA . ARG C  3  791  ? 178.329 189.604 300.917 1.00 0.00 ? 791  ARG C CA 1 
ATOM 1293 C CA . VAL C  3  792  ? 176.646 188.404 304.112 1.00 0.00 ? 792  VAL C CA 1 
ATOM 1294 C CA . ASP C  3  793  ? 179.770 187.867 306.254 1.00 0.00 ? 793  ASP C CA 1 
ATOM 1295 C CA . ARG C  3  794  ? 180.279 191.649 306.136 1.00 0.00 ? 794  ARG C CA 1 
ATOM 1296 C CA . THR C  3  795  ? 177.019 192.010 308.041 1.00 0.00 ? 795  THR C CA 1 
ATOM 1297 C CA . LEU C  3  796  ? 178.157 189.069 310.188 1.00 0.00 ? 796  LEU C CA 1 
ATOM 1298 C CA . VAL C  3  797  ? 181.391 190.962 310.966 1.00 0.00 ? 797  VAL C CA 1 
ATOM 1299 C CA . GLU C  3  798  ? 179.572 194.243 311.644 1.00 0.00 ? 798  GLU C CA 1 
ATOM 1300 C CA . ASP C  3  799  ? 177.400 192.379 314.146 1.00 0.00 ? 799  ASP C CA 1 
ATOM 1301 C CA . LEU C  3  800  ? 180.630 191.100 315.714 1.00 0.00 ? 800  LEU C CA 1 
ATOM 1302 C CA . PHE C  3  801  ? 182.143 194.574 315.998 1.00 0.00 ? 801  PHE C CA 1 
ATOM 1303 C CA . ALA C  3  802  ? 179.050 196.260 317.445 1.00 0.00 ? 802  ALA C CA 1 
ATOM 1304 C CA . ASP C  3  803  ? 178.906 193.697 320.278 1.00 0.00 ? 803  ASP C CA 1 
ATOM 1305 C CA . LYS C  3  804  ? 182.616 194.282 320.941 1.00 0.00 ? 804  LYS C CA 1 
ATOM 1306 C CA . HIS C  3  805  ? 183.967 190.779 320.315 1.00 0.00 ? 805  HIS C CA 1 
ATOM 1307 C CA . ILE C  3  806  ? 186.660 192.227 318.050 1.00 0.00 ? 806  ILE C CA 1 
ATOM 1308 C CA . GLN C  3  807  ? 188.726 195.195 319.215 1.00 0.00 ? 807  GLN C CA 1 
ATOM 1309 C CA . VAL C  3  808  ? 190.849 195.407 316.053 1.00 0.00 ? 808  VAL C CA 1 
ATOM 1310 C CA . LEU C  3  809  ? 189.256 195.786 312.607 1.00 0.00 ? 809  LEU C CA 1 
ATOM 1311 C CA . VAL C  3  810  ? 191.070 196.845 309.437 1.00 0.00 ? 810  VAL C CA 1 
ATOM 1312 C CA . SER C  3  811  ? 188.878 198.002 306.506 1.00 0.00 ? 811  SER C CA 1 
ATOM 1313 C CA . THR C  3  812  ? 188.112 200.413 303.625 1.00 0.00 ? 812  THR C CA 1 
ATOM 1314 C CA . ALA C  3  813  ? 186.310 203.774 303.223 1.00 0.00 ? 813  ALA C CA 1 
ATOM 1315 C CA . THR C  3  814  ? 183.136 202.037 301.974 1.00 0.00 ? 814  THR C CA 1 
ATOM 1316 C CA . LEU C  3  815  ? 182.686 200.782 305.530 1.00 0.00 ? 815  LEU C CA 1 
ATOM 1317 C CA . ALA C  3  816  ? 182.537 204.354 306.811 1.00 0.00 ? 816  ALA C CA 1 
ATOM 1318 C CA . TRP C  3  817  ? 180.253 205.429 303.975 1.00 0.00 ? 817  TRP C CA 1 
ATOM 1319 C CA . GLY C  3  818  ? 177.999 202.346 304.260 1.00 0.00 ? 818  GLY C CA 1 
ATOM 1320 C CA . VAL C  3  819  ? 176.107 201.023 307.290 1.00 0.00 ? 819  VAL C CA 1 
ATOM 1321 C CA . ASN C  3  820  ? 176.978 203.065 310.393 1.00 0.00 ? 820  ASN C CA 1 
ATOM 1322 C CA . LEU C  3  821  ? 179.139 201.677 313.174 1.00 0.00 ? 821  LEU C CA 1 
ATOM 1323 C CA . PRO C  3  822  ? 181.756 203.692 315.106 1.00 0.00 ? 822  PRO C CA 1 
ATOM 1324 C CA . ALA C  3  823  ? 184.989 202.683 316.856 1.00 0.00 ? 823  ALA C CA 1 
ATOM 1325 C CA . HIS C  3  824  ? 186.602 203.945 320.078 1.00 0.00 ? 824  HIS C CA 1 
ATOM 1326 C CA . THR C  3  825  ? 189.688 204.941 318.124 1.00 0.00 ? 825  THR C CA 1 
ATOM 1327 C CA . VAL C  3  826  ? 190.270 204.889 314.381 1.00 0.00 ? 826  VAL C CA 1 
ATOM 1328 C CA . ILE C  3  827  ? 193.554 205.019 312.482 1.00 0.00 ? 827  ILE C CA 1 
ATOM 1329 C CA . ILE C  3  828  ? 193.903 206.210 308.868 1.00 0.00 ? 828  ILE C CA 1 
ATOM 1330 C CA . LYS C  3  829  ? 196.851 204.576 307.170 1.00 0.00 ? 829  LYS C CA 1 
ATOM 1331 C CA . GLY C  3  830  ? 198.600 206.704 304.564 1.00 0.00 ? 830  GLY C CA 1 
ATOM 1332 C CA . THR C  3  831  ? 195.861 208.988 303.164 1.00 0.00 ? 831  THR C CA 1 
ATOM 1333 C CA . GLN C  3  832  ? 197.058 208.337 299.595 1.00 0.00 ? 832  GLN C CA 1 
ATOM 1334 C CA . VAL C  3  833  ? 194.987 206.466 296.999 1.00 0.00 ? 833  VAL C CA 1 
ATOM 1335 C CA . TYR C  3  834  ? 195.240 205.495 293.325 1.00 0.00 ? 834  TYR C CA 1 
ATOM 1336 C CA . SER C  3  835  ? 193.294 207.654 290.881 1.00 0.00 ? 835  SER C CA 1 
ATOM 1337 C CA . PRO C  3  836  ? 192.781 206.054 287.443 1.00 0.00 ? 836  PRO C CA 1 
ATOM 1338 C CA . GLU C  3  837  ? 191.133 209.302 286.400 1.00 0.00 ? 837  GLU C CA 1 
ATOM 1339 C CA . LYS C  3  838  ? 194.321 211.186 287.274 1.00 0.00 ? 838  LYS C CA 1 
ATOM 1340 C CA . GLY C  3  839  ? 196.530 208.315 286.060 1.00 0.00 ? 839  GLY C CA 1 
ATOM 1341 C CA . ARG C  3  840  ? 198.607 208.450 289.245 1.00 0.00 ? 840  ARG C CA 1 
ATOM 1342 C CA . TRP C  3  841  ? 198.419 208.332 293.043 1.00 0.00 ? 841  TRP C CA 1 
ATOM 1343 C CA . THR C  3  842  ? 196.853 211.218 294.995 1.00 0.00 ? 842  THR C CA 1 
ATOM 1344 C CA . GLU C  3  843  ? 195.867 212.002 298.582 1.00 0.00 ? 843  GLU C CA 1 
ATOM 1345 C CA . LEU C  3  844  ? 192.245 211.038 299.234 1.00 0.00 ? 844  LEU C CA 1 
ATOM 1346 C CA . GLY C  3  845  ? 189.405 213.550 299.120 1.00 0.00 ? 845  GLY C CA 1 
ATOM 1347 C CA . ALA C  3  846  ? 188.098 215.845 301.830 1.00 0.00 ? 846  ALA C CA 1 
ATOM 1348 C CA . LEU C  3  847  ? 184.858 213.947 302.302 1.00 0.00 ? 847  LEU C CA 1 
ATOM 1349 C CA . ASP C  3  848  ? 186.623 210.574 302.542 1.00 0.00 ? 848  ASP C CA 1 
ATOM 1350 C CA . ILE C  3  849  ? 188.668 211.445 305.617 1.00 0.00 ? 849  ILE C CA 1 
ATOM 1351 C CA . LEU C  3  850  ? 185.921 213.626 307.066 1.00 0.00 ? 850  LEU C CA 1 
ATOM 1352 C CA . GLN C  3  851  ? 183.578 210.633 306.839 1.00 0.00 ? 851  GLN C CA 1 
ATOM 1353 C CA . MET C  3  852  ? 185.993 207.967 308.105 1.00 0.00 ? 852  MET C CA 1 
ATOM 1354 C CA . LEU C  3  853  ? 187.423 210.034 310.976 1.00 0.00 ? 853  LEU C CA 1 
ATOM 1355 C CA . GLY C  3  854  ? 183.941 211.216 311.863 1.00 0.00 ? 854  GLY C CA 1 
ATOM 1356 C CA . ARG C  3  855  ? 183.414 207.570 312.703 1.00 0.00 ? 855  ARG C CA 1 
ATOM 1357 C CA . ALA C  3  856  ? 185.750 208.019 315.687 1.00 0.00 ? 856  ALA C CA 1 
ATOM 1358 C CA . GLY C  3  857  ? 184.215 207.211 319.065 1.00 0.00 ? 857  GLY C CA 1 
ATOM 1359 C CA . ARG C  3  858  ? 180.847 205.707 319.946 1.00 0.00 ? 858  ARG C CA 1 
ATOM 1360 C CA . PRO C  3  859  ? 177.777 207.816 320.829 1.00 0.00 ? 859  PRO C CA 1 
ATOM 1361 C CA . GLN C  3  860  ? 176.769 205.297 323.501 1.00 0.00 ? 860  GLN C CA 1 
ATOM 1362 C CA . TYR C  3  861  ? 179.551 203.100 324.869 1.00 0.00 ? 861  TYR C CA 1 
ATOM 1363 C CA . ASP C  3  862  ? 182.203 205.818 324.682 1.00 0.00 ? 862  ASP C CA 1 
ATOM 1364 C CA . THR C  3  863  ? 183.434 208.781 326.743 1.00 0.00 ? 863  THR C CA 1 
ATOM 1365 C CA . LYS C  3  864  ? 185.576 210.561 324.153 1.00 0.00 ? 864  LYS C CA 1 
ATOM 1366 C CA . GLY C  3  865  ? 186.891 209.483 320.746 1.00 0.00 ? 865  GLY C CA 1 
ATOM 1367 C CA . GLU C  3  866  ? 190.410 209.850 319.355 1.00 0.00 ? 866  GLU C CA 1 
ATOM 1368 C CA . GLY C  3  867  ? 191.693 209.502 315.821 1.00 0.00 ? 867  GLY C CA 1 
ATOM 1369 C CA . ILE C  3  868  ? 195.086 209.076 314.199 1.00 0.00 ? 868  ILE C CA 1 
ATOM 1370 C CA . LEU C  3  869  ? 195.950 210.239 310.715 1.00 0.00 ? 869  LEU C CA 1 
ATOM 1371 C CA . ILE C  3  870  ? 199.237 208.860 309.441 1.00 0.00 ? 870  ILE C CA 1 
ATOM 1372 C CA . THR C  3  871  ? 200.263 210.913 306.429 1.00 0.00 ? 871  THR C CA 1 
ATOM 1373 C CA . SER C  3  872  ? 203.150 212.482 304.545 1.00 0.00 ? 872  SER C CA 1 
ATOM 1374 C CA . HIS C  3  873  ? 204.601 215.445 306.448 1.00 0.00 ? 873  HIS C CA 1 
ATOM 1375 C CA . GLY C  3  874  ? 204.099 217.729 303.448 1.00 0.00 ? 874  GLY C CA 1 
ATOM 1376 C CA . GLU C  3  875  ? 200.348 217.235 303.563 1.00 0.00 ? 875  GLU C CA 1 
ATOM 1377 C CA . LEU C  3  876  ? 200.349 217.416 307.358 1.00 0.00 ? 876  LEU C CA 1 
ATOM 1378 C CA . GLN C  3  877  ? 199.423 221.092 307.305 1.00 0.00 ? 877  GLN C CA 1 
ATOM 1379 C CA . TYR C  3  878  ? 196.508 220.360 305.012 1.00 0.00 ? 878  TYR C CA 1 
ATOM 1380 C CA . TYR C  3  879  ? 194.782 217.753 307.145 1.00 0.00 ? 879  TYR C CA 1 
ATOM 1381 C CA . LEU C  3  880  ? 194.917 220.206 310.056 1.00 0.00 ? 880  LEU C CA 1 
ATOM 1382 C CA . SER C  3  881  ? 193.138 222.964 308.098 1.00 0.00 ? 881  SER C CA 1 
ATOM 1383 C CA . LEU C  3  882  ? 190.249 220.552 307.632 1.00 0.00 ? 882  LEU C CA 1 
ATOM 1384 C CA . LEU C  3  883  ? 189.496 218.803 310.892 1.00 0.00 ? 883  LEU C CA 1 
ATOM 1385 C CA . ASN C  3  884  ? 189.717 222.198 312.562 1.00 0.00 ? 884  ASN C CA 1 
ATOM 1386 C CA . GLN C  3  885  ? 187.973 224.867 310.585 1.00 0.00 ? 885  GLN C CA 1 
ATOM 1387 C CA . GLN C  3  886  ? 190.712 226.598 308.678 1.00 0.00 ? 886  GLN C CA 1 
ATOM 1388 C CA . LEU C  3  887  ? 189.944 225.531 305.120 1.00 0.00 ? 887  LEU C CA 1 
ATOM 1389 C CA . PRO C  3  888  ? 188.341 227.701 302.433 1.00 0.00 ? 888  PRO C CA 1 
ATOM 1390 C CA . ILE C  3  889  ? 185.686 226.199 300.191 1.00 0.00 ? 889  ILE C CA 1 
ATOM 1391 C CA . GLU C  3  890  ? 186.598 227.211 296.644 1.00 0.00 ? 890  GLU C CA 1 
ATOM 1392 C CA . SER C  3  891  ? 185.105 226.371 293.250 1.00 0.00 ? 891  SER C CA 1 
ATOM 1393 C CA . GLN C  3  892  ? 186.765 224.134 290.677 1.00 0.00 ? 892  GLN C CA 1 
ATOM 1394 C CA . MET C  3  893  ? 184.174 225.478 288.188 1.00 0.00 ? 893  MET C CA 1 
ATOM 1395 C CA . VAL C  3  894  ? 186.710 227.073 285.793 1.00 0.00 ? 894  VAL C CA 1 
ATOM 1396 C CA . SER C  3  895  ? 188.097 223.703 284.720 1.00 0.00 ? 895  SER C CA 1 
ATOM 1397 C CA . LYS C  3  896  ? 184.670 222.524 283.592 1.00 0.00 ? 896  LYS C CA 1 
ATOM 1398 C CA . LEU C  3  897  ? 183.300 225.893 282.371 1.00 0.00 ? 897  LEU C CA 1 
ATOM 1399 C CA . PRO C  3  898  ? 183.219 224.914 278.664 1.00 0.00 ? 898  PRO C CA 1 
ATOM 1400 C CA . ASP C  3  899  ? 181.261 221.722 279.384 1.00 0.00 ? 899  ASP C CA 1 
ATOM 1401 C CA . MET C  3  900  ? 178.868 223.486 281.737 1.00 0.00 ? 900  MET C CA 1 
ATOM 1402 C CA . LEU C  3  901  ? 178.120 226.213 279.186 1.00 0.00 ? 901  LEU C CA 1 
ATOM 1403 C CA . ASN C  3  902  ? 177.337 223.703 276.421 1.00 0.00 ? 902  ASN C CA 1 
ATOM 1404 C CA . ALA C  3  903  ? 174.738 221.797 278.439 1.00 0.00 ? 903  ALA C CA 1 
ATOM 1405 C CA . GLU C  3  904  ? 173.012 225.087 279.276 1.00 0.00 ? 904  GLU C CA 1 
ATOM 1406 C CA . ILE C  3  905  ? 172.829 226.005 275.587 1.00 0.00 ? 905  ILE C CA 1 
ATOM 1407 C CA . VAL C  3  906  ? 171.611 222.468 274.981 1.00 0.00 ? 906  VAL C CA 1 
ATOM 1408 C CA . LEU C  3  907  ? 168.736 223.043 277.395 1.00 0.00 ? 907  LEU C CA 1 
ATOM 1409 C CA . GLY C  3  908  ? 168.057 226.386 275.731 1.00 0.00 ? 908  GLY C CA 1 
ATOM 1410 C CA . ASN C  3  909  ? 168.628 228.247 278.971 1.00 0.00 ? 909  ASN C CA 1 
ATOM 1411 C CA . VAL C  3  910  ? 171.271 230.402 277.312 1.00 0.00 ? 910  VAL C CA 1 
ATOM 1412 C CA . GLN C  3  911  ? 170.703 231.841 273.840 1.00 0.00 ? 911  GLN C CA 1 
ATOM 1413 C CA . ASN C  3  912  ? 173.586 234.299 273.674 1.00 0.00 ? 912  ASN C CA 1 
ATOM 1414 C CA . ALA C  3  913  ? 176.624 235.753 275.437 1.00 0.00 ? 913  ALA C CA 1 
ATOM 1415 C CA . LYS C  3  914  ? 174.462 237.963 277.668 1.00 0.00 ? 914  LYS C CA 1 
ATOM 1416 C CA . ASP C  3  915  ? 172.346 235.110 278.986 1.00 0.00 ? 915  ASP C CA 1 
ATOM 1417 C CA . ALA C  3  916  ? 175.637 233.283 279.527 1.00 0.00 ? 916  ALA C CA 1 
ATOM 1418 C CA . VAL C  3  917  ? 177.078 235.998 281.774 1.00 0.00 ? 917  VAL C CA 1 
ATOM 1419 C CA . ASN C  3  918  ? 173.706 236.135 283.543 1.00 0.00 ? 918  ASN C CA 1 
ATOM 1420 C CA . TRP C  3  919  ? 173.925 232.401 284.160 1.00 0.00 ? 919  TRP C CA 1 
ATOM 1421 C CA . LEU C  3  920  ? 177.509 232.529 285.404 1.00 0.00 ? 920  LEU C CA 1 
ATOM 1422 C CA . GLY C  3  921  ? 176.386 235.294 287.734 1.00 0.00 ? 921  GLY C CA 1 
ATOM 1423 C CA . TYR C  3  922  ? 174.489 232.546 289.576 1.00 0.00 ? 922  TYR C CA 1 
ATOM 1424 C CA . ALA C  3  923  ? 177.593 230.369 290.148 1.00 0.00 ? 923  ALA C CA 1 
ATOM 1425 C CA . TYR C  3  924  ? 179.526 229.776 293.386 1.00 0.00 ? 924  TYR C CA 1 
ATOM 1426 C CA . LEU C  3  925  ? 182.614 230.804 291.399 1.00 0.00 ? 925  LEU C CA 1 
ATOM 1427 C CA . TYR C  3  926  ? 180.941 234.173 290.904 1.00 0.00 ? 926  TYR C CA 1 
ATOM 1428 C CA . ILE C  3  927  ? 180.644 235.045 294.578 1.00 0.00 ? 927  ILE C CA 1 
ATOM 1429 C CA . ARG C  3  928  ? 184.134 233.660 295.167 1.00 0.00 ? 928  ARG C CA 1 
ATOM 1430 C CA . MET C  3  929  ? 185.519 235.775 292.307 1.00 0.00 ? 929  MET C CA 1 
ATOM 1431 C CA . LEU C  3  930  ? 183.712 238.689 293.922 1.00 0.00 ? 930  LEU C CA 1 
ATOM 1432 C CA . ARG C  3  931  ? 184.917 238.259 297.505 1.00 0.00 ? 931  ARG C CA 1 
ATOM 1433 C CA . SER C  3  932  ? 188.420 236.912 296.803 1.00 0.00 ? 932  SER C CA 1 
ATOM 1434 C CA . PRO C  3  933  ? 189.557 238.212 293.373 1.00 0.00 ? 933  PRO C CA 1 
ATOM 1435 C CA . THR C  3  934  ? 193.179 238.006 294.521 1.00 0.00 ? 934  THR C CA 1 
ATOM 1436 C CA . LEU C  3  935  ? 192.936 234.204 294.521 1.00 0.00 ? 935  LEU C CA 1 
ATOM 1437 C CA . TYR C  3  936  ? 190.939 233.797 291.340 1.00 0.00 ? 936  TYR C CA 1 
ATOM 1438 C CA . GLY C  3  937  ? 193.235 235.718 288.993 1.00 0.00 ? 937  GLY C CA 1 
ATOM 1439 C CA . ILE C  3  938  ? 191.877 239.263 289.277 1.00 0.00 ? 938  ILE C CA 1 
ATOM 1440 C CA . SER C  3  939  ? 194.140 242.153 290.254 1.00 0.00 ? 939  SER C CA 1 
ATOM 1441 C CA . HIS C  3  940  ? 192.351 244.678 292.450 1.00 0.00 ? 940  HIS C CA 1 
ATOM 1442 C CA . ASP C  3  941  ? 192.869 247.599 290.037 1.00 0.00 ? 941  ASP C CA 1 
ATOM 1443 C CA . ASP C  3  942  ? 191.062 246.040 287.071 1.00 0.00 ? 942  ASP C CA 1 
ATOM 1444 C CA . LEU C  3  943  ? 188.519 244.853 289.657 1.00 0.00 ? 943  LEU C CA 1 
ATOM 1445 C CA . LYS C  3  944  ? 187.951 248.503 290.542 1.00 0.00 ? 944  LYS C CA 1 
ATOM 1446 C CA . GLY C  3  945  ? 187.808 249.182 286.808 1.00 0.00 ? 945  GLY C CA 1 
ATOM 1447 C CA . ASP C  3  946  ? 184.981 246.664 286.533 1.00 0.00 ? 946  ASP C CA 1 
ATOM 1448 C CA . PRO C  3  947  ? 183.239 246.277 289.935 1.00 0.00 ? 947  PRO C CA 1 
ATOM 1449 C CA . LEU C  3  948  ? 180.426 244.015 288.743 1.00 0.00 ? 948  LEU C CA 1 
ATOM 1450 C CA . LEU C  3  949  ? 182.830 241.682 286.896 1.00 0.00 ? 949  LEU C CA 1 
ATOM 1451 C CA . ASP C  3  950  ? 180.686 242.225 283.772 1.00 0.00 ? 950  ASP C CA 1 
ATOM 1452 C CA . GLN C  3  951  ? 183.788 242.289 281.562 1.00 0.00 ? 951  GLN C CA 1 
ATOM 1453 C CA . ARG C  3  952  ? 185.446 239.330 283.279 1.00 0.00 ? 952  ARG C CA 1 
ATOM 1454 C CA . ARG C  3  953  ? 182.240 237.267 283.063 1.00 0.00 ? 953  ARG C CA 1 
ATOM 1455 C CA . LEU C  3  954  ? 182.103 238.378 279.429 1.00 0.00 ? 954  LEU C CA 1 
ATOM 1456 C CA . ASP C  3  955  ? 185.759 237.367 278.923 1.00 0.00 ? 955  ASP C CA 1 
ATOM 1457 C CA . LEU C  3  956  ? 185.072 234.243 280.916 1.00 0.00 ? 956  LEU C CA 1 
ATOM 1458 C CA . VAL C  3  957  ? 182.579 232.212 278.865 1.00 0.00 ? 957  VAL C CA 1 
ATOM 1459 C CA . HIS C  3  958  ? 183.975 233.790 275.696 1.00 0.00 ? 958  HIS C CA 1 
ATOM 1460 C CA . THR C  3  959  ? 186.789 231.281 275.783 1.00 0.00 ? 959  THR C CA 1 
ATOM 1461 C CA . ALA C  3  960  ? 184.291 228.551 276.566 1.00 0.00 ? 960  ALA C CA 1 
ATOM 1462 C CA . ALA C  3  961  ? 182.266 229.705 273.567 1.00 0.00 ? 961  ALA C CA 1 
ATOM 1463 C CA . LEU C  3  962  ? 185.374 229.534 271.390 1.00 0.00 ? 962  LEU C CA 1 
ATOM 1464 C CA . MET C  3  963  ? 186.292 226.065 272.679 1.00 0.00 ? 963  MET C CA 1 
ATOM 1465 C CA . LEU C  3  964  ? 182.797 224.806 271.961 1.00 0.00 ? 964  LEU C CA 1 
ATOM 1466 C CA . ASP C  3  965  ? 182.875 226.350 268.509 1.00 0.00 ? 965  ASP C CA 1 
ATOM 1467 C CA . LYS C  3  966  ? 186.257 224.871 267.652 1.00 0.00 ? 966  LYS C CA 1 
ATOM 1468 C CA . ASN C  3  967  ? 185.065 221.405 268.605 1.00 0.00 ? 967  ASN C CA 1 
ATOM 1469 C CA . ASN C  3  968  ? 181.729 221.987 266.826 1.00 0.00 ? 968  ASN C CA 1 
ATOM 1470 C CA . LEU C  3  969  ? 179.437 221.725 269.862 1.00 0.00 ? 969  LEU C CA 1 
ATOM 1471 C CA . VAL C  3  970  ? 178.061 225.187 269.081 1.00 0.00 ? 970  VAL C CA 1 
ATOM 1472 C CA . LYS C  3  971  ? 177.904 227.566 266.126 1.00 0.00 ? 971  LYS C CA 1 
ATOM 1473 C CA . TYR C  3  972  ? 178.449 231.029 267.586 1.00 0.00 ? 972  TYR C CA 1 
ATOM 1474 C CA . ASP C  3  973  ? 179.579 234.092 265.654 1.00 0.00 ? 973  ASP C CA 1 
ATOM 1475 C CA . LYS C  3  974  ? 181.313 236.872 267.573 1.00 0.00 ? 974  LYS C CA 1 
ATOM 1476 C CA . LYS C  3  975  ? 179.132 239.534 265.942 1.00 0.00 ? 975  LYS C CA 1 
ATOM 1477 C CA . THR C  3  976  ? 175.686 238.587 267.270 1.00 0.00 ? 976  THR C CA 1 
ATOM 1478 C CA . GLY C  3  977  ? 176.974 236.908 270.409 1.00 0.00 ? 977  GLY C CA 1 
ATOM 1479 C CA . ASN C  3  978  ? 174.348 234.220 269.822 1.00 0.00 ? 978  ASN C CA 1 
ATOM 1480 C CA . PHE C  3  979  ? 174.886 230.474 270.231 1.00 0.00 ? 979  PHE C CA 1 
ATOM 1481 C CA . GLN C  3  980  ? 173.381 227.722 268.109 1.00 0.00 ? 980  GLN C CA 1 
ATOM 1482 C CA . VAL C  3  981  ? 173.290 224.117 269.280 1.00 0.00 ? 981  VAL C CA 1 
ATOM 1483 C CA . THR C  3  982  ? 174.401 221.194 267.124 1.00 0.00 ? 982  THR C CA 1 
ATOM 1484 C CA . GLU C  3  983  ? 173.299 217.573 267.460 1.00 0.00 ? 983  GLU C CA 1 
ATOM 1485 C CA . LEU C  3  984  ? 176.905 216.792 268.403 1.00 0.00 ? 984  LEU C CA 1 
ATOM 1486 C CA . GLY C  3  985  ? 176.518 219.268 271.237 1.00 0.00 ? 985  GLY C CA 1 
ATOM 1487 C CA . ARG C  3  986  ? 173.300 217.691 272.434 1.00 0.00 ? 986  ARG C CA 1 
ATOM 1488 C CA . ILE C  3  987  ? 174.840 214.227 272.339 1.00 0.00 ? 987  ILE C CA 1 
ATOM 1489 C CA . ALA C  3  988  ? 177.773 215.564 274.287 1.00 0.00 ? 988  ALA C CA 1 
ATOM 1490 C CA . SER C  3  989  ? 175.610 217.117 276.990 1.00 0.00 ? 989  SER C CA 1 
ATOM 1491 C CA . HIS C  3  990  ? 173.301 214.111 277.241 1.00 0.00 ? 990  HIS C CA 1 
ATOM 1492 C CA . TYR C  3  991  ? 176.163 211.707 277.831 1.00 0.00 ? 991  TYR C CA 1 
ATOM 1493 C CA . TYR C  3  992  ? 178.286 213.956 280.050 1.00 0.00 ? 992  TYR C CA 1 
ATOM 1494 C CA . ILE C  3  993  ? 181.143 213.427 277.662 1.00 0.00 ? 993  ILE C CA 1 
ATOM 1495 C CA . THR C  3  994  ? 183.760 216.193 277.404 1.00 0.00 ? 994  THR C CA 1 
ATOM 1496 C CA . ASN C  3  995  ? 184.043 218.423 274.362 1.00 0.00 ? 995  ASN C CA 1 
ATOM 1497 C CA . ASP C  3  996  ? 187.508 217.152 273.388 1.00 0.00 ? 996  ASP C CA 1 
ATOM 1498 C CA . THR C  3  997  ? 186.363 213.548 273.272 1.00 0.00 ? 997  THR C CA 1 
ATOM 1499 C CA . VAL C  3  998  ? 183.360 214.474 271.152 1.00 0.00 ? 998  VAL C CA 1 
ATOM 1500 C CA . GLN C  3  999  ? 185.425 216.203 268.473 1.00 0.00 ? 999  GLN C CA 1 
ATOM 1501 C CA . THR C  3  1000 ? 187.805 213.263 268.505 1.00 0.00 ? 1000 THR C CA 1 
ATOM 1502 C CA . TYR C  3  1001 ? 184.726 211.194 267.640 1.00 0.00 ? 1001 TYR C CA 1 
ATOM 1503 C CA . ASN C  3  1002 ? 183.619 213.691 265.005 1.00 0.00 ? 1002 ASN C CA 1 
ATOM 1504 C CA . GLN C  3  1003 ? 186.910 213.469 263.148 1.00 0.00 ? 1003 GLN C CA 1 
ATOM 1505 C CA . LEU C  3  1004 ? 187.578 209.771 263.702 1.00 0.00 ? 1004 LEU C CA 1 
ATOM 1506 C CA . LEU C  3  1005 ? 184.158 208.187 263.001 1.00 0.00 ? 1005 LEU C CA 1 
ATOM 1507 C CA . LYS C  3  1006 ? 183.416 207.157 259.439 1.00 0.00 ? 1006 LYS C CA 1 
ATOM 1508 C CA . PRO C  3  1007 ? 180.655 204.873 257.953 1.00 0.00 ? 1007 PRO C CA 1 
ATOM 1509 C CA . THR C  3  1008 ? 183.112 202.136 257.031 1.00 0.00 ? 1008 THR C CA 1 
ATOM 1510 C CA . LEU C  3  1009 ? 184.619 201.425 260.491 1.00 0.00 ? 1009 LEU C CA 1 
ATOM 1511 C CA . SER C  3  1010 ? 185.189 197.808 261.575 1.00 0.00 ? 1010 SER C CA 1 
ATOM 1512 C CA . GLU C  3  1011 ? 184.869 196.657 265.185 1.00 0.00 ? 1011 GLU C CA 1 
ATOM 1513 C CA . ILE C  3  1012 ? 188.702 196.484 265.127 1.00 0.00 ? 1012 ILE C CA 1 
ATOM 1514 C CA . GLU C  3  1013 ? 188.693 200.223 264.582 1.00 0.00 ? 1013 GLU C CA 1 
ATOM 1515 C CA . LEU C  3  1014 ? 185.616 201.102 266.635 1.00 0.00 ? 1014 LEU C CA 1 
ATOM 1516 C CA . PHE C  3  1015 ? 187.495 199.989 269.757 1.00 0.00 ? 1015 PHE C CA 1 
ATOM 1517 C CA . ARG C  3  1016 ? 190.528 202.185 268.885 1.00 0.00 ? 1016 ARG C CA 1 
ATOM 1518 C CA . VAL C  3  1017 ? 188.307 205.246 268.417 1.00 0.00 ? 1017 VAL C CA 1 
ATOM 1519 C CA . PHE C  3  1018 ? 186.800 204.438 271.806 1.00 0.00 ? 1018 PHE C CA 1 
ATOM 1520 C CA . SER C  3  1019 ? 190.313 204.250 273.254 1.00 0.00 ? 1019 SER C CA 1 
ATOM 1521 C CA . LEU C  3  1020 ? 191.086 207.700 271.922 1.00 0.00 ? 1020 LEU C CA 1 
ATOM 1522 C CA . SER C  3  1021 ? 188.444 209.302 274.155 1.00 0.00 ? 1021 SER C CA 1 
ATOM 1523 C CA . SER C  3  1022 ? 189.843 212.421 275.801 1.00 0.00 ? 1022 SER C CA 1 
ATOM 1524 C CA . GLU C  3  1023 ? 188.336 211.178 279.086 1.00 0.00 ? 1023 GLU C CA 1 
ATOM 1525 C CA . PHE C  3  1024 ? 191.195 208.656 279.280 1.00 0.00 ? 1024 PHE C CA 1 
ATOM 1526 C CA . LYS C  3  1025 ? 193.956 211.194 278.574 1.00 0.00 ? 1025 LYS C CA 1 
ATOM 1527 C CA . ASN C  3  1026 ? 195.984 210.414 281.698 1.00 0.00 ? 1026 ASN C CA 1 
ATOM 1528 C CA . ILE C  3  1027 ? 195.905 206.625 281.501 1.00 0.00 ? 1027 ILE C CA 1 
ATOM 1529 C CA . THR C  3  1028 ? 199.334 205.247 280.783 1.00 0.00 ? 1028 THR C CA 1 
ATOM 1530 C CA . VAL C  3  1029 ? 200.998 201.836 280.596 1.00 0.00 ? 1029 VAL C CA 1 
ATOM 1531 C CA . ARG C  3  1030 ? 203.395 200.852 283.407 1.00 0.00 ? 1030 ARG C CA 1 
ATOM 1532 C CA . GLU C  3  1031 ? 206.467 198.678 282.819 1.00 0.00 ? 1031 GLU C CA 1 
ATOM 1533 C CA . GLU C  3  1032 ? 205.487 196.044 285.395 1.00 0.00 ? 1032 GLU C CA 1 
ATOM 1534 C CA . GLU C  3  1033 ? 202.072 195.455 283.919 1.00 0.00 ? 1033 GLU C CA 1 
ATOM 1535 C CA . LYS C  3  1034 ? 203.266 195.216 280.302 1.00 0.00 ? 1034 LYS C CA 1 
ATOM 1536 C CA . LEU C  3  1035 ? 204.022 191.573 281.099 1.00 0.00 ? 1035 LEU C CA 1 
ATOM 1537 C CA . GLU C  3  1036 ? 200.345 190.765 281.735 1.00 0.00 ? 1036 GLU C CA 1 
ATOM 1538 C CA . LEU C  3  1037 ? 198.911 193.097 279.079 1.00 0.00 ? 1037 LEU C CA 1 
ATOM 1539 C CA . GLN C  3  1038 ? 200.683 191.033 276.420 1.00 0.00 ? 1038 GLN C CA 1 
ATOM 1540 C CA . LYS C  3  1039 ? 199.014 187.818 277.591 1.00 0.00 ? 1039 LYS C CA 1 
ATOM 1541 C CA . LEU C  3  1040 ? 195.671 189.603 277.697 1.00 0.00 ? 1040 LEU C CA 1 
ATOM 1542 C CA . LEU C  3  1041 ? 196.418 190.966 274.261 1.00 0.00 ? 1041 LEU C CA 1 
ATOM 1543 C CA . GLU C  3  1042 ? 196.629 187.517 272.745 1.00 0.00 ? 1042 GLU C CA 1 
ATOM 1544 C CA . ARG C  3  1043 ? 193.508 186.287 274.564 1.00 0.00 ? 1043 ARG C CA 1 
ATOM 1545 C CA . VAL C  3  1044 ? 191.217 188.972 273.096 1.00 0.00 ? 1044 VAL C CA 1 
ATOM 1546 C CA . PRO C  3  1045 ? 188.696 188.300 270.263 1.00 0.00 ? 1045 PRO C CA 1 
ATOM 1547 C CA . ILE C  3  1046 ? 188.911 191.704 268.585 1.00 0.00 ? 1046 ILE C CA 1 
ATOM 1548 C CA . PRO C  3  1047 ? 192.339 192.426 267.099 1.00 0.00 ? 1047 PRO C CA 1 
ATOM 1549 C CA . VAL C  3  1048 ? 194.017 195.414 268.701 1.00 0.00 ? 1048 VAL C CA 1 
ATOM 1550 C CA . LYS C  3  1049 ? 197.070 194.756 266.667 1.00 0.00 ? 1049 LYS C CA 1 
ATOM 1551 C CA . GLU C  3  1050 ? 196.630 198.070 264.849 1.00 0.00 ? 1050 GLU C CA 1 
ATOM 1552 C CA . SER C  3  1051 ? 198.284 199.453 268.000 1.00 0.00 ? 1051 SER C CA 1 
ATOM 1553 C CA . ILE C  3  1052 ? 201.360 198.379 270.029 1.00 0.00 ? 1052 ILE C CA 1 
ATOM 1554 C CA . GLU C  3  1053 ? 201.836 199.087 273.781 1.00 0.00 ? 1053 GLU C CA 1 
ATOM 1555 C CA . GLU C  3  1054 ? 200.762 202.676 274.335 1.00 0.00 ? 1054 GLU C CA 1 
ATOM 1556 C CA . PRO C  3  1055 ? 197.676 203.911 276.156 1.00 0.00 ? 1055 PRO C CA 1 
ATOM 1557 C CA . SER C  3  1056 ? 195.353 203.013 273.279 1.00 0.00 ? 1056 SER C CA 1 
ATOM 1558 C CA . ALA C  3  1057 ? 196.258 199.342 273.566 1.00 0.00 ? 1057 ALA C CA 1 
ATOM 1559 C CA . LYS C  3  1058 ? 195.953 199.231 277.349 1.00 0.00 ? 1058 LYS C CA 1 
ATOM 1560 C CA . ILE C  3  1059 ? 192.510 200.794 277.283 1.00 0.00 ? 1059 ILE C CA 1 
ATOM 1561 C CA . ASN C  3  1060 ? 191.366 198.578 274.403 1.00 0.00 ? 1060 ASN C CA 1 
ATOM 1562 C CA . VAL C  3  1061 ? 192.597 195.272 275.829 1.00 0.00 ? 1061 VAL C CA 1 
ATOM 1563 C CA . LEU C  3  1062 ? 191.076 196.380 279.130 1.00 0.00 ? 1062 LEU C CA 1 
ATOM 1564 C CA . LEU C  3  1063 ? 187.599 196.972 277.690 1.00 0.00 ? 1063 LEU C CA 1 
ATOM 1565 C CA . GLN C  3  1064 ? 187.783 193.597 275.975 1.00 0.00 ? 1064 GLN C CA 1 
ATOM 1566 C CA . ALA C  3  1065 ? 189.004 191.959 279.183 1.00 0.00 ? 1065 ALA C CA 1 
ATOM 1567 C CA . PHE C  3  1066 ? 186.022 193.355 281.026 1.00 0.00 ? 1066 PHE C CA 1 
ATOM 1568 C CA . ILE C  3  1067 ? 183.578 192.201 278.390 1.00 0.00 ? 1067 ILE C CA 1 
ATOM 1569 C CA . SER C  3  1068 ? 185.328 188.848 278.025 1.00 0.00 ? 1068 SER C CA 1 
ATOM 1570 C CA . GLN C  3  1069 ? 185.128 188.743 281.837 1.00 0.00 ? 1069 GLN C CA 1 
ATOM 1571 C CA . LEU C  3  1070 ? 188.791 188.267 282.709 1.00 0.00 ? 1070 LEU C CA 1 
ATOM 1572 C CA . LYS C  3  1071 ? 190.406 188.733 286.117 1.00 0.00 ? 1071 LYS C CA 1 
ATOM 1573 C CA . LEU C  3  1072 ? 193.602 190.763 286.359 1.00 0.00 ? 1072 LEU C CA 1 
ATOM 1574 C CA . GLU C  3  1073 ? 196.626 190.141 288.601 1.00 0.00 ? 1073 GLU C CA 1 
ATOM 1575 C CA . GLY C  3  1074 ? 197.893 193.718 288.923 1.00 0.00 ? 1074 GLY C CA 1 
ATOM 1576 C CA . PHE C  3  1075 ? 195.892 196.086 291.121 1.00 0.00 ? 1075 PHE C CA 1 
ATOM 1577 C CA . ALA C  3  1076 ? 196.720 199.157 289.012 1.00 0.00 ? 1076 ALA C CA 1 
ATOM 1578 C CA . LEU C  3  1077 ? 195.187 197.471 285.974 1.00 0.00 ? 1077 LEU C CA 1 
ATOM 1579 C CA . MET C  3  1078 ? 192.122 196.457 287.922 1.00 0.00 ? 1078 MET C CA 1 
ATOM 1580 C CA . ALA C  3  1079 ? 191.321 200.007 289.060 1.00 0.00 ? 1079 ALA C CA 1 
ATOM 1581 C CA . ASP C  3  1080 ? 192.178 201.275 285.590 1.00 0.00 ? 1080 ASP C CA 1 
ATOM 1582 C CA . MET C  3  1081 ? 189.860 198.747 283.919 1.00 0.00 ? 1081 MET C CA 1 
ATOM 1583 C CA . VAL C  3  1082 ? 187.066 199.706 286.262 1.00 0.00 ? 1082 VAL C CA 1 
ATOM 1584 C CA . TYR C  3  1083 ? 187.462 203.364 285.249 1.00 0.00 ? 1083 TYR C CA 1 
ATOM 1585 C CA . VAL C  3  1084 ? 187.542 202.537 281.567 1.00 0.00 ? 1084 VAL C CA 1 
ATOM 1586 C CA . THR C  3  1085 ? 184.450 200.316 281.666 1.00 0.00 ? 1085 THR C CA 1 
ATOM 1587 C CA . GLN C  3  1086 ? 182.353 202.594 283.834 1.00 0.00 ? 1086 GLN C CA 1 
ATOM 1588 C CA . SER C  3  1087 ? 182.977 205.575 281.550 1.00 0.00 ? 1087 SER C CA 1 
ATOM 1589 C CA . ALA C  3  1088 ? 182.528 203.245 278.544 1.00 0.00 ? 1088 ALA C CA 1 
ATOM 1590 C CA . GLY C  3  1089 ? 178.743 203.119 278.804 1.00 0.00 ? 1089 GLY C CA 1 
ATOM 1591 C CA . ARG C  3  1090 ? 178.238 206.816 278.241 1.00 0.00 ? 1090 ARG C CA 1 
ATOM 1592 C CA . LEU C  3  1091 ? 181.102 206.939 275.725 1.00 0.00 ? 1091 LEU C CA 1 
ATOM 1593 C CA . MET C  3  1092 ? 179.954 204.064 273.481 1.00 0.00 ? 1092 MET C CA 1 
ATOM 1594 C CA . ARG C  3  1093 ? 176.415 205.332 273.746 1.00 0.00 ? 1093 ARG C CA 1 
ATOM 1595 C CA . ALA C  3  1094 ? 177.271 208.826 272.549 1.00 0.00 ? 1094 ALA C CA 1 
ATOM 1596 C CA . ILE C  3  1095 ? 179.065 207.121 269.688 1.00 0.00 ? 1095 ILE C CA 1 
ATOM 1597 C CA . PHE C  3  1096 ? 175.884 205.118 268.845 1.00 0.00 ? 1096 PHE C CA 1 
ATOM 1598 C CA . GLU C  3  1097 ? 173.689 208.223 269.039 1.00 0.00 ? 1097 GLU C CA 1 
ATOM 1599 C CA . ILE C  3  1098 ? 176.024 210.191 266.736 1.00 0.00 ? 1098 ILE C CA 1 
ATOM 1600 C CA . VAL C  3  1099 ? 176.575 207.463 264.210 1.00 0.00 ? 1099 VAL C CA 1 
ATOM 1601 C CA . LEU C  3  1100 ? 172.813 206.769 264.162 1.00 0.00 ? 1100 LEU C CA 1 
ATOM 1602 C CA . ASN C  3  1101 ? 171.880 210.365 263.648 1.00 0.00 ? 1101 ASN C CA 1 
ATOM 1603 C CA . ARG C  3  1102 ? 174.227 210.241 260.670 1.00 0.00 ? 1102 ARG C CA 1 
ATOM 1604 C CA . GLY C  3  1103 ? 172.341 207.244 259.353 1.00 0.00 ? 1103 GLY C CA 1 
ATOM 1605 C CA . TRP C  3  1104 ? 175.227 204.818 258.801 1.00 0.00 ? 1104 TRP C CA 1 
ATOM 1606 C CA . ALA C  3  1105 ? 173.570 201.480 259.308 1.00 0.00 ? 1105 ALA C CA 1 
ATOM 1607 C CA . GLN C  3  1106 ? 176.375 199.006 259.814 1.00 0.00 ? 1106 GLN C CA 1 
ATOM 1608 C CA . LEU C  3  1107 ? 178.222 201.049 262.403 1.00 0.00 ? 1107 LEU C CA 1 
ATOM 1609 C CA . THR C  3  1108 ? 175.105 201.887 264.381 1.00 0.00 ? 1108 THR C CA 1 
ATOM 1610 C CA . ASP C  3  1109 ? 174.601 198.131 264.630 1.00 0.00 ? 1109 ASP C CA 1 
ATOM 1611 C CA . LYS C  3  1110 ? 178.189 197.510 265.720 1.00 0.00 ? 1110 LYS C CA 1 
ATOM 1612 C CA . THR C  3  1111 ? 177.887 200.321 268.290 1.00 0.00 ? 1111 THR C CA 1 
ATOM 1613 C CA . LEU C  3  1112 ? 174.549 199.458 269.853 1.00 0.00 ? 1112 LEU C CA 1 
ATOM 1614 C CA . ASN C  3  1113 ? 175.714 195.866 270.122 1.00 0.00 ? 1113 ASN C CA 1 
ATOM 1615 C CA . LEU C  3  1114 ? 178.903 197.021 271.796 1.00 0.00 ? 1114 LEU C CA 1 
ATOM 1616 C CA . CYS C  3  1115 ? 176.761 199.066 274.221 1.00 0.00 ? 1115 CYS C CA 1 
ATOM 1617 C CA . LYS C  3  1116 ? 174.778 195.973 275.101 1.00 0.00 ? 1116 LYS C CA 1 
ATOM 1618 C CA . MET C  3  1117 ? 177.945 193.917 275.456 1.00 0.00 ? 1117 MET C CA 1 
ATOM 1619 C CA . ILE C  3  1118 ? 179.315 196.415 277.950 1.00 0.00 ? 1118 ILE C CA 1 
ATOM 1620 C CA . ASP C  3  1119 ? 176.040 196.636 279.872 1.00 0.00 ? 1119 ASP C CA 1 
ATOM 1621 C CA . LYS C  3  1120 ? 175.623 192.859 280.120 1.00 0.00 ? 1120 LYS C CA 1 
ATOM 1622 C CA . ARG C  3  1121 ? 179.317 191.928 280.319 1.00 0.00 ? 1121 ARG C CA 1 
ATOM 1623 C CA . MET C  3  1122 ? 179.292 189.393 277.526 1.00 0.00 ? 1122 MET C CA 1 
ATOM 1624 C CA . TRP C  3  1123 ? 179.887 188.916 273.824 1.00 0.00 ? 1123 TRP C CA 1 
ATOM 1625 C CA . GLN C  3  1124 ? 176.944 188.120 271.549 1.00 0.00 ? 1124 GLN C CA 1 
ATOM 1626 C CA . SER C  3  1125 ? 178.498 184.745 270.772 1.00 0.00 ? 1125 SER C CA 1 
ATOM 1627 C CA . MET C  3  1126 ? 177.207 183.706 274.170 1.00 0.00 ? 1126 MET C CA 1 
ATOM 1628 C CA . CYS C  3  1127 ? 173.702 182.372 274.830 1.00 0.00 ? 1127 CYS C CA 1 
ATOM 1629 C CA . PRO C  3  1128 ? 171.080 185.119 275.369 1.00 0.00 ? 1128 PRO C CA 1 
ATOM 1630 C CA . LEU C  3  1129 ? 169.725 183.050 278.264 1.00 0.00 ? 1129 LEU C CA 1 
ATOM 1631 C CA . ARG C  3  1130 ? 172.642 184.503 280.228 1.00 0.00 ? 1130 ARG C CA 1 
ATOM 1632 C CA . GLN C  3  1131 ? 170.961 187.913 280.453 1.00 0.00 ? 1131 GLN C CA 1 
ATOM 1633 C CA . PHE C  3  1132 ? 168.539 186.167 282.781 1.00 0.00 ? 1132 PHE C CA 1 
ATOM 1634 C CA . ARG C  3  1133 ? 170.832 185.856 285.761 1.00 0.00 ? 1133 ARG C CA 1 
ATOM 1635 C CA . LYS C  3  1134 ? 168.269 183.509 287.284 1.00 0.00 ? 1134 LYS C CA 1 
ATOM 1636 C CA . LEU C  3  1135 ? 169.840 180.660 285.294 1.00 0.00 ? 1135 LEU C CA 1 
ATOM 1637 C CA . PRO C  3  1136 ? 172.465 178.074 286.421 1.00 0.00 ? 1136 PRO C CA 1 
ATOM 1638 C CA . GLU C  3  1137 ? 175.897 178.480 284.804 1.00 0.00 ? 1137 GLU C CA 1 
ATOM 1639 C CA . GLU C  3  1138 ? 176.522 174.820 284.005 1.00 0.00 ? 1138 GLU C CA 1 
ATOM 1640 C CA . VAL C  3  1139 ? 173.209 174.561 282.157 1.00 0.00 ? 1139 VAL C CA 1 
ATOM 1641 C CA . VAL C  3  1140 ? 174.004 177.605 280.035 1.00 0.00 ? 1140 VAL C CA 1 
ATOM 1642 C CA . LYS C  3  1141 ? 177.500 176.291 279.254 1.00 0.00 ? 1141 LYS C CA 1 
ATOM 1643 C CA . LYS C  3  1142 ? 175.844 172.952 278.413 1.00 0.00 ? 1142 LYS C CA 1 
ATOM 1644 C CA . ILE C  3  1143 ? 173.477 174.456 275.844 1.00 0.00 ? 1143 ILE C CA 1 
ATOM 1645 C CA . GLU C  3  1144 ? 176.468 176.354 274.426 1.00 0.00 ? 1144 GLU C CA 1 
ATOM 1646 C CA . LYS C  3  1145 ? 178.348 173.041 274.109 1.00 0.00 ? 1145 LYS C CA 1 
ATOM 1647 C CA . LYS C  3  1146 ? 175.983 171.685 271.453 1.00 0.00 ? 1146 LYS C CA 1 
ATOM 1648 C CA . ASN C  3  1147 ? 175.345 174.293 268.786 1.00 0.00 ? 1147 ASN C CA 1 
ATOM 1649 C CA . PHE C  3  1148 ? 171.569 174.637 268.469 1.00 0.00 ? 1148 PHE C CA 1 
ATOM 1650 C CA . PRO C  3  1149 ? 170.585 178.115 267.198 1.00 0.00 ? 1149 PRO C CA 1 
ATOM 1651 C CA . PHE C  3  1150 ? 168.585 180.014 269.814 1.00 0.00 ? 1150 PHE C CA 1 
ATOM 1652 C CA . GLU C  3  1151 ? 165.520 180.949 267.764 1.00 0.00 ? 1151 GLU C CA 1 
ATOM 1653 C CA . ARG C  3  1152 ? 165.042 177.200 267.294 1.00 0.00 ? 1152 ARG C CA 1 
ATOM 1654 C CA . LEU C  3  1153 ? 164.059 176.851 270.962 1.00 0.00 ? 1153 LEU C CA 1 
ATOM 1655 C CA . TYR C  3  1154 ? 160.520 178.167 270.349 1.00 0.00 ? 1154 TYR C CA 1 
ATOM 1656 C CA . ASP C  3  1155 ? 159.544 175.132 268.275 1.00 0.00 ? 1155 ASP C CA 1 
ATOM 1657 C CA . LEU C  3  1156 ? 160.300 172.799 271.185 1.00 0.00 ? 1156 LEU C CA 1 
ATOM 1658 C CA . ASN C  3  1157 ? 158.035 171.989 274.137 1.00 0.00 ? 1157 ASN C CA 1 
ATOM 1659 C CA . HIS C  3  1158 ? 159.151 171.567 277.746 1.00 0.00 ? 1158 HIS C CA 1 
ATOM 1660 C CA . ASN C  3  1159 ? 160.341 168.002 277.130 1.00 0.00 ? 1159 ASN C CA 1 
ATOM 1661 C CA . GLU C  3  1160 ? 162.016 168.519 273.748 1.00 0.00 ? 1160 GLU C CA 1 
ATOM 1662 C CA . ILE C  3  1161 ? 164.187 171.213 275.303 1.00 0.00 ? 1161 ILE C CA 1 
ATOM 1663 C CA . GLY C  3  1162 ? 165.677 169.037 278.026 1.00 0.00 ? 1162 GLY C CA 1 
ATOM 1664 C CA . GLU C  3  1163 ? 166.393 166.311 275.481 1.00 0.00 ? 1163 GLU C CA 1 
ATOM 1665 C CA . LEU C  3  1164 ? 169.077 168.387 273.756 1.00 0.00 ? 1164 LEU C CA 1 
ATOM 1666 C CA . ILE C  3  1165 ? 171.401 168.786 276.730 1.00 0.00 ? 1165 ILE C CA 1 
ATOM 1667 C CA . ARG C  3  1166 ? 170.221 165.480 278.289 1.00 0.00 ? 1166 ARG C CA 1 
ATOM 1668 C CA . MET C  3  1167 ? 169.263 167.400 281.435 1.00 0.00 ? 1167 MET C CA 1 
ATOM 1669 C CA . PRO C  3  1168 ? 165.471 166.836 281.439 1.00 0.00 ? 1168 PRO C CA 1 
ATOM 1670 C CA . LYS C  3  1169 ? 164.987 167.992 285.043 1.00 0.00 ? 1169 LYS C CA 1 
ATOM 1671 C CA . MET C  3  1170 ? 165.738 171.490 283.739 1.00 0.00 ? 1170 MET C CA 1 
ATOM 1672 C CA . GLY C  3  1171 ? 163.305 171.158 280.841 1.00 0.00 ? 1171 GLY C CA 1 
ATOM 1673 C CA . LYS C  3  1172 ? 160.482 173.201 282.351 1.00 0.00 ? 1172 LYS C CA 1 
ATOM 1674 C CA . THR C  3  1173 ? 162.575 176.050 283.780 1.00 0.00 ? 1173 THR C CA 1 
ATOM 1675 C CA . ILE C  3  1174 ? 164.571 176.609 280.593 1.00 0.00 ? 1174 ILE C CA 1 
ATOM 1676 C CA . HIS C  3  1175 ? 161.289 176.835 278.728 1.00 0.00 ? 1175 HIS C CA 1 
ATOM 1677 C CA . LYS C  3  1176 ? 160.098 179.629 281.018 1.00 0.00 ? 1176 LYS C CA 1 
ATOM 1678 C CA . TYR C  3  1177 ? 163.133 181.735 280.162 1.00 0.00 ? 1177 TYR C CA 1 
ATOM 1679 C CA . VAL C  3  1178 ? 162.929 181.018 276.457 1.00 0.00 ? 1178 VAL C CA 1 
ATOM 1680 C CA . HIS C  3  1179 ? 159.445 182.494 276.478 1.00 0.00 ? 1179 HIS C CA 1 
ATOM 1681 C CA . LEU C  3  1180 ? 160.471 185.296 278.826 1.00 0.00 ? 1180 LEU C CA 1 
ATOM 1682 C CA . PHE C  3  1181 ? 162.980 186.486 276.244 1.00 0.00 ? 1181 PHE C CA 1 
ATOM 1683 C CA . PRO C  3  1182 ? 161.480 189.477 274.403 1.00 0.00 ? 1182 PRO C CA 1 
ATOM 1684 C CA . LYS C  3  1183 ? 160.275 188.585 270.910 1.00 0.00 ? 1183 LYS C CA 1 
ATOM 1685 C CA . LEU C  3  1184 ? 158.368 190.683 268.427 1.00 0.00 ? 1184 LEU C CA 1 
ATOM 1686 C CA . GLU C  3  1185 ? 156.716 189.437 265.263 1.00 0.00 ? 1185 GLU C CA 1 
ATOM 1687 C CA . LEU C  3  1186 ? 155.953 192.035 262.637 1.00 0.00 ? 1186 LEU C CA 1 
ATOM 1688 C CA . SER C  3  1187 ? 153.814 192.483 259.562 1.00 0.00 ? 1187 SER C CA 1 
ATOM 1689 C CA . VAL C  3  1188 ? 153.826 195.251 257.001 1.00 0.00 ? 1188 VAL C CA 1 
ATOM 1690 C CA . HIS C  3  1189 ? 151.293 196.797 254.644 1.00 0.00 ? 1189 HIS C CA 1 
ATOM 1691 C CA . LEU C  3  1190 ? 152.980 198.859 251.976 1.00 0.00 ? 1190 LEU C CA 1 
ATOM 1692 C CA . GLN C  3  1191 ? 151.435 201.135 249.383 1.00 0.00 ? 1191 GLN C CA 1 
ATOM 1693 C CA . PRO C  3  1192 ? 153.082 203.589 246.996 1.00 0.00 ? 1192 PRO C CA 1 
ATOM 1694 C CA . ILE C  3  1193 ? 152.174 207.248 247.412 1.00 0.00 ? 1193 ILE C CA 1 
ATOM 1695 C CA . THR C  3  1194 ? 154.235 208.950 244.717 1.00 0.00 ? 1194 THR C CA 1 
ATOM 1696 C CA . ARG C  3  1195 ? 157.037 207.673 242.477 1.00 0.00 ? 1195 ARG C CA 1 
ATOM 1697 C CA . SER C  3  1196 ? 159.358 209.104 245.150 1.00 0.00 ? 1196 SER C CA 1 
ATOM 1698 C CA . THR C  3  1197 ? 157.682 207.801 248.356 1.00 0.00 ? 1197 THR C CA 1 
ATOM 1699 C CA . LEU C  3  1198 ? 156.073 204.663 249.768 1.00 0.00 ? 1198 LEU C CA 1 
ATOM 1700 C CA . LYS C  3  1199 ? 153.897 204.354 252.873 1.00 0.00 ? 1199 LYS C CA 1 
ATOM 1701 C CA . VAL C  3  1200 ? 154.582 201.640 255.435 1.00 0.00 ? 1200 VAL C CA 1 
ATOM 1702 C CA . GLU C  3  1201 ? 152.250 200.322 258.137 1.00 0.00 ? 1201 GLU C CA 1 
ATOM 1703 C CA . LEU C  3  1202 ? 154.208 198.166 260.536 1.00 0.00 ? 1202 LEU C CA 1 
ATOM 1704 C CA . THR C  3  1203 ? 152.265 195.910 262.846 1.00 0.00 ? 1203 THR C CA 1 
ATOM 1705 C CA . ILE C  3  1204 ? 154.171 194.840 265.900 1.00 0.00 ? 1204 ILE C CA 1 
ATOM 1706 C CA . THR C  3  1205 ? 152.724 191.851 267.729 1.00 0.00 ? 1205 THR C CA 1 
ATOM 1707 C CA . PRO C  3  1206 ? 154.371 190.907 271.024 1.00 0.00 ? 1206 PRO C CA 1 
ATOM 1708 C CA . ASP C  3  1207 ? 155.437 187.250 271.020 1.00 0.00 ? 1207 ASP C CA 1 
ATOM 1709 C CA . PHE C  3  1208 ? 156.829 187.031 274.575 1.00 0.00 ? 1208 PHE C CA 1 
ATOM 1710 C CA . GLN C  3  1209 ? 155.495 186.471 278.108 1.00 0.00 ? 1209 GLN C CA 1 
ATOM 1711 C CA . TRP C  3  1210 ? 155.878 189.623 280.198 1.00 0.00 ? 1210 TRP C CA 1 
ATOM 1712 C CA . ASP C  3  1211 ? 157.202 189.520 283.770 1.00 0.00 ? 1211 ASP C CA 1 
ATOM 1713 C CA . GLU C  3  1212 ? 157.835 192.853 285.531 1.00 0.00 ? 1212 GLU C CA 1 
ATOM 1714 C CA . LYS C  3  1213 ? 160.550 191.182 287.605 1.00 0.00 ? 1213 LYS C CA 1 
ATOM 1715 C CA . VAL C  3  1214 ? 162.370 190.796 284.292 1.00 0.00 ? 1214 VAL C CA 1 
ATOM 1716 C CA . HIS C  3  1215 ? 161.021 193.209 281.676 1.00 0.00 ? 1215 HIS C CA 1 
ATOM 1717 C CA . GLY C  3  1216 ? 159.913 195.698 284.304 1.00 0.00 ? 1216 GLY C CA 1 
ATOM 1718 C CA . SER C  3  1217 ? 157.655 198.655 283.607 1.00 0.00 ? 1217 SER C CA 1 
ATOM 1719 C CA . SER C  3  1218 ? 158.702 199.210 279.961 1.00 0.00 ? 1218 SER C CA 1 
ATOM 1720 C CA . GLU C  3  1219 ? 160.597 197.615 277.052 1.00 0.00 ? 1219 GLU C CA 1 
ATOM 1721 C CA . ALA C  3  1220 ? 162.501 199.621 274.457 1.00 0.00 ? 1220 ALA C CA 1 
ATOM 1722 C CA . PHE C  3  1221 ? 162.980 198.898 270.767 1.00 0.00 ? 1221 PHE C CA 1 
ATOM 1723 C CA . TRP C  3  1222 ? 164.496 200.728 267.826 1.00 0.00 ? 1222 TRP C CA 1 
ATOM 1724 C CA . ILE C  3  1223 ? 162.717 200.206 264.538 1.00 0.00 ? 1223 ILE C CA 1 
ATOM 1725 C CA . LEU C  3  1224 ? 164.867 201.211 261.623 1.00 0.00 ? 1224 LEU C CA 1 
ATOM 1726 C CA . VAL C  3  1225 ? 164.281 200.715 257.888 1.00 0.00 ? 1225 VAL C CA 1 
ATOM 1727 C CA . GLU C  3  1226 ? 167.534 200.128 256.054 1.00 0.00 ? 1226 GLU C CA 1 
ATOM 1728 C CA . ASP C  3  1227 ? 168.202 200.370 252.325 1.00 0.00 ? 1227 ASP C CA 1 
ATOM 1729 C CA . VAL C  3  1228 ? 168.989 197.651 249.809 1.00 0.00 ? 1228 VAL C CA 1 
ATOM 1730 C CA . ASP C  3  1229 ? 172.458 196.767 250.997 1.00 0.00 ? 1229 ASP C CA 1 
ATOM 1731 C CA . SER C  3  1230 ? 171.763 197.349 254.690 1.00 0.00 ? 1230 SER C CA 1 
ATOM 1732 C CA . GLU C  3  1231 ? 174.100 200.305 254.270 1.00 0.00 ? 1231 GLU C CA 1 
ATOM 1733 C CA . VAL C  3  1232 ? 172.026 203.432 254.724 1.00 0.00 ? 1232 VAL C CA 1 
ATOM 1734 C CA . ILE C  3  1233 ? 169.261 203.830 257.285 1.00 0.00 ? 1233 ILE C CA 1 
ATOM 1735 C CA . LEU C  3  1234 ? 166.376 205.381 255.402 1.00 0.00 ? 1234 LEU C CA 1 
ATOM 1736 C CA . HIS C  3  1235 ? 164.318 205.900 258.535 1.00 0.00 ? 1235 HIS C CA 1 
ATOM 1737 C CA . HIS C  3  1236 ? 164.236 205.162 262.270 1.00 0.00 ? 1236 HIS C CA 1 
ATOM 1738 C CA . GLU C  3  1237 ? 161.885 205.484 265.211 1.00 0.00 ? 1237 GLU C CA 1 
ATOM 1739 C CA . TYR C  3  1238 ? 162.177 204.748 268.925 1.00 0.00 ? 1238 TYR C CA 1 
ATOM 1740 C CA . PHE C  3  1239 ? 159.274 202.432 269.782 1.00 0.00 ? 1239 PHE C CA 1 
ATOM 1741 C CA . LEU C  3  1240 ? 158.485 201.702 273.396 1.00 0.00 ? 1240 LEU C CA 1 
ATOM 1742 C CA . LEU C  3  1241 ? 156.053 199.006 274.518 1.00 0.00 ? 1241 LEU C CA 1 
ATOM 1743 C CA . LYS C  3  1242 ? 154.746 199.585 278.013 1.00 0.00 ? 1242 LYS C CA 1 
ATOM 1744 C CA . ALA C  3  1243 ? 153.766 196.963 280.587 1.00 0.00 ? 1243 ALA C CA 1 
ATOM 1745 C CA . LYS C  3  1244 ? 150.002 197.203 280.049 1.00 0.00 ? 1244 LYS C CA 1 
ATOM 1746 C CA . TYR C  3  1245 ? 150.223 196.701 276.345 1.00 0.00 ? 1245 TYR C CA 1 
ATOM 1747 C CA . ALA C  3  1246 ? 152.190 193.481 275.919 1.00 0.00 ? 1246 ALA C CA 1 
ATOM 1748 C CA . GLN C  3  1247 ? 149.945 191.270 273.730 1.00 0.00 ? 1247 GLN C CA 1 
ATOM 1749 C CA . ASP C  3  1248 ? 148.380 194.407 272.169 1.00 0.00 ? 1248 ASP C CA 1 
ATOM 1750 C CA . GLU C  3  1249 ? 149.535 194.820 268.591 1.00 0.00 ? 1249 GLU C CA 1 
ATOM 1751 C CA . HIS C  3  1250 ? 150.893 198.315 267.986 1.00 0.00 ? 1250 HIS C CA 1 
ATOM 1752 C CA . LEU C  3  1251 ? 150.521 200.017 264.598 1.00 0.00 ? 1251 LEU C CA 1 
ATOM 1753 C CA . ILE C  3  1252 ? 153.307 202.332 263.443 1.00 0.00 ? 1252 ILE C CA 1 
ATOM 1754 C CA . THR C  3  1253 ? 152.864 204.316 260.226 1.00 0.00 ? 1253 THR C CA 1 
ATOM 1755 C CA . PHE C  3  1254 ? 155.797 205.950 258.422 1.00 0.00 ? 1254 PHE C CA 1 
ATOM 1756 C CA . PHE C  3  1255 ? 156.874 206.979 254.915 1.00 0.00 ? 1255 PHE C CA 1 
ATOM 1757 C CA . VAL C  3  1256 ? 160.149 206.029 253.188 1.00 0.00 ? 1256 VAL C CA 1 
ATOM 1758 C CA . PRO C  3  1257 ? 161.694 207.337 249.911 1.00 0.00 ? 1257 PRO C CA 1 
ATOM 1759 C CA . VAL C  3  1258 ? 162.595 205.283 246.851 1.00 0.00 ? 1258 VAL C CA 1 
ATOM 1760 C CA . PHE C  3  1259 ? 165.251 206.036 244.279 1.00 0.00 ? 1259 PHE C CA 1 
ATOM 1761 C CA . GLU C  3  1260 ? 166.039 205.838 240.569 1.00 0.00 ? 1260 GLU C CA 1 
ATOM 1762 C CA . PRO C  3  1261 ? 167.424 202.331 240.259 1.00 0.00 ? 1261 PRO C CA 1 
ATOM 1763 C CA . LEU C  3  1262 ? 164.311 200.841 241.986 1.00 0.00 ? 1262 LEU C CA 1 
ATOM 1764 C CA . PRO C  3  1263 ? 165.767 198.321 244.375 1.00 0.00 ? 1263 PRO C CA 1 
ATOM 1765 C CA . PRO C  3  1264 ? 164.837 194.698 245.079 1.00 0.00 ? 1264 PRO C CA 1 
ATOM 1766 C CA . GLN C  3  1265 ? 163.771 195.443 248.655 1.00 0.00 ? 1265 GLN C CA 1 
ATOM 1767 C CA . TYR C  3  1266 ? 164.164 197.420 251.851 1.00 0.00 ? 1266 TYR C CA 1 
ATOM 1768 C CA . PHE C  3  1267 ? 164.585 195.916 255.266 1.00 0.00 ? 1267 PHE C CA 1 
ATOM 1769 C CA . ILE C  3  1268 ? 162.622 196.760 258.375 1.00 0.00 ? 1268 ILE C CA 1 
ATOM 1770 C CA . ARG C  3  1269 ? 164.753 195.960 261.420 1.00 0.00 ? 1269 ARG C CA 1 
ATOM 1771 C CA . VAL C  3  1270 ? 163.558 195.943 265.033 1.00 0.00 ? 1270 VAL C CA 1 
ATOM 1772 C CA . VAL C  3  1271 ? 165.956 195.598 267.968 1.00 0.00 ? 1271 VAL C CA 1 
ATOM 1773 C CA . SER C  3  1272 ? 165.688 195.917 271.732 1.00 0.00 ? 1272 SER C CA 1 
ATOM 1774 C CA . ASP C  3  1273 ? 167.708 198.732 273.202 1.00 0.00 ? 1273 ASP C CA 1 
ATOM 1775 C CA . ARG C  3  1274 ? 169.024 197.037 276.320 1.00 0.00 ? 1274 ARG C CA 1 
ATOM 1776 C CA . TRP C  3  1275 ? 168.512 193.379 275.317 1.00 0.00 ? 1275 TRP C CA 1 
ATOM 1777 C CA . LEU C  3  1276 ? 171.441 191.595 273.648 1.00 0.00 ? 1276 LEU C CA 1 
ATOM 1778 C CA . SER C  3  1277 ? 170.883 189.062 270.825 1.00 0.00 ? 1277 SER C CA 1 
ATOM 1779 C CA . CYS C  3  1278 ? 167.275 190.202 270.627 1.00 0.00 ? 1278 CYS C CA 1 
ATOM 1780 C CA . GLU C  3  1279 ? 166.325 191.229 267.050 1.00 0.00 ? 1279 GLU C CA 1 
ATOM 1781 C CA . THR C  3  1280 ? 163.787 190.672 264.218 1.00 0.00 ? 1280 THR C CA 1 
ATOM 1782 C CA . GLN C  3  1281 ? 164.340 191.619 260.542 1.00 0.00 ? 1281 GLN C CA 1 
ATOM 1783 C CA . LEU C  3  1282 ? 161.575 191.937 257.944 1.00 0.00 ? 1282 LEU C CA 1 
ATOM 1784 C CA . PRO C  3  1283 ? 162.438 192.037 254.236 1.00 0.00 ? 1283 PRO C CA 1 
ATOM 1785 C CA . VAL C  3  1284 ? 160.064 194.346 252.423 1.00 0.00 ? 1284 VAL C CA 1 
ATOM 1786 C CA . SER C  3  1285 ? 160.256 193.248 248.819 1.00 0.00 ? 1285 SER C CA 1 
ATOM 1787 C CA . PHE C  3  1286 ? 159.563 195.551 245.919 1.00 0.00 ? 1286 PHE C CA 1 
ATOM 1788 C CA . ARG C  3  1287 ? 159.754 192.756 243.348 1.00 0.00 ? 1287 ARG C CA 1 
ATOM 1789 C CA . HIS C  3  1288 ? 156.133 193.406 242.455 1.00 0.00 ? 1288 HIS C CA 1 
ATOM 1790 C CA . LEU C  3  1289 ? 155.932 197.138 243.165 1.00 0.00 ? 1289 LEU C CA 1 
ATOM 1791 C CA . ILE C  3  1290 ? 154.248 199.315 240.566 1.00 0.00 ? 1290 ILE C CA 1 
ATOM 1792 C CA . LEU C  3  1291 ? 155.088 202.974 241.006 1.00 0.00 ? 1291 LEU C CA 1 
ATOM 1793 C CA . PRO C  3  1292 ? 152.493 205.670 240.155 1.00 0.00 ? 1292 PRO C CA 1 
ATOM 1794 C CA . GLU C  3  1293 ? 152.679 207.698 236.950 1.00 0.00 ? 1293 GLU C CA 1 
ATOM 1795 C CA . LYS C  3  1294 ? 154.935 210.770 237.421 1.00 0.00 ? 1294 LYS C CA 1 
ATOM 1796 C CA . TYR C  3  1295 ? 152.856 213.907 237.783 1.00 0.00 ? 1295 TYR C CA 1 
ATOM 1797 C CA . PRO C  3  1296 ? 152.611 216.566 235.037 1.00 0.00 ? 1296 PRO C CA 1 
ATOM 1798 C CA . PRO C  3  1297 ? 153.797 220.102 235.805 1.00 0.00 ? 1297 PRO C CA 1 
ATOM 1799 C CA . PRO C  3  1298 ? 151.205 222.495 237.273 1.00 0.00 ? 1298 PRO C CA 1 
ATOM 1800 C CA . THR C  3  1299 ? 149.686 224.980 234.835 1.00 0.00 ? 1299 THR C CA 1 
ATOM 1801 C CA . GLU C  3  1300 ? 151.968 227.987 234.718 1.00 0.00 ? 1300 GLU C CA 1 
ATOM 1802 C CA . LEU C  3  1301 ? 150.835 231.159 236.411 1.00 0.00 ? 1301 LEU C CA 1 
ATOM 1803 C CA . LEU C  3  1302 ? 150.585 233.568 233.522 1.00 0.00 ? 1302 LEU C CA 1 
ATOM 1804 C CA . ASP C  3  1303 ? 151.753 237.130 233.954 1.00 0.00 ? 1303 ASP C CA 1 
ATOM 1805 C CA . LEU C  3  1304 ? 148.519 239.081 233.632 1.00 0.00 ? 1304 LEU C CA 1 
ATOM 1806 C CA . GLN C  3  1305 ? 147.423 242.643 234.093 1.00 0.00 ? 1305 GLN C CA 1 
ATOM 1807 C CA . PRO C  3  1306 ? 145.814 242.246 237.536 1.00 0.00 ? 1306 PRO C CA 1 
ATOM 1808 C CA . LEU C  3  1307 ? 142.051 242.392 237.029 1.00 0.00 ? 1307 LEU C CA 1 
ATOM 1809 C CA . PRO C  3  1308 ? 140.177 245.341 238.548 1.00 0.00 ? 1308 PRO C CA 1 
ATOM 1810 C CA . VAL C  3  1309 ? 136.752 244.809 240.118 1.00 0.00 ? 1309 VAL C CA 1 
ATOM 1811 C CA . SER C  3  1310 ? 135.536 246.951 237.207 1.00 0.00 ? 1310 SER C CA 1 
ATOM 1812 C CA . ALA C  3  1311 ? 135.612 243.894 234.956 1.00 0.00 ? 1311 ALA C CA 1 
ATOM 1813 C CA . LEU C  3  1312 ? 132.079 242.586 235.544 1.00 0.00 ? 1312 LEU C CA 1 
ATOM 1814 C CA . ARG C  3  1313 ? 129.913 245.208 233.904 1.00 0.00 ? 1313 ARG C CA 1 
ATOM 1815 C CA . ASN C  3  1314 ? 127.405 244.803 236.765 1.00 0.00 ? 1314 ASN C CA 1 
ATOM 1816 C CA . SER C  3  1315 ? 127.602 247.661 239.290 1.00 0.00 ? 1315 SER C CA 1 
ATOM 1817 C CA . ALA C  3  1316 ? 125.560 245.806 241.902 1.00 0.00 ? 1316 ALA C CA 1 
ATOM 1818 C CA . PHE C  3  1317 ? 128.204 243.093 241.779 1.00 0.00 ? 1317 PHE C CA 1 
ATOM 1819 C CA . GLU C  3  1318 ? 131.150 245.485 241.901 1.00 0.00 ? 1318 GLU C CA 1 
ATOM 1820 C CA . SER C  3  1319 ? 129.762 246.889 245.177 1.00 0.00 ? 1319 SER C CA 1 
ATOM 1821 C CA . LEU C  3  1320 ? 130.470 243.761 247.288 1.00 0.00 ? 1320 LEU C CA 1 
ATOM 1822 C CA . TYR C  3  1321 ? 134.165 243.787 246.324 1.00 0.00 ? 1321 TYR C CA 1 
ATOM 1823 C CA . GLN C  3  1322 ? 135.461 247.311 245.506 1.00 0.00 ? 1322 GLN C CA 1 
ATOM 1824 C CA . ASP C  3  1323 ? 135.437 248.576 249.118 1.00 0.00 ? 1323 ASP C CA 1 
ATOM 1825 C CA . LYS C  3  1324 ? 137.364 245.484 250.234 1.00 0.00 ? 1324 LYS C CA 1 
ATOM 1826 C CA . PHE C  3  1325 ? 140.210 245.064 247.733 1.00 0.00 ? 1325 PHE C CA 1 
ATOM 1827 C CA . PRO C  3  1326 ? 141.159 247.076 244.594 1.00 0.00 ? 1326 PRO C CA 1 
ATOM 1828 C CA . PHE C  3  1327 ? 142.411 244.098 242.541 1.00 0.00 ? 1327 PHE C CA 1 
ATOM 1829 C CA . PHE C  3  1328 ? 141.843 240.355 242.148 1.00 0.00 ? 1328 PHE C CA 1 
ATOM 1830 C CA . ASN C  3  1329 ? 144.905 238.131 242.655 1.00 0.00 ? 1329 ASN C CA 1 
ATOM 1831 C CA . PRO C  3  1330 ? 146.733 236.440 239.723 1.00 0.00 ? 1330 PRO C CA 1 
ATOM 1832 C CA . ILE C  3  1331 ? 144.949 233.135 240.388 1.00 0.00 ? 1331 ILE C CA 1 
ATOM 1833 C CA . GLN C  3  1332 ? 141.554 234.781 240.236 1.00 0.00 ? 1332 GLN C CA 1 
ATOM 1834 C CA . THR C  3  1333 ? 142.394 236.964 237.255 1.00 0.00 ? 1333 THR C CA 1 
ATOM 1835 C CA . GLN C  3  1334 ? 143.699 233.899 235.363 1.00 0.00 ? 1334 GLN C CA 1 
ATOM 1836 C CA . VAL C  3  1335 ? 140.566 231.852 236.176 1.00 0.00 ? 1335 VAL C CA 1 
ATOM 1837 C CA . PHE C  3  1336 ? 138.200 234.752 235.587 1.00 0.00 ? 1336 PHE C CA 1 
ATOM 1838 C CA . ASN C  3  1337 ? 137.317 234.616 231.898 1.00 0.00 ? 1337 ASN C CA 1 
ATOM 1839 C CA . THR C  3  1338 ? 136.853 230.861 232.082 1.00 0.00 ? 1338 THR C CA 1 
ATOM 1840 C CA . VAL C  3  1339 ? 134.749 230.798 235.238 1.00 0.00 ? 1339 VAL C CA 1 
ATOM 1841 C CA . TYR C  3  1340 ? 132.789 234.016 234.654 1.00 0.00 ? 1340 TYR C CA 1 
ATOM 1842 C CA . ASN C  3  1341 ? 132.430 234.750 230.944 1.00 0.00 ? 1341 ASN C CA 1 
ATOM 1843 C CA . SER C  3  1342 ? 132.114 231.050 230.095 1.00 0.00 ? 1342 SER C CA 1 
ATOM 1844 C CA . ASP C  3  1343 ? 129.695 228.250 230.949 1.00 0.00 ? 1343 ASP C CA 1 
ATOM 1845 C CA . ASP C  3  1344 ? 131.966 225.176 231.210 1.00 0.00 ? 1344 ASP C CA 1 
ATOM 1846 C CA . ASN C  3  1345 ? 133.083 223.046 234.180 1.00 0.00 ? 1345 ASN C CA 1 
ATOM 1847 C CA . VAL C  3  1346 ? 136.287 224.301 235.762 1.00 0.00 ? 1346 VAL C CA 1 
ATOM 1848 C CA . PHE C  3  1347 ? 138.729 222.944 238.284 1.00 0.00 ? 1347 PHE C CA 1 
ATOM 1849 C CA . VAL C  3  1348 ? 140.831 225.363 240.310 1.00 0.00 ? 1348 VAL C CA 1 
ATOM 1850 C CA . GLY C  3  1349 ? 143.515 224.021 242.595 1.00 0.00 ? 1349 GLY C CA 1 
ATOM 1851 C CA . ALA C  3  1350 ? 145.591 226.546 244.492 1.00 0.00 ? 1350 ALA C CA 1 
ATOM 1852 C CA . PRO C  3  1351 ? 147.101 226.093 247.967 1.00 0.00 ? 1351 PRO C CA 1 
ATOM 1853 C CA . THR C  3  1352 ? 144.812 227.239 250.791 1.00 0.00 ? 1352 THR C CA 1 
ATOM 1854 C CA . GLY C  3  1353 ? 144.951 231.002 251.086 1.00 0.00 ? 1353 GLY C CA 1 
ATOM 1855 C CA . SER C  3  1354 ? 144.690 231.566 247.345 1.00 0.00 ? 1354 SER C CA 1 
ATOM 1856 C CA . GLY C  3  1355 ? 141.184 233.059 247.211 1.00 0.00 ? 1355 GLY C CA 1 
ATOM 1857 C CA . LYS C  3  1356 ? 139.306 230.289 245.396 1.00 0.00 ? 1356 LYS C CA 1 
ATOM 1858 C CA . THR C  3  1357 ? 136.113 231.173 247.304 1.00 0.00 ? 1357 THR C CA 1 
ATOM 1859 C CA . ILE C  3  1358 ? 135.498 234.202 245.142 1.00 0.00 ? 1358 ILE C CA 1 
ATOM 1860 C CA . CYS C  3  1359 ? 136.418 232.034 242.171 1.00 0.00 ? 1359 CYS C CA 1 
ATOM 1861 C CA . ALA C  3  1360 ? 133.288 230.085 243.123 1.00 0.00 ? 1360 ALA C CA 1 
ATOM 1862 C CA . GLU C  3  1361 ? 131.478 233.377 243.621 1.00 0.00 ? 1361 GLU C CA 1 
ATOM 1863 C CA . PHE C  3  1362 ? 132.314 234.254 240.006 1.00 0.00 ? 1362 PHE C CA 1 
ATOM 1864 C CA . ALA C  3  1363 ? 130.403 231.215 238.762 1.00 0.00 ? 1363 ALA C CA 1 
ATOM 1865 C CA . ILE C  3  1364 ? 127.619 232.066 241.164 1.00 0.00 ? 1364 ILE C CA 1 
ATOM 1866 C CA . LEU C  3  1365 ? 127.388 235.592 239.716 1.00 0.00 ? 1365 LEU C CA 1 
ATOM 1867 C CA . ARG C  3  1366 ? 127.298 234.191 236.184 1.00 0.00 ? 1366 ARG C CA 1 
ATOM 1868 C CA . MET C  3  1367 ? 124.362 231.967 237.181 1.00 0.00 ? 1367 MET C CA 1 
ATOM 1869 C CA . LEU C  3  1368 ? 122.830 235.063 238.715 1.00 0.00 ? 1368 LEU C CA 1 
ATOM 1870 C CA . LEU C  3  1369 ? 122.866 236.794 235.326 1.00 0.00 ? 1369 LEU C CA 1 
ATOM 1871 C CA . GLN C  3  1370 ? 121.634 233.555 233.740 1.00 0.00 ? 1370 GLN C CA 1 
ATOM 1872 C CA . SER C  3  1371 ? 118.317 233.382 235.585 1.00 0.00 ? 1371 SER C CA 1 
ATOM 1873 C CA . SER C  3  1372 ? 116.341 235.260 238.255 1.00 0.00 ? 1372 SER C CA 1 
ATOM 1874 C CA . GLU C  3  1373 ? 115.367 232.071 240.075 1.00 0.00 ? 1373 GLU C CA 1 
ATOM 1875 C CA . GLY C  3  1374 ? 118.600 230.286 239.146 1.00 0.00 ? 1374 GLY C CA 1 
ATOM 1876 C CA . ARG C  3  1375 ? 119.416 227.557 241.651 1.00 0.00 ? 1375 ARG C CA 1 
ATOM 1877 C CA . CYS C  3  1376 ? 122.898 226.753 243.073 1.00 0.00 ? 1376 CYS C CA 1 
ATOM 1878 C CA . VAL C  3  1377 ? 124.206 224.096 245.488 1.00 0.00 ? 1377 VAL C CA 1 
ATOM 1879 C CA . TYR C  3  1378 ? 127.549 224.599 247.285 1.00 0.00 ? 1378 TYR C CA 1 
ATOM 1880 C CA . ILE C  3  1379 ? 129.446 221.927 249.242 1.00 0.00 ? 1379 ILE C CA 1 
ATOM 1881 C CA . THR C  3  1380 ? 132.290 221.918 251.803 1.00 0.00 ? 1380 THR C CA 1 
ATOM 1882 C CA . PRO C  3  1381 ? 133.475 218.762 253.679 1.00 0.00 ? 1381 PRO C CA 1 
ATOM 1883 C CA . MET C  3  1382 ? 133.779 220.649 256.971 1.00 0.00 ? 1382 MET C CA 1 
ATOM 1884 C CA . GLU C  3  1383 ? 130.607 221.737 258.793 1.00 0.00 ? 1383 GLU C CA 1 
ATOM 1885 C CA . ALA C  3  1384 ? 132.595 224.468 260.503 1.00 0.00 ? 1384 ALA C CA 1 
ATOM 1886 C CA . LEU C  3  1385 ? 133.851 225.734 257.173 1.00 0.00 ? 1385 LEU C CA 1 
ATOM 1887 C CA . ALA C  3  1386 ? 130.237 225.544 255.940 1.00 0.00 ? 1386 ALA C CA 1 
ATOM 1888 C CA . GLU C  3  1387 ? 128.873 227.865 258.615 1.00 0.00 ? 1387 GLU C CA 1 
ATOM 1889 C CA . GLN C  3  1388 ? 131.896 230.069 257.927 1.00 0.00 ? 1388 GLN C CA 1 
ATOM 1890 C CA . VAL C  3  1389 ? 130.863 230.273 254.260 1.00 0.00 ? 1389 VAL C CA 1 
ATOM 1891 C CA . TYR C  3  1390 ? 127.195 230.832 255.073 1.00 0.00 ? 1390 TYR C CA 1 
ATOM 1892 C CA . MET C  3  1391 ? 127.869 233.852 257.268 1.00 0.00 ? 1391 MET C CA 1 
ATOM 1893 C CA . ASP C  3  1392 ? 129.740 235.510 254.397 1.00 0.00 ? 1392 ASP C CA 1 
ATOM 1894 C CA . TRP C  3  1393 ? 127.443 234.519 251.545 1.00 0.00 ? 1393 TRP C CA 1 
ATOM 1895 C CA . TYR C  3  1394 ? 124.308 235.552 253.442 1.00 0.00 ? 1394 TYR C CA 1 
ATOM 1896 C CA . GLU C  3  1395 ? 125.520 239.156 253.490 1.00 0.00 ? 1395 GLU C CA 1 
ATOM 1897 C CA . LYS C  3  1396 ? 127.228 238.961 250.086 1.00 0.00 ? 1396 LYS C CA 1 
ATOM 1898 C CA . PHE C  3  1397 ? 124.020 237.747 248.419 1.00 0.00 ? 1397 PHE C CA 1 
ATOM 1899 C CA . GLN C  3  1398 ? 120.854 237.920 250.517 1.00 0.00 ? 1398 GLN C CA 1 
ATOM 1900 C CA . ASP C  3  1399 ? 121.670 241.315 252.052 1.00 0.00 ? 1399 ASP C CA 1 
ATOM 1901 C CA . ARG C  3  1400 ? 123.000 243.132 248.968 1.00 0.00 ? 1400 ARG C CA 1 
ATOM 1902 C CA . LEU C  3  1401 ? 121.601 241.135 246.032 1.00 0.00 ? 1401 LEU C CA 1 
ATOM 1903 C CA . ASN C  3  1402 ? 118.248 240.203 247.644 1.00 0.00 ? 1402 ASN C CA 1 
ATOM 1904 C CA . LYS C  3  1403 ? 118.774 236.586 246.575 1.00 0.00 ? 1403 LYS C CA 1 
ATOM 1905 C CA . LYS C  3  1404 ? 117.728 234.139 249.321 1.00 0.00 ? 1404 LYS C CA 1 
ATOM 1906 C CA . VAL C  3  1405 ? 120.578 232.070 250.845 1.00 0.00 ? 1405 VAL C CA 1 
ATOM 1907 C CA . VAL C  3  1406 ? 120.240 228.900 252.925 1.00 0.00 ? 1406 VAL C CA 1 
ATOM 1908 C CA . LEU C  3  1407 ? 122.302 226.454 254.983 1.00 0.00 ? 1407 LEU C CA 1 
ATOM 1909 C CA . LEU C  3  1408 ? 121.295 222.808 255.203 1.00 0.00 ? 1408 LEU C CA 1 
ATOM 1910 C CA . THR C  3  1409 ? 120.743 220.953 258.476 1.00 0.00 ? 1409 THR C CA 1 
ATOM 1911 C CA . GLY C  3  1410 ? 119.981 217.503 259.847 1.00 0.00 ? 1410 GLY C CA 1 
ATOM 1912 C CA . GLU C  3  1411 ? 116.273 217.016 259.204 1.00 0.00 ? 1411 GLU C CA 1 
ATOM 1913 C CA . THR C  3  1412 ? 115.085 215.760 255.808 1.00 0.00 ? 1412 THR C CA 1 
ATOM 1914 C CA . SER C  3  1413 ? 111.830 217.724 255.816 1.00 0.00 ? 1413 SER C CA 1 
ATOM 1915 C CA . THR C  3  1414 ? 113.155 221.109 256.929 1.00 0.00 ? 1414 THR C CA 1 
ATOM 1916 C CA . ASP C  3  1415 ? 116.097 220.705 254.544 1.00 0.00 ? 1415 ASP C CA 1 
ATOM 1917 C CA . LEU C  3  1416 ? 113.858 219.960 251.600 1.00 0.00 ? 1416 LEU C CA 1 
ATOM 1918 C CA . LYS C  3  1417 ? 111.748 223.020 252.333 1.00 0.00 ? 1417 LYS C CA 1 
ATOM 1919 C CA . LEU C  3  1418 ? 114.998 224.974 252.650 1.00 0.00 ? 1418 LEU C CA 1 
ATOM 1920 C CA . LEU C  3  1419 ? 116.212 224.397 249.115 1.00 0.00 ? 1419 LEU C CA 1 
ATOM 1921 C CA . GLY C  3  1420 ? 114.032 225.612 246.253 1.00 0.00 ? 1420 GLY C CA 1 
ATOM 1922 C CA . LYS C  3  1421 ? 113.215 228.704 248.260 1.00 0.00 ? 1421 LYS C CA 1 
ATOM 1923 C CA . GLY C  3  1422 ? 116.933 229.491 248.159 1.00 0.00 ? 1422 GLY C CA 1 
ATOM 1924 C CA . ASN C  3  1423 ? 119.120 230.526 245.239 1.00 0.00 ? 1423 ASN C CA 1 
ATOM 1925 C CA . ILE C  3  1424 ? 122.244 229.338 247.007 1.00 0.00 ? 1424 ILE C CA 1 
ATOM 1926 C CA . ILE C  3  1425 ? 122.191 226.181 249.090 1.00 0.00 ? 1425 ILE C CA 1 
ATOM 1927 C CA . ILE C  3  1426 ? 125.194 225.658 251.370 1.00 0.00 ? 1426 ILE C CA 1 
ATOM 1928 C CA . SER C  3  1427 ? 125.685 222.110 252.637 1.00 0.00 ? 1427 SER C CA 1 
ATOM 1929 C CA . THR C  3  1428 ? 127.956 219.364 253.910 1.00 0.00 ? 1428 THR C CA 1 
ATOM 1930 C CA . PRO C  3  1429 ? 128.336 216.038 252.078 1.00 0.00 ? 1429 PRO C CA 1 
ATOM 1931 C CA . GLU C  3  1430 ? 126.279 213.928 254.458 1.00 0.00 ? 1430 GLU C CA 1 
ATOM 1932 C CA . LYS C  3  1431 ? 123.300 216.342 254.415 1.00 0.00 ? 1431 LYS C CA 1 
ATOM 1933 C CA . TRP C  3  1432 ? 123.353 216.324 250.620 1.00 0.00 ? 1432 TRP C CA 1 
ATOM 1934 C CA . ASP C  3  1433 ? 123.681 212.529 250.425 1.00 0.00 ? 1433 ASP C CA 1 
ATOM 1935 C CA . ILE C  3  1434 ? 120.591 211.429 252.381 1.00 0.00 ? 1434 ILE C CA 1 
ATOM 1936 C CA . LEU C  3  1435 ? 118.647 214.069 250.457 1.00 0.00 ? 1435 LEU C CA 1 
ATOM 1937 C CA . SER C  3  1436 ? 119.588 213.566 246.750 1.00 0.00 ? 1436 SER C CA 1 
ATOM 1938 C CA . ARG C  3  1437 ? 119.936 209.788 247.132 1.00 0.00 ? 1437 ARG C CA 1 
ATOM 1939 C CA . ARG C  3  1438 ? 116.207 209.774 246.372 1.00 0.00 ? 1438 ARG C CA 1 
ATOM 1940 C CA . TRP C  3  1439 ? 116.768 212.446 243.705 1.00 0.00 ? 1439 TRP C CA 1 
ATOM 1941 C CA . LYS C  3  1440 ? 114.570 210.761 241.109 1.00 0.00 ? 1440 LYS C CA 1 
ATOM 1942 C CA . GLN C  3  1441 ? 111.488 211.787 243.118 1.00 0.00 ? 1441 GLN C CA 1 
ATOM 1943 C CA . ARG C  3  1442 ? 112.686 215.238 244.250 1.00 0.00 ? 1442 ARG C CA 1 
ATOM 1944 C CA . LYS C  3  1443 ? 112.460 217.772 241.433 1.00 0.00 ? 1443 LYS C CA 1 
ATOM 1945 C CA . ASN C  3  1444 ? 114.304 220.317 243.558 1.00 0.00 ? 1444 ASN C CA 1 
ATOM 1946 C CA . VAL C  3  1445 ? 117.452 218.243 243.312 1.00 0.00 ? 1445 VAL C CA 1 
ATOM 1947 C CA . GLN C  3  1446 ? 117.280 217.943 239.526 1.00 0.00 ? 1446 GLN C CA 1 
ATOM 1948 C CA . ASN C  3  1447 ? 116.630 221.563 238.594 1.00 0.00 ? 1447 ASN C CA 1 
ATOM 1949 C CA . ILE C  3  1448 ? 119.875 223.021 239.990 1.00 0.00 ? 1448 ILE C CA 1 
ATOM 1950 C CA . ASN C  3  1449 ? 121.883 225.305 237.670 1.00 0.00 ? 1449 ASN C CA 1 
ATOM 1951 C CA . LEU C  3  1450 ? 125.262 225.300 239.370 1.00 0.00 ? 1450 LEU C CA 1 
ATOM 1952 C CA . PHE C  3  1451 ? 127.068 222.805 241.579 1.00 0.00 ? 1451 PHE C CA 1 
ATOM 1953 C CA . VAL C  3  1452 ? 130.178 223.726 243.551 1.00 0.00 ? 1452 VAL C CA 1 
ATOM 1954 C CA . VAL C  3  1453 ? 132.584 221.449 245.434 1.00 0.00 ? 1453 VAL C CA 1 
ATOM 1955 C CA . ASP C  3  1454 ? 135.009 223.269 247.709 1.00 0.00 ? 1454 ASP C CA 1 
ATOM 1956 C CA . GLU C  3  1455 ? 138.083 221.541 249.128 1.00 0.00 ? 1455 GLU C CA 1 
ATOM 1957 C CA . VAL C  3  1456 ? 137.620 218.447 246.928 1.00 0.00 ? 1456 VAL C CA 1 
ATOM 1958 C CA . HIS C  3  1457 ? 141.057 217.172 247.781 1.00 0.00 ? 1457 HIS C CA 1 
ATOM 1959 C CA . LEU C  3  1458 ? 139.379 216.273 251.051 1.00 0.00 ? 1458 LEU C CA 1 
ATOM 1960 C CA . ILE C  3  1459 ? 138.171 213.224 249.094 1.00 0.00 ? 1459 ILE C CA 1 
ATOM 1961 C CA . GLY C  3  1460 ? 141.471 211.799 250.296 1.00 0.00 ? 1460 GLY C CA 1 
ATOM 1962 C CA . GLY C  3  1461 ? 140.472 211.969 253.967 1.00 0.00 ? 1461 GLY C CA 1 
ATOM 1963 C CA . GLU C  3  1462 ? 137.780 210.041 255.815 1.00 0.00 ? 1462 GLU C CA 1 
ATOM 1964 C CA . ASN C  3  1463 ? 134.207 211.109 255.250 1.00 0.00 ? 1463 ASN C CA 1 
ATOM 1965 C CA . GLY C  3  1464 ? 135.685 211.544 251.791 1.00 0.00 ? 1464 GLY C CA 1 
ATOM 1966 C CA . PRO C  3  1465 ? 133.808 208.661 250.126 1.00 0.00 ? 1465 PRO C CA 1 
ATOM 1967 C CA . VAL C  3  1466 ? 130.542 210.465 250.814 1.00 0.00 ? 1466 VAL C CA 1 
ATOM 1968 C CA . LEU C  3  1467 ? 131.881 213.544 249.054 1.00 0.00 ? 1467 LEU C CA 1 
ATOM 1969 C CA . GLU C  3  1468 ? 133.088 211.459 246.111 1.00 0.00 ? 1468 GLU C CA 1 
ATOM 1970 C CA . VAL C  3  1469 ? 129.752 209.641 245.869 1.00 0.00 ? 1469 VAL C CA 1 
ATOM 1971 C CA . ILE C  3  1470 ? 127.746 212.877 245.871 1.00 0.00 ? 1470 ILE C CA 1 
ATOM 1972 C CA . CYS C  3  1471 ? 129.818 214.522 243.150 1.00 0.00 ? 1471 CYS C CA 1 
ATOM 1973 C CA . SER C  3  1472 ? 129.643 211.374 241.093 1.00 0.00 ? 1472 SER C CA 1 
ATOM 1974 C CA . ARG C  3  1473 ? 125.871 211.163 241.598 1.00 0.00 ? 1473 ARG C CA 1 
ATOM 1975 C CA . MET C  3  1474 ? 125.622 214.829 240.609 1.00 0.00 ? 1474 MET C CA 1 
ATOM 1976 C CA . ARG C  3  1475 ? 127.210 213.893 237.296 1.00 0.00 ? 1475 ARG C CA 1 
ATOM 1977 C CA . TYR C  3  1476 ? 124.842 210.953 236.786 1.00 0.00 ? 1476 TYR C CA 1 
ATOM 1978 C CA . ILE C  3  1477 ? 121.929 213.337 237.276 1.00 0.00 ? 1477 ILE C CA 1 
ATOM 1979 C CA . SER C  3  1478 ? 123.291 215.751 234.717 1.00 0.00 ? 1478 SER C CA 1 
ATOM 1980 C CA . SER C  3  1479 ? 123.507 212.713 232.482 1.00 0.00 ? 1479 SER C CA 1 
ATOM 1981 C CA . GLN C  3  1480 ? 119.818 211.874 232.830 1.00 0.00 ? 1480 GLN C CA 1 
ATOM 1982 C CA . ILE C  3  1481 ? 118.313 215.367 233.113 1.00 0.00 ? 1481 ILE C CA 1 
ATOM 1983 C CA . GLU C  3  1482 ? 119.373 216.073 229.512 1.00 0.00 ? 1482 GLU C CA 1 
ATOM 1984 C CA . ARG C  3  1483 ? 120.291 219.593 230.643 1.00 0.00 ? 1483 ARG C CA 1 
ATOM 1985 C CA . PRO C  3  1484 ? 123.899 220.327 231.589 1.00 0.00 ? 1484 PRO C CA 1 
ATOM 1986 C CA . ILE C  3  1485 ? 124.540 221.150 235.255 1.00 0.00 ? 1485 ILE C CA 1 
ATOM 1987 C CA . ARG C  3  1486 ? 127.750 223.154 235.524 1.00 0.00 ? 1486 ARG C CA 1 
ATOM 1988 C CA . ILE C  3  1487 ? 130.179 221.741 238.069 1.00 0.00 ? 1487 ILE C CA 1 
ATOM 1989 C CA . VAL C  3  1488 ? 132.908 223.875 239.582 1.00 0.00 ? 1488 VAL C CA 1 
ATOM 1990 C CA . ALA C  3  1489 ? 135.391 222.125 241.832 1.00 0.00 ? 1489 ALA C CA 1 
ATOM 1991 C CA . LEU C  3  1490 ? 137.905 223.817 244.089 1.00 0.00 ? 1490 LEU C CA 1 
ATOM 1992 C CA . SER C  3  1491 ? 140.905 222.081 245.620 1.00 0.00 ? 1491 SER C CA 1 
ATOM 1993 C CA . SER C  3  1492 ? 144.249 222.829 247.187 1.00 0.00 ? 1492 SER C CA 1 
ATOM 1994 C CA . SER C  3  1493 ? 147.311 222.161 245.028 1.00 0.00 ? 1493 SER C CA 1 
ATOM 1995 C CA . LEU C  3  1494 ? 146.855 218.689 243.633 1.00 0.00 ? 1494 LEU C CA 1 
ATOM 1996 C CA . SER C  3  1495 ? 149.540 216.674 241.834 1.00 0.00 ? 1495 SER C CA 1 
ATOM 1997 C CA . ASN C  3  1496 ? 146.967 214.388 240.222 1.00 0.00 ? 1496 ASN C CA 1 
ATOM 1998 C CA . ALA C  3  1497 ? 144.517 217.195 239.460 1.00 0.00 ? 1497 ALA C CA 1 
ATOM 1999 C CA . LYS C  3  1498 ? 144.218 215.739 235.951 1.00 0.00 ? 1498 LYS C CA 1 
ATOM 2000 C CA . ASP C  3  1499 ? 142.304 212.727 237.284 1.00 0.00 ? 1499 ASP C CA 1 
ATOM 2001 C CA . VAL C  3  1500 ? 139.957 214.832 239.389 1.00 0.00 ? 1500 VAL C CA 1 
ATOM 2002 C CA . ALA C  3  1501 ? 139.202 217.024 236.373 1.00 0.00 ? 1501 ALA C CA 1 
ATOM 2003 C CA . HIS C  3  1502 ? 138.679 214.051 234.057 1.00 0.00 ? 1502 HIS C CA 1 
ATOM 2004 C CA . TRP C  3  1503 ? 136.279 212.590 236.604 1.00 0.00 ? 1503 TRP C CA 1 
ATOM 2005 C CA . LEU C  3  1504 ? 134.326 215.834 237.103 1.00 0.00 ? 1504 LEU C CA 1 
ATOM 2006 C CA . GLY C  3  1505 ? 134.302 216.575 233.389 1.00 0.00 ? 1505 GLY C CA 1 
ATOM 2007 C CA . CYS C  3  1506 ? 136.625 219.516 232.936 1.00 0.00 ? 1506 CYS C CA 1 
ATOM 2008 C CA . SER C  3  1507 ? 138.474 219.994 229.662 1.00 0.00 ? 1507 SER C CA 1 
ATOM 2009 C CA . ALA C  3  1508 ? 142.204 220.359 230.223 1.00 0.00 ? 1508 ALA C CA 1 
ATOM 2010 C CA . THR C  3  1509 ? 141.948 223.876 228.842 1.00 0.00 ? 1509 THR C CA 1 
ATOM 2011 C CA . SER C  3  1510 ? 139.620 224.902 231.680 1.00 0.00 ? 1510 SER C CA 1 
ATOM 2012 C CA . THR C  3  1511 ? 141.721 223.051 234.299 1.00 0.00 ? 1511 THR C CA 1 
ATOM 2013 C CA . PHE C  3  1512 ? 143.857 225.316 236.484 1.00 0.00 ? 1512 PHE C CA 1 
ATOM 2014 C CA . ASN C  3  1513 ? 146.105 223.438 238.889 1.00 0.00 ? 1513 ASN C CA 1 
ATOM 2015 C CA . PHE C  3  1514 ? 148.626 225.709 240.603 1.00 0.00 ? 1514 PHE C CA 1 
ATOM 2016 C CA . HIS C  3  1515 ? 151.808 224.998 242.522 1.00 0.00 ? 1515 HIS C CA 1 
ATOM 2017 C CA . PRO C  3  1516 ? 151.956 225.793 246.262 1.00 0.00 ? 1516 PRO C CA 1 
ATOM 2018 C CA . ASN C  3  1517 ? 154.582 228.408 245.413 1.00 0.00 ? 1517 ASN C CA 1 
ATOM 2019 C CA . VAL C  3  1518 ? 151.838 230.426 243.734 1.00 0.00 ? 1518 VAL C CA 1 
ATOM 2020 C CA . ARG C  3  1519 ? 150.120 232.229 246.563 1.00 0.00 ? 1519 ARG C CA 1 
ATOM 2021 C CA . PRO C  3  1520 ? 148.896 235.813 246.823 1.00 0.00 ? 1520 PRO C CA 1 
ATOM 2022 C CA . VAL C  3  1521 ? 151.076 236.272 249.878 1.00 0.00 ? 1521 VAL C CA 1 
ATOM 2023 C CA . PRO C  3  1522 ? 154.371 234.368 249.934 1.00 0.00 ? 1522 PRO C CA 1 
ATOM 2024 C CA . LEU C  3  1523 ? 154.943 231.922 252.781 1.00 0.00 ? 1523 LEU C CA 1 
ATOM 2025 C CA . GLU C  3  1524 ? 158.101 231.207 254.774 1.00 0.00 ? 1524 GLU C CA 1 
ATOM 2026 C CA . LEU C  3  1525 ? 157.839 227.695 256.178 1.00 0.00 ? 1525 LEU C CA 1 
ATOM 2027 C CA . HIS C  3  1526 ? 160.189 226.326 258.822 1.00 0.00 ? 1526 HIS C CA 1 
ATOM 2028 C CA . ILE C  3  1527 ? 160.175 222.856 260.401 1.00 0.00 ? 1527 ILE C CA 1 
ATOM 2029 C CA . GLN C  3  1528 ? 161.645 222.207 263.857 1.00 0.00 ? 1528 GLN C CA 1 
ATOM 2030 C CA . GLY C  3  1529 ? 162.659 218.663 264.761 1.00 0.00 ? 1529 GLY C CA 1 
ATOM 2031 C CA . PHE C  3  1530 ? 162.606 217.540 268.388 1.00 0.00 ? 1530 PHE C CA 1 
ATOM 2032 C CA . ASN C  3  1531 ? 164.261 214.241 269.287 1.00 0.00 ? 1531 ASN C CA 1 
ATOM 2033 C CA . ILE C  3  1532 ? 162.236 213.577 272.416 1.00 0.00 ? 1532 ILE C CA 1 
ATOM 2034 C CA . SER C  3  1533 ? 159.735 210.776 271.755 1.00 0.00 ? 1533 SER C CA 1 
ATOM 2035 C CA . HIS C  3  1534 ? 157.937 210.922 275.076 1.00 0.00 ? 1534 HIS C CA 1 
ATOM 2036 C CA . THR C  3  1535 ? 155.208 213.411 274.293 1.00 0.00 ? 1535 THR C CA 1 
ATOM 2037 C CA . GLN C  3  1536 ? 154.934 215.246 277.574 1.00 0.00 ? 1536 GLN C CA 1 
ATOM 2038 C CA . THR C  3  1537 ? 158.652 215.953 277.676 1.00 0.00 ? 1537 THR C CA 1 
ATOM 2039 C CA . ARG C  3  1538 ? 158.650 216.956 274.007 1.00 0.00 ? 1538 ARG C CA 1 
ATOM 2040 C CA . LEU C  3  1539 ? 155.663 219.248 274.349 1.00 0.00 ? 1539 LEU C CA 1 
ATOM 2041 C CA . LEU C  3  1540 ? 157.195 220.846 277.425 1.00 0.00 ? 1540 LEU C CA 1 
ATOM 2042 C CA . SER C  3  1541 ? 160.588 221.324 275.866 1.00 0.00 ? 1541 SER C CA 1 
ATOM 2043 C CA . MET C  3  1542 ? 159.117 223.188 272.943 1.00 0.00 ? 1542 MET C CA 1 
ATOM 2044 C CA . ALA C  3  1543 ? 157.711 225.860 275.287 1.00 0.00 ? 1543 ALA C CA 1 
ATOM 2045 C CA . LYS C  3  1544 ? 160.682 228.228 275.155 1.00 0.00 ? 1544 LYS C CA 1 
ATOM 2046 C CA . PRO C  3  1545 ? 161.125 227.767 271.364 1.00 0.00 ? 1545 PRO C CA 1 
ATOM 2047 C CA . VAL C  3  1546 ? 157.573 229.079 270.913 1.00 0.00 ? 1546 VAL C CA 1 
ATOM 2048 C CA . TYR C  3  1547 ? 158.432 232.402 272.503 1.00 0.00 ? 1547 TYR C CA 1 
ATOM 2049 C CA . HIS C  3  1548 ? 161.678 232.547 270.540 1.00 0.00 ? 1548 HIS C CA 1 
ATOM 2050 C CA . ALA C  3  1549 ? 159.853 231.740 267.313 1.00 0.00 ? 1549 ALA C CA 1 
ATOM 2051 C CA . ILE C  3  1550 ? 157.681 234.790 267.947 1.00 0.00 ? 1550 ILE C CA 1 
ATOM 2052 C CA . THR C  3  1551 ? 160.553 237.133 268.865 1.00 0.00 ? 1551 THR C CA 1 
ATOM 2053 C CA . LYS C  3  1552 ? 162.366 235.987 265.740 1.00 0.00 ? 1552 LYS C CA 1 
ATOM 2054 C CA . HIS C  3  1553 ? 159.894 235.556 262.936 1.00 0.00 ? 1553 HIS C CA 1 
ATOM 2055 C CA . SER C  3  1554 ? 157.088 237.919 263.992 1.00 0.00 ? 1554 SER C CA 1 
ATOM 2056 C CA . PRO C  3  1555 ? 157.998 240.132 266.943 1.00 0.00 ? 1555 PRO C CA 1 
ATOM 2057 C CA . LYS C  3  1556 ? 155.418 242.908 266.441 1.00 0.00 ? 1556 LYS C CA 1 
ATOM 2058 C CA . LYS C  3  1557 ? 152.790 241.134 264.297 1.00 0.00 ? 1557 LYS C CA 1 
ATOM 2059 C CA . PRO C  3  1558 ? 149.744 238.877 265.053 1.00 0.00 ? 1558 PRO C CA 1 
ATOM 2060 C CA . VAL C  3  1559 ? 150.532 235.281 266.029 1.00 0.00 ? 1559 VAL C CA 1 
ATOM 2061 C CA . ILE C  3  1560 ? 148.404 232.126 266.268 1.00 0.00 ? 1560 ILE C CA 1 
ATOM 2062 C CA . VAL C  3  1561 ? 149.586 229.020 268.110 1.00 0.00 ? 1561 VAL C CA 1 
ATOM 2063 C CA . PHE C  3  1562 ? 147.875 225.652 267.541 1.00 0.00 ? 1562 PHE C CA 1 
ATOM 2064 C CA . VAL C  3  1563 ? 148.076 223.004 270.272 1.00 0.00 ? 1563 VAL C CA 1 
ATOM 2065 C CA . PRO C  3  1564 ? 147.302 219.254 270.658 1.00 0.00 ? 1564 PRO C CA 1 
ATOM 2066 C CA . SER C  3  1565 ? 144.991 219.571 273.668 1.00 0.00 ? 1565 SER C CA 1 
ATOM 2067 C CA . ARG C  3  1566 ? 141.870 221.406 274.803 1.00 0.00 ? 1566 ARG C CA 1 
ATOM 2068 C CA . LYS C  3  1567 ? 143.573 222.275 278.066 1.00 0.00 ? 1567 LYS C CA 1 
ATOM 2069 C CA . GLN C  3  1568 ? 147.042 222.754 276.562 1.00 0.00 ? 1568 GLN C CA 1 
ATOM 2070 C CA . THR C  3  1569 ? 145.877 226.129 275.253 1.00 0.00 ? 1569 THR C CA 1 
ATOM 2071 C CA . ARG C  3  1570 ? 145.645 227.647 278.746 1.00 0.00 ? 1570 ARG C CA 1 
ATOM 2072 C CA . LEU C  3  1571 ? 148.981 226.229 279.849 1.00 0.00 ? 1571 LEU C CA 1 
ATOM 2073 C CA . THR C  3  1572 ? 150.769 227.454 276.722 1.00 0.00 ? 1572 THR C CA 1 
ATOM 2074 C CA . ALA C  3  1573 ? 149.287 230.961 277.082 1.00 0.00 ? 1573 ALA C CA 1 
ATOM 2075 C CA . ILE C  3  1574 ? 150.579 230.950 280.660 1.00 0.00 ? 1574 ILE C CA 1 
ATOM 2076 C CA . ASP C  3  1575 ? 154.052 229.720 279.693 1.00 0.00 ? 1575 ASP C CA 1 
ATOM 2077 C CA . ILE C  3  1576 ? 154.213 232.346 276.950 1.00 0.00 ? 1576 ILE C CA 1 
ATOM 2078 C CA . LEU C  3  1577 ? 153.543 234.904 279.674 1.00 0.00 ? 1577 LEU C CA 1 
ATOM 2079 C CA . THR C  3  1578 ? 155.968 233.484 282.268 1.00 0.00 ? 1578 THR C CA 1 
ATOM 2080 C CA . THR C  3  1579 ? 158.866 233.319 279.815 1.00 0.00 ? 1579 THR C CA 1 
ATOM 2081 C CA . CYS C  3  1580 ? 157.699 236.746 278.650 1.00 0.00 ? 1580 CYS C CA 1 
ATOM 2082 C CA . ALA C  3  1581 ? 158.888 238.058 282.026 1.00 0.00 ? 1581 ALA C CA 1 
ATOM 2083 C CA . ALA C  3  1582 ? 162.322 236.464 281.464 1.00 0.00 ? 1582 ALA C CA 1 
ATOM 2084 C CA . ASP C  3  1583 ? 163.061 238.847 278.586 1.00 0.00 ? 1583 ASP C CA 1 
ATOM 2085 C CA . ILE C  3  1584 ? 162.712 241.646 281.171 1.00 0.00 ? 1584 ILE C CA 1 
ATOM 2086 C CA . GLN C  3  1585 ? 159.904 242.604 278.746 1.00 0.00 ? 1585 GLN C CA 1 
ATOM 2087 C CA . ARG C  3  1586 ? 156.433 242.435 280.327 1.00 0.00 ? 1586 ARG C CA 1 
ATOM 2088 C CA . GLN C  3  1587 ? 153.091 242.669 278.490 1.00 0.00 ? 1587 GLN C CA 1 
ATOM 2089 C CA . ARG C  3  1588 ? 154.720 243.136 275.092 1.00 0.00 ? 1588 ARG C CA 1 
ATOM 2090 C CA . PHE C  3  1589 ? 151.782 241.535 273.322 1.00 0.00 ? 1589 PHE C CA 1 
ATOM 2091 C CA . LEU C  3  1590 ? 149.225 244.029 274.589 1.00 0.00 ? 1590 LEU C CA 1 
ATOM 2092 C CA . HIS C  3  1591 ? 148.774 246.985 272.242 1.00 0.00 ? 1591 HIS C CA 1 
ATOM 2093 C CA . CYS C  3  1592 ? 146.195 248.923 274.289 1.00 0.00 ? 1592 CYS C CA 1 
ATOM 2094 C CA . THR C  3  1593 ? 146.001 250.169 277.883 1.00 0.00 ? 1593 THR C CA 1 
ATOM 2095 C CA . GLU C  3  1594 ? 144.278 248.092 280.581 1.00 0.00 ? 1594 GLU C CA 1 
ATOM 2096 C CA . LYS C  3  1595 ? 141.452 250.642 280.821 1.00 0.00 ? 1595 LYS C CA 1 
ATOM 2097 C CA . ASP C  3  1596 ? 140.308 249.732 277.298 1.00 0.00 ? 1596 ASP C CA 1 
ATOM 2098 C CA . LEU C  3  1597 ? 140.037 245.972 277.911 1.00 0.00 ? 1597 LEU C CA 1 
ATOM 2099 C CA . ILE C  3  1598 ? 137.731 246.327 280.912 1.00 0.00 ? 1598 ILE C CA 1 
ATOM 2100 C CA . PRO C  3  1599 ? 134.511 246.522 278.822 1.00 0.00 ? 1599 PRO C CA 1 
ATOM 2101 C CA . TYR C  3  1600 ? 135.498 243.205 277.225 1.00 0.00 ? 1600 TYR C CA 1 
ATOM 2102 C CA . LEU C  3  1601 ? 136.601 241.472 280.433 1.00 0.00 ? 1601 LEU C CA 1 
ATOM 2103 C CA . GLU C  3  1602 ? 133.230 242.118 282.149 1.00 0.00 ? 1602 GLU C CA 1 
ATOM 2104 C CA . LYS C  3  1603 ? 131.767 239.340 280.000 1.00 0.00 ? 1603 LYS C CA 1 
ATOM 2105 C CA . LEU C  3  1604 ? 134.104 236.616 281.254 1.00 0.00 ? 1604 LEU C CA 1 
ATOM 2106 C CA . SER C  3  1605 ? 133.645 233.521 283.422 1.00 0.00 ? 1605 SER C CA 1 
ATOM 2107 C CA . ASP C  3  1606 ? 137.093 231.913 283.134 1.00 0.00 ? 1606 ASP C CA 1 
ATOM 2108 C CA . SER C  3  1607 ? 139.373 233.601 285.671 1.00 0.00 ? 1607 SER C CA 1 
ATOM 2109 C CA . THR C  3  1608 ? 142.721 232.635 284.146 1.00 0.00 ? 1608 THR C CA 1 
ATOM 2110 C CA . LEU C  3  1609 ? 141.540 233.832 280.740 1.00 0.00 ? 1609 LEU C CA 1 
ATOM 2111 C CA . LYS C  3  1610 ? 141.112 237.271 282.288 1.00 0.00 ? 1610 LYS C CA 1 
ATOM 2112 C CA . GLU C  3  1611 ? 144.800 237.195 283.272 1.00 0.00 ? 1611 GLU C CA 1 
ATOM 2113 C CA . THR C  3  1612 ? 146.172 235.844 280.002 1.00 0.00 ? 1612 THR C CA 1 
ATOM 2114 C CA . LEU C  3  1613 ? 144.104 238.427 278.127 1.00 0.00 ? 1613 LEU C CA 1 
ATOM 2115 C CA . LEU C  3  1614 ? 145.338 241.175 280.441 1.00 0.00 ? 1614 LEU C CA 1 
ATOM 2116 C CA . ASN C  3  1615 ? 148.899 240.616 279.221 1.00 0.00 ? 1615 ASN C CA 1 
ATOM 2117 C CA . GLY C  3  1616 ? 147.887 240.317 275.577 1.00 0.00 ? 1616 GLY C CA 1 
ATOM 2118 C CA . VAL C  3  1617 ? 147.490 236.594 275.021 1.00 0.00 ? 1617 VAL C CA 1 
ATOM 2119 C CA . GLY C  3  1618 ? 144.159 234.811 275.555 1.00 0.00 ? 1618 GLY C CA 1 
ATOM 2120 C CA . TYR C  3  1619 ? 143.092 231.420 274.196 1.00 0.00 ? 1619 TYR C CA 1 
ATOM 2121 C CA . LEU C  3  1620 ? 140.270 229.607 272.332 1.00 0.00 ? 1620 LEU C CA 1 
ATOM 2122 C CA . HIS C  3  1621 ? 138.858 226.118 272.866 1.00 0.00 ? 1621 HIS C CA 1 
ATOM 2123 C CA . GLU C  3  1622 ? 135.878 223.733 273.107 1.00 0.00 ? 1622 GLU C CA 1 
ATOM 2124 C CA . GLY C  3  1623 ? 134.646 224.835 276.521 1.00 0.00 ? 1623 GLY C CA 1 
ATOM 2125 C CA . LEU C  3  1624 ? 134.556 228.600 275.960 1.00 0.00 ? 1624 LEU C CA 1 
ATOM 2126 C CA . SER C  3  1625 ? 131.170 230.299 275.633 1.00 0.00 ? 1625 SER C CA 1 
ATOM 2127 C CA . PRO C  3  1626 ? 130.596 231.588 272.071 1.00 0.00 ? 1626 PRO C CA 1 
ATOM 2128 C CA . MET C  3  1627 ? 130.586 235.100 273.503 1.00 0.00 ? 1627 MET C CA 1 
ATOM 2129 C CA . GLU C  3  1628 ? 133.996 234.547 275.096 1.00 0.00 ? 1628 GLU C CA 1 
ATOM 2130 C CA . ARG C  3  1629 ? 135.328 233.257 271.771 1.00 0.00 ? 1629 ARG C CA 1 
ATOM 2131 C CA . ARG C  3  1630 ? 133.794 236.105 269.745 1.00 0.00 ? 1630 ARG C CA 1 
ATOM 2132 C CA . LEU C  3  1631 ? 135.370 238.541 272.196 1.00 0.00 ? 1631 LEU C CA 1 
ATOM 2133 C CA . VAL C  3  1632 ? 138.861 237.021 271.950 1.00 0.00 ? 1632 VAL C CA 1 
ATOM 2134 C CA . GLU C  3  1633 ? 138.614 236.966 268.147 1.00 0.00 ? 1633 GLU C CA 1 
ATOM 2135 C CA . GLN C  3  1634 ? 137.522 240.626 268.170 1.00 0.00 ? 1634 GLN C CA 1 
ATOM 2136 C CA . LEU C  3  1635 ? 140.422 241.638 270.409 1.00 0.00 ? 1635 LEU C CA 1 
ATOM 2137 C CA . PHE C  3  1636 ? 142.864 239.805 268.167 1.00 0.00 ? 1636 PHE C CA 1 
ATOM 2138 C CA . SER C  3  1637 ? 141.679 241.081 264.788 1.00 0.00 ? 1637 SER C CA 1 
ATOM 2139 C CA . SER C  3  1638 ? 141.252 244.644 266.053 1.00 0.00 ? 1638 SER C CA 1 
ATOM 2140 C CA . GLY C  3  1639 ? 144.912 244.443 267.064 1.00 0.00 ? 1639 GLY C CA 1 
ATOM 2141 C CA . ALA C  3  1640 ? 144.583 244.719 270.846 1.00 0.00 ? 1640 ALA C CA 1 
ATOM 2142 C CA . ILE C  3  1641 ? 146.167 241.353 271.660 1.00 0.00 ? 1641 ILE C CA 1 
ATOM 2143 C CA . GLN C  3  1642 ? 149.124 240.170 269.595 1.00 0.00 ? 1642 GLN C CA 1 
ATOM 2144 C CA . VAL C  3  1643 ? 149.042 236.418 270.329 1.00 0.00 ? 1643 VAL C CA 1 
ATOM 2145 C CA . VAL C  3  1644 ? 146.280 233.777 270.605 1.00 0.00 ? 1644 VAL C CA 1 
ATOM 2146 C CA . VAL C  3  1645 ? 146.781 230.148 271.583 1.00 0.00 ? 1645 VAL C CA 1 
ATOM 2147 C CA . ALA C  3  1646 ? 144.128 227.904 270.018 1.00 0.00 ? 1646 ALA C CA 1 
ATOM 2148 C CA . SER C  3  1647 ? 143.035 224.279 270.272 1.00 0.00 ? 1647 SER C CA 1 
ATOM 2149 C CA . ARG C  3  1648 ? 143.683 222.244 267.144 1.00 0.00 ? 1648 ARG C CA 1 
ATOM 2150 C CA . SER C  3  1649 ? 139.989 221.512 266.668 1.00 0.00 ? 1649 SER C CA 1 
ATOM 2151 C CA . LEU C  3  1650 ? 139.454 225.201 265.964 1.00 0.00 ? 1650 LEU C CA 1 
ATOM 2152 C CA . CYS C  3  1651 ? 141.743 225.277 262.923 1.00 0.00 ? 1651 CYS C CA 1 
ATOM 2153 C CA . TRP C  3  1652 ? 138.782 224.714 260.617 1.00 0.00 ? 1652 TRP C CA 1 
ATOM 2154 C CA . GLY C  3  1653 ? 136.108 227.022 261.962 1.00 0.00 ? 1653 GLY C CA 1 
ATOM 2155 C CA . MET C  3  1654 ? 138.283 230.022 262.794 1.00 0.00 ? 1654 MET C CA 1 
ATOM 2156 C CA . ASN C  3  1655 ? 137.487 233.323 261.077 1.00 0.00 ? 1655 ASN C CA 1 
ATOM 2157 C CA . VAL C  3  1656 ? 140.498 235.293 262.307 1.00 0.00 ? 1656 VAL C CA 1 
ATOM 2158 C CA . ALA C  3  1657 ? 143.870 235.097 260.508 1.00 0.00 ? 1657 ALA C CA 1 
ATOM 2159 C CA . ALA C  3  1658 ? 147.465 235.999 261.455 1.00 0.00 ? 1658 ALA C CA 1 
ATOM 2160 C CA . HIS C  3  1659 ? 151.055 236.788 260.390 1.00 0.00 ? 1659 HIS C CA 1 
ATOM 2161 C CA . LEU C  3  1660 ? 153.025 233.996 262.065 1.00 0.00 ? 1660 LEU C CA 1 
ATOM 2162 C CA . VAL C  3  1661 ? 151.566 230.574 262.799 1.00 0.00 ? 1661 VAL C CA 1 
ATOM 2163 C CA . ILE C  3  1662 ? 153.347 228.155 265.115 1.00 0.00 ? 1662 ILE C CA 1 
ATOM 2164 C CA . ILE C  3  1663 ? 152.152 224.562 265.139 1.00 0.00 ? 1663 ILE C CA 1 
ATOM 2165 C CA . MET C  3  1664 ? 153.189 222.873 268.365 1.00 0.00 ? 1664 MET C CA 1 
ATOM 2166 C CA . ASP C  3  1665 ? 153.632 219.089 268.387 1.00 0.00 ? 1665 ASP C CA 1 
ATOM 2167 C CA . THR C  3  1666 ? 151.695 217.538 265.450 1.00 0.00 ? 1666 THR C CA 1 
ATOM 2168 C CA . GLN C  3  1667 ? 150.521 214.358 267.345 1.00 0.00 ? 1667 GLN C CA 1 
ATOM 2169 C CA . TYR C  3  1668 ? 147.402 213.959 269.528 1.00 0.00 ? 1668 TYR C CA 1 
ATOM 2170 C CA . TYR C  3  1669 ? 146.139 211.399 272.086 1.00 0.00 ? 1669 TYR C CA 1 
ATOM 2171 C CA . ASN C  3  1670 ? 143.635 208.623 271.332 1.00 0.00 ? 1670 ASN C CA 1 
ATOM 2172 C CA . GLY C  3  1671 ? 142.254 206.622 274.220 1.00 0.00 ? 1671 GLY C CA 1 
ATOM 2173 C CA . LYS C  3  1672 ? 140.840 203.863 272.053 1.00 0.00 ? 1672 LYS C CA 1 
ATOM 2174 C CA . ILE C  3  1673 ? 144.180 202.244 271.136 1.00 0.00 ? 1673 ILE C CA 1 
ATOM 2175 C CA . HIS C  3  1674 ? 145.999 204.140 273.886 1.00 0.00 ? 1674 HIS C CA 1 
ATOM 2176 C CA . ALA C  3  1675 ? 148.545 205.838 271.603 1.00 0.00 ? 1675 ALA C CA 1 
ATOM 2177 C CA . TYR C  3  1676 ? 149.329 209.180 269.983 1.00 0.00 ? 1676 TYR C CA 1 
ATOM 2178 C CA . VAL C  3  1677 ? 148.420 209.702 266.306 1.00 0.00 ? 1677 VAL C CA 1 
ATOM 2179 C CA . ASP C  3  1678 ? 149.644 212.330 263.822 1.00 0.00 ? 1678 ASP C CA 1 
ATOM 2180 C CA . TYR C  3  1679 ? 147.642 215.343 262.689 1.00 0.00 ? 1679 TYR C CA 1 
ATOM 2181 C CA . PRO C  3  1680 ? 145.901 214.576 259.400 1.00 0.00 ? 1680 PRO C CA 1 
ATOM 2182 C CA . ILE C  3  1681 ? 147.966 216.318 256.733 1.00 0.00 ? 1681 ILE C CA 1 
ATOM 2183 C CA . TYR C  3  1682 ? 145.164 218.488 255.333 1.00 0.00 ? 1682 TYR C CA 1 
ATOM 2184 C CA . ASP C  3  1683 ? 144.569 219.829 258.820 1.00 0.00 ? 1683 ASP C CA 1 
ATOM 2185 C CA . VAL C  3  1684 ? 148.216 220.829 259.038 1.00 0.00 ? 1684 VAL C CA 1 
ATOM 2186 C CA . LEU C  3  1685 ? 147.968 222.515 255.674 1.00 0.00 ? 1685 LEU C CA 1 
ATOM 2187 C CA . GLN C  3  1686 ? 144.890 224.416 256.901 1.00 0.00 ? 1686 GLN C CA 1 
ATOM 2188 C CA . MET C  3  1687 ? 146.668 225.616 260.052 1.00 0.00 ? 1687 MET C CA 1 
ATOM 2189 C CA . VAL C  3  1688 ? 149.508 226.744 257.798 1.00 0.00 ? 1688 VAL C CA 1 
ATOM 2190 C CA . GLY C  3  1689 ? 147.109 228.561 255.482 1.00 0.00 ? 1689 GLY C CA 1 
ATOM 2191 C CA . HIS C  3  1690 ? 145.925 230.438 258.548 1.00 0.00 ? 1690 HIS C CA 1 
ATOM 2192 C CA . ALA C  3  1691 ? 148.944 232.678 258.184 1.00 0.00 ? 1691 ALA C CA 1 
ATOM 2193 C CA . ASN C  3  1692 ? 147.703 234.962 255.447 1.00 0.00 ? 1692 ASN C CA 1 
ATOM 2194 C CA . ARG C  3  1693 ? 147.203 238.742 255.613 1.00 0.00 ? 1693 ARG C CA 1 
ATOM 2195 C CA . PRO C  3  1694 ? 147.035 239.914 251.977 1.00 0.00 ? 1694 PRO C CA 1 
ATOM 2196 C CA . LEU C  3  1695 ? 145.640 243.288 252.872 1.00 0.00 ? 1695 LEU C CA 1 
ATOM 2197 C CA . GLN C  3  1696 ? 148.869 244.329 254.626 1.00 0.00 ? 1696 GLN C CA 1 
ATOM 2198 C CA . ASP C  3  1697 ? 151.759 241.818 254.933 1.00 0.00 ? 1697 ASP C CA 1 
ATOM 2199 C CA . ASP C  3  1698 ? 154.257 241.115 252.137 1.00 0.00 ? 1698 ASP C CA 1 
ATOM 2200 C CA . GLU C  3  1699 ? 154.936 237.695 253.651 1.00 0.00 ? 1699 GLU C CA 1 
ATOM 2201 C CA . GLY C  3  1700 ? 153.486 235.176 256.064 1.00 0.00 ? 1700 GLY C CA 1 
ATOM 2202 C CA . ARG C  3  1701 ? 155.322 232.807 258.342 1.00 0.00 ? 1701 ARG C CA 1 
ATOM 2203 C CA . CYS C  3  1702 ? 154.954 229.382 259.866 1.00 0.00 ? 1702 CYS C CA 1 
ATOM 2204 C CA . VAL C  3  1703 ? 157.004 227.297 262.283 1.00 0.00 ? 1703 VAL C CA 1 
ATOM 2205 C CA . ILE C  3  1704 ? 156.044 223.668 262.744 1.00 0.00 ? 1704 ILE C CA 1 
ATOM 2206 C CA . MET C  3  1705 ? 157.547 221.995 265.782 1.00 0.00 ? 1705 MET C CA 1 
ATOM 2207 C CA . CYS C  3  1706 ? 157.292 218.233 265.521 1.00 0.00 ? 1706 CYS C CA 1 
ATOM 2208 C CA . GLN C  3  1707 ? 158.940 214.955 266.476 1.00 0.00 ? 1707 GLN C CA 1 
ATOM 2209 C CA . GLY C  3  1708 ? 162.107 213.591 264.878 1.00 0.00 ? 1708 GLY C CA 1 
ATOM 2210 C CA . SER C  3  1709 ? 160.184 210.912 263.007 1.00 0.00 ? 1709 SER C CA 1 
ATOM 2211 C CA . LYS C  3  1710 ? 157.695 213.290 261.568 1.00 0.00 ? 1710 LYS C CA 1 
ATOM 2212 C CA . LYS C  3  1711 ? 160.216 215.859 260.334 1.00 0.00 ? 1711 LYS C CA 1 
ATOM 2213 C CA . ASP C  3  1712 ? 161.086 214.494 256.921 1.00 0.00 ? 1712 ASP C CA 1 
ATOM 2214 C CA . PHE C  3  1713 ? 157.465 213.797 256.084 1.00 0.00 ? 1713 PHE C CA 1 
ATOM 2215 C CA . PHE C  3  1714 ? 156.554 217.451 256.449 1.00 0.00 ? 1714 PHE C CA 1 
ATOM 2216 C CA . LYS C  3  1715 ? 159.724 218.562 254.665 1.00 0.00 ? 1715 LYS C CA 1 
ATOM 2217 C CA . LYS C  3  1716 ? 158.543 216.523 251.675 1.00 0.00 ? 1716 LYS C CA 1 
ATOM 2218 C CA . PHE C  3  1717 ? 154.793 217.074 251.561 1.00 0.00 ? 1717 PHE C CA 1 
ATOM 2219 C CA . LEU C  3  1718 ? 154.175 220.661 252.637 1.00 0.00 ? 1718 LEU C CA 1 
ATOM 2220 C CA . TYR C  3  1719 ? 156.095 222.081 249.681 1.00 0.00 ? 1719 TYR C CA 1 
ATOM 2221 C CA . GLU C  3  1720 ? 155.056 219.732 246.863 1.00 0.00 ? 1720 GLU C CA 1 
ATOM 2222 C CA . PRO C  3  1721 ? 151.560 219.591 245.454 1.00 0.00 ? 1721 PRO C CA 1 
ATOM 2223 C CA . LEU C  3  1722 ? 149.572 216.808 247.132 1.00 0.00 ? 1722 LEU C CA 1 
ATOM 2224 C CA . PRO C  3  1723 ? 148.404 213.472 245.686 1.00 0.00 ? 1723 PRO C CA 1 
ATOM 2225 C CA . VAL C  3  1724 ? 144.781 212.400 246.408 1.00 0.00 ? 1724 VAL C CA 1 
ATOM 2226 C CA . GLU C  3  1725 ? 143.400 208.885 246.288 1.00 0.00 ? 1725 GLU C CA 1 
ATOM 2227 C CA . SER C  3  1726 ? 139.917 207.407 246.551 1.00 0.00 ? 1726 SER C CA 1 
ATOM 2228 C CA . HIS C  3  1727 ? 138.629 205.628 249.622 1.00 0.00 ? 1727 HIS C CA 1 
ATOM 2229 C CA . LEU C  3  1728 ? 135.331 204.409 248.187 1.00 0.00 ? 1728 LEU C CA 1 
ATOM 2230 C CA . ASP C  3  1729 ? 136.718 200.912 247.828 1.00 0.00 ? 1729 ASP C CA 1 
ATOM 2231 C CA . HIS C  3  1730 ? 136.631 200.607 251.617 1.00 0.00 ? 1730 HIS C CA 1 
ATOM 2232 C CA . CYS C  3  1731 ? 133.431 202.430 252.455 1.00 0.00 ? 1731 CYS C CA 1 
ATOM 2233 C CA . MET C  3  1732 ? 131.238 200.794 249.841 1.00 0.00 ? 1732 MET C CA 1 
ATOM 2234 C CA . HIS C  3  1733 ? 128.291 198.729 251.106 1.00 0.00 ? 1733 HIS C CA 1 
ATOM 2235 C CA . ASP C  3  1734 ? 126.223 201.614 252.439 1.00 0.00 ? 1734 ASP C CA 1 
ATOM 2236 C CA . HIS C  3  1735 ? 125.993 203.248 249.013 1.00 0.00 ? 1735 HIS C CA 1 
ATOM 2237 C CA . PHE C  3  1736 ? 125.394 200.111 246.989 1.00 0.00 ? 1736 PHE C CA 1 
ATOM 2238 C CA . ASN C  3  1737 ? 122.620 199.329 249.413 1.00 0.00 ? 1737 ASN C CA 1 
ATOM 2239 C CA . ALA C  3  1738 ? 121.066 202.793 249.220 1.00 0.00 ? 1738 ALA C CA 1 
ATOM 2240 C CA . GLU C  3  1739 ? 121.440 202.864 245.446 1.00 0.00 ? 1739 GLU C CA 1 
ATOM 2241 C CA . ILE C  3  1740 ? 119.898 199.416 245.003 1.00 0.00 ? 1740 ILE C CA 1 
ATOM 2242 C CA . VAL C  3  1741 ? 117.004 200.749 247.082 1.00 0.00 ? 1741 VAL C CA 1 
ATOM 2243 C CA . THR C  3  1742 ? 116.471 203.592 244.548 1.00 0.00 ? 1742 THR C CA 1 
ATOM 2244 C CA . LYS C  3  1743 ? 116.676 200.976 241.824 1.00 0.00 ? 1743 LYS C CA 1 
ATOM 2245 C CA . THR C  3  1744 ? 119.719 202.790 240.444 1.00 0.00 ? 1744 THR C CA 1 
ATOM 2246 C CA . ILE C  3  1745 ? 121.430 199.454 240.714 1.00 0.00 ? 1745 ILE C CA 1 
ATOM 2247 C CA . GLU C  3  1746 ? 118.952 196.874 239.501 1.00 0.00 ? 1746 GLU C CA 1 
ATOM 2248 C CA . ASN C  3  1747 ? 121.497 194.108 238.924 1.00 0.00 ? 1747 ASN C CA 1 
ATOM 2249 C CA . LYS C  3  1748 ? 125.232 193.394 239.158 1.00 0.00 ? 1748 LYS C CA 1 
ATOM 2250 C CA . GLN C  3  1749 ? 125.887 195.062 235.806 1.00 0.00 ? 1749 GLN C CA 1 
ATOM 2251 C CA . ASP C  3  1750 ? 124.342 198.335 236.922 1.00 0.00 ? 1750 ASP C CA 1 
ATOM 2252 C CA . ALA C  3  1751 ? 126.712 198.030 239.907 1.00 0.00 ? 1751 ALA C CA 1 
ATOM 2253 C CA . VAL C  3  1752 ? 129.857 197.924 237.775 1.00 0.00 ? 1752 VAL C CA 1 
ATOM 2254 C CA . ASP C  3  1753 ? 128.545 200.724 235.627 1.00 0.00 ? 1753 ASP C CA 1 
ATOM 2255 C CA . TYR C  3  1754 ? 127.880 202.804 238.755 1.00 0.00 ? 1754 TYR C CA 1 
ATOM 2256 C CA . LEU C  3  1755 ? 131.470 202.148 239.747 1.00 0.00 ? 1755 LEU C CA 1 
ATOM 2257 C CA . THR C  3  1756 ? 132.695 203.652 236.492 1.00 0.00 ? 1756 THR C CA 1 
ATOM 2258 C CA . TRP C  3  1757 ? 131.242 207.050 237.460 1.00 0.00 ? 1757 TRP C CA 1 
ATOM 2259 C CA . THR C  3  1758 ? 133.533 207.410 240.434 1.00 0.00 ? 1758 THR C CA 1 
ATOM 2260 C CA . PHE C  3  1759 ? 136.928 208.869 241.230 1.00 0.00 ? 1759 PHE C CA 1 
ATOM 2261 C CA . LEU C  3  1760 ? 138.003 205.434 242.373 1.00 0.00 ? 1760 LEU C CA 1 
ATOM 2262 C CA . TYR C  3  1761 ? 137.532 204.198 238.807 1.00 0.00 ? 1761 TYR C CA 1 
ATOM 2263 C CA . ARG C  3  1762 ? 139.825 206.982 237.715 1.00 0.00 ? 1762 ARG C CA 1 
ATOM 2264 C CA . ARG C  3  1763 ? 142.586 206.344 240.224 1.00 0.00 ? 1763 ARG C CA 1 
ATOM 2265 C CA . MET C  3  1764 ? 142.671 202.552 240.199 1.00 0.00 ? 1764 MET C CA 1 
ATOM 2266 C CA . THR C  3  1765 ? 144.694 202.294 237.017 1.00 0.00 ? 1765 THR C CA 1 
ATOM 2267 C CA . GLN C  3  1766 ? 146.810 205.297 237.972 1.00 0.00 ? 1766 GLN C CA 1 
ATOM 2268 C CA . ASN C  3  1767 ? 148.290 203.799 241.095 1.00 0.00 ? 1767 ASN C CA 1 
ATOM 2269 C CA . PRO C  3  1768 ? 147.108 200.213 241.218 1.00 0.00 ? 1768 PRO C CA 1 
ATOM 2270 C CA . ASN C  3  1769 ? 149.288 199.056 244.089 1.00 0.00 ? 1769 ASN C CA 1 
ATOM 2271 C CA . TYR C  3  1770 ? 147.459 201.406 246.433 1.00 0.00 ? 1770 TYR C CA 1 
ATOM 2272 C CA . TYR C  3  1771 ? 144.116 199.754 245.771 1.00 0.00 ? 1771 TYR C CA 1 
ATOM 2273 C CA . ASN C  3  1772 ? 145.779 196.338 245.868 1.00 0.00 ? 1772 ASN C CA 1 
ATOM 2274 C CA . LEU C  3  1773 ? 145.157 195.920 242.200 1.00 0.00 ? 1773 LEU C CA 1 
ATOM 2275 C CA . GLN C  3  1774 ? 148.017 193.896 240.813 1.00 0.00 ? 1774 GLN C CA 1 
ATOM 2276 C CA . GLY C  3  1775 ? 148.222 195.037 237.187 1.00 0.00 ? 1775 GLY C CA 1 
ATOM 2277 C CA . ILE C  3  1776 ? 147.578 198.101 235.084 1.00 0.00 ? 1776 ILE C CA 1 
ATOM 2278 C CA . SER C  3  1777 ? 145.927 196.116 232.291 1.00 0.00 ? 1777 SER C CA 1 
ATOM 2279 C CA . HIS C  3  1778 ? 142.342 196.097 231.022 1.00 0.00 ? 1778 HIS C CA 1 
ATOM 2280 C CA . ARG C  3  1779 ? 141.192 192.727 232.270 1.00 0.00 ? 1779 ARG C CA 1 
ATOM 2281 C CA . HIS C  3  1780 ? 143.146 193.577 235.419 1.00 0.00 ? 1780 HIS C CA 1 
ATOM 2282 C CA . LEU C  3  1781 ? 141.003 196.535 236.205 1.00 0.00 ? 1781 LEU C CA 1 
ATOM 2283 C CA . SER C  3  1782 ? 137.909 194.770 234.905 1.00 0.00 ? 1782 SER C CA 1 
ATOM 2284 C CA . ASP C  3  1783 ? 138.465 191.679 237.028 1.00 0.00 ? 1783 ASP C CA 1 
ATOM 2285 C CA . HIS C  3  1784 ? 139.136 194.003 239.929 1.00 0.00 ? 1784 HIS C CA 1 
ATOM 2286 C CA . LEU C  3  1785 ? 135.873 195.911 239.696 1.00 0.00 ? 1785 LEU C CA 1 
ATOM 2287 C CA . SER C  3  1786 ? 134.088 192.602 239.122 1.00 0.00 ? 1786 SER C CA 1 
ATOM 2288 C CA . GLU C  3  1787 ? 135.507 191.002 242.261 1.00 0.00 ? 1787 GLU C CA 1 
ATOM 2289 C CA . LEU C  3  1788 ? 134.517 194.229 243.962 1.00 0.00 ? 1788 LEU C CA 1 
ATOM 2290 C CA . VAL C  3  1789 ? 130.770 194.359 243.243 1.00 0.00 ? 1789 VAL C CA 1 
ATOM 2291 C CA . GLU C  3  1790 ? 130.834 190.605 243.740 1.00 0.00 ? 1790 GLU C CA 1 
ATOM 2292 C CA . GLN C  3  1791 ? 131.921 190.799 247.307 1.00 0.00 ? 1791 GLN C CA 1 
ATOM 2293 C CA . THR C  3  1792 ? 130.025 193.978 248.136 1.00 0.00 ? 1792 THR C CA 1 
ATOM 2294 C CA . LEU C  3  1793 ? 126.766 192.433 246.980 1.00 0.00 ? 1793 LEU C CA 1 
ATOM 2295 C CA . SER C  3  1794 ? 127.618 189.170 248.725 1.00 0.00 ? 1794 SER C CA 1 
ATOM 2296 C CA . ASP C  3  1795 ? 128.378 190.872 252.023 1.00 0.00 ? 1795 ASP C CA 1 
ATOM 2297 C CA . LEU C  3  1796 ? 125.210 192.883 251.570 1.00 0.00 ? 1796 LEU C CA 1 
ATOM 2298 C CA . GLU C  3  1797 ? 123.130 189.730 250.922 1.00 0.00 ? 1797 GLU C CA 1 
ATOM 2299 C CA . GLN C  3  1798 ? 124.647 187.886 253.871 1.00 0.00 ? 1798 GLN C CA 1 
ATOM 2300 C CA . SER C  3  1799 ? 123.399 190.744 256.016 1.00 0.00 ? 1799 SER C CA 1 
ATOM 2301 C CA . LYS C  3  1800 ? 119.906 190.370 254.577 1.00 0.00 ? 1800 LYS C CA 1 
ATOM 2302 C CA . CYS C  3  1801 ? 119.892 193.930 253.224 1.00 0.00 ? 1801 CYS C CA 1 
ATOM 2303 C CA . ILE C  3  1802 ? 119.391 192.661 249.656 1.00 0.00 ? 1802 ILE C CA 1 
ATOM 2304 C CA . SER C  3  1803 ? 118.384 189.564 247.702 1.00 0.00 ? 1803 SER C CA 1 
ATOM 2305 C CA . ILE C  3  1804 ? 120.446 188.286 244.792 1.00 0.00 ? 1804 ILE C CA 1 
ATOM 2306 C CA . GLU C  3  1805 ? 118.391 186.464 242.150 1.00 0.00 ? 1805 GLU C CA 1 
ATOM 2307 C CA . ASP C  3  1806 ? 119.719 184.028 239.518 1.00 0.00 ? 1806 ASP C CA 1 
ATOM 2308 C CA . GLU C  3  1807 ? 123.146 185.310 240.597 1.00 0.00 ? 1807 GLU C CA 1 
ATOM 2309 C CA . MET C  3  1808 ? 122.486 188.298 238.340 1.00 0.00 ? 1808 MET C CA 1 
ATOM 2310 C CA . ASP C  3  1809 ? 119.724 190.602 239.653 1.00 0.00 ? 1809 ASP C CA 1 
ATOM 2311 C CA . VAL C  3  1810 ? 119.347 192.392 242.998 1.00 0.00 ? 1810 VAL C CA 1 
ATOM 2312 C CA . ALA C  3  1811 ? 116.500 193.764 245.095 1.00 0.00 ? 1811 ALA C CA 1 
ATOM 2313 C CA . PRO C  3  1812 ? 116.365 195.662 248.397 1.00 0.00 ? 1812 PRO C CA 1 
ATOM 2314 C CA . LEU C  3  1813 ? 114.958 193.826 251.430 1.00 0.00 ? 1813 LEU C CA 1 
ATOM 2315 C CA . ASN C  3  1814 ? 113.393 194.999 254.707 1.00 0.00 ? 1814 ASN C CA 1 
ATOM 2316 C CA . LEU C  3  1815 ? 116.670 195.666 256.550 1.00 0.00 ? 1815 LEU C CA 1 
ATOM 2317 C CA . GLY C  3  1816 ? 118.407 197.507 253.709 1.00 0.00 ? 1816 GLY C CA 1 
ATOM 2318 C CA . MET C  3  1817 ? 115.228 199.509 253.150 1.00 0.00 ? 1817 MET C CA 1 
ATOM 2319 C CA . ILE C  3  1818 ? 115.297 200.702 256.762 1.00 0.00 ? 1818 ILE C CA 1 
ATOM 2320 C CA . ALA C  3  1819 ? 119.003 201.426 256.626 1.00 0.00 ? 1819 ALA C CA 1 
ATOM 2321 C CA . ALA C  3  1820 ? 118.719 203.481 253.454 1.00 0.00 ? 1820 ALA C CA 1 
ATOM 2322 C CA . TYR C  3  1821 ? 115.687 205.318 254.848 1.00 0.00 ? 1821 TYR C CA 1 
ATOM 2323 C CA . TYR C  3  1822 ? 117.258 206.535 258.080 1.00 0.00 ? 1822 TYR C CA 1 
ATOM 2324 C CA . TYR C  3  1823 ? 120.805 206.842 256.749 1.00 0.00 ? 1823 TYR C CA 1 
ATOM 2325 C CA . ILE C  3  1824 ? 122.294 204.330 259.170 1.00 0.00 ? 1824 ILE C CA 1 
ATOM 2326 C CA . ASN C  3  1825 ? 125.380 202.164 258.642 1.00 0.00 ? 1825 ASN C CA 1 
ATOM 2327 C CA . TYR C  3  1826 ? 124.412 198.724 257.380 1.00 0.00 ? 1826 TYR C CA 1 
ATOM 2328 C CA . THR C  3  1827 ? 126.454 196.782 259.968 1.00 0.00 ? 1827 THR C CA 1 
ATOM 2329 C CA . THR C  3  1828 ? 124.629 198.795 262.601 1.00 0.00 ? 1828 THR C CA 1 
ATOM 2330 C CA . ILE C  3  1829 ? 121.220 197.512 261.670 1.00 0.00 ? 1829 ILE C CA 1 
ATOM 2331 C CA . GLU C  3  1830 ? 122.604 194.030 261.135 1.00 0.00 ? 1830 GLU C CA 1 
ATOM 2332 C CA . LEU C  3  1831 ? 123.833 194.134 264.731 1.00 0.00 ? 1831 LEU C CA 1 
ATOM 2333 C CA . PHE C  3  1832 ? 120.335 195.309 265.562 1.00 0.00 ? 1832 PHE C CA 1 
ATOM 2334 C CA . SER C  3  1833 ? 118.990 192.340 263.623 1.00 0.00 ? 1833 SER C CA 1 
ATOM 2335 C CA . MET C  3  1834 ? 120.940 189.725 265.582 1.00 0.00 ? 1834 MET C CA 1 
ATOM 2336 C CA . SER C  3  1835 ? 120.516 191.571 268.906 1.00 0.00 ? 1835 SER C CA 1 
ATOM 2337 C CA . LEU C  3  1836 ? 116.894 192.690 269.408 1.00 0.00 ? 1836 LEU C CA 1 
ATOM 2338 C CA . ASN C  3  1837 ? 114.728 189.730 270.393 1.00 0.00 ? 1837 ASN C CA 1 
ATOM 2339 C CA . ALA C  3  1838 ? 111.152 189.086 271.507 1.00 0.00 ? 1838 ALA C CA 1 
ATOM 2340 C CA . LYS C  3  1839 ? 111.874 189.839 275.174 1.00 0.00 ? 1839 LYS C CA 1 
ATOM 2341 C CA . THR C  3  1840 ? 114.192 192.868 274.813 1.00 0.00 ? 1840 THR C CA 1 
ATOM 2342 C CA . LYS C  3  1841 ? 113.366 195.977 276.846 1.00 0.00 ? 1841 LYS C CA 1 
ATOM 2343 C CA . VAL C  3  1842 ? 114.851 199.428 277.549 1.00 0.00 ? 1842 VAL C CA 1 
ATOM 2344 C CA . ARG C  3  1843 ? 117.786 197.941 279.491 1.00 0.00 ? 1843 ARG C CA 1 
ATOM 2345 C CA . GLY C  3  1844 ? 118.778 196.006 276.391 1.00 0.00 ? 1844 GLY C CA 1 
ATOM 2346 C CA . LEU C  3  1845 ? 117.692 198.733 273.974 1.00 0.00 ? 1845 LEU C CA 1 
ATOM 2347 C CA . ILE C  3  1846 ? 120.148 201.102 275.655 1.00 0.00 ? 1846 ILE C CA 1 
ATOM 2348 C CA . GLU C  3  1847 ? 123.175 198.862 275.043 1.00 0.00 ? 1847 GLU C CA 1 
ATOM 2349 C CA . ILE C  3  1848 ? 122.019 197.668 271.601 1.00 0.00 ? 1848 ILE C CA 1 
ATOM 2350 C CA . ILE C  3  1849 ? 121.463 201.235 270.394 1.00 0.00 ? 1849 ILE C CA 1 
ATOM 2351 C CA . SER C  3  1850 ? 124.817 202.114 272.002 1.00 0.00 ? 1850 SER C CA 1 
ATOM 2352 C CA . ASN C  3  1851 ? 126.841 199.577 270.017 1.00 0.00 ? 1851 ASN C CA 1 
ATOM 2353 C CA . ALA C  3  1852 ? 125.642 201.325 266.859 1.00 0.00 ? 1852 ALA C CA 1 
ATOM 2354 C CA . ALA C  3  1853 ? 128.388 202.146 264.383 1.00 0.00 ? 1853 ALA C CA 1 
ATOM 2355 C CA . GLU C  3  1854 ? 127.673 205.899 264.350 1.00 0.00 ? 1854 GLU C CA 1 
ATOM 2356 C CA . TYR C  3  1855 ? 128.643 205.978 268.035 1.00 0.00 ? 1855 TYR C CA 1 
ATOM 2357 C CA . GLU C  3  1856 ? 132.167 204.661 267.510 1.00 0.00 ? 1856 GLU C CA 1 
ATOM 2358 C CA . ASN C  3  1857 ? 133.087 208.091 266.225 1.00 0.00 ? 1857 ASN C CA 1 
ATOM 2359 C CA . ILE C  3  1858 ? 132.935 209.077 269.885 1.00 0.00 ? 1858 ILE C CA 1 
ATOM 2360 C CA . PRO C  3  1859 ? 136.564 209.366 271.100 1.00 0.00 ? 1859 PRO C CA 1 
ATOM 2361 C CA . ILE C  3  1860 ? 138.385 208.696 274.382 1.00 0.00 ? 1860 ILE C CA 1 
ATOM 2362 C CA . ARG C  3  1861 ? 140.606 211.350 276.010 1.00 0.00 ? 1861 ARG C CA 1 
ATOM 2363 C CA . HIS C  3  1862 ? 143.645 211.381 278.351 1.00 0.00 ? 1862 HIS C CA 1 
ATOM 2364 C CA . HIS C  3  1863 ? 142.876 209.176 281.363 1.00 0.00 ? 1863 HIS C CA 1 
ATOM 2365 C CA . GLU C  3  1864 ? 139.176 208.616 280.613 1.00 0.00 ? 1864 GLU C CA 1 
ATOM 2366 C CA . ASP C  3  1865 ? 139.435 205.097 282.057 1.00 0.00 ? 1865 ASP C CA 1 
ATOM 2367 C CA . ASN C  3  1866 ? 138.965 206.353 285.634 1.00 0.00 ? 1866 ASN C CA 1 
ATOM 2368 C CA . LEU C  3  1867 ? 136.525 209.131 284.746 1.00 0.00 ? 1867 LEU C CA 1 
ATOM 2369 C CA . LEU C  3  1868 ? 133.868 206.910 283.123 1.00 0.00 ? 1868 LEU C CA 1 
ATOM 2370 C CA . ARG C  3  1869 ? 134.306 204.361 285.908 1.00 0.00 ? 1869 ARG C CA 1 
ATOM 2371 C CA . GLN C  3  1870 ? 133.469 207.027 288.453 1.00 0.00 ? 1870 GLN C CA 1 
ATOM 2372 C CA . LEU C  3  1871 ? 130.413 207.935 286.376 1.00 0.00 ? 1871 LEU C CA 1 
ATOM 2373 C CA . ALA C  3  1872 ? 129.419 204.301 285.747 1.00 0.00 ? 1872 ALA C CA 1 
ATOM 2374 C CA . GLN C  3  1873 ? 129.438 203.623 289.457 1.00 0.00 ? 1873 GLN C CA 1 
ATOM 2375 C CA . LYS C  3  1874 ? 126.488 205.977 289.992 1.00 0.00 ? 1874 LYS C CA 1 
ATOM 2376 C CA . VAL C  3  1875 ? 124.341 205.179 286.926 1.00 0.00 ? 1875 VAL C CA 1 
ATOM 2377 C CA . PRO C  3  1876 ? 121.013 203.223 287.081 1.00 0.00 ? 1876 PRO C CA 1 
ATOM 2378 C CA . HIS C  3  1877 ? 122.157 200.292 284.956 1.00 0.00 ? 1877 HIS C CA 1 
ATOM 2379 C CA . LYS C  3  1878 ? 125.551 198.726 285.580 1.00 0.00 ? 1878 LYS C CA 1 
ATOM 2380 C CA . LEU C  3  1879 ? 127.479 196.801 282.913 1.00 0.00 ? 1879 LEU C CA 1 
ATOM 2381 C CA . ASN C  3  1880 ? 129.104 193.401 282.491 1.00 0.00 ? 1880 ASN C CA 1 
ATOM 2382 C CA . ASN C  3  1881 ? 132.870 193.778 282.867 1.00 0.00 ? 1881 ASN C CA 1 
ATOM 2383 C CA . PRO C  3  1882 ? 132.965 196.969 280.751 1.00 0.00 ? 1882 PRO C CA 1 
ATOM 2384 C CA . LYS C  3  1883 ? 136.152 198.277 279.186 1.00 0.00 ? 1883 LYS C CA 1 
ATOM 2385 C CA . PHE C  3  1884 ? 136.322 202.008 279.852 1.00 0.00 ? 1884 PHE C CA 1 
ATOM 2386 C CA . ASN C  3  1885 ? 138.268 202.975 276.730 1.00 0.00 ? 1885 ASN C CA 1 
ATOM 2387 C CA . ASP C  3  1886 ? 135.401 201.730 274.529 1.00 0.00 ? 1886 ASP C CA 1 
ATOM 2388 C CA . PRO C  3  1887 ? 133.113 204.444 273.056 1.00 0.00 ? 1887 PRO C CA 1 
ATOM 2389 C CA . HIS C  3  1888 ? 130.040 202.166 273.081 1.00 0.00 ? 1888 HIS C CA 1 
ATOM 2390 C CA . VAL C  3  1889 ? 130.329 201.823 276.849 1.00 0.00 ? 1889 VAL C CA 1 
ATOM 2391 C CA . LYS C  3  1890 ? 130.911 205.575 277.074 1.00 0.00 ? 1890 LYS C CA 1 
ATOM 2392 C CA . THR C  3  1891 ? 127.768 206.331 275.061 1.00 0.00 ? 1891 THR C CA 1 
ATOM 2393 C CA . ASN C  3  1892 ? 125.710 203.915 277.183 1.00 0.00 ? 1892 ASN C CA 1 
ATOM 2394 C CA . LEU C  3  1893 ? 126.882 205.769 280.326 1.00 0.00 ? 1893 LEU C CA 1 
ATOM 2395 C CA . LEU C  3  1894 ? 126.431 209.251 278.811 1.00 0.00 ? 1894 LEU C CA 1 
ATOM 2396 C CA . LEU C  3  1895 ? 122.954 208.242 277.665 1.00 0.00 ? 1895 LEU C CA 1 
ATOM 2397 C CA . GLN C  3  1896 ? 121.881 206.991 281.108 1.00 0.00 ? 1896 GLN C CA 1 
ATOM 2398 C CA . ALA C  3  1897 ? 123.411 210.177 282.522 1.00 0.00 ? 1897 ALA C CA 1 
ATOM 2399 C CA . HIS C  3  1898 ? 121.174 212.195 280.177 1.00 0.00 ? 1898 HIS C CA 1 
ATOM 2400 C CA . LEU C  3  1899 ? 118.145 210.126 281.204 1.00 0.00 ? 1899 LEU C CA 1 
ATOM 2401 C CA . SER C  3  1900 ? 118.898 210.779 284.884 1.00 0.00 ? 1900 SER C CA 1 
ATOM 2402 C CA . ARG C  3  1901 ? 119.358 214.490 284.130 1.00 0.00 ? 1901 ARG C CA 1 
ATOM 2403 C CA . MET C  3  1902 ? 122.815 214.395 285.709 1.00 0.00 ? 1902 MET C CA 1 
ATOM 2404 C CA . GLN C  3  1903 ? 124.833 217.543 284.999 1.00 0.00 ? 1903 GLN C CA 1 
ATOM 2405 C CA . LEU C  3  1904 ? 128.335 216.561 283.865 1.00 0.00 ? 1904 LEU C CA 1 
ATOM 2406 C CA . SER C  3  1905 ? 131.417 218.480 282.719 1.00 0.00 ? 1905 SER C CA 1 
ATOM 2407 C CA . ALA C  3  1906 ? 130.967 220.511 279.517 1.00 0.00 ? 1906 ALA C CA 1 
ATOM 2408 C CA . GLU C  3  1907 ? 133.651 218.303 277.947 1.00 0.00 ? 1907 GLU C CA 1 
ATOM 2409 C CA . LEU C  3  1908 ? 131.524 215.152 278.022 1.00 0.00 ? 1908 LEU C CA 1 
ATOM 2410 C CA . GLN C  3  1909 ? 128.349 217.252 277.834 1.00 0.00 ? 1909 GLN C CA 1 
ATOM 2411 C CA . SER C  3  1910 ? 129.258 218.303 274.295 1.00 0.00 ? 1910 SER C CA 1 
ATOM 2412 C CA . ASP C  3  1911 ? 129.665 214.586 273.581 1.00 0.00 ? 1911 ASP C CA 1 
ATOM 2413 C CA . THR C  3  1912 ? 126.244 213.810 275.089 1.00 0.00 ? 1912 THR C CA 1 
ATOM 2414 C CA . GLU C  3  1913 ? 124.664 216.424 272.816 1.00 0.00 ? 1913 GLU C CA 1 
ATOM 2415 C CA . GLU C  3  1914 ? 126.295 214.904 269.745 1.00 0.00 ? 1914 GLU C CA 1 
ATOM 2416 C CA . ILE C  3  1915 ? 125.047 211.409 270.666 1.00 0.00 ? 1915 ILE C CA 1 
ATOM 2417 C CA . LEU C  3  1916 ? 121.538 212.766 271.149 1.00 0.00 ? 1916 LEU C CA 1 
ATOM 2418 C CA . SER C  3  1917 ? 121.660 214.489 267.748 1.00 0.00 ? 1917 SER C CA 1 
ATOM 2419 C CA . LYS C  3  1918 ? 121.570 211.162 265.896 1.00 0.00 ? 1918 LYS C CA 1 
ATOM 2420 C CA . ALA C  3  1919 ? 119.841 209.064 268.631 1.00 0.00 ? 1919 ALA C CA 1 
ATOM 2421 C CA . ILE C  3  1920 ? 116.175 209.351 267.556 1.00 0.00 ? 1920 ILE C CA 1 
ATOM 2422 C CA . ARG C  3  1921 ? 116.847 207.943 264.059 1.00 0.00 ? 1921 ARG C CA 1 
ATOM 2423 C CA . LEU C  3  1922 ? 118.447 204.812 265.535 1.00 0.00 ? 1922 LEU C CA 1 
ATOM 2424 C CA . ILE C  3  1923 ? 115.611 204.422 268.049 1.00 0.00 ? 1923 ILE C CA 1 
ATOM 2425 C CA . GLN C  3  1924 ? 112.999 204.619 265.289 1.00 0.00 ? 1924 GLN C CA 1 
ATOM 2426 C CA . ALA C  3  1925 ? 114.972 202.080 263.309 1.00 0.00 ? 1925 ALA C CA 1 
ATOM 2427 C CA . CYS C  3  1926 ? 114.659 199.756 266.275 1.00 0.00 ? 1926 CYS C CA 1 
ATOM 2428 C CA . VAL C  3  1927 ? 110.909 200.422 266.295 1.00 0.00 ? 1927 VAL C CA 1 
ATOM 2429 C CA . ASP C  3  1928 ? 110.838 199.336 262.662 1.00 0.00 ? 1928 ASP C CA 1 
ATOM 2430 C CA . VAL C  3  1929 ? 113.009 196.230 263.078 1.00 0.00 ? 1929 VAL C CA 1 
ATOM 2431 C CA . LEU C  3  1930 ? 110.911 195.110 266.040 1.00 0.00 ? 1930 LEU C CA 1 
ATOM 2432 C CA . SER C  3  1931 ? 107.517 195.788 264.511 1.00 0.00 ? 1931 SER C CA 1 
ATOM 2433 C CA . SER C  3  1932 ? 108.633 194.034 261.332 1.00 0.00 ? 1932 SER C CA 1 
ATOM 2434 C CA . ASN C  3  1933 ? 109.934 191.100 263.381 1.00 0.00 ? 1933 ASN C CA 1 
ATOM 2435 C CA . GLY C  3  1934 ? 106.469 191.195 265.016 1.00 0.00 ? 1934 GLY C CA 1 
ATOM 2436 C CA . TRP C  3  1935 ? 107.010 191.818 268.738 1.00 0.00 ? 1935 TRP C CA 1 
ATOM 2437 C CA . LEU C  3  1936 ? 104.659 194.064 270.759 1.00 0.00 ? 1936 LEU C CA 1 
ATOM 2438 C CA . SER C  3  1937 ? 106.462 194.773 274.026 1.00 0.00 ? 1937 SER C CA 1 
ATOM 2439 C CA . PRO C  3  1938 ? 109.875 195.727 272.645 1.00 0.00 ? 1938 PRO C CA 1 
ATOM 2440 C CA . ALA C  3  1939 ? 108.318 197.912 269.964 1.00 0.00 ? 1939 ALA C CA 1 
ATOM 2441 C CA . LEU C  3  1940 ? 106.081 199.882 272.285 1.00 0.00 ? 1940 LEU C CA 1 
ATOM 2442 C CA . ALA C  3  1941 ? 108.989 200.144 274.727 1.00 0.00 ? 1941 ALA C CA 1 
ATOM 2443 C CA . ALA C  3  1942 ? 111.167 201.542 271.941 1.00 0.00 ? 1942 ALA C CA 1 
ATOM 2444 C CA . MET C  3  1943 ? 108.649 204.250 271.145 1.00 0.00 ? 1943 MET C CA 1 
ATOM 2445 C CA . GLU C  3  1944 ? 108.633 204.891 274.892 1.00 0.00 ? 1944 GLU C CA 1 
ATOM 2446 C CA . LEU C  3  1945 ? 112.441 205.233 274.707 1.00 0.00 ? 1945 LEU C CA 1 
ATOM 2447 C CA . ALA C  3  1946 ? 112.029 207.805 271.937 1.00 0.00 ? 1946 ALA C CA 1 
ATOM 2448 C CA . GLN C  3  1947 ? 109.868 209.781 274.347 1.00 0.00 ? 1947 GLN C CA 1 
ATOM 2449 C CA . MET C  3  1948 ? 112.342 209.313 277.233 1.00 0.00 ? 1948 MET C CA 1 
ATOM 2450 C CA . VAL C  3  1949 ? 115.183 210.661 275.130 1.00 0.00 ? 1949 VAL C CA 1 
ATOM 2451 C CA . THR C  3  1950 ? 113.122 213.640 273.941 1.00 0.00 ? 1950 THR C CA 1 
ATOM 2452 C CA . GLN C  3  1951 ? 112.130 214.668 277.468 1.00 0.00 ? 1951 GLN C CA 1 
ATOM 2453 C CA . ALA C  3  1952 ? 115.215 213.342 279.300 1.00 0.00 ? 1952 ALA C CA 1 
ATOM 2454 C CA . MET C  3  1953 ? 113.704 210.973 281.891 1.00 0.00 ? 1953 MET C CA 1 
ATOM 2455 C CA . TRP C  3  1954 ? 113.586 207.311 282.911 1.00 0.00 ? 1954 TRP C CA 1 
ATOM 2456 C CA . SER C  3  1955 ? 110.615 205.072 281.984 1.00 0.00 ? 1955 SER C CA 1 
ATOM 2457 C CA . LYS C  3  1956 ? 109.114 205.001 285.479 1.00 0.00 ? 1956 LYS C CA 1 
ATOM 2458 C CA . ASP C  3  1957 ? 109.041 208.673 286.417 1.00 0.00 ? 1957 ASP C CA 1 
ATOM 2459 C CA . SER C  3  1958 ? 106.778 211.631 287.109 1.00 0.00 ? 1958 SER C CA 1 
ATOM 2460 C CA . TYR C  3  1959 ? 105.060 212.861 283.953 1.00 0.00 ? 1959 TYR C CA 1 
ATOM 2461 C CA . LEU C  3  1960 ? 105.046 216.396 285.384 1.00 0.00 ? 1960 LEU C CA 1 
ATOM 2462 C CA . LYS C  3  1961 ? 108.817 216.876 285.354 1.00 0.00 ? 1961 LYS C CA 1 
ATOM 2463 C CA . GLN C  3  1962 ? 108.514 217.676 281.644 1.00 0.00 ? 1962 GLN C CA 1 
ATOM 2464 C CA . LEU C  3  1963 ? 107.363 221.144 282.748 1.00 0.00 ? 1963 LEU C CA 1 
ATOM 2465 C CA . PRO C  3  1964 ? 110.015 223.903 283.057 1.00 0.00 ? 1964 PRO C CA 1 
ATOM 2466 C CA . THR C  3  1967 ? 116.609 224.821 288.659 1.00 0.00 ? 1967 THR C CA 1 
ATOM 2467 C CA . SER C  3  1968 ? 115.357 222.257 291.173 1.00 0.00 ? 1968 SER C CA 1 
ATOM 2468 C CA . GLU C  3  1969 ? 113.271 224.916 292.888 1.00 0.00 ? 1969 GLU C CA 1 
ATOM 2469 C CA . HIS C  3  1970 ? 111.621 225.529 289.517 1.00 0.00 ? 1970 HIS C CA 1 
ATOM 2470 C CA . ILE C  3  1971 ? 110.253 221.988 289.653 1.00 0.00 ? 1971 ILE C CA 1 
ATOM 2471 C CA . LYS C  3  1972 ? 108.378 222.740 292.886 1.00 0.00 ? 1972 LYS C CA 1 
ATOM 2472 C CA . ARG C  3  1973 ? 106.179 225.378 291.251 1.00 0.00 ? 1973 ARG C CA 1 
ATOM 2473 C CA . CYS C  3  1974 ? 106.073 223.547 287.927 1.00 0.00 ? 1974 CYS C CA 1 
ATOM 2474 C CA . THR C  3  1975 ? 104.676 220.378 289.522 1.00 0.00 ? 1975 THR C CA 1 
ATOM 2475 C CA . ASP C  3  1976 ? 102.405 222.323 291.892 1.00 0.00 ? 1976 ASP C CA 1 
ATOM 2476 C CA . LYS C  3  1977 ? 101.065 224.124 288.811 1.00 0.00 ? 1977 LYS C CA 1 
ATOM 2477 C CA . LEU C  3  1997 ? 106.665 226.930 294.210 1.00 0.00 ? 1997 LEU C CA 1 
ATOM 2478 C CA . GLN C  3  1998 ? 108.393 229.939 292.647 1.00 0.00 ? 1998 GLN C CA 1 
ATOM 2479 C CA . LEU C  3  1999 ? 106.887 232.969 290.906 1.00 0.00 ? 1999 LEU C CA 1 
ATOM 2480 C CA . THR C  3  2000 ? 106.327 233.445 289.409 1.00 0.00 ? 2000 THR C CA 1 
ATOM 2481 C CA . ASP C  3  2001 ? 104.725 235.070 286.337 1.00 0.00 ? 2001 ASP C CA 1 
ATOM 2482 C CA . SER C  3  2002 ? 107.622 234.460 283.921 1.00 0.00 ? 2002 SER C CA 1 
ATOM 2483 C CA . GLN C  3  2003 ? 108.043 230.797 284.876 1.00 0.00 ? 2003 GLN C CA 1 
ATOM 2484 C CA . ILE C  3  2004 ? 104.269 230.257 285.137 1.00 0.00 ? 2004 ILE C CA 1 
ATOM 2485 C CA . ALA C  3  2005 ? 103.914 231.652 281.599 1.00 0.00 ? 2005 ALA C CA 1 
ATOM 2486 C CA . ASP C  3  2006 ? 106.780 229.426 280.436 1.00 0.00 ? 2006 ASP C CA 1 
ATOM 2487 C CA . VAL C  3  2007 ? 104.842 226.484 281.882 1.00 0.00 ? 2007 VAL C CA 1 
ATOM 2488 C CA . ALA C  3  2008 ? 101.571 227.730 280.362 1.00 0.00 ? 2008 ALA C CA 1 
ATOM 2489 C CA . ARG C  3  2009 ? 103.021 227.631 276.847 1.00 0.00 ? 2009 ARG C CA 1 
ATOM 2490 C CA . PHE C  3  2010 ? 104.123 224.019 277.413 1.00 0.00 ? 2010 PHE C CA 1 
ATOM 2491 C CA . CYS C  3  2011 ? 100.637 223.166 278.649 1.00 0.00 ? 2011 CYS C CA 1 
ATOM 2492 C CA . ASN C  3  2012 ? 99.118  224.660 275.520 1.00 0.00 ? 2012 ASN C CA 1 
ATOM 2493 C CA . ARG C  3  2013 ? 101.664 222.852 273.316 1.00 0.00 ? 2013 ARG C CA 1 
ATOM 2494 C CA . TYR C  3  2014 ? 101.053 219.529 275.068 1.00 0.00 ? 2014 TYR C CA 1 
ATOM 2495 C CA . PRO C  3  2015 ? 98.914  217.267 272.816 1.00 0.00 ? 2015 PRO C CA 1 
ATOM 2496 C CA . ASN C  3  2016 ? 95.145  217.247 273.143 1.00 0.00 ? 2016 ASN C CA 1 
ATOM 2497 C CA . ILE C  3  2017 ? 94.006  214.548 270.716 1.00 0.00 ? 2017 ILE C CA 1 
ATOM 2498 C CA . GLU C  3  2018 ? 90.681  212.739 270.423 1.00 0.00 ? 2018 GLU C CA 1 
ATOM 2499 C CA . LEU C  3  2019 ? 90.443  209.675 268.215 1.00 0.00 ? 2019 LEU C CA 1 
ATOM 2500 C CA . SER C  3  2020 ? 87.560  207.509 267.044 1.00 0.00 ? 2020 SER C CA 1 
ATOM 2501 C CA . TYR C  3  2021 ? 88.034  203.870 266.047 1.00 0.00 ? 2021 TYR C CA 1 
ATOM 2502 C CA . GLU C  3  2022 ? 85.828  201.296 264.315 1.00 0.00 ? 2022 GLU C CA 1 
ATOM 2503 C CA . VAL C  3  2023 ? 86.010  197.850 262.737 1.00 0.00 ? 2023 VAL C CA 1 
ATOM 2504 C CA . VAL C  3  2024 ? 84.685  197.897 259.172 1.00 0.00 ? 2024 VAL C CA 1 
ATOM 2505 C CA . ASP C  3  2025 ? 81.915  195.317 258.642 1.00 0.00 ? 2025 ASP C CA 1 
ATOM 2506 C CA . LYS C  3  2026 ? 82.615  193.646 261.982 1.00 0.00 ? 2026 LYS C CA 1 
ATOM 2507 C CA . ASP C  3  2027 ? 80.073  190.827 261.689 1.00 0.00 ? 2027 ASP C CA 1 
ATOM 2508 C CA . SER C  3  2028 ? 81.438  189.491 258.408 1.00 0.00 ? 2028 SER C CA 1 
ATOM 2509 C CA . ILE C  3  2029 ? 84.903  188.028 259.027 1.00 0.00 ? 2029 ILE C CA 1 
ATOM 2510 C CA . ARG C  3  2030 ? 86.468  184.794 257.740 1.00 0.00 ? 2030 ARG C CA 1 
ATOM 2511 C CA . SER C  3  2031 ? 89.905  183.208 258.310 1.00 0.00 ? 2031 SER C CA 1 
ATOM 2512 C CA . GLY C  3  2032 ? 92.454  184.800 256.014 1.00 0.00 ? 2032 GLY C CA 1 
ATOM 2513 C CA . GLY C  3  2033 ? 89.875  187.490 255.309 1.00 0.00 ? 2033 GLY C CA 1 
ATOM 2514 C CA . PRO C  3  2034 ? 90.979  191.092 255.574 1.00 0.00 ? 2034 PRO C CA 1 
ATOM 2515 C CA . VAL C  3  2035 ? 90.157  192.894 258.802 1.00 0.00 ? 2035 VAL C CA 1 
ATOM 2516 C CA . VAL C  3  2036 ? 90.069  196.670 258.486 1.00 0.00 ? 2036 VAL C CA 1 
ATOM 2517 C CA . VAL C  3  2037 ? 90.281  198.933 261.516 1.00 0.00 ? 2037 VAL C CA 1 
ATOM 2518 C CA . LEU C  3  2038 ? 89.710  202.609 260.757 1.00 0.00 ? 2038 LEU C CA 1 
ATOM 2519 C CA . VAL C  3  2039 ? 91.070  205.186 263.214 1.00 0.00 ? 2039 VAL C CA 1 
ATOM 2520 C CA . GLN C  3  2040 ? 90.181  208.899 263.024 1.00 0.00 ? 2040 GLN C CA 1 
ATOM 2521 C CA . LEU C  3  2041 ? 92.221  211.629 264.733 1.00 0.00 ? 2041 LEU C CA 1 
ATOM 2522 C CA . GLU C  3  2042 ? 91.374  215.201 265.725 1.00 0.00 ? 2042 GLU C CA 1 
ATOM 2523 C CA . ARG C  3  2043 ? 92.963  217.968 267.805 1.00 0.00 ? 2043 ARG C CA 1 
ATOM 2524 C CA . GLU C  3  2044 ? 91.390  220.962 269.561 1.00 0.00 ? 2044 GLU C CA 1 
ATOM 2525 C CA . GLU C  3  2045 ? 94.861  222.188 270.529 1.00 0.00 ? 2045 GLU C CA 1 
ATOM 2526 C CA . GLU C  3  2046 ? 96.102  225.326 268.744 1.00 0.00 ? 2046 GLU C CA 1 
ATOM 2527 C CA . VAL C  3  2047 ? 98.582  224.362 266.036 1.00 0.00 ? 2047 VAL C CA 1 
ATOM 2528 C CA . THR C  3  2048 ? 101.768 226.398 266.410 1.00 0.00 ? 2048 THR C CA 1 
ATOM 2529 C CA . GLY C  3  2049 ? 105.510 225.794 266.702 1.00 0.00 ? 2049 GLY C CA 1 
ATOM 2530 C CA . PRO C  3  2050 ? 107.523 222.579 267.268 1.00 0.00 ? 2050 PRO C CA 1 
ATOM 2531 C CA . VAL C  3  2051 ? 107.691 220.265 270.269 1.00 0.00 ? 2051 VAL C CA 1 
ATOM 2532 C CA . ILE C  3  2052 ? 108.955 222.020 273.395 1.00 0.00 ? 2052 ILE C CA 1 
ATOM 2533 C CA . ALA C  3  2053 ? 111.747 219.937 274.929 1.00 0.00 ? 2053 ALA C CA 1 
ATOM 2534 C CA . PRO C  3  2054 ? 114.472 222.319 276.230 1.00 0.00 ? 2054 PRO C CA 1 
ATOM 2535 C CA . LEU C  3  2055 ? 116.869 219.504 277.196 1.00 0.00 ? 2055 LEU C CA 1 
ATOM 2536 C CA . PHE C  3  2056 ? 117.322 218.438 273.576 1.00 0.00 ? 2056 PHE C CA 1 
ATOM 2537 C CA . PRO C  3  2057 ? 119.719 219.963 270.997 1.00 0.00 ? 2057 PRO C CA 1 
ATOM 2538 C CA . GLN C  3  2058 ? 117.319 219.385 268.087 1.00 0.00 ? 2058 GLN C CA 1 
ATOM 2539 C CA . LYS C  3  2059 ? 113.976 220.960 267.243 1.00 0.00 ? 2059 LYS C CA 1 
ATOM 2540 C CA . ARG C  3  2060 ? 111.420 218.232 266.496 1.00 0.00 ? 2060 ARG C CA 1 
ATOM 2541 C CA . GLU C  3  2061 ? 107.812 217.719 265.360 1.00 0.00 ? 2061 GLU C CA 1 
ATOM 2542 C CA . GLU C  3  2062 ? 105.188 215.271 266.672 1.00 0.00 ? 2062 GLU C CA 1 
ATOM 2543 C CA . GLY C  3  2063 ? 105.539 211.754 265.306 1.00 0.00 ? 2063 GLY C CA 1 
ATOM 2544 C CA . TRP C  3  2064 ? 102.921 209.107 266.073 1.00 0.00 ? 2064 TRP C CA 1 
ATOM 2545 C CA . TRP C  3  2065 ? 102.551 205.335 265.859 1.00 0.00 ? 2065 TRP C CA 1 
ATOM 2546 C CA . VAL C  3  2066 ? 99.125  203.775 265.548 1.00 0.00 ? 2066 VAL C CA 1 
ATOM 2547 C CA . VAL C  3  2067 ? 99.552  200.134 266.387 1.00 0.00 ? 2067 VAL C CA 1 
ATOM 2548 C CA . ILE C  3  2068 ? 97.263  197.131 266.686 1.00 0.00 ? 2068 ILE C CA 1 
ATOM 2549 C CA . GLY C  3  2069 ? 98.291  193.931 268.397 1.00 0.00 ? 2069 GLY C CA 1 
ATOM 2550 C CA . ASP C  3  2070 ? 97.245  190.969 270.465 1.00 0.00 ? 2070 ASP C CA 1 
ATOM 2551 C CA . ALA C  3  2071 ? 98.948  191.752 273.743 1.00 0.00 ? 2071 ALA C CA 1 
ATOM 2552 C CA . LYS C  3  2072 ? 98.471  188.216 275.110 1.00 0.00 ? 2072 LYS C CA 1 
ATOM 2553 C CA . SER C  3  2073 ? 100.912 186.537 272.676 1.00 0.00 ? 2073 SER C CA 1 
ATOM 2554 C CA . ASN C  3  2074 ? 103.277 189.538 272.516 1.00 0.00 ? 2074 ASN C CA 1 
ATOM 2555 C CA . SER C  3  2075 ? 102.387 189.823 268.838 1.00 0.00 ? 2075 SER C CA 1 
ATOM 2556 C CA . LEU C  3  2076 ? 102.393 192.996 266.784 1.00 0.00 ? 2076 LEU C CA 1 
ATOM 2557 C CA . ILE C  3  2077 ? 99.423  192.417 264.511 1.00 0.00 ? 2077 ILE C CA 1 
ATOM 2558 C CA . SER C  3  2078 ? 99.523  195.689 262.577 1.00 0.00 ? 2078 SER C CA 1 
ATOM 2559 C CA . ILE C  3  2079 ? 101.175 199.132 262.614 1.00 0.00 ? 2079 ILE C CA 1 
ATOM 2560 C CA . LYS C  3  2080 ? 101.278 202.540 260.902 1.00 0.00 ? 2080 LYS C CA 1 
ATOM 2561 C CA . ARG C  3  2081 ? 103.110 205.878 261.322 1.00 0.00 ? 2081 ARG C CA 1 
ATOM 2562 C CA . LEU C  3  2082 ? 101.890 209.454 260.917 1.00 0.00 ? 2082 LEU C CA 1 
ATOM 2563 C CA . THR C  3  2083 ? 102.261 213.167 261.559 1.00 0.00 ? 2083 THR C CA 1 
ATOM 2564 C CA . LEU C  3  2084 ? 98.897  214.861 262.144 1.00 0.00 ? 2084 LEU C CA 1 
ATOM 2565 C CA . GLN C  3  2085 ? 98.639  218.564 263.071 1.00 0.00 ? 2085 GLN C CA 1 
ATOM 2566 C CA . GLN C  3  2086 ? 94.958  219.169 263.967 1.00 0.00 ? 2086 GLN C CA 1 
ATOM 2567 C CA . LYS C  3  2087 ? 93.279  216.529 261.783 1.00 0.00 ? 2087 LYS C CA 1 
ATOM 2568 C CA . ALA C  3  2088 ? 93.960  212.938 260.686 1.00 0.00 ? 2088 ALA C CA 1 
ATOM 2569 C CA . LYS C  3  2089 ? 92.371  209.845 259.147 1.00 0.00 ? 2089 LYS C CA 1 
ATOM 2570 C CA . VAL C  3  2090 ? 94.317  206.577 259.444 1.00 0.00 ? 2090 VAL C CA 1 
ATOM 2571 C CA . LYS C  3  2091 ? 93.140  203.099 258.481 1.00 0.00 ? 2091 LYS C CA 1 
ATOM 2572 C CA . LEU C  3  2092 ? 95.055  199.877 259.080 1.00 0.00 ? 2092 LEU C CA 1 
ATOM 2573 C CA . ASP C  3  2093 ? 94.350  196.268 258.196 1.00 0.00 ? 2093 ASP C CA 1 
ATOM 2574 C CA . PHE C  3  2094 ? 95.496  192.702 258.782 1.00 0.00 ? 2094 PHE C CA 1 
ATOM 2575 C CA . VAL C  3  2095 ? 94.619  189.056 258.105 1.00 0.00 ? 2095 VAL C CA 1 
ATOM 2576 C CA . ALA C  3  2096 ? 91.985  187.400 260.312 1.00 0.00 ? 2096 ALA C CA 1 
ATOM 2577 C CA . PRO C  3  2097 ? 93.173  184.267 262.210 1.00 0.00 ? 2097 PRO C CA 1 
ATOM 2578 C CA . ALA C  3  2098 ? 91.170  181.143 263.101 1.00 0.00 ? 2098 ALA C CA 1 
ATOM 2579 C CA . THR C  3  2099 ? 87.377  181.099 263.460 1.00 0.00 ? 2099 THR C CA 1 
ATOM 2580 C CA . GLY C  3  2100 ? 86.553  184.808 263.658 1.00 0.00 ? 2100 GLY C CA 1 
ATOM 2581 C CA . ALA C  3  2101 ? 85.789  185.146 267.392 1.00 0.00 ? 2101 ALA C CA 1 
ATOM 2582 C CA . HIS C  3  2102 ? 88.710  187.103 268.835 1.00 0.00 ? 2102 HIS C CA 1 
ATOM 2583 C CA . ASN C  3  2103 ? 89.888  190.236 270.669 1.00 0.00 ? 2103 ASN C CA 1 
ATOM 2584 C CA . TYR C  3  2104 ? 92.822  192.644 270.311 1.00 0.00 ? 2104 TYR C CA 1 
ATOM 2585 C CA . THR C  3  2105 ? 94.287  195.952 271.500 1.00 0.00 ? 2105 THR C CA 1 
ATOM 2586 C CA . LEU C  3  2106 ? 94.677  199.290 269.697 1.00 0.00 ? 2106 LEU C CA 1 
ATOM 2587 C CA . TYR C  3  2107 ? 97.684  201.409 270.767 1.00 0.00 ? 2107 TYR C CA 1 
ATOM 2588 C CA . PHE C  3  2108 ? 98.608  205.026 270.084 1.00 0.00 ? 2108 PHE C CA 1 
ATOM 2589 C CA . MET C  3  2109 ? 102.024 206.552 270.796 1.00 0.00 ? 2109 MET C CA 1 
ATOM 2590 C CA . SER C  3  2110 ? 104.327 209.571 270.410 1.00 0.00 ? 2110 SER C CA 1 
ATOM 2591 C CA . ASP C  3  2111 ? 108.093 209.887 269.823 1.00 0.00 ? 2111 ASP C CA 1 
ATOM 2592 C CA . ALA C  3  2112 ? 108.396 212.977 272.021 1.00 0.00 ? 2112 ALA C CA 1 
ATOM 2593 C CA . TYR C  3  2113 ? 105.975 213.594 274.891 1.00 0.00 ? 2113 TYR C CA 1 
ATOM 2594 C CA . MET C  3  2114 ? 105.422 211.245 277.825 1.00 0.00 ? 2114 MET C CA 1 
ATOM 2595 C CA . GLY C  3  2115 ? 101.884 210.300 278.802 1.00 0.00 ? 2115 GLY C CA 1 
ATOM 2596 C CA . CYS C  3  2116 ? 99.839  210.699 275.632 1.00 0.00 ? 2116 CYS C CA 1 
ATOM 2597 C CA . ASP C  3  2117 ? 99.894  206.947 274.971 1.00 0.00 ? 2117 ASP C CA 1 
ATOM 2598 C CA . GLN C  3  2118 ? 96.417  205.480 274.446 1.00 0.00 ? 2118 GLN C CA 1 
ATOM 2599 C CA . GLU C  3  2119 ? 95.187  201.881 274.674 1.00 0.00 ? 2119 GLU C CA 1 
ATOM 2600 C CA . TYR C  3  2120 ? 91.774  200.588 273.598 1.00 0.00 ? 2120 TYR C CA 1 
ATOM 2601 C CA . LYS C  3  2121 ? 90.949  196.876 273.964 1.00 0.00 ? 2121 LYS C CA 1 
ATOM 2602 C CA . PHE C  3  2122 ? 88.462  195.805 271.322 1.00 0.00 ? 2122 PHE C CA 1 
ATOM 2603 C CA . SER C  3  2123 ? 86.532  192.755 270.166 1.00 0.00 ? 2123 SER C CA 1 
ATOM 2604 C CA . VAL C  3  2124 ? 85.908  191.667 266.581 1.00 0.00 ? 2124 VAL C CA 1 
ATOM 2605 C CA . ASP C  3  2125 ? 82.713  189.797 265.446 1.00 0.00 ? 2125 ASP C CA 1 
ATOM 2606 C CA . TYR D  4  3    ? 251.566 212.171 208.658 1.00 0.00 ? 3    TYR E CA 1 
ATOM 2607 C CA . MET D  4  4    ? 254.053 214.725 207.266 1.00 0.00 ? 4    MET E CA 1 
ATOM 2608 C CA . LEU D  4  5    ? 253.659 216.770 204.057 1.00 0.00 ? 5    LEU E CA 1 
ATOM 2609 C CA . PRO D  4  6    ? 255.451 215.299 201.011 1.00 0.00 ? 6    PRO E CA 1 
ATOM 2610 C CA . HIS D  4  7    ? 258.790 216.789 199.957 1.00 0.00 ? 7    HIS E CA 1 
ATOM 2611 C CA . LEU D  4  8    ? 260.489 216.885 196.562 1.00 0.00 ? 8    LEU E CA 1 
ATOM 2612 C CA . HIS D  4  9    ? 264.248 216.628 196.434 1.00 0.00 ? 9    HIS E CA 1 
ATOM 2613 C CA . ASN D  4  10   ? 265.328 217.674 192.928 1.00 0.00 ? 10   ASN E CA 1 
ATOM 2614 C CA . GLY D  4  11   ? 264.159 219.629 189.878 1.00 0.00 ? 11   GLY E CA 1 
ATOM 2615 C CA . TRP D  4  12   ? 263.230 216.409 188.069 1.00 0.00 ? 12   TRP E CA 1 
ATOM 2616 C CA . GLN D  4  13   ? 260.860 215.388 190.891 1.00 0.00 ? 13   GLN E CA 1 
ATOM 2617 C CA . VAL D  4  14   ? 259.288 218.873 190.956 1.00 0.00 ? 14   VAL E CA 1 
ATOM 2618 C CA . ASP D  4  15   ? 258.839 218.672 187.170 1.00 0.00 ? 15   ASP E CA 1 
ATOM 2619 C CA . GLN D  4  16   ? 257.146 215.262 187.446 1.00 0.00 ? 16   GLN E CA 1 
ATOM 2620 C CA . ALA D  4  17   ? 254.843 216.453 190.260 1.00 0.00 ? 17   ALA E CA 1 
ATOM 2621 C CA . ILE D  4  18   ? 253.718 219.591 188.427 1.00 0.00 ? 18   ILE E CA 1 
ATOM 2622 C CA . LEU D  4  19   ? 253.211 217.424 185.316 1.00 0.00 ? 19   LEU E CA 1 
ATOM 2623 C CA . SER D  4  20   ? 251.281 214.650 187.047 1.00 0.00 ? 20   SER E CA 1 
ATOM 2624 C CA . GLU D  4  21   ? 248.004 216.263 188.167 1.00 0.00 ? 21   GLU E CA 1 
ATOM 2625 C CA . GLU D  4  22   ? 245.180 216.570 185.643 1.00 0.00 ? 22   GLU E CA 1 
ATOM 2626 C CA . ASP D  4  23   ? 242.539 217.476 188.233 1.00 0.00 ? 23   ASP E CA 1 
ATOM 2627 C CA . ARG D  4  24   ? 244.278 218.975 191.252 1.00 0.00 ? 24   ARG E CA 1 
ATOM 2628 C CA . VAL D  4  25   ? 246.062 222.255 191.939 1.00 0.00 ? 25   VAL E CA 1 
ATOM 2629 C CA . VAL D  4  26   ? 249.743 221.604 192.622 1.00 0.00 ? 26   VAL E CA 1 
ATOM 2630 C CA . VAL D  4  27   ? 250.653 223.763 195.590 1.00 0.00 ? 27   VAL E CA 1 
ATOM 2631 C CA . ILE D  4  28   ? 254.378 224.247 196.092 1.00 0.00 ? 28   ILE E CA 1 
ATOM 2632 C CA . ARG D  4  29   ? 256.071 225.822 199.051 1.00 0.00 ? 29   ARG E CA 1 
ATOM 2633 C CA . PHE D  4  30   ? 259.580 226.994 198.127 1.00 0.00 ? 30   PHE E CA 1 
ATOM 2634 C CA . GLY D  4  31   ? 261.822 227.772 201.086 1.00 0.00 ? 31   GLY E CA 1 
ATOM 2635 C CA . HIS D  4  32   ? 263.420 225.766 203.876 1.00 0.00 ? 32   HIS E CA 1 
ATOM 2636 C CA . ASP D  4  33   ? 261.972 223.802 206.831 1.00 0.00 ? 33   ASP E CA 1 
ATOM 2637 C CA . TRP D  4  34   ? 264.304 225.665 209.220 1.00 0.00 ? 34   TRP E CA 1 
ATOM 2638 C CA . ASP D  4  35   ? 262.876 229.060 208.229 1.00 0.00 ? 35   ASP E CA 1 
ATOM 2639 C CA . PRO D  4  36   ? 260.419 230.698 210.703 1.00 0.00 ? 36   PRO E CA 1 
ATOM 2640 C CA . THR D  4  37   ? 258.109 232.024 207.970 1.00 0.00 ? 37   THR E CA 1 
ATOM 2641 C CA . CYS D  4  38   ? 258.149 228.567 206.384 1.00 0.00 ? 38   CYS E CA 1 
ATOM 2642 C CA . MET D  4  39   ? 257.412 227.011 209.781 1.00 0.00 ? 39   MET E CA 1 
ATOM 2643 C CA . LYS D  4  40   ? 254.185 229.081 210.106 1.00 0.00 ? 40   LYS E CA 1 
ATOM 2644 C CA . MET D  4  41   ? 253.164 228.478 206.478 1.00 0.00 ? 41   MET E CA 1 
ATOM 2645 C CA . ASP D  4  42   ? 253.929 224.736 206.750 1.00 0.00 ? 42   ASP E CA 1 
ATOM 2646 C CA . GLU D  4  43   ? 251.664 224.436 209.824 1.00 0.00 ? 43   GLU E CA 1 
ATOM 2647 C CA . VAL D  4  44   ? 248.806 225.946 207.795 1.00 0.00 ? 44   VAL E CA 1 
ATOM 2648 C CA . LEU D  4  45   ? 249.425 223.697 204.804 1.00 0.00 ? 45   LEU E CA 1 
ATOM 2649 C CA . TYR D  4  46   ? 249.774 220.635 207.025 1.00 0.00 ? 46   TYR E CA 1 
ATOM 2650 C CA . SER D  4  47   ? 246.500 221.415 208.801 1.00 0.00 ? 47   SER E CA 1 
ATOM 2651 C CA . ILE D  4  48   ? 244.506 221.978 205.547 1.00 0.00 ? 48   ILE E CA 1 
ATOM 2652 C CA . ALA D  4  49   ? 246.100 219.237 203.393 1.00 0.00 ? 49   ALA E CA 1 
ATOM 2653 C CA . GLU D  4  50   ? 243.424 216.660 204.192 1.00 0.00 ? 50   GLU E CA 1 
ATOM 2654 C CA . LYS D  4  51   ? 240.601 219.170 203.643 1.00 0.00 ? 51   LYS E CA 1 
ATOM 2655 C CA . VAL D  4  52   ? 241.729 220.222 200.146 1.00 0.00 ? 52   VAL E CA 1 
ATOM 2656 C CA . LYS D  4  53   ? 243.105 216.813 199.086 1.00 0.00 ? 53   LYS E CA 1 
ATOM 2657 C CA . ASN D  4  54   ? 240.407 216.227 196.450 1.00 0.00 ? 54   ASN E CA 1 
ATOM 2658 C CA . PHE D  4  55   ? 241.417 219.297 194.397 1.00 0.00 ? 55   PHE E CA 1 
ATOM 2659 C CA . ALA D  4  56   ? 244.903 220.161 195.684 1.00 0.00 ? 56   ALA E CA 1 
ATOM 2660 C CA . VAL D  4  57   ? 248.171 218.444 196.479 1.00 0.00 ? 57   VAL E CA 1 
ATOM 2661 C CA . ILE D  4  58   ? 250.832 220.262 198.474 1.00 0.00 ? 58   ILE E CA 1 
ATOM 2662 C CA . TYR D  4  59   ? 254.586 219.744 198.162 1.00 0.00 ? 59   TYR E CA 1 
ATOM 2663 C CA . LEU D  4  60   ? 257.495 221.254 200.102 1.00 0.00 ? 60   LEU E CA 1 
ATOM 2664 C CA . VAL D  4  61   ? 260.701 222.134 198.278 1.00 0.00 ? 61   VAL E CA 1 
ATOM 2665 C CA . ASP D  4  62   ? 263.972 223.180 199.905 1.00 0.00 ? 62   ASP E CA 1 
ATOM 2666 C CA . ILE D  4  63   ? 265.453 225.784 197.521 1.00 0.00 ? 63   ILE E CA 1 
ATOM 2667 C CA . THR D  4  64   ? 268.993 225.023 198.695 1.00 0.00 ? 64   THR E CA 1 
ATOM 2668 C CA . GLU D  4  65   ? 268.579 221.318 197.893 1.00 0.00 ? 65   GLU E CA 1 
ATOM 2669 C CA . VAL D  4  66   ? 266.544 222.332 194.792 1.00 0.00 ? 66   VAL E CA 1 
ATOM 2670 C CA . PRO D  4  67   ? 267.766 225.705 193.421 1.00 0.00 ? 67   PRO E CA 1 
ATOM 2671 C CA . ASP D  4  68   ? 266.581 224.857 189.871 1.00 0.00 ? 68   ASP E CA 1 
ATOM 2672 C CA . PHE D  4  69   ? 263.691 227.345 189.953 1.00 0.00 ? 69   PHE E CA 1 
ATOM 2673 C CA . ASN D  4  70   ? 265.278 230.180 191.927 1.00 0.00 ? 70   ASN E CA 1 
ATOM 2674 C CA . LYS D  4  71   ? 266.117 232.316 188.856 1.00 0.00 ? 71   LYS E CA 1 
ATOM 2675 C CA . MET D  4  72   ? 262.930 231.262 186.996 1.00 0.00 ? 72   MET E CA 1 
ATOM 2676 C CA . TYR D  4  73   ? 260.478 232.275 189.737 1.00 0.00 ? 73   TYR E CA 1 
ATOM 2677 C CA . GLU D  4  74   ? 262.679 234.839 191.561 1.00 0.00 ? 74   GLU E CA 1 
ATOM 2678 C CA . LEU D  4  75   ? 262.591 232.799 194.790 1.00 0.00 ? 75   LEU E CA 1 
ATOM 2679 C CA . TYR D  4  76   ? 264.389 235.335 196.977 1.00 0.00 ? 76   TYR E CA 1 
ATOM 2680 C CA . ASP D  4  77   ? 261.849 235.447 199.789 1.00 0.00 ? 77   ASP E CA 1 
ATOM 2681 C CA . PRO D  4  78   ? 262.129 233.151 202.855 1.00 0.00 ? 78   PRO E CA 1 
ATOM 2682 C CA . CYS D  4  79   ? 258.809 231.520 201.934 1.00 0.00 ? 79   CYS E CA 1 
ATOM 2683 C CA . THR D  4  80   ? 257.080 231.231 198.588 1.00 0.00 ? 80   THR E CA 1 
ATOM 2684 C CA . VAL D  4  81   ? 253.852 229.439 197.842 1.00 0.00 ? 81   VAL E CA 1 
ATOM 2685 C CA . MET D  4  82   ? 253.027 229.059 194.138 1.00 0.00 ? 82   MET E CA 1 
ATOM 2686 C CA . PHE D  4  83   ? 250.156 227.381 192.258 1.00 0.00 ? 83   PHE E CA 1 
ATOM 2687 C CA . PHE D  4  84   ? 250.096 225.161 189.169 1.00 0.00 ? 84   PHE E CA 1 
ATOM 2688 C CA . PHE D  4  85   ? 247.289 223.591 187.253 1.00 0.00 ? 85   PHE E CA 1 
ATOM 2689 C CA . ARG D  4  86   ? 247.799 221.230 184.336 1.00 0.00 ? 86   ARG E CA 1 
ATOM 2690 C CA . ASN D  4  87   ? 251.471 222.230 184.131 1.00 0.00 ? 87   ASN E CA 1 
ATOM 2691 C CA . LYS D  4  88   ? 250.661 225.940 184.087 1.00 0.00 ? 88   LYS E CA 1 
ATOM 2692 C CA . HIS D  4  89   ? 251.634 228.584 186.607 1.00 0.00 ? 89   HIS E CA 1 
ATOM 2693 C CA . ILE D  4  90   ? 248.386 230.075 187.905 1.00 0.00 ? 90   ILE E CA 1 
ATOM 2694 C CA . MET D  4  91   ? 248.489 233.717 188.883 1.00 0.00 ? 91   MET E CA 1 
ATOM 2695 C CA . ILE D  4  92   ? 246.492 235.227 191.725 1.00 0.00 ? 92   ILE E CA 1 
ATOM 2696 C CA . ASP D  4  93   ? 245.656 238.894 192.196 1.00 0.00 ? 93   ASP E CA 1 
ATOM 2697 C CA . LEU D  4  94   ? 246.139 239.203 195.963 1.00 0.00 ? 94   LEU E CA 1 
ATOM 2698 C CA . GLY D  4  95   ? 245.996 242.978 195.756 1.00 0.00 ? 95   GLY E CA 1 
ATOM 2699 C CA . THR D  4  96   ? 249.760 243.124 196.391 1.00 0.00 ? 96   THR E CA 1 
ATOM 2700 C CA . GLY D  4  97   ? 251.041 244.017 192.900 1.00 0.00 ? 97   GLY E CA 1 
ATOM 2701 C CA . ASN D  4  98   ? 252.700 240.601 192.604 1.00 0.00 ? 98   ASN E CA 1 
ATOM 2702 C CA . ASN D  4  99   ? 250.327 238.074 191.035 1.00 0.00 ? 99   ASN E CA 1 
ATOM 2703 C CA . ASN D  4  100  ? 252.862 235.230 190.851 1.00 0.00 ? 100  ASN E CA 1 
ATOM 2704 C CA . LYS D  4  101  ? 252.991 234.022 194.461 1.00 0.00 ? 101  LYS E CA 1 
ATOM 2705 C CA . ILE D  4  102  ? 252.132 234.128 198.159 1.00 0.00 ? 102  ILE E CA 1 
ATOM 2706 C CA . ASN D  4  103  ? 255.379 235.170 199.824 1.00 0.00 ? 103  ASN E CA 1 
ATOM 2707 C CA . TRP D  4  104  ? 254.394 235.701 203.444 1.00 0.00 ? 104  TRP E CA 1 
ATOM 2708 C CA . ALA D  4  105  ? 253.034 233.287 206.029 1.00 0.00 ? 105  ALA E CA 1 
ATOM 2709 C CA . MET D  4  106  ? 249.331 233.772 206.183 1.00 0.00 ? 106  MET E CA 1 
ATOM 2710 C CA . GLU D  4  107  ? 248.181 231.772 209.172 1.00 0.00 ? 107  GLU E CA 1 
ATOM 2711 C CA . ASP D  4  108  ? 244.469 231.978 208.384 1.00 0.00 ? 108  ASP E CA 1 
ATOM 2712 C CA . LYS D  4  109  ? 243.612 228.339 207.654 1.00 0.00 ? 109  LYS E CA 1 
ATOM 2713 C CA . GLN D  4  110  ? 240.179 228.664 205.999 1.00 0.00 ? 110  GLN E CA 1 
ATOM 2714 C CA . GLU D  4  111  ? 241.520 231.704 204.108 1.00 0.00 ? 111  GLU E CA 1 
ATOM 2715 C CA . MET D  4  112  ? 244.226 229.516 202.549 1.00 0.00 ? 112  MET E CA 1 
ATOM 2716 C CA . VAL D  4  113  ? 241.622 226.846 201.766 1.00 0.00 ? 113  VAL E CA 1 
ATOM 2717 C CA . ASP D  4  114  ? 239.434 229.463 200.039 1.00 0.00 ? 114  ASP E CA 1 
ATOM 2718 C CA . ILE D  4  115  ? 242.413 230.710 198.008 1.00 0.00 ? 115  ILE E CA 1 
ATOM 2719 C CA . ILE D  4  116  ? 243.286 227.198 196.825 1.00 0.00 ? 116  ILE E CA 1 
ATOM 2720 C CA . GLU D  4  117  ? 239.642 226.558 195.913 1.00 0.00 ? 117  GLU E CA 1 
ATOM 2721 C CA . THR D  4  118  ? 239.536 229.827 193.936 1.00 0.00 ? 118  THR E CA 1 
ATOM 2722 C CA . VAL D  4  119  ? 242.729 228.847 192.088 1.00 0.00 ? 119  VAL E CA 1 
ATOM 2723 C CA . TYR D  4  120  ? 241.251 225.404 191.312 1.00 0.00 ? 120  TYR E CA 1 
ATOM 2724 C CA . ARG D  4  121  ? 237.889 226.752 190.141 1.00 0.00 ? 121  ARG E CA 1 
ATOM 2725 C CA . GLY D  4  122  ? 239.476 229.535 188.108 1.00 0.00 ? 122  GLY E CA 1 
ATOM 2726 C CA . ALA D  4  123  ? 242.099 227.373 186.411 1.00 0.00 ? 123  ALA E CA 1 
ATOM 2727 C CA . ARG D  4  124  ? 239.627 224.596 185.570 1.00 0.00 ? 124  ARG E CA 1 
ATOM 2728 C CA . LYS D  4  125  ? 237.668 227.200 183.603 1.00 0.00 ? 125  LYS E CA 1 
ATOM 2729 C CA . GLY D  4  126  ? 240.852 228.295 181.834 1.00 0.00 ? 126  GLY E CA 1 
ATOM 2730 C CA . ARG D  4  127  ? 241.602 231.428 183.845 1.00 0.00 ? 127  ARG E CA 1 
ATOM 2731 C CA . GLY D  4  128  ? 245.369 231.992 184.026 1.00 0.00 ? 128  GLY E CA 1 
ATOM 2732 C CA . LEU D  4  129  ? 244.714 234.792 186.526 1.00 0.00 ? 129  LEU E CA 1 
ATOM 2733 C CA . VAL D  4  130  ? 242.312 234.680 189.493 1.00 0.00 ? 130  VAL E CA 1 
ATOM 2734 C CA . VAL D  4  131  ? 241.451 237.129 192.323 1.00 0.00 ? 131  VAL E CA 1 
ATOM 2735 C CA . SER D  4  132  ? 241.926 236.336 196.017 1.00 0.00 ? 132  SER E CA 1 
ATOM 2736 C CA . PRO D  4  133  ? 238.693 236.648 198.067 1.00 0.00 ? 133  PRO E CA 1 
ATOM 2737 C CA . LYS D  4  134  ? 240.443 238.937 200.589 1.00 0.00 ? 134  LYS E CA 1 
ATOM 2738 C CA . ASP D  4  135  ? 242.518 242.023 199.661 1.00 0.00 ? 135  ASP E CA 1 
ATOM 2739 C CA . TYR D  4  136  ? 246.015 241.736 201.202 1.00 0.00 ? 136  TYR E CA 1 
ATOM 2740 C CA . SER D  4  137  ? 246.489 245.530 200.924 1.00 0.00 ? 137  SER E CA 1 
ATOM 2741 C CA . SER E  5  26   ? 232.257 252.736 110.193 1.00 0.00 ? 26   SER A CA 1 
ATOM 2742 C CA . GLU E  5  27   ? 230.200 250.970 107.494 1.00 0.00 ? 27   GLU A CA 1 
ATOM 2743 C CA . GLU E  5  28   ? 233.410 249.213 106.399 1.00 0.00 ? 28   GLU A CA 1 
ATOM 2744 C CA . LYS E  5  29   ? 234.353 248.377 110.006 1.00 0.00 ? 29   LYS A CA 1 
ATOM 2745 C CA . LEU E  5  30   ? 231.010 246.708 110.823 1.00 0.00 ? 30   LEU A CA 1 
ATOM 2746 C CA . GLN E  5  31   ? 230.915 244.965 107.446 1.00 0.00 ? 31   GLN A CA 1 
ATOM 2747 C CA . GLU E  5  32   ? 234.289 243.343 108.179 1.00 0.00 ? 32   GLU A CA 1 
ATOM 2748 C CA . LYS E  5  33   ? 233.374 242.426 111.783 1.00 0.00 ? 33   LYS A CA 1 
ATOM 2749 C CA . ALA E  5  34   ? 230.456 240.288 110.566 1.00 0.00 ? 34   ALA A CA 1 
ATOM 2750 C CA . ARG E  5  35   ? 232.517 238.697 107.772 1.00 0.00 ? 35   ARG A CA 1 
ATOM 2751 C CA . LYS E  5  36   ? 234.973 237.417 110.403 1.00 0.00 ? 36   LYS A CA 1 
ATOM 2752 C CA . TRP E  5  37   ? 232.106 236.387 112.682 1.00 0.00 ? 37   TRP A CA 1 
ATOM 2753 C CA . GLN E  5  38   ? 230.064 234.496 110.069 1.00 0.00 ? 38   GLN A CA 1 
ATOM 2754 C CA . GLN E  5  39   ? 233.106 232.442 109.009 1.00 0.00 ? 39   GLN A CA 1 
ATOM 2755 C CA . LEU E  5  40   ? 233.798 231.481 112.648 1.00 0.00 ? 40   LEU A CA 1 
ATOM 2756 C CA . GLN E  5  41   ? 230.169 230.381 113.025 1.00 0.00 ? 41   GLN A CA 1 
ATOM 2757 C CA . ALA E  5  42   ? 230.490 228.531 109.703 1.00 0.00 ? 42   ALA A CA 1 
ATOM 2758 C CA . LYS E  5  43   ? 233.469 226.486 110.987 1.00 0.00 ? 43   LYS A CA 1 
ATOM 2759 C CA . ARG E  5  44   ? 231.492 225.607 114.136 1.00 0.00 ? 44   ARG A CA 1 
ATOM 2760 C CA . TYR E  5  45   ? 228.128 224.383 112.742 1.00 0.00 ? 45   TYR A CA 1 
ATOM 2761 C CA . ALA E  5  46   ? 227.861 220.823 113.937 1.00 0.00 ? 46   ALA A CA 1 
ATOM 2762 C CA . GLU E  5  47   ? 227.969 219.930 117.669 1.00 0.00 ? 47   GLU A CA 1 
ATOM 2763 C CA . LYS E  5  48   ? 225.332 219.915 120.387 1.00 0.00 ? 48   LYS A CA 1 
ATOM 2764 C CA . ARG E  5  49   ? 223.499 223.093 119.733 1.00 0.00 ? 49   ARG A CA 1 
ATOM 2765 C CA . LYS E  5  50   ? 223.867 225.645 122.456 1.00 0.00 ? 50   LYS A CA 1 
ATOM 2766 C CA . PHE E  5  51   ? 226.226 228.603 122.365 1.00 0.00 ? 51   PHE A CA 1 
ATOM 2767 C CA . GLY E  5  52   ? 228.477 229.436 125.326 1.00 0.00 ? 52   GLY A CA 1 
ATOM 2768 C CA . PHE E  5  53   ? 227.597 226.273 127.214 1.00 0.00 ? 53   PHE A CA 1 
ATOM 2769 C CA . MET E  5  61   ? 238.108 205.082 136.159 1.00 0.00 ? 61   MET A CA 1 
ATOM 2770 C CA . PRO E  5  62   ? 239.023 201.502 135.699 1.00 0.00 ? 62   PRO A CA 1 
ATOM 2771 C CA . PRO E  5  63   ? 238.746 199.173 138.800 1.00 0.00 ? 63   PRO A CA 1 
ATOM 2772 C CA . GLU E  5  64   ? 242.488 198.397 138.632 1.00 0.00 ? 64   GLU A CA 1 
ATOM 2773 C CA . HIS E  5  65   ? 243.405 202.057 139.232 1.00 0.00 ? 65   HIS A CA 1 
ATOM 2774 C CA . VAL E  5  66   ? 242.175 201.826 142.844 1.00 0.00 ? 66   VAL A CA 1 
ATOM 2775 C CA . ARG E  5  67   ? 243.418 198.271 143.434 1.00 0.00 ? 67   ARG A CA 1 
ATOM 2776 C CA . LYS E  5  68   ? 246.976 199.310 142.508 1.00 0.00 ? 68   LYS A CA 1 
ATOM 2777 C CA . ILE E  5  69   ? 247.026 202.166 145.046 1.00 0.00 ? 69   ILE A CA 1 
ATOM 2778 C CA . ILE E  5  70   ? 246.261 199.716 147.880 1.00 0.00 ? 70   ILE A CA 1 
ATOM 2779 C CA . ARG E  5  71   ? 249.236 197.560 146.862 1.00 0.00 ? 71   ARG A CA 1 
ATOM 2780 C CA . ASP E  5  72   ? 251.676 200.457 146.350 1.00 0.00 ? 72   ASP A CA 1 
ATOM 2781 C CA . HIS E  5  73   ? 250.818 202.173 149.655 1.00 0.00 ? 73   HIS A CA 1 
ATOM 2782 C CA . GLY E  5  74   ? 250.951 198.921 151.655 1.00 0.00 ? 74   GLY A CA 1 
ATOM 2783 C CA . ASP E  5  75   ? 251.150 199.776 155.364 1.00 0.00 ? 75   ASP A CA 1 
ATOM 2784 C CA . MET E  5  76   ? 252.293 203.386 154.869 1.00 0.00 ? 76   MET A CA 1 
ATOM 2785 C CA . THR E  5  77   ? 255.945 202.509 155.486 1.00 0.00 ? 77   THR A CA 1 
ATOM 2786 C CA . ASN E  5  78   ? 257.936 204.026 152.603 1.00 0.00 ? 78   ASN A CA 1 
ATOM 2787 C CA . ARG E  5  79   ? 258.969 207.677 152.297 1.00 0.00 ? 79   ARG A CA 1 
ATOM 2788 C CA . LYS E  5  80   ? 257.624 207.926 148.724 1.00 0.00 ? 80   LYS A CA 1 
ATOM 2789 C CA . PHE E  5  81   ? 254.206 208.564 150.344 1.00 0.00 ? 81   PHE A CA 1 
ATOM 2790 C CA . ARG E  5  82   ? 255.442 210.731 153.267 1.00 0.00 ? 82   ARG A CA 1 
ATOM 2791 C CA . HIS E  5  83   ? 253.095 213.446 151.942 1.00 0.00 ? 83   HIS A CA 1 
ATOM 2792 C CA . ASP E  5  84   ? 249.825 211.472 152.154 1.00 0.00 ? 84   ASP A CA 1 
ATOM 2793 C CA . LYS E  5  85   ? 250.348 210.594 155.839 1.00 0.00 ? 85   LYS A CA 1 
ATOM 2794 C CA . ARG E  5  86   ? 248.903 213.978 156.896 1.00 0.00 ? 86   ARG A CA 1 
ATOM 2795 C CA . VAL E  5  87   ? 245.590 213.290 155.114 1.00 0.00 ? 87   VAL A CA 1 
ATOM 2796 C CA . TYR E  5  88   ? 245.560 209.628 156.205 1.00 0.00 ? 88   TYR A CA 1 
ATOM 2797 C CA . LEU E  5  89   ? 244.713 210.681 159.771 1.00 0.00 ? 89   LEU A CA 1 
ATOM 2798 C CA . GLY E  5  90   ? 242.378 213.304 158.349 1.00 0.00 ? 90   GLY A CA 1 
ATOM 2799 C CA . ALA E  5  91   ? 240.361 210.349 156.995 1.00 0.00 ? 91   ALA A CA 1 
ATOM 2800 C CA . LEU E  5  92   ? 239.928 208.829 160.482 1.00 0.00 ? 92   LEU A CA 1 
ATOM 2801 C CA . LYS E  5  93   ? 237.117 211.298 161.141 1.00 0.00 ? 93   LYS A CA 1 
ATOM 2802 C CA . TYR E  5  94   ? 235.079 209.680 158.315 1.00 0.00 ? 94   TYR A CA 1 
ATOM 2803 C CA . MET E  5  95   ? 235.801 206.008 159.120 1.00 0.00 ? 95   MET A CA 1 
ATOM 2804 C CA . PRO E  5  96   ? 232.605 205.430 161.203 1.00 0.00 ? 96   PRO A CA 1 
ATOM 2805 C CA . HIS E  5  97   ? 230.678 206.692 158.171 1.00 0.00 ? 97   HIS A CA 1 
ATOM 2806 C CA . ALA E  5  98   ? 232.425 204.156 155.889 1.00 0.00 ? 98   ALA A CA 1 
ATOM 2807 C CA . VAL E  5  99   ? 231.497 201.174 158.092 1.00 0.00 ? 99   VAL A CA 1 
ATOM 2808 C CA . LEU E  5  100  ? 227.860 202.283 157.981 1.00 0.00 ? 100  LEU A CA 1 
ATOM 2809 C CA . LYS E  5  101  ? 227.627 202.401 154.176 1.00 0.00 ? 101  LYS A CA 1 
ATOM 2810 C CA . LEU E  5  102  ? 229.400 199.049 153.915 1.00 0.00 ? 102  LEU A CA 1 
ATOM 2811 C CA . LEU E  5  103  ? 227.071 197.157 156.273 1.00 0.00 ? 103  LEU A CA 1 
ATOM 2812 C CA . GLU E  5  104  ? 223.817 198.563 154.884 1.00 0.00 ? 104  GLU A CA 1 
ATOM 2813 C CA . ASN E  5  105  ? 225.027 196.895 151.680 1.00 0.00 ? 105  ASN A CA 1 
ATOM 2814 C CA . MET E  5  106  ? 225.958 193.352 152.836 1.00 0.00 ? 106  MET A CA 1 
ATOM 2815 C CA . PRO E  5  107  ? 225.214 190.998 149.922 1.00 0.00 ? 107  PRO A CA 1 
ATOM 2816 C CA . MET E  5  108  ? 222.435 188.854 151.500 1.00 0.00 ? 108  MET A CA 1 
ATOM 2817 C CA . PRO E  5  109  ? 222.396 185.000 151.451 1.00 0.00 ? 109  PRO A CA 1 
ATOM 2818 C CA . TRP E  5  110  ? 220.937 184.185 148.009 1.00 0.00 ? 110  TRP A CA 1 
ATOM 2819 C CA . GLU E  5  111  ? 223.547 186.393 146.266 1.00 0.00 ? 111  GLU A CA 1 
ATOM 2820 C CA . GLN E  5  112  ? 226.861 184.901 145.154 1.00 0.00 ? 112  GLN A CA 1 
ATOM 2821 C CA . ILE E  5  113  ? 228.890 188.157 145.375 1.00 0.00 ? 113  ILE A CA 1 
ATOM 2822 C CA . ARG E  5  114  ? 227.205 191.489 144.437 1.00 0.00 ? 114  ARG A CA 1 
ATOM 2823 C CA . ASP E  5  115  ? 228.940 194.411 142.730 1.00 0.00 ? 115  ASP A CA 1 
ATOM 2824 C CA . VAL E  5  116  ? 228.925 197.886 144.315 1.00 0.00 ? 116  VAL A CA 1 
ATOM 2825 C CA . PRO E  5  117  ? 230.053 201.472 143.444 1.00 0.00 ? 117  PRO A CA 1 
ATOM 2826 C CA . VAL E  5  118  ? 232.686 203.348 145.423 1.00 0.00 ? 118  VAL A CA 1 
ATOM 2827 C CA . LEU E  5  119  ? 234.198 206.702 146.357 1.00 0.00 ? 119  LEU A CA 1 
ATOM 2828 C CA . TYR E  5  120  ? 237.908 206.424 147.111 1.00 0.00 ? 120  TYR A CA 1 
ATOM 2829 C CA . HIS E  5  121  ? 240.317 209.141 148.152 1.00 0.00 ? 121  HIS A CA 1 
ATOM 2830 C CA . ILE E  5  122  ? 242.951 209.167 145.377 1.00 0.00 ? 122  ILE A CA 1 
ATOM 2831 C CA . THR E  5  123  ? 245.322 208.992 148.356 1.00 0.00 ? 123  THR A CA 1 
ATOM 2832 C CA . GLY E  5  124  ? 243.956 205.453 148.993 1.00 0.00 ? 124  GLY A CA 1 
ATOM 2833 C CA . ALA E  5  125  ? 242.756 206.732 152.363 1.00 0.00 ? 125  ALA A CA 1 
ATOM 2834 C CA . ILE E  5  126  ? 239.175 205.346 152.452 1.00 0.00 ? 126  ILE A CA 1 
ATOM 2835 C CA . SER E  5  127  ? 236.499 203.562 150.423 1.00 0.00 ? 127  SER A CA 1 
ATOM 2836 C CA . PHE E  5  128  ? 232.882 204.762 150.660 1.00 0.00 ? 128  PHE A CA 1 
ATOM 2837 C CA . VAL E  5  129  ? 230.309 202.264 149.404 1.00 0.00 ? 129  VAL A CA 1 
ATOM 2838 C CA . ASN E  5  130  ? 228.109 204.759 147.554 1.00 0.00 ? 130  ASN A CA 1 
ATOM 2839 C CA . GLU E  5  131  ? 224.902 202.760 147.065 1.00 0.00 ? 131  GLU A CA 1 
ATOM 2840 C CA . ILE E  5  132  ? 221.900 202.253 149.233 1.00 0.00 ? 132  ILE A CA 1 
ATOM 2841 C CA . PRO E  5  133  ? 220.487 198.686 149.138 1.00 0.00 ? 133  PRO A CA 1 
ATOM 2842 C CA . TRP E  5  134  ? 217.113 199.714 147.621 1.00 0.00 ? 134  TRP A CA 1 
ATOM 2843 C CA . VAL E  5  135  ? 214.658 196.856 147.100 1.00 0.00 ? 135  VAL A CA 1 
ATOM 2844 C CA . ILE E  5  136  ? 211.014 196.265 146.148 1.00 0.00 ? 136  ILE A CA 1 
ATOM 2845 C CA . GLU E  5  137  ? 209.256 195.187 149.294 1.00 0.00 ? 137  GLU A CA 1 
ATOM 2846 C CA . PRO E  5  138  ? 206.796 192.325 148.485 1.00 0.00 ? 138  PRO A CA 1 
ATOM 2847 C CA . VAL E  5  139  ? 209.620 190.644 146.531 1.00 0.00 ? 139  VAL A CA 1 
ATOM 2848 C CA . TYR E  5  140  ? 212.248 191.046 149.260 1.00 0.00 ? 140  TYR A CA 1 
ATOM 2849 C CA . ILE E  5  141  ? 209.810 189.549 151.784 1.00 0.00 ? 141  ILE A CA 1 
ATOM 2850 C CA . SER E  5  142  ? 209.206 186.609 149.440 1.00 0.00 ? 142  SER A CA 1 
ATOM 2851 C CA . GLN E  5  143  ? 212.966 186.061 149.155 1.00 0.00 ? 143  GLN A CA 1 
ATOM 2852 C CA . TRP E  5  144  ? 213.690 186.117 152.914 1.00 0.00 ? 144  TRP A CA 1 
ATOM 2853 C CA . GLY E  5  145  ? 210.669 183.802 153.327 1.00 0.00 ? 145  GLY A CA 1 
ATOM 2854 C CA . SER E  5  146  ? 212.263 181.468 150.780 1.00 0.00 ? 146  SER A CA 1 
ATOM 2855 C CA . MET E  5  147  ? 215.448 181.548 152.892 1.00 0.00 ? 147  MET A CA 1 
ATOM 2856 C CA . TRP E  5  148  ? 213.533 180.593 156.018 1.00 0.00 ? 148  TRP A CA 1 
ATOM 2857 C CA . ILE E  5  149  ? 212.223 177.667 153.938 1.00 0.00 ? 149  ILE A CA 1 
ATOM 2858 C CA . MET E  5  150  ? 215.642 176.269 152.902 1.00 0.00 ? 150  MET A CA 1 
ATOM 2859 C CA . MET E  5  151  ? 217.262 177.154 156.225 1.00 0.00 ? 151  MET A CA 1 
ATOM 2860 C CA . ARG E  5  152  ? 214.870 174.969 158.258 1.00 0.00 ? 152  ARG A CA 1 
ATOM 2861 C CA . ARG E  5  153  ? 214.799 172.141 155.708 1.00 0.00 ? 153  ARG A CA 1 
ATOM 2862 C CA . GLU E  5  154  ? 218.611 172.164 155.522 1.00 0.00 ? 154  GLU A CA 1 
ATOM 2863 C CA . LYS E  5  155  ? 219.093 172.094 159.321 1.00 0.00 ? 155  LYS A CA 1 
ATOM 2864 C CA . ARG E  5  156  ? 217.098 168.849 159.581 1.00 0.00 ? 156  ARG A CA 1 
ATOM 2865 C CA . ASP E  5  157  ? 218.895 166.984 156.765 1.00 0.00 ? 157  ASP A CA 1 
ATOM 2866 C CA . ARG E  5  158  ? 222.493 167.894 157.659 1.00 0.00 ? 158  ARG A CA 1 
ATOM 2867 C CA . ARG E  5  159  ? 223.128 166.185 161.029 1.00 0.00 ? 159  ARG A CA 1 
ATOM 2868 C CA . HIS E  5  160  ? 226.706 167.463 161.548 1.00 0.00 ? 160  HIS A CA 1 
ATOM 2869 C CA . PHE E  5  161  ? 226.492 171.257 161.294 1.00 0.00 ? 161  PHE A CA 1 
ATOM 2870 C CA . LYS E  5  162  ? 229.922 172.829 161.863 1.00 0.00 ? 162  LYS A CA 1 
ATOM 2871 C CA . ARG E  5  163  ? 229.532 176.473 162.915 1.00 0.00 ? 163  ARG A CA 1 
ATOM 2872 C CA . MET E  5  164  ? 232.351 178.934 162.089 1.00 0.00 ? 164  MET A CA 1 
ATOM 2873 C CA . ARG E  5  165  ? 235.500 179.167 164.225 1.00 0.00 ? 165  ARG A CA 1 
ATOM 2874 C CA . PHE E  5  166  ? 235.644 182.971 164.471 1.00 0.00 ? 166  PHE A CA 1 
ATOM 2875 C CA . PRO E  5  167  ? 238.627 185.186 164.782 1.00 0.00 ? 167  PRO A CA 1 
ATOM 2876 C CA . PRO E  5  168  ? 238.358 183.579 161.320 1.00 0.00 ? 168  PRO A CA 1 
ATOM 2877 C CA . PHE E  5  169  ? 242.054 184.289 160.736 1.00 0.00 ? 169  PHE A CA 1 
ATOM 2878 C CA . ASP E  5  170  ? 244.650 184.276 163.520 1.00 0.00 ? 170  ASP A CA 1 
ATOM 2879 C CA . ASP E  5  171  ? 245.743 187.592 165.081 1.00 0.00 ? 171  ASP A CA 1 
ATOM 2880 C CA . GLU E  5  172  ? 249.315 187.560 163.739 1.00 0.00 ? 172  GLU A CA 1 
ATOM 2881 C CA . GLU E  5  173  ? 248.335 186.582 160.186 1.00 0.00 ? 173  GLU A CA 1 
ATOM 2882 C CA . PRO E  5  174  ? 248.224 189.529 157.734 1.00 0.00 ? 174  PRO A CA 1 
ATOM 2883 C CA . PRO E  5  175  ? 245.006 190.267 155.761 1.00 0.00 ? 175  PRO A CA 1 
ATOM 2884 C CA . LEU E  5  176  ? 244.092 188.435 152.554 1.00 0.00 ? 176  LEU A CA 1 
ATOM 2885 C CA . ASP E  5  177  ? 243.228 191.500 150.435 1.00 0.00 ? 177  ASP A CA 1 
ATOM 2886 C CA . TYR E  5  178  ? 246.905 192.526 150.320 1.00 0.00 ? 178  TYR A CA 1 
ATOM 2887 C CA . ALA E  5  179  ? 247.762 189.064 148.969 1.00 0.00 ? 179  ALA A CA 1 
ATOM 2888 C CA . ASP E  5  180  ? 244.807 189.240 146.534 1.00 0.00 ? 180  ASP A CA 1 
ATOM 2889 C CA . ASN E  5  181  ? 244.077 185.669 145.223 1.00 0.00 ? 181  ASN A CA 1 
ATOM 2890 C CA . ILE E  5  182  ? 240.304 186.025 145.728 1.00 0.00 ? 182  ILE A CA 1 
ATOM 2891 C CA . LEU E  5  183  ? 239.780 187.145 142.115 1.00 0.00 ? 183  LEU A CA 1 
ATOM 2892 C CA . ASP E  5  184  ? 240.874 183.681 140.946 1.00 0.00 ? 184  ASP A CA 1 
ATOM 2893 C CA . VAL E  5  185  ? 239.037 181.357 143.359 1.00 0.00 ? 185  VAL A CA 1 
ATOM 2894 C CA . GLU E  5  186  ? 235.622 181.612 141.669 1.00 0.00 ? 186  GLU A CA 1 
ATOM 2895 C CA . PRO E  5  187  ? 232.506 182.342 143.790 1.00 0.00 ? 187  PRO A CA 1 
ATOM 2896 C CA . LEU E  5  188  ? 230.805 178.983 144.641 1.00 0.00 ? 188  LEU A CA 1 
ATOM 2897 C CA . GLU E  5  189  ? 227.004 178.462 144.765 1.00 0.00 ? 189  GLU A CA 1 
ATOM 2898 C CA . ALA E  5  190  ? 224.678 179.909 147.447 1.00 0.00 ? 190  ALA A CA 1 
ATOM 2899 C CA . ILE E  5  191  ? 221.268 178.908 148.869 1.00 0.00 ? 191  ILE A CA 1 
ATOM 2900 C CA . GLN E  5  192  ? 218.333 179.678 146.503 1.00 0.00 ? 192  GLN A CA 1 
ATOM 2901 C CA . LEU E  5  193  ? 215.210 177.532 146.159 1.00 0.00 ? 193  LEU A CA 1 
ATOM 2902 C CA . GLU E  5  194  ? 214.063 175.067 143.464 1.00 0.00 ? 194  GLU A CA 1 
ATOM 2903 C CA . LEU E  5  195  ? 211.489 176.967 141.518 1.00 0.00 ? 195  LEU A CA 1 
ATOM 2904 C CA . ASP E  5  196  ? 209.643 174.667 139.168 1.00 0.00 ? 196  ASP A CA 1 
ATOM 2905 C CA . PRO E  5  197  ? 208.999 176.163 135.694 1.00 0.00 ? 197  PRO A CA 1 
ATOM 2906 C CA . GLU E  5  198  ? 205.329 175.146 135.441 1.00 0.00 ? 198  GLU A CA 1 
ATOM 2907 C CA . GLU E  5  199  ? 204.249 176.994 138.596 1.00 0.00 ? 199  GLU A CA 1 
ATOM 2908 C CA . ASP E  5  200  ? 206.716 179.809 139.332 1.00 0.00 ? 200  ASP A CA 1 
ATOM 2909 C CA . ALA E  5  201  ? 207.090 180.835 135.655 1.00 0.00 ? 201  ALA A CA 1 
ATOM 2910 C CA . PRO E  5  202  ? 206.562 184.644 136.035 1.00 0.00 ? 202  PRO A CA 1 
ATOM 2911 C CA . VAL E  5  203  ? 209.274 185.052 138.723 1.00 0.00 ? 203  VAL A CA 1 
ATOM 2912 C CA . LEU E  5  204  ? 211.955 182.467 137.935 1.00 0.00 ? 204  LEU A CA 1 
ATOM 2913 C CA . ASP E  5  205  ? 213.878 184.718 135.570 1.00 0.00 ? 205  ASP A CA 1 
ATOM 2914 C CA . TRP E  5  206  ? 214.628 187.372 138.225 1.00 0.00 ? 206  TRP A CA 1 
ATOM 2915 C CA . PHE E  5  207  ? 213.650 186.047 141.672 1.00 0.00 ? 207  PHE A CA 1 
ATOM 2916 C CA . TYR E  5  208  ? 217.366 186.105 142.633 1.00 0.00 ? 208  TYR A CA 1 
ATOM 2917 C CA . ASP E  5  209  ? 219.006 189.228 141.141 1.00 0.00 ? 209  ASP A CA 1 
ATOM 2918 C CA . HIS E  5  210  ? 220.448 192.289 142.906 1.00 0.00 ? 210  HIS A CA 1 
ATOM 2919 C CA . GLN E  5  211  ? 218.356 195.058 141.288 1.00 0.00 ? 211  GLN A CA 1 
ATOM 2920 C CA . PRO E  5  212  ? 215.645 192.682 140.046 1.00 0.00 ? 212  PRO A CA 1 
ATOM 2921 C CA . LEU E  5  213  ? 214.081 194.000 136.823 1.00 0.00 ? 213  LEU A CA 1 
ATOM 2922 C CA . ARG E  5  214  ? 216.262 197.087 136.265 1.00 0.00 ? 214  ARG A CA 1 
ATOM 2923 C CA . ASP E  5  215  ? 215.918 196.607 132.496 1.00 0.00 ? 215  ASP A CA 1 
ATOM 2924 C CA . SER E  5  216  ? 212.171 196.028 132.038 1.00 0.00 ? 216  SER A CA 1 
ATOM 2925 C CA . ARG E  5  217  ? 209.241 198.450 132.241 1.00 0.00 ? 217  ARG A CA 1 
ATOM 2926 C CA . LYS E  5  218  ? 207.153 196.085 134.367 1.00 0.00 ? 218  LYS A CA 1 
ATOM 2927 C CA . TYR E  5  219  ? 207.679 198.450 137.182 1.00 0.00 ? 219  TYR A CA 1 
ATOM 2928 C CA . VAL E  5  220  ? 209.826 201.183 135.750 1.00 0.00 ? 220  VAL A CA 1 
ATOM 2929 C CA . ASN E  5  221  ? 211.859 203.384 136.476 1.00 0.00 ? 221  ASN A CA 1 
ATOM 2930 C CA . GLY E  5  222  ? 215.381 202.533 135.378 1.00 0.00 ? 222  GLY A CA 1 
ATOM 2931 C CA . SER E  5  223  ? 218.743 202.153 137.125 1.00 0.00 ? 223  SER A CA 1 
ATOM 2932 C CA . THR E  5  224  ? 217.730 204.577 139.931 1.00 0.00 ? 224  THR A CA 1 
ATOM 2933 C CA . TYR E  5  225  ? 215.358 201.756 140.908 1.00 0.00 ? 225  TYR A CA 1 
ATOM 2934 C CA . GLN E  5  226  ? 212.613 203.795 142.587 1.00 0.00 ? 226  GLN A CA 1 
ATOM 2935 C CA . ARG E  5  227  ? 208.945 203.078 141.694 1.00 0.00 ? 227  ARG A CA 1 
ATOM 2936 C CA . TRP E  5  228  ? 207.865 199.592 140.630 1.00 0.00 ? 228  TRP A CA 1 
ATOM 2937 C CA . GLN E  5  229  ? 204.743 198.094 138.899 1.00 0.00 ? 229  GLN A CA 1 
ATOM 2938 C CA . PHE E  5  230  ? 204.066 194.362 139.139 1.00 0.00 ? 230  PHE A CA 1 
ATOM 2939 C CA . THR E  5  231  ? 201.719 192.180 137.114 1.00 0.00 ? 231  THR A CA 1 
ATOM 2940 C CA . LEU E  5  232  ? 198.870 190.343 138.852 1.00 0.00 ? 232  LEU A CA 1 
ATOM 2941 C CA . PRO E  5  233  ? 200.327 186.803 138.388 1.00 0.00 ? 233  PRO A CA 1 
ATOM 2942 C CA . MET E  5  234  ? 203.724 188.025 139.677 1.00 0.00 ? 234  MET A CA 1 
ATOM 2943 C CA . MET E  5  235  ? 202.340 189.508 142.899 1.00 0.00 ? 235  MET A CA 1 
ATOM 2944 C CA . SER E  5  236  ? 200.474 186.195 143.152 1.00 0.00 ? 236  SER A CA 1 
ATOM 2945 C CA . THR E  5  237  ? 203.678 184.121 143.241 1.00 0.00 ? 237  THR A CA 1 
ATOM 2946 C CA . LEU E  5  238  ? 205.504 186.541 145.565 1.00 0.00 ? 238  LEU A CA 1 
ATOM 2947 C CA . TYR E  5  239  ? 202.570 186.314 147.965 1.00 0.00 ? 239  TYR A CA 1 
ATOM 2948 C CA . ARG E  5  240  ? 202.532 182.516 147.704 1.00 0.00 ? 240  ARG A CA 1 
ATOM 2949 C CA . LEU E  5  241  ? 206.321 182.315 148.244 1.00 0.00 ? 241  LEU A CA 1 
ATOM 2950 C CA . ALA E  5  242  ? 206.400 184.780 151.144 1.00 0.00 ? 242  ALA A CA 1 
ATOM 2951 C CA . ASN E  5  243  ? 203.269 183.208 152.701 1.00 0.00 ? 243  ASN A CA 1 
ATOM 2952 C CA . GLN E  5  244  ? 205.196 181.681 155.634 1.00 0.00 ? 244  GLN A CA 1 
ATOM 2953 C CA . LEU E  5  245  ? 206.224 185.194 156.765 1.00 0.00 ? 245  LEU A CA 1 
ATOM 2954 C CA . LEU E  5  246  ? 203.384 187.739 156.382 1.00 0.00 ? 246  LEU A CA 1 
ATOM 2955 C CA . THR E  5  247  ? 200.341 187.759 158.685 1.00 0.00 ? 247  THR A CA 1 
ATOM 2956 C CA . ASP E  5  248  ? 196.676 186.629 158.428 1.00 0.00 ? 248  ASP A CA 1 
ATOM 2957 C CA . LEU E  5  249  ? 194.401 189.138 160.227 1.00 0.00 ? 249  LEU A CA 1 
ATOM 2958 C CA . VAL E  5  250  ? 192.845 191.432 157.571 1.00 0.00 ? 250  VAL A CA 1 
ATOM 2959 C CA . ASP E  5  251  ? 190.253 192.722 160.094 1.00 0.00 ? 251  ASP A CA 1 
ATOM 2960 C CA . ASP E  5  252  ? 192.069 194.961 162.611 1.00 0.00 ? 252  ASP A CA 1 
ATOM 2961 C CA . ASN E  5  253  ? 189.258 194.379 165.144 1.00 0.00 ? 253  ASN A CA 1 
ATOM 2962 C CA . TYR E  5  254  ? 191.651 191.733 166.471 1.00 0.00 ? 254  TYR A CA 1 
ATOM 2963 C CA . PHE E  5  255  ? 193.823 194.433 168.070 1.00 0.00 ? 255  PHE A CA 1 
ATOM 2964 C CA . TYR E  5  256  ? 190.995 196.087 170.100 1.00 0.00 ? 256  TYR A CA 1 
ATOM 2965 C CA . LEU E  5  257  ? 193.099 196.674 173.258 1.00 0.00 ? 257  LEU A CA 1 
ATOM 2966 C CA . PHE E  5  258  ? 196.495 196.305 171.559 1.00 0.00 ? 258  PHE A CA 1 
ATOM 2967 C CA . ASP E  5  259  ? 196.718 199.484 169.471 1.00 0.00 ? 259  ASP A CA 1 
ATOM 2968 C CA . LEU E  5  260  ? 199.458 202.161 169.702 1.00 0.00 ? 260  LEU A CA 1 
ATOM 2969 C CA . LYS E  5  261  ? 196.751 204.397 171.212 1.00 0.00 ? 261  LYS A CA 1 
ATOM 2970 C CA . ALA E  5  262  ? 195.646 202.021 174.002 1.00 0.00 ? 262  ALA A CA 1 
ATOM 2971 C CA . PHE E  5  263  ? 199.303 201.501 174.980 1.00 0.00 ? 263  PHE A CA 1 
ATOM 2972 C CA . PHE E  5  264  ? 199.705 205.285 175.306 1.00 0.00 ? 264  PHE A CA 1 
ATOM 2973 C CA . THR E  5  265  ? 196.827 205.611 177.764 1.00 0.00 ? 265  THR A CA 1 
ATOM 2974 C CA . SER E  5  266  ? 198.127 202.637 179.779 1.00 0.00 ? 266  SER A CA 1 
ATOM 2975 C CA . LYS E  5  267  ? 201.430 204.534 180.008 1.00 0.00 ? 267  LYS A CA 1 
ATOM 2976 C CA . ALA E  5  268  ? 199.561 207.698 181.086 1.00 0.00 ? 268  ALA A CA 1 
ATOM 2977 C CA . LEU E  5  269  ? 197.198 205.976 183.520 1.00 0.00 ? 269  LEU A CA 1 
ATOM 2978 C CA . ASN E  5  270  ? 200.202 204.145 184.969 1.00 0.00 ? 270  ASN A CA 1 
ATOM 2979 C CA . MET E  5  271  ? 198.099 200.959 184.726 1.00 0.00 ? 271  MET A CA 1 
ATOM 2980 C CA . ALA E  5  272  ? 199.436 198.089 182.602 1.00 0.00 ? 272  ALA A CA 1 
ATOM 2981 C CA . ILE E  5  273  ? 197.659 195.711 180.238 1.00 0.00 ? 273  ILE A CA 1 
ATOM 2982 C CA . PRO E  5  274  ? 198.450 191.960 180.372 1.00 0.00 ? 274  PRO A CA 1 
ATOM 2983 C CA . GLY E  5  275  ? 200.254 191.072 177.102 1.00 0.00 ? 275  GLY A CA 1 
ATOM 2984 C CA . GLY E  5  276  ? 201.630 194.578 176.636 1.00 0.00 ? 276  GLY A CA 1 
ATOM 2985 C CA . PRO E  5  277  ? 204.476 196.850 177.873 1.00 0.00 ? 277  PRO A CA 1 
ATOM 2986 C CA . LYS E  5  278  ? 204.940 198.547 181.258 1.00 0.00 ? 278  LYS A CA 1 
ATOM 2987 C CA . PHE E  5  279  ? 206.775 201.838 181.823 1.00 0.00 ? 279  PHE A CA 1 
ATOM 2988 C CA . GLU E  5  280  ? 207.664 204.293 184.562 1.00 0.00 ? 280  GLU A CA 1 
ATOM 2989 C CA . PRO E  5  281  ? 204.648 206.110 186.130 1.00 0.00 ? 281  PRO A CA 1 
ATOM 2990 C CA . LEU E  5  282  ? 204.520 209.400 184.111 1.00 0.00 ? 282  LEU A CA 1 
ATOM 2991 C CA . VAL E  5  283  ? 202.294 211.985 185.851 1.00 0.00 ? 283  VAL A CA 1 
ATOM 2992 C CA . ARG E  5  284  ? 202.514 212.131 189.637 1.00 0.00 ? 284  ARG A CA 1 
ATOM 2993 C CA . ASP E  5  285  ? 199.627 210.410 191.421 1.00 0.00 ? 285  ASP A CA 1 
ATOM 2994 C CA . ILE E  5  286  ? 198.020 212.327 194.314 1.00 0.00 ? 286  ILE A CA 1 
ATOM 2995 C CA . ASN E  5  287  ? 198.215 210.983 197.874 1.00 0.00 ? 287  ASN A CA 1 
ATOM 2996 C CA . LEU E  5  288  ? 194.782 211.499 199.469 1.00 0.00 ? 288  LEU A CA 1 
ATOM 2997 C CA . GLN E  5  289  ? 195.524 209.467 202.592 1.00 0.00 ? 289  GLN A CA 1 
ATOM 2998 C CA . ASP E  5  290  ? 195.368 212.581 204.856 1.00 0.00 ? 290  ASP A CA 1 
ATOM 2999 C CA . GLU E  5  291  ? 191.894 213.626 203.630 1.00 0.00 ? 291  GLU A CA 1 
ATOM 3000 C CA . ASP E  5  292  ? 188.672 212.841 205.510 1.00 0.00 ? 292  ASP A CA 1 
ATOM 3001 C CA . TRP E  5  293  ? 187.260 209.333 204.859 1.00 0.00 ? 293  TRP A CA 1 
ATOM 3002 C CA . ASN E  5  294  ? 184.203 210.720 203.144 1.00 0.00 ? 294  ASN A CA 1 
ATOM 3003 C CA . GLU E  5  295  ? 185.033 213.531 201.206 1.00 0.00 ? 295  GLU A CA 1 
ATOM 3004 C CA . PHE E  5  296  ? 183.731 212.591 197.742 1.00 0.00 ? 296  PHE A CA 1 
ATOM 3005 C CA . ASN E  5  297  ? 184.525 208.880 197.412 1.00 0.00 ? 297  ASN A CA 1 
ATOM 3006 C CA . ASP E  5  298  ? 182.816 207.306 200.468 1.00 0.00 ? 298  ASP A CA 1 
ATOM 3007 C CA . ILE E  5  299  ? 182.216 203.557 200.337 1.00 0.00 ? 299  ILE A CA 1 
ATOM 3008 C CA . ASN E  5  300  ? 178.694 203.945 201.758 1.00 0.00 ? 300  ASN A CA 1 
ATOM 3009 C CA . LYS E  5  301  ? 177.620 206.101 198.785 1.00 0.00 ? 301  LYS A CA 1 
ATOM 3010 C CA . ILE E  5  302  ? 179.026 203.794 196.076 1.00 0.00 ? 302  ILE A CA 1 
ATOM 3011 C CA . ILE E  5  303  ? 177.252 200.702 194.710 1.00 0.00 ? 303  ILE A CA 1 
ATOM 3012 C CA . ILE E  5  304  ? 179.698 197.775 194.369 1.00 0.00 ? 304  ILE A CA 1 
ATOM 3013 C CA . ARG E  5  305  ? 178.570 195.827 191.308 1.00 0.00 ? 305  ARG A CA 1 
ATOM 3014 C CA . GLN E  5  306  ? 181.363 194.217 189.271 1.00 0.00 ? 306  GLN A CA 1 
ATOM 3015 C CA . PRO E  5  307  ? 184.812 195.546 190.316 1.00 0.00 ? 307  PRO A CA 1 
ATOM 3016 C CA . ILE E  5  308  ? 185.635 197.541 187.128 1.00 0.00 ? 308  ILE A CA 1 
ATOM 3017 C CA . ARG E  5  309  ? 188.866 196.268 185.577 1.00 0.00 ? 309  ARG A CA 1 
ATOM 3018 C CA . THR E  5  310  ? 191.862 198.031 184.002 1.00 0.00 ? 310  THR A CA 1 
ATOM 3019 C CA . GLU E  5  311  ? 190.507 197.076 180.558 1.00 0.00 ? 311  GLU A CA 1 
ATOM 3020 C CA . TYR E  5  312  ? 187.583 199.434 181.284 1.00 0.00 ? 312  TYR A CA 1 
ATOM 3021 C CA . LYS E  5  313  ? 189.688 202.532 181.997 1.00 0.00 ? 313  LYS A CA 1 
ATOM 3022 C CA . ILE E  5  314  ? 191.727 202.096 178.794 1.00 0.00 ? 314  ILE A CA 1 
ATOM 3023 C CA . ALA E  5  315  ? 188.526 202.114 176.701 1.00 0.00 ? 315  ALA A CA 1 
ATOM 3024 C CA . PHE E  5  316  ? 186.618 205.136 178.077 1.00 0.00 ? 316  PHE A CA 1 
ATOM 3025 C CA . PRO E  5  317  ? 189.388 207.023 179.945 1.00 0.00 ? 317  PRO A CA 1 
ATOM 3026 C CA . TYR E  5  318  ? 187.268 210.190 180.322 1.00 0.00 ? 318  TYR A CA 1 
ATOM 3027 C CA . LEU E  5  319  ? 184.365 208.237 181.861 1.00 0.00 ? 319  LEU A CA 1 
ATOM 3028 C CA . TYR E  5  320  ? 185.592 205.400 184.105 1.00 0.00 ? 320  TYR A CA 1 
ATOM 3029 C CA . ASN E  5  321  ? 188.785 207.273 185.033 1.00 0.00 ? 321  ASN A CA 1 
ATOM 3030 C CA . ASN E  5  322  ? 189.232 210.695 186.656 1.00 0.00 ? 322  ASN A CA 1 
ATOM 3031 C CA . LEU E  5  323  ? 192.060 213.230 186.262 1.00 0.00 ? 323  LEU A CA 1 
ATOM 3032 C CA . PRO E  5  324  ? 192.861 211.669 182.811 1.00 0.00 ? 324  PRO A CA 1 
ATOM 3033 C CA . HIS E  5  325  ? 195.641 213.663 181.098 1.00 0.00 ? 325  HIS A CA 1 
ATOM 3034 C CA . HIS E  5  326  ? 198.143 212.884 178.313 1.00 0.00 ? 326  HIS A CA 1 
ATOM 3035 C CA . VAL E  5  327  ? 195.635 210.289 177.068 1.00 0.00 ? 327  VAL A CA 1 
ATOM 3036 C CA . HIS E  5  328  ? 194.840 209.207 173.510 1.00 0.00 ? 328  HIS A CA 1 
ATOM 3037 C CA . LEU E  5  329  ? 191.428 207.949 172.423 1.00 0.00 ? 329  LEU A CA 1 
ATOM 3038 C CA . THR E  5  330  ? 191.247 204.808 170.266 1.00 0.00 ? 330  THR A CA 1 
ATOM 3039 C CA . TRP E  5  331  ? 189.342 203.788 167.118 1.00 0.00 ? 331  TRP A CA 1 
ATOM 3040 C CA . TYR E  5  332  ? 186.041 202.281 168.289 1.00 0.00 ? 332  TYR A CA 1 
ATOM 3041 C CA . HIS E  5  333  ? 185.384 199.281 166.016 1.00 0.00 ? 333  HIS A CA 1 
ATOM 3042 C CA . THR E  5  334  ? 185.815 198.631 162.275 1.00 0.00 ? 334  THR A CA 1 
ATOM 3043 C CA . PRO E  5  335  ? 183.347 197.040 159.765 1.00 0.00 ? 335  PRO A CA 1 
ATOM 3044 C CA . ASN E  5  336  ? 184.698 193.452 160.098 1.00 0.00 ? 336  ASN A CA 1 
ATOM 3045 C CA . VAL E  5  337  ? 185.861 191.662 156.937 1.00 0.00 ? 337  VAL A CA 1 
ATOM 3046 C CA . VAL E  5  338  ? 183.793 188.770 155.577 1.00 0.00 ? 338  VAL A CA 1 
ATOM 3047 C CA . PHE E  5  339  ? 186.324 187.251 153.169 1.00 0.00 ? 339  PHE A CA 1 
ATOM 3048 C CA . ILE E  5  340  ? 187.430 183.641 153.541 1.00 0.00 ? 340  ILE A CA 1 
ATOM 3049 C CA . LYS E  5  341  ? 190.027 182.656 150.937 1.00 0.00 ? 341  LYS A CA 1 
ATOM 3050 C CA . THR E  5  342  ? 189.379 179.538 148.840 1.00 0.00 ? 342  THR A CA 1 
ATOM 3051 C CA . GLU E  5  343  ? 191.273 176.628 150.422 1.00 0.00 ? 343  GLU A CA 1 
ATOM 3052 C CA . ASP E  5  344  ? 190.411 174.076 147.710 1.00 0.00 ? 344  ASP A CA 1 
ATOM 3053 C CA . PRO E  5  345  ? 191.171 175.894 144.417 1.00 0.00 ? 345  PRO A CA 1 
ATOM 3054 C CA . ASP E  5  346  ? 188.944 173.976 141.972 1.00 0.00 ? 346  ASP A CA 1 
ATOM 3055 C CA . LEU E  5  347  ? 185.472 175.332 142.685 1.00 0.00 ? 347  LEU A CA 1 
ATOM 3056 C CA . PRO E  5  348  ? 184.902 178.715 140.962 1.00 0.00 ? 348  PRO A CA 1 
ATOM 3057 C CA . ALA E  5  349  ? 185.412 182.254 142.285 1.00 0.00 ? 349  ALA A CA 1 
ATOM 3058 C CA . PHE E  5  350  ? 181.666 182.713 142.898 1.00 0.00 ? 350  PHE A CA 1 
ATOM 3059 C CA . TYR E  5  351  ? 180.358 179.660 144.734 1.00 0.00 ? 351  TYR A CA 1 
ATOM 3060 C CA . PHE E  5  352  ? 177.920 179.874 147.663 1.00 0.00 ? 352  PHE A CA 1 
ATOM 3061 C CA . ASP E  5  353  ? 180.048 178.826 150.643 1.00 0.00 ? 353  ASP A CA 1 
ATOM 3062 C CA . PRO E  5  354  ? 178.627 176.340 153.221 1.00 0.00 ? 354  PRO A CA 1 
ATOM 3063 C CA . LEU E  5  355  ? 179.578 178.710 156.079 1.00 0.00 ? 355  LEU A CA 1 
ATOM 3064 C CA . ILE E  5  356  ? 176.871 181.256 155.224 1.00 0.00 ? 356  ILE A CA 1 
ATOM 3065 C CA . ASN E  5  357  ? 173.477 180.551 156.788 1.00 0.00 ? 357  ASN A CA 1 
ATOM 3066 C CA . PRO E  5  358  ? 170.705 179.304 154.463 1.00 0.00 ? 358  PRO A CA 1 
ATOM 3067 C CA . ILE E  5  359  ? 168.794 182.655 154.097 1.00 0.00 ? 359  ILE A CA 1 
ATOM 3068 C CA . SER E  5  360  ? 165.273 181.333 154.860 1.00 0.00 ? 360  SER A CA 1 
ATOM 3069 C CA . HIS E  5  361  ? 162.567 183.914 155.671 1.00 0.00 ? 361  HIS A CA 1 
ATOM 3070 C CA . ARG E  5  362  ? 158.996 184.168 157.023 1.00 0.00 ? 362  ARG A CA 1 
ATOM 3071 C CA . HIS E  5  363  ? 156.187 186.780 157.108 1.00 0.00 ? 363  HIS A CA 1 
ATOM 3072 C CA . SER E  5  364  ? 154.742 189.252 158.045 1.00 0.00 ? 364  SER A CA 1 
ATOM 3073 C CA . VAL E  5  365  ? 154.407 191.645 155.089 1.00 0.00 ? 365  VAL A CA 1 
ATOM 3074 C CA . LYS E  5  366  ? 151.691 193.919 153.625 1.00 0.00 ? 366  LYS A CA 1 
ATOM 3075 C CA . SER E  5  367  ? 149.017 192.595 151.250 1.00 0.00 ? 367  SER A CA 1 
ATOM 3076 C CA . GLN E  5  368  ? 147.784 193.835 147.863 1.00 0.00 ? 368  GLN A CA 1 
ATOM 3077 C CA . GLU E  5  369  ? 145.276 192.107 145.551 1.00 0.00 ? 369  GLU A CA 1 
ATOM 3078 C CA . PRO E  5  370  ? 147.022 192.670 142.152 1.00 0.00 ? 370  PRO A CA 1 
ATOM 3079 C CA . LEU E  5  371  ? 150.524 191.593 143.238 1.00 0.00 ? 371  LEU A CA 1 
ATOM 3080 C CA . PRO E  5  372  ? 153.500 193.699 142.022 1.00 0.00 ? 372  PRO A CA 1 
ATOM 3081 C CA . ASP E  5  373  ? 154.904 191.208 139.487 1.00 0.00 ? 373  ASP A CA 1 
ATOM 3082 C CA . ASP E  5  374  ? 151.585 190.001 138.032 1.00 0.00 ? 374  ASP A CA 1 
ATOM 3083 C CA . ASP E  5  375  ? 150.423 193.616 137.656 1.00 0.00 ? 375  ASP A CA 1 
ATOM 3084 C CA . GLU E  5  376  ? 153.620 194.790 135.929 1.00 0.00 ? 376  GLU A CA 1 
ATOM 3085 C CA . GLU E  5  377  ? 153.268 192.078 133.256 1.00 0.00 ? 377  GLU A CA 1 
ATOM 3086 C CA . PHE E  5  378  ? 149.452 192.122 133.240 1.00 0.00 ? 378  PHE A CA 1 
ATOM 3087 C CA . GLU E  5  379  ? 149.437 195.716 131.936 1.00 0.00 ? 379  GLU A CA 1 
ATOM 3088 C CA . LEU E  5  380  ? 151.122 194.507 128.748 1.00 0.00 ? 380  LEU A CA 1 
ATOM 3089 C CA . PRO E  5  381  ? 152.644 191.013 128.411 1.00 0.00 ? 381  PRO A CA 1 
ATOM 3090 C CA . GLU E  5  382  ? 156.199 191.065 126.997 1.00 0.00 ? 382  GLU A CA 1 
ATOM 3091 C CA . PHE E  5  383  ? 158.250 188.200 125.548 1.00 0.00 ? 383  PHE A CA 1 
ATOM 3092 C CA . VAL E  5  384  ? 161.958 189.150 125.464 1.00 0.00 ? 384  VAL A CA 1 
ATOM 3093 C CA . GLU E  5  385  ? 165.288 187.836 126.786 1.00 0.00 ? 385  GLU A CA 1 
ATOM 3094 C CA . PRO E  5  386  ? 168.144 189.731 128.508 1.00 0.00 ? 386  PRO A CA 1 
ATOM 3095 C CA . PHE E  5  387  ? 171.752 189.858 127.293 1.00 0.00 ? 387  PHE A CA 1 
ATOM 3096 C CA . LEU E  5  388  ? 175.149 191.236 128.517 1.00 0.00 ? 388  LEU A CA 1 
ATOM 3097 C CA . LYS E  5  389  ? 176.852 189.409 127.082 1.00 0.00 ? 389  LYS A CA 1 
ATOM 3098 C CA . ASP E  5  390  ? 180.160 188.002 126.038 1.00 0.00 ? 390  ASP A CA 1 
ATOM 3099 C CA . THR E  5  391  ? 182.592 188.286 128.953 1.00 0.00 ? 391  THR A CA 1 
ATOM 3100 C CA . PRO E  5  392  ? 181.683 185.584 131.521 1.00 0.00 ? 392  PRO A CA 1 
ATOM 3101 C CA . LEU E  5  393  ? 181.834 186.571 135.213 1.00 0.00 ? 393  LEU A CA 1 
ATOM 3102 C CA . TYR E  5  394  ? 185.162 184.812 135.829 1.00 0.00 ? 394  TYR A CA 1 
ATOM 3103 C CA . THR E  5  395  ? 188.526 185.019 134.068 1.00 0.00 ? 395  THR A CA 1 
ATOM 3104 C CA . ASP E  5  396  ? 191.887 183.234 134.545 1.00 0.00 ? 396  ASP A CA 1 
ATOM 3105 C CA . ASN E  5  397  ? 193.224 185.342 137.429 1.00 0.00 ? 397  ASN A CA 1 
ATOM 3106 C CA . THR E  5  398  ? 189.999 186.655 139.013 1.00 0.00 ? 398  THR A CA 1 
ATOM 3107 C CA . ALA E  5  399  ? 190.592 184.073 141.771 1.00 0.00 ? 399  ALA A CA 1 
ATOM 3108 C CA . ASN E  5  400  ? 194.196 185.055 142.599 1.00 0.00 ? 400  ASN A CA 1 
ATOM 3109 C CA . GLY E  5  401  ? 193.142 188.734 142.530 1.00 0.00 ? 401  GLY A CA 1 
ATOM 3110 C CA . ILE E  5  402  ? 190.406 188.581 145.199 1.00 0.00 ? 402  ILE A CA 1 
ATOM 3111 C CA . ALA E  5  403  ? 192.911 186.865 147.520 1.00 0.00 ? 403  ALA A CA 1 
ATOM 3112 C CA . LEU E  5  404  ? 195.155 189.934 147.214 1.00 0.00 ? 404  LEU A CA 1 
ATOM 3113 C CA . LEU E  5  405  ? 192.611 192.716 147.793 1.00 0.00 ? 405  LEU A CA 1 
ATOM 3114 C CA . TRP E  5  406  ? 192.215 191.401 151.314 1.00 0.00 ? 406  TRP A CA 1 
ATOM 3115 C CA . ALA E  5  407  ? 195.907 190.814 152.050 1.00 0.00 ? 407  ALA A CA 1 
ATOM 3116 C CA . PRO E  5  408  ? 198.456 192.366 154.464 1.00 0.00 ? 408  PRO A CA 1 
ATOM 3117 C CA . ARG E  5  409  ? 199.943 195.730 153.421 1.00 0.00 ? 409  ARG A CA 1 
ATOM 3118 C CA . PRO E  5  410  ? 202.911 195.174 151.049 1.00 0.00 ? 410  PRO A CA 1 
ATOM 3119 C CA . PHE E  5  411  ? 201.172 192.623 148.784 1.00 0.00 ? 411  PHE A CA 1 
ATOM 3120 C CA . ASN E  5  412  ? 197.756 194.281 148.362 1.00 0.00 ? 412  ASN A CA 1 
ATOM 3121 C CA . LEU E  5  413  ? 199.408 197.297 146.673 1.00 0.00 ? 413  LEU A CA 1 
ATOM 3122 C CA . ARG E  5  414  ? 200.286 195.858 143.242 1.00 0.00 ? 414  ARG A CA 1 
ATOM 3123 C CA . SER E  5  415  ? 202.600 198.894 142.503 1.00 0.00 ? 415  SER A CA 1 
ATOM 3124 C CA . GLY E  5  416  ? 204.805 200.510 145.160 1.00 0.00 ? 416  GLY A CA 1 
ATOM 3125 C CA . ARG E  5  417  ? 207.680 202.885 145.856 1.00 0.00 ? 417  ARG A CA 1 
ATOM 3126 C CA . THR E  5  418  ? 210.912 201.026 146.790 1.00 0.00 ? 418  THR A CA 1 
ATOM 3127 C CA . ARG E  5  419  ? 212.235 201.018 150.376 1.00 0.00 ? 419  ARG A CA 1 
ATOM 3128 C CA . ARG E  5  420  ? 215.736 200.000 151.493 1.00 0.00 ? 420  ARG A CA 1 
ATOM 3129 C CA . ALA E  5  421  ? 216.614 196.575 152.955 1.00 0.00 ? 421  ALA A CA 1 
ATOM 3130 C CA . LEU E  5  422  ? 216.996 198.206 156.399 1.00 0.00 ? 422  LEU A CA 1 
ATOM 3131 C CA . ASP E  5  423  ? 213.422 199.563 156.247 1.00 0.00 ? 423  ASP A CA 1 
ATOM 3132 C CA . ILE E  5  424  ? 211.785 196.180 155.563 1.00 0.00 ? 424  ILE A CA 1 
ATOM 3133 C CA . PRO E  5  425  ? 211.256 194.676 159.049 1.00 0.00 ? 425  PRO A CA 1 
ATOM 3134 C CA . LEU E  5  426  ? 209.995 191.260 157.833 1.00 0.00 ? 426  LEU A CA 1 
ATOM 3135 C CA . VAL E  5  427  ? 208.816 189.870 161.178 1.00 0.00 ? 427  VAL A CA 1 
ATOM 3136 C CA . LYS E  5  428  ? 207.713 192.829 163.306 1.00 0.00 ? 428  LYS A CA 1 
ATOM 3137 C CA . ASN E  5  429  ? 204.079 191.665 163.049 1.00 0.00 ? 429  ASN A CA 1 
ATOM 3138 C CA . TRP E  5  430  ? 204.978 188.561 165.094 1.00 0.00 ? 430  TRP A CA 1 
ATOM 3139 C CA . TYR E  5  431  ? 205.411 190.721 168.207 1.00 0.00 ? 431  TYR A CA 1 
ATOM 3140 C CA . ARG E  5  432  ? 202.211 192.742 167.696 1.00 0.00 ? 432  ARG A CA 1 
ATOM 3141 C CA . GLU E  5  433  ? 199.432 190.157 167.379 1.00 0.00 ? 433  GLU A CA 1 
ATOM 3142 C CA . HIS E  5  434  ? 200.652 189.028 170.855 1.00 0.00 ? 434  HIS A CA 1 
ATOM 3143 C CA . CYS E  5  435  ? 202.179 185.759 171.926 1.00 0.00 ? 435  CYS A CA 1 
ATOM 3144 C CA . PRO E  5  436  ? 200.714 182.269 171.346 1.00 0.00 ? 436  PRO A CA 1 
ATOM 3145 C CA . ALA E  5  437  ? 200.087 180.172 174.470 1.00 0.00 ? 437  ALA A CA 1 
ATOM 3146 C CA . GLY E  5  438  ? 202.417 177.610 176.069 1.00 0.00 ? 438  GLY A CA 1 
ATOM 3147 C CA . GLN E  5  439  ? 205.619 179.634 175.633 1.00 0.00 ? 439  GLN A CA 1 
ATOM 3148 C CA . PRO E  5  440  ? 208.481 179.751 178.188 1.00 0.00 ? 440  PRO A CA 1 
ATOM 3149 C CA . VAL E  5  441  ? 209.088 182.930 180.209 1.00 0.00 ? 441  VAL A CA 1 
ATOM 3150 C CA . LYS E  5  442  ? 212.359 183.528 178.311 1.00 0.00 ? 442  LYS A CA 1 
ATOM 3151 C CA . VAL E  5  443  ? 210.240 184.256 175.226 1.00 0.00 ? 443  VAL A CA 1 
ATOM 3152 C CA . ARG E  5  444  ? 207.131 185.952 176.655 1.00 0.00 ? 444  ARG A CA 1 
ATOM 3153 C CA . VAL E  5  445  ? 209.378 188.599 178.253 1.00 0.00 ? 445  VAL A CA 1 
ATOM 3154 C CA . SER E  5  446  ? 211.282 189.281 174.998 1.00 0.00 ? 446  SER A CA 1 
ATOM 3155 C CA . TYR E  5  447  ? 207.959 189.743 173.146 1.00 0.00 ? 447  TYR A CA 1 
ATOM 3156 C CA . GLN E  5  448  ? 207.089 192.617 175.509 1.00 0.00 ? 448  GLN A CA 1 
ATOM 3157 C CA . LYS E  5  449  ? 210.515 194.301 175.278 1.00 0.00 ? 449  LYS A CA 1 
ATOM 3158 C CA . LEU E  5  450  ? 210.075 194.315 171.482 1.00 0.00 ? 450  LEU A CA 1 
ATOM 3159 C CA . LEU E  5  451  ? 206.586 195.684 171.781 1.00 0.00 ? 451  LEU A CA 1 
ATOM 3160 C CA . LYS E  5  452  ? 207.664 198.403 174.239 1.00 0.00 ? 452  LYS A CA 1 
ATOM 3161 C CA . TYR E  5  453  ? 210.154 199.867 171.746 1.00 0.00 ? 453  TYR A CA 1 
ATOM 3162 C CA . TYR E  5  454  ? 207.577 199.877 168.926 1.00 0.00 ? 454  TYR A CA 1 
ATOM 3163 C CA . VAL E  5  455  ? 205.217 201.878 171.174 1.00 0.00 ? 455  VAL A CA 1 
ATOM 3164 C CA . LEU E  5  456  ? 207.917 204.199 172.507 1.00 0.00 ? 456  LEU A CA 1 
ATOM 3165 C CA . ASN E  5  457  ? 208.846 205.274 168.951 1.00 0.00 ? 457  ASN A CA 1 
ATOM 3166 C CA . ALA E  5  458  ? 205.256 205.673 167.759 1.00 0.00 ? 458  ALA A CA 1 
ATOM 3167 C CA . LEU E  5  459  ? 204.816 207.891 170.821 1.00 0.00 ? 459  LEU A CA 1 
ATOM 3168 C CA . LYS E  5  460  ? 207.547 210.428 170.022 1.00 0.00 ? 460  LYS A CA 1 
ATOM 3169 C CA . HIS E  5  461  ? 207.560 210.354 166.189 1.00 0.00 ? 461  HIS A CA 1 
ATOM 3170 C CA . ARG E  5  462  ? 207.985 214.004 165.352 1.00 0.00 ? 462  ARG A CA 1 
ATOM 3171 C CA . PRO E  5  463  ? 206.770 214.647 161.815 1.00 0.00 ? 463  PRO A CA 1 
ATOM 3172 C CA . PRO E  5  464  ? 209.890 215.580 159.768 1.00 0.00 ? 464  PRO A CA 1 
ATOM 3173 C CA . LYS E  5  465  ? 211.280 219.125 159.370 1.00 0.00 ? 465  LYS A CA 1 
ATOM 3174 C CA . ALA E  5  466  ? 211.489 220.803 155.945 1.00 0.00 ? 466  ALA A CA 1 
ATOM 3175 C CA . GLN E  5  467  ? 215.070 221.081 154.624 1.00 0.00 ? 467  GLN A CA 1 
ATOM 3176 C CA . LYS E  5  468  ? 217.191 220.973 151.482 1.00 0.00 ? 468  LYS A CA 1 
ATOM 3177 C CA . LYS E  5  469  ? 219.251 217.791 151.003 1.00 0.00 ? 469  LYS A CA 1 
ATOM 3178 C CA . ARG E  5  470  ? 222.807 218.004 152.370 1.00 0.00 ? 470  ARG A CA 1 
ATOM 3179 C CA . TYR E  5  471  ? 224.152 214.532 151.482 1.00 0.00 ? 471  TYR A CA 1 
ATOM 3180 C CA . LEU E  5  472  ? 227.823 214.277 152.406 1.00 0.00 ? 472  LEU A CA 1 
ATOM 3181 C CA . PHE E  5  473  ? 228.706 211.441 149.989 1.00 0.00 ? 473  PHE A CA 1 
ATOM 3182 C CA . ARG E  5  474  ? 227.992 213.718 146.946 1.00 0.00 ? 474  ARG A CA 1 
ATOM 3183 C CA . SER E  5  475  ? 229.877 216.691 148.209 1.00 0.00 ? 475  SER A CA 1 
ATOM 3184 C CA . PHE E  5  476  ? 233.108 214.654 148.495 1.00 0.00 ? 476  PHE A CA 1 
ATOM 3185 C CA . LYS E  5  477  ? 232.306 213.303 145.012 1.00 0.00 ? 477  LYS A CA 1 
ATOM 3186 C CA . ALA E  5  478  ? 232.344 216.901 143.689 1.00 0.00 ? 478  ALA A CA 1 
ATOM 3187 C CA . THR E  5  479  ? 235.928 217.806 144.710 1.00 0.00 ? 479  THR A CA 1 
ATOM 3188 C CA . LYS E  5  480  ? 238.889 216.535 142.637 1.00 0.00 ? 480  LYS A CA 1 
ATOM 3189 C CA . PHE E  5  481  ? 240.158 214.348 145.517 1.00 0.00 ? 481  PHE A CA 1 
ATOM 3190 C CA . PHE E  5  482  ? 237.639 211.503 145.184 1.00 0.00 ? 482  PHE A CA 1 
ATOM 3191 C CA . GLN E  5  483  ? 237.144 209.167 142.228 1.00 0.00 ? 483  GLN A CA 1 
ATOM 3192 C CA . SER E  5  484  ? 234.407 206.637 141.554 1.00 0.00 ? 484  SER A CA 1 
ATOM 3193 C CA . THR E  5  485  ? 234.539 203.007 140.375 1.00 0.00 ? 485  THR A CA 1 
ATOM 3194 C CA . LYS E  5  486  ? 232.598 199.741 140.818 1.00 0.00 ? 486  LYS A CA 1 
ATOM 3195 C CA . LEU E  5  487  ? 234.065 196.631 142.437 1.00 0.00 ? 487  LEU A CA 1 
ATOM 3196 C CA . ASP E  5  488  ? 233.168 193.483 144.431 1.00 0.00 ? 488  ASP A CA 1 
ATOM 3197 C CA . TRP E  5  489  ? 231.779 193.874 147.963 1.00 0.00 ? 489  TRP A CA 1 
ATOM 3198 C CA . VAL E  5  490  ? 234.375 191.686 149.717 1.00 0.00 ? 490  VAL A CA 1 
ATOM 3199 C CA . GLU E  5  491  ? 237.203 193.684 148.122 1.00 0.00 ? 491  GLU A CA 1 
ATOM 3200 C CA . VAL E  5  492  ? 235.815 196.983 149.452 1.00 0.00 ? 492  VAL A CA 1 
ATOM 3201 C CA . GLY E  5  493  ? 235.276 195.232 152.810 1.00 0.00 ? 493  GLY A CA 1 
ATOM 3202 C CA . LEU E  5  494  ? 238.955 194.331 153.058 1.00 0.00 ? 494  LEU A CA 1 
ATOM 3203 C CA . GLN E  5  495  ? 239.815 197.784 151.680 1.00 0.00 ? 495  GLN A CA 1 
ATOM 3204 C CA . VAL E  5  496  ? 238.120 199.385 154.716 1.00 0.00 ? 496  VAL A CA 1 
ATOM 3205 C CA . CYS E  5  497  ? 239.322 196.830 157.274 1.00 0.00 ? 497  CYS A CA 1 
ATOM 3206 C CA . ARG E  5  498  ? 242.840 197.694 156.093 1.00 0.00 ? 498  ARG A CA 1 
ATOM 3207 C CA . GLN E  5  499  ? 242.410 201.494 155.821 1.00 0.00 ? 499  GLN A CA 1 
ATOM 3208 C CA . GLY E  5  500  ? 241.212 201.428 159.460 1.00 0.00 ? 500  GLY A CA 1 
ATOM 3209 C CA . TYR E  5  501  ? 244.217 199.350 160.571 1.00 0.00 ? 501  TYR A CA 1 
ATOM 3210 C CA . ASN E  5  502  ? 246.681 201.889 159.146 1.00 0.00 ? 502  ASN A CA 1 
ATOM 3211 C CA . MET E  5  503  ? 244.676 204.940 160.272 1.00 0.00 ? 503  MET A CA 1 
ATOM 3212 C CA . LEU E  5  504  ? 245.137 203.697 163.856 1.00 0.00 ? 504  LEU A CA 1 
ATOM 3213 C CA . ASN E  5  505  ? 248.754 202.624 163.416 1.00 0.00 ? 505  ASN A CA 1 
ATOM 3214 C CA . LEU E  5  506  ? 249.684 206.103 162.151 1.00 0.00 ? 506  LEU A CA 1 
ATOM 3215 C CA . LEU E  5  507  ? 247.943 207.590 165.155 1.00 0.00 ? 507  LEU A CA 1 
ATOM 3216 C CA . ILE E  5  508  ? 249.717 205.253 167.591 1.00 0.00 ? 508  ILE A CA 1 
ATOM 3217 C CA . HIS E  5  509  ? 253.125 205.995 166.040 1.00 0.00 ? 509  HIS A CA 1 
ATOM 3218 C CA . ARG E  5  510  ? 252.541 209.756 165.803 1.00 0.00 ? 510  ARG A CA 1 
ATOM 3219 C CA . LYS E  5  511  ? 252.122 209.722 169.596 1.00 0.00 ? 511  LYS A CA 1 
ATOM 3220 C CA . ASN E  5  512  ? 255.439 207.802 169.695 1.00 0.00 ? 512  ASN A CA 1 
ATOM 3221 C CA . LEU E  5  513  ? 253.545 205.023 171.483 1.00 0.00 ? 513  LEU A CA 1 
ATOM 3222 C CA . ASN E  5  514  ? 255.642 202.435 169.661 1.00 0.00 ? 514  ASN A CA 1 
ATOM 3223 C CA . TYR E  5  515  ? 255.799 199.766 172.403 1.00 0.00 ? 515  TYR A CA 1 
ATOM 3224 C CA . LEU E  5  516  ? 252.197 198.714 171.759 1.00 0.00 ? 516  LEU A CA 1 
ATOM 3225 C CA . HIS E  5  517  ? 251.173 196.933 168.560 1.00 0.00 ? 517  HIS A CA 1 
ATOM 3226 C CA . LEU E  5  518  ? 247.673 196.328 167.228 1.00 0.00 ? 518  LEU A CA 1 
ATOM 3227 C CA . ASP E  5  519  ? 247.090 192.786 165.999 1.00 0.00 ? 519  ASP A CA 1 
ATOM 3228 C CA . TYR E  5  520  ? 245.545 192.568 162.524 1.00 0.00 ? 520  TYR A CA 1 
ATOM 3229 C CA . ASN E  5  521  ? 242.382 191.691 164.496 1.00 0.00 ? 521  ASN A CA 1 
ATOM 3230 C CA . PHE E  5  522  ? 242.089 195.150 166.111 1.00 0.00 ? 522  PHE A CA 1 
ATOM 3231 C CA . ASN E  5  523  ? 243.533 193.802 169.382 1.00 0.00 ? 523  ASN A CA 1 
ATOM 3232 C CA . LEU E  5  524  ? 245.690 196.272 171.312 1.00 0.00 ? 524  LEU A CA 1 
ATOM 3233 C CA . LYS E  5  525  ? 248.399 194.999 173.685 1.00 0.00 ? 525  LYS A CA 1 
ATOM 3234 C CA . PRO E  5  526  ? 251.745 196.060 175.247 1.00 0.00 ? 526  PRO A CA 1 
ATOM 3235 C CA . VAL E  5  527  ? 255.038 194.207 174.726 1.00 0.00 ? 527  VAL A CA 1 
ATOM 3236 C CA . LYS E  5  528  ? 257.604 196.021 176.874 1.00 0.00 ? 528  LYS A CA 1 
ATOM 3237 C CA . THR E  5  529  ? 255.548 196.099 180.101 1.00 0.00 ? 529  THR A CA 1 
ATOM 3238 C CA . LEU E  5  530  ? 255.750 199.686 181.298 1.00 0.00 ? 530  LEU A CA 1 
ATOM 3239 C CA . THR E  5  531  ? 256.341 202.015 184.230 1.00 0.00 ? 531  THR A CA 1 
ATOM 3240 C CA . THR E  5  532  ? 253.374 203.991 185.592 1.00 0.00 ? 532  THR A CA 1 
ATOM 3241 C CA . LYS E  5  533  ? 254.932 207.003 183.810 1.00 0.00 ? 533  LYS A CA 1 
ATOM 3242 C CA . GLU E  5  534  ? 254.926 205.162 180.462 1.00 0.00 ? 534  GLU A CA 1 
ATOM 3243 C CA . ARG E  5  535  ? 251.387 203.819 181.032 1.00 0.00 ? 535  ARG A CA 1 
ATOM 3244 C CA . LYS E  5  536  ? 249.826 207.294 181.378 1.00 0.00 ? 536  LYS A CA 1 
ATOM 3245 C CA . LYS E  5  537  ? 251.031 208.035 177.822 1.00 0.00 ? 537  LYS A CA 1 
ATOM 3246 C CA . SER E  5  538  ? 249.322 204.877 176.539 1.00 0.00 ? 538  SER A CA 1 
ATOM 3247 C CA . ARG E  5  539  ? 245.899 205.361 178.198 1.00 0.00 ? 539  ARG A CA 1 
ATOM 3248 C CA . PHE E  5  540  ? 243.948 205.692 174.934 1.00 0.00 ? 540  PHE A CA 1 
ATOM 3249 C CA . GLY E  5  541  ? 240.521 207.309 175.285 1.00 0.00 ? 541  GLY A CA 1 
ATOM 3250 C CA . ASN E  5  542  ? 236.851 206.306 175.217 1.00 0.00 ? 542  ASN A CA 1 
ATOM 3251 C CA . ALA E  5  543  ? 236.661 207.355 171.532 1.00 0.00 ? 543  ALA A CA 1 
ATOM 3252 C CA . PHE E  5  544  ? 239.658 205.609 169.898 1.00 0.00 ? 544  PHE A CA 1 
ATOM 3253 C CA . HIS E  5  545  ? 238.593 202.387 171.673 1.00 0.00 ? 545  HIS A CA 1 
ATOM 3254 C CA . LEU E  5  546  ? 234.979 202.687 170.513 1.00 0.00 ? 546  LEU A CA 1 
ATOM 3255 C CA . CYS E  5  547  ? 236.258 203.408 166.984 1.00 0.00 ? 547  CYS A CA 1 
ATOM 3256 C CA . ARG E  5  548  ? 238.569 200.379 167.282 1.00 0.00 ? 548  ARG A CA 1 
ATOM 3257 C CA . GLU E  5  549  ? 235.936 197.891 168.495 1.00 0.00 ? 549  GLU A CA 1 
ATOM 3258 C CA . VAL E  5  550  ? 233.688 199.011 165.651 1.00 0.00 ? 550  VAL A CA 1 
ATOM 3259 C CA . LEU E  5  551  ? 236.488 197.918 163.327 1.00 0.00 ? 551  LEU A CA 1 
ATOM 3260 C CA . ARG E  5  552  ? 236.931 194.546 165.049 1.00 0.00 ? 552  ARG A CA 1 
ATOM 3261 C CA . LEU E  5  553  ? 233.267 193.925 164.147 1.00 0.00 ? 553  LEU A CA 1 
ATOM 3262 C CA . THR E  5  554  ? 233.717 194.971 160.501 1.00 0.00 ? 554  THR A CA 1 
ATOM 3263 C CA . LYS E  5  555  ? 236.654 192.543 160.292 1.00 0.00 ? 555  LYS A CA 1 
ATOM 3264 C CA . LEU E  5  556  ? 234.485 189.599 161.414 1.00 0.00 ? 556  LEU A CA 1 
ATOM 3265 C CA . VAL E  5  557  ? 231.651 190.281 158.983 1.00 0.00 ? 557  VAL A CA 1 
ATOM 3266 C CA . VAL E  5  558  ? 234.124 190.675 156.094 1.00 0.00 ? 558  VAL A CA 1 
ATOM 3267 C CA . ASP E  5  559  ? 236.551 187.856 156.974 1.00 0.00 ? 559  ASP A CA 1 
ATOM 3268 C CA . SER E  5  560  ? 233.508 185.598 157.313 1.00 0.00 ? 560  SER A CA 1 
ATOM 3269 C CA . HIS E  5  561  ? 232.803 186.384 153.626 1.00 0.00 ? 561  HIS A CA 1 
ATOM 3270 C CA . VAL E  5  562  ? 236.417 186.138 152.441 1.00 0.00 ? 562  VAL A CA 1 
ATOM 3271 C CA . GLN E  5  563  ? 236.433 182.701 154.068 1.00 0.00 ? 563  GLN A CA 1 
ATOM 3272 C CA . TYR E  5  564  ? 233.247 181.688 152.209 1.00 0.00 ? 564  TYR A CA 1 
ATOM 3273 C CA . ARG E  5  565  ? 234.899 182.621 148.949 1.00 0.00 ? 565  ARG A CA 1 
ATOM 3274 C CA . LEU E  5  566  ? 237.721 180.141 149.619 1.00 0.00 ? 566  LEU A CA 1 
ATOM 3275 C CA . GLY E  5  567  ? 235.230 177.317 149.994 1.00 0.00 ? 567  GLY A CA 1 
ATOM 3276 C CA . ASN E  5  568  ? 236.117 176.630 153.649 1.00 0.00 ? 568  ASN A CA 1 
ATOM 3277 C CA . VAL E  5  569  ? 232.612 177.426 154.869 1.00 0.00 ? 569  VAL A CA 1 
ATOM 3278 C CA . ASP E  5  570  ? 229.861 176.989 152.225 1.00 0.00 ? 570  ASP A CA 1 
ATOM 3279 C CA . ALA E  5  571  ? 226.724 179.164 152.251 1.00 0.00 ? 571  ALA A CA 1 
ATOM 3280 C CA . PHE E  5  572  ? 224.474 177.611 154.939 1.00 0.00 ? 572  PHE A CA 1 
ATOM 3281 C CA . GLN E  5  573  ? 227.331 177.815 157.446 1.00 0.00 ? 573  GLN A CA 1 
ATOM 3282 C CA . LEU E  5  574  ? 228.034 181.437 156.435 1.00 0.00 ? 574  LEU A CA 1 
ATOM 3283 C CA . ALA E  5  575  ? 224.430 182.588 157.009 1.00 0.00 ? 575  ALA A CA 1 
ATOM 3284 C CA . ASP E  5  576  ? 224.601 181.054 160.494 1.00 0.00 ? 576  ASP A CA 1 
ATOM 3285 C CA . GLY E  5  577  ? 228.065 182.609 160.898 1.00 0.00 ? 577  GLY A CA 1 
ATOM 3286 C CA . LEU E  5  578  ? 226.707 186.114 160.211 1.00 0.00 ? 578  LEU A CA 1 
ATOM 3287 C CA . GLN E  5  579  ? 223.752 185.490 162.519 1.00 0.00 ? 579  GLN A CA 1 
ATOM 3288 C CA . TYR E  5  580  ? 225.987 184.359 165.403 1.00 0.00 ? 580  TYR A CA 1 
ATOM 3289 C CA . ILE E  5  581  ? 228.068 187.544 165.075 1.00 0.00 ? 581  ILE A CA 1 
ATOM 3290 C CA . PHE E  5  582  ? 225.239 190.096 165.408 1.00 0.00 ? 582  PHE A CA 1 
ATOM 3291 C CA . ALA E  5  583  ? 223.436 188.078 168.086 1.00 0.00 ? 583  ALA A CA 1 
ATOM 3292 C CA . HIS E  5  584  ? 226.651 187.857 170.147 1.00 0.00 ? 584  HIS A CA 1 
ATOM 3293 C CA . VAL E  5  585  ? 228.378 191.200 169.388 1.00 0.00 ? 585  VAL A CA 1 
ATOM 3294 C CA . GLY E  5  586  ? 228.633 191.645 173.192 1.00 0.00 ? 586  GLY A CA 1 
ATOM 3295 C CA . GLN E  5  587  ? 231.030 188.659 173.292 1.00 0.00 ? 587  GLN A CA 1 
ATOM 3296 C CA . LEU E  5  588  ? 233.101 189.050 170.098 1.00 0.00 ? 588  LEU A CA 1 
ATOM 3297 C CA . THR E  5  589  ? 233.982 192.723 170.281 1.00 0.00 ? 589  THR A CA 1 
ATOM 3298 C CA . GLY E  5  590  ? 234.051 193.961 173.926 1.00 0.00 ? 590  GLY A CA 1 
ATOM 3299 C CA . MET E  5  591  ? 232.668 197.336 172.845 1.00 0.00 ? 591  MET A CA 1 
ATOM 3300 C CA . TYR E  5  592  ? 229.954 197.893 175.473 1.00 0.00 ? 592  TYR A CA 1 
ATOM 3301 C CA . ARG E  5  593  ? 232.774 198.971 177.843 1.00 0.00 ? 593  ARG A CA 1 
ATOM 3302 C CA . TYR E  5  594  ? 233.234 202.283 175.959 1.00 0.00 ? 594  TYR A CA 1 
ATOM 3303 C CA . LYS E  5  595  ? 229.574 203.227 175.350 1.00 0.00 ? 595  LYS A CA 1 
ATOM 3304 C CA . TYR E  5  596  ? 227.230 201.531 177.814 1.00 0.00 ? 596  TYR A CA 1 
ATOM 3305 C CA . LYS E  5  597  ? 223.998 202.480 175.978 1.00 0.00 ? 597  LYS A CA 1 
ATOM 3306 C CA . LEU E  5  598  ? 225.116 199.785 173.511 1.00 0.00 ? 598  LEU A CA 1 
ATOM 3307 C CA . MET E  5  599  ? 223.755 197.223 176.014 1.00 0.00 ? 599  MET A CA 1 
ATOM 3308 C CA . ARG E  5  600  ? 220.348 198.218 174.560 1.00 0.00 ? 600  ARG A CA 1 
ATOM 3309 C CA . GLN E  5  601  ? 221.205 197.267 170.954 1.00 0.00 ? 601  GLN A CA 1 
ATOM 3310 C CA . ILE E  5  602  ? 222.535 194.006 172.413 1.00 0.00 ? 602  ILE A CA 1 
ATOM 3311 C CA . ARG E  5  603  ? 219.548 193.200 174.630 1.00 0.00 ? 603  ARG A CA 1 
ATOM 3312 C CA . MET E  5  604  ? 217.243 193.747 171.632 1.00 0.00 ? 604  MET A CA 1 
ATOM 3313 C CA . CYS E  5  605  ? 219.137 191.407 169.251 1.00 0.00 ? 605  CYS A CA 1 
ATOM 3314 C CA . LYS E  5  606  ? 218.945 188.817 172.038 1.00 0.00 ? 606  LYS A CA 1 
ATOM 3315 C CA . ASP E  5  607  ? 215.198 189.480 172.290 1.00 0.00 ? 607  ASP A CA 1 
ATOM 3316 C CA . LEU E  5  608  ? 214.909 188.718 168.558 1.00 0.00 ? 608  LEU A CA 1 
ATOM 3317 C CA . LYS E  5  609  ? 216.843 185.444 168.774 1.00 0.00 ? 609  LYS A CA 1 
ATOM 3318 C CA . HIS E  5  610  ? 214.351 184.078 171.339 1.00 0.00 ? 610  HIS A CA 1 
ATOM 3319 C CA . LEU E  5  611  ? 211.394 185.226 169.246 1.00 0.00 ? 611  LEU A CA 1 
ATOM 3320 C CA . ILE E  5  612  ? 212.717 183.539 166.062 1.00 0.00 ? 612  ILE A CA 1 
ATOM 3321 C CA . TYR E  5  613  ? 214.239 180.294 167.402 1.00 0.00 ? 613  TYR A CA 1 
ATOM 3322 C CA . TYR E  5  614  ? 211.082 179.308 169.295 1.00 0.00 ? 614  TYR A CA 1 
ATOM 3323 C CA . ARG E  5  615  ? 209.222 179.738 165.968 1.00 0.00 ? 615  ARG A CA 1 
ATOM 3324 C CA . PHE E  5  616  ? 211.746 178.183 163.541 1.00 0.00 ? 616  PHE A CA 1 
ATOM 3325 C CA . ASN E  5  617  ? 213.982 175.960 165.694 1.00 0.00 ? 617  ASN A CA 1 
ATOM 3326 C CA . THR E  5  618  ? 211.083 174.068 167.315 1.00 0.00 ? 618  THR A CA 1 
ATOM 3327 C CA . GLY E  5  619  ? 209.113 172.456 164.461 1.00 0.00 ? 619  GLY A CA 1 
ATOM 3328 C CA . PRO E  5  620  ? 210.169 168.781 164.603 1.00 0.00 ? 620  PRO A CA 1 
ATOM 3329 C CA . VAL E  5  621  ? 213.877 169.589 164.060 1.00 0.00 ? 621  VAL A CA 1 
ATOM 3330 C CA . GLY E  5  622  ? 215.290 171.806 166.828 1.00 0.00 ? 622  GLY A CA 1 
ATOM 3331 C CA . LYS E  5  623  ? 218.439 171.972 168.923 1.00 0.00 ? 623  LYS A CA 1 
ATOM 3332 C CA . GLY E  5  624  ? 221.581 173.644 167.551 1.00 0.00 ? 624  GLY A CA 1 
ATOM 3333 C CA . PRO E  5  625  ? 223.188 175.759 164.791 1.00 0.00 ? 625  PRO A CA 1 
ATOM 3334 C CA . GLY E  5  626  ? 221.524 176.140 161.365 1.00 0.00 ? 626  GLY A CA 1 
ATOM 3335 C CA . CYS E  5  627  ? 219.149 179.148 161.621 1.00 0.00 ? 627  CYS A CA 1 
ATOM 3336 C CA . GLY E  5  628  ? 220.953 181.960 159.727 1.00 0.00 ? 628  GLY A CA 1 
ATOM 3337 C CA . PHE E  5  629  ? 217.854 184.196 159.475 1.00 0.00 ? 629  PHE A CA 1 
ATOM 3338 C CA . TRP E  5  630  ? 219.843 187.357 160.279 1.00 0.00 ? 630  TRP A CA 1 
ATOM 3339 C CA . ALA E  5  631  ? 217.892 190.141 158.615 1.00 0.00 ? 631  ALA A CA 1 
ATOM 3340 C CA . ALA E  5  632  ? 216.184 191.306 161.847 1.00 0.00 ? 632  ALA A CA 1 
ATOM 3341 C CA . GLY E  5  633  ? 219.328 190.882 163.995 1.00 0.00 ? 633  GLY A CA 1 
ATOM 3342 C CA . TRP E  5  634  ? 221.183 192.803 161.264 1.00 0.00 ? 634  TRP A CA 1 
ATOM 3343 C CA . ARG E  5  635  ? 218.838 195.822 161.244 1.00 0.00 ? 635  ARG A CA 1 
ATOM 3344 C CA . VAL E  5  636  ? 219.408 196.544 164.951 1.00 0.00 ? 636  VAL A CA 1 
ATOM 3345 C CA . TRP E  5  637  ? 223.109 197.219 164.330 1.00 0.00 ? 637  TRP A CA 1 
ATOM 3346 C CA . LEU E  5  638  ? 222.541 199.465 161.294 1.00 0.00 ? 638  LEU A CA 1 
ATOM 3347 C CA . PHE E  5  639  ? 220.176 201.875 163.043 1.00 0.00 ? 639  PHE A CA 1 
ATOM 3348 C CA . PHE E  5  640  ? 222.766 201.974 165.846 1.00 0.00 ? 640  PHE A CA 1 
ATOM 3349 C CA . MET E  5  641  ? 225.433 203.319 163.459 1.00 0.00 ? 641  MET A CA 1 
ATOM 3350 C CA . ARG E  5  642  ? 222.917 205.927 162.237 1.00 0.00 ? 642  ARG A CA 1 
ATOM 3351 C CA . GLY E  5  643  ? 223.024 207.420 165.740 1.00 0.00 ? 643  GLY A CA 1 
ATOM 3352 C CA . ILE E  5  644  ? 226.720 206.845 166.489 1.00 0.00 ? 644  ILE A CA 1 
ATOM 3353 C CA . THR E  5  645  ? 228.388 208.002 163.243 1.00 0.00 ? 645  THR A CA 1 
ATOM 3354 C CA . PRO E  5  646  ? 227.442 211.683 163.897 1.00 0.00 ? 646  PRO A CA 1 
ATOM 3355 C CA . LEU E  5  647  ? 228.746 211.524 167.487 1.00 0.00 ? 647  LEU A CA 1 
ATOM 3356 C CA . LEU E  5  648  ? 231.790 209.408 166.610 1.00 0.00 ? 648  LEU A CA 1 
ATOM 3357 C CA . GLU E  5  649  ? 232.921 212.009 164.084 1.00 0.00 ? 649  GLU A CA 1 
ATOM 3358 C CA . ARG E  5  650  ? 232.782 214.857 166.619 1.00 0.00 ? 650  ARG A CA 1 
ATOM 3359 C CA . TRP E  5  651  ? 234.821 212.706 169.039 1.00 0.00 ? 651  TRP A CA 1 
ATOM 3360 C CA . LEU E  5  652  ? 237.362 211.742 166.363 1.00 0.00 ? 652  LEU A CA 1 
ATOM 3361 C CA . GLY E  5  653  ? 237.562 215.204 164.837 1.00 0.00 ? 653  GLY A CA 1 
ATOM 3362 C CA . ASN E  5  654  ? 237.873 216.796 168.286 1.00 0.00 ? 654  ASN A CA 1 
ATOM 3363 C CA . LEU E  5  655  ? 240.677 214.311 169.031 1.00 0.00 ? 655  LEU A CA 1 
ATOM 3364 C CA . LEU E  5  656  ? 242.552 215.066 165.787 1.00 0.00 ? 656  LEU A CA 1 
ATOM 3365 C CA . ALA E  5  657  ? 242.445 218.825 166.325 1.00 0.00 ? 657  ALA A CA 1 
ATOM 3366 C CA . ARG E  5  658  ? 244.039 218.129 169.725 1.00 0.00 ? 658  ARG A CA 1 
ATOM 3367 C CA . GLN E  5  659  ? 246.739 216.150 167.899 1.00 0.00 ? 659  GLN A CA 1 
ATOM 3368 C CA . PHE E  5  660  ? 247.677 218.832 165.336 1.00 0.00 ? 660  PHE A CA 1 
ATOM 3369 C CA . GLU E  5  661  ? 247.278 221.904 167.570 1.00 0.00 ? 661  GLU A CA 1 
ATOM 3370 C CA . GLY E  5  662  ? 247.539 221.061 171.275 1.00 0.00 ? 662  GLY A CA 1 
ATOM 3371 C CA . ARG E  5  663  ? 244.346 222.558 170.758 1.00 0.00 ? 663  ARG A CA 1 
ATOM 3372 C CA . HIS E  5  664  ? 243.163 225.483 168.592 1.00 0.00 ? 664  HIS A CA 1 
ATOM 3373 C CA . SER E  5  665  ? 244.138 229.159 168.975 1.00 0.00 ? 665  SER A CA 1 
ATOM 3374 C CA . LYS E  5  666  ? 243.731 230.902 172.349 1.00 0.00 ? 666  LYS A CA 1 
ATOM 3375 C CA . GLY E  5  667  ? 240.124 232.130 172.472 1.00 0.00 ? 667  GLY A CA 1 
ATOM 3376 C CA . VAL E  5  668  ? 237.205 229.877 171.504 1.00 0.00 ? 668  VAL A CA 1 
ATOM 3377 C CA . ALA E  5  669  ? 234.848 231.127 174.284 1.00 0.00 ? 669  ALA A CA 1 
ATOM 3378 C CA . LYS E  5  670  ? 234.772 230.786 178.078 1.00 0.00 ? 670  LYS A CA 1 
ATOM 3379 C CA . THR E  5  671  ? 230.978 230.708 178.609 1.00 0.00 ? 671  THR A CA 1 
ATOM 3380 C CA . VAL E  5  672  ? 230.635 232.439 182.014 1.00 0.00 ? 672  VAL A CA 1 
ATOM 3381 C CA . THR E  5  673  ? 229.392 229.942 184.684 1.00 0.00 ? 673  THR A CA 1 
ATOM 3382 C CA . LYS E  5  674  ? 228.999 230.838 188.372 1.00 0.00 ? 674  LYS A CA 1 
ATOM 3383 C CA . GLN E  5  675  ? 223.748 230.662 194.323 1.00 0.00 ? 675  GLN A CA 1 
ATOM 3384 C CA . ARG E  5  676  ? 224.179 229.531 192.403 1.00 0.00 ? 676  ARG A CA 1 
ATOM 3385 C CA . VAL E  5  677  ? 227.502 228.830 193.546 1.00 0.00 ? 677  VAL A CA 1 
ATOM 3386 C CA . GLU E  5  678  ? 227.591 232.736 197.618 1.00 0.00 ? 678  GLU A CA 1 
ATOM 3387 C CA . SER E  5  679  ? 231.326 231.915 197.594 1.00 0.00 ? 679  SER A CA 1 
ATOM 3388 C CA . HIS E  5  680  ? 231.780 232.003 193.800 1.00 0.00 ? 680  HIS A CA 1 
ATOM 3389 C CA . PHE E  5  681  ? 229.842 235.295 193.609 1.00 0.00 ? 681  PHE A CA 1 
ATOM 3390 C CA . ASP E  5  682  ? 232.448 236.990 195.821 1.00 0.00 ? 682  ASP A CA 1 
ATOM 3391 C CA . LEU E  5  683  ? 235.454 235.373 194.121 1.00 0.00 ? 683  LEU A CA 1 
ATOM 3392 C CA . GLU E  5  684  ? 234.424 237.240 190.936 1.00 0.00 ? 684  GLU A CA 1 
ATOM 3393 C CA . LEU E  5  685  ? 233.798 240.555 192.744 1.00 0.00 ? 685  LEU A CA 1 
ATOM 3394 C CA . ARG E  5  686  ? 237.210 240.259 194.475 1.00 0.00 ? 686  ARG A CA 1 
ATOM 3395 C CA . ALA E  5  687  ? 238.631 239.772 190.956 1.00 0.00 ? 687  ALA A CA 1 
ATOM 3396 C CA . ALA E  5  688  ? 236.731 242.652 189.310 1.00 0.00 ? 688  ALA A CA 1 
ATOM 3397 C CA . VAL E  5  689  ? 238.188 245.099 191.847 1.00 0.00 ? 689  VAL A CA 1 
ATOM 3398 C CA . MET E  5  690  ? 241.620 243.500 191.362 1.00 0.00 ? 690  MET A CA 1 
ATOM 3399 C CA . HIS E  5  691  ? 240.954 244.593 187.752 1.00 0.00 ? 691  HIS A CA 1 
ATOM 3400 C CA . ASP E  5  692  ? 239.586 248.111 188.172 1.00 0.00 ? 692  ASP A CA 1 
ATOM 3401 C CA . ILE E  5  693  ? 242.336 249.156 190.619 1.00 0.00 ? 693  ILE A CA 1 
ATOM 3402 C CA . LEU E  5  694  ? 245.113 247.861 188.364 1.00 0.00 ? 694  LEU A CA 1 
ATOM 3403 C CA . ASP E  5  695  ? 243.730 250.261 185.723 1.00 0.00 ? 695  ASP A CA 1 
ATOM 3404 C CA . MET E  5  696  ? 242.793 253.108 188.094 1.00 0.00 ? 696  MET A CA 1 
ATOM 3405 C CA . MET E  5  697  ? 246.416 253.270 189.310 1.00 0.00 ? 697  MET A CA 1 
ATOM 3406 C CA . PRO E  5  698  ? 248.646 255.304 186.921 1.00 0.00 ? 698  PRO A CA 1 
ATOM 3407 C CA . GLU E  5  699  ? 251.782 254.055 185.120 1.00 0.00 ? 699  GLU A CA 1 
ATOM 3408 C CA . GLY E  5  700  ? 254.208 253.855 188.074 1.00 0.00 ? 700  GLY A CA 1 
ATOM 3409 C CA . ILE E  5  701  ? 252.978 254.149 191.661 1.00 0.00 ? 701  ILE A CA 1 
ATOM 3410 C CA . LYS E  5  702  ? 253.855 250.668 193.008 1.00 0.00 ? 702  LYS A CA 1 
ATOM 3411 C CA . GLN E  5  703  ? 251.387 247.761 193.249 1.00 0.00 ? 703  GLN A CA 1 
ATOM 3412 C CA . ASN E  5  704  ? 251.528 247.426 197.055 1.00 0.00 ? 704  ASN A CA 1 
ATOM 3413 C CA . LYS E  5  705  ? 247.855 248.485 197.120 1.00 0.00 ? 705  LYS A CA 1 
ATOM 3414 C CA . ALA E  5  706  ? 246.283 245.923 194.738 1.00 0.00 ? 706  ALA A CA 1 
ATOM 3415 C CA . ARG E  5  707  ? 245.617 243.477 197.607 1.00 0.00 ? 707  ARG A CA 1 
ATOM 3416 C CA . THR E  5  708  ? 245.447 246.286 200.196 1.00 0.00 ? 708  THR A CA 1 
ATOM 3417 C CA . ILE E  5  709  ? 242.392 248.009 198.670 1.00 0.00 ? 709  ILE A CA 1 
ATOM 3418 C CA . LEU E  5  710  ? 240.229 244.952 199.372 1.00 0.00 ? 710  LEU A CA 1 
ATOM 3419 C CA . GLN E  5  711  ? 240.488 244.982 203.180 1.00 0.00 ? 711  GLN A CA 1 
ATOM 3420 C CA . HIS E  5  712  ? 238.710 248.350 202.934 1.00 0.00 ? 712  HIS A CA 1 
ATOM 3421 C CA . LEU E  5  713  ? 236.060 247.068 200.507 1.00 0.00 ? 713  LEU A CA 1 
ATOM 3422 C CA . SER E  5  714  ? 235.126 244.245 202.912 1.00 0.00 ? 714  SER A CA 1 
ATOM 3423 C CA . GLU E  5  715  ? 235.233 246.469 206.022 1.00 0.00 ? 715  GLU A CA 1 
ATOM 3424 C CA . ALA E  5  716  ? 233.036 248.893 204.046 1.00 0.00 ? 716  ALA A CA 1 
ATOM 3425 C CA . TRP E  5  717  ? 230.528 246.095 203.355 1.00 0.00 ? 717  TRP A CA 1 
ATOM 3426 C CA . ARG E  5  718  ? 230.647 244.952 207.005 1.00 0.00 ? 718  ARG A CA 1 
ATOM 3427 C CA . CYS E  5  719  ? 230.111 248.602 207.961 1.00 0.00 ? 719  CYS A CA 1 
ATOM 3428 C CA . TRP E  5  720  ? 226.971 248.824 205.767 1.00 0.00 ? 720  TRP A CA 1 
ATOM 3429 C CA . LYS E  5  721  ? 225.326 245.717 207.266 1.00 0.00 ? 721  LYS A CA 1 
ATOM 3430 C CA . ALA E  5  722  ? 225.921 247.243 210.717 1.00 0.00 ? 722  ALA A CA 1 
ATOM 3431 C CA . ASN E  5  723  ? 224.693 250.670 209.497 1.00 0.00 ? 723  ASN A CA 1 
ATOM 3432 C CA . ILE E  5  724  ? 227.778 252.474 210.836 1.00 0.00 ? 724  ILE A CA 1 
ATOM 3433 C CA . PRO E  5  725  ? 228.978 255.231 208.453 1.00 0.00 ? 725  PRO A CA 1 
ATOM 3434 C CA . TRP E  5  726  ? 230.716 253.942 210.286 1.00 0.00 ? 726  TRP A CA 1 
ATOM 3435 C CA . LYS E  5  727  ? 230.038 251.307 205.319 1.00 0.00 ? 727  LYS A CA 1 
ATOM 3436 C CA . VAL E  5  728  ? 231.760 255.912 205.134 1.00 0.00 ? 728  VAL A CA 1 
ATOM 3437 C CA . PRO E  5  729  ? 234.363 259.879 205.445 1.00 0.00 ? 729  PRO A CA 1 
ATOM 3438 C CA . GLY E  5  730  ? 235.230 261.709 202.208 1.00 0.00 ? 730  GLY A CA 1 
ATOM 3439 C CA . LEU E  5  731  ? 235.869 259.206 199.456 1.00 0.00 ? 731  LEU A CA 1 
ATOM 3440 C CA . PRO E  5  732  ? 234.852 259.829 195.810 1.00 0.00 ? 732  PRO A CA 1 
ATOM 3441 C CA . THR E  5  733  ? 231.095 259.266 195.335 1.00 0.00 ? 733  THR A CA 1 
ATOM 3442 C CA . PRO E  5  734  ? 232.185 257.359 192.166 1.00 0.00 ? 734  PRO A CA 1 
ATOM 3443 C CA . ILE E  5  735  ? 234.255 254.860 194.222 1.00 0.00 ? 735  ILE A CA 1 
ATOM 3444 C CA . GLU E  5  736  ? 231.536 254.692 196.909 1.00 0.00 ? 736  GLU A CA 1 
ATOM 3445 C CA . ASN E  5  737  ? 229.323 253.123 194.218 1.00 0.00 ? 737  ASN A CA 1 
ATOM 3446 C CA . MET E  5  738  ? 232.063 250.980 192.633 1.00 0.00 ? 738  MET A CA 1 
ATOM 3447 C CA . ILE E  5  739  ? 232.094 249.218 196.002 1.00 0.00 ? 739  ILE A CA 1 
ATOM 3448 C CA . LEU E  5  740  ? 228.340 249.319 196.747 1.00 0.00 ? 740  LEU A CA 1 
ATOM 3449 C CA . ARG E  5  741  ? 227.933 247.560 193.382 1.00 0.00 ? 741  ARG A CA 1 
ATOM 3450 C CA . TYR E  5  742  ? 230.679 244.911 193.627 1.00 0.00 ? 742  TYR A CA 1 
ATOM 3451 C CA . VAL E  5  743  ? 229.437 244.146 197.145 1.00 0.00 ? 743  VAL A CA 1 
ATOM 3452 C CA . LYS E  5  744  ? 225.827 243.643 196.020 1.00 0.00 ? 744  LYS A CA 1 
ATOM 3453 C CA . ALA E  5  745  ? 227.098 241.002 193.570 1.00 0.00 ? 745  ALA A CA 1 
ATOM 3454 C CA . LYS E  5  746  ? 228.874 239.021 196.318 1.00 0.00 ? 746  LYS A CA 1 
ATOM 3455 C CA . ALA E  5  747  ? 225.772 239.351 198.543 1.00 0.00 ? 747  ALA A CA 1 
ATOM 3456 C CA . ASP E  5  748  ? 223.831 237.347 195.916 1.00 0.00 ? 748  ASP A CA 1 
ATOM 3457 C CA . TRP E  5  749  ? 226.254 234.500 195.180 1.00 0.00 ? 749  TRP A CA 1 
ATOM 3458 C CA . TRP E  5  750  ? 226.555 234.243 198.993 1.00 0.00 ? 750  TRP A CA 1 
ATOM 3459 C CA . THR E  5  751  ? 222.800 234.230 199.717 1.00 0.00 ? 751  THR A CA 1 
ATOM 3460 C CA . ASN E  5  752  ? 222.060 232.040 196.670 1.00 0.00 ? 752  ASN A CA 1 
ATOM 3461 C CA . THR E  5  753  ? 224.341 229.322 198.074 1.00 0.00 ? 753  THR A CA 1 
ATOM 3462 C CA . ALA E  5  754  ? 222.712 229.320 201.542 1.00 0.00 ? 754  ALA A CA 1 
ATOM 3463 C CA . HIS E  5  755  ? 219.538 228.500 199.568 1.00 0.00 ? 755  HIS A CA 1 
ATOM 3464 C CA . TYR E  5  756  ? 221.080 225.782 197.384 1.00 0.00 ? 756  TYR A CA 1 
ATOM 3465 C CA . ASN E  5  757  ? 222.796 224.001 200.307 1.00 0.00 ? 757  ASN A CA 1 
ATOM 3466 C CA . ARG E  5  758  ? 219.846 224.139 202.699 1.00 0.00 ? 758  ARG A CA 1 
ATOM 3467 C CA . GLU E  5  759  ? 218.114 222.103 199.980 1.00 0.00 ? 759  GLU A CA 1 
ATOM 3468 C CA . ARG E  5  760  ? 220.913 219.586 199.604 1.00 0.00 ? 760  ARG A CA 1 
ATOM 3469 C CA . ILE E  5  761  ? 220.531 218.920 203.341 1.00 0.00 ? 761  ILE A CA 1 
ATOM 3470 C CA . ARG E  5  762  ? 216.737 219.000 203.548 1.00 0.00 ? 762  ARG A CA 1 
ATOM 3471 C CA . ARG E  5  763  ? 217.074 216.226 200.964 1.00 0.00 ? 763  ARG A CA 1 
ATOM 3472 C CA . GLY E  5  764  ? 220.067 214.361 202.457 1.00 0.00 ? 764  GLY A CA 1 
ATOM 3473 C CA . ALA E  5  765  ? 222.842 214.496 199.811 1.00 0.00 ? 765  ALA A CA 1 
ATOM 3474 C CA . THR E  5  766  ? 225.588 216.361 201.716 1.00 0.00 ? 766  THR A CA 1 
ATOM 3475 C CA . VAL E  5  767  ? 227.560 215.440 204.846 1.00 0.00 ? 767  VAL A CA 1 
ATOM 3476 C CA . ASP E  5  768  ? 230.795 216.307 206.719 1.00 0.00 ? 768  ASP A CA 1 
ATOM 3477 C CA . LYS E  5  769  ? 230.257 219.135 209.219 1.00 0.00 ? 769  LYS A CA 1 
ATOM 3478 C CA . THR E  5  770  ? 232.095 221.709 207.038 1.00 0.00 ? 770  THR A CA 1 
ATOM 3479 C CA . VAL E  5  771  ? 229.065 222.194 204.740 1.00 0.00 ? 771  VAL A CA 1 
ATOM 3480 C CA . CYS E  5  772  ? 226.405 221.698 207.422 1.00 0.00 ? 772  CYS A CA 1 
ATOM 3481 C CA . LYS E  5  773  ? 228.537 223.974 209.622 1.00 0.00 ? 773  LYS A CA 1 
ATOM 3482 C CA . LYS E  5  774  ? 229.038 226.747 207.051 1.00 0.00 ? 774  LYS A CA 1 
ATOM 3483 C CA . ASN E  5  775  ? 225.476 226.662 205.668 1.00 0.00 ? 775  ASN A CA 1 
ATOM 3484 C CA . LEU E  5  776  ? 224.200 226.948 209.226 1.00 0.00 ? 776  LEU A CA 1 
ATOM 3485 C CA . GLY E  5  777  ? 226.317 230.082 209.732 1.00 0.00 ? 777  GLY A CA 1 
ATOM 3486 C CA . ARG E  5  778  ? 225.185 231.764 206.489 1.00 0.00 ? 778  ARG A CA 1 
ATOM 3487 C CA . LEU E  5  779  ? 221.567 231.196 207.578 1.00 0.00 ? 779  LEU A CA 1 
ATOM 3488 C CA . THR E  5  780  ? 222.074 232.441 211.152 1.00 0.00 ? 780  THR A CA 1 
ATOM 3489 C CA . ARG E  5  781  ? 223.286 235.701 209.545 1.00 0.00 ? 781  ARG A CA 1 
ATOM 3490 C CA . LEU E  5  782  ? 220.667 235.805 206.754 1.00 0.00 ? 782  LEU A CA 1 
ATOM 3491 C CA . TYR E  5  783  ? 218.073 235.410 209.525 1.00 0.00 ? 783  TYR A CA 1 
ATOM 3492 C CA . LEU E  5  784  ? 219.492 237.972 211.995 1.00 0.00 ? 784  LEU A CA 1 
ATOM 3493 C CA . LYS E  5  785  ? 219.674 240.403 209.073 1.00 0.00 ? 785  LYS A CA 1 
ATOM 3494 C CA . ALA E  5  786  ? 215.887 239.970 208.728 1.00 0.00 ? 786  ALA A CA 1 
ATOM 3495 C CA . GLU E  5  787  ? 215.031 239.953 212.448 1.00 0.00 ? 787  GLU A CA 1 
ATOM 3496 C CA . GLN E  5  788  ? 216.802 243.334 212.616 1.00 0.00 ? 788  GLN A CA 1 
ATOM 3497 C CA . GLU E  5  789  ? 214.478 244.827 209.968 1.00 0.00 ? 789  GLU A CA 1 
ATOM 3498 C CA . ARG E  5  790  ? 211.400 243.323 211.618 1.00 0.00 ? 790  ARG A CA 1 
ATOM 3499 C CA . GLN E  5  791  ? 212.332 245.368 214.715 1.00 0.00 ? 791  GLN A CA 1 
ATOM 3500 C CA . HIS E  5  792  ? 213.491 248.645 213.153 1.00 0.00 ? 792  HIS A CA 1 
ATOM 3501 C CA . ASN E  5  793  ? 210.465 248.531 210.825 1.00 0.00 ? 793  ASN A CA 1 
ATOM 3502 C CA . TYR E  5  794  ? 208.215 248.154 213.885 1.00 0.00 ? 794  TYR A CA 1 
ATOM 3503 C CA . LEU E  5  795  ? 209.188 251.380 215.684 1.00 0.00 ? 795  LEU A CA 1 
ATOM 3504 C CA . LYS E  5  796  ? 209.170 253.263 212.357 1.00 0.00 ? 796  LYS A CA 1 
ATOM 3505 C CA . ASP E  5  797  ? 205.824 251.733 211.327 1.00 0.00 ? 797  ASP A CA 1 
ATOM 3506 C CA . GLY E  5  798  ? 204.474 251.843 214.870 1.00 0.00 ? 798  GLY A CA 1 
ATOM 3507 C CA . PRO E  5  799  ? 200.890 250.299 217.747 1.00 0.00 ? 799  PRO A CA 1 
ATOM 3508 C CA . TYR E  5  800  ? 198.705 247.767 215.929 1.00 0.00 ? 800  TYR A CA 1 
ATOM 3509 C CA . ILE E  5  801  ? 196.513 247.032 218.977 1.00 0.00 ? 801  ILE A CA 1 
ATOM 3510 C CA . THR E  5  802  ? 194.426 250.248 218.874 1.00 0.00 ? 802  THR A CA 1 
ATOM 3511 C CA . ALA E  5  803  ? 193.373 251.492 222.326 1.00 0.00 ? 803  ALA A CA 1 
ATOM 3512 C CA . GLU E  5  804  ? 189.720 250.386 221.984 1.00 0.00 ? 804  GLU A CA 1 
ATOM 3513 C CA . GLU E  5  805  ? 190.905 246.780 221.595 1.00 0.00 ? 805  GLU A CA 1 
ATOM 3514 C CA . ALA E  5  806  ? 193.417 247.105 224.457 1.00 0.00 ? 806  ALA A CA 1 
ATOM 3515 C CA . VAL E  5  807  ? 190.730 248.629 226.706 1.00 0.00 ? 807  VAL A CA 1 
ATOM 3516 C CA . ALA E  5  808  ? 188.479 245.583 226.239 1.00 0.00 ? 808  ALA A CA 1 
ATOM 3517 C CA . VAL E  5  809  ? 191.359 243.131 226.750 1.00 0.00 ? 809  VAL A CA 1 
ATOM 3518 C CA . TYR E  5  810  ? 192.529 244.908 229.928 1.00 0.00 ? 810  TYR A CA 1 
ATOM 3519 C CA . THR E  5  811  ? 189.037 245.334 231.426 1.00 0.00 ? 811  THR A CA 1 
ATOM 3520 C CA . THR E  5  812  ? 187.953 241.760 230.604 1.00 0.00 ? 812  THR A CA 1 
ATOM 3521 C CA . THR E  5  813  ? 191.178 240.554 232.256 1.00 0.00 ? 813  THR A CA 1 
ATOM 3522 C CA . VAL E  5  814  ? 190.402 242.659 235.351 1.00 0.00 ? 814  VAL A CA 1 
ATOM 3523 C CA . HIS E  5  815  ? 186.990 240.972 235.630 1.00 0.00 ? 815  HIS A CA 1 
ATOM 3524 C CA . TRP E  5  816  ? 188.653 237.532 235.531 1.00 0.00 ? 816  TRP A CA 1 
ATOM 3525 C CA . LEU E  5  817  ? 191.116 238.365 238.331 1.00 0.00 ? 817  LEU A CA 1 
ATOM 3526 C CA . GLU E  5  818  ? 188.211 240.041 240.115 1.00 0.00 ? 818  GLU A CA 1 
ATOM 3527 C CA . SER E  5  819  ? 186.116 236.849 239.873 1.00 0.00 ? 819  SER A CA 1 
ATOM 3528 C CA . ARG E  5  820  ? 188.896 234.726 241.416 1.00 0.00 ? 820  ARG A CA 1 
ATOM 3529 C CA . ARG E  5  821  ? 189.251 236.947 244.514 1.00 0.00 ? 821  ARG A CA 1 
ATOM 3530 C CA . PHE E  5  822  ? 192.901 237.033 243.391 1.00 0.00 ? 822  PHE A CA 1 
ATOM 3531 C CA . SER E  5  823  ? 195.676 238.473 245.551 1.00 0.00 ? 823  SER A CA 1 
ATOM 3532 C CA . PRO E  5  824  ? 198.622 240.126 243.723 1.00 0.00 ? 824  PRO A CA 1 
ATOM 3533 C CA . ILE E  5  825  ? 202.157 238.802 244.261 1.00 0.00 ? 825  ILE A CA 1 
ATOM 3534 C CA . PRO E  5  826  ? 204.007 241.155 246.676 1.00 0.00 ? 826  PRO A CA 1 
ATOM 3535 C CA . PHE E  5  827  ? 207.689 242.108 246.737 1.00 0.00 ? 827  PHE A CA 1 
ATOM 3536 C CA . PRO E  5  828  ? 209.948 239.621 248.607 1.00 0.00 ? 828  PRO A CA 1 
ATOM 3537 C CA . PRO E  5  829  ? 209.861 240.372 252.375 1.00 0.00 ? 829  PRO A CA 1 
ATOM 3538 C CA . LEU E  5  830  ? 213.277 240.805 254.030 1.00 0.00 ? 830  LEU A CA 1 
ATOM 3539 C CA . SER E  5  831  ? 212.267 238.104 256.537 1.00 0.00 ? 831  SER A CA 1 
ATOM 3540 C CA . TYR E  5  832  ? 211.046 235.398 254.152 1.00 0.00 ? 832  TYR A CA 1 
ATOM 3541 C CA . LYS E  5  833  ? 211.461 231.739 255.186 1.00 0.00 ? 833  LYS A CA 1 
ATOM 3542 C CA . HIS E  5  834  ? 211.352 230.456 251.576 1.00 0.00 ? 834  HIS A CA 1 
ATOM 3543 C CA . ASP E  5  835  ? 213.987 232.625 249.838 1.00 0.00 ? 835  ASP A CA 1 
ATOM 3544 C CA . THR E  5  836  ? 217.089 230.550 250.776 1.00 0.00 ? 836  THR A CA 1 
ATOM 3545 C CA . LYS E  5  837  ? 215.317 227.484 249.346 1.00 0.00 ? 837  LYS A CA 1 
ATOM 3546 C CA . LEU E  5  838  ? 214.428 229.464 246.197 1.00 0.00 ? 838  LEU A CA 1 
ATOM 3547 C CA . LEU E  5  839  ? 217.955 230.692 245.533 1.00 0.00 ? 839  LEU A CA 1 
ATOM 3548 C CA . ILE E  5  840  ? 219.600 227.242 245.591 1.00 0.00 ? 840  ILE A CA 1 
ATOM 3549 C CA . LEU E  5  841  ? 217.062 226.010 243.008 1.00 0.00 ? 841  LEU A CA 1 
ATOM 3550 C CA . ALA E  5  842  ? 217.995 228.931 240.744 1.00 0.00 ? 842  ALA A CA 1 
ATOM 3551 C CA . LEU E  5  843  ? 221.715 228.053 240.877 1.00 0.00 ? 843  LEU A CA 1 
ATOM 3552 C CA . GLU E  5  844  ? 221.120 224.313 240.492 1.00 0.00 ? 844  GLU A CA 1 
ATOM 3553 C CA . ARG E  5  845  ? 219.317 225.223 237.256 1.00 0.00 ? 845  ARG A CA 1 
ATOM 3554 C CA . LEU E  5  846  ? 222.318 227.289 236.087 1.00 0.00 ? 846  LEU A CA 1 
ATOM 3555 C CA . LYS E  5  847  ? 224.704 224.504 237.182 1.00 0.00 ? 847  LYS A CA 1 
ATOM 3556 C CA . GLU E  5  848  ? 223.061 222.030 234.773 1.00 0.00 ? 848  GLU A CA 1 
ATOM 3557 C CA . ALA E  5  849  ? 224.435 223.964 231.778 1.00 0.00 ? 849  ALA A CA 1 
ATOM 3558 C CA . TYR E  5  850  ? 228.142 223.471 232.516 1.00 0.00 ? 850  TYR A CA 1 
ATOM 3559 C CA . SER E  5  851  ? 228.467 220.132 234.358 1.00 0.00 ? 851  SER A CA 1 
ATOM 3560 C CA . VAL E  5  852  ? 227.968 218.324 231.020 1.00 0.00 ? 852  VAL A CA 1 
ATOM 3561 C CA . LYS E  5  853  ? 230.395 220.346 228.874 1.00 0.00 ? 853  LYS A CA 1 
ATOM 3562 C CA . SER E  5  854  ? 234.019 219.132 228.966 1.00 0.00 ? 854  SER A CA 1 
ATOM 3563 C CA . ARG E  5  855  ? 235.399 222.533 227.907 1.00 0.00 ? 855  ARG A CA 1 
ATOM 3564 C CA . LEU E  5  856  ? 234.345 225.867 229.419 1.00 0.00 ? 856  LEU A CA 1 
ATOM 3565 C CA . ASN E  5  857  ? 234.488 229.394 227.995 1.00 0.00 ? 857  ASN A CA 1 
ATOM 3566 C CA . GLN E  5  858  ? 235.337 232.855 229.383 1.00 0.00 ? 858  GLN A CA 1 
ATOM 3567 C CA . SER E  5  859  ? 231.726 233.812 230.189 1.00 0.00 ? 859  SER A CA 1 
ATOM 3568 C CA . GLN E  5  860  ? 231.170 230.331 231.687 1.00 0.00 ? 860  GLN A CA 1 
ATOM 3569 C CA . ARG E  5  861  ? 234.350 230.655 233.798 1.00 0.00 ? 861  ARG A CA 1 
ATOM 3570 C CA . GLU E  5  862  ? 232.976 234.044 234.878 1.00 0.00 ? 862  GLU A CA 1 
ATOM 3571 C CA . GLU E  5  863  ? 229.536 232.656 235.787 1.00 0.00 ? 863  GLU A CA 1 
ATOM 3572 C CA . LEU E  5  864  ? 230.822 229.663 237.770 1.00 0.00 ? 864  LEU A CA 1 
ATOM 3573 C CA . GLY E  5  865  ? 232.685 231.967 240.147 1.00 0.00 ? 865  GLY A CA 1 
ATOM 3574 C CA . LEU E  5  866  ? 229.534 234.022 240.754 1.00 0.00 ? 866  LEU A CA 1 
ATOM 3575 C CA . ILE E  5  867  ? 227.650 230.740 241.158 1.00 0.00 ? 867  ILE A CA 1 
ATOM 3576 C CA . GLU E  5  868  ? 230.151 229.266 243.654 1.00 0.00 ? 868  GLU A CA 1 
ATOM 3577 C CA . GLN E  5  869  ? 230.363 232.587 245.534 1.00 0.00 ? 869  GLN A CA 1 
ATOM 3578 C CA . ALA E  5  870  ? 226.563 232.553 245.972 1.00 0.00 ? 870  ALA A CA 1 
ATOM 3579 C CA . TYR E  5  871  ? 226.610 229.046 247.507 1.00 0.00 ? 871  TYR A CA 1 
ATOM 3580 C CA . ASP E  5  872  ? 229.009 230.171 250.255 1.00 0.00 ? 872  ASP A CA 1 
ATOM 3581 C CA . ASN E  5  873  ? 226.983 233.149 251.524 1.00 0.00 ? 873  ASN A CA 1 
ATOM 3582 C CA . PRO E  5  874  ? 223.305 233.391 250.468 1.00 0.00 ? 874  PRO A CA 1 
ATOM 3583 C CA . HIS E  5  875  ? 222.052 236.398 252.491 1.00 0.00 ? 875  HIS A CA 1 
ATOM 3584 C CA . GLU E  5  876  ? 224.718 238.643 250.950 1.00 0.00 ? 876  GLU A CA 1 
ATOM 3585 C CA . ALA E  5  877  ? 223.675 237.387 247.491 1.00 0.00 ? 877  ALA A CA 1 
ATOM 3586 C CA . LEU E  5  878  ? 219.971 237.833 248.362 1.00 0.00 ? 878  LEU A CA 1 
ATOM 3587 C CA . SER E  5  879  ? 220.668 241.455 249.309 1.00 0.00 ? 879  SER A CA 1 
ATOM 3588 C CA . ARG E  5  880  ? 222.255 242.021 245.883 1.00 0.00 ? 880  ARG A CA 1 
ATOM 3589 C CA . ILE E  5  881  ? 219.348 240.356 244.021 1.00 0.00 ? 881  ILE A CA 1 
ATOM 3590 C CA . LYS E  5  882  ? 216.660 242.536 245.658 1.00 0.00 ? 882  LYS A CA 1 
ATOM 3591 C CA . ARG E  5  883  ? 218.704 245.654 244.834 1.00 0.00 ? 883  ARG A CA 1 
ATOM 3592 C CA . HIS E  5  884  ? 219.091 244.561 241.192 1.00 0.00 ? 884  HIS A CA 1 
ATOM 3593 C CA . LEU E  5  885  ? 215.296 244.402 240.794 1.00 0.00 ? 885  LEU A CA 1 
ATOM 3594 C CA . LEU E  5  886  ? 214.337 247.746 242.351 1.00 0.00 ? 886  LEU A CA 1 
ATOM 3595 C CA . THR E  5  887  ? 216.814 250.039 240.597 1.00 0.00 ? 887  THR A CA 1 
ATOM 3596 C CA . GLN E  5  888  ? 218.127 248.605 237.306 1.00 0.00 ? 888  GLN A CA 1 
ATOM 3597 C CA . ARG E  5  889  ? 216.091 249.152 234.135 1.00 0.00 ? 889  ARG A CA 1 
ATOM 3598 C CA . ALA E  5  890  ? 218.776 248.885 231.401 1.00 0.00 ? 890  ALA A CA 1 
ATOM 3599 C CA . PHE E  5  891  ? 220.706 245.673 230.692 1.00 0.00 ? 891  PHE A CA 1 
ATOM 3600 C CA . LYS E  5  892  ? 223.783 244.628 228.689 1.00 0.00 ? 892  LYS A CA 1 
ATOM 3601 C CA . GLU E  5  893  ? 223.693 243.388 225.093 1.00 0.00 ? 893  GLU A CA 1 
ATOM 3602 C CA . VAL E  5  894  ? 222.147 239.943 224.719 1.00 0.00 ? 894  VAL A CA 1 
ATOM 3603 C CA . GLY E  5  895  ? 223.622 237.914 221.887 1.00 0.00 ? 895  GLY A CA 1 
ATOM 3604 C CA . ILE E  5  896  ? 221.472 235.740 219.674 1.00 0.00 ? 896  ILE A CA 1 
ATOM 3605 C CA . GLU E  5  897  ? 222.546 232.437 218.174 1.00 0.00 ? 897  GLU A CA 1 
ATOM 3606 C CA . PHE E  5  898  ? 220.663 229.844 216.082 1.00 0.00 ? 898  PHE A CA 1 
ATOM 3607 C CA . MET E  5  899  ? 220.586 226.195 217.177 1.00 0.00 ? 899  MET A CA 1 
ATOM 3608 C CA . ASP E  5  900  ? 220.046 224.211 213.974 1.00 0.00 ? 900  ASP A CA 1 
ATOM 3609 C CA . LEU E  5  901  ? 217.739 221.189 213.557 1.00 0.00 ? 901  LEU A CA 1 
ATOM 3610 C CA . TYR E  5  902  ? 218.009 220.830 209.752 1.00 0.00 ? 902  TYR A CA 1 
ATOM 3611 C CA . SER E  5  903  ? 214.198 221.183 209.605 1.00 0.00 ? 903  SER A CA 1 
ATOM 3612 C CA . HIS E  5  904  ? 213.583 224.459 211.455 1.00 0.00 ? 904  HIS A CA 1 
ATOM 3613 C CA . LEU E  5  905  ? 215.965 226.766 213.302 1.00 0.00 ? 905  LEU A CA 1 
ATOM 3614 C CA . VAL E  5  906  ? 215.734 228.218 216.784 1.00 0.00 ? 906  VAL A CA 1 
ATOM 3615 C CA . PRO E  5  907  ? 217.062 231.520 218.169 1.00 0.00 ? 907  PRO A CA 1 
ATOM 3616 C CA . VAL E  5  908  ? 219.040 231.047 221.400 1.00 0.00 ? 908  VAL A CA 1 
ATOM 3617 C CA . TYR E  5  909  ? 219.704 233.888 223.819 1.00 0.00 ? 909  TYR A CA 1 
ATOM 3618 C CA . ASP E  5  910  ? 223.124 234.256 225.457 1.00 0.00 ? 910  ASP A CA 1 
ATOM 3619 C CA . VAL E  5  911  ? 222.375 236.497 228.450 1.00 0.00 ? 911  VAL A CA 1 
ATOM 3620 C CA . GLU E  5  912  ? 224.983 237.974 230.829 1.00 0.00 ? 912  GLU A CA 1 
ATOM 3621 C CA . PRO E  5  913  ? 225.927 235.884 233.928 1.00 0.00 ? 913  PRO A CA 1 
ATOM 3622 C CA . LEU E  5  914  ? 224.873 238.267 236.730 1.00 0.00 ? 914  LEU A CA 1 
ATOM 3623 C CA . GLU E  5  915  ? 221.505 239.188 235.163 1.00 0.00 ? 915  GLU A CA 1 
ATOM 3624 C CA . LYS E  5  916  ? 220.809 235.434 234.917 1.00 0.00 ? 916  LYS A CA 1 
ATOM 3625 C CA . ILE E  5  917  ? 221.256 234.881 238.676 1.00 0.00 ? 917  ILE A CA 1 
ATOM 3626 C CA . THR E  5  918  ? 218.766 237.682 239.329 1.00 0.00 ? 918  THR A CA 1 
ATOM 3627 C CA . ASP E  5  919  ? 216.347 236.492 236.613 1.00 0.00 ? 919  ASP A CA 1 
ATOM 3628 C CA . ALA E  5  920  ? 216.608 232.867 237.765 1.00 0.00 ? 920  ALA A CA 1 
ATOM 3629 C CA . TYR E  5  921  ? 215.636 233.919 241.296 1.00 0.00 ? 921  TYR A CA 1 
ATOM 3630 C CA . LEU E  5  922  ? 212.734 235.950 239.907 1.00 0.00 ? 922  LEU A CA 1 
ATOM 3631 C CA . ASP E  5  923  ? 211.547 233.100 237.658 1.00 0.00 ? 923  ASP A CA 1 
ATOM 3632 C CA . GLN E  5  924  ? 211.517 230.633 240.554 1.00 0.00 ? 924  GLN A CA 1 
ATOM 3633 C CA . TYR E  5  925  ? 209.723 233.255 242.692 1.00 0.00 ? 925  TYR A CA 1 
ATOM 3634 C CA . LEU E  5  926  ? 206.629 233.999 240.568 1.00 0.00 ? 926  LEU A CA 1 
ATOM 3635 C CA . TRP E  5  927  ? 206.000 230.306 239.943 1.00 0.00 ? 927  TRP A CA 1 
ATOM 3636 C CA . TYR E  5  928  ? 206.209 229.394 243.644 1.00 0.00 ? 928  TYR A CA 1 
ATOM 3637 C CA . GLU E  5  929  ? 203.924 232.287 244.612 1.00 0.00 ? 929  GLU A CA 1 
ATOM 3638 C CA . ALA E  5  930  ? 201.461 232.010 241.694 1.00 0.00 ? 930  ALA A CA 1 
ATOM 3639 C CA . ASP E  5  931  ? 200.713 228.360 242.526 1.00 0.00 ? 931  ASP A CA 1 
ATOM 3640 C CA . LYS E  5  932  ? 200.490 229.257 246.221 1.00 0.00 ? 932  LYS A CA 1 
ATOM 3641 C CA . ARG E  5  933  ? 197.422 231.351 245.315 1.00 0.00 ? 933  ARG A CA 1 
ATOM 3642 C CA . ARG E  5  934  ? 196.106 229.528 242.213 1.00 0.00 ? 934  ARG A CA 1 
ATOM 3643 C CA . LEU E  5  935  ? 196.612 232.215 239.556 1.00 0.00 ? 935  LEU A CA 1 
ATOM 3644 C CA . PHE E  5  936  ? 196.423 229.672 236.717 1.00 0.00 ? 936  PHE A CA 1 
ATOM 3645 C CA . PRO E  5  937  ? 193.330 227.698 235.685 1.00 0.00 ? 937  PRO A CA 1 
ATOM 3646 C CA . PRO E  5  938  ? 193.429 223.916 235.030 1.00 0.00 ? 938  PRO A CA 1 
ATOM 3647 C CA . TRP E  5  939  ? 193.323 224.185 231.214 1.00 0.00 ? 939  TRP A CA 1 
ATOM 3648 C CA . ILE E  5  940  ? 196.697 225.990 230.857 1.00 0.00 ? 940  ILE A CA 1 
ATOM 3649 C CA . LYS E  5  941  ? 198.465 222.660 230.656 1.00 0.00 ? 941  LYS A CA 1 
ATOM 3650 C CA . PRO E  5  942  ? 202.134 221.858 230.432 1.00 0.00 ? 942  PRO A CA 1 
ATOM 3651 C CA . ALA E  5  943  ? 201.711 221.574 234.218 1.00 0.00 ? 943  ALA A CA 1 
ATOM 3652 C CA . ASP E  5  944  ? 203.560 219.663 236.948 1.00 0.00 ? 944  ASP A CA 1 
ATOM 3653 C CA . THR E  5  945  ? 200.951 216.856 237.097 1.00 0.00 ? 945  THR A CA 1 
ATOM 3654 C CA . GLU E  5  946  ? 201.150 215.158 233.683 1.00 0.00 ? 946  GLU A CA 1 
ATOM 3655 C CA . PRO E  5  947  ? 203.981 214.448 231.298 1.00 0.00 ? 947  PRO A CA 1 
ATOM 3656 C CA . PRO E  5  948  ? 202.834 214.919 227.647 1.00 0.00 ? 948  PRO A CA 1 
ATOM 3657 C CA . PRO E  5  949  ? 201.858 211.229 226.930 1.00 0.00 ? 949  PRO A CA 1 
ATOM 3658 C CA . LEU E  5  950  ? 199.622 210.966 230.016 1.00 0.00 ? 950  LEU A CA 1 
ATOM 3659 C CA . LEU E  5  951  ? 198.041 214.213 228.816 1.00 0.00 ? 951  LEU A CA 1 
ATOM 3660 C CA . VAL E  5  952  ? 196.849 212.490 225.620 1.00 0.00 ? 952  VAL A CA 1 
ATOM 3661 C CA . TYR E  5  953  ? 195.398 209.593 227.641 1.00 0.00 ? 953  TYR A CA 1 
ATOM 3662 C CA . LYS E  5  954  ? 193.653 211.924 230.099 1.00 0.00 ? 954  LYS A CA 1 
ATOM 3663 C CA . TRP E  5  955  ? 192.284 213.905 227.113 1.00 0.00 ? 955  TRP A CA 1 
ATOM 3664 C CA . CYS E  5  956  ? 190.884 210.776 225.416 1.00 0.00 ? 956  CYS A CA 1 
ATOM 3665 C CA . GLN E  5  957  ? 189.559 209.606 228.804 1.00 0.00 ? 957  GLN A CA 1 
ATOM 3666 C CA . GLY E  5  958  ? 187.692 212.948 228.860 1.00 0.00 ? 958  GLY A CA 1 
ATOM 3667 C CA . ILE E  5  959  ? 186.118 212.596 225.384 1.00 0.00 ? 959  ILE A CA 1 
ATOM 3668 C CA . ASN E  5  960  ? 184.345 209.432 226.574 1.00 0.00 ? 960  ASN A CA 1 
ATOM 3669 C CA . ASN E  5  961  ? 183.254 210.943 229.901 1.00 0.00 ? 961  ASN A CA 1 
ATOM 3670 C CA . LEU E  5  962  ? 180.984 213.571 228.372 1.00 0.00 ? 962  LEU A CA 1 
ATOM 3671 C CA . GLN E  5  963  ? 177.263 212.716 228.508 1.00 0.00 ? 963  GLN A CA 1 
ATOM 3672 C CA . ASP E  5  964  ? 176.018 210.978 225.337 1.00 0.00 ? 964  ASP A CA 1 
ATOM 3673 C CA . VAL E  5  965  ? 178.950 211.792 223.042 1.00 0.00 ? 965  VAL A CA 1 
ATOM 3674 C CA . TRP E  5  966  ? 178.612 209.080 220.399 1.00 0.00 ? 966  TRP A CA 1 
ATOM 3675 C CA . GLU E  5  967  ? 174.925 209.604 219.521 1.00 0.00 ? 967  GLU A CA 1 
ATOM 3676 C CA . THR E  5  968  ? 174.633 210.654 215.865 1.00 0.00 ? 968  THR A CA 1 
ATOM 3677 C CA . SER E  5  969  ? 170.936 209.717 215.754 1.00 0.00 ? 969  SER A CA 1 
ATOM 3678 C CA . GLU E  5  970  ? 169.076 213.034 215.316 1.00 0.00 ? 970  GLU A CA 1 
ATOM 3679 C CA . GLY E  5  971  ? 171.492 215.387 213.531 1.00 0.00 ? 971  GLY A CA 1 
ATOM 3680 C CA . GLU E  5  972  ? 174.102 215.866 216.287 1.00 0.00 ? 972  GLU A CA 1 
ATOM 3681 C CA . CYS E  5  973  ? 177.649 216.830 215.241 1.00 0.00 ? 973  CYS A CA 1 
ATOM 3682 C CA . ASN E  5  974  ? 181.014 216.922 217.031 1.00 0.00 ? 974  ASN A CA 1 
ATOM 3683 C CA . VAL E  5  975  ? 183.939 219.128 216.037 1.00 0.00 ? 975  VAL A CA 1 
ATOM 3684 C CA . MET E  5  976  ? 187.313 218.791 217.786 1.00 0.00 ? 976  MET A CA 1 
ATOM 3685 C CA . LEU E  5  977  ? 189.784 221.416 216.619 1.00 0.00 ? 977  LEU A CA 1 
ATOM 3686 C CA . GLU E  5  978  ? 193.521 221.898 217.161 1.00 0.00 ? 978  GLU A CA 1 
ATOM 3687 C CA . SER E  5  979  ? 195.390 225.073 216.166 1.00 0.00 ? 979  SER A CA 1 
ATOM 3688 C CA . ARG E  5  980  ? 198.618 227.073 216.202 1.00 0.00 ? 980  ARG A CA 1 
ATOM 3689 C CA . PHE E  5  981  ? 198.584 230.837 216.878 1.00 0.00 ? 981  PHE A CA 1 
ATOM 3690 C CA . GLU E  5  982  ? 200.975 231.566 213.975 1.00 0.00 ? 982  GLU A CA 1 
ATOM 3691 C CA . LYS E  5  983  ? 203.270 234.255 215.455 1.00 0.00 ? 983  LYS A CA 1 
ATOM 3692 C CA . MET E  5  984  ? 202.270 235.059 219.027 1.00 0.00 ? 984  MET A CA 1 
ATOM 3693 C CA . TYR E  5  985  ? 205.736 235.960 220.286 1.00 0.00 ? 985  TYR A CA 1 
ATOM 3694 C CA . GLU E  5  986  ? 206.290 238.490 217.476 1.00 0.00 ? 986  GLU A CA 1 
ATOM 3695 C CA . LYS E  5  987  ? 202.853 240.133 217.744 1.00 0.00 ? 987  LYS A CA 1 
ATOM 3696 C CA . ILE E  5  988  ? 203.202 240.912 221.471 1.00 0.00 ? 988  ILE A CA 1 
ATOM 3697 C CA . ASP E  5  989  ? 203.845 244.491 222.648 1.00 0.00 ? 989  ASP A CA 1 
ATOM 3698 C CA . LEU E  5  990  ? 205.635 245.627 225.815 1.00 0.00 ? 990  LEU A CA 1 
ATOM 3699 C CA . THR E  5  991  ? 203.376 248.578 226.686 1.00 0.00 ? 991  THR A CA 1 
ATOM 3700 C CA . LEU E  5  992  ? 200.271 246.388 226.951 1.00 0.00 ? 992  LEU A CA 1 
ATOM 3701 C CA . LEU E  5  993  ? 202.371 243.736 228.680 1.00 0.00 ? 993  LEU A CA 1 
ATOM 3702 C CA . ASN E  5  994  ? 203.576 246.348 231.191 1.00 0.00 ? 994  ASN A CA 1 
ATOM 3703 C CA . ARG E  5  995  ? 199.987 247.216 232.121 1.00 0.00 ? 995  ARG A CA 1 
ATOM 3704 C CA . LEU E  5  996  ? 198.802 243.584 232.193 1.00 0.00 ? 996  LEU A CA 1 
ATOM 3705 C CA . LEU E  5  997  ? 201.825 242.627 234.313 1.00 0.00 ? 997  LEU A CA 1 
ATOM 3706 C CA . ARG E  5  998  ? 201.166 245.470 236.743 1.00 0.00 ? 998  ARG A CA 1 
ATOM 3707 C CA . LEU E  5  999  ? 198.008 243.604 237.840 1.00 0.00 ? 999  LEU A CA 1 
ATOM 3708 C CA . ILE E  5  1000 ? 199.458 240.209 238.782 1.00 0.00 ? 1000 ILE A CA 1 
ATOM 3709 C CA . VAL E  5  1001 ? 202.154 241.508 241.165 1.00 0.00 ? 1001 VAL A CA 1 
ATOM 3710 C CA . ASP E  5  1002 ? 203.779 244.593 242.730 1.00 0.00 ? 1002 ASP A CA 1 
ATOM 3711 C CA . HIS E  5  1003 ? 204.351 247.506 240.372 1.00 0.00 ? 1003 HIS A CA 1 
ATOM 3712 C CA . ASN E  5  1004 ? 208.124 247.449 241.000 1.00 0.00 ? 1004 ASN A CA 1 
ATOM 3713 C CA . ILE E  5  1005 ? 208.729 243.843 239.905 1.00 0.00 ? 1005 ILE A CA 1 
ATOM 3714 C CA . ALA E  5  1006 ? 206.542 244.195 236.794 1.00 0.00 ? 1006 ALA A CA 1 
ATOM 3715 C CA . ASP E  5  1007 ? 208.856 247.073 235.801 1.00 0.00 ? 1007 ASP A CA 1 
ATOM 3716 C CA . TYR E  5  1008 ? 211.837 244.685 235.765 1.00 0.00 ? 1008 TYR A CA 1 
ATOM 3717 C CA . MET E  5  1009 ? 210.132 242.174 233.456 1.00 0.00 ? 1009 MET A CA 1 
ATOM 3718 C CA . THR E  5  1010 ? 208.868 244.779 230.956 1.00 0.00 ? 1010 THR A CA 1 
ATOM 3719 C CA . ALA E  5  1011 ? 212.260 246.541 230.952 1.00 0.00 ? 1011 ALA A CA 1 
ATOM 3720 C CA . LYS E  5  1012 ? 214.136 243.228 230.732 1.00 0.00 ? 1012 LYS A CA 1 
ATOM 3721 C CA . ASN E  5  1013 ? 212.394 242.550 227.390 1.00 0.00 ? 1013 ASN A CA 1 
ATOM 3722 C CA . ASN E  5  1014 ? 213.546 245.680 225.503 1.00 0.00 ? 1014 ASN A CA 1 
ATOM 3723 C CA . VAL E  5  1015 ? 217.259 244.800 225.200 1.00 0.00 ? 1015 VAL A CA 1 
ATOM 3724 C CA . VAL E  5  1016 ? 219.667 245.037 222.276 1.00 0.00 ? 1016 VAL A CA 1 
ATOM 3725 C CA . ILE E  5  1017 ? 220.158 241.890 220.195 1.00 0.00 ? 1017 ILE A CA 1 
ATOM 3726 C CA . ASN E  5  1018 ? 223.612 241.173 218.777 1.00 0.00 ? 1018 ASN A CA 1 
ATOM 3727 C CA . TYR E  5  1019 ? 225.288 238.819 216.296 1.00 0.00 ? 1019 TYR A CA 1 
ATOM 3728 C CA . LYS E  5  1020 ? 228.629 239.553 214.603 1.00 0.00 ? 1020 LYS A CA 1 
ATOM 3729 C CA . ASP E  5  1021 ? 228.661 242.779 212.525 1.00 0.00 ? 1021 ASP A CA 1 
ATOM 3730 C CA . MET E  5  1022 ? 225.044 243.649 213.311 1.00 0.00 ? 1022 MET A CA 1 
ATOM 3731 C CA . ASN E  5  1023 ? 222.565 244.297 216.119 1.00 0.00 ? 1023 ASN A CA 1 
ATOM 3732 C CA . HIS E  5  1024 ? 219.254 246.071 216.821 1.00 0.00 ? 1024 HIS A CA 1 
ATOM 3733 C CA . THR E  5  1025 ? 216.862 247.022 219.628 1.00 0.00 ? 1025 THR A CA 1 
ATOM 3734 C CA . ASN E  5  1026 ? 213.958 244.753 220.626 1.00 0.00 ? 1026 ASN A CA 1 
ATOM 3735 C CA . SER E  5  1027 ? 210.984 246.998 221.399 1.00 0.00 ? 1027 SER A CA 1 
ATOM 3736 C CA . TYR E  5  1028 ? 208.093 245.151 219.718 1.00 0.00 ? 1028 TYR A CA 1 
ATOM 3737 C CA . GLY E  5  1029 ? 208.669 241.420 220.366 1.00 0.00 ? 1029 GLY A CA 1 
ATOM 3738 C CA . ILE E  5  1030 ? 208.877 239.350 223.553 1.00 0.00 ? 1030 ILE A CA 1 
ATOM 3739 C CA . ILE E  5  1031 ? 212.138 237.519 224.209 1.00 0.00 ? 1031 ILE A CA 1 
ATOM 3740 C CA . ARG E  5  1032 ? 212.283 233.956 225.556 1.00 0.00 ? 1032 ARG A CA 1 
ATOM 3741 C CA . GLY E  5  1033 ? 215.917 233.867 226.751 1.00 0.00 ? 1033 GLY A CA 1 
ATOM 3742 C CA . LEU E  5  1034 ? 214.795 235.292 230.112 1.00 0.00 ? 1034 LEU A CA 1 
ATOM 3743 C CA . GLN E  5  1035 ? 214.616 232.763 232.946 1.00 0.00 ? 1035 GLN A CA 1 
ATOM 3744 C CA . PHE E  5  1036 ? 210.992 233.809 233.588 1.00 0.00 ? 1036 PHE A CA 1 
ATOM 3745 C CA . ALA E  5  1037 ? 209.917 234.084 229.928 1.00 0.00 ? 1037 ALA A CA 1 
ATOM 3746 C CA . SER E  5  1038 ? 207.778 230.983 230.614 1.00 0.00 ? 1038 SER A CA 1 
ATOM 3747 C CA . PHE E  5  1039 ? 205.751 232.771 233.301 1.00 0.00 ? 1039 PHE A CA 1 
ATOM 3748 C CA . ILE E  5  1040 ? 205.347 235.604 230.734 1.00 0.00 ? 1040 ILE A CA 1 
ATOM 3749 C CA . VAL E  5  1041 ? 203.946 233.584 228.038 1.00 0.00 ? 1041 VAL A CA 1 
ATOM 3750 C CA . GLN E  5  1042 ? 201.581 231.520 230.210 1.00 0.00 ? 1042 GLN A CA 1 
ATOM 3751 C CA . TYR E  5  1043 ? 199.719 234.454 231.783 1.00 0.00 ? 1043 TYR A CA 1 
ATOM 3752 C CA . TYR E  5  1044 ? 199.697 236.465 228.523 1.00 0.00 ? 1044 TYR A CA 1 
ATOM 3753 C CA . GLY E  5  1045 ? 198.507 233.232 226.866 1.00 0.00 ? 1045 GLY A CA 1 
ATOM 3754 C CA . LEU E  5  1046 ? 195.726 233.225 229.466 1.00 0.00 ? 1046 LEU A CA 1 
ATOM 3755 C CA . VAL E  5  1047 ? 194.475 236.445 227.815 1.00 0.00 ? 1047 VAL A CA 1 
ATOM 3756 C CA . MET E  5  1048 ? 194.284 234.739 224.404 1.00 0.00 ? 1048 MET A CA 1 
ATOM 3757 C CA . ASP E  5  1049 ? 192.028 232.082 225.972 1.00 0.00 ? 1049 ASP A CA 1 
ATOM 3758 C CA . LEU E  5  1050 ? 189.705 234.657 227.543 1.00 0.00 ? 1050 LEU A CA 1 
ATOM 3759 C CA . LEU E  5  1051 ? 188.892 236.080 224.109 1.00 0.00 ? 1051 LEU A CA 1 
ATOM 3760 C CA . VAL E  5  1052 ? 187.844 232.719 222.675 1.00 0.00 ? 1052 VAL A CA 1 
ATOM 3761 C CA . LEU E  5  1053 ? 186.043 231.193 225.686 1.00 0.00 ? 1053 LEU A CA 1 
ATOM 3762 C CA . GLY E  5  1054 ? 184.238 234.205 227.080 1.00 0.00 ? 1054 GLY A CA 1 
ATOM 3763 C CA . LEU E  5  1055 ? 183.970 235.117 230.754 1.00 0.00 ? 1055 LEU A CA 1 
ATOM 3764 C CA . HIS E  5  1056 ? 180.775 233.090 231.254 1.00 0.00 ? 1056 HIS A CA 1 
ATOM 3765 C CA . ARG E  5  1057 ? 181.961 229.710 229.912 1.00 0.00 ? 1057 ARG A CA 1 
ATOM 3766 C CA . ALA E  5  1058 ? 185.461 230.076 231.420 1.00 0.00 ? 1058 ALA A CA 1 
ATOM 3767 C CA . SER E  5  1059 ? 184.100 230.356 234.981 1.00 0.00 ? 1059 SER A CA 1 
ATOM 3768 C CA . GLU E  5  1060 ? 182.108 227.145 234.377 1.00 0.00 ? 1060 GLU A CA 1 
ATOM 3769 C CA . MET E  5  1061 ? 185.141 225.163 233.149 1.00 0.00 ? 1061 MET A CA 1 
ATOM 3770 C CA . ALA E  5  1062 ? 187.542 226.172 235.947 1.00 0.00 ? 1062 ALA A CA 1 
ATOM 3771 C CA . GLY E  5  1063 ? 184.509 226.206 238.255 1.00 0.00 ? 1063 GLY A CA 1 
ATOM 3772 C CA . PRO E  5  1064 ? 184.702 227.889 241.696 1.00 0.00 ? 1064 PRO A CA 1 
ATOM 3773 C CA . PRO E  5  1065 ? 188.092 229.434 242.628 1.00 0.00 ? 1065 PRO A CA 1 
ATOM 3774 C CA . GLN E  5  1066 ? 187.559 228.021 246.146 1.00 0.00 ? 1066 GLN A CA 1 
ATOM 3775 C CA . MET E  5  1067 ? 187.489 224.470 244.711 1.00 0.00 ? 1067 MET A CA 1 
ATOM 3776 C CA . PRO E  5  1068 ? 188.250 224.201 240.959 1.00 0.00 ? 1068 PRO A CA 1 
ATOM 3777 C CA . ASN E  5  1069 ? 187.189 221.228 238.827 1.00 0.00 ? 1069 ASN A CA 1 
ATOM 3778 C CA . ASP E  5  1070 ? 189.456 218.401 237.638 1.00 0.00 ? 1070 ASP A CA 1 
ATOM 3779 C CA . PHE E  5  1071 ? 191.498 218.559 234.417 1.00 0.00 ? 1071 PHE A CA 1 
ATOM 3780 C CA . LEU E  5  1072 ? 188.427 217.482 232.402 1.00 0.00 ? 1072 LEU A CA 1 
ATOM 3781 C CA . SER E  5  1073 ? 185.399 217.333 234.713 1.00 0.00 ? 1073 SER A CA 1 
ATOM 3782 C CA . PHE E  5  1074 ? 182.487 219.532 235.824 1.00 0.00 ? 1074 PHE A CA 1 
ATOM 3783 C CA . GLN E  5  1075 ? 180.087 219.869 238.759 1.00 0.00 ? 1075 GLN A CA 1 
ATOM 3784 C CA . ASP E  5  1076 ? 176.740 219.486 236.965 1.00 0.00 ? 1076 ASP A CA 1 
ATOM 3785 C CA . ILE E  5  1077 ? 175.512 217.904 233.730 1.00 0.00 ? 1077 ILE A CA 1 
ATOM 3786 C CA . ALA E  5  1078 ? 173.506 221.110 233.112 1.00 0.00 ? 1078 ALA A CA 1 
ATOM 3787 C CA . THR E  5  1079 ? 176.567 223.389 232.933 1.00 0.00 ? 1079 THR A CA 1 
ATOM 3788 C CA . GLU E  5  1080 ? 178.330 220.691 230.881 1.00 0.00 ? 1080 GLU A CA 1 
ATOM 3789 C CA . ALA E  5  1081 ? 175.694 220.840 228.114 1.00 0.00 ? 1081 ALA A CA 1 
ATOM 3790 C CA . ALA E  5  1082 ? 175.040 224.614 228.212 1.00 0.00 ? 1082 ALA A CA 1 
ATOM 3791 C CA . HIS E  5  1083 ? 177.591 225.360 225.478 1.00 0.00 ? 1083 HIS A CA 1 
ATOM 3792 C CA . PRO E  5  1084 ? 178.876 223.691 222.268 1.00 0.00 ? 1084 PRO A CA 1 
ATOM 3793 C CA . ILE E  5  1085 ? 182.417 224.018 223.700 1.00 0.00 ? 1085 ILE A CA 1 
ATOM 3794 C CA . ARG E  5  1086 ? 182.663 221.076 226.117 1.00 0.00 ? 1086 ARG A CA 1 
ATOM 3795 C CA . LEU E  5  1087 ? 186.378 220.885 226.982 1.00 0.00 ? 1087 LEU A CA 1 
ATOM 3796 C CA . PHE E  5  1088 ? 189.434 222.852 225.856 1.00 0.00 ? 1088 PHE A CA 1 
ATOM 3797 C CA . CYS E  5  1089 ? 193.154 223.037 226.714 1.00 0.00 ? 1089 CYS A CA 1 
ATOM 3798 C CA . ARG E  5  1090 ? 196.158 225.164 225.737 1.00 0.00 ? 1090 ARG A CA 1 
ATOM 3799 C CA . TYR E  5  1091 ? 199.702 223.764 225.557 1.00 0.00 ? 1091 TYR A CA 1 
ATOM 3800 C CA . ILE E  5  1092 ? 201.977 226.810 225.169 1.00 0.00 ? 1092 ILE A CA 1 
ATOM 3801 C CA . ASP E  5  1093 ? 201.108 227.866 221.579 1.00 0.00 ? 1093 ASP A CA 1 
ATOM 3802 C CA . ARG E  5  1094 ? 198.763 224.990 220.670 1.00 0.00 ? 1094 ARG A CA 1 
ATOM 3803 C CA . ILE E  5  1095 ? 195.025 225.087 221.323 1.00 0.00 ? 1095 ILE A CA 1 
ATOM 3804 C CA . HIS E  5  1096 ? 192.626 222.160 221.697 1.00 0.00 ? 1096 HIS A CA 1 
ATOM 3805 C CA . ILE E  5  1097 ? 188.822 222.531 221.611 1.00 0.00 ? 1097 ILE A CA 1 
ATOM 3806 C CA . PHE E  5  1098 ? 185.888 220.158 221.757 1.00 0.00 ? 1098 PHE A CA 1 
ATOM 3807 C CA . PHE E  5  1099 ? 182.589 221.263 220.198 1.00 0.00 ? 1099 PHE A CA 1 
ATOM 3808 C CA . ARG E  5  1100 ? 179.139 219.649 220.101 1.00 0.00 ? 1100 ARG A CA 1 
ATOM 3809 C CA . PHE E  5  1101 ? 176.204 220.935 218.038 1.00 0.00 ? 1101 PHE A CA 1 
ATOM 3810 C CA . THR E  5  1102 ? 172.475 220.325 217.767 1.00 0.00 ? 1102 THR A CA 1 
ATOM 3811 C CA . ALA E  5  1103 ? 170.908 220.286 214.277 1.00 0.00 ? 1103 ALA A CA 1 
ATOM 3812 C CA . ASP E  5  1104 ? 169.523 223.780 214.979 1.00 0.00 ? 1104 ASP A CA 1 
ATOM 3813 C CA . GLU E  5  1105 ? 172.926 225.332 215.787 1.00 0.00 ? 1105 GLU A CA 1 
ATOM 3814 C CA . ALA E  5  1106 ? 174.782 223.383 213.067 1.00 0.00 ? 1106 ALA A CA 1 
ATOM 3815 C CA . ARG E  5  1107 ? 172.262 224.683 210.500 1.00 0.00 ? 1107 ARG A CA 1 
ATOM 3816 C CA . ASP E  5  1108 ? 172.696 228.303 211.658 1.00 0.00 ? 1108 ASP A CA 1 
ATOM 3817 C CA . LEU E  5  1109 ? 176.488 228.149 211.864 1.00 0.00 ? 1109 LEU A CA 1 
ATOM 3818 C CA . ILE E  5  1110 ? 176.920 226.674 208.374 1.00 0.00 ? 1110 ILE A CA 1 
ATOM 3819 C CA . GLN E  5  1111 ? 174.322 229.012 206.843 1.00 0.00 ? 1111 GLN A CA 1 
ATOM 3820 C CA . ARG E  5  1112 ? 175.701 232.158 208.518 1.00 0.00 ? 1112 ARG A CA 1 
ATOM 3821 C CA . TYR E  5  1113 ? 179.262 231.406 207.355 1.00 0.00 ? 1113 TYR A CA 1 
ATOM 3822 C CA . LEU E  5  1114 ? 178.014 230.555 203.849 1.00 0.00 ? 1114 LEU A CA 1 
ATOM 3823 C CA . THR E  5  1115 ? 176.094 233.855 203.744 1.00 0.00 ? 1115 THR A CA 1 
ATOM 3824 C CA . GLU E  5  1116 ? 179.131 235.947 204.766 1.00 0.00 ? 1116 GLU A CA 1 
ATOM 3825 C CA . HIS E  5  1117 ? 181.181 234.189 202.067 1.00 0.00 ? 1117 HIS A CA 1 
ATOM 3826 C CA . PRO E  5  1118 ? 179.133 232.405 199.347 1.00 0.00 ? 1118 PRO A CA 1 
ATOM 3827 C CA . ASP E  5  1119 ? 180.082 228.966 197.983 1.00 0.00 ? 1119 ASP A CA 1 
ATOM 3828 C CA . PRO E  5  1120 ? 179.154 228.793 194.252 1.00 0.00 ? 1120 PRO A CA 1 
ATOM 3829 C CA . ASN E  5  1121 ? 182.206 226.923 192.895 1.00 0.00 ? 1121 ASN A CA 1 
ATOM 3830 C CA . ASN E  5  1122 ? 182.402 224.378 195.745 1.00 0.00 ? 1122 ASN A CA 1 
ATOM 3831 C CA . GLU E  5  1123 ? 186.187 224.364 196.232 1.00 0.00 ? 1123 GLU A CA 1 
ATOM 3832 C CA . ASN E  5  1124 ? 185.785 223.925 200.005 1.00 0.00 ? 1124 ASN A CA 1 
ATOM 3833 C CA . ILE E  5  1125 ? 186.350 220.177 199.611 1.00 0.00 ? 1125 ILE A CA 1 
ATOM 3834 C CA . VAL E  5  1126 ? 189.549 220.539 197.577 1.00 0.00 ? 1126 VAL A CA 1 
ATOM 3835 C CA . GLY E  5  1127 ? 191.870 222.146 200.150 1.00 0.00 ? 1127 GLY A CA 1 
ATOM 3836 C CA . TYR E  5  1128 ? 190.411 220.913 203.454 1.00 0.00 ? 1128 TYR A CA 1 
ATOM 3837 C CA . ASN E  5  1129 ? 193.220 218.407 204.079 1.00 0.00 ? 1129 ASN A CA 1 
ATOM 3838 C CA . ASN E  5  1130 ? 196.337 218.865 201.967 1.00 0.00 ? 1130 ASN A CA 1 
ATOM 3839 C CA . LYS E  5  1131 ? 197.873 215.764 203.601 1.00 0.00 ? 1131 LYS A CA 1 
ATOM 3840 C CA . LYS E  5  1132 ? 196.815 212.156 204.147 1.00 0.00 ? 1132 LYS A CA 1 
ATOM 3841 C CA . CYS E  5  1133 ? 197.607 209.861 207.020 1.00 0.00 ? 1133 CYS A CA 1 
ATOM 3842 C CA . TRP E  5  1134 ? 196.144 206.580 208.242 1.00 0.00 ? 1134 TRP A CA 1 
ATOM 3843 C CA . PRO E  5  1135 ? 194.500 204.086 205.844 1.00 0.00 ? 1135 PRO A CA 1 
ATOM 3844 C CA . ARG E  5  1136 ? 191.814 205.255 203.389 1.00 0.00 ? 1136 ARG A CA 1 
ATOM 3845 C CA . ASP E  5  1137 ? 189.224 203.471 205.559 1.00 0.00 ? 1137 ASP A CA 1 
ATOM 3846 C CA . ALA E  5  1138 ? 190.123 205.401 208.726 1.00 0.00 ? 1138 ALA A CA 1 
ATOM 3847 C CA . ARG E  5  1139 ? 190.721 208.683 206.857 1.00 0.00 ? 1139 ARG A CA 1 
ATOM 3848 C CA . MET E  5  1140 ? 187.988 211.306 207.377 1.00 0.00 ? 1140 MET A CA 1 
ATOM 3849 C CA . ARG E  5  1141 ? 185.353 211.325 204.609 1.00 0.00 ? 1141 ARG A CA 1 
ATOM 3850 C CA . LEU E  5  1142 ? 184.472 214.604 202.938 1.00 0.00 ? 1142 LEU A CA 1 
ATOM 3851 C CA . MET E  5  1143 ? 180.752 215.316 202.763 1.00 0.00 ? 1143 MET A CA 1 
ATOM 3852 C CA . LYS E  5  1144 ? 179.542 218.744 201.577 1.00 0.00 ? 1144 LYS A CA 1 
ATOM 3853 C CA . HIS E  5  1145 ? 177.923 219.202 205.012 1.00 0.00 ? 1145 HIS A CA 1 
ATOM 3854 C CA . ASP E  5  1146 ? 180.863 218.035 207.159 1.00 0.00 ? 1146 ASP A CA 1 
ATOM 3855 C CA . VAL E  5  1147 ? 183.467 220.122 205.312 1.00 0.00 ? 1147 VAL A CA 1 
ATOM 3856 C CA . ASN E  5  1148 ? 181.465 223.341 205.711 1.00 0.00 ? 1148 ASN A CA 1 
ATOM 3857 C CA . LEU E  5  1149 ? 180.851 222.706 209.413 1.00 0.00 ? 1149 LEU A CA 1 
ATOM 3858 C CA . GLY E  5  1150 ? 184.533 222.819 210.419 1.00 0.00 ? 1150 GLY A CA 1 
ATOM 3859 C CA . ARG E  5  1151 ? 185.523 225.447 207.815 1.00 0.00 ? 1151 ARG A CA 1 
ATOM 3860 C CA . ALA E  5  1152 ? 182.875 227.604 209.541 1.00 0.00 ? 1152 ALA A CA 1 
ATOM 3861 C CA . VAL E  5  1153 ? 183.886 226.851 213.165 1.00 0.00 ? 1153 VAL A CA 1 
ATOM 3862 C CA . PHE E  5  1154 ? 187.423 227.885 212.184 1.00 0.00 ? 1154 PHE A CA 1 
ATOM 3863 C CA . TRP E  5  1155 ? 186.094 231.128 210.757 1.00 0.00 ? 1155 TRP A CA 1 
ATOM 3864 C CA . ASP E  5  1156 ? 183.909 231.753 213.802 1.00 0.00 ? 1156 ASP A CA 1 
ATOM 3865 C CA . ILE E  5  1157 ? 186.744 231.296 216.322 1.00 0.00 ? 1157 ILE A CA 1 
ATOM 3866 C CA . LYS E  5  1158 ? 189.281 233.163 214.171 1.00 0.00 ? 1158 LYS A CA 1 
ATOM 3867 C CA . ASN E  5  1159 ? 187.147 236.308 214.534 1.00 0.00 ? 1159 ASN A CA 1 
ATOM 3868 C CA . ARG E  5  1160 ? 187.049 236.029 218.347 1.00 0.00 ? 1160 ARG A CA 1 
ATOM 3869 C CA . LEU E  5  1161 ? 190.749 236.939 218.511 1.00 0.00 ? 1161 LEU A CA 1 
ATOM 3870 C CA . PRO E  5  1162 ? 191.928 240.383 217.333 1.00 0.00 ? 1162 PRO A CA 1 
ATOM 3871 C CA . ARG E  5  1163 ? 194.142 240.334 214.232 1.00 0.00 ? 1163 ARG A CA 1 
ATOM 3872 C CA . SER E  5  1164 ? 196.586 242.577 216.142 1.00 0.00 ? 1164 SER A CA 1 
ATOM 3873 C CA . VAL E  5  1165 ? 197.356 240.159 219.002 1.00 0.00 ? 1165 VAL A CA 1 
ATOM 3874 C CA . THR E  5  1166 ? 197.792 236.993 216.897 1.00 0.00 ? 1166 THR A CA 1 
ATOM 3875 C CA . THR E  5  1167 ? 196.261 235.212 213.951 1.00 0.00 ? 1167 THR A CA 1 
ATOM 3876 C CA . VAL E  5  1168 ? 194.982 231.727 213.268 1.00 0.00 ? 1168 VAL A CA 1 
ATOM 3877 C CA . GLN E  5  1169 ? 195.871 229.917 210.030 1.00 0.00 ? 1169 GLN A CA 1 
ATOM 3878 C CA . TRP E  5  1170 ? 194.225 227.269 207.864 1.00 0.00 ? 1170 TRP A CA 1 
ATOM 3879 C CA . GLU E  5  1171 ? 197.460 225.344 207.240 1.00 0.00 ? 1171 GLU A CA 1 
ATOM 3880 C CA . ASN E  5  1172 ? 198.288 225.068 210.957 1.00 0.00 ? 1172 ASN A CA 1 
ATOM 3881 C CA . SER E  5  1173 ? 194.785 223.763 211.773 1.00 0.00 ? 1173 SER A CA 1 
ATOM 3882 C CA . PHE E  5  1174 ? 192.700 220.657 211.044 1.00 0.00 ? 1174 PHE A CA 1 
ATOM 3883 C CA . VAL E  5  1175 ? 189.380 220.164 212.801 1.00 0.00 ? 1175 VAL A CA 1 
ATOM 3884 C CA . SER E  5  1176 ? 187.846 216.672 212.678 1.00 0.00 ? 1176 SER A CA 1 
ATOM 3885 C CA . VAL E  5  1177 ? 184.073 216.499 212.207 1.00 0.00 ? 1177 VAL A CA 1 
ATOM 3886 C CA . TYR E  5  1178 ? 182.345 213.510 213.833 1.00 0.00 ? 1178 TYR A CA 1 
ATOM 3887 C CA . SER E  5  1179 ? 178.791 213.152 212.509 1.00 0.00 ? 1179 SER A CA 1 
ATOM 3888 C CA . LYS E  5  1180 ? 176.496 210.497 211.004 1.00 0.00 ? 1180 LYS A CA 1 
ATOM 3889 C CA . ASP E  5  1181 ? 178.904 209.895 208.091 1.00 0.00 ? 1181 ASP A CA 1 
ATOM 3890 C CA . ASN E  5  1182 ? 182.305 210.345 209.785 1.00 0.00 ? 1182 ASN A CA 1 
ATOM 3891 C CA . PRO E  5  1183 ? 182.650 207.503 212.353 1.00 0.00 ? 1183 PRO A CA 1 
ATOM 3892 C CA . ASN E  5  1184 ? 186.092 208.476 213.750 1.00 0.00 ? 1184 ASN A CA 1 
ATOM 3893 C CA . LEU E  5  1185 ? 187.597 211.329 215.742 1.00 0.00 ? 1185 LEU A CA 1 
ATOM 3894 C CA . LEU E  5  1186 ? 191.138 212.270 214.637 1.00 0.00 ? 1186 LEU A CA 1 
ATOM 3895 C CA . PHE E  5  1187 ? 193.721 214.612 216.171 1.00 0.00 ? 1187 PHE A CA 1 
ATOM 3896 C CA . ASN E  5  1188 ? 197.436 214.933 217.073 1.00 0.00 ? 1188 ASN A CA 1 
ATOM 3897 C CA . MET E  5  1189 ? 198.383 216.134 220.570 1.00 0.00 ? 1189 MET A CA 1 
ATOM 3898 C CA . CYS E  5  1190 ? 202.136 216.787 220.942 1.00 0.00 ? 1190 CYS A CA 1 
ATOM 3899 C CA . GLY E  5  1191 ? 203.589 213.805 219.056 1.00 0.00 ? 1191 GLY A CA 1 
ATOM 3900 C CA . PHE E  5  1192 ? 200.992 211.073 218.643 1.00 0.00 ? 1192 PHE A CA 1 
ATOM 3901 C CA . GLU E  5  1193 ? 197.930 210.677 216.440 1.00 0.00 ? 1193 GLU A CA 1 
ATOM 3902 C CA . CYS E  5  1194 ? 194.838 209.114 218.050 1.00 0.00 ? 1194 CYS A CA 1 
ATOM 3903 C CA . ARG E  5  1195 ? 191.714 208.250 216.133 1.00 0.00 ? 1195 ARG A CA 1 
ATOM 3904 C CA . ILE E  5  1196 ? 188.782 207.074 218.234 1.00 0.00 ? 1196 ILE A CA 1 
ATOM 3905 C CA . LEU E  5  1197 ? 186.432 204.546 216.627 1.00 0.00 ? 1197 LEU A CA 1 
ATOM 3906 C CA . PRO E  5  1198 ? 183.547 204.025 219.124 1.00 0.00 ? 1198 PRO A CA 1 
ATOM 3907 C CA . LYS E  5  1199 ? 182.328 200.488 219.909 1.00 0.00 ? 1199 LYS A CA 1 
ATOM 3908 C CA . CYS E  5  1200 ? 178.957 201.429 218.367 1.00 0.00 ? 1200 CYS A CA 1 
ATOM 3909 C CA . ARG E  5  1201 ? 180.097 202.302 214.834 1.00 0.00 ? 1201 ARG A CA 1 
ATOM 3910 C CA . THR E  5  1202 ? 182.772 199.613 214.275 1.00 0.00 ? 1202 THR A CA 1 
ATOM 3911 C CA . SER E  5  1203 ? 182.000 197.256 211.373 1.00 0.00 ? 1203 SER A CA 1 
ATOM 3912 C CA . TYR E  5  1204 ? 185.301 195.386 211.321 1.00 0.00 ? 1204 TYR A CA 1 
ATOM 3913 C CA . GLU E  5  1205 ? 185.917 193.023 213.942 1.00 0.00 ? 1205 GLU A CA 1 
ATOM 3914 C CA . GLU E  5  1206 ? 185.051 192.106 217.348 1.00 0.00 ? 1206 GLU A CA 1 
ATOM 3915 C CA . PHE E  5  1207 ? 187.699 193.829 219.489 1.00 0.00 ? 1207 PHE A CA 1 
ATOM 3916 C CA . THR E  5  1208 ? 191.195 193.393 218.044 1.00 0.00 ? 1208 THR A CA 1 
ATOM 3917 C CA . HIS E  5  1209 ? 193.172 194.803 220.985 1.00 0.00 ? 1209 HIS A CA 1 
ATOM 3918 C CA . LYS E  5  1210 ? 196.606 195.300 219.401 1.00 0.00 ? 1210 LYS A CA 1 
ATOM 3919 C CA . ASP E  5  1211 ? 199.690 196.504 221.291 1.00 0.00 ? 1211 ASP A CA 1 
ATOM 3920 C CA . GLY E  5  1212 ? 198.931 200.055 220.024 1.00 0.00 ? 1212 GLY A CA 1 
ATOM 3921 C CA . VAL E  5  1213 ? 195.325 200.824 220.982 1.00 0.00 ? 1213 VAL A CA 1 
ATOM 3922 C CA . TRP E  5  1214 ? 193.983 201.928 224.362 1.00 0.00 ? 1214 TRP A CA 1 
ATOM 3923 C CA . ASN E  5  1215 ? 190.635 200.558 225.554 1.00 0.00 ? 1215 ASN A CA 1 
ATOM 3924 C CA . LEU E  5  1216 ? 188.886 203.684 226.848 1.00 0.00 ? 1216 LEU A CA 1 
ATOM 3925 C CA . GLN E  5  1217 ? 186.283 203.141 229.587 1.00 0.00 ? 1217 GLN A CA 1 
ATOM 3926 C CA . ASN E  5  1218 ? 183.486 205.252 231.043 1.00 0.00 ? 1218 ASN A CA 1 
ATOM 3927 C CA . GLU E  5  1219 ? 183.374 206.002 234.787 1.00 0.00 ? 1219 GLU A CA 1 
ATOM 3928 C CA . VAL E  5  1220 ? 179.726 204.908 235.172 1.00 0.00 ? 1220 VAL A CA 1 
ATOM 3929 C CA . THR E  5  1221 ? 179.254 202.102 232.627 1.00 0.00 ? 1221 THR A CA 1 
ATOM 3930 C CA . LYS E  5  1222 ? 182.600 200.409 233.408 1.00 0.00 ? 1222 LYS A CA 1 
ATOM 3931 C CA . GLU E  5  1223 ? 182.839 198.991 229.847 1.00 0.00 ? 1223 GLU A CA 1 
ATOM 3932 C CA . ARG E  5  1224 ? 184.628 199.373 226.484 1.00 0.00 ? 1224 ARG A CA 1 
ATOM 3933 C CA . THR E  5  1225 ? 183.074 202.440 224.835 1.00 0.00 ? 1225 THR A CA 1 
ATOM 3934 C CA . ALA E  5  1226 ? 185.753 203.143 222.185 1.00 0.00 ? 1226 ALA A CA 1 
ATOM 3935 C CA . GLN E  5  1227 ? 189.067 201.839 220.804 1.00 0.00 ? 1227 GLN A CA 1 
ATOM 3936 C CA . CYS E  5  1228 ? 191.566 204.767 220.568 1.00 0.00 ? 1228 CYS A CA 1 
ATOM 3937 C CA . PHE E  5  1229 ? 194.135 203.734 217.983 1.00 0.00 ? 1229 PHE A CA 1 
ATOM 3938 C CA . LEU E  5  1230 ? 197.439 205.523 218.559 1.00 0.00 ? 1230 LEU A CA 1 
ATOM 3939 C CA . ARG E  5  1231 ? 200.638 206.271 216.609 1.00 0.00 ? 1231 ARG A CA 1 
ATOM 3940 C CA . VAL E  5  1232 ? 203.648 208.542 216.203 1.00 0.00 ? 1232 VAL A CA 1 
ATOM 3941 C CA . ASP E  5  1233 ? 202.887 211.708 214.241 1.00 0.00 ? 1233 ASP A CA 1 
ATOM 3942 C CA . ASP E  5  1234 ? 204.857 212.385 211.054 1.00 0.00 ? 1234 ASP A CA 1 
ATOM 3943 C CA . GLU E  5  1235 ? 206.895 215.029 212.927 1.00 0.00 ? 1235 GLU A CA 1 
ATOM 3944 C CA . SER E  5  1236 ? 208.425 213.043 215.806 1.00 0.00 ? 1236 SER A CA 1 
ATOM 3945 C CA . MET E  5  1237 ? 209.613 210.564 213.167 1.00 0.00 ? 1237 MET A CA 1 
ATOM 3946 C CA . GLN E  5  1238 ? 211.608 213.192 211.225 1.00 0.00 ? 1238 GLN A CA 1 
ATOM 3947 C CA . ARG E  5  1239 ? 212.367 215.003 214.512 1.00 0.00 ? 1239 ARG A CA 1 
ATOM 3948 C CA . PHE E  5  1240 ? 214.157 211.888 215.803 1.00 0.00 ? 1240 PHE A CA 1 
ATOM 3949 C CA . HIS E  5  1241 ? 215.609 211.178 212.348 1.00 0.00 ? 1241 HIS A CA 1 
ATOM 3950 C CA . ASN E  5  1242 ? 217.486 214.460 212.899 1.00 0.00 ? 1242 ASN A CA 1 
ATOM 3951 C CA . ARG E  5  1243 ? 218.539 214.065 216.550 1.00 0.00 ? 1243 ARG A CA 1 
ATOM 3952 C CA . VAL E  5  1244 ? 220.684 211.298 215.023 1.00 0.00 ? 1244 VAL A CA 1 
ATOM 3953 C CA . ARG E  5  1245 ? 222.008 213.356 212.063 1.00 0.00 ? 1245 ARG A CA 1 
ATOM 3954 C CA . GLN E  5  1246 ? 222.995 215.928 214.708 1.00 0.00 ? 1246 GLN A CA 1 
ATOM 3955 C CA . ILE E  5  1247 ? 225.161 213.277 216.420 1.00 0.00 ? 1247 ILE A CA 1 
ATOM 3956 C CA . LEU E  5  1248 ? 226.942 212.372 213.164 1.00 0.00 ? 1248 LEU A CA 1 
ATOM 3957 C CA . MET E  5  1249 ? 227.950 215.998 212.565 1.00 0.00 ? 1249 MET A CA 1 
ATOM 3958 C CA . ALA E  5  1250 ? 229.059 217.104 216.043 1.00 0.00 ? 1250 ALA A CA 1 
ATOM 3959 C CA . SER E  5  1251 ? 231.416 214.138 216.510 1.00 0.00 ? 1251 SER A CA 1 
ATOM 3960 C CA . GLY E  5  1252 ? 233.723 214.739 213.525 1.00 0.00 ? 1252 GLY A CA 1 
ATOM 3961 C CA . SER E  5  1253 ? 236.397 213.018 215.639 1.00 0.00 ? 1253 SER A CA 1 
ATOM 3962 C CA . THR E  5  1254 ? 235.474 211.676 219.086 1.00 0.00 ? 1254 THR A CA 1 
ATOM 3963 C CA . THR E  5  1255 ? 235.519 208.450 221.139 1.00 0.00 ? 1255 THR A CA 1 
ATOM 3964 C CA . PHE E  5  1256 ? 233.548 205.297 220.282 1.00 0.00 ? 1256 PHE A CA 1 
ATOM 3965 C CA . THR E  5  1257 ? 232.368 205.083 223.883 1.00 0.00 ? 1257 THR A CA 1 
ATOM 3966 C CA . LYS E  5  1258 ? 230.795 208.556 223.659 1.00 0.00 ? 1258 LYS A CA 1 
ATOM 3967 C CA . ILE E  5  1259 ? 228.959 208.097 220.330 1.00 0.00 ? 1259 ILE A CA 1 
ATOM 3968 C CA . VAL E  5  1260 ? 227.260 204.997 221.740 1.00 0.00 ? 1260 VAL A CA 1 
ATOM 3969 C CA . ASN E  5  1261 ? 226.390 207.051 224.841 1.00 0.00 ? 1261 ASN A CA 1 
ATOM 3970 C CA . LYS E  5  1262 ? 224.568 209.664 222.717 1.00 0.00 ? 1262 LYS A CA 1 
ATOM 3971 C CA . TRP E  5  1263 ? 222.788 206.966 220.685 1.00 0.00 ? 1263 TRP A CA 1 
ATOM 3972 C CA . ASN E  5  1264 ? 221.504 205.333 223.897 1.00 0.00 ? 1264 ASN A CA 1 
ATOM 3973 C CA . THR E  5  1265 ? 220.024 208.547 225.329 1.00 0.00 ? 1265 THR A CA 1 
ATOM 3974 C CA . ALA E  5  1266 ? 218.447 209.439 221.967 1.00 0.00 ? 1266 ALA A CA 1 
ATOM 3975 C CA . LEU E  5  1267 ? 216.979 205.940 221.565 1.00 0.00 ? 1267 LEU A CA 1 
ATOM 3976 C CA . ILE E  5  1268 ? 215.801 205.429 225.160 1.00 0.00 ? 1268 ILE A CA 1 
ATOM 3977 C CA . GLY E  5  1269 ? 214.248 208.925 225.042 1.00 0.00 ? 1269 GLY A CA 1 
ATOM 3978 C CA . LEU E  5  1270 ? 212.415 207.827 221.863 1.00 0.00 ? 1270 LEU A CA 1 
ATOM 3979 C CA . MET E  5  1271 ? 211.134 204.519 223.264 1.00 0.00 ? 1271 MET A CA 1 
ATOM 3980 C CA . THR E  5  1272 ? 210.334 205.854 226.751 1.00 0.00 ? 1272 THR A CA 1 
ATOM 3981 C CA . TYR E  5  1273 ? 207.964 208.507 225.379 1.00 0.00 ? 1273 TYR A CA 1 
ATOM 3982 C CA . PHE E  5  1274 ? 206.250 206.912 222.368 1.00 0.00 ? 1274 PHE A CA 1 
ATOM 3983 C CA . ARG E  5  1275 ? 206.456 203.499 224.097 1.00 0.00 ? 1275 ARG A CA 1 
ATOM 3984 C CA . GLU E  5  1276 ? 203.195 201.952 222.849 1.00 0.00 ? 1276 GLU A CA 1 
ATOM 3985 C CA . ALA E  5  1277 ? 202.940 204.000 219.648 1.00 0.00 ? 1277 ALA A CA 1 
ATOM 3986 C CA . VAL E  5  1278 ? 206.482 203.775 218.422 1.00 0.00 ? 1278 VAL A CA 1 
ATOM 3987 C CA . VAL E  5  1279 ? 206.232 199.979 218.083 1.00 0.00 ? 1279 VAL A CA 1 
ATOM 3988 C CA . ASN E  5  1280 ? 202.805 200.291 216.407 1.00 0.00 ? 1280 ASN A CA 1 
ATOM 3989 C CA . THR E  5  1281 ? 204.024 202.219 213.321 1.00 0.00 ? 1281 THR A CA 1 
ATOM 3990 C CA . GLN E  5  1282 ? 206.137 200.956 210.416 1.00 0.00 ? 1282 GLN A CA 1 
ATOM 3991 C CA . GLU E  5  1283 ? 207.517 204.342 209.468 1.00 0.00 ? 1283 GLU A CA 1 
ATOM 3992 C CA . LEU E  5  1284 ? 209.392 204.817 212.774 1.00 0.00 ? 1284 LEU A CA 1 
ATOM 3993 C CA . LEU E  5  1285 ? 210.629 201.216 212.806 1.00 0.00 ? 1285 LEU A CA 1 
ATOM 3994 C CA . ASP E  5  1286 ? 212.387 201.573 209.464 1.00 0.00 ? 1286 ASP A CA 1 
ATOM 3995 C CA . LEU E  5  1287 ? 214.402 204.487 210.802 1.00 0.00 ? 1287 LEU A CA 1 
ATOM 3996 C CA . LEU E  5  1288 ? 215.344 202.762 214.051 1.00 0.00 ? 1288 LEU A CA 1 
ATOM 3997 C CA . VAL E  5  1289 ? 216.941 200.100 211.844 1.00 0.00 ? 1289 VAL A CA 1 
ATOM 3998 C CA . LYS E  5  1290 ? 218.692 202.387 209.306 1.00 0.00 ? 1290 LYS A CA 1 
ATOM 3999 C CA . CYS E  5  1291 ? 219.780 204.873 212.015 1.00 0.00 ? 1291 CYS A CA 1 
ATOM 4000 C CA . GLU E  5  1292 ? 221.136 202.134 214.300 1.00 0.00 ? 1292 GLU A CA 1 
ATOM 4001 C CA . ASN E  5  1293 ? 223.154 201.058 211.248 1.00 0.00 ? 1293 ASN A CA 1 
ATOM 4002 C CA . LYS E  5  1294 ? 224.276 204.644 210.520 1.00 0.00 ? 1294 LYS A CA 1 
ATOM 4003 C CA . ILE E  5  1295 ? 225.891 204.748 213.975 1.00 0.00 ? 1295 ILE A CA 1 
ATOM 4004 C CA . GLN E  5  1296 ? 227.584 201.347 213.687 1.00 0.00 ? 1296 GLN A CA 1 
ATOM 4005 C CA . THR E  5  1297 ? 228.815 202.422 210.230 1.00 0.00 ? 1297 THR A CA 1 
ATOM 4006 C CA . ARG E  5  1298 ? 230.473 205.411 211.934 1.00 0.00 ? 1298 ARG A CA 1 
ATOM 4007 C CA . ILE E  5  1299 ? 232.636 203.164 214.132 1.00 0.00 ? 1299 ILE A CA 1 
ATOM 4008 C CA . LYS E  5  1300 ? 232.850 200.548 211.358 1.00 0.00 ? 1300 LYS A CA 1 
ATOM 4009 C CA . ILE E  5  1301 ? 234.586 203.236 209.232 1.00 0.00 ? 1301 ILE A CA 1 
ATOM 4010 C CA . GLY E  5  1302 ? 236.798 204.556 212.077 1.00 0.00 ? 1302 GLY A CA 1 
ATOM 4011 C CA . LEU E  5  1303 ? 238.571 201.156 212.087 1.00 0.00 ? 1303 LEU A CA 1 
ATOM 4012 C CA . ASN E  5  1304 ? 238.797 200.501 208.343 1.00 0.00 ? 1304 ASN A CA 1 
ATOM 4013 C CA . SER E  5  1305 ? 237.706 202.062 205.051 1.00 0.00 ? 1305 SER A CA 1 
ATOM 4014 C CA . LYS E  5  1306 ? 236.972 198.938 202.914 1.00 0.00 ? 1306 LYS A CA 1 
ATOM 4015 C CA . MET E  5  1307 ? 233.713 198.412 204.889 1.00 0.00 ? 1307 MET A CA 1 
ATOM 4016 C CA . PRO E  5  1308 ? 233.241 194.993 206.565 1.00 0.00 ? 1308 PRO A CA 1 
ATOM 4017 C CA . SER E  5  1309 ? 230.996 192.517 204.712 1.00 0.00 ? 1309 SER A CA 1 
ATOM 4018 C CA . ARG E  5  1310 ? 229.667 191.445 208.122 1.00 0.00 ? 1310 ARG A CA 1 
ATOM 4019 C CA . PHE E  5  1311 ? 230.757 192.346 211.658 1.00 0.00 ? 1311 PHE A CA 1 
ATOM 4020 C CA . PRO E  5  1312 ? 230.728 190.624 215.084 1.00 0.00 ? 1312 PRO A CA 1 
ATOM 4021 C CA . PRO E  5  1313 ? 227.608 191.838 216.987 1.00 0.00 ? 1313 PRO A CA 1 
ATOM 4022 C CA . VAL E  5  1314 ? 229.319 191.134 220.337 1.00 0.00 ? 1314 VAL A CA 1 
ATOM 4023 C CA . VAL E  5  1315 ? 231.548 194.180 219.749 1.00 0.00 ? 1315 VAL A CA 1 
ATOM 4024 C CA . PHE E  5  1316 ? 228.556 196.566 219.686 1.00 0.00 ? 1316 PHE A CA 1 
ATOM 4025 C CA . TYR E  5  1317 ? 225.916 195.064 221.954 1.00 0.00 ? 1317 TYR A CA 1 
ATOM 4026 C CA . THR E  5  1318 ? 228.057 193.431 224.651 1.00 0.00 ? 1318 THR A CA 1 
ATOM 4027 C CA . PRO E  5  1319 ? 227.862 195.323 227.963 1.00 0.00 ? 1319 PRO A CA 1 
ATOM 4028 C CA . LYS E  5  1320 ? 230.609 197.847 228.758 1.00 0.00 ? 1320 LYS A CA 1 
ATOM 4029 C CA . GLU E  5  1321 ? 232.063 195.758 231.603 1.00 0.00 ? 1321 GLU A CA 1 
ATOM 4030 C CA . LEU E  5  1322 ? 233.232 193.257 228.944 1.00 0.00 ? 1322 LEU A CA 1 
ATOM 4031 C CA . GLY E  5  1323 ? 234.836 195.975 226.785 1.00 0.00 ? 1323 GLY A CA 1 
ATOM 4032 C CA . GLY E  5  1324 ? 231.611 196.695 224.841 1.00 0.00 ? 1324 GLY A CA 1 
ATOM 4033 C CA . LEU E  5  1325 ? 229.983 199.916 223.610 1.00 0.00 ? 1325 LEU A CA 1 
ATOM 4034 C CA . GLY E  5  1326 ? 226.749 198.850 225.314 1.00 0.00 ? 1326 GLY A CA 1 
ATOM 4035 C CA . MET E  5  1327 ? 224.499 200.318 222.573 1.00 0.00 ? 1327 MET A CA 1 
ATOM 4036 C CA . LEU E  5  1328 ? 220.987 198.893 222.944 1.00 0.00 ? 1328 LEU A CA 1 
ATOM 4037 C CA . SER E  5  1329 ? 219.067 198.155 219.768 1.00 0.00 ? 1329 SER A CA 1 
ATOM 4038 C CA . MET E  5  1330 ? 215.591 198.300 218.302 1.00 0.00 ? 1330 MET A CA 1 
ATOM 4039 C CA . GLY E  5  1331 ? 214.798 195.813 215.514 1.00 0.00 ? 1331 GLY A CA 1 
ATOM 4040 C CA . HIS E  5  1332 ? 216.333 192.329 215.282 1.00 0.00 ? 1332 HIS A CA 1 
ATOM 4041 C CA . VAL E  5  1333 ? 219.955 191.249 214.815 1.00 0.00 ? 1333 VAL A CA 1 
ATOM 4042 C CA . LEU E  5  1334 ? 220.301 187.642 213.660 1.00 0.00 ? 1334 LEU A CA 1 
ATOM 4043 C CA . ILE E  5  1335 ? 223.368 186.481 215.634 1.00 0.00 ? 1335 ILE A CA 1 
ATOM 4044 C CA . PRO E  5  1336 ? 224.955 183.908 213.264 1.00 0.00 ? 1336 PRO A CA 1 
ATOM 4045 C CA . GLN E  5  1337 ? 225.513 180.497 214.871 1.00 0.00 ? 1337 GLN A CA 1 
ATOM 4046 C CA . SER E  5  1338 ? 229.223 180.292 213.953 1.00 0.00 ? 1338 SER A CA 1 
ATOM 4047 C CA . ASP E  5  1339 ? 230.031 183.245 216.262 1.00 0.00 ? 1339 ASP A CA 1 
ATOM 4048 C CA . LEU E  5  1340 ? 229.115 181.454 219.503 1.00 0.00 ? 1340 LEU A CA 1 
ATOM 4049 C CA . ARG E  5  1341 ? 231.595 178.554 219.598 1.00 0.00 ? 1341 ARG A CA 1 
ATOM 4050 C CA . TRP E  5  1342 ? 234.339 178.766 222.254 1.00 0.00 ? 1342 TRP A CA 1 
ATOM 4051 C CA . SER E  5  1343 ? 237.106 176.637 223.780 1.00 0.00 ? 1343 SER A CA 1 
ATOM 4052 C CA . LYS E  5  1344 ? 238.547 176.002 227.258 1.00 0.00 ? 1344 LYS A CA 1 
ATOM 4053 C CA . GLN E  5  1345 ? 241.776 174.206 228.196 1.00 0.00 ? 1345 GLN A CA 1 
ATOM 4054 C CA . THR E  5  1346 ? 242.558 172.227 231.324 1.00 0.00 ? 1346 THR A CA 1 
ATOM 4055 C CA . ASP E  5  1347 ? 245.578 169.905 231.641 1.00 0.00 ? 1347 ASP A CA 1 
ATOM 4056 C CA . VAL E  5  1348 ? 243.321 166.916 230.843 1.00 0.00 ? 1348 VAL A CA 1 
ATOM 4057 C CA . GLY E  5  1349 ? 242.292 168.212 227.389 1.00 0.00 ? 1349 GLY A CA 1 
ATOM 4058 C CA . ILE E  5  1350 ? 240.649 171.020 225.429 1.00 0.00 ? 1350 ILE A CA 1 
ATOM 4059 C CA . THR E  5  1351 ? 236.844 171.084 225.754 1.00 0.00 ? 1351 THR A CA 1 
ATOM 4060 C CA . HIS E  5  1352 ? 234.780 172.504 222.873 1.00 0.00 ? 1352 HIS A CA 1 
ATOM 4061 C CA . PHE E  5  1353 ? 231.354 174.098 223.387 1.00 0.00 ? 1353 PHE A CA 1 
ATOM 4062 C CA . ARG E  5  1354 ? 228.419 175.127 221.189 1.00 0.00 ? 1354 ARG A CA 1 
ATOM 4063 C CA . SER E  5  1355 ? 225.790 177.548 222.517 1.00 0.00 ? 1355 SER A CA 1 
ATOM 4064 C CA . GLY E  5  1356 ? 223.749 177.079 219.315 1.00 0.00 ? 1356 GLY A CA 1 
ATOM 4065 C CA . MET E  5  1357 ? 223.960 173.269 219.064 1.00 0.00 ? 1357 MET A CA 1 
ATOM 4066 C CA . SER E  5  1358 ? 221.849 172.981 222.241 1.00 0.00 ? 1358 SER A CA 1 
ATOM 4067 C CA . HIS E  5  1359 ? 218.054 173.442 222.061 1.00 0.00 ? 1359 HIS A CA 1 
ATOM 4068 C CA . GLU E  5  1360 ? 217.704 177.135 223.015 1.00 0.00 ? 1360 GLU A CA 1 
ATOM 4069 C CA . GLU E  5  1361 ? 215.545 180.071 221.853 1.00 0.00 ? 1361 GLU A CA 1 
ATOM 4070 C CA . ASP E  5  1362 ? 216.416 181.501 218.423 1.00 0.00 ? 1362 ASP A CA 1 
ATOM 4071 C CA . GLN E  5  1363 ? 219.576 183.591 218.757 1.00 0.00 ? 1363 GLN A CA 1 
ATOM 4072 C CA . LEU E  5  1364 ? 218.509 187.198 218.185 1.00 0.00 ? 1364 LEU A CA 1 
ATOM 4073 C CA . ILE E  5  1365 ? 219.672 190.225 220.165 1.00 0.00 ? 1365 ILE A CA 1 
ATOM 4074 C CA . PRO E  5  1366 ? 216.845 191.146 222.600 1.00 0.00 ? 1366 PRO A CA 1 
ATOM 4075 C CA . ASN E  5  1367 ? 214.667 194.121 221.624 1.00 0.00 ? 1367 ASN A CA 1 
ATOM 4076 C CA . LEU E  5  1368 ? 214.375 197.254 223.748 1.00 0.00 ? 1368 LEU A CA 1 
ATOM 4077 C CA . TYR E  5  1369 ? 210.573 197.522 223.853 1.00 0.00 ? 1369 TYR A CA 1 
ATOM 4078 C CA . ARG E  5  1370 ? 210.155 194.153 225.618 1.00 0.00 ? 1370 ARG A CA 1 
ATOM 4079 C CA . TYR E  5  1371 ? 211.587 195.755 228.794 1.00 0.00 ? 1371 TYR A CA 1 
ATOM 4080 C CA . ILE E  5  1372 ? 209.344 198.846 228.998 1.00 0.00 ? 1372 ILE A CA 1 
ATOM 4081 C CA . GLN E  5  1373 ? 205.889 198.784 230.634 1.00 0.00 ? 1373 GLN A CA 1 
ATOM 4082 C CA . PRO E  5  1374 ? 203.627 200.253 227.902 1.00 0.00 ? 1374 PRO A CA 1 
ATOM 4083 C CA . TRP E  5  1375 ? 201.921 203.415 229.204 1.00 0.00 ? 1375 TRP A CA 1 
ATOM 4084 C CA . GLU E  5  1376 ? 198.330 202.104 229.615 1.00 0.00 ? 1376 GLU A CA 1 
ATOM 4085 C CA . SER E  5  1377 ? 199.729 199.572 232.125 1.00 0.00 ? 1377 SER A CA 1 
ATOM 4086 C CA . GLU E  5  1378 ? 201.794 202.221 233.974 1.00 0.00 ? 1378 GLU A CA 1 
ATOM 4087 C CA . PHE E  5  1379 ? 198.834 204.640 234.029 1.00 0.00 ? 1379 PHE A CA 1 
ATOM 4088 C CA . ILE E  5  1380 ? 196.527 201.920 235.400 1.00 0.00 ? 1380 ILE A CA 1 
ATOM 4089 C CA . ASP E  5  1381 ? 199.059 200.683 237.977 1.00 0.00 ? 1381 ASP A CA 1 
ATOM 4090 C CA . SER E  5  1382 ? 200.099 204.209 239.024 1.00 0.00 ? 1382 SER A CA 1 
ATOM 4091 C CA . GLN E  5  1383 ? 196.682 205.256 240.376 1.00 0.00 ? 1383 GLN A CA 1 
ATOM 4092 C CA . ARG E  5  1384 ? 196.389 201.735 241.829 1.00 0.00 ? 1384 ARG A CA 1 
ATOM 4093 C CA . VAL E  5  1385 ? 199.840 202.003 243.466 1.00 0.00 ? 1385 VAL A CA 1 
ATOM 4094 C CA . TRP E  5  1386 ? 199.368 205.546 244.800 1.00 0.00 ? 1386 TRP A CA 1 
ATOM 4095 C CA . ALA E  5  1387 ? 196.025 204.364 246.201 1.00 0.00 ? 1387 ALA A CA 1 
ATOM 4096 C CA . GLU E  5  1388 ? 197.880 201.373 247.689 1.00 0.00 ? 1388 GLU A CA 1 
ATOM 4097 C CA . TYR E  5  1389 ? 200.270 203.927 249.224 1.00 0.00 ? 1389 TYR A CA 1 
ATOM 4098 C CA . ALA E  5  1390 ? 197.290 205.972 250.474 1.00 0.00 ? 1390 ALA A CA 1 
ATOM 4099 C CA . LEU E  5  1391 ? 196.015 202.732 252.061 1.00 0.00 ? 1391 LEU A CA 1 
ATOM 4100 C CA . LYS E  5  1392 ? 199.265 201.857 253.844 1.00 0.00 ? 1392 LYS A CA 1 
ATOM 4101 C CA . ARG E  5  1393 ? 200.073 205.482 254.760 1.00 0.00 ? 1393 ARG A CA 1 
ATOM 4102 C CA . GLN E  5  1394 ? 196.659 206.146 256.347 1.00 0.00 ? 1394 GLN A CA 1 
ATOM 4103 C CA . GLU E  5  1395 ? 196.413 202.704 257.976 1.00 0.00 ? 1395 GLU A CA 1 
ATOM 4104 C CA . ALA E  5  1396 ? 199.888 203.452 259.375 1.00 0.00 ? 1396 ALA A CA 1 
ATOM 4105 C CA . ILE E  5  1397 ? 198.558 206.679 260.933 1.00 0.00 ? 1397 ILE A CA 1 
ATOM 4106 C CA . ALA E  5  1398 ? 195.514 204.729 262.194 1.00 0.00 ? 1398 ALA A CA 1 
ATOM 4107 C CA . GLN E  5  1399 ? 197.930 202.327 263.904 1.00 0.00 ? 1399 GLN A CA 1 
ATOM 4108 C CA . ASN E  5  1400 ? 199.899 205.414 265.013 1.00 0.00 ? 1400 ASN A CA 1 
ATOM 4109 C CA . ARG E  5  1401 ? 203.129 203.776 263.791 1.00 0.00 ? 1401 ARG A CA 1 
ATOM 4110 C CA . ARG E  5  1402 ? 205.337 205.168 260.991 1.00 0.00 ? 1402 ARG A CA 1 
ATOM 4111 C CA . LEU E  5  1403 ? 205.612 203.558 257.536 1.00 0.00 ? 1403 LEU A CA 1 
ATOM 4112 C CA . THR E  5  1404 ? 208.365 200.981 256.961 1.00 0.00 ? 1404 THR A CA 1 
ATOM 4113 C CA . LEU E  5  1405 ? 210.715 200.032 254.130 1.00 0.00 ? 1405 LEU A CA 1 
ATOM 4114 C CA . GLU E  5  1406 ? 209.387 196.448 254.223 1.00 0.00 ? 1406 GLU A CA 1 
ATOM 4115 C CA . ASP E  5  1407 ? 206.024 197.430 252.684 1.00 0.00 ? 1407 ASP A CA 1 
ATOM 4116 C CA . LEU E  5  1408 ? 207.331 199.839 250.026 1.00 0.00 ? 1408 LEU A CA 1 
ATOM 4117 C CA . GLU E  5  1409 ? 209.749 197.328 248.470 1.00 0.00 ? 1409 GLU A CA 1 
ATOM 4118 C CA . ASP E  5  1410 ? 206.630 195.719 246.976 1.00 0.00 ? 1410 ASP A CA 1 
ATOM 4119 C CA . SER E  5  1411 ? 206.151 198.815 244.786 1.00 0.00 ? 1411 SER A CA 1 
ATOM 4120 C CA . TRP E  5  1412 ? 209.426 200.546 243.881 1.00 0.00 ? 1412 TRP A CA 1 
ATOM 4121 C CA . ASP E  5  1413 ? 209.549 200.973 240.086 1.00 0.00 ? 1413 ASP A CA 1 
ATOM 4122 C CA . ARG E  5  1414 ? 205.842 201.829 239.727 1.00 0.00 ? 1414 ARG A CA 1 
ATOM 4123 C CA . GLY E  5  1415 ? 203.724 204.993 239.703 1.00 0.00 ? 1415 GLY A CA 1 
ATOM 4124 C CA . ILE E  5  1416 ? 204.340 207.747 237.132 1.00 0.00 ? 1416 ILE A CA 1 
ATOM 4125 C CA . PRO E  5  1417 ? 205.603 209.735 240.073 1.00 0.00 ? 1417 PRO A CA 1 
ATOM 4126 C CA . ARG E  5  1418 ? 207.610 206.607 240.994 1.00 0.00 ? 1418 ARG A CA 1 
ATOM 4127 C CA . ILE E  5  1419 ? 207.387 206.020 244.780 1.00 0.00 ? 1419 ILE A CA 1 
ATOM 4128 C CA . ASN E  5  1420 ? 211.204 206.193 244.905 1.00 0.00 ? 1420 ASN A CA 1 
ATOM 4129 C CA . THR E  5  1421 ? 210.746 209.946 244.230 1.00 0.00 ? 1421 THR A CA 1 
ATOM 4130 C CA . LEU E  5  1422 ? 209.292 210.147 247.752 1.00 0.00 ? 1422 LEU A CA 1 
ATOM 4131 C CA . PHE E  5  1423 ? 212.717 209.080 249.080 1.00 0.00 ? 1423 PHE A CA 1 
ATOM 4132 C CA . GLN E  5  1424 ? 214.501 211.422 246.645 1.00 0.00 ? 1424 GLN A CA 1 
ATOM 4133 C CA . LYS E  5  1425 ? 217.050 213.481 248.596 1.00 0.00 ? 1425 LYS A CA 1 
ATOM 4134 C CA . ASP E  5  1426 ? 215.920 217.025 247.671 1.00 0.00 ? 1426 ASP A CA 1 
ATOM 4135 C CA . ARG E  5  1427 ? 212.325 216.315 248.813 1.00 0.00 ? 1427 ARG A CA 1 
ATOM 4136 C CA . HIS E  5  1428 ? 212.163 219.243 251.281 1.00 0.00 ? 1428 HIS A CA 1 
ATOM 4137 C CA . THR E  5  1429 ? 213.663 221.676 248.742 1.00 0.00 ? 1429 THR A CA 1 
ATOM 4138 C CA . LEU E  5  1430 ? 211.901 220.370 245.606 1.00 0.00 ? 1430 LEU A CA 1 
ATOM 4139 C CA . ALA E  5  1431 ? 208.647 220.944 247.501 1.00 0.00 ? 1431 ALA A CA 1 
ATOM 4140 C CA . TYR E  5  1432 ? 209.242 224.680 247.000 1.00 0.00 ? 1432 TYR A CA 1 
ATOM 4141 C CA . ASP E  5  1433 ? 210.273 224.269 243.359 1.00 0.00 ? 1433 ASP A CA 1 
ATOM 4142 C CA . LYS E  5  1434 ? 207.198 224.661 241.142 1.00 0.00 ? 1434 LYS A CA 1 
ATOM 4143 C CA . GLY E  5  1435 ? 206.124 225.193 237.531 1.00 0.00 ? 1435 GLY A CA 1 
ATOM 4144 C CA . TRP E  5  1436 ? 209.263 223.198 236.620 1.00 0.00 ? 1436 TRP A CA 1 
ATOM 4145 C CA . ARG E  5  1437 ? 207.729 221.215 233.723 1.00 0.00 ? 1437 ARG A CA 1 
ATOM 4146 C CA . VAL E  5  1438 ? 207.264 224.446 231.716 1.00 0.00 ? 1438 VAL A CA 1 
ATOM 4147 C CA . ARG E  5  1439 ? 210.771 225.724 232.549 1.00 0.00 ? 1439 ARG A CA 1 
ATOM 4148 C CA . THR E  5  1440 ? 212.424 222.778 230.815 1.00 0.00 ? 1440 THR A CA 1 
ATOM 4149 C CA . ASP E  5  1441 ? 210.321 223.097 227.713 1.00 0.00 ? 1441 ASP A CA 1 
ATOM 4150 C CA . PHE E  5  1442 ? 211.423 226.732 227.371 1.00 0.00 ? 1442 PHE A CA 1 
ATOM 4151 C CA . LYS E  5  1443 ? 215.068 226.074 228.332 1.00 0.00 ? 1443 LYS A CA 1 
ATOM 4152 C CA . GLN E  5  1444 ? 215.729 225.113 224.672 1.00 0.00 ? 1444 GLN A CA 1 
ATOM 4153 C CA . TYR E  5  1445 ? 215.729 228.879 223.929 1.00 0.00 ? 1445 TYR A CA 1 
ATOM 4154 C CA . GLN E  5  1446 ? 218.205 229.586 226.757 1.00 0.00 ? 1446 GLN A CA 1 
ATOM 4155 C CA . VAL E  5  1447 ? 221.090 227.373 225.542 1.00 0.00 ? 1447 VAL A CA 1 
ATOM 4156 C CA . LEU E  5  1448 ? 221.839 225.489 222.308 1.00 0.00 ? 1448 LEU A CA 1 
ATOM 4157 C CA . LYS E  5  1449 ? 222.143 221.948 223.699 1.00 0.00 ? 1449 LYS A CA 1 
ATOM 4158 C CA . GLN E  5  1450 ? 219.388 219.739 222.228 1.00 0.00 ? 1450 GLN A CA 1 
ATOM 4159 C CA . ASN E  5  1451 ? 217.965 217.845 225.214 1.00 0.00 ? 1451 ASN A CA 1 
ATOM 4160 C CA . PRO E  5  1452 ? 216.136 214.511 224.607 1.00 0.00 ? 1452 PRO A CA 1 
ATOM 4161 C CA . PHE E  5  1453 ? 214.735 214.436 228.163 1.00 0.00 ? 1453 PHE A CA 1 
ATOM 4162 C CA . TRP E  5  1454 ? 212.681 217.639 227.984 1.00 0.00 ? 1454 TRP A CA 1 
ATOM 4163 C CA . TRP E  5  1455 ? 209.149 216.320 228.613 1.00 0.00 ? 1455 TRP A CA 1 
ATOM 4164 C CA . THR E  5  1456 ? 210.196 214.993 232.040 1.00 0.00 ? 1456 THR A CA 1 
ATOM 4165 C CA . HIS E  5  1457 ? 212.647 215.469 234.907 1.00 0.00 ? 1457 HIS A CA 1 
ATOM 4166 C CA . GLN E  5  1458 ? 214.489 212.801 236.908 1.00 0.00 ? 1458 GLN A CA 1 
ATOM 4167 C CA . ARG E  5  1459 ? 214.022 214.593 240.249 1.00 0.00 ? 1459 ARG A CA 1 
ATOM 4168 C CA . HIS E  5  1460 ? 210.214 214.948 240.135 1.00 0.00 ? 1460 HIS A CA 1 
ATOM 4169 C CA . ASP E  5  1461 ? 209.256 211.888 238.048 1.00 0.00 ? 1461 ASP A CA 1 
ATOM 4170 C CA . GLY E  5  1462 ? 212.283 209.753 238.996 1.00 0.00 ? 1462 GLY A CA 1 
ATOM 4171 C CA . LYS E  5  1463 ? 213.604 207.088 236.617 1.00 0.00 ? 1463 LYS A CA 1 
ATOM 4172 C CA . LEU E  5  1464 ? 210.657 206.260 234.352 1.00 0.00 ? 1464 LEU A CA 1 
ATOM 4173 C CA . TRP E  5  1465 ? 212.655 203.371 232.853 1.00 0.00 ? 1465 TRP A CA 1 
ATOM 4174 C CA . ASN E  5  1466 ? 214.708 200.424 234.092 1.00 0.00 ? 1466 ASN A CA 1 
ATOM 4175 C CA . LEU E  5  1467 ? 217.017 198.361 231.878 1.00 0.00 ? 1467 LEU A CA 1 
ATOM 4176 C CA . ASN E  5  1468 ? 218.648 196.101 234.514 1.00 0.00 ? 1468 ASN A CA 1 
ATOM 4177 C CA . ASN E  5  1469 ? 217.148 192.918 233.006 1.00 0.00 ? 1469 ASN A CA 1 
ATOM 4178 C CA . TYR E  5  1470 ? 218.017 193.905 229.397 1.00 0.00 ? 1470 TYR A CA 1 
ATOM 4179 C CA . ARG E  5  1471 ? 221.778 193.670 229.984 1.00 0.00 ? 1471 ARG A CA 1 
ATOM 4180 C CA . THR E  5  1472 ? 221.511 190.169 231.488 1.00 0.00 ? 1472 THR A CA 1 
ATOM 4181 C CA . ASP E  5  1473 ? 219.426 188.743 228.629 1.00 0.00 ? 1473 ASP A CA 1 
ATOM 4182 C CA . MET E  5  1474 ? 221.775 190.228 226.035 1.00 0.00 ? 1474 MET A CA 1 
ATOM 4183 C CA . ILE E  5  1475 ? 224.793 188.407 227.507 1.00 0.00 ? 1475 ILE A CA 1 
ATOM 4184 C CA . GLN E  5  1476 ? 223.060 185.012 227.296 1.00 0.00 ? 1476 GLN A CA 1 
ATOM 4185 C CA . ALA E  5  1477 ? 222.144 185.725 223.650 1.00 0.00 ? 1477 ALA A CA 1 
ATOM 4186 C CA . LEU E  5  1478 ? 225.833 186.426 222.923 1.00 0.00 ? 1478 LEU A CA 1 
ATOM 4187 C CA . GLY E  5  1479 ? 226.827 183.077 224.474 1.00 0.00 ? 1479 GLY A CA 1 
ATOM 4188 C CA . GLY E  5  1480 ? 227.383 184.003 228.145 1.00 0.00 ? 1480 GLY A CA 1 
ATOM 4189 C CA . VAL E  5  1481 ? 230.503 185.746 229.481 1.00 0.00 ? 1481 VAL A CA 1 
ATOM 4190 C CA . GLU E  5  1482 ? 232.634 183.003 227.874 1.00 0.00 ? 1482 GLU A CA 1 
ATOM 4191 C CA . GLY E  5  1483 ? 230.966 183.402 224.451 1.00 0.00 ? 1483 GLY A CA 1 
ATOM 4192 C CA . ILE E  5  1484 ? 231.798 187.127 224.478 1.00 0.00 ? 1484 ILE A CA 1 
ATOM 4193 C CA . LEU E  5  1485 ? 235.243 186.954 226.122 1.00 0.00 ? 1485 LEU A CA 1 
ATOM 4194 C CA . GLU E  5  1486 ? 236.286 184.412 223.478 1.00 0.00 ? 1486 GLU A CA 1 
ATOM 4195 C CA . HIS E  5  1487 ? 236.053 187.179 220.841 1.00 0.00 ? 1487 HIS A CA 1 
ATOM 4196 C CA . THR E  5  1488 ? 238.395 189.336 222.957 1.00 0.00 ? 1488 THR A CA 1 
ATOM 4197 C CA . LEU E  5  1489 ? 242.054 189.167 224.037 1.00 0.00 ? 1489 LEU A CA 1 
ATOM 4198 C CA . PHE E  5  1490 ? 241.094 188.104 227.550 1.00 0.00 ? 1490 PHE A CA 1 
ATOM 4199 C CA . LYS E  5  1491 ? 242.881 184.741 227.195 1.00 0.00 ? 1491 LYS A CA 1 
ATOM 4200 C CA . GLY E  5  1492 ? 245.985 186.424 225.702 1.00 0.00 ? 1492 GLY A CA 1 
ATOM 4201 C CA . THR E  5  1493 ? 246.461 188.264 229.003 1.00 0.00 ? 1493 THR A CA 1 
ATOM 4202 C CA . TYR E  5  1494 ? 246.128 184.894 230.798 1.00 0.00 ? 1494 TYR A CA 1 
ATOM 4203 C CA . PHE E  5  1495 ? 244.364 186.186 233.922 1.00 0.00 ? 1495 PHE A CA 1 
ATOM 4204 C CA . PRO E  5  1496 ? 242.909 183.466 236.224 1.00 0.00 ? 1496 PRO A CA 1 
ATOM 4205 C CA . THR E  5  1497 ? 239.191 184.332 235.815 1.00 0.00 ? 1497 THR A CA 1 
ATOM 4206 C CA . TRP E  5  1498 ? 237.005 187.335 234.984 1.00 0.00 ? 1498 TRP A CA 1 
ATOM 4207 C CA . GLU E  5  1499 ? 235.547 187.335 238.538 1.00 0.00 ? 1499 GLU A CA 1 
ATOM 4208 C CA . GLY E  5  1500 ? 237.586 190.340 239.744 1.00 0.00 ? 1500 GLY A CA 1 
ATOM 4209 C CA . LEU E  5  1501 ? 239.163 192.318 236.886 1.00 0.00 ? 1501 LEU A CA 1 
ATOM 4210 C CA . PHE E  5  1502 ? 239.517 196.007 236.151 1.00 0.00 ? 1502 PHE A CA 1 
ATOM 4211 C CA . TRP E  5  1503 ? 239.395 198.881 233.640 1.00 0.00 ? 1503 TRP A CA 1 
ATOM 4212 C CA . GLU E  5  1504 ? 241.147 202.281 233.830 1.00 0.00 ? 1504 GLU A CA 1 
ATOM 4213 C CA . LYS E  5  1505 ? 240.011 205.674 232.509 1.00 0.00 ? 1505 LYS A CA 1 
ATOM 4214 C CA . ALA E  5  1506 ? 242.481 208.115 230.950 1.00 0.00 ? 1506 ALA A CA 1 
ATOM 4215 C CA . SER E  5  1507 ? 242.062 211.689 229.687 1.00 0.00 ? 1507 SER A CA 1 
ATOM 4216 C CA . GLY E  5  1508 ? 241.091 212.069 226.024 1.00 0.00 ? 1508 GLY A CA 1 
ATOM 4217 C CA . PHE E  5  1509 ? 241.905 215.809 225.970 1.00 0.00 ? 1509 PHE A CA 1 
ATOM 4218 C CA . GLU E  5  1510 ? 244.672 218.145 227.172 1.00 0.00 ? 1510 GLU A CA 1 
ATOM 4219 C CA . GLU E  5  1511 ? 243.680 219.706 230.519 1.00 0.00 ? 1511 GLU A CA 1 
ATOM 4220 C CA . SER E  5  1512 ? 246.743 221.955 230.125 1.00 0.00 ? 1512 SER A CA 1 
ATOM 4221 C CA . MET E  5  1513 ? 248.278 223.877 227.204 1.00 0.00 ? 1513 MET A CA 1 
ATOM 4222 C CA . LYS E  5  1514 ? 251.682 224.118 228.899 1.00 0.00 ? 1514 LYS A CA 1 
ATOM 4223 C CA . TRP E  5  1515 ? 252.225 220.542 227.810 1.00 0.00 ? 1515 TRP A CA 1 
ATOM 4224 C CA . LYS E  5  1516 ? 251.615 221.786 224.297 1.00 0.00 ? 1516 LYS A CA 1 
ATOM 4225 C CA . LYS E  5  1517 ? 249.648 223.679 221.633 1.00 0.00 ? 1517 LYS A CA 1 
ATOM 4226 C CA . LEU E  5  1518 ? 248.392 220.961 219.316 1.00 0.00 ? 1518 LEU A CA 1 
ATOM 4227 C CA . THR E  5  1519 ? 246.070 222.849 216.906 1.00 0.00 ? 1519 THR A CA 1 
ATOM 4228 C CA . ASN E  5  1520 ? 243.301 220.929 215.070 1.00 0.00 ? 1520 ASN A CA 1 
ATOM 4229 C CA . ALA E  5  1521 ? 244.515 217.698 213.437 1.00 0.00 ? 1521 ALA A CA 1 
ATOM 4230 C CA . GLN E  5  1522 ? 246.479 216.720 216.571 1.00 0.00 ? 1522 GLN A CA 1 
ATOM 4231 C CA . ARG E  5  1523 ? 243.584 217.128 219.034 1.00 0.00 ? 1523 ARG A CA 1 
ATOM 4232 C CA . SER E  5  1524 ? 241.373 214.912 216.837 1.00 0.00 ? 1524 SER A CA 1 
ATOM 4233 C CA . GLY E  5  1525 ? 244.037 212.170 216.982 1.00 0.00 ? 1525 GLY A CA 1 
ATOM 4234 C CA . LEU E  5  1526 ? 244.382 212.715 220.751 1.00 0.00 ? 1526 LEU A CA 1 
ATOM 4235 C CA . ASN E  5  1527 ? 240.669 212.380 221.431 1.00 0.00 ? 1527 ASN A CA 1 
ATOM 4236 C CA . GLN E  5  1528 ? 240.810 209.000 219.686 1.00 0.00 ? 1528 GLN A CA 1 
ATOM 4237 C CA . ILE E  5  1529 ? 243.472 207.543 222.003 1.00 0.00 ? 1529 ILE A CA 1 
ATOM 4238 C CA . PRO E  5  1530 ? 240.973 205.600 224.200 1.00 0.00 ? 1530 PRO A CA 1 
ATOM 4239 C CA . ASN E  5  1531 ? 239.427 204.387 220.931 1.00 0.00 ? 1531 ASN A CA 1 
ATOM 4240 C CA . ARG E  5  1532 ? 242.748 202.714 220.031 1.00 0.00 ? 1532 ARG A CA 1 
ATOM 4241 C CA . ARG E  5  1533 ? 242.580 200.209 222.930 1.00 0.00 ? 1533 ARG A CA 1 
ATOM 4242 C CA . PHE E  5  1534 ? 239.040 199.165 221.913 1.00 0.00 ? 1534 PHE A CA 1 
ATOM 4243 C CA . THR E  5  1535 ? 240.516 197.794 218.660 1.00 0.00 ? 1535 THR A CA 1 
ATOM 4244 C CA . LEU E  5  1536 ? 243.125 195.755 220.553 1.00 0.00 ? 1536 LEU A CA 1 
ATOM 4245 C CA . TRP E  5  1537 ? 240.518 194.186 222.874 1.00 0.00 ? 1537 TRP A CA 1 
ATOM 4246 C CA . TRP E  5  1538 ? 238.377 192.928 219.948 1.00 0.00 ? 1538 TRP A CA 1 
ATOM 4247 C CA . SER E  5  1539 ? 241.244 192.365 217.471 1.00 0.00 ? 1539 SER A CA 1 
ATOM 4248 C CA . PRO E  5  1540 ? 240.716 188.498 217.510 1.00 0.00 ? 1540 PRO A CA 1 
ATOM 4249 C CA . THR E  5  1541 ? 237.189 188.750 216.100 1.00 0.00 ? 1541 THR A CA 1 
ATOM 4250 C CA . ILE E  5  1542 ? 237.768 191.792 213.858 1.00 0.00 ? 1542 ILE A CA 1 
ATOM 4251 C CA . ASN E  5  1543 ? 240.945 190.699 212.053 1.00 0.00 ? 1543 ASN A CA 1 
ATOM 4252 C CA . ARG E  5  1544 ? 239.620 187.683 210.118 1.00 0.00 ? 1544 ARG A CA 1 
ATOM 4253 C CA . ALA E  5  1545 ? 238.740 186.703 206.531 1.00 0.00 ? 1545 ALA A CA 1 
ATOM 4254 C CA . ASN E  5  1546 ? 234.968 186.627 207.173 1.00 0.00 ? 1546 ASN A CA 1 
ATOM 4255 C CA . VAL E  5  1547 ? 234.945 190.263 208.348 1.00 0.00 ? 1547 VAL A CA 1 
ATOM 4256 C CA . TYR E  5  1548 ? 237.336 191.659 205.713 1.00 0.00 ? 1548 TYR A CA 1 
ATOM 4257 C CA . VAL E  5  1549 ? 237.353 190.080 202.245 1.00 0.00 ? 1549 VAL A CA 1 
ATOM 4258 C CA . GLY E  5  1550 ? 240.753 191.727 201.797 1.00 0.00 ? 1550 GLY A CA 1 
ATOM 4259 C CA . PHE E  5  1551 ? 244.365 191.104 200.855 1.00 0.00 ? 1551 PHE A CA 1 
ATOM 4260 C CA . GLN E  5  1552 ? 246.032 189.103 203.623 1.00 0.00 ? 1552 GLN A CA 1 
ATOM 4261 C CA . VAL E  5  1553 ? 249.517 190.562 204.029 1.00 0.00 ? 1553 VAL A CA 1 
ATOM 4262 C CA . GLN E  5  1554 ? 251.784 189.318 206.821 1.00 0.00 ? 1554 GLN A CA 1 
ATOM 4263 C CA . LEU E  5  1555 ? 252.932 192.031 209.231 1.00 0.00 ? 1555 LEU A CA 1 
ATOM 4264 C CA . ASP E  5  1556 ? 256.734 192.323 209.124 1.00 0.00 ? 1556 ASP A CA 1 
ATOM 4265 C CA . LEU E  5  1557 ? 259.019 190.826 211.807 1.00 0.00 ? 1557 LEU A CA 1 
ATOM 4266 C CA . THR E  5  1558 ? 256.116 188.682 213.040 1.00 0.00 ? 1558 THR A CA 1 
ATOM 4267 C CA . GLY E  5  1559 ? 253.914 185.673 212.234 1.00 0.00 ? 1559 GLY A CA 1 
ATOM 4268 C CA . ILE E  5  1560 ? 250.644 187.700 212.461 1.00 0.00 ? 1560 ILE A CA 1 
ATOM 4269 C CA . PHE E  5  1561 ? 248.423 188.567 209.494 1.00 0.00 ? 1561 PHE A CA 1 
ATOM 4270 C CA . MET E  5  1562 ? 246.529 191.809 208.931 1.00 0.00 ? 1562 MET A CA 1 
ATOM 4271 C CA . HIS E  5  1563 ? 243.527 191.198 206.643 1.00 0.00 ? 1563 HIS A CA 1 
ATOM 4272 C CA . GLY E  5  1564 ? 242.488 194.828 206.096 1.00 0.00 ? 1564 GLY A CA 1 
ATOM 4273 C CA . LYS E  5  1565 ? 244.697 197.846 206.756 1.00 0.00 ? 1565 LYS A CA 1 
ATOM 4274 C CA . ILE E  5  1566 ? 243.182 198.705 210.145 1.00 0.00 ? 1566 ILE A CA 1 
ATOM 4275 C CA . PRO E  5  1567 ? 246.103 201.084 210.935 1.00 0.00 ? 1567 PRO A CA 1 
ATOM 4276 C CA . THR E  5  1568 ? 244.987 201.611 214.570 1.00 0.00 ? 1568 THR A CA 1 
ATOM 4277 C CA . LEU E  5  1569 ? 245.595 197.877 215.033 1.00 0.00 ? 1569 LEU A CA 1 
ATOM 4278 C CA . LYS E  5  1570 ? 248.810 197.695 212.980 1.00 0.00 ? 1570 LYS A CA 1 
ATOM 4279 C CA . ILE E  5  1571 ? 250.458 200.306 215.232 1.00 0.00 ? 1571 ILE A CA 1 
ATOM 4280 C CA . SER E  5  1572 ? 249.407 198.727 218.541 1.00 0.00 ? 1572 SER A CA 1 
ATOM 4281 C CA . LEU E  5  1573 ? 250.654 195.266 217.511 1.00 0.00 ? 1573 LEU A CA 1 
ATOM 4282 C CA . ILE E  5  1574 ? 254.031 196.632 216.462 1.00 0.00 ? 1574 ILE A CA 1 
ATOM 4283 C CA . GLN E  5  1575 ? 254.169 198.543 219.758 1.00 0.00 ? 1575 GLN A CA 1 
ATOM 4284 C CA . ILE E  5  1576 ? 253.833 195.167 221.553 1.00 0.00 ? 1576 ILE A CA 1 
ATOM 4285 C CA . PHE E  5  1577 ? 256.339 193.173 219.459 1.00 0.00 ? 1577 PHE A CA 1 
ATOM 4286 C CA . ARG E  5  1578 ? 258.676 196.152 219.666 1.00 0.00 ? 1578 ARG A CA 1 
ATOM 4287 C CA . ALA E  5  1579 ? 262.119 194.492 219.883 1.00 0.00 ? 1579 ALA A CA 1 
ATOM 4288 C CA . HIS E  5  1580 ? 262.286 191.169 218.012 1.00 0.00 ? 1580 HIS A CA 1 
ATOM 4289 C CA . LEU E  5  1581 ? 259.875 189.534 220.427 1.00 0.00 ? 1581 LEU A CA 1 
ATOM 4290 C CA . TRP E  5  1582 ? 258.679 186.910 217.898 1.00 0.00 ? 1582 TRP A CA 1 
ATOM 4291 C CA . GLN E  5  1583 ? 262.143 185.369 217.325 1.00 0.00 ? 1583 GLN A CA 1 
ATOM 4292 C CA . LYS E  5  1584 ? 262.881 185.552 221.069 1.00 0.00 ? 1584 LYS A CA 1 
ATOM 4293 C CA . ILE E  5  1585 ? 259.694 183.623 221.941 1.00 0.00 ? 1585 ILE A CA 1 
ATOM 4294 C CA . HIS E  5  1586 ? 260.675 180.875 219.487 1.00 0.00 ? 1586 HIS A CA 1 
ATOM 4295 C CA . GLU E  5  1587 ? 264.240 180.651 220.818 1.00 0.00 ? 1587 GLU A CA 1 
ATOM 4296 C CA . SER E  5  1588 ? 263.195 181.013 224.481 1.00 0.00 ? 1588 SER A CA 1 
ATOM 4297 C CA . ILE E  5  1589 ? 260.983 177.933 224.033 1.00 0.00 ? 1589 ILE A CA 1 
ATOM 4298 C CA . VAL E  5  1590 ? 263.557 175.859 222.120 1.00 0.00 ? 1590 VAL A CA 1 
ATOM 4299 C CA . MET E  5  1591 ? 266.300 176.915 224.562 1.00 0.00 ? 1591 MET A CA 1 
ATOM 4300 C CA . ASP E  5  1592 ? 264.126 175.718 227.464 1.00 0.00 ? 1592 ASP A CA 1 
ATOM 4301 C CA . LEU E  5  1593 ? 263.489 172.385 225.768 1.00 0.00 ? 1593 LEU A CA 1 
ATOM 4302 C CA . CYS E  5  1594 ? 267.219 171.657 225.524 1.00 0.00 ? 1594 CYS A CA 1 
ATOM 4303 C CA . GLN E  5  1595 ? 267.600 172.236 229.282 1.00 0.00 ? 1595 GLN A CA 1 
ATOM 4304 C CA . VAL E  5  1596 ? 264.917 169.606 230.027 1.00 0.00 ? 1596 VAL A CA 1 
ATOM 4305 C CA . PHE E  5  1597 ? 266.102 167.003 227.489 1.00 0.00 ? 1597 PHE A CA 1 
ATOM 4306 C CA . ASP E  5  1598 ? 269.699 166.966 228.740 1.00 0.00 ? 1598 ASP A CA 1 
ATOM 4307 C CA . GLN E  5  1599 ? 268.687 166.044 232.297 1.00 0.00 ? 1599 GLN A CA 1 
ATOM 4308 C CA . GLU E  5  1600 ? 266.337 163.203 231.320 1.00 0.00 ? 1600 GLU A CA 1 
ATOM 4309 C CA . LEU E  5  1601 ? 268.275 161.816 228.340 1.00 0.00 ? 1601 LEU A CA 1 
ATOM 4310 C CA . ASP E  5  1602 ? 269.330 158.739 230.368 1.00 0.00 ? 1602 ASP A CA 1 
ATOM 4311 C CA . ALA E  5  1603 ? 265.717 157.499 230.602 1.00 0.00 ? 1603 ALA A CA 1 
ATOM 4312 C CA . LEU E  5  1604 ? 264.908 157.915 226.893 1.00 0.00 ? 1604 LEU A CA 1 
ATOM 4313 C CA . GLU E  5  1605 ? 268.305 156.346 226.152 1.00 0.00 ? 1605 GLU A CA 1 
ATOM 4314 C CA . ILE E  5  1606 ? 269.260 159.249 223.863 1.00 0.00 ? 1606 ILE A CA 1 
ATOM 4315 C CA . GLU E  5  1607 ? 272.584 158.978 222.015 1.00 0.00 ? 1607 GLU A CA 1 
ATOM 4316 C CA . THR E  5  1608 ? 273.013 162.725 221.405 1.00 0.00 ? 1608 THR A CA 1 
ATOM 4317 C CA . VAL E  5  1609 ? 270.849 165.839 221.857 1.00 0.00 ? 1609 VAL A CA 1 
ATOM 4318 C CA . GLN E  5  1610 ? 271.680 168.515 219.274 1.00 0.00 ? 1610 GLN A CA 1 
ATOM 4319 C CA . LYS E  5  1611 ? 269.888 171.780 218.455 1.00 0.00 ? 1611 LYS A CA 1 
ATOM 4320 C CA . GLU E  5  1612 ? 270.175 172.790 214.783 1.00 0.00 ? 1612 GLU A CA 1 
ATOM 4321 C CA . THR E  5  1613 ? 271.449 176.131 213.475 1.00 0.00 ? 1613 THR A CA 1 
ATOM 4322 C CA . ILE E  5  1614 ? 268.389 178.398 213.255 1.00 0.00 ? 1614 ILE A CA 1 
ATOM 4323 C CA . HIS E  5  1615 ? 267.842 180.625 210.225 1.00 0.00 ? 1615 HIS A CA 1 
ATOM 4324 C CA . PRO E  5  1616 ? 267.098 184.266 211.220 1.00 0.00 ? 1616 PRO A CA 1 
ATOM 4325 C CA . ARG E  5  1617 ? 263.675 184.337 209.493 1.00 0.00 ? 1617 ARG A CA 1 
ATOM 4326 C CA . LYS E  5  1618 ? 262.584 180.715 210.112 1.00 0.00 ? 1618 LYS A CA 1 
ATOM 4327 C CA . SER E  5  1619 ? 260.682 181.831 213.236 1.00 0.00 ? 1619 SER A CA 1 
ATOM 4328 C CA . TYR E  5  1620 ? 258.075 183.793 211.224 1.00 0.00 ? 1620 TYR A CA 1 
ATOM 4329 C CA . LYS E  5  1621 ? 257.964 181.913 207.903 1.00 0.00 ? 1621 LYS A CA 1 
ATOM 4330 C CA . MET E  5  1622 ? 254.815 179.892 207.143 1.00 0.00 ? 1622 MET A CA 1 
ATOM 4331 C CA . ASN E  5  1623 ? 255.280 177.831 203.961 1.00 0.00 ? 1623 ASN A CA 1 
ATOM 4332 C CA . SER E  5  1624 ? 258.455 176.135 205.261 1.00 0.00 ? 1624 SER A CA 1 
ATOM 4333 C CA . SER E  5  1625 ? 259.850 175.122 208.670 1.00 0.00 ? 1625 SER A CA 1 
ATOM 4334 C CA . CYS E  5  1626 ? 263.050 173.136 209.305 1.00 0.00 ? 1626 CYS A CA 1 
ATOM 4335 C CA . ALA E  5  1627 ? 263.355 171.247 212.620 1.00 0.00 ? 1627 ALA A CA 1 
ATOM 4336 C CA . ASP E  5  1628 ? 265.125 172.976 215.511 1.00 0.00 ? 1628 ASP A CA 1 
ATOM 4337 C CA . ILE E  5  1629 ? 265.981 170.005 217.782 1.00 0.00 ? 1629 ILE A CA 1 
ATOM 4338 C CA . LEU E  5  1630 ? 267.243 166.633 216.512 1.00 0.00 ? 1630 LEU A CA 1 
ATOM 4339 C CA . LEU E  5  1631 ? 267.392 163.467 218.655 1.00 0.00 ? 1631 LEU A CA 1 
ATOM 4340 C CA . PHE E  5  1632 ? 268.582 159.852 218.389 1.00 0.00 ? 1632 PHE A CA 1 
ATOM 4341 C CA . ALA E  5  1633 ? 267.811 156.543 220.125 1.00 0.00 ? 1633 ALA A CA 1 
ATOM 4342 C CA . SER E  5  1634 ? 270.206 153.956 221.591 1.00 0.00 ? 1634 SER A CA 1 
ATOM 4343 C CA . TYR E  5  1635 ? 267.803 150.983 221.516 1.00 0.00 ? 1635 TYR A CA 1 
ATOM 4344 C CA . LYS E  5  1636 ? 264.502 151.156 219.559 1.00 0.00 ? 1636 LYS A CA 1 
ATOM 4345 C CA . TRP E  5  1637 ? 261.174 152.976 219.859 1.00 0.00 ? 1637 TRP A CA 1 
ATOM 4346 C CA . ASN E  5  1638 ? 257.886 151.507 218.572 1.00 0.00 ? 1638 ASN A CA 1 
ATOM 4347 C CA . VAL E  5  1639 ? 255.516 154.493 218.416 1.00 0.00 ? 1639 VAL A CA 1 
ATOM 4348 C CA . SER E  5  1640 ? 251.971 155.061 217.077 1.00 0.00 ? 1640 SER A CA 1 
ATOM 4349 C CA . ARG E  5  1641 ? 250.043 157.083 214.494 1.00 0.00 ? 1641 ARG A CA 1 
ATOM 4350 C CA . PRO E  5  1642 ? 250.263 160.670 215.851 1.00 0.00 ? 1642 PRO A CA 1 
ATOM 4351 C CA . SER E  5  1643 ? 247.803 161.573 218.623 1.00 0.00 ? 1643 SER A CA 1 
ATOM 4352 C CA . LEU E  5  1644 ? 247.259 164.525 220.999 1.00 0.00 ? 1644 LEU A CA 1 
ATOM 4353 C CA . LEU E  5  1645 ? 248.938 165.414 224.302 1.00 0.00 ? 1645 LEU A CA 1 
ATOM 4354 C CA . ALA E  5  1646 ? 246.321 166.505 226.841 1.00 0.00 ? 1646 ALA A CA 1 
ATOM 4355 C CA . ASP E  5  1647 ? 243.601 163.987 225.861 1.00 0.00 ? 1647 ASP A CA 1 
ATOM 4356 C CA . SER E  5  1648 ? 243.160 160.938 228.102 1.00 0.00 ? 1648 SER A CA 1 
ATOM 4357 C CA . LYS E  5  1649 ? 243.118 157.741 225.994 1.00 0.00 ? 1649 LYS A CA 1 
ATOM 4358 C CA . ASP E  5  1650 ? 246.012 157.504 223.512 1.00 0.00 ? 1650 ASP A CA 1 
ATOM 4359 C CA . VAL E  5  1651 ? 247.184 154.457 221.515 1.00 0.00 ? 1651 VAL A CA 1 
ATOM 4360 C CA . MET E  5  1652 ? 250.782 153.180 221.659 1.00 0.00 ? 1652 MET A CA 1 
ATOM 4361 C CA . ASP E  5  1653 ? 251.223 150.428 219.015 1.00 0.00 ? 1653 ASP A CA 1 
ATOM 4362 C CA . SER E  5  1654 ? 250.112 151.952 215.696 1.00 0.00 ? 1654 SER A CA 1 
ATOM 4363 C CA . THR E  5  1655 ? 253.572 152.584 214.155 1.00 0.00 ? 1655 THR A CA 1 
ATOM 4364 C CA . THR E  5  1656 ? 257.286 151.742 214.521 1.00 0.00 ? 1656 THR A CA 1 
ATOM 4365 C CA . THR E  5  1657 ? 260.298 154.103 214.523 1.00 0.00 ? 1657 THR A CA 1 
ATOM 4366 C CA . GLN E  5  1658 ? 263.761 154.717 216.029 1.00 0.00 ? 1658 GLN A CA 1 
ATOM 4367 C CA . LYS E  5  1659 ? 264.073 158.548 215.872 1.00 0.00 ? 1659 LYS A CA 1 
ATOM 4368 C CA . TYR E  5  1660 ? 262.249 161.878 216.319 1.00 0.00 ? 1660 TYR A CA 1 
ATOM 4369 C CA . TRP E  5  1661 ? 262.736 165.664 216.237 1.00 0.00 ? 1661 TRP A CA 1 
ATOM 4370 C CA . ILE E  5  1662 ? 261.069 168.827 217.597 1.00 0.00 ? 1662 ILE A CA 1 
ATOM 4371 C CA . ASP E  5  1663 ? 260.000 171.961 215.719 1.00 0.00 ? 1663 ASP A CA 1 
ATOM 4372 C CA . ILE E  5  1664 ? 258.020 174.689 217.513 1.00 0.00 ? 1664 ILE A CA 1 
ATOM 4373 C CA . GLN E  5  1665 ? 255.509 176.826 215.591 1.00 0.00 ? 1665 GLN A CA 1 
ATOM 4374 C CA . LEU E  5  1666 ? 254.238 180.116 217.040 1.00 0.00 ? 1666 LEU A CA 1 
ATOM 4375 C CA . ARG E  5  1667 ? 250.814 181.140 215.728 1.00 0.00 ? 1667 ARG A CA 1 
ATOM 4376 C CA . TRP E  5  1668 ? 248.610 184.192 216.323 1.00 0.00 ? 1668 TRP A CA 1 
ATOM 4377 C CA . GLY E  5  1669 ? 245.012 182.985 216.123 1.00 0.00 ? 1669 GLY A CA 1 
ATOM 4378 C CA . ASP E  5  1670 ? 241.796 184.520 214.807 1.00 0.00 ? 1670 ASP A CA 1 
ATOM 4379 C CA . TYR E  5  1671 ? 238.407 183.966 216.431 1.00 0.00 ? 1671 TYR A CA 1 
ATOM 4380 C CA . ASP E  5  1672 ? 237.639 181.847 213.346 1.00 0.00 ? 1672 ASP A CA 1 
ATOM 4381 C CA . SER E  5  1673 ? 240.653 179.614 214.057 1.00 0.00 ? 1673 SER A CA 1 
ATOM 4382 C CA . HIS E  5  1674 ? 241.995 178.938 217.558 1.00 0.00 ? 1674 HIS A CA 1 
ATOM 4383 C CA . ASP E  5  1675 ? 241.943 175.113 217.329 1.00 0.00 ? 1675 ASP A CA 1 
ATOM 4384 C CA . ILE E  5  1676 ? 245.610 174.123 217.497 1.00 0.00 ? 1676 ILE A CA 1 
ATOM 4385 C CA . GLU E  5  1677 ? 244.610 170.435 217.310 1.00 0.00 ? 1677 GLU A CA 1 
ATOM 4386 C CA . ARG E  5  1678 ? 243.352 170.854 213.721 1.00 0.00 ? 1678 ARG A CA 1 
ATOM 4387 C CA . TYR E  5  1679 ? 246.163 173.341 212.981 1.00 0.00 ? 1679 TYR A CA 1 
ATOM 4388 C CA . ALA E  5  1680 ? 249.116 171.099 213.908 1.00 0.00 ? 1680 ALA A CA 1 
ATOM 4389 C CA . ARG E  5  1681 ? 247.335 168.033 212.464 1.00 0.00 ? 1681 ARG A CA 1 
ATOM 4390 C CA . ALA E  5  1682 ? 247.478 169.724 209.037 1.00 0.00 ? 1682 ALA A CA 1 
ATOM 4391 C CA . LYS E  5  1683 ? 251.119 170.817 209.514 1.00 0.00 ? 1683 LYS A CA 1 
ATOM 4392 C CA . PHE E  5  1684 ? 252.298 167.220 210.113 1.00 0.00 ? 1684 PHE A CA 1 
ATOM 4393 C CA . LEU E  5  1685 ? 250.329 165.706 207.224 1.00 0.00 ? 1685 LEU A CA 1 
ATOM 4394 C CA . ASP E  5  1686 ? 251.797 168.563 205.165 1.00 0.00 ? 1686 ASP A CA 1 
ATOM 4395 C CA . TYR E  5  1687 ? 255.452 168.724 206.238 1.00 0.00 ? 1687 TYR A CA 1 
ATOM 4396 C CA . THR E  5  1688 ? 255.789 164.957 206.855 1.00 0.00 ? 1688 THR A CA 1 
ATOM 4397 C CA . THR E  5  1689 ? 255.002 163.726 203.322 1.00 0.00 ? 1689 THR A CA 1 
ATOM 4398 C CA . ASP E  5  1690 ? 256.388 166.861 201.604 1.00 0.00 ? 1690 ASP A CA 1 
ATOM 4399 C CA . ASN E  5  1691 ? 259.539 166.057 199.633 1.00 0.00 ? 1691 ASN A CA 1 
ATOM 4400 C CA . MET E  5  1692 ? 260.929 169.622 199.765 1.00 0.00 ? 1692 MET A CA 1 
ATOM 4401 C CA . SER E  5  1693 ? 261.170 169.784 203.574 1.00 0.00 ? 1693 SER A CA 1 
ATOM 4402 C CA . ILE E  5  1694 ? 264.487 168.311 204.749 1.00 0.00 ? 1694 ILE A CA 1 
ATOM 4403 C CA . TYR E  5  1695 ? 263.858 166.541 208.043 1.00 0.00 ? 1695 TYR A CA 1 
ATOM 4404 C CA . PRO E  5  1696 ? 266.274 163.689 208.988 1.00 0.00 ? 1696 PRO A CA 1 
ATOM 4405 C CA . SER E  5  1697 ? 263.695 160.921 209.322 1.00 0.00 ? 1697 SER A CA 1 
ATOM 4406 C CA . PRO E  5  1698 ? 260.032 160.666 208.228 1.00 0.00 ? 1698 PRO A CA 1 
ATOM 4407 C CA . THR E  5  1699 ? 259.184 160.323 211.947 1.00 0.00 ? 1699 THR A CA 1 
ATOM 4408 C CA . GLY E  5  1700 ? 259.065 163.179 214.477 1.00 0.00 ? 1700 GLY A CA 1 
ATOM 4409 C CA . VAL E  5  1701 ? 257.053 165.724 216.468 1.00 0.00 ? 1701 VAL A CA 1 
ATOM 4410 C CA . LEU E  5  1702 ? 255.880 169.352 216.213 1.00 0.00 ? 1702 LEU A CA 1 
ATOM 4411 C CA . ILE E  5  1703 ? 254.658 171.614 219.028 1.00 0.00 ? 1703 ILE A CA 1 
ATOM 4412 C CA . ALA E  5  1704 ? 252.114 174.300 218.182 1.00 0.00 ? 1704 ALA A CA 1 
ATOM 4413 C CA . ILE E  5  1705 ? 251.658 177.372 220.375 1.00 0.00 ? 1705 ILE A CA 1 
ATOM 4414 C CA . ASP E  5  1706 ? 249.169 180.238 220.158 1.00 0.00 ? 1706 ASP A CA 1 
ATOM 4415 C CA . LEU E  5  1707 ? 249.897 183.539 221.886 1.00 0.00 ? 1707 LEU A CA 1 
ATOM 4416 C CA . ALA E  5  1708 ? 246.405 185.013 221.498 1.00 0.00 ? 1708 ALA A CA 1 
ATOM 4417 C CA . TYR E  5  1709 ? 244.592 182.264 223.436 1.00 0.00 ? 1709 TYR A CA 1 
ATOM 4418 C CA . ASN E  5  1710 ? 247.672 180.880 225.229 1.00 0.00 ? 1710 ASN A CA 1 
ATOM 4419 C CA . LEU E  5  1711 ? 247.139 177.237 224.208 1.00 0.00 ? 1711 LEU A CA 1 
ATOM 4420 C CA . HIS E  5  1712 ? 249.410 174.392 223.039 1.00 0.00 ? 1712 HIS A CA 1 
ATOM 4421 C CA . SER E  5  1713 ? 249.369 170.857 221.608 1.00 0.00 ? 1713 SER A CA 1 
ATOM 4422 C CA . ALA E  5  1714 ? 251.242 168.449 219.321 1.00 0.00 ? 1714 ALA A CA 1 
ATOM 4423 C CA . TYR E  5  1715 ? 250.173 165.762 216.842 1.00 0.00 ? 1715 TYR A CA 1 
ATOM 4424 C CA . GLY E  5  1716 ? 253.456 163.812 216.761 1.00 0.00 ? 1716 GLY A CA 1 
ATOM 4425 C CA . ASN E  5  1717 ? 254.901 160.346 217.368 1.00 0.00 ? 1717 ASN A CA 1 
ATOM 4426 C CA . TRP E  5  1718 ? 254.536 159.635 221.098 1.00 0.00 ? 1718 TRP A CA 1 
ATOM 4427 C CA . PHE E  5  1719 ? 256.036 157.164 223.567 1.00 0.00 ? 1719 PHE A CA 1 
ATOM 4428 C CA . PRO E  5  1720 ? 255.674 156.084 227.244 1.00 0.00 ? 1720 PRO A CA 1 
ATOM 4429 C CA . GLY E  5  1721 ? 257.758 158.729 229.024 1.00 0.00 ? 1721 GLY A CA 1 
ATOM 4430 C CA . SER E  5  1722 ? 257.478 161.459 226.363 1.00 0.00 ? 1722 SER A CA 1 
ATOM 4431 C CA . LYS E  5  1723 ? 253.702 161.923 226.817 1.00 0.00 ? 1723 LYS A CA 1 
ATOM 4432 C CA . PRO E  5  1724 ? 253.900 162.762 230.587 1.00 0.00 ? 1724 PRO A CA 1 
ATOM 4433 C CA . LEU E  5  1725 ? 257.171 164.677 230.026 1.00 0.00 ? 1725 LEU A CA 1 
ATOM 4434 C CA . ILE E  5  1726 ? 256.030 167.167 227.374 1.00 0.00 ? 1726 ILE A CA 1 
ATOM 4435 C CA . GLN E  5  1727 ? 252.697 167.382 229.234 1.00 0.00 ? 1727 GLN A CA 1 
ATOM 4436 C CA . GLN E  5  1728 ? 254.419 168.560 232.434 1.00 0.00 ? 1728 GLN A CA 1 
ATOM 4437 C CA . ALA E  5  1729 ? 257.319 170.369 230.711 1.00 0.00 ? 1729 ALA A CA 1 
ATOM 4438 C CA . MET E  5  1730 ? 255.105 172.495 228.434 1.00 0.00 ? 1730 MET A CA 1 
ATOM 4439 C CA . ALA E  5  1731 ? 252.578 173.236 231.195 1.00 0.00 ? 1731 ALA A CA 1 
ATOM 4440 C CA . LYS E  5  1732 ? 255.593 174.561 233.127 1.00 0.00 ? 1732 LYS A CA 1 
ATOM 4441 C CA . ILE E  5  1733 ? 257.078 176.392 230.106 1.00 0.00 ? 1733 ILE A CA 1 
ATOM 4442 C CA . MET E  5  1734 ? 253.715 178.054 229.357 1.00 0.00 ? 1734 MET A CA 1 
ATOM 4443 C CA . LYS E  5  1735 ? 253.571 179.337 232.951 1.00 0.00 ? 1735 LYS A CA 1 
ATOM 4444 C CA . ALA E  5  1736 ? 257.346 179.829 233.344 1.00 0.00 ? 1736 ALA A CA 1 
ATOM 4445 C CA . ASN E  5  1737 ? 258.985 181.298 230.218 1.00 0.00 ? 1737 ASN A CA 1 
ATOM 4446 C CA . PRO E  5  1738 ? 260.216 184.916 230.445 1.00 0.00 ? 1738 PRO A CA 1 
ATOM 4447 C CA . ALA E  5  1739 ? 259.351 185.490 226.757 1.00 0.00 ? 1739 ALA A CA 1 
ATOM 4448 C CA . LEU E  5  1740 ? 255.674 184.611 227.270 1.00 0.00 ? 1740 LEU A CA 1 
ATOM 4449 C CA . TYR E  5  1741 ? 255.583 186.629 230.489 1.00 0.00 ? 1741 TYR A CA 1 
ATOM 4450 C CA . VAL E  5  1742 ? 256.866 189.708 228.621 1.00 0.00 ? 1742 VAL A CA 1 
ATOM 4451 C CA . LEU E  5  1743 ? 254.252 189.203 225.932 1.00 0.00 ? 1743 LEU A CA 1 
ATOM 4452 C CA . ARG E  5  1744 ? 251.421 189.084 228.483 1.00 0.00 ? 1744 ARG A CA 1 
ATOM 4453 C CA . GLU E  5  1745 ? 252.616 192.234 230.286 1.00 0.00 ? 1745 GLU A CA 1 
ATOM 4454 C CA . ARG E  5  1746 ? 252.965 194.154 227.007 1.00 0.00 ? 1746 ARG A CA 1 
ATOM 4455 C CA . ILE E  5  1747 ? 249.368 193.269 226.057 1.00 0.00 ? 1747 ILE A CA 1 
ATOM 4456 C CA . ARG E  5  1748 ? 248.117 194.432 229.466 1.00 0.00 ? 1748 ARG A CA 1 
ATOM 4457 C CA . LYS E  5  1749 ? 250.029 197.690 228.860 1.00 0.00 ? 1749 LYS A CA 1 
ATOM 4458 C CA . GLY E  5  1750 ? 247.873 198.157 225.746 1.00 0.00 ? 1750 GLY A CA 1 
ATOM 4459 C CA . LEU E  5  1751 ? 244.565 197.041 227.279 1.00 0.00 ? 1751 LEU A CA 1 
ATOM 4460 C CA . GLN E  5  1752 ? 245.256 198.870 230.548 1.00 0.00 ? 1752 GLN A CA 1 
ATOM 4461 C CA . LEU E  5  1753 ? 243.517 195.843 232.084 1.00 0.00 ? 1753 LEU A CA 1 
ATOM 4462 C CA . TYR E  5  1754 ? 244.618 195.425 235.710 1.00 0.00 ? 1754 TYR A CA 1 
ATOM 4463 C CA . SER E  5  1755 ? 243.222 193.064 238.379 1.00 0.00 ? 1755 SER A CA 1 
ATOM 4464 C CA . SER E  5  1756 ? 234.017 197.006 250.274 1.00 0.00 ? 1756 SER A CA 1 
ATOM 4465 C CA . GLU E  5  1757 ? 236.803 199.161 251.746 1.00 0.00 ? 1757 GLU A CA 1 
ATOM 4466 C CA . PRO E  5  1758 ? 236.916 196.913 254.882 1.00 0.00 ? 1758 PRO A CA 1 
ATOM 4467 C CA . THR E  5  1759 ? 238.330 194.013 252.814 1.00 0.00 ? 1759 THR A CA 1 
ATOM 4468 C CA . GLU E  5  1760 ? 241.803 194.097 254.391 1.00 0.00 ? 1760 GLU A CA 1 
ATOM 4469 C CA . PRO E  5  1761 ? 242.474 190.695 256.029 1.00 0.00 ? 1761 PRO A CA 1 
ATOM 4470 C CA . TYR E  5  1762 ? 245.583 192.247 257.375 1.00 0.00 ? 1762 TYR A CA 1 
ATOM 4471 C CA . LEU E  5  1763 ? 247.818 191.683 260.334 1.00 0.00 ? 1763 LEU A CA 1 
ATOM 4472 C CA . SER E  5  1764 ? 247.206 188.341 262.009 1.00 0.00 ? 1764 SER A CA 1 
ATOM 4473 C CA . SER E  5  1765 ? 249.249 186.588 264.730 1.00 0.00 ? 1765 SER A CA 1 
ATOM 4474 C CA . GLN E  5  1766 ? 251.618 185.175 262.075 1.00 0.00 ? 1766 GLN A CA 1 
ATOM 4475 C CA . ASN E  5  1767 ? 252.376 188.687 260.763 1.00 0.00 ? 1767 ASN A CA 1 
ATOM 4476 C CA . TYR E  5  1768 ? 253.859 189.691 264.140 1.00 0.00 ? 1768 TYR A CA 1 
ATOM 4477 C CA . GLY E  5  1769 ? 256.736 187.245 263.622 1.00 0.00 ? 1769 GLY A CA 1 
ATOM 4478 C CA . GLU E  5  1770 ? 257.211 188.588 260.082 1.00 0.00 ? 1770 GLU A CA 1 
ATOM 4479 C CA . LEU E  5  1771 ? 257.368 192.276 261.062 1.00 0.00 ? 1771 LEU A CA 1 
ATOM 4480 C CA . PHE E  5  1772 ? 260.435 191.593 263.256 1.00 0.00 ? 1772 PHE A CA 1 
ATOM 4481 C CA . SER E  5  1773 ? 262.569 190.352 260.352 1.00 0.00 ? 1773 SER A CA 1 
ATOM 4482 C CA . ASN E  5  1774 ? 265.738 191.872 258.853 1.00 0.00 ? 1774 ASN A CA 1 
ATOM 4483 C CA . GLN E  5  1775 ? 263.532 194.105 256.671 1.00 0.00 ? 1775 GLN A CA 1 
ATOM 4484 C CA . ILE E  5  1776 ? 262.920 197.684 257.832 1.00 0.00 ? 1776 ILE A CA 1 
ATOM 4485 C CA . ILE E  5  1777 ? 259.235 198.601 258.358 1.00 0.00 ? 1777 ILE A CA 1 
ATOM 4486 C CA . TRP E  5  1778 ? 257.077 201.511 259.630 1.00 0.00 ? 1778 TRP A CA 1 
ATOM 4487 C CA . PHE E  5  1779 ? 253.794 201.947 261.522 1.00 0.00 ? 1779 PHE A CA 1 
ATOM 4488 C CA . VAL E  5  1780 ? 252.248 205.220 260.310 1.00 0.00 ? 1780 VAL A CA 1 
ATOM 4489 C CA . ASP E  5  1781 ? 249.656 206.459 262.827 1.00 0.00 ? 1781 ASP A CA 1 
ATOM 4490 C CA . ASP E  5  1782 ? 247.801 209.504 261.464 1.00 0.00 ? 1782 ASP A CA 1 
ATOM 4491 C CA . THR E  5  1783 ? 245.401 209.541 264.431 1.00 0.00 ? 1783 THR A CA 1 
ATOM 4492 C CA . ASN E  5  1784 ? 246.969 212.645 266.007 1.00 0.00 ? 1784 ASN A CA 1 
ATOM 4493 C CA . VAL E  5  1785 ? 247.158 215.304 263.288 1.00 0.00 ? 1785 VAL A CA 1 
ATOM 4494 C CA . TYR E  5  1786 ? 243.872 217.167 263.831 1.00 0.00 ? 1786 TYR A CA 1 
ATOM 4495 C CA . ARG E  5  1787 ? 242.395 217.913 267.256 1.00 0.00 ? 1787 ARG A CA 1 
ATOM 4496 C CA . VAL E  5  1788 ? 240.474 220.891 268.683 1.00 0.00 ? 1788 VAL A CA 1 
ATOM 4497 C CA . THR E  5  1789 ? 240.280 222.443 272.141 1.00 0.00 ? 1789 THR A CA 1 
ATOM 4498 C CA . ILE E  5  1790 ? 236.993 223.865 273.346 1.00 0.00 ? 1790 ILE A CA 1 
ATOM 4499 C CA . HIS E  5  1791 ? 236.400 227.627 273.096 1.00 0.00 ? 1791 HIS A CA 1 
ATOM 4500 C CA . LYS E  5  1792 ? 233.300 229.363 274.485 1.00 0.00 ? 1792 LYS A CA 1 
ATOM 4501 C CA . THR E  5  1793 ? 232.304 232.597 272.789 1.00 0.00 ? 1793 THR A CA 1 
ATOM 4502 C CA . PHE E  5  1794 ? 231.434 235.690 274.839 1.00 0.00 ? 1794 PHE A CA 1 
ATOM 4503 C CA . GLU E  5  1795 ? 227.775 235.477 273.605 1.00 0.00 ? 1795 GLU A CA 1 
ATOM 4504 C CA . GLY E  5  1796 ? 228.822 232.773 273.227 1.00 0.00 ? 1796 GLY A CA 1 
ATOM 4505 C CA . ASN E  5  1797 ? 228.400 230.365 270.378 1.00 0.00 ? 1797 ASN A CA 1 
ATOM 4506 C CA . LEU E  5  1798 ? 230.431 227.155 270.875 1.00 0.00 ? 1798 LEU A CA 1 
ATOM 4507 C CA . THR E  5  1799 ? 233.560 227.070 268.716 1.00 0.00 ? 1799 THR A CA 1 
ATOM 4508 C CA . THR E  5  1800 ? 236.627 224.884 268.140 1.00 0.00 ? 1800 THR A CA 1 
ATOM 4509 C CA . LYS E  5  1801 ? 240.319 225.626 267.636 1.00 0.00 ? 1801 LYS A CA 1 
ATOM 4510 C CA . PRO E  5  1802 ? 243.068 223.140 266.688 1.00 0.00 ? 1802 PRO A CA 1 
ATOM 4511 C CA . ILE E  5  1803 ? 246.027 222.088 268.821 1.00 0.00 ? 1803 ILE A CA 1 
ATOM 4512 C CA . ASN E  5  1804 ? 249.241 220.838 267.237 1.00 0.00 ? 1804 ASN A CA 1 
ATOM 4513 C CA . GLY E  5  1805 ? 249.321 217.085 266.520 1.00 0.00 ? 1805 GLY A CA 1 
ATOM 4514 C CA . ALA E  5  1806 ? 252.052 214.510 265.890 1.00 0.00 ? 1806 ALA A CA 1 
ATOM 4515 C CA . ILE E  5  1807 ? 252.412 212.464 262.703 1.00 0.00 ? 1807 ILE A CA 1 
ATOM 4516 C CA . PHE E  5  1808 ? 253.399 209.264 264.539 1.00 0.00 ? 1808 PHE A CA 1 
ATOM 4517 C CA . ILE E  5  1809 ? 255.682 206.929 262.579 1.00 0.00 ? 1809 ILE A CA 1 
ATOM 4518 C CA . PHE E  5  1810 ? 256.839 204.023 264.760 1.00 0.00 ? 1810 PHE A CA 1 
ATOM 4519 C CA . ASN E  5  1811 ? 259.721 201.705 263.849 1.00 0.00 ? 1811 ASN A CA 1 
ATOM 4520 C CA . PRO E  5  1812 ? 259.538 197.933 264.570 1.00 0.00 ? 1812 PRO A CA 1 
ATOM 4521 C CA . ARG E  5  1813 ? 263.362 197.600 264.600 1.00 0.00 ? 1813 ARG A CA 1 
ATOM 4522 C CA . THR E  5  1814 ? 265.091 200.753 265.896 1.00 0.00 ? 1814 THR A CA 1 
ATOM 4523 C CA . GLY E  5  1815 ? 262.132 201.654 268.150 1.00 0.00 ? 1815 GLY A CA 1 
ATOM 4524 C CA . GLN E  5  1816 ? 262.506 205.352 267.281 1.00 0.00 ? 1816 GLN A CA 1 
ATOM 4525 C CA . LEU E  5  1817 ? 259.926 207.931 266.209 1.00 0.00 ? 1817 LEU A CA 1 
ATOM 4526 C CA . PHE E  5  1818 ? 259.748 210.507 263.403 1.00 0.00 ? 1818 PHE A CA 1 
ATOM 4527 C CA . LEU E  5  1819 ? 257.365 213.060 264.918 1.00 0.00 ? 1819 LEU A CA 1 
ATOM 4528 C CA . LYS E  5  1820 ? 256.193 216.001 262.871 1.00 0.00 ? 1820 LYS A CA 1 
ATOM 4529 C CA . ILE E  5  1821 ? 254.641 218.956 264.675 1.00 0.00 ? 1821 ILE A CA 1 
ATOM 4530 C CA . ILE E  5  1822 ? 252.191 220.999 262.614 1.00 0.00 ? 1822 ILE A CA 1 
ATOM 4531 C CA . HIS E  5  1823 ? 251.371 224.630 263.382 1.00 0.00 ? 1823 HIS A CA 1 
ATOM 4532 C CA . THR E  5  1824 ? 247.826 225.934 263.869 1.00 0.00 ? 1824 THR A CA 1 
ATOM 4533 C CA . SER E  5  1825 ? 248.558 228.514 261.149 1.00 0.00 ? 1825 SER A CA 1 
ATOM 4534 C CA . VAL E  5  1826 ? 248.414 225.880 258.411 1.00 0.00 ? 1826 VAL A CA 1 
ATOM 4535 C CA . TRP E  5  1827 ? 244.934 224.960 259.670 1.00 0.00 ? 1827 TRP A CA 1 
ATOM 4536 C CA . ALA E  5  1828 ? 243.887 228.599 259.854 1.00 0.00 ? 1828 ALA A CA 1 
ATOM 4537 C CA . GLY E  5  1829 ? 241.835 230.004 256.961 1.00 0.00 ? 1829 GLY A CA 1 
ATOM 4538 C CA . GLN E  5  1830 ? 240.999 226.595 255.436 1.00 0.00 ? 1830 GLN A CA 1 
ATOM 4539 C CA . LYS E  5  1831 ? 237.844 224.725 254.388 1.00 0.00 ? 1831 LYS A CA 1 
ATOM 4540 C CA . ARG E  5  1832 ? 237.194 220.965 254.665 1.00 0.00 ? 1832 ARG A CA 1 
ATOM 4541 C CA . LEU E  5  1833 ? 240.206 220.628 256.999 1.00 0.00 ? 1833 LEU A CA 1 
ATOM 4542 C CA . GLY E  5  1834 ? 239.357 217.120 258.286 1.00 0.00 ? 1834 GLY A CA 1 
ATOM 4543 C CA . GLN E  5  1835 ? 240.110 215.648 254.844 1.00 0.00 ? 1835 GLN A CA 1 
ATOM 4544 C CA . LEU E  5  1836 ? 242.879 218.202 254.223 1.00 0.00 ? 1836 LEU A CA 1 
ATOM 4545 C CA . ALA E  5  1837 ? 244.825 217.099 257.327 1.00 0.00 ? 1837 ALA A CA 1 
ATOM 4546 C CA . LYS E  5  1838 ? 244.759 213.476 256.154 1.00 0.00 ? 1838 LYS A CA 1 
ATOM 4547 C CA . TRP E  5  1839 ? 246.466 214.544 252.898 1.00 0.00 ? 1839 TRP A CA 1 
ATOM 4548 C CA . LYS E  5  1840 ? 248.903 216.814 254.763 1.00 0.00 ? 1840 LYS A CA 1 
ATOM 4549 C CA . THR E  5  1841 ? 250.115 213.877 256.895 1.00 0.00 ? 1841 THR A CA 1 
ATOM 4550 C CA . ALA E  5  1842 ? 250.802 211.624 253.874 1.00 0.00 ? 1842 ALA A CA 1 
ATOM 4551 C CA . GLU E  5  1843 ? 252.766 214.428 252.170 1.00 0.00 ? 1843 GLU A CA 1 
ATOM 4552 C CA . GLU E  5  1844 ? 255.155 214.654 255.131 1.00 0.00 ? 1844 GLU A CA 1 
ATOM 4553 C CA . VAL E  5  1845 ? 255.405 210.869 255.588 1.00 0.00 ? 1845 VAL A CA 1 
ATOM 4554 C CA . ALA E  5  1846 ? 256.756 210.631 252.025 1.00 0.00 ? 1846 ALA A CA 1 
ATOM 4555 C CA . ALA E  5  1847 ? 259.006 213.648 252.712 1.00 0.00 ? 1847 ALA A CA 1 
ATOM 4556 C CA . LEU E  5  1848 ? 260.467 211.814 255.730 1.00 0.00 ? 1848 LEU A CA 1 
ATOM 4557 C CA . ILE E  5  1849 ? 261.246 208.725 253.632 1.00 0.00 ? 1849 ILE A CA 1 
ATOM 4558 C CA . ARG E  5  1850 ? 263.041 210.931 251.095 1.00 0.00 ? 1850 ARG A CA 1 
ATOM 4559 C CA . SER E  5  1851 ? 265.155 212.536 253.849 1.00 0.00 ? 1851 SER A CA 1 
ATOM 4560 C CA . LEU E  5  1852 ? 266.029 209.035 255.079 1.00 0.00 ? 1852 LEU A CA 1 
ATOM 4561 C CA . PRO E  5  1853 ? 268.900 207.487 253.060 1.00 0.00 ? 1853 PRO A CA 1 
ATOM 4562 C CA . VAL E  5  1854 ? 268.320 204.591 250.634 1.00 0.00 ? 1854 VAL A CA 1 
ATOM 4563 C CA . GLU E  5  1855 ? 269.891 202.261 253.227 1.00 0.00 ? 1855 GLU A CA 1 
ATOM 4564 C CA . GLU E  5  1856 ? 267.355 203.220 255.899 1.00 0.00 ? 1856 GLU A CA 1 
ATOM 4565 C CA . GLN E  5  1857 ? 264.205 203.475 253.754 1.00 0.00 ? 1857 GLN A CA 1 
ATOM 4566 C CA . PRO E  5  1858 ? 261.402 201.061 254.801 1.00 0.00 ? 1858 PRO A CA 1 
ATOM 4567 C CA . LYS E  5  1859 ? 260.243 197.937 252.950 1.00 0.00 ? 1859 LYS A CA 1 
ATOM 4568 C CA . GLN E  5  1860 ? 256.652 197.638 254.220 1.00 0.00 ? 1860 GLN A CA 1 
ATOM 4569 C CA . ILE E  5  1861 ? 254.598 200.566 255.527 1.00 0.00 ? 1861 ILE A CA 1 
ATOM 4570 C CA . ILE E  5  1862 ? 251.682 199.723 257.839 1.00 0.00 ? 1862 ILE A CA 1 
ATOM 4571 C CA . VAL E  5  1863 ? 248.789 202.038 258.722 1.00 0.00 ? 1863 VAL A CA 1 
ATOM 4572 C CA . THR E  5  1864 ? 246.222 201.873 261.546 1.00 0.00 ? 1864 THR A CA 1 
ATOM 4573 C CA . ARG E  5  1865 ? 243.134 202.897 259.546 1.00 0.00 ? 1865 ARG A CA 1 
ATOM 4574 C CA . LYS E  5  1866 ? 241.905 201.605 256.173 1.00 0.00 ? 1866 LYS A CA 1 
ATOM 4575 C CA . GLY E  5  1867 ? 241.052 205.129 254.927 1.00 0.00 ? 1867 GLY A CA 1 
ATOM 4576 C CA . MET E  5  1868 ? 244.745 206.111 254.818 1.00 0.00 ? 1868 MET A CA 1 
ATOM 4577 C CA . LEU E  5  1869 ? 245.526 203.888 251.813 1.00 0.00 ? 1869 LEU A CA 1 
ATOM 4578 C CA . ASP E  5  1870 ? 243.919 206.255 249.296 1.00 0.00 ? 1870 ASP A CA 1 
ATOM 4579 C CA . PRO E  5  1871 ? 245.962 209.463 249.993 1.00 0.00 ? 1871 PRO A CA 1 
ATOM 4580 C CA . LEU E  5  1872 ? 249.175 207.602 250.897 1.00 0.00 ? 1872 LEU A CA 1 
ATOM 4581 C CA . GLU E  5  1873 ? 249.479 205.571 247.660 1.00 0.00 ? 1873 GLU A CA 1 
ATOM 4582 C CA . VAL E  5  1874 ? 249.672 208.769 245.567 1.00 0.00 ? 1874 VAL A CA 1 
ATOM 4583 C CA . HIS E  5  1875 ? 252.949 209.847 247.219 1.00 0.00 ? 1875 HIS A CA 1 
ATOM 4584 C CA . LEU E  5  1876 ? 254.388 206.324 247.522 1.00 0.00 ? 1876 LEU A CA 1 
ATOM 4585 C CA . LEU E  5  1877 ? 253.938 205.574 243.819 1.00 0.00 ? 1877 LEU A CA 1 
ATOM 4586 C CA . ASP E  5  1878 ? 257.380 207.155 243.252 1.00 0.00 ? 1878 ASP A CA 1 
ATOM 4587 C CA . PHE E  5  1879 ? 258.719 204.498 245.659 1.00 0.00 ? 1879 PHE A CA 1 
ATOM 4588 C CA . PRO E  5  1880 ? 256.874 201.519 244.097 1.00 0.00 ? 1880 PRO A CA 1 
ATOM 4589 C CA . ASN E  5  1881 ? 258.747 198.664 245.840 1.00 0.00 ? 1881 ASN A CA 1 
ATOM 4590 C CA . ILE E  5  1882 ? 257.145 199.387 249.232 1.00 0.00 ? 1882 ILE A CA 1 
ATOM 4591 C CA . VAL E  5  1883 ? 254.072 197.307 250.123 1.00 0.00 ? 1883 VAL A CA 1 
ATOM 4592 C CA . ILE E  5  1884 ? 251.362 199.391 251.803 1.00 0.00 ? 1884 ILE A CA 1 
ATOM 4593 C CA . LYS E  5  1885 ? 249.213 197.291 254.152 1.00 0.00 ? 1885 LYS A CA 1 
ATOM 4594 C CA . GLY E  5  1886 ? 245.824 197.821 255.838 1.00 0.00 ? 1886 GLY A CA 1 
ATOM 4595 C CA . SER E  5  1887 ? 245.224 196.120 259.316 1.00 0.00 ? 1887 SER A CA 1 
ATOM 4596 C CA . GLU E  5  1888 ? 242.389 194.885 261.549 1.00 0.00 ? 1888 GLU A CA 1 
ATOM 4597 C CA . LEU E  5  1889 ? 244.251 195.517 264.821 1.00 0.00 ? 1889 LEU A CA 1 
ATOM 4598 C CA . GLN E  5  1890 ? 243.244 198.008 267.521 1.00 0.00 ? 1890 GLN A CA 1 
ATOM 4599 C CA . LEU E  5  1891 ? 246.769 199.387 267.901 1.00 0.00 ? 1891 LEU A CA 1 
ATOM 4600 C CA . PRO E  5  1892 ? 247.146 201.581 271.026 1.00 0.00 ? 1892 PRO A CA 1 
ATOM 4601 C CA . PHE E  5  1893 ? 248.460 204.837 269.526 1.00 0.00 ? 1893 PHE A CA 1 
ATOM 4602 C CA . GLN E  5  1894 ? 245.816 206.838 271.408 1.00 0.00 ? 1894 GLN A CA 1 
ATOM 4603 C CA . ALA E  5  1895 ? 247.815 207.097 274.645 1.00 0.00 ? 1895 ALA A CA 1 
ATOM 4604 C CA . CYS E  5  1896 ? 250.951 208.754 273.216 1.00 0.00 ? 1896 CYS A CA 1 
ATOM 4605 C CA . LEU E  5  1897 ? 249.948 212.364 273.992 1.00 0.00 ? 1897 LEU A CA 1 
ATOM 4606 C CA . LYS E  5  1898 ? 249.336 211.357 277.624 1.00 0.00 ? 1898 LYS A CA 1 
ATOM 4607 C CA . VAL E  5  1899 ? 253.065 211.715 278.411 1.00 0.00 ? 1899 VAL A CA 1 
ATOM 4608 C CA . GLU E  5  1900 ? 253.569 215.049 280.193 1.00 0.00 ? 1900 GLU A CA 1 
ATOM 4609 C CA . LYS E  5  1901 ? 256.740 216.208 278.387 1.00 0.00 ? 1901 LYS A CA 1 
ATOM 4610 C CA . PHE E  5  1902 ? 255.003 215.820 275.000 1.00 0.00 ? 1902 PHE A CA 1 
ATOM 4611 C CA . GLY E  5  1903 ? 252.139 218.065 276.106 1.00 0.00 ? 1903 GLY A CA 1 
ATOM 4612 C CA . ASP E  5  1904 ? 254.471 220.705 277.596 1.00 0.00 ? 1904 ASP A CA 1 
ATOM 4613 C CA . LEU E  5  1905 ? 256.977 220.893 274.731 1.00 0.00 ? 1905 LEU A CA 1 
ATOM 4614 C CA . ILE E  5  1906 ? 254.477 220.872 271.855 1.00 0.00 ? 1906 ILE A CA 1 
ATOM 4615 C CA . LEU E  5  1907 ? 252.283 223.529 273.495 1.00 0.00 ? 1907 LEU A CA 1 
ATOM 4616 C CA . LYS E  5  1908 ? 255.440 225.660 273.704 1.00 0.00 ? 1908 LYS A CA 1 
ATOM 4617 C CA . ALA E  5  1909 ? 256.703 224.791 270.186 1.00 0.00 ? 1909 ALA A CA 1 
ATOM 4618 C CA . THR E  5  1910 ? 256.131 227.799 267.914 1.00 0.00 ? 1910 THR A CA 1 
ATOM 4619 C CA . GLU E  5  1911 ? 257.363 226.247 264.645 1.00 0.00 ? 1911 GLU A CA 1 
ATOM 4620 C CA . PRO E  5  1912 ? 257.243 222.925 262.722 1.00 0.00 ? 1912 PRO A CA 1 
ATOM 4621 C CA . GLN E  5  1913 ? 260.059 220.728 264.060 1.00 0.00 ? 1913 GLN A CA 1 
ATOM 4622 C CA . MET E  5  1914 ? 261.396 217.355 262.904 1.00 0.00 ? 1914 MET A CA 1 
ATOM 4623 C CA . VAL E  5  1915 ? 261.923 215.737 266.309 1.00 0.00 ? 1915 VAL A CA 1 
ATOM 4624 C CA . LEU E  5  1916 ? 263.343 212.262 267.017 1.00 0.00 ? 1916 LEU A CA 1 
ATOM 4625 C CA . PHE E  5  1917 ? 262.278 210.222 270.062 1.00 0.00 ? 1917 PHE A CA 1 
ATOM 4626 C CA . ASN E  5  1918 ? 263.210 206.843 271.548 1.00 0.00 ? 1918 ASN A CA 1 
ATOM 4627 C CA . LEU E  5  1919 ? 260.531 204.557 272.988 1.00 0.00 ? 1919 LEU A CA 1 
ATOM 4628 C CA . TYR E  5  1920 ? 263.058 202.090 274.384 1.00 0.00 ? 1920 TYR A CA 1 
ATOM 4629 C CA . ASP E  5  1921 ? 265.459 204.291 276.405 1.00 0.00 ? 1921 ASP A CA 1 
ATOM 4630 C CA . ASP E  5  1922 ? 268.534 202.052 276.423 1.00 0.00 ? 1922 ASP A CA 1 
ATOM 4631 C CA . TRP E  5  1923 ? 266.468 198.928 277.067 1.00 0.00 ? 1923 TRP A CA 1 
ATOM 4632 C CA . LEU E  5  1924 ? 268.589 197.207 274.395 1.00 0.00 ? 1924 LEU A CA 1 
ATOM 4633 C CA . LYS E  5  1925 ? 271.365 196.874 276.993 1.00 0.00 ? 1925 LYS A CA 1 
ATOM 4634 C CA . THR E  5  1926 ? 269.083 194.820 279.275 1.00 0.00 ? 1926 THR A CA 1 
ATOM 4635 C CA . ILE E  5  1927 ? 265.708 193.995 277.681 1.00 0.00 ? 1927 ILE A CA 1 
ATOM 4636 C CA . SER E  5  1928 ? 265.426 192.501 274.197 1.00 0.00 ? 1928 SER A CA 1 
ATOM 4637 C CA . SER E  5  1929 ? 263.268 193.892 271.364 1.00 0.00 ? 1929 SER A CA 1 
ATOM 4638 C CA . TYR E  5  1930 ? 260.436 191.435 270.565 1.00 0.00 ? 1930 TYR A CA 1 
ATOM 4639 C CA . THR E  5  1931 ? 259.324 191.161 274.220 1.00 0.00 ? 1931 THR A CA 1 
ATOM 4640 C CA . ALA E  5  1932 ? 259.650 194.937 274.783 1.00 0.00 ? 1932 ALA A CA 1 
ATOM 4641 C CA . PHE E  5  1933 ? 257.273 195.589 271.851 1.00 0.00 ? 1933 PHE A CA 1 
ATOM 4642 C CA . SER E  5  1934 ? 254.508 193.519 273.481 1.00 0.00 ? 1934 SER A CA 1 
ATOM 4643 C CA . ARG E  5  1935 ? 255.345 195.337 276.746 1.00 0.00 ? 1935 ARG A CA 1 
ATOM 4644 C CA . LEU E  5  1936 ? 254.962 198.960 275.579 1.00 0.00 ? 1936 LEU A CA 1 
ATOM 4645 C CA . ILE E  5  1937 ? 251.913 198.004 273.466 1.00 0.00 ? 1937 ILE A CA 1 
ATOM 4646 C CA . LEU E  5  1938 ? 250.481 196.649 276.716 1.00 0.00 ? 1938 LEU A CA 1 
ATOM 4647 C CA . ILE E  5  1939 ? 251.610 199.821 278.533 1.00 0.00 ? 1939 ILE A CA 1 
ATOM 4648 C CA . LEU E  5  1940 ? 250.217 202.166 275.849 1.00 0.00 ? 1940 LEU A CA 1 
ATOM 4649 C CA . ARG E  5  1941 ? 246.917 200.357 276.221 1.00 0.00 ? 1941 ARG A CA 1 
ATOM 4650 C CA . ALA E  5  1942 ? 247.280 200.774 279.969 1.00 0.00 ? 1942 ALA A CA 1 
ATOM 4651 C CA . LEU E  5  1943 ? 246.994 204.590 279.719 1.00 0.00 ? 1943 LEU A CA 1 
ATOM 4652 C CA . HIS E  5  1944 ? 243.417 204.202 278.447 1.00 0.00 ? 1944 HIS A CA 1 
ATOM 4653 C CA . VAL E  5  1945 ? 242.803 201.915 281.412 1.00 0.00 ? 1945 VAL A CA 1 
ATOM 4654 C CA . ASN E  5  1946 ? 241.197 203.158 284.607 1.00 0.00 ? 1946 ASN A CA 1 
ATOM 4655 C CA . ASN E  5  1947 ? 241.800 206.183 282.349 1.00 0.00 ? 1947 ASN A CA 1 
ATOM 4656 C CA . ASP E  5  1948 ? 244.355 208.204 284.345 1.00 0.00 ? 1948 ASP A CA 1 
ATOM 4657 C CA . ARG E  5  1949 ? 244.768 205.831 287.274 1.00 0.00 ? 1949 ARG A CA 1 
ATOM 4658 C CA . ALA E  5  1950 ? 247.317 203.474 285.738 1.00 0.00 ? 1950 ALA A CA 1 
ATOM 4659 C CA . LYS E  5  1951 ? 249.841 206.259 285.174 1.00 0.00 ? 1951 LYS A CA 1 
ATOM 4660 C CA . VAL E  5  1952 ? 248.955 207.330 288.741 1.00 0.00 ? 1952 VAL A CA 1 
ATOM 4661 C CA . ILE E  5  1953 ? 250.206 203.887 289.854 1.00 0.00 ? 1953 ILE A CA 1 
ATOM 4662 C CA . LEU E  5  1954 ? 253.536 204.639 288.143 1.00 0.00 ? 1954 LEU A CA 1 
ATOM 4663 C CA . LYS E  5  1955 ? 253.890 207.937 290.038 1.00 0.00 ? 1955 LYS A CA 1 
ATOM 4664 C CA . PRO E  5  1956 ? 254.229 206.475 293.596 1.00 0.00 ? 1956 PRO A CA 1 
ATOM 4665 C CA . ASP E  5  1957 ? 256.761 204.059 292.053 1.00 0.00 ? 1957 ASP A CA 1 
ATOM 4666 C CA . LYS E  5  1958 ? 259.648 206.391 292.946 1.00 0.00 ? 1958 LYS A CA 1 
ATOM 4667 C CA . THR E  5  1959 ? 262.470 203.896 293.618 1.00 0.00 ? 1959 THR A CA 1 
ATOM 4668 C CA . THR E  5  1960 ? 262.407 202.934 289.918 1.00 0.00 ? 1960 THR A CA 1 
ATOM 4669 C CA . ILE E  5  1961 ? 263.604 206.328 288.673 1.00 0.00 ? 1961 ILE A CA 1 
ATOM 4670 C CA . THR E  5  1962 ? 263.275 207.244 284.986 1.00 0.00 ? 1962 THR A CA 1 
ATOM 4671 C CA . GLU E  5  1963 ? 266.483 208.088 283.119 1.00 0.00 ? 1963 GLU A CA 1 
ATOM 4672 C CA . PRO E  5  1964 ? 267.048 211.793 282.252 1.00 0.00 ? 1964 PRO A CA 1 
ATOM 4673 C CA . HIS E  5  1965 ? 268.059 211.155 278.609 1.00 0.00 ? 1965 HIS A CA 1 
ATOM 4674 C CA . HIS E  5  1966 ? 265.295 208.563 278.122 1.00 0.00 ? 1966 HIS A CA 1 
ATOM 4675 C CA . ILE E  5  1967 ? 261.544 207.976 278.477 1.00 0.00 ? 1967 ILE A CA 1 
ATOM 4676 C CA . TRP E  5  1968 ? 260.458 204.809 280.332 1.00 0.00 ? 1968 TRP A CA 1 
ATOM 4677 C CA . PRO E  5  1969 ? 261.305 203.757 283.911 1.00 0.00 ? 1969 PRO A CA 1 
ATOM 4678 C CA . THR E  5  1970 ? 264.050 201.244 284.789 1.00 0.00 ? 1970 THR A CA 1 
ATOM 4679 C CA . LEU E  5  1971 ? 261.950 198.164 285.642 1.00 0.00 ? 1971 LEU A CA 1 
ATOM 4680 C CA . THR E  5  1972 ? 263.803 194.905 286.376 1.00 0.00 ? 1972 THR A CA 1 
ATOM 4681 C CA . ASP E  5  1973 ? 262.756 191.399 285.240 1.00 0.00 ? 1973 ASP A CA 1 
ATOM 4682 C CA . GLU E  5  1974 ? 260.631 190.923 288.382 1.00 0.00 ? 1974 GLU A CA 1 
ATOM 4683 C CA . GLU E  5  1975 ? 259.123 194.418 288.082 1.00 0.00 ? 1975 GLU A CA 1 
ATOM 4684 C CA . TRP E  5  1976 ? 258.180 193.708 284.442 1.00 0.00 ? 1976 TRP A CA 1 
ATOM 4685 C CA . ILE E  5  1977 ? 256.228 190.637 285.599 1.00 0.00 ? 1977 ILE A CA 1 
ATOM 4686 C CA . LYS E  5  1978 ? 254.578 192.819 288.267 1.00 0.00 ? 1978 LYS A CA 1 
ATOM 4687 C CA . VAL E  5  1979 ? 253.681 195.507 285.702 1.00 0.00 ? 1979 VAL A CA 1 
ATOM 4688 C CA . GLU E  5  1980 ? 252.226 193.036 283.176 1.00 0.00 ? 1980 GLU A CA 1 
ATOM 4689 C CA . VAL E  5  1981 ? 249.401 191.701 285.386 1.00 0.00 ? 1981 VAL A CA 1 
ATOM 4690 C CA . GLN E  5  1982 ? 248.398 195.062 286.914 1.00 0.00 ? 1982 GLN A CA 1 
ATOM 4691 C CA . LEU E  5  1983 ? 247.925 196.513 283.425 1.00 0.00 ? 1983 LEU A CA 1 
ATOM 4692 C CA . LYS E  5  1984 ? 246.377 193.339 281.976 1.00 0.00 ? 1984 LYS A CA 1 
ATOM 4693 C CA . ASP E  5  1985 ? 243.839 193.235 284.838 1.00 0.00 ? 1985 ASP A CA 1 
ATOM 4694 C CA . LEU E  5  1986 ? 242.929 196.903 284.484 1.00 0.00 ? 1986 LEU A CA 1 
ATOM 4695 C CA . ILE E  5  1987 ? 242.814 196.646 280.663 1.00 0.00 ? 1987 ILE A CA 1 
ATOM 4696 C CA . LEU E  5  1988 ? 240.195 193.887 280.762 1.00 0.00 ? 1988 LEU A CA 1 
ATOM 4697 C CA . ALA E  5  1989 ? 238.383 196.070 283.315 1.00 0.00 ? 1989 ALA A CA 1 
ATOM 4698 C CA . ASP E  5  1990 ? 237.791 198.836 280.732 1.00 0.00 ? 1990 ASP A CA 1 
ATOM 4699 C CA . TYR E  5  1991 ? 236.759 196.171 278.204 1.00 0.00 ? 1991 TYR A CA 1 
ATOM 4700 C CA . GLY E  5  1992 ? 234.283 195.102 280.913 1.00 0.00 ? 1992 GLY A CA 1 
ATOM 4701 C CA . LYS E  5  1993 ? 233.207 198.731 281.500 1.00 0.00 ? 1993 LYS A CA 1 
ATOM 4702 C CA . LYS E  5  1994 ? 232.908 199.796 277.841 1.00 0.00 ? 1994 LYS A CA 1 
ATOM 4703 C CA . ASN E  5  1995 ? 232.006 196.506 276.138 1.00 0.00 ? 1995 ASN A CA 1 
ATOM 4704 C CA . ASN E  5  1996 ? 229.914 195.076 279.011 1.00 0.00 ? 1996 ASN A CA 1 
ATOM 4705 C CA . VAL E  5  1997 ? 231.232 191.474 278.832 1.00 0.00 ? 1997 VAL A CA 1 
ATOM 4706 C CA . ASN E  5  1998 ? 233.771 190.693 281.568 1.00 0.00 ? 1998 ASN A CA 1 
ATOM 4707 C CA . VAL E  5  1999 ? 236.200 187.765 281.133 1.00 0.00 ? 1999 VAL A CA 1 
ATOM 4708 C CA . ALA E  5  2000 ? 235.825 185.094 278.447 1.00 0.00 ? 2000 ALA A CA 1 
ATOM 4709 C CA . SER E  5  2001 ? 238.042 182.412 276.850 1.00 0.00 ? 2001 SER A CA 1 
ATOM 4710 C CA . LEU E  5  2002 ? 241.698 183.174 276.067 1.00 0.00 ? 2002 LEU A CA 1 
ATOM 4711 C CA . THR E  5  2003 ? 241.354 184.957 272.713 1.00 0.00 ? 2003 THR A CA 1 
ATOM 4712 C CA . GLN E  5  2004 ? 243.347 187.954 271.441 1.00 0.00 ? 2004 GLN A CA 1 
ATOM 4713 C CA . SER E  5  2005 ? 240.883 190.817 270.854 1.00 0.00 ? 2005 SER A CA 1 
ATOM 4714 C CA . GLU E  5  2006 ? 243.436 193.185 269.303 1.00 0.00 ? 2006 GLU A CA 1 
ATOM 4715 C CA . PHE E  5  2067 ? 196.774 179.117 258.937 1.00 0.00 ? 2067 PHE A CA 1 
ATOM 4716 C CA . SER E  5  2068 ? 198.638 179.575 262.260 1.00 0.00 ? 2068 SER A CA 1 
ATOM 4717 C CA . SER E  5  2069 ? 195.198 179.886 263.917 1.00 0.00 ? 2069 SER A CA 1 
ATOM 4718 C CA . LYS E  5  2070 ? 196.397 182.559 266.347 1.00 0.00 ? 2070 LYS A CA 1 
ATOM 4719 C CA . THR E  5  2071 ? 198.645 185.256 264.811 1.00 0.00 ? 2071 THR A CA 1 
ATOM 4720 C CA . GLU E  5  2072 ? 197.595 184.283 261.280 1.00 0.00 ? 2072 GLU A CA 1 
ATOM 4721 C CA . TRP E  5  2073 ? 193.990 185.102 262.108 1.00 0.00 ? 2073 TRP A CA 1 
ATOM 4722 C CA . ARG E  5  2074 ? 194.640 188.664 263.267 1.00 0.00 ? 2074 ARG A CA 1 
ATOM 4723 C CA . VAL E  5  2075 ? 196.982 189.862 260.570 1.00 0.00 ? 2075 VAL A CA 1 
ATOM 4724 C CA . ARG E  5  2076 ? 194.402 188.998 257.927 1.00 0.00 ? 2076 ARG A CA 1 
ATOM 4725 C CA . ALA E  5  2077 ? 191.656 190.293 260.172 1.00 0.00 ? 2077 ALA A CA 1 
ATOM 4726 C CA . ILE E  5  2078 ? 192.881 193.849 260.450 1.00 0.00 ? 2078 ILE A CA 1 
ATOM 4727 C CA . SER E  5  2079 ? 193.810 193.591 256.798 1.00 0.00 ? 2079 SER A CA 1 
ATOM 4728 C CA . ALA E  5  2080 ? 190.292 192.711 255.600 1.00 0.00 ? 2080 ALA A CA 1 
ATOM 4729 C CA . ALA E  5  2081 ? 188.850 195.790 257.334 1.00 0.00 ? 2081 ALA A CA 1 
ATOM 4730 C CA . ASN E  5  2082 ? 190.222 197.647 254.310 1.00 0.00 ? 2082 ASN A CA 1 
ATOM 4731 C CA . LEU E  5  2083 ? 188.651 195.488 251.603 1.00 0.00 ? 2083 LEU A CA 1 
ATOM 4732 C CA . HIS E  5  2084 ? 186.148 198.229 250.881 1.00 0.00 ? 2084 HIS A CA 1 
ATOM 4733 C CA . LEU E  5  2085 ? 189.017 200.284 249.546 1.00 0.00 ? 2085 LEU A CA 1 
ATOM 4734 C CA . ARG E  5  2086 ? 189.494 197.798 246.701 1.00 0.00 ? 2086 ARG A CA 1 
ATOM 4735 C CA . THR E  5  2087 ? 185.843 198.190 245.945 1.00 0.00 ? 2087 THR A CA 1 
ATOM 4736 C CA . ASN E  5  2088 ? 186.257 201.319 243.827 1.00 0.00 ? 2088 ASN A CA 1 
ATOM 4737 C CA . HIS E  5  2089 ? 189.164 200.101 241.704 1.00 0.00 ? 2089 HIS A CA 1 
ATOM 4738 C CA . ILE E  5  2090 ? 188.209 197.097 239.595 1.00 0.00 ? 2090 ILE A CA 1 
ATOM 4739 C CA . TYR E  5  2091 ? 189.267 195.817 236.213 1.00 0.00 ? 2091 TYR A CA 1 
ATOM 4740 C CA . VAL E  5  2092 ? 187.421 193.546 233.867 1.00 0.00 ? 2092 VAL A CA 1 
ATOM 4741 C CA . SER E  5  2093 ? 188.915 191.270 231.307 1.00 0.00 ? 2093 SER A CA 1 
ATOM 4742 C CA . SER E  5  2094 ? 188.172 192.427 227.804 1.00 0.00 ? 2094 SER A CA 1 
ATOM 4743 C CA . ASP E  5  2095 ? 189.203 189.801 225.310 1.00 0.00 ? 2095 ASP A CA 1 
ATOM 4744 C CA . ASP E  5  2096 ? 188.000 188.209 222.087 1.00 0.00 ? 2096 ASP A CA 1 
ATOM 4745 C CA . ILE E  5  2097 ? 184.204 187.935 221.957 1.00 0.00 ? 2097 ILE A CA 1 
ATOM 4746 C CA . LYS E  5  2098 ? 182.836 184.664 220.529 1.00 0.00 ? 2098 LYS A CA 1 
ATOM 4747 C CA . GLU E  5  2099 ? 179.645 186.569 219.534 1.00 0.00 ? 2099 GLU A CA 1 
ATOM 4748 C CA . THR E  5  2100 ? 177.608 183.373 219.410 1.00 0.00 ? 2100 THR A CA 1 
ATOM 4749 C CA . GLY E  5  2101 ? 177.950 183.293 223.174 1.00 0.00 ? 2101 GLY A CA 1 
ATOM 4750 C CA . TYR E  5  2102 ? 175.868 184.765 225.980 1.00 0.00 ? 2102 TYR A CA 1 
ATOM 4751 C CA . THR E  5  2103 ? 177.049 187.927 227.671 1.00 0.00 ? 2103 THR A CA 1 
ATOM 4752 C CA . TYR E  5  2104 ? 176.652 188.399 231.397 1.00 0.00 ? 2104 TYR A CA 1 
ATOM 4753 C CA . ILE E  5  2105 ? 175.954 191.647 233.227 1.00 0.00 ? 2105 ILE A CA 1 
ATOM 4754 C CA . LEU E  5  2106 ? 176.914 191.820 236.938 1.00 0.00 ? 2106 LEU A CA 1 
ATOM 4755 C CA . PRO E  5  2107 ? 175.247 194.557 238.985 1.00 0.00 ? 2107 PRO A CA 1 
ATOM 4756 C CA . LYS E  5  2108 ? 177.952 196.481 240.771 1.00 0.00 ? 2108 LYS A CA 1 
ATOM 4757 C CA . ASN E  5  2109 ? 176.374 196.555 244.194 1.00 0.00 ? 2109 ASN A CA 1 
ATOM 4758 C CA . VAL E  5  2110 ? 176.490 192.825 244.821 1.00 0.00 ? 2110 VAL A CA 1 
ATOM 4759 C CA . LEU E  5  2111 ? 180.070 192.846 243.527 1.00 0.00 ? 2111 LEU A CA 1 
ATOM 4760 C CA . LYS E  5  2112 ? 181.091 195.493 246.037 1.00 0.00 ? 2112 LYS A CA 1 
ATOM 4761 C CA . LYS E  5  2113 ? 179.450 193.658 248.953 1.00 0.00 ? 2113 LYS A CA 1 
ATOM 4762 C CA . PHE E  5  2114 ? 180.861 190.312 247.851 1.00 0.00 ? 2114 PHE A CA 1 
ATOM 4763 C CA . ILE E  5  2115 ? 184.371 191.762 247.792 1.00 0.00 ? 2115 ILE A CA 1 
ATOM 4764 C CA . CYS E  5  2116 ? 183.762 193.334 251.168 1.00 0.00 ? 2116 CYS A CA 1 
ATOM 4765 C CA . ILE E  5  2117 ? 182.807 190.163 252.992 1.00 0.00 ? 2117 ILE A CA 1 
ATOM 4766 C CA . SER E  5  2118 ? 185.768 188.203 251.624 1.00 0.00 ? 2118 SER A CA 1 
ATOM 4767 C CA . ASP E  5  2119 ? 189.257 187.555 252.925 1.00 0.00 ? 2119 ASP A CA 1 
ATOM 4768 C CA . LEU E  5  2120 ? 192.584 187.794 251.152 1.00 0.00 ? 2120 LEU A CA 1 
ATOM 4769 C CA . ARG E  5  2121 ? 193.592 184.187 251.668 1.00 0.00 ? 2121 ARG A CA 1 
ATOM 4770 C CA . ALA E  5  2122 ? 190.567 181.921 251.953 1.00 0.00 ? 2122 ALA A CA 1 
ATOM 4771 C CA . GLN E  5  2123 ? 188.502 181.758 248.773 1.00 0.00 ? 2123 GLN A CA 1 
ATOM 4772 C CA . ILE E  5  2124 ? 184.859 182.539 249.302 1.00 0.00 ? 2124 ILE A CA 1 
ATOM 4773 C CA . ALA E  5  2125 ? 182.288 181.690 246.696 1.00 0.00 ? 2125 ALA A CA 1 
ATOM 4774 C CA . GLY E  5  2126 ? 178.774 182.697 245.729 1.00 0.00 ? 2126 GLY A CA 1 
ATOM 4775 C CA . TYR E  5  2127 ? 176.172 181.307 243.391 1.00 0.00 ? 2127 TYR A CA 1 
ATOM 4776 C CA . LEU E  5  2128 ? 174.784 183.352 240.490 1.00 0.00 ? 2128 LEU A CA 1 
ATOM 4777 C CA . TYR E  5  2129 ? 171.089 183.669 239.710 1.00 0.00 ? 2129 TYR A CA 1 
ATOM 4778 C CA . GLY E  5  2130 ? 169.562 185.807 236.960 1.00 0.00 ? 2130 GLY A CA 1 
ATOM 4779 C CA . VAL E  5  2131 ? 167.242 186.174 233.968 1.00 0.00 ? 2131 VAL A CA 1 
ATOM 4780 C CA . SER E  5  2132 ? 167.659 187.497 230.440 1.00 0.00 ? 2132 SER A CA 1 
ATOM 4781 C CA . PRO E  5  2133 ? 165.928 190.822 229.820 1.00 0.00 ? 2133 PRO A CA 1 
ATOM 4782 C CA . PRO E  5  2134 ? 162.687 190.739 227.844 1.00 0.00 ? 2134 PRO A CA 1 
ATOM 4783 C CA . ASP E  5  2135 ? 163.122 190.338 224.111 1.00 0.00 ? 2135 ASP A CA 1 
ATOM 4784 C CA . ASN E  5  2136 ? 166.871 190.049 224.494 1.00 0.00 ? 2136 ASN A CA 1 
ATOM 4785 C CA . PRO E  5  2137 ? 167.765 186.415 224.977 1.00 0.00 ? 2137 PRO A CA 1 
ATOM 4786 C CA . GLN E  5  2138 ? 171.527 186.673 224.401 1.00 0.00 ? 2138 GLN A CA 1 
ATOM 4787 C CA . VAL E  5  2139 ? 172.353 188.667 227.557 1.00 0.00 ? 2139 VAL A CA 1 
ATOM 4788 C CA . LYS E  5  2140 ? 172.060 187.332 231.097 1.00 0.00 ? 2140 LYS A CA 1 
ATOM 4789 C CA . GLU E  5  2141 ? 171.493 189.849 233.864 1.00 0.00 ? 2141 GLU A CA 1 
ATOM 4790 C CA . ILE E  5  2142 ? 172.778 188.476 237.150 1.00 0.00 ? 2142 ILE A CA 1 
ATOM 4791 C CA . ARG E  5  2143 ? 170.178 189.598 239.649 1.00 0.00 ? 2143 ARG A CA 1 
ATOM 4792 C CA . CYS E  5  2144 ? 171.119 187.621 242.704 1.00 0.00 ? 2144 CYS A CA 1 
ATOM 4793 C CA . ILE E  5  2145 ? 173.996 186.086 244.602 1.00 0.00 ? 2145 ILE A CA 1 
ATOM 4794 C CA . VAL E  5  2146 ? 173.446 183.230 247.041 1.00 0.00 ? 2146 VAL A CA 1 
ATOM 4795 C CA . MET E  5  2147 ? 175.906 182.483 249.868 1.00 0.00 ? 2147 MET A CA 1 
ATOM 4796 C CA . VAL E  5  2148 ? 175.805 178.931 251.277 1.00 0.00 ? 2148 VAL A CA 1 
ATOM 4797 C CA . PRO E  5  2149 ? 177.675 177.249 254.129 1.00 0.00 ? 2149 PRO A CA 1 
ATOM 4798 C CA . GLN E  5  2150 ? 181.224 176.963 252.845 1.00 0.00 ? 2150 GLN A CA 1 
ATOM 4799 C CA . TRP E  5  2151 ? 184.910 177.217 253.622 1.00 0.00 ? 2151 TRP A CA 1 
ATOM 4800 C CA . GLY E  5  2152 ? 187.964 177.976 251.508 1.00 0.00 ? 2152 GLY A CA 1 
ATOM 4801 C CA . THR E  5  2153 ? 191.617 177.180 250.902 1.00 0.00 ? 2153 THR A CA 1 
ATOM 4802 C CA . HIS E  5  2154 ? 193.910 179.709 249.270 1.00 0.00 ? 2154 HIS A CA 1 
ATOM 4803 C CA . GLN E  5  2155 ? 193.530 177.790 246.033 1.00 0.00 ? 2155 GLN A CA 1 
ATOM 4804 C CA . THR E  5  2156 ? 189.920 176.485 246.215 1.00 0.00 ? 2156 THR A CA 1 
ATOM 4805 C CA . VAL E  5  2157 ? 186.534 176.451 247.924 1.00 0.00 ? 2157 VAL A CA 1 
ATOM 4806 C CA . HIS E  5  2158 ? 184.530 173.700 249.572 1.00 0.00 ? 2158 HIS A CA 1 
ATOM 4807 C CA . LEU E  5  2159 ? 180.783 174.276 249.445 1.00 0.00 ? 2159 LEU A CA 1 
ATOM 4808 C CA . PRO E  5  2160 ? 178.048 171.639 249.954 1.00 0.00 ? 2160 PRO A CA 1 
ATOM 4809 C CA . GLY E  5  2161 ? 176.296 169.328 247.502 1.00 0.00 ? 2161 GLY A CA 1 
ATOM 4810 C CA . GLN E  5  2162 ? 172.811 170.845 247.825 1.00 0.00 ? 2162 GLN A CA 1 
ATOM 4811 C CA . LEU E  5  2163 ? 172.165 173.725 245.418 1.00 0.00 ? 2163 LEU A CA 1 
ATOM 4812 C CA . PRO E  5  2164 ? 170.140 176.716 246.612 1.00 0.00 ? 2164 PRO A CA 1 
ATOM 4813 C CA . GLN E  5  2165 ? 166.396 175.984 246.845 1.00 0.00 ? 2165 GLN A CA 1 
ATOM 4814 C CA . HIS E  5  2166 ? 164.088 178.984 247.683 1.00 0.00 ? 2166 HIS A CA 1 
ATOM 4815 C CA . GLU E  5  2167 ? 160.982 180.938 246.596 1.00 0.00 ? 2167 GLU A CA 1 
ATOM 4816 C CA . TYR E  5  2168 ? 162.600 184.200 245.474 1.00 0.00 ? 2168 TYR A CA 1 
ATOM 4817 C CA . LEU E  5  2169 ? 164.828 182.054 243.377 1.00 0.00 ? 2169 LEU A CA 1 
ATOM 4818 C CA . LYS E  5  2170 ? 162.049 180.311 241.435 1.00 0.00 ? 2170 LYS A CA 1 
ATOM 4819 C CA . GLU E  5  2171 ? 161.666 183.290 239.056 1.00 0.00 ? 2171 GLU A CA 1 
ATOM 4820 C CA . MET E  5  2172 ? 165.237 183.115 237.774 1.00 0.00 ? 2172 MET A CA 1 
ATOM 4821 C CA . GLU E  5  2173 ? 167.730 180.618 236.376 1.00 0.00 ? 2173 GLU A CA 1 
ATOM 4822 C CA . PRO E  5  2174 ? 171.138 179.670 237.793 1.00 0.00 ? 2174 PRO A CA 1 
ATOM 4823 C CA . LEU E  5  2175 ? 174.051 181.308 235.951 1.00 0.00 ? 2175 LEU A CA 1 
ATOM 4824 C CA . GLY E  5  2176 ? 176.869 179.505 237.772 1.00 0.00 ? 2176 GLY A CA 1 
ATOM 4825 C CA . TRP E  5  2177 ? 179.082 180.859 240.588 1.00 0.00 ? 2177 TRP A CA 1 
ATOM 4826 C CA . ILE E  5  2178 ? 181.656 183.564 241.539 1.00 0.00 ? 2178 ILE A CA 1 
ATOM 4827 C CA . HIS E  5  2179 ? 184.688 183.322 243.827 1.00 0.00 ? 2179 HIS A CA 1 
ATOM 4828 C CA . THR E  5  2180 ? 187.609 185.262 245.261 1.00 0.00 ? 2180 THR A CA 1 
ATOM 4829 C CA . GLN E  5  2181 ? 191.099 184.389 244.074 1.00 0.00 ? 2181 GLN A CA 1 
ATOM 4830 C CA . PRO E  5  2182 ? 194.026 185.480 246.289 1.00 0.00 ? 2182 PRO A CA 1 
ATOM 4831 C CA . ASN E  5  2183 ? 196.544 185.428 243.464 1.00 0.00 ? 2183 ASN A CA 1 
ATOM 4832 C CA . GLU E  5  2184 ? 195.792 186.484 239.916 1.00 0.00 ? 2184 GLU A CA 1 
ATOM 4833 C CA . SER E  5  2185 ? 196.199 183.831 237.236 1.00 0.00 ? 2185 SER A CA 1 
ATOM 4834 C CA . PRO E  5  2186 ? 195.299 184.153 233.565 1.00 0.00 ? 2186 PRO A CA 1 
ATOM 4835 C CA . GLN E  5  2187 ? 193.623 180.742 233.535 1.00 0.00 ? 2187 GLN A CA 1 
ATOM 4836 C CA . LEU E  5  2188 ? 190.723 178.879 235.123 1.00 0.00 ? 2188 LEU A CA 1 
ATOM 4837 C CA . SER E  5  2189 ? 192.253 176.884 237.965 1.00 0.00 ? 2189 SER A CA 1 
ATOM 4838 C CA . PRO E  5  2190 ? 191.983 173.098 237.529 1.00 0.00 ? 2190 PRO A CA 1 
ATOM 4839 C CA . GLN E  5  2191 ? 190.229 173.065 240.896 1.00 0.00 ? 2191 GLN A CA 1 
ATOM 4840 C CA . ASP E  5  2192 ? 187.578 175.278 239.326 1.00 0.00 ? 2192 ASP A CA 1 
ATOM 4841 C CA . VAL E  5  2193 ? 186.935 173.449 236.033 1.00 0.00 ? 2193 VAL A CA 1 
ATOM 4842 C CA . THR E  5  2194 ? 186.812 170.273 238.060 1.00 0.00 ? 2194 THR A CA 1 
ATOM 4843 C CA . THR E  5  2195 ? 184.394 171.826 240.601 1.00 0.00 ? 2195 THR A CA 1 
ATOM 4844 C CA . HIS E  5  2196 ? 182.141 173.190 237.882 1.00 0.00 ? 2196 HIS A CA 1 
ATOM 4845 C CA . ALA E  5  2197 ? 182.014 170.029 235.828 1.00 0.00 ? 2197 ALA A CA 1 
ATOM 4846 C CA . LYS E  5  2198 ? 181.234 168.080 239.002 1.00 0.00 ? 2198 LYS A CA 1 
ATOM 4847 C CA . ILE E  5  2199 ? 178.320 170.444 239.799 1.00 0.00 ? 2199 ILE A CA 1 
ATOM 4848 C CA . MET E  5  2200 ? 177.096 170.065 236.291 1.00 0.00 ? 2200 MET A CA 1 
ATOM 4849 C CA . ALA E  5  2201 ? 177.255 166.321 236.416 1.00 0.00 ? 2201 ALA A CA 1 
ATOM 4850 C CA . ASP E  5  2202 ? 175.032 166.221 239.440 1.00 0.00 ? 2202 ASP A CA 1 
ATOM 4851 C CA . ASN E  5  2203 ? 172.906 169.108 238.222 1.00 0.00 ? 2203 ASN A CA 1 
ATOM 4852 C CA . PRO E  5  2204 ? 170.820 169.181 234.981 1.00 0.00 ? 2204 PRO A CA 1 
ATOM 4853 C CA . SER E  5  2205 ? 169.481 172.436 236.357 1.00 0.00 ? 2205 SER A CA 1 
ATOM 4854 C CA . TRP E  5  2206 ? 172.862 173.904 235.375 1.00 0.00 ? 2206 TRP A CA 1 
ATOM 4855 C CA . ASP E  5  2207 ? 173.186 174.188 231.593 1.00 0.00 ? 2207 ASP A CA 1 
ATOM 4856 C CA . GLY E  5  2208 ? 176.663 173.711 230.158 1.00 0.00 ? 2208 GLY A CA 1 
ATOM 4857 C CA . GLU E  5  2209 ? 176.375 176.621 227.787 1.00 0.00 ? 2209 GLU A CA 1 
ATOM 4858 C CA . LYS E  5  2210 ? 174.523 178.986 230.059 1.00 0.00 ? 2210 LYS A CA 1 
ATOM 4859 C CA . THR E  5  2211 ? 176.483 178.850 233.318 1.00 0.00 ? 2211 THR A CA 1 
ATOM 4860 C CA . ILE E  5  2212 ? 179.865 180.393 234.067 1.00 0.00 ? 2212 ILE A CA 1 
ATOM 4861 C CA . ILE E  5  2213 ? 182.607 180.795 236.655 1.00 0.00 ? 2213 ILE A CA 1 
ATOM 4862 C CA . ILE E  5  2214 ? 183.471 184.416 237.497 1.00 0.00 ? 2214 ILE A CA 1 
ATOM 4863 C CA . THR E  5  2215 ? 186.928 184.676 239.046 1.00 0.00 ? 2215 THR A CA 1 
ATOM 4864 C CA . CYS E  5  2216 ? 187.502 187.792 241.093 1.00 0.00 ? 2216 CYS A CA 1 
ATOM 4865 C CA . SER E  5  2217 ? 191.216 188.247 241.892 1.00 0.00 ? 2217 SER A CA 1 
ATOM 4866 C CA . PHE E  5  2218 ? 192.811 190.639 244.362 1.00 0.00 ? 2218 PHE A CA 1 
ATOM 4867 C CA . THR E  5  2219 ? 195.292 192.803 242.552 1.00 0.00 ? 2219 THR A CA 1 
ATOM 4868 C CA . PRO E  5  2220 ? 197.349 195.376 244.369 1.00 0.00 ? 2220 PRO A CA 1 
ATOM 4869 C CA . GLY E  5  2221 ? 194.942 197.924 245.875 1.00 0.00 ? 2221 GLY A CA 1 
ATOM 4870 C CA . SER E  5  2222 ? 192.469 196.532 243.506 1.00 0.00 ? 2222 SER A CA 1 
ATOM 4871 C CA . CYS E  5  2223 ? 190.196 193.857 242.329 1.00 0.00 ? 2223 CYS A CA 1 
ATOM 4872 C CA . THR E  5  2224 ? 190.109 192.391 238.879 1.00 0.00 ? 2224 THR A CA 1 
ATOM 4873 C CA . LEU E  5  2225 ? 187.817 189.843 237.280 1.00 0.00 ? 2225 LEU A CA 1 
ATOM 4874 C CA . THR E  5  2226 ? 187.400 187.397 234.405 1.00 0.00 ? 2226 THR A CA 1 
ATOM 4875 C CA . ALA E  5  2227 ? 184.551 185.051 233.355 1.00 0.00 ? 2227 ALA A CA 1 
ATOM 4876 C CA . TYR E  5  2228 ? 184.892 181.455 232.148 1.00 0.00 ? 2228 TYR A CA 1 
ATOM 4877 C CA . LYS E  5  2229 ? 182.771 178.774 230.501 1.00 0.00 ? 2229 LYS A CA 1 
ATOM 4878 C CA . LEU E  5  2230 ? 183.669 175.108 230.377 1.00 0.00 ? 2230 LEU A CA 1 
ATOM 4879 C CA . THR E  5  2231 ? 184.146 173.630 226.915 1.00 0.00 ? 2231 THR A CA 1 
ATOM 4880 C CA . PRO E  5  2232 ? 182.798 170.100 226.444 1.00 0.00 ? 2232 PRO A CA 1 
ATOM 4881 C CA . SER E  5  2233 ? 186.408 168.810 226.500 1.00 0.00 ? 2233 SER A CA 1 
ATOM 4882 C CA . GLY E  5  2234 ? 186.729 170.515 229.822 1.00 0.00 ? 2234 GLY A CA 1 
ATOM 4883 C CA . TYR E  5  2235 ? 183.444 169.294 231.164 1.00 0.00 ? 2235 TYR A CA 1 
ATOM 4884 C CA . GLU E  5  2236 ? 184.394 165.684 230.455 1.00 0.00 ? 2236 GLU A CA 1 
ATOM 4885 C CA . TRP E  5  2237 ? 187.878 166.058 231.977 1.00 0.00 ? 2237 TRP A CA 1 
ATOM 4886 C CA . GLY E  5  2238 ? 186.387 167.641 235.062 1.00 0.00 ? 2238 GLY A CA 1 
ATOM 4887 C CA . ARG E  5  2239 ? 183.658 165.088 235.552 1.00 0.00 ? 2239 ARG A CA 1 
ATOM 4888 C CA . GLN E  5  2240 ? 186.453 162.504 235.404 1.00 0.00 ? 2240 GLN A CA 1 
ATOM 4889 C CA . ASN E  5  2241 ? 189.076 164.270 237.521 1.00 0.00 ? 2241 ASN A CA 1 
ATOM 4890 C CA . THR E  5  2242 ? 190.017 163.070 240.999 1.00 0.00 ? 2242 THR A CA 1 
ATOM 4891 C CA . ASP E  5  2243 ? 193.348 164.713 241.810 1.00 0.00 ? 2243 ASP A CA 1 
ATOM 4892 C CA . LYS E  5  2244 ? 192.857 168.241 243.204 1.00 0.00 ? 2244 LYS A CA 1 
ATOM 4893 C CA . GLY E  5  2245 ? 196.523 169.240 243.139 1.00 0.00 ? 2245 GLY A CA 1 
ATOM 4894 C CA . ASN E  5  2246 ? 197.607 172.338 241.229 1.00 0.00 ? 2246 ASN A CA 1 
ATOM 4895 C CA . ASN E  5  2247 ? 198.691 170.234 238.286 1.00 0.00 ? 2247 ASN A CA 1 
ATOM 4896 C CA . PRO E  5  2248 ? 196.378 167.282 237.599 1.00 0.00 ? 2248 PRO A CA 1 
ATOM 4897 C CA . LYS E  5  2249 ? 196.985 164.858 234.742 1.00 0.00 ? 2249 LYS A CA 1 
ATOM 4898 C CA . GLY E  5  2250 ? 195.378 165.722 231.423 1.00 0.00 ? 2250 GLY A CA 1 
ATOM 4899 C CA . TYR E  5  2251 ? 194.524 169.315 232.248 1.00 0.00 ? 2251 TYR A CA 1 
ATOM 4900 C CA . LEU E  5  2252 ? 194.450 171.630 229.247 1.00 0.00 ? 2252 LEU A CA 1 
ATOM 4901 C CA . PRO E  5  2253 ? 193.807 175.274 228.295 1.00 0.00 ? 2253 PRO A CA 1 
ATOM 4902 C CA . SER E  5  2254 ? 191.400 173.669 225.798 1.00 0.00 ? 2254 SER A CA 1 
ATOM 4903 C CA . HIS E  5  2255 ? 189.080 172.959 228.710 1.00 0.00 ? 2255 HIS A CA 1 
ATOM 4904 C CA . TYR E  5  2256 ? 187.757 176.436 229.328 1.00 0.00 ? 2256 TYR A CA 1 
ATOM 4905 C CA . GLU E  5  2257 ? 186.838 179.532 227.381 1.00 0.00 ? 2257 GLU A CA 1 
ATOM 4906 C CA . ARG E  5  2258 ? 186.695 183.205 228.396 1.00 0.00 ? 2258 ARG A CA 1 
ATOM 4907 C CA . VAL E  5  2259 ? 183.270 184.834 228.166 1.00 0.00 ? 2259 VAL A CA 1 
ATOM 4908 C CA . GLN E  5  2260 ? 181.961 188.383 227.921 1.00 0.00 ? 2260 GLN A CA 1 
ATOM 4909 C CA . MET E  5  2261 ? 180.928 190.122 231.124 1.00 0.00 ? 2261 MET A CA 1 
ATOM 4910 C CA . LEU E  5  2262 ? 180.124 193.758 232.033 1.00 0.00 ? 2262 LEU A CA 1 
ATOM 4911 C CA . LEU E  5  2263 ? 179.620 195.576 235.322 1.00 0.00 ? 2263 LEU A CA 1 
ATOM 4912 C CA . SER E  5  2264 ? 176.517 197.706 235.721 1.00 0.00 ? 2264 SER A CA 1 
ATOM 4913 C CA . ASP E  5  2265 ? 175.108 200.552 237.762 1.00 0.00 ? 2265 ASP A CA 1 
ATOM 4914 C CA . ARG E  5  2266 ? 171.756 200.309 235.936 1.00 0.00 ? 2266 ARG A CA 1 
ATOM 4915 C CA . PHE E  5  2267 ? 170.095 197.805 238.274 1.00 0.00 ? 2267 PHE A CA 1 
ATOM 4916 C CA . LEU E  5  2268 ? 170.653 196.383 241.779 1.00 0.00 ? 2268 LEU A CA 1 
ATOM 4917 C CA . GLY E  5  2269 ? 171.340 192.772 242.572 1.00 0.00 ? 2269 GLY A CA 1 
ATOM 4918 C CA . PHE E  5  2270 ? 170.327 191.176 245.867 1.00 0.00 ? 2270 PHE A CA 1 
ATOM 4919 C CA . PHE E  5  2271 ? 171.649 188.534 248.275 1.00 0.00 ? 2271 PHE A CA 1 
ATOM 4920 C CA . MET E  5  2272 ? 170.354 185.201 249.558 1.00 0.00 ? 2272 MET A CA 1 
ATOM 4921 C CA . VAL E  5  2273 ? 171.871 183.885 252.754 1.00 0.00 ? 2273 VAL A CA 1 
ATOM 4922 C CA . PRO E  5  2274 ? 171.671 180.785 254.983 1.00 0.00 ? 2274 PRO A CA 1 
ATOM 4923 C CA . ALA E  5  2275 ? 168.511 180.365 257.013 1.00 0.00 ? 2275 ALA A CA 1 
ATOM 4924 C CA . GLN E  5  2276 ? 169.596 179.371 260.514 1.00 0.00 ? 2276 GLN A CA 1 
ATOM 4925 C CA . SER E  5  2277 ? 173.298 180.295 260.455 1.00 0.00 ? 2277 SER A CA 1 
ATOM 4926 C CA . SER E  5  2278 ? 175.594 182.384 258.395 1.00 0.00 ? 2278 SER A CA 1 
ATOM 4927 C CA . TRP E  5  2279 ? 177.541 181.312 255.344 1.00 0.00 ? 2279 TRP A CA 1 
ATOM 4928 C CA . ASN E  5  2280 ? 181.140 181.318 256.525 1.00 0.00 ? 2280 ASN A CA 1 
ATOM 4929 C CA . TYR E  5  2281 ? 182.263 178.042 257.970 1.00 0.00 ? 2281 TYR A CA 1 
ATOM 4930 C CA . ASN E  5  2282 ? 185.995 178.638 257.665 1.00 0.00 ? 2282 ASN A CA 1 
ATOM 4931 C CA . PHE E  5  2283 ? 186.303 178.982 261.400 1.00 0.00 ? 2283 PHE A CA 1 
ATOM 4932 C CA . MET E  5  2284 ? 184.505 175.670 261.928 1.00 0.00 ? 2284 MET A CA 1 
ATOM 4933 C CA . GLY E  5  2285 ? 185.688 173.036 259.460 1.00 0.00 ? 2285 GLY A CA 1 
ATOM 4934 C CA . VAL E  5  2286 ? 184.320 170.101 261.390 1.00 0.00 ? 2286 VAL A CA 1 
ATOM 4935 C CA . ARG E  5  2287 ? 180.839 171.597 261.305 1.00 0.00 ? 2287 ARG A CA 1 
ATOM 4936 C CA . HIS E  5  2288 ? 180.808 171.544 257.521 1.00 0.00 ? 2288 HIS A CA 1 
ATOM 4937 C CA . ASP E  5  2289 ? 179.738 168.537 255.451 1.00 0.00 ? 2289 ASP A CA 1 
ATOM 4938 C CA . PRO E  5  2290 ? 179.190 167.865 251.730 1.00 0.00 ? 2290 PRO A CA 1 
ATOM 4939 C CA . ASN E  5  2291 ? 175.800 166.422 252.466 1.00 0.00 ? 2291 ASN A CA 1 
ATOM 4940 C CA . MET E  5  2292 ? 174.715 169.232 254.796 1.00 0.00 ? 2292 MET A CA 1 
ATOM 4941 C CA . LYS E  5  2293 ? 171.290 170.764 254.110 1.00 0.00 ? 2293 LYS A CA 1 
ATOM 4942 C CA . TYR E  5  2294 ? 170.296 174.419 254.430 1.00 0.00 ? 2294 TYR A CA 1 
ATOM 4943 C CA . GLU E  5  2295 ? 167.459 176.822 253.837 1.00 0.00 ? 2295 GLU A CA 1 
ATOM 4944 C CA . LEU E  5  2296 ? 167.668 180.443 252.729 1.00 0.00 ? 2296 LEU A CA 1 
ATOM 4945 C CA . GLN E  5  2297 ? 166.533 183.956 253.476 1.00 0.00 ? 2297 GLN A CA 1 
ATOM 4946 C CA . LEU E  5  2298 ? 166.539 187.419 252.006 1.00 0.00 ? 2298 LEU A CA 1 
ATOM 4947 C CA . ALA E  5  2299 ? 169.230 189.290 253.938 1.00 0.00 ? 2299 ALA A CA 1 
ATOM 4948 C CA . ASN E  5  2300 ? 172.817 190.383 253.427 1.00 0.00 ? 2300 ASN A CA 1 
ATOM 4949 C CA . PRO E  5  2301 ? 176.032 188.455 254.182 1.00 0.00 ? 2301 PRO A CA 1 
ATOM 4950 C CA . LYS E  5  2302 ? 178.032 189.279 257.342 1.00 0.00 ? 2302 LYS A CA 1 
ATOM 4951 C CA . GLU E  5  2303 ? 181.720 190.081 256.930 1.00 0.00 ? 2303 GLU A CA 1 
ATOM 4952 C CA . PHE E  5  2304 ? 184.323 187.293 257.041 1.00 0.00 ? 2304 PHE A CA 1 
ATOM 4953 C CA . TYR E  5  2305 ? 185.657 188.079 260.479 1.00 0.00 ? 2305 TYR A CA 1 
ATOM 4954 C CA . HIS E  5  2306 ? 182.236 188.962 261.854 1.00 0.00 ? 2306 HIS A CA 1 
ATOM 4955 C CA . GLU E  5  2307 ? 181.741 187.882 265.438 1.00 0.00 ? 2307 GLU A CA 1 
ATOM 4956 C CA . VAL E  5  2308 ? 179.247 185.202 264.484 1.00 0.00 ? 2308 VAL A CA 1 
ATOM 4957 C CA . HIS E  5  2309 ? 181.577 183.329 262.156 1.00 0.00 ? 2309 HIS A CA 1 
ATOM 4958 C CA . ARG E  5  2310 ? 184.000 183.056 265.036 1.00 0.00 ? 2310 ARG A CA 1 
ATOM 4959 C CA . PRO E  5  2311 ? 182.300 181.614 268.066 1.00 0.00 ? 2311 PRO A CA 1 
ATOM 4960 C CA . SER E  5  2312 ? 185.302 179.709 269.474 1.00 0.00 ? 2312 SER A CA 1 
ATOM 4961 C CA . HIS E  5  2313 ? 187.167 182.946 269.957 1.00 0.00 ? 2313 HIS A CA 1 
ATOM 4962 C CA . PHE E  5  2314 ? 184.469 184.855 271.794 1.00 0.00 ? 2314 PHE A CA 1 
ATOM 4963 C CA . TRP F  6  352  ? 208.793 167.506 149.345 1.00 0.00 ? 352  TRP F CA 1 
ATOM 4964 C CA . ASP F  6  353  ? 210.427 164.362 150.719 1.00 0.00 ? 353  ASP F CA 1 
ATOM 4965 C CA . ASP F  6  354  ? 211.244 165.424 154.257 1.00 0.00 ? 354  ASP F CA 1 
ATOM 4966 C CA . ARG F  6  355  ? 212.197 162.104 155.809 1.00 0.00 ? 355  ARG F CA 1 
ATOM 4967 C CA . HIS F  6  356  ? 215.218 161.925 158.041 1.00 0.00 ? 356  HIS F CA 1 
ATOM 4968 C CA . TRP F  6  357  ? 217.980 159.854 156.307 1.00 0.00 ? 357  TRP F CA 1 
ATOM 4969 C CA . SER F  6  358  ? 217.465 157.100 158.843 1.00 0.00 ? 358  SER F CA 1 
ATOM 4970 C CA . GLN F  6  359  ? 214.043 156.603 157.264 1.00 0.00 ? 359  GLN F CA 1 
ATOM 4971 C CA . LYS F  6  360  ? 215.532 155.990 153.834 1.00 0.00 ? 360  LYS F CA 1 
ATOM 4972 C CA . LYS F  6  361  ? 217.247 153.127 152.045 1.00 0.00 ? 361  LYS F CA 1 
ATOM 4973 C CA . LEU F  6  362  ? 220.952 153.578 151.226 1.00 0.00 ? 362  LEU F CA 1 
ATOM 4974 C CA . ASP F  6  363  ? 220.307 154.227 147.528 1.00 0.00 ? 363  ASP F CA 1 
ATOM 4975 C CA . GLU F  6  364  ? 217.944 157.039 148.467 1.00 0.00 ? 364  GLU F CA 1 
ATOM 4976 C CA . MET F  6  365  ? 220.581 158.987 150.365 1.00 0.00 ? 365  MET F CA 1 
ATOM 4977 C CA . THR F  6  366  ? 220.987 162.532 149.034 1.00 0.00 ? 366  THR F CA 1 
ATOM 4978 C CA . ASP F  6  367  ? 223.887 165.001 149.488 1.00 0.00 ? 367  ASP F CA 1 
ATOM 4979 C CA . ARG F  6  368  ? 221.822 166.750 152.168 1.00 0.00 ? 368  ARG F CA 1 
ATOM 4980 C CA . ASP F  6  369  ? 221.156 163.378 153.831 1.00 0.00 ? 369  ASP F CA 1 
ATOM 4981 C CA . TRP F  6  370  ? 224.916 162.738 154.034 1.00 0.00 ? 370  TRP F CA 1 
ATOM 4982 C CA . ARG F  6  371  ? 225.451 166.205 155.533 1.00 0.00 ? 371  ARG F CA 1 
ATOM 4983 C CA . ILE F  6  372  ? 222.735 165.581 158.192 1.00 0.00 ? 372  ILE F CA 1 
ATOM 4984 C CA . PHE F  6  373  ? 224.235 162.129 158.731 1.00 0.00 ? 373  PHE F CA 1 
ATOM 4985 C CA . ARG F  6  374  ? 227.702 163.520 159.418 1.00 0.00 ? 374  ARG F CA 1 
ATOM 4986 C CA . GLU F  6  375  ? 226.181 166.150 161.665 1.00 0.00 ? 375  GLU F CA 1 
ATOM 4987 C CA . ASP F  6  376  ? 224.298 163.435 163.603 1.00 0.00 ? 376  ASP F CA 1 
ATOM 4988 C CA . TYR F  6  377  ? 227.545 161.521 164.216 1.00 0.00 ? 377  TYR F CA 1 
ATOM 4989 C CA . SER F  6  378  ? 229.856 164.605 164.469 1.00 0.00 ? 378  SER F CA 1 
ATOM 4990 C CA . ILE F  6  379  ? 232.004 163.407 161.602 1.00 0.00 ? 379  ILE F CA 1 
ATOM 4991 C CA . THR F  6  380  ? 234.438 166.010 160.253 1.00 0.00 ? 380  THR F CA 1 
ATOM 4992 C CA . THR F  6  381  ? 236.803 165.174 157.388 1.00 0.00 ? 381  THR F CA 1 
ATOM 4993 C CA . LYS F  6  382  ? 239.698 166.533 155.338 1.00 0.00 ? 382  LYS F CA 1 
ATOM 4994 C CA . GLY F  6  383  ? 240.917 165.140 151.998 1.00 0.00 ? 383  GLY F CA 1 
ATOM 4995 C CA . GLY F  6  384  ? 239.380 164.708 148.549 1.00 0.00 ? 384  GLY F CA 1 
ATOM 4996 C CA . LYS F  6  385  ? 236.622 162.354 147.445 1.00 0.00 ? 385  LYS F CA 1 
ATOM 4997 C CA . ILE F  6  386  ? 235.906 160.879 150.859 1.00 0.00 ? 386  ILE F CA 1 
ATOM 4998 C CA . PRO F  6  387  ? 233.758 157.771 150.508 1.00 0.00 ? 387  PRO F CA 1 
ATOM 4999 C CA . ASN F  6  388  ? 230.262 157.804 152.141 1.00 0.00 ? 388  ASN F CA 1 
ATOM 5000 C CA . PRO F  6  389  ? 230.297 156.570 155.781 1.00 0.00 ? 389  PRO F CA 1 
ATOM 5001 C CA . ILE F  6  390  ? 228.675 153.294 156.815 1.00 0.00 ? 390  ILE F CA 1 
ATOM 5002 C CA . ARG F  6  391  ? 225.024 153.699 157.912 1.00 0.00 ? 391  ARG F CA 1 
ATOM 5003 C CA . SER F  6  392  ? 224.965 150.304 159.641 1.00 0.00 ? 392  SER F CA 1 
ATOM 5004 C CA . TRP F  6  393  ? 226.743 146.953 159.347 1.00 0.00 ? 393  TRP F CA 1 
ATOM 5005 C CA . LYS F  6  394  ? 223.973 145.546 157.195 1.00 0.00 ? 394  LYS F CA 1 
ATOM 5006 C CA . ASP F  6  395  ? 224.100 148.615 154.994 1.00 0.00 ? 395  ASP F CA 1 
ATOM 5007 C CA . SER F  6  396  ? 227.841 148.246 154.683 1.00 0.00 ? 396  SER F CA 1 
ATOM 5008 C CA . SER F  6  397  ? 229.457 146.365 151.828 1.00 0.00 ? 397  SER F CA 1 
ATOM 5009 C CA . LEU F  6  398  ? 231.493 144.232 154.206 1.00 0.00 ? 398  LEU F CA 1 
ATOM 5010 C CA . PRO F  6  399  ? 231.881 140.539 153.256 1.00 0.00 ? 399  PRO F CA 1 
ATOM 5011 C CA . PRO F  6  400  ? 229.403 138.079 154.839 1.00 0.00 ? 400  PRO F CA 1 
ATOM 5012 C CA . HIS F  6  401  ? 232.074 136.326 156.872 1.00 0.00 ? 401  HIS F CA 1 
ATOM 5013 C CA . ILE F  6  402  ? 233.347 139.637 158.249 1.00 0.00 ? 402  ILE F CA 1 
ATOM 5014 C CA . LEU F  6  403  ? 229.890 140.792 159.242 1.00 0.00 ? 403  LEU F CA 1 
ATOM 5015 C CA . GLU F  6  404  ? 229.355 137.427 160.915 1.00 0.00 ? 404  GLU F CA 1 
ATOM 5016 C CA . VAL F  6  405  ? 232.370 137.991 163.126 1.00 0.00 ? 405  VAL F CA 1 
ATOM 5017 C CA . ILE F  6  406  ? 231.314 141.575 163.832 1.00 0.00 ? 406  ILE F CA 1 
ATOM 5018 C CA . ASP F  6  407  ? 227.839 140.330 164.793 1.00 0.00 ? 407  ASP F CA 1 
ATOM 5019 C CA . LYS F  6  408  ? 229.259 137.523 166.958 1.00 0.00 ? 408  LYS F CA 1 
ATOM 5020 C CA . CYS F  6  409  ? 231.624 139.856 168.827 1.00 0.00 ? 409  CYS F CA 1 
ATOM 5021 C CA . GLY F  6  410  ? 228.546 141.916 169.700 1.00 0.00 ? 410  GLY F CA 1 
ATOM 5022 C CA . TYR F  6  411  ? 229.513 145.213 168.045 1.00 0.00 ? 411  TYR F CA 1 
ATOM 5023 C CA . LYS F  6  412  ? 225.883 146.106 167.253 1.00 0.00 ? 412  LYS F CA 1 
ATOM 5024 C CA . GLU F  6  413  ? 226.461 149.512 165.579 1.00 0.00 ? 413  GLU F CA 1 
ATOM 5025 C CA . PRO F  6  414  ? 229.533 151.171 164.056 1.00 0.00 ? 414  PRO F CA 1 
ATOM 5026 C CA . THR F  6  415  ? 230.932 153.985 166.269 1.00 0.00 ? 415  THR F CA 1 
ATOM 5027 C CA . PRO F  6  416  ? 231.503 157.345 164.534 1.00 0.00 ? 416  PRO F CA 1 
ATOM 5028 C CA . ILE F  6  417  ? 235.189 156.781 163.752 1.00 0.00 ? 417  ILE F CA 1 
ATOM 5029 C CA . GLN F  6  418  ? 234.361 153.304 162.454 1.00 0.00 ? 418  GLN F CA 1 
ATOM 5030 C CA . ARG F  6  419  ? 231.593 154.666 160.199 1.00 0.00 ? 419  ARG F CA 1 
ATOM 5031 C CA . GLN F  6  420  ? 233.936 156.947 158.301 1.00 0.00 ? 420  GLN F CA 1 
ATOM 5032 C CA . ALA F  6  421  ? 237.377 155.415 158.641 1.00 0.00 ? 421  ALA F CA 1 
ATOM 5033 C CA . ILE F  6  422  ? 236.399 151.899 157.511 1.00 0.00 ? 422  ILE F CA 1 
ATOM 5034 C CA . PRO F  6  423  ? 235.379 152.862 153.937 1.00 0.00 ? 423  PRO F CA 1 
ATOM 5035 C CA . ILE F  6  424  ? 238.578 154.979 153.557 1.00 0.00 ? 424  ILE F CA 1 
ATOM 5036 C CA . GLY F  6  425  ? 240.660 152.012 154.761 1.00 0.00 ? 425  GLY F CA 1 
ATOM 5037 C CA . LEU F  6  426  ? 238.887 149.818 152.208 1.00 0.00 ? 426  LEU F CA 1 
ATOM 5038 C CA . GLN F  6  427  ? 240.256 152.070 149.476 1.00 0.00 ? 427  GLN F CA 1 
ATOM 5039 C CA . ASN F  6  428  ? 243.818 151.468 150.815 1.00 0.00 ? 428  ASN F CA 1 
ATOM 5040 C CA . ARG F  6  429  ? 244.025 155.152 151.791 1.00 0.00 ? 429  ARG F CA 1 
ATOM 5041 C CA . ASP F  6  430  ? 246.045 156.525 154.682 1.00 0.00 ? 430  ASP F CA 1 
ATOM 5042 C CA . ILE F  6  431  ? 244.226 158.055 157.591 1.00 0.00 ? 431  ILE F CA 1 
ATOM 5043 C CA . ILE F  6  432  ? 244.750 160.372 160.420 1.00 0.00 ? 432  ILE F CA 1 
ATOM 5044 C CA . GLY F  6  433  ? 241.985 159.710 162.917 1.00 0.00 ? 433  GLY F CA 1 
ATOM 5045 C CA . VAL F  6  434  ? 241.409 162.259 165.623 1.00 0.00 ? 434  VAL F CA 1 
ATOM 5046 C CA . ALA F  6  435  ? 239.589 160.602 168.469 1.00 0.00 ? 435  ALA F CA 1 
ATOM 5047 C CA . GLU F  6  436  ? 240.364 159.308 171.924 1.00 0.00 ? 436  GLU F CA 1 
ATOM 5048 C CA . THR F  6  437  ? 240.690 155.783 173.233 1.00 0.00 ? 437  THR F CA 1 
ATOM 5049 C CA . GLY F  6  438  ? 237.247 154.353 173.978 1.00 0.00 ? 438  GLY F CA 1 
ATOM 5050 C CA . SER F  6  439  ? 235.825 155.577 170.680 1.00 0.00 ? 439  SER F CA 1 
ATOM 5051 C CA . GLY F  6  440  ? 236.294 152.293 168.804 1.00 0.00 ? 440  GLY F CA 1 
ATOM 5052 C CA . LYS F  6  441  ? 239.520 153.247 167.004 1.00 0.00 ? 441  LYS F CA 1 
ATOM 5053 C CA . THR F  6  442  ? 240.849 149.686 167.206 1.00 0.00 ? 442  THR F CA 1 
ATOM 5054 C CA . ALA F  6  443  ? 238.086 148.010 165.244 1.00 0.00 ? 443  ALA F CA 1 
ATOM 5055 C CA . ALA F  6  444  ? 238.151 150.965 162.845 1.00 0.00 ? 444  ALA F CA 1 
ATOM 5056 C CA . PHE F  6  445  ? 241.655 150.005 161.761 1.00 0.00 ? 445  PHE F CA 1 
ATOM 5057 C CA . LEU F  6  446  ? 241.290 146.232 162.272 1.00 0.00 ? 446  LEU F CA 1 
ATOM 5058 C CA . ILE F  6  447  ? 238.326 145.717 159.943 1.00 0.00 ? 447  ILE F CA 1 
ATOM 5059 C CA . PRO F  6  448  ? 239.869 146.796 156.602 1.00 0.00 ? 448  PRO F CA 1 
ATOM 5060 C CA . LEU F  6  449  ? 242.952 144.746 157.472 1.00 0.00 ? 449  LEU F CA 1 
ATOM 5061 C CA . LEU F  6  450  ? 240.803 141.651 158.123 1.00 0.00 ? 450  LEU F CA 1 
ATOM 5062 C CA . VAL F  6  451  ? 238.897 142.151 154.916 1.00 0.00 ? 451  VAL F CA 1 
ATOM 5063 C CA . TRP F  6  452  ? 242.228 142.369 153.068 1.00 0.00 ? 452  TRP F CA 1 
ATOM 5064 C CA . ILE F  6  453  ? 243.877 139.353 154.681 1.00 0.00 ? 453  ILE F CA 1 
ATOM 5065 C CA . THR F  6  454  ? 240.938 136.943 154.514 1.00 0.00 ? 454  THR F CA 1 
ATOM 5066 C CA . THR F  6  455  ? 240.155 137.735 150.909 1.00 0.00 ? 455  THR F CA 1 
ATOM 5067 C CA . LEU F  6  456  ? 243.599 136.966 149.568 1.00 0.00 ? 456  LEU F CA 1 
ATOM 5068 C CA . PRO F  6  457  ? 243.582 133.927 147.191 1.00 0.00 ? 457  PRO F CA 1 
ATOM 5069 C CA . LYS F  6  458  ? 244.789 130.797 148.967 1.00 0.00 ? 458  LYS F CA 1 
ATOM 5070 C CA . ILE F  6  459  ? 247.529 130.514 146.449 1.00 0.00 ? 459  ILE F CA 1 
ATOM 5071 C CA . ASP F  6  460  ? 248.557 134.029 147.560 1.00 0.00 ? 460  ASP F CA 1 
ATOM 5072 C CA . ARG F  6  461  ? 248.113 133.469 151.302 1.00 0.00 ? 461  ARG F CA 1 
ATOM 5073 C CA . ILE F  6  462  ? 250.659 130.746 150.758 1.00 0.00 ? 462  ILE F CA 1 
ATOM 5074 C CA . GLU F  6  463  ? 254.143 131.316 152.005 1.00 0.00 ? 463  GLU F CA 1 
ATOM 5075 C CA . GLU F  6  464  ? 256.521 128.497 152.994 1.00 0.00 ? 464  GLU F CA 1 
ATOM 5076 C CA . SER F  6  465  ? 259.050 130.645 154.854 1.00 0.00 ? 465  SER F CA 1 
ATOM 5077 C CA . ASP F  6  466  ? 258.007 132.873 157.774 1.00 0.00 ? 466  ASP F CA 1 
ATOM 5078 C CA . GLN F  6  467  ? 258.084 136.500 156.638 1.00 0.00 ? 467  GLN F CA 1 
ATOM 5079 C CA . GLY F  6  468  ? 256.837 138.377 159.685 1.00 0.00 ? 468  GLY F CA 1 
ATOM 5080 C CA . PRO F  6  469  ? 253.406 140.053 159.985 1.00 0.00 ? 469  PRO F CA 1 
ATOM 5081 C CA . TYR F  6  470  ? 251.071 141.599 157.443 1.00 0.00 ? 470  TYR F CA 1 
ATOM 5082 C CA . ALA F  6  471  ? 250.529 144.367 160.000 1.00 0.00 ? 471  ALA F CA 1 
ATOM 5083 C CA . ILE F  6  472  ? 252.119 146.163 162.893 1.00 0.00 ? 472  ILE F CA 1 
ATOM 5084 C CA . ILE F  6  473  ? 250.146 148.146 165.451 1.00 0.00 ? 473  ILE F CA 1 
ATOM 5085 C CA . LEU F  6  474  ? 252.311 150.418 167.547 1.00 0.00 ? 474  LEU F CA 1 
ATOM 5086 C CA . ALA F  6  475  ? 251.110 151.717 170.933 1.00 0.00 ? 475  ALA F CA 1 
ATOM 5087 C CA . PRO F  6  476  ? 252.926 154.012 173.376 1.00 0.00 ? 476  PRO F CA 1 
ATOM 5088 C CA . THR F  6  477  ? 252.244 151.947 176.473 1.00 0.00 ? 477  THR F CA 1 
ATOM 5089 C CA . ARG F  6  478  ? 252.137 148.361 177.607 1.00 0.00 ? 478  ARG F CA 1 
ATOM 5090 C CA . GLU F  6  479  ? 248.684 149.027 179.061 1.00 0.00 ? 479  GLU F CA 1 
ATOM 5091 C CA . LEU F  6  480  ? 247.265 150.257 175.757 1.00 0.00 ? 480  LEU F CA 1 
ATOM 5092 C CA . ALA F  6  481  ? 249.034 147.556 173.736 1.00 0.00 ? 481  ALA F CA 1 
ATOM 5093 C CA . GLN F  6  482  ? 247.365 144.847 175.855 1.00 0.00 ? 482  GLN F CA 1 
ATOM 5094 C CA . GLN F  6  483  ? 243.944 146.430 175.375 1.00 0.00 ? 483  GLN F CA 1 
ATOM 5095 C CA . ILE F  6  484  ? 244.539 146.367 171.635 1.00 0.00 ? 484  ILE F CA 1 
ATOM 5096 C CA . GLU F  6  485  ? 245.805 142.797 171.755 1.00 0.00 ? 485  GLU F CA 1 
ATOM 5097 C CA . GLU F  6  486  ? 242.769 141.473 173.613 1.00 0.00 ? 486  GLU F CA 1 
ATOM 5098 C CA . GLU F  6  487  ? 240.508 143.051 171.072 1.00 0.00 ? 487  GLU F CA 1 
ATOM 5099 C CA . THR F  6  488  ? 242.620 141.939 168.150 1.00 0.00 ? 488  THR F CA 1 
ATOM 5100 C CA . ILE F  6  489  ? 242.574 138.324 169.417 1.00 0.00 ? 489  ILE F CA 1 
ATOM 5101 C CA . LYS F  6  490  ? 238.795 138.326 169.797 1.00 0.00 ? 490  LYS F CA 1 
ATOM 5102 C CA . PHE F  6  491  ? 238.431 139.495 166.199 1.00 0.00 ? 491  PHE F CA 1 
ATOM 5103 C CA . GLY F  6  492  ? 241.291 137.488 164.701 1.00 0.00 ? 492  GLY F CA 1 
ATOM 5104 C CA . LYS F  6  493  ? 240.947 134.029 166.217 1.00 0.00 ? 493  LYS F CA 1 
ATOM 5105 C CA . PRO F  6  494  ? 237.544 133.251 164.687 1.00 0.00 ? 494  PRO F CA 1 
ATOM 5106 C CA . LEU F  6  495  ? 239.128 134.195 161.353 1.00 0.00 ? 495  LEU F CA 1 
ATOM 5107 C CA . GLY F  6  496  ? 242.249 132.098 161.877 1.00 0.00 ? 496  GLY F CA 1 
ATOM 5108 C CA . ILE F  6  497  ? 244.369 135.225 162.195 1.00 0.00 ? 497  ILE F CA 1 
ATOM 5109 C CA . ARG F  6  498  ? 247.329 135.082 164.607 1.00 0.00 ? 498  ARG F CA 1 
ATOM 5110 C CA . THR F  6  499  ? 248.393 137.990 166.795 1.00 0.00 ? 499  THR F CA 1 
ATOM 5111 C CA . VAL F  6  500  ? 251.598 138.377 168.793 1.00 0.00 ? 500  VAL F CA 1 
ATOM 5112 C CA . ALA F  6  501  ? 252.394 141.032 171.429 1.00 0.00 ? 501  ALA F CA 1 
ATOM 5113 C CA . VAL F  6  502  ? 255.934 142.462 171.540 1.00 0.00 ? 502  VAL F CA 1 
ATOM 5114 C CA . ILE F  6  503  ? 255.794 144.573 174.700 1.00 0.00 ? 503  ILE F CA 1 
ATOM 5115 C CA . GLY F  6  504  ? 257.441 145.106 178.105 1.00 0.00 ? 504  GLY F CA 1 
ATOM 5116 C CA . GLY F  6  505  ? 256.206 143.485 181.323 1.00 0.00 ? 505  GLY F CA 1 
ATOM 5117 C CA . ILE F  6  506  ? 256.413 140.042 179.772 1.00 0.00 ? 506  ILE F CA 1 
ATOM 5118 C CA . SER F  6  507  ? 259.150 137.388 179.952 1.00 0.00 ? 507  SER F CA 1 
ATOM 5119 C CA . ARG F  6  508  ? 261.621 137.298 177.036 1.00 0.00 ? 508  ARG F CA 1 
ATOM 5120 C CA . GLU F  6  509  ? 261.457 133.505 176.993 1.00 0.00 ? 509  GLU F CA 1 
ATOM 5121 C CA . ASP F  6  510  ? 257.685 133.587 176.448 1.00 0.00 ? 510  ASP F CA 1 
ATOM 5122 C CA . GLN F  6  511  ? 258.077 136.504 174.068 1.00 0.00 ? 511  GLN F CA 1 
ATOM 5123 C CA . GLY F  6  512  ? 261.070 134.991 172.276 1.00 0.00 ? 512  GLY F CA 1 
ATOM 5124 C CA . PHE F  6  513  ? 259.154 131.731 171.907 1.00 0.00 ? 513  PHE F CA 1 
ATOM 5125 C CA . ARG F  6  514  ? 255.900 133.185 170.557 1.00 0.00 ? 514  ARG F CA 1 
ATOM 5126 C CA . LEU F  6  515  ? 257.951 135.015 167.928 1.00 0.00 ? 515  LEU F CA 1 
ATOM 5127 C CA . ARG F  6  516  ? 259.298 131.798 166.456 1.00 0.00 ? 516  ARG F CA 1 
ATOM 5128 C CA . MET F  6  517  ? 255.805 130.572 165.546 1.00 0.00 ? 517  MET F CA 1 
ATOM 5129 C CA . GLY F  6  518  ? 254.929 133.105 162.833 1.00 0.00 ? 518  GLY F CA 1 
ATOM 5130 C CA . GLU F  6  520  ? 249.759 137.890 160.852 1.00 0.00 ? 520  GLU F CA 1 
ATOM 5131 C CA . ILE F  6  521  ? 249.635 140.832 163.264 1.00 0.00 ? 521  ILE F CA 1 
ATOM 5132 C CA . VAL F  6  522  ? 252.127 142.185 165.750 1.00 0.00 ? 522  VAL F CA 1 
ATOM 5133 C CA . ILE F  6  523  ? 251.095 144.624 168.439 1.00 0.00 ? 523  ILE F CA 1 
ATOM 5134 C CA . ALA F  6  524  ? 254.061 146.428 170.026 1.00 0.00 ? 524  ALA F CA 1 
ATOM 5135 C CA . THR F  6  525  ? 255.507 149.290 172.065 1.00 0.00 ? 525  THR F CA 1 
ATOM 5136 C CA . PRO F  6  526  ? 258.276 151.395 170.428 1.00 0.00 ? 526  PRO F CA 1 
ATOM 5137 C CA . GLY F  6  527  ? 261.154 150.578 172.781 1.00 0.00 ? 527  GLY F CA 1 
ATOM 5138 C CA . ARG F  6  528  ? 260.535 146.861 172.680 1.00 0.00 ? 528  ARG F CA 1 
ATOM 5139 C CA . LEU F  6  529  ? 259.968 146.778 168.937 1.00 0.00 ? 529  LEU F CA 1 
ATOM 5140 C CA . ILE F  6  530  ? 263.140 148.579 167.963 1.00 0.00 ? 530  ILE F CA 1 
ATOM 5141 C CA . ASP F  6  531  ? 265.268 146.259 170.114 1.00 0.00 ? 531  ASP F CA 1 
ATOM 5142 C CA . VAL F  6  532  ? 263.642 143.263 168.456 1.00 0.00 ? 532  VAL F CA 1 
ATOM 5143 C CA . LEU F  6  533  ? 264.214 144.658 164.973 1.00 0.00 ? 533  LEU F CA 1 
ATOM 5144 C CA . GLU F  6  534  ? 267.767 145.667 165.851 1.00 0.00 ? 534  GLU F CA 1 
ATOM 5145 C CA . ASN F  6  535  ? 268.479 142.043 166.790 1.00 0.00 ? 535  ASN F CA 1 
ATOM 5146 C CA . ARG F  6  536  ? 266.573 140.581 163.862 1.00 0.00 ? 536  ARG F CA 1 
ATOM 5147 C CA . TYR F  6  537  ? 264.223 138.591 166.119 1.00 0.00 ? 537  TYR F CA 1 
ATOM 5148 C CA . LEU F  6  538  ? 261.531 139.860 163.717 1.00 0.00 ? 538  LEU F CA 1 
ATOM 5149 C CA . VAL F  6  539  ? 261.354 141.374 160.211 1.00 0.00 ? 539  VAL F CA 1 
ATOM 5150 C CA . LEU F  6  540  ? 258.858 143.554 158.306 1.00 0.00 ? 540  LEU F CA 1 
ATOM 5151 C CA . SER F  6  541  ? 259.138 141.782 154.937 1.00 0.00 ? 541  SER F CA 1 
ATOM 5152 C CA . ARG F  6  542  ? 255.385 141.485 154.105 1.00 0.00 ? 542  ARG F CA 1 
ATOM 5153 C CA . CYS F  6  543  ? 254.036 144.303 156.248 1.00 0.00 ? 543  CYS F CA 1 
ATOM 5154 C CA . THR F  6  544  ? 251.436 146.201 154.268 1.00 0.00 ? 544  THR F CA 1 
ATOM 5155 C CA . TYR F  6  545  ? 249.698 147.880 157.207 1.00 0.00 ? 545  TYR F CA 1 
ATOM 5156 C CA . VAL F  6  546  ? 251.229 150.294 159.679 1.00 0.00 ? 546  VAL F CA 1 
ATOM 5157 C CA . VAL F  6  547  ? 249.331 151.693 162.690 1.00 0.00 ? 547  VAL F CA 1 
ATOM 5158 C CA . LEU F  6  548  ? 250.459 154.399 165.113 1.00 0.00 ? 548  LEU F CA 1 
ATOM 5159 C CA . ASP F  6  549  ? 247.954 154.599 167.977 1.00 0.00 ? 549  ASP F CA 1 
ATOM 5160 C CA . GLU F  6  550  ? 248.075 157.628 170.381 1.00 0.00 ? 550  GLU F CA 1 
ATOM 5161 C CA . ALA F  6  551  ? 250.927 159.170 168.416 1.00 0.00 ? 551  ALA F CA 1 
ATOM 5162 C CA . ASP F  6  552  ? 250.759 162.324 170.578 1.00 0.00 ? 552  ASP F CA 1 
ATOM 5163 C CA . ARG F  6  553  ? 251.402 160.244 173.697 1.00 0.00 ? 553  ARG F CA 1 
ATOM 5164 C CA . MET F  6  554  ? 254.317 158.534 171.916 1.00 0.00 ? 554  MET F CA 1 
ATOM 5165 C CA . ILE F  6  555  ? 255.731 161.999 171.255 1.00 0.00 ? 555  ILE F CA 1 
ATOM 5166 C CA . ASP F  6  556  ? 255.189 163.052 174.882 1.00 0.00 ? 556  ASP F CA 1 
ATOM 5167 C CA . MET F  6  557  ? 257.077 160.002 176.105 1.00 0.00 ? 557  MET F CA 1 
ATOM 5168 C CA . GLY F  6  558  ? 260.143 160.890 174.034 1.00 0.00 ? 558  GLY F CA 1 
ATOM 5169 C CA . PHE F  6  559  ? 259.536 158.144 171.453 1.00 0.00 ? 559  PHE F CA 1 
ATOM 5170 C CA . GLU F  6  560  ? 259.884 160.298 168.282 1.00 0.00 ? 560  GLU F CA 1 
ATOM 5171 C CA . PRO F  6  561  ? 263.414 159.073 167.454 1.00 0.00 ? 561  PRO F CA 1 
ATOM 5172 C CA . ASP F  6  562  ? 262.510 155.437 168.186 1.00 0.00 ? 562  ASP F CA 1 
ATOM 5173 C CA . VAL F  6  563  ? 259.427 155.648 166.037 1.00 0.00 ? 563  VAL F CA 1 
ATOM 5174 C CA . GLN F  6  564  ? 261.594 157.194 163.290 1.00 0.00 ? 564  GLN F CA 1 
ATOM 5175 C CA . LYS F  6  565  ? 264.116 154.409 163.539 1.00 0.00 ? 565  LYS F CA 1 
ATOM 5176 C CA . ILE F  6  566  ? 261.356 151.767 163.387 1.00 0.00 ? 566  ILE F CA 1 
ATOM 5177 C CA . LEU F  6  567  ? 260.076 153.280 160.112 1.00 0.00 ? 567  LEU F CA 1 
ATOM 5178 C CA . GLU F  6  568  ? 263.554 152.893 158.707 1.00 0.00 ? 568  GLU F CA 1 
ATOM 5179 C CA . HIS F  6  569  ? 263.121 149.066 158.799 1.00 0.00 ? 569  HIS F CA 1 
ATOM 5180 C CA . MET F  6  570  ? 260.001 149.042 156.594 1.00 0.00 ? 570  MET F CA 1 
ATOM 5181 C CA . PRO F  6  571  ? 260.686 148.129 152.931 1.00 0.00 ? 571  PRO F CA 1 
ATOM 5182 C CA . VAL F  6  572  ? 260.631 151.458 151.061 1.00 0.00 ? 572  VAL F CA 1 
ATOM 5183 C CA . SER F  6  573  ? 259.291 150.153 147.814 1.00 0.00 ? 573  SER F CA 1 
ATOM 5184 C CA . ASN F  6  574  ? 255.791 149.434 149.061 1.00 0.00 ? 574  ASN F CA 1 
ATOM 5185 C CA . GLN F  6  575  ? 255.057 153.089 150.005 1.00 0.00 ? 575  GLN F CA 1 
ATOM 5186 C CA . LYS F  6  576  ? 252.423 154.864 147.914 1.00 0.00 ? 576  LYS F CA 1 
ATOM 5187 C CA . PRO F  6  577  ? 253.539 157.556 145.449 1.00 0.00 ? 577  PRO F CA 1 
ATOM 5188 C CA . ASP F  6  578  ? 253.277 161.135 146.647 1.00 0.00 ? 578  ASP F CA 1 
ATOM 5189 C CA . THR F  6  579  ? 250.842 162.374 144.004 1.00 0.00 ? 579  THR F CA 1 
ATOM 5190 C CA . ASP F  6  580  ? 247.161 163.169 143.660 1.00 0.00 ? 580  ASP F CA 1 
ATOM 5191 C CA . GLU F  6  581  ? 246.738 159.483 142.780 1.00 0.00 ? 581  GLU F CA 1 
ATOM 5192 C CA . ALA F  6  582  ? 247.234 158.548 146.448 1.00 0.00 ? 582  ALA F CA 1 
ATOM 5193 C CA . GLU F  6  583  ? 243.742 159.877 147.150 1.00 0.00 ? 583  GLU F CA 1 
ATOM 5194 C CA . ASP F  6  584  ? 242.072 158.964 143.868 1.00 0.00 ? 584  ASP F CA 1 
ATOM 5195 C CA . PRO F  6  585  ? 239.316 156.515 144.948 1.00 0.00 ? 585  PRO F CA 1 
ATOM 5196 C CA . GLU F  6  586  ? 239.075 154.538 141.697 1.00 0.00 ? 586  GLU F CA 1 
ATOM 5197 C CA . LYS F  6  587  ? 242.817 153.939 141.611 1.00 0.00 ? 587  LYS F CA 1 
ATOM 5198 C CA . MET F  6  588  ? 243.293 153.343 145.306 1.00 0.00 ? 588  MET F CA 1 
ATOM 5199 C CA . LEU F  6  589  ? 240.310 150.922 145.415 1.00 0.00 ? 589  LEU F CA 1 
ATOM 5200 C CA . ALA F  6  590  ? 241.736 149.019 142.476 1.00 0.00 ? 590  ALA F CA 1 
ATOM 5201 C CA . ASN F  6  591  ? 245.012 148.923 144.390 1.00 0.00 ? 591  ASN F CA 1 
ATOM 5202 C CA . PHE F  6  592  ? 243.338 147.579 147.565 1.00 0.00 ? 592  PHE F CA 1 
ATOM 5203 C CA . GLU F  6  593  ? 241.752 144.774 145.536 1.00 0.00 ? 593  GLU F CA 1 
ATOM 5204 C CA . SER F  6  594  ? 245.120 144.004 143.939 1.00 0.00 ? 594  SER F CA 1 
ATOM 5205 C CA . GLY F  6  595  ? 245.552 141.726 146.904 1.00 0.00 ? 595  GLY F CA 1 
ATOM 5206 C CA . LYS F  6  596  ? 249.040 140.780 147.881 1.00 0.00 ? 596  LYS F CA 1 
ATOM 5207 C CA . HIS F  6  597  ? 250.768 143.502 145.859 1.00 0.00 ? 597  HIS F CA 1 
ATOM 5208 C CA . LYS F  6  598  ? 248.995 146.626 147.016 1.00 0.00 ? 598  LYS F CA 1 
ATOM 5209 C CA . TYR F  6  599  ? 250.744 149.696 148.413 1.00 0.00 ? 599  TYR F CA 1 
ATOM 5210 C CA . ARG F  6  600  ? 251.107 149.748 152.180 1.00 0.00 ? 600  ARG F CA 1 
ATOM 5211 C CA . GLN F  6  601  ? 248.623 151.819 154.088 1.00 0.00 ? 601  GLN F CA 1 
ATOM 5212 C CA . THR F  6  602  ? 249.283 153.672 157.278 1.00 0.00 ? 602  THR F CA 1 
ATOM 5213 C CA . VAL F  6  603  ? 246.912 154.867 159.978 1.00 0.00 ? 603  VAL F CA 1 
ATOM 5214 C CA . MET F  6  604  ? 247.746 157.355 162.707 1.00 0.00 ? 604  MET F CA 1 
ATOM 5215 C CA . PHE F  6  605  ? 245.439 157.941 165.645 1.00 0.00 ? 605  PHE F CA 1 
ATOM 5216 C CA . THR F  6  606  ? 245.977 160.932 167.906 1.00 0.00 ? 606  THR F CA 1 
ATOM 5217 C CA . ALA F  6  607  ? 244.068 163.407 170.042 1.00 0.00 ? 607  ALA F CA 1 
ATOM 5218 C CA . THR F  6  608  ? 246.266 166.371 169.128 1.00 0.00 ? 608  THR F CA 1 
ATOM 5219 C CA . MET F  6  609  ? 248.525 167.611 166.287 1.00 0.00 ? 609  MET F CA 1 
ATOM 5220 C CA . PRO F  6  610  ? 251.572 169.279 167.707 1.00 0.00 ? 610  PRO F CA 1 
ATOM 5221 C CA . PRO F  6  611  ? 254.478 169.792 165.325 1.00 0.00 ? 611  PRO F CA 1 
ATOM 5222 C CA . ALA F  6  612  ? 256.229 166.512 166.207 1.00 0.00 ? 612  ALA F CA 1 
ATOM 5223 C CA . VAL F  6  613  ? 253.087 164.596 165.335 1.00 0.00 ? 613  VAL F CA 1 
ATOM 5224 C CA . GLU F  6  614  ? 252.895 166.466 162.047 1.00 0.00 ? 614  GLU F CA 1 
ATOM 5225 C CA . ARG F  6  615  ? 256.529 165.437 161.407 1.00 0.00 ? 615  ARG F CA 1 
ATOM 5226 C CA . LEU F  6  616  ? 255.575 161.802 161.910 1.00 0.00 ? 616  LEU F CA 1 
ATOM 5227 C CA . ALA F  6  617  ? 252.676 162.223 159.544 1.00 0.00 ? 617  ALA F CA 1 
ATOM 5228 C CA . ARG F  6  618  ? 254.820 163.831 156.804 1.00 0.00 ? 618  ARG F CA 1 
ATOM 5229 C CA . SER F  6  619  ? 257.164 160.836 156.937 1.00 0.00 ? 619  SER F CA 1 
ATOM 5230 C CA . TYR F  6  620  ? 254.798 157.938 157.559 1.00 0.00 ? 620  TYR F CA 1 
ATOM 5231 C CA . LEU F  6  621  ? 251.785 158.985 155.490 1.00 0.00 ? 621  LEU F CA 1 
ATOM 5232 C CA . ARG F  6  622  ? 250.928 159.874 151.953 1.00 0.00 ? 622  ARG F CA 1 
ATOM 5233 C CA . ARG F  6  623  ? 248.008 162.246 151.273 1.00 0.00 ? 623  ARG F CA 1 
ATOM 5234 C CA . PRO F  6  624  ? 246.062 160.959 154.283 1.00 0.00 ? 624  PRO F CA 1 
ATOM 5235 C CA . ALA F  6  625  ? 242.382 161.682 154.837 1.00 0.00 ? 625  ALA F CA 1 
ATOM 5236 C CA . VAL F  6  626  ? 241.567 163.158 158.201 1.00 0.00 ? 626  VAL F CA 1 
ATOM 5237 C CA . VAL F  6  627  ? 238.643 161.842 160.247 1.00 0.00 ? 627  VAL F CA 1 
ATOM 5238 C CA . TYR F  6  628  ? 237.815 163.977 163.217 1.00 0.00 ? 628  TYR F CA 1 
ATOM 5239 C CA . ILE F  6  629  ? 235.048 163.031 165.649 1.00 0.00 ? 629  ILE F CA 1 
ATOM 5240 C CA . GLY F  6  630  ? 234.481 163.147 165.751 1.00 0.00 ? 630  GLY F CA 1 
ATOM 5241 C CA . GLU F  6  637  ? 235.571 162.472 181.542 1.00 0.00 ? 637  GLU F CA 1 
ATOM 5242 C CA . ARG F  6  638  ? 235.807 161.343 183.927 1.00 0.00 ? 638  ARG F CA 1 
ATOM 5243 C CA . VAL F  6  639  ? 234.124 163.449 185.192 1.00 0.00 ? 639  VAL F CA 1 
ATOM 5244 C CA . GLU F  6  640  ? 236.410 166.464 185.510 1.00 0.00 ? 640  GLU F CA 1 
ATOM 5245 C CA . GLN F  6  641  ? 236.537 167.468 189.189 1.00 0.00 ? 641  GLN F CA 1 
ATOM 5246 C CA . LYS F  6  642  ? 237.758 170.743 190.721 1.00 0.00 ? 642  LYS F CA 1 
ATOM 5247 C CA . VAL F  6  643  ? 237.855 171.766 194.391 1.00 0.00 ? 643  VAL F CA 1 
ATOM 5248 C CA . PHE F  6  644  ? 238.189 175.030 196.294 1.00 0.00 ? 644  PHE F CA 1 
ATOM 5249 C CA . LEU F  6  645  ? 239.054 175.006 199.967 1.00 0.00 ? 645  LEU F CA 1 
ATOM 5250 C CA . MET F  6  646  ? 237.474 177.892 201.795 1.00 0.00 ? 646  MET F CA 1 
ATOM 5251 C CA . SER F  6  647  ? 235.566 178.898 204.868 1.00 0.00 ? 647  SER F CA 1 
ATOM 5252 C CA . GLU F  6  648  ? 231.805 178.643 204.784 1.00 0.00 ? 648  GLU F CA 1 
ATOM 5253 C CA . SER F  6  649  ? 231.392 182.430 204.625 1.00 0.00 ? 649  SER F CA 1 
ATOM 5254 C CA . GLU F  6  650  ? 233.293 182.502 201.316 1.00 0.00 ? 650  GLU F CA 1 
ATOM 5255 C CA . LYS F  6  651  ? 230.942 180.209 199.397 1.00 0.00 ? 651  LYS F CA 1 
ATOM 5256 C CA . ARG F  6  652  ? 228.437 182.731 198.040 1.00 0.00 ? 652  ARG F CA 1 
ATOM 5257 C CA . LYS F  6  653  ? 230.960 185.098 196.523 1.00 0.00 ? 653  LYS F CA 1 
ATOM 5258 C CA . LYS F  6  654  ? 232.983 182.226 194.954 1.00 0.00 ? 654  LYS F CA 1 
ATOM 5259 C CA . LEU F  6  655  ? 229.787 180.859 193.392 1.00 0.00 ? 655  LEU F CA 1 
ATOM 5260 C CA . LEU F  6  656  ? 228.934 184.282 191.962 1.00 0.00 ? 656  LEU F CA 1 
ATOM 5261 C CA . ALA F  6  657  ? 232.435 184.693 190.551 1.00 0.00 ? 657  ALA F CA 1 
ATOM 5262 C CA . ILE F  6  658  ? 232.065 181.293 188.890 1.00 0.00 ? 658  ILE F CA 1 
ATOM 5263 C CA . LEU F  6  659  ? 228.609 182.082 187.497 1.00 0.00 ? 659  LEU F CA 1 
ATOM 5264 C CA . GLU F  6  660  ? 229.854 185.466 186.189 1.00 0.00 ? 660  GLU F CA 1 
ATOM 5265 C CA . GLN F  6  661  ? 232.389 183.589 184.074 1.00 0.00 ? 661  GLN F CA 1 
ATOM 5266 C CA . GLY F  6  662  ? 229.347 182.212 182.192 1.00 0.00 ? 662  GLY F CA 1 
ATOM 5267 C CA . PHE F  6  663  ? 228.071 178.652 181.784 1.00 0.00 ? 663  PHE F CA 1 
ATOM 5268 C CA . ASP F  6  664  ? 226.208 176.190 179.571 1.00 0.00 ? 664  ASP F CA 1 
ATOM 5269 C CA . PRO F  6  665  ? 222.678 175.887 181.007 1.00 0.00 ? 665  PRO F CA 1 
ATOM 5270 C CA . PRO F  6  666  ? 221.328 174.029 182.600 1.00 0.00 ? 666  PRO F CA 1 
ATOM 5271 C CA . ILE F  6  667  ? 223.617 173.482 185.567 1.00 0.00 ? 667  ILE F CA 1 
ATOM 5272 C CA . ILE F  6  668  ? 222.938 171.949 188.961 1.00 0.00 ? 668  ILE F CA 1 
ATOM 5273 C CA . ILE F  6  669  ? 224.025 173.282 192.353 1.00 0.00 ? 669  ILE F CA 1 
ATOM 5274 C CA . PHE F  6  670  ? 223.760 170.866 195.258 1.00 0.00 ? 670  PHE F CA 1 
ATOM 5275 C CA . VAL F  6  671  ? 223.270 171.792 198.917 1.00 0.00 ? 671  VAL F CA 1 
ATOM 5276 C CA . ASN F  6  672  ? 222.907 169.651 202.026 1.00 0.00 ? 672  ASN F CA 1 
ATOM 5277 C CA . GLN F  6  673  ? 219.685 170.968 203.608 1.00 0.00 ? 673  GLN F CA 1 
ATOM 5278 C CA . LYS F  6  674  ? 216.385 172.007 202.000 1.00 0.00 ? 674  LYS F CA 1 
ATOM 5279 C CA . LYS F  6  675  ? 216.415 175.426 203.649 1.00 0.00 ? 675  LYS F CA 1 
ATOM 5280 C CA . GLY F  6  676  ? 219.764 176.049 202.010 1.00 0.00 ? 676  GLY F CA 1 
ATOM 5281 C CA . CYS F  6  677  ? 218.139 175.078 198.719 1.00 0.00 ? 677  CYS F CA 1 
ATOM 5282 C CA . ASP F  6  678  ? 215.452 177.754 199.093 1.00 0.00 ? 678  ASP F CA 1 
ATOM 5283 C CA . VAL F  6  679  ? 217.638 180.631 200.353 1.00 0.00 ? 679  VAL F CA 1 
ATOM 5284 C CA . LEU F  6  680  ? 220.506 180.107 197.905 1.00 0.00 ? 680  LEU F CA 1 
ATOM 5285 C CA . ALA F  6  681  ? 217.919 179.999 195.110 1.00 0.00 ? 681  ALA F CA 1 
ATOM 5286 C CA . LYS F  6  682  ? 216.439 183.327 196.194 1.00 0.00 ? 682  LYS F CA 1 
ATOM 5287 C CA . SER F  6  683  ? 219.812 185.091 196.161 1.00 0.00 ? 683  SER F CA 1 
ATOM 5288 C CA . LEU F  6  684  ? 220.490 183.938 192.605 1.00 0.00 ? 684  LEU F CA 1 
ATOM 5289 C CA . GLU F  6  685  ? 217.129 185.195 191.350 1.00 0.00 ? 685  GLU F CA 1 
ATOM 5290 C CA . LYS F  6  686  ? 218.159 188.427 193.084 1.00 0.00 ? 686  LYS F CA 1 
ATOM 5291 C CA . MET F  6  687  ? 221.385 188.478 191.052 1.00 0.00 ? 687  MET F CA 1 
ATOM 5292 C CA . GLY F  6  688  ? 219.211 188.107 187.962 1.00 0.00 ? 688  GLY F CA 1 
ATOM 5293 C CA . TYR F  6  689  ? 219.469 184.351 187.474 1.00 0.00 ? 689  TYR F CA 1 
ATOM 5294 C CA . ASN F  6  690  ? 216.697 181.936 186.433 1.00 0.00 ? 690  ASN F CA 1 
ATOM 5295 C CA . ALA F  6  691  ? 216.652 179.410 189.262 1.00 0.00 ? 691  ALA F CA 1 
ATOM 5296 C CA . CYS F  6  692  ? 214.488 176.354 189.969 1.00 0.00 ? 692  CYS F CA 1 
ATOM 5297 C CA . THR F  6  693  ? 214.267 174.712 193.379 1.00 0.00 ? 693  THR F CA 1 
ATOM 5298 C CA . LEU F  6  694  ? 214.135 171.014 194.322 1.00 0.00 ? 694  LEU F CA 1 
ATOM 5299 C CA . ARG F  6  703  ? 208.523 168.532 189.758 1.00 0.00 ? 703  ARG F CA 1 
ATOM 5300 C CA . GLU F  6  704  ? 208.294 167.562 186.094 1.00 0.00 ? 704  GLU F CA 1 
ATOM 5301 C CA . PHE F  6  705  ? 207.539 171.251 185.589 1.00 0.00 ? 705  PHE F CA 1 
ATOM 5302 C CA . ALA F  6  706  ? 211.024 172.258 186.718 1.00 0.00 ? 706  ALA F CA 1 
ATOM 5303 C CA . LEU F  6  707  ? 212.858 169.971 184.293 1.00 0.00 ? 707  LEU F CA 1 
ATOM 5304 C CA . SER F  6  708  ? 210.799 171.029 181.283 1.00 0.00 ? 708  SER F CA 1 
ATOM 5305 C CA . ASN F  6  709  ? 211.789 174.673 181.702 1.00 0.00 ? 709  ASN F CA 1 
ATOM 5306 C CA . LEU F  6  710  ? 215.414 173.683 182.230 1.00 0.00 ? 710  LEU F CA 1 
ATOM 5307 C CA . LYS F  6  711  ? 215.203 171.385 179.222 1.00 0.00 ? 711  LYS F CA 1 
ATOM 5308 C CA . ALA F  6  712  ? 213.492 174.208 177.322 1.00 0.00 ? 712  ALA F CA 1 
ATOM 5309 C CA . GLY F  6  713  ? 216.105 176.784 178.314 1.00 0.00 ? 713  GLY F CA 1 
ATOM 5310 C CA . ALA F  6  714  ? 213.716 178.806 180.464 1.00 0.00 ? 714  ALA F CA 1 
ATOM 5311 C CA . LYS F  6  715  ? 215.479 178.144 183.766 1.00 0.00 ? 715  LYS F CA 1 
ATOM 5312 C CA . ASP F  6  716  ? 219.271 177.884 183.726 1.00 0.00 ? 716  ASP F CA 1 
ATOM 5313 C CA . ILE F  6  717  ? 220.092 176.838 187.283 1.00 0.00 ? 717  ILE F CA 1 
ATOM 5314 C CA . LEU F  6  718  ? 218.666 173.997 189.342 1.00 0.00 ? 718  LEU F CA 1 
ATOM 5315 C CA . VAL F  6  719  ? 219.300 174.185 193.090 1.00 0.00 ? 719  VAL F CA 1 
ATOM 5316 C CA . ALA F  6  720  ? 218.818 170.856 194.879 1.00 0.00 ? 720  ALA F CA 1 
ATOM 5317 C CA . THR F  6  721  ? 219.558 168.514 197.823 1.00 0.00 ? 721  THR F CA 1 
ATOM 5318 C CA . ASP F  6  722  ? 220.694 164.869 197.623 1.00 0.00 ? 722  ASP F CA 1 
ATOM 5319 C CA . VAL F  6  723  ? 217.041 163.740 197.284 1.00 0.00 ? 723  VAL F CA 1 
ATOM 5320 C CA . ILE F  6  728  ? 214.413 161.953 189.666 1.00 0.00 ? 728  ILE F CA 1 
ATOM 5321 C CA . ASP F  6  729  ? 215.414 161.921 185.962 1.00 0.00 ? 729  ASP F CA 1 
ATOM 5322 C CA . ILE F  6  730  ? 217.279 164.789 184.284 1.00 0.00 ? 730  ILE F CA 1 
ATOM 5323 C CA . GLN F  6  731  ? 219.330 165.641 181.181 1.00 0.00 ? 731  GLN F CA 1 
ATOM 5324 C CA . ASP F  6  732  ? 223.143 165.620 181.048 1.00 0.00 ? 732  ASP F CA 1 
ATOM 5325 C CA . VAL F  6  733  ? 224.588 168.852 182.471 1.00 0.00 ? 733  VAL F CA 1 
ATOM 5326 C CA . SER F  6  734  ? 227.754 170.727 181.598 1.00 0.00 ? 734  SER F CA 1 
ATOM 5327 C CA . MET F  6  735  ? 228.422 171.586 185.258 1.00 0.00 ? 735  MET F CA 1 
ATOM 5328 C CA . VAL F  6  736  ? 227.569 170.399 188.745 1.00 0.00 ? 736  VAL F CA 1 
ATOM 5329 C CA . VAL F  6  737  ? 228.509 172.595 191.723 1.00 0.00 ? 737  VAL F CA 1 
ATOM 5330 C CA . ASN F  6  738  ? 228.714 171.064 195.171 1.00 0.00 ? 738  ASN F CA 1 
ATOM 5331 C CA . TYR F  6  739  ? 228.057 174.314 197.068 1.00 0.00 ? 739  TYR F CA 1 
ATOM 5332 C CA . ASP F  6  740  ? 227.951 172.074 200.128 1.00 0.00 ? 740  ASP F CA 1 
ATOM 5333 C CA . MET F  6  741  ? 230.139 168.982 199.965 1.00 0.00 ? 741  MET F CA 1 
ATOM 5334 C CA . ALA F  6  742  ? 228.236 165.672 200.375 1.00 0.00 ? 742  ALA F CA 1 
ATOM 5335 C CA . LYS F  6  743  ? 228.510 163.866 203.724 1.00 0.00 ? 743  LYS F CA 1 
ATOM 5336 C CA . ASN F  6  744  ? 229.662 160.599 202.120 1.00 0.00 ? 744  ASN F CA 1 
ATOM 5337 C CA . ILE F  6  745  ? 231.454 159.802 198.876 1.00 0.00 ? 745  ILE F CA 1 
ATOM 5338 C CA . GLU F  6  746  ? 228.617 157.705 197.451 1.00 0.00 ? 746  GLU F CA 1 
ATOM 5339 C CA . ASP F  6  747  ? 226.268 160.750 197.379 1.00 0.00 ? 747  ASP F CA 1 
ATOM 5340 C CA . TYR F  6  748  ? 229.106 162.855 195.903 1.00 0.00 ? 748  TYR F CA 1 
ATOM 5341 C CA . ILE F  6  749  ? 229.589 160.208 193.132 1.00 0.00 ? 749  ILE F CA 1 
ATOM 5342 C CA . HIS F  6  750  ? 225.878 160.230 192.317 1.00 0.00 ? 750  HIS F CA 1 
ATOM 5343 C CA . ARG F  6  751  ? 225.908 164.043 192.105 1.00 0.00 ? 751  ARG F CA 1 
ATOM 5344 C CA . ILE F  6  752  ? 228.778 164.479 189.733 1.00 0.00 ? 752  ILE F CA 1 
ATOM 5345 C CA . GLY F  6  753  ? 227.307 161.594 187.674 1.00 0.00 ? 753  GLY F CA 1 
ATOM 5346 C CA . ARG F  6  754  ? 224.742 164.143 186.523 1.00 0.00 ? 754  ARG F CA 1 
ATOM 5347 C CA . THR F  6  755  ? 227.165 165.531 183.937 1.00 0.00 ? 755  THR F CA 1 
ATOM 5348 C CA . GLY F  6  756  ? 226.107 162.369 182.011 1.00 0.00 ? 756  GLY F CA 1 
ATOM 5349 C CA . ARG F  6  757  ? 226.997 158.706 181.570 1.00 0.00 ? 757  ARG F CA 1 
ATOM 5350 C CA . ALA F  6  758  ? 229.239 159.592 178.576 1.00 0.00 ? 758  ALA F CA 1 
ATOM 5351 C CA . GLY F  6  759  ? 229.931 162.287 175.965 1.00 0.00 ? 759  GLY F CA 1 
ATOM 5352 C CA . LYS F  6  760  ? 231.251 165.651 177.206 1.00 0.00 ? 760  LYS F CA 1 
ATOM 5353 C CA . SER F  6  761  ? 233.066 165.044 180.484 1.00 0.00 ? 761  SER F CA 1 
ATOM 5354 C CA . GLY F  6  762  ? 231.474 168.115 182.076 1.00 0.00 ? 762  GLY F CA 1 
ATOM 5355 C CA . VAL F  6  763  ? 232.780 169.658 185.306 1.00 0.00 ? 763  VAL F CA 1 
ATOM 5356 C CA . ALA F  6  764  ? 232.039 169.173 188.984 1.00 0.00 ? 764  ALA F CA 1 
ATOM 5357 C CA . ILE F  6  765  ? 233.202 171.997 191.249 1.00 0.00 ? 765  ILE F CA 1 
ATOM 5358 C CA . THR F  6  766  ? 233.250 171.363 194.985 1.00 0.00 ? 766  THR F CA 1 
ATOM 5359 C CA . PHE F  6  767  ? 233.486 173.883 197.841 1.00 0.00 ? 767  PHE F CA 1 
ATOM 5360 C CA . LEU F  6  768  ? 235.332 172.221 200.718 1.00 0.00 ? 768  LEU F CA 1 
ATOM 5361 C CA . THR F  6  769  ? 235.417 173.569 204.286 1.00 0.00 ? 769  THR F CA 1 
ATOM 5362 C CA . LYS F  6  770  ? 236.837 172.259 207.543 1.00 0.00 ? 770  LYS F CA 1 
ATOM 5363 C CA . GLU F  6  771  ? 233.424 170.818 208.355 1.00 0.00 ? 771  GLU F CA 1 
ATOM 5364 C CA . ASP F  6  772  ? 233.987 168.311 205.494 1.00 0.00 ? 772  ASP F CA 1 
ATOM 5365 C CA . SER F  6  773  ? 237.188 166.779 206.830 1.00 0.00 ? 773  SER F CA 1 
ATOM 5366 C CA . ALA F  6  774  ? 235.686 163.309 207.196 1.00 0.00 ? 774  ALA F CA 1 
ATOM 5367 C CA . VAL F  6  775  ? 235.247 163.016 203.414 1.00 0.00 ? 775  VAL F CA 1 
ATOM 5368 C CA . PHE F  6  776  ? 238.674 164.428 202.456 1.00 0.00 ? 776  PHE F CA 1 
ATOM 5369 C CA . TYR F  6  777  ? 240.441 161.070 202.179 1.00 0.00 ? 777  TYR F CA 1 
ATOM 5370 C CA . GLU F  6  778  ? 237.808 159.531 199.916 1.00 0.00 ? 778  GLU F CA 1 
ATOM 5371 C CA . LEU F  6  779  ? 237.401 162.767 197.950 1.00 0.00 ? 779  LEU F CA 1 
ATOM 5372 C CA . LYS F  6  780  ? 241.158 162.754 197.412 1.00 0.00 ? 780  LYS F CA 1 
ATOM 5373 C CA . GLN F  6  781  ? 240.943 159.187 196.123 1.00 0.00 ? 781  GLN F CA 1 
ATOM 5374 C CA . ALA F  6  782  ? 238.029 160.008 193.821 1.00 0.00 ? 782  ALA F CA 1 
ATOM 5375 C CA . ILE F  6  783  ? 240.117 162.694 192.127 1.00 0.00 ? 783  ILE F CA 1 
ATOM 5376 C CA . LEU F  6  784  ? 243.466 160.910 192.094 1.00 0.00 ? 784  LEU F CA 1 
ATOM 5377 C CA . GLU F  6  785  ? 241.596 158.103 190.220 1.00 0.00 ? 785  GLU F CA 1 
ATOM 5378 C CA . SER F  6  786  ? 240.286 160.577 187.647 1.00 0.00 ? 786  SER F CA 1 
ATOM 5379 C CA . PRO F  6  787  ? 242.568 160.852 184.593 1.00 0.00 ? 787  PRO F CA 1 
ATOM 5380 C CA . VAL F  6  788  ? 240.338 163.637 183.290 1.00 0.00 ? 788  VAL F CA 1 
ATOM 5381 C CA . SER F  6  789  ? 241.052 165.632 186.477 1.00 0.00 ? 789  SER F CA 1 
ATOM 5382 C CA . SER F  6  790  ? 244.163 167.545 187.566 1.00 0.00 ? 790  SER F CA 1 
ATOM 5383 C CA . PRO F  6  792  ? 244.748 169.083 193.468 1.00 0.00 ? 792  PRO F CA 1 
ATOM 5384 C CA . PRO F  6  793  ? 247.705 169.452 195.895 1.00 0.00 ? 793  PRO F CA 1 
ATOM 5385 C CA . GLU F  6  794  ? 245.541 171.582 198.232 1.00 0.00 ? 794  GLU F CA 1 
ATOM 5386 C CA . LEU F  6  795  ? 243.504 168.466 199.025 1.00 0.00 ? 795  LEU F CA 1 
ATOM 5387 C CA . ALA F  6  796  ? 246.035 165.774 198.159 1.00 0.00 ? 796  ALA F CA 1 
ATOM 5388 C CA . ASN F  6  797  ? 248.541 167.246 200.599 1.00 0.00 ? 797  ASN F CA 1 
ATOM 5389 C CA . HIS F  6  798  ? 246.045 168.262 203.255 1.00 0.00 ? 798  HIS F CA 1 
ATOM 5390 C CA . PRO F  6  799  ? 246.642 166.840 206.787 1.00 0.00 ? 799  PRO F CA 1 
ATOM 5391 C CA . ASP F  6  800  ? 243.042 165.549 206.939 1.00 0.00 ? 800  ASP F CA 1 
ATOM 5392 C CA . ALA F  6  801  ? 243.198 163.689 203.610 1.00 0.00 ? 801  ALA F CA 1 
ATOM 5393 C CA . GLN F  6  802  ? 245.992 161.371 204.676 1.00 0.00 ? 802  GLN F CA 1 
ATOM 5394 C CA . HIS F  6  803  ? 244.121 158.612 206.553 1.00 0.00 ? 803  HIS F CA 1 
ATOM 5395 C CA . LYS F  6  804  ? 240.729 156.908 206.286 1.00 0.00 ? 804  LYS F CA 1 
ATOM 5396 C CA . PRO F  6  805  ? 238.194 158.582 208.610 1.00 0.00 ? 805  PRO F CA 1 
ATOM 5397 C CA . GLY F  6  806  ? 237.502 156.962 211.968 1.00 0.00 ? 806  GLY F CA 1 
ATOM 5398 C CA . TYR G  7  114  ? 177.094 224.823 139.938 1.00 0.00 ? 114  TYR B CA 1 
ATOM 5399 C CA . GLU G  7  115  ? 177.051 228.536 140.800 1.00 0.00 ? 115  GLU B CA 1 
ATOM 5400 C CA . MET G  7  116  ? 176.005 229.512 144.343 1.00 0.00 ? 116  MET B CA 1 
ATOM 5401 C CA . ASP G  7  117  ? 173.132 231.788 143.232 1.00 0.00 ? 117  ASP B CA 1 
ATOM 5402 C CA . PHE G  7  118  ? 171.503 228.841 141.417 1.00 0.00 ? 118  PHE B CA 1 
ATOM 5403 C CA . LEU G  7  119  ? 171.641 226.924 144.723 1.00 0.00 ? 119  LEU B CA 1 
ATOM 5404 C CA . ALA G  7  120  ? 169.714 229.789 146.373 1.00 0.00 ? 120  ALA B CA 1 
ATOM 5405 C CA . ASP G  7  121  ? 167.421 229.875 143.314 1.00 0.00 ? 121  ASP B CA 1 
ATOM 5406 C CA . LEU G  7  122  ? 166.325 226.287 143.928 1.00 0.00 ? 122  LEU B CA 1 
ATOM 5407 C CA . MET G  7  123  ? 166.263 226.695 147.749 1.00 0.00 ? 123  MET B CA 1 
ATOM 5408 C CA . ASP G  7  124  ? 164.037 229.791 147.458 1.00 0.00 ? 124  ASP B CA 1 
ATOM 5409 C CA . ASN G  7  125  ? 162.144 229.388 144.170 1.00 0.00 ? 125  ASN B CA 1 
ATOM 5410 C CA . SER G  7  126  ? 160.696 225.895 143.805 1.00 0.00 ? 126  SER B CA 1 
ATOM 5411 C CA . GLU G  7  127  ? 159.892 222.395 145.141 1.00 0.00 ? 127  GLU B CA 1 
ATOM 5412 C CA . LEU G  7  128  ? 163.113 220.994 143.609 1.00 0.00 ? 128  LEU B CA 1 
ATOM 5413 C CA . ILE G  7  129  ? 164.480 220.863 147.160 1.00 0.00 ? 129  ILE B CA 1 
ATOM 5414 C CA . ARG G  7  130  ? 164.223 217.657 149.162 1.00 0.00 ? 130  ARG B CA 1 
ATOM 5415 C CA . ASN G  7  131  ? 165.776 216.576 152.448 1.00 0.00 ? 131  ASN B CA 1 
ATOM 5416 C CA . VAL G  7  132  ? 166.398 213.429 154.319 1.00 0.00 ? 132  VAL B CA 1 
ATOM 5417 C CA . THR G  7  133  ? 168.434 211.588 156.889 1.00 0.00 ? 133  THR B CA 1 
ATOM 5418 C CA . LEU G  7  134  ? 171.062 209.070 155.864 1.00 0.00 ? 134  LEU B CA 1 
ATOM 5419 C CA . CYS G  7  135  ? 171.125 206.246 158.428 1.00 0.00 ? 135  CYS B CA 1 
ATOM 5420 C CA . GLY G  7  136  ? 172.107 202.634 159.131 1.00 0.00 ? 136  GLY B CA 1 
ATOM 5421 C CA . HIS G  7  137  ? 174.469 200.617 161.317 1.00 0.00 ? 137  HIS B CA 1 
ATOM 5422 C CA . LEU G  7  138  ? 178.183 201.310 161.993 1.00 0.00 ? 138  LEU B CA 1 
ATOM 5423 C CA . HIS G  7  139  ? 180.562 201.596 159.028 1.00 0.00 ? 139  HIS B CA 1 
ATOM 5424 C CA . HIS G  7  140  ? 177.821 200.757 156.472 1.00 0.00 ? 140  HIS B CA 1 
ATOM 5425 C CA . GLY G  7  141  ? 179.014 203.534 154.153 1.00 0.00 ? 141  GLY B CA 1 
ATOM 5426 C CA . LYS G  7  142  ? 176.822 206.495 155.109 1.00 0.00 ? 142  LYS B CA 1 
ATOM 5427 C CA . THR G  7  143  ? 179.423 209.272 155.301 1.00 0.00 ? 143  THR B CA 1 
ATOM 5428 C CA . CYS G  7  144  ? 181.170 207.702 152.280 1.00 0.00 ? 144  CYS B CA 1 
ATOM 5429 C CA . PHE G  7  145  ? 177.992 207.953 150.229 1.00 0.00 ? 145  PHE B CA 1 
ATOM 5430 C CA . VAL G  7  146  ? 177.761 211.749 150.546 1.00 0.00 ? 146  VAL B CA 1 
ATOM 5431 C CA . ASP G  7  147  ? 181.506 211.860 149.787 1.00 0.00 ? 147  ASP B CA 1 
ATOM 5432 C CA . CYS G  7  148  ? 180.636 210.254 146.554 1.00 0.00 ? 148  CYS B CA 1 
ATOM 5433 C CA . LEU G  7  149  ? 178.334 213.132 145.646 1.00 0.00 ? 149  LEU B CA 1 
ATOM 5434 C CA . ILE G  7  150  ? 180.806 215.787 146.829 1.00 0.00 ? 150  ILE B CA 1 
ATOM 5435 C CA . GLU G  7  151  ? 183.602 214.401 144.576 1.00 0.00 ? 151  GLU B CA 1 
ATOM 5436 C CA . GLN G  7  152  ? 181.434 214.897 141.484 1.00 0.00 ? 152  GLN B CA 1 
ATOM 5437 C CA . THR G  7  153  ? 180.476 218.478 142.432 1.00 0.00 ? 153  THR B CA 1 
ATOM 5438 C CA . HIS G  7  154  ? 183.650 219.841 144.121 1.00 0.00 ? 154  HIS B CA 1 
ATOM 5439 C CA . PRO G  7  155  ? 186.470 219.384 141.542 1.00 0.00 ? 155  PRO B CA 1 
ATOM 5440 C CA . GLU G  7  156  ? 189.356 220.290 143.894 1.00 0.00 ? 156  GLU B CA 1 
ATOM 5441 C CA . ILE G  7  157  ? 188.697 217.768 146.695 1.00 0.00 ? 157  ILE B CA 1 
ATOM 5442 C CA . ARG G  7  158  ? 191.003 214.735 146.688 1.00 0.00 ? 158  ARG B CA 1 
ATOM 5443 C CA . LYS G  7  159  ? 191.020 211.613 148.862 1.00 0.00 ? 159  LYS B CA 1 
ATOM 5444 C CA . ARG G  7  160  ? 193.560 211.460 151.683 1.00 0.00 ? 160  ARG B CA 1 
ATOM 5445 C CA . TYR G  7  161  ? 195.708 208.412 150.921 1.00 0.00 ? 161  TYR B CA 1 
ATOM 5446 C CA . ASP G  7  162  ? 195.859 206.730 154.337 1.00 0.00 ? 162  ASP B CA 1 
ATOM 5447 C CA . GLN G  7  163  ? 192.211 206.942 155.336 1.00 0.00 ? 163  GLN B CA 1 
ATOM 5448 C CA . ASP G  7  164  ? 189.131 207.102 153.091 1.00 0.00 ? 164  ASP B CA 1 
ATOM 5449 C CA . LEU G  7  165  ? 188.167 210.785 153.199 1.00 0.00 ? 165  LEU B CA 1 
ATOM 5450 C CA . CYS G  7  166  ? 185.138 211.428 155.469 1.00 0.00 ? 166  CYS B CA 1 
ATOM 5451 C CA . TYR G  7  167  ? 183.721 214.810 154.348 1.00 0.00 ? 167  TYR B CA 1 
ATOM 5452 C CA . THR G  7  168  ? 180.972 215.570 156.937 1.00 0.00 ? 168  THR B CA 1 
ATOM 5453 C CA . ASP G  7  169  ? 182.889 214.336 160.000 1.00 0.00 ? 169  ASP B CA 1 
ATOM 5454 C CA . ILE G  7  170  ? 184.743 217.595 160.599 1.00 0.00 ? 170  ILE B CA 1 
ATOM 5455 C CA . LEU G  7  171  ? 185.400 217.271 164.383 1.00 0.00 ? 171  LEU B CA 1 
ATOM 5456 C CA . PHE G  7  172  ? 188.884 216.107 165.289 1.00 0.00 ? 172  PHE B CA 1 
ATOM 5457 C CA . THR G  7  173  ? 187.314 213.642 167.729 1.00 0.00 ? 173  THR B CA 1 
ATOM 5458 C CA . GLU G  7  174  ? 185.298 212.232 164.800 1.00 0.00 ? 174  GLU B CA 1 
ATOM 5459 C CA . GLN G  7  175  ? 188.633 211.753 162.980 1.00 0.00 ? 175  GLN B CA 1 
ATOM 5460 C CA . GLU G  7  176  ? 190.744 210.143 165.741 1.00 0.00 ? 176  GLU B CA 1 
ATOM 5461 C CA . ARG G  7  177  ? 188.018 207.570 166.446 1.00 0.00 ? 177  ARG B CA 1 
ATOM 5462 C CA . GLY G  7  178  ? 187.125 207.426 162.731 1.00 0.00 ? 178  GLY B CA 1 
ATOM 5463 C CA . VAL G  7  179  ? 183.432 206.851 163.568 1.00 0.00 ? 179  VAL B CA 1 
ATOM 5464 C CA . GLY G  7  180  ? 180.945 209.680 162.991 1.00 0.00 ? 180  GLY B CA 1 
ATOM 5465 C CA . ILE G  7  181  ? 179.557 211.136 166.250 1.00 0.00 ? 181  ILE B CA 1 
ATOM 5466 C CA . LYS G  7  182  ? 177.648 214.410 165.813 1.00 0.00 ? 182  LYS B CA 1 
ATOM 5467 C CA . SER G  7  183  ? 175.241 214.592 162.861 1.00 0.00 ? 183  SER B CA 1 
ATOM 5468 C CA . THR G  7  184  ? 176.291 217.224 160.327 1.00 0.00 ? 184  THR B CA 1 
ATOM 5469 C CA . PRO G  7  185  ? 174.143 218.846 157.591 1.00 0.00 ? 185  PRO B CA 1 
ATOM 5470 C CA . VAL G  7  186  ? 174.964 219.411 153.907 1.00 0.00 ? 186  VAL B CA 1 
ATOM 5471 C CA . THR G  7  187  ? 173.364 220.996 150.856 1.00 0.00 ? 187  THR B CA 1 
ATOM 5472 C CA . VAL G  7  188  ? 174.504 220.512 147.233 1.00 0.00 ? 188  VAL B CA 1 
ATOM 5473 C CA . VAL G  7  189  ? 173.218 220.826 143.657 1.00 0.00 ? 189  VAL B CA 1 
ATOM 5474 C CA . LEU G  7  190  ? 172.588 217.250 142.577 1.00 0.00 ? 190  LEU B CA 1 
ATOM 5475 C CA . PRO G  7  191  ? 171.706 216.411 138.927 1.00 0.00 ? 191  PRO B CA 1 
ATOM 5476 C CA . ASP G  7  192  ? 169.299 213.633 137.875 1.00 0.00 ? 192  ASP B CA 1 
ATOM 5477 C CA . THR G  7  193  ? 168.365 211.379 134.912 1.00 0.00 ? 193  THR B CA 1 
ATOM 5478 C CA . LYS G  7  194  ? 167.479 213.627 131.933 1.00 0.00 ? 194  LYS B CA 1 
ATOM 5479 C CA . GLY G  7  195  ? 169.431 216.321 133.842 1.00 0.00 ? 195  GLY B CA 1 
ATOM 5480 C CA . LYS G  7  196  ? 167.162 218.284 136.241 1.00 0.00 ? 196  LYS B CA 1 
ATOM 5481 C CA . SER G  7  197  ? 169.071 219.674 139.256 1.00 0.00 ? 197  SER B CA 1 
ATOM 5482 C CA . TYR G  7  198  ? 167.642 219.630 142.791 1.00 0.00 ? 198  TYR B CA 1 
ATOM 5483 C CA . LEU G  7  199  ? 169.019 220.881 146.083 1.00 0.00 ? 199  LEU B CA 1 
ATOM 5484 C CA . PHE G  7  200  ? 169.492 218.148 148.591 1.00 0.00 ? 200  PHE B CA 1 
ATOM 5485 C CA . ASN G  7  201  ? 169.693 218.966 152.262 1.00 0.00 ? 201  ASN B CA 1 
ATOM 5486 C CA . ILE G  7  202  ? 171.332 215.796 153.555 1.00 0.00 ? 202  ILE B CA 1 
ATOM 5487 C CA . MET G  7  203  ? 172.205 214.930 157.157 1.00 0.00 ? 203  MET B CA 1 
ATOM 5488 C CA . ASP G  7  204  ? 174.800 212.256 157.959 1.00 0.00 ? 204  ASP B CA 1 
ATOM 5489 C CA . THR G  7  205  ? 173.745 210.484 161.141 1.00 0.00 ? 205  THR B CA 1 
ATOM 5490 C CA . PRO G  7  206  ? 176.111 208.637 163.496 1.00 0.00 ? 206  PRO B CA 1 
ATOM 5491 C CA . GLY G  7  207  ? 175.907 204.900 162.790 1.00 0.00 ? 207  GLY B CA 1 
ATOM 5492 C CA . HIS G  7  208  ? 177.186 204.000 166.248 1.00 0.00 ? 208  HIS B CA 1 
ATOM 5493 C CA . VAL G  7  209  ? 174.325 202.691 168.393 1.00 0.00 ? 209  VAL B CA 1 
ATOM 5494 C CA . ASN G  7  210  ? 174.914 205.183 171.233 1.00 0.00 ? 210  ASN B CA 1 
ATOM 5495 C CA . PHE G  7  211  ? 174.282 208.405 169.282 1.00 0.00 ? 211  PHE B CA 1 
ATOM 5496 C CA . SER G  7  212  ? 170.747 207.460 168.150 1.00 0.00 ? 212  SER B CA 1 
ATOM 5497 C CA . ASP G  7  213  ? 170.006 210.821 169.859 1.00 0.00 ? 213  ASP B CA 1 
ATOM 5498 C CA . GLU G  7  214  ? 171.463 212.612 166.825 1.00 0.00 ? 214  GLU B CA 1 
ATOM 5499 C CA . VAL G  7  215  ? 169.460 210.403 164.465 1.00 0.00 ? 215  VAL B CA 1 
ATOM 5500 C CA . THR G  7  216  ? 166.078 211.314 166.029 1.00 0.00 ? 216  THR B CA 1 
ATOM 5501 C CA . ALA G  7  217  ? 166.826 215.070 166.238 1.00 0.00 ? 217  ALA B CA 1 
ATOM 5502 C CA . GLY G  7  218  ? 166.766 215.616 162.469 1.00 0.00 ? 218  GLY B CA 1 
ATOM 5503 C CA . LEU G  7  219  ? 163.935 213.042 162.094 1.00 0.00 ? 219  LEU B CA 1 
ATOM 5504 C CA . ARG G  7  220  ? 161.433 215.670 163.284 1.00 0.00 ? 220  ARG B CA 1 
ATOM 5505 C CA . ILE G  7  221  ? 162.575 217.874 160.437 1.00 0.00 ? 221  ILE B CA 1 
ATOM 5506 C CA . SER G  7  222  ? 163.495 215.713 157.430 1.00 0.00 ? 222  SER B CA 1 
ATOM 5507 C CA . ASP G  7  223  ? 160.860 214.605 154.913 1.00 0.00 ? 223  ASP B CA 1 
ATOM 5508 C CA . GLY G  7  224  ? 162.126 211.009 154.685 1.00 0.00 ? 224  GLY B CA 1 
ATOM 5509 C CA . VAL G  7  225  ? 164.848 208.521 155.577 1.00 0.00 ? 225  VAL B CA 1 
ATOM 5510 C CA . VAL G  7  226  ? 167.529 207.030 153.387 1.00 0.00 ? 226  VAL B CA 1 
ATOM 5511 C CA . LEU G  7  227  ? 168.947 203.668 154.573 1.00 0.00 ? 227  LEU B CA 1 
ATOM 5512 C CA . PHE G  7  228  ? 172.433 202.238 154.168 1.00 0.00 ? 228  PHE B CA 1 
ATOM 5513 C CA . ILE G  7  229  ? 172.925 198.541 154.631 1.00 0.00 ? 229  ILE B CA 1 
ATOM 5514 C CA . ASP G  7  230  ? 175.946 196.296 154.052 1.00 0.00 ? 230  ASP B CA 1 
ATOM 5515 C CA . ALA G  7  231  ? 175.493 193.451 151.557 1.00 0.00 ? 231  ALA B CA 1 
ATOM 5516 C CA . ALA G  7  232  ? 177.981 191.494 153.700 1.00 0.00 ? 232  ALA B CA 1 
ATOM 5517 C CA . GLU G  7  233  ? 176.912 192.289 157.291 1.00 0.00 ? 233  GLU B CA 1 
ATOM 5518 C CA . GLY G  7  234  ? 173.184 192.282 156.426 1.00 0.00 ? 234  GLY B CA 1 
ATOM 5519 C CA . VAL G  7  235  ? 170.608 194.155 158.530 1.00 0.00 ? 235  VAL B CA 1 
ATOM 5520 C CA . MET G  7  236  ? 172.201 194.547 161.965 1.00 0.00 ? 236  MET B CA 1 
ATOM 5521 C CA . LEU G  7  237  ? 170.759 196.389 165.004 1.00 0.00 ? 237  LEU B CA 1 
ATOM 5522 C CA . ASN G  7  238  ? 170.480 200.132 164.220 1.00 0.00 ? 238  ASN B CA 1 
ATOM 5523 C CA . THR G  7  239  ? 168.968 199.292 160.803 1.00 0.00 ? 239  THR B CA 1 
ATOM 5524 C CA . GLU G  7  240  ? 166.041 197.768 162.779 1.00 0.00 ? 240  GLU B CA 1 
ATOM 5525 C CA . ARG G  7  241  ? 166.044 200.291 165.592 1.00 0.00 ? 241  ARG B CA 1 
ATOM 5526 C CA . LEU G  7  242  ? 165.698 202.990 162.902 1.00 0.00 ? 242  LEU B CA 1 
ATOM 5527 C CA . ILE G  7  243  ? 163.375 201.319 160.338 1.00 0.00 ? 243  ILE B CA 1 
ATOM 5528 C CA . LYS G  7  244  ? 160.828 200.620 163.088 1.00 0.00 ? 244  LYS B CA 1 
ATOM 5529 C CA . HIS G  7  245  ? 161.177 204.083 164.658 1.00 0.00 ? 245  HIS B CA 1 
ATOM 5530 C CA . ALA G  7  246  ? 161.068 205.625 161.141 1.00 0.00 ? 246  ALA B CA 1 
ATOM 5531 C CA . VAL G  7  247  ? 157.725 204.148 160.026 1.00 0.00 ? 247  VAL B CA 1 
ATOM 5532 C CA . GLN G  7  248  ? 156.135 205.352 163.297 1.00 0.00 ? 248  GLN B CA 1 
ATOM 5533 C CA . GLU G  7  249  ? 156.483 208.879 162.035 1.00 0.00 ? 249  GLU B CA 1 
ATOM 5534 C CA . ARG G  7  250  ? 155.426 208.038 158.444 1.00 0.00 ? 250  ARG B CA 1 
ATOM 5535 C CA . LEU G  7  251  ? 158.985 208.401 157.074 1.00 0.00 ? 251  LEU B CA 1 
ATOM 5536 C CA . ALA G  7  252  ? 159.132 206.918 153.561 1.00 0.00 ? 252  ALA B CA 1 
ATOM 5537 C CA . VAL G  7  253  ? 162.232 204.746 153.102 1.00 0.00 ? 253  VAL B CA 1 
ATOM 5538 C CA . THR G  7  254  ? 164.860 204.459 150.364 1.00 0.00 ? 254  THR B CA 1 
ATOM 5539 C CA . VAL G  7  255  ? 167.309 201.603 150.770 1.00 0.00 ? 255  VAL B CA 1 
ATOM 5540 C CA . CYS G  7  256  ? 170.855 201.758 149.507 1.00 0.00 ? 256  CYS B CA 1 
ATOM 5541 C CA . ILE G  7  257  ? 172.557 198.396 149.541 1.00 0.00 ? 257  ILE B CA 1 
ATOM 5542 C CA . ASN G  7  258  ? 176.185 199.398 149.965 1.00 0.00 ? 258  ASN B CA 1 
ATOM 5543 C CA . LYS G  7  259  ? 179.495 197.560 149.486 1.00 0.00 ? 259  LYS B CA 1 
ATOM 5544 C CA . ILE G  7  260  ? 178.258 195.288 146.681 1.00 0.00 ? 260  ILE B CA 1 
ATOM 5545 C CA . ASP G  7  261  ? 181.686 195.318 144.992 1.00 0.00 ? 261  ASP B CA 1 
ATOM 5546 C CA . ARG G  7  262  ? 183.088 193.847 148.228 1.00 0.00 ? 262  ARG B CA 1 
ATOM 5547 C CA . LEU G  7  263  ? 180.812 190.780 147.924 1.00 0.00 ? 263  LEU B CA 1 
ATOM 5548 C CA . ILE G  7  264  ? 182.426 190.181 144.476 1.00 0.00 ? 264  ILE B CA 1 
ATOM 5549 C CA . LEU G  7  265  ? 186.033 190.549 145.710 1.00 0.00 ? 265  LEU B CA 1 
ATOM 5550 C CA . GLU G  7  266  ? 186.118 189.765 149.446 1.00 0.00 ? 266  GLU B CA 1 
ATOM 5551 C CA . LEU G  7  267  ? 183.585 186.919 149.499 1.00 0.00 ? 267  LEU B CA 1 
ATOM 5552 C CA . LYS G  7  268  ? 183.832 186.140 145.765 1.00 0.00 ? 268  LYS B CA 1 
ATOM 5553 C CA . LEU G  7  269  ? 180.365 184.590 145.611 1.00 0.00 ? 269  LEU B CA 1 
ATOM 5554 C CA . PRO G  7  270  ? 179.288 183.351 142.158 1.00 0.00 ? 270  PRO B CA 1 
ATOM 5555 C CA . PRO G  7  271  ? 176.771 185.803 140.585 1.00 0.00 ? 271  PRO B CA 1 
ATOM 5556 C CA . THR G  7  272  ? 173.692 183.555 141.049 1.00 0.00 ? 272  THR B CA 1 
ATOM 5557 C CA . ASP G  7  273  ? 174.415 182.881 144.749 1.00 0.00 ? 273  ASP B CA 1 
ATOM 5558 C CA . ALA G  7  274  ? 175.121 186.596 145.261 1.00 0.00 ? 274  ALA B CA 1 
ATOM 5559 C CA . TYR G  7  275  ? 171.625 187.430 143.932 1.00 0.00 ? 275  TYR B CA 1 
ATOM 5560 C CA . TYR G  7  276  ? 170.127 185.378 146.784 1.00 0.00 ? 276  TYR B CA 1 
ATOM 5561 C CA . LYS G  7  277  ? 172.405 187.255 149.213 1.00 0.00 ? 277  LYS B CA 1 
ATOM 5562 C CA . LEU G  7  278  ? 171.072 190.543 147.772 1.00 0.00 ? 278  LEU B CA 1 
ATOM 5563 C CA . ARG G  7  279  ? 167.359 189.617 147.704 1.00 0.00 ? 279  ARG B CA 1 
ATOM 5564 C CA . HIS G  7  280  ? 167.823 188.292 151.263 1.00 0.00 ? 280  HIS B CA 1 
ATOM 5565 C CA . ILE G  7  281  ? 168.869 191.745 152.566 1.00 0.00 ? 281  ILE B CA 1 
ATOM 5566 C CA . VAL G  7  282  ? 165.828 193.426 150.932 1.00 0.00 ? 282  VAL B CA 1 
ATOM 5567 C CA . ASP G  7  283  ? 163.450 190.902 152.540 1.00 0.00 ? 283  ASP B CA 1 
ATOM 5568 C CA . GLU G  7  284  ? 164.981 191.214 156.012 1.00 0.00 ? 284  GLU B CA 1 
ATOM 5569 C CA . VAL G  7  285  ? 164.440 194.994 155.792 1.00 0.00 ? 285  VAL B CA 1 
ATOM 5570 C CA . ASN G  7  286  ? 160.702 194.411 155.293 1.00 0.00 ? 286  ASN B CA 1 
ATOM 5571 C CA . GLY G  7  287  ? 160.610 191.845 158.150 1.00 0.00 ? 287  GLY B CA 1 
ATOM 5572 C CA . LEU G  7  288  ? 161.209 194.876 160.383 1.00 0.00 ? 288  LEU B CA 1 
ATOM 5573 C CA . ILE G  7  289  ? 158.590 196.896 158.492 1.00 0.00 ? 289  ILE B CA 1 
ATOM 5574 C CA . SER G  7  290  ? 155.899 194.180 158.811 1.00 0.00 ? 290  SER B CA 1 
ATOM 5575 C CA . MET G  7  291  ? 156.196 194.227 162.627 1.00 0.00 ? 291  MET B CA 1 
ATOM 5576 C CA . TYR G  7  292  ? 155.398 197.953 162.775 1.00 0.00 ? 292  TYR B CA 1 
ATOM 5577 C CA . SER G  7  293  ? 152.787 197.940 159.975 1.00 0.00 ? 293  SER B CA 1 
ATOM 5578 C CA . THR G  7  294  ? 151.380 195.358 157.555 1.00 0.00 ? 294  THR B CA 1 
ATOM 5579 C CA . ASP G  7  295  ? 150.632 198.127 155.034 1.00 0.00 ? 295  ASP B CA 1 
ATOM 5580 C CA . GLU G  7  296  ? 151.971 197.812 151.478 1.00 0.00 ? 296  GLU B CA 1 
ATOM 5581 C CA . ASN G  7  297  ? 152.212 201.585 150.995 1.00 0.00 ? 297  ASN B CA 1 
ATOM 5582 C CA . LEU G  7  298  ? 155.789 201.278 152.303 1.00 0.00 ? 298  LEU B CA 1 
ATOM 5583 C CA . ILE G  7  299  ? 157.455 197.977 151.281 1.00 0.00 ? 299  ILE B CA 1 
ATOM 5584 C CA . LEU G  7  300  ? 160.983 198.453 150.031 1.00 0.00 ? 300  LEU B CA 1 
ATOM 5585 C CA . SER G  7  301  ? 161.887 196.699 146.775 1.00 0.00 ? 301  SER B CA 1 
ATOM 5586 C CA . PRO G  7  302  ? 164.046 197.378 143.662 1.00 0.00 ? 302  PRO B CA 1 
ATOM 5587 C CA . LEU G  7  303  ? 161.067 196.588 141.405 1.00 0.00 ? 303  LEU B CA 1 
ATOM 5588 C CA . LEU G  7  304  ? 159.445 199.785 142.725 1.00 0.00 ? 304  LEU B CA 1 
ATOM 5589 C CA . GLY G  7  305  ? 162.534 202.021 142.943 1.00 0.00 ? 305  GLY B CA 1 
ATOM 5590 C CA . ASN G  7  306  ? 163.161 202.175 146.725 1.00 0.00 ? 306  ASN B CA 1 
ATOM 5591 C CA . VAL G  7  307  ? 166.375 200.101 146.430 1.00 0.00 ? 307  VAL B CA 1 
ATOM 5592 C CA . CYS G  7  308  ? 169.797 201.252 145.242 1.00 0.00 ? 308  CYS B CA 1 
ATOM 5593 C CA . PHE G  7  309  ? 172.779 198.938 144.644 1.00 0.00 ? 309  PHE B CA 1 
ATOM 5594 C CA . SER G  7  310  ? 175.963 200.926 145.233 1.00 0.00 ? 310  SER B CA 1 
ATOM 5595 C CA . SER G  7  311  ? 179.598 200.768 146.290 1.00 0.00 ? 311  SER B CA 1 
ATOM 5596 C CA . SER G  7  312  ? 180.751 204.136 147.632 1.00 0.00 ? 312  SER B CA 1 
ATOM 5597 C CA . GLN G  7  313  ? 184.406 203.028 147.432 1.00 0.00 ? 313  GLN B CA 1 
ATOM 5598 C CA . TYR G  7  314  ? 184.480 202.465 143.650 1.00 0.00 ? 314  TYR B CA 1 
ATOM 5599 C CA . SER G  7  315  ? 182.032 205.287 143.056 1.00 0.00 ? 315  SER B CA 1 
ATOM 5600 C CA . ILE G  7  316  ? 178.824 203.895 141.431 1.00 0.00 ? 316  ILE B CA 1 
ATOM 5601 C CA . CYS G  7  317  ? 175.143 203.820 142.562 1.00 0.00 ? 317  CYS B CA 1 
ATOM 5602 C CA . PHE G  7  318  ? 172.490 202.351 140.302 1.00 0.00 ? 318  PHE B CA 1 
ATOM 5603 C CA . THR G  7  319  ? 168.842 201.449 140.364 1.00 0.00 ? 319  THR B CA 1 
ATOM 5604 C CA . LEU G  7  320  ? 167.265 198.972 137.979 1.00 0.00 ? 320  LEU B CA 1 
ATOM 5605 C CA . GLY G  7  321  ? 165.949 201.990 136.041 1.00 0.00 ? 321  GLY B CA 1 
ATOM 5606 C CA . SER G  7  322  ? 169.450 203.496 135.657 1.00 0.00 ? 322  SER B CA 1 
ATOM 5607 C CA . PHE G  7  323  ? 171.078 200.249 134.473 1.00 0.00 ? 323  PHE B CA 1 
ATOM 5608 C CA . ALA G  7  324  ? 168.271 199.871 131.902 1.00 0.00 ? 324  ALA B CA 1 
ATOM 5609 C CA . LYS G  7  325  ? 169.001 203.353 130.475 1.00 0.00 ? 325  LYS B CA 1 
ATOM 5610 C CA . ILE G  7  326  ? 172.634 202.314 129.860 1.00 0.00 ? 326  ILE B CA 1 
ATOM 5611 C CA . TYR G  7  327  ? 171.479 199.623 127.405 1.00 0.00 ? 327  TYR B CA 1 
ATOM 5612 C CA . ALA G  7  328  ? 168.703 201.674 125.840 1.00 0.00 ? 328  ALA B CA 1 
ATOM 5613 C CA . ASP G  7  329  ? 170.723 204.882 125.254 1.00 0.00 ? 329  ASP B CA 1 
ATOM 5614 C CA . THR G  7  330  ? 173.160 202.734 123.343 1.00 0.00 ? 330  THR B CA 1 
ATOM 5615 C CA . PHE G  7  331  ? 170.494 200.499 121.711 1.00 0.00 ? 331  PHE B CA 1 
ATOM 5616 C CA . GLY G  7  332  ? 167.564 202.078 119.894 1.00 0.00 ? 332  GLY B CA 1 
ATOM 5617 C CA . ASP G  7  333  ? 164.119 202.215 121.481 1.00 0.00 ? 333  ASP B CA 1 
ATOM 5618 C CA . ILE G  7  334  ? 162.387 200.486 124.378 1.00 0.00 ? 334  ILE B CA 1 
ATOM 5619 C CA . ASN G  7  335  ? 160.755 201.872 127.533 1.00 0.00 ? 335  ASN B CA 1 
ATOM 5620 C CA . TYR G  7  336  ? 162.887 202.083 130.682 1.00 0.00 ? 336  TYR B CA 1 
ATOM 5621 C CA . GLN G  7  337  ? 159.777 201.230 132.705 1.00 0.00 ? 337  GLN B CA 1 
ATOM 5622 C CA . GLU G  7  338  ? 158.693 198.111 130.782 1.00 0.00 ? 338  GLU B CA 1 
ATOM 5623 C CA . PHE G  7  339  ? 162.298 196.916 131.197 1.00 0.00 ? 339  PHE B CA 1 
ATOM 5624 C CA . ALA G  7  340  ? 162.908 197.628 134.909 1.00 0.00 ? 340  ALA B CA 1 
ATOM 5625 C CA . LYS G  7  341  ? 159.760 195.704 135.981 1.00 0.00 ? 341  LYS B CA 1 
ATOM 5626 C CA . ARG G  7  342  ? 161.171 192.400 134.720 1.00 0.00 ? 342  ARG B CA 1 
ATOM 5627 C CA . LEU G  7  343  ? 164.747 192.808 136.029 1.00 0.00 ? 343  LEU B CA 1 
ATOM 5628 C CA . TRP G  7  344  ? 163.956 191.589 139.555 1.00 0.00 ? 344  TRP B CA 1 
ATOM 5629 C CA . GLY G  7  345  ? 163.987 187.880 140.379 1.00 0.00 ? 345  GLY B CA 1 
ATOM 5630 C CA . ASP G  7  346  ? 161.728 184.832 140.051 1.00 0.00 ? 346  ASP B CA 1 
ATOM 5631 C CA . ILE G  7  347  ? 161.783 185.689 136.318 1.00 0.00 ? 347  ILE B CA 1 
ATOM 5632 C CA . TYR G  7  348  ? 163.964 184.209 133.562 1.00 0.00 ? 348  TYR B CA 1 
ATOM 5633 C CA . PHE G  7  349  ? 165.153 185.203 130.088 1.00 0.00 ? 349  PHE B CA 1 
ATOM 5634 C CA . ASN G  7  350  ? 165.406 182.910 127.066 1.00 0.00 ? 350  ASN B CA 1 
ATOM 5635 C CA . PRO G  7  351  ? 168.222 184.064 124.722 1.00 0.00 ? 351  PRO B CA 1 
ATOM 5636 C CA . LYS G  7  352  ? 166.665 181.767 122.074 1.00 0.00 ? 352  LYS B CA 1 
ATOM 5637 C CA . THR G  7  353  ? 163.114 183.171 122.069 1.00 0.00 ? 353  THR B CA 1 
ATOM 5638 C CA . ARG G  7  354  ? 164.000 186.705 123.290 1.00 0.00 ? 354  ARG B CA 1 
ATOM 5639 C CA . LYS G  7  355  ? 161.108 186.713 125.789 1.00 0.00 ? 355  LYS B CA 1 
ATOM 5640 C CA . PHE G  7  356  ? 160.500 186.458 129.557 1.00 0.00 ? 356  PHE B CA 1 
ATOM 5641 C CA . THR G  7  357  ? 158.783 183.778 131.663 1.00 0.00 ? 357  THR B CA 1 
ATOM 5642 C CA . LYS G  7  358  ? 158.297 182.543 135.226 1.00 0.00 ? 358  LYS B CA 1 
ATOM 5643 C CA . LYS G  7  359  ? 159.111 179.101 133.744 1.00 0.00 ? 359  LYS B CA 1 
ATOM 5644 C CA . ALA G  7  360  ? 161.769 177.365 135.806 1.00 0.00 ? 360  ALA B CA 1 
ATOM 5645 C CA . PRO G  7  361  ? 165.049 177.424 133.826 1.00 0.00 ? 361  PRO B CA 1 
ATOM 5646 C CA . THR G  7  362  ? 165.136 174.868 131.002 1.00 0.00 ? 362  THR B CA 1 
ATOM 5647 C CA . SER G  7  363  ? 168.865 174.464 130.225 1.00 0.00 ? 363  SER B CA 1 
ATOM 5648 C CA . SER G  7  364  ? 170.477 177.949 130.331 1.00 0.00 ? 364  SER B CA 1 
ATOM 5649 C CA . SER G  7  365  ? 167.796 180.197 131.827 1.00 0.00 ? 365  SER B CA 1 
ATOM 5650 C CA . GLN G  7  366  ? 169.782 182.273 134.303 1.00 0.00 ? 366  GLN B CA 1 
ATOM 5651 C CA . ARG G  7  367  ? 167.462 184.862 135.962 1.00 0.00 ? 367  ARG B CA 1 
ATOM 5652 C CA . SER G  7  368  ? 166.897 188.232 134.233 1.00 0.00 ? 368  SER B CA 1 
ATOM 5653 C CA . PHE G  7  369  ? 168.791 190.087 137.008 1.00 0.00 ? 369  PHE B CA 1 
ATOM 5654 C CA . VAL G  7  370  ? 172.007 187.995 136.852 1.00 0.00 ? 370  VAL B CA 1 
ATOM 5655 C CA . GLU G  7  371  ? 171.857 188.063 133.010 1.00 0.00 ? 371  GLU B CA 1 
ATOM 5656 C CA . PHE G  7  372  ? 171.587 191.842 132.540 1.00 0.00 ? 372  PHE B CA 1 
ATOM 5657 C CA . ILE G  7  373  ? 173.220 193.270 135.690 1.00 0.00 ? 373  ILE B CA 1 
ATOM 5658 C CA . LEU G  7  374  ? 175.442 191.102 137.887 1.00 0.00 ? 374  LEU B CA 1 
ATOM 5659 C CA . GLU G  7  375  ? 177.396 189.075 135.328 1.00 0.00 ? 375  GLU B CA 1 
ATOM 5660 C CA . PRO G  7  376  ? 178.109 192.292 133.293 1.00 0.00 ? 376  PRO B CA 1 
ATOM 5661 C CA . LEU G  7  377  ? 179.180 193.778 136.646 1.00 0.00 ? 377  LEU B CA 1 
ATOM 5662 C CA . TYR G  7  378  ? 181.380 190.804 137.739 1.00 0.00 ? 378  TYR B CA 1 
ATOM 5663 C CA . LYS G  7  379  ? 183.169 191.107 134.356 1.00 0.00 ? 379  LYS B CA 1 
ATOM 5664 C CA . ILE G  7  380  ? 184.314 194.719 135.173 1.00 0.00 ? 380  ILE B CA 1 
ATOM 5665 C CA . LEU G  7  381  ? 185.660 193.840 138.673 1.00 0.00 ? 381  LEU B CA 1 
ATOM 5666 C CA . ALA G  7  382  ? 187.496 190.990 136.894 1.00 0.00 ? 382  ALA B CA 1 
ATOM 5667 C CA . GLN G  7  383  ? 188.497 192.776 133.646 1.00 0.00 ? 383  GLN B CA 1 
ATOM 5668 C CA . VAL G  7  384  ? 190.269 195.753 135.249 1.00 0.00 ? 384  VAL B CA 1 
ATOM 5669 C CA . VAL G  7  385  ? 191.855 193.654 138.006 1.00 0.00 ? 385  VAL B CA 1 
ATOM 5670 C CA . GLY G  7  386  ? 193.027 190.644 135.949 1.00 0.00 ? 386  GLY B CA 1 
ATOM 5671 C CA . ASP G  7  387  ? 195.372 192.814 133.808 1.00 0.00 ? 387  ASP B CA 1 
ATOM 5672 C CA . VAL G  7  388  ? 193.756 191.797 130.512 1.00 0.00 ? 388  VAL B CA 1 
ATOM 5673 C CA . ASP G  7  389  ? 194.581 195.312 129.427 1.00 0.00 ? 389  ASP B CA 1 
ATOM 5674 C CA . THR G  7  390  ? 194.398 194.482 125.671 1.00 0.00 ? 390  THR B CA 1 
ATOM 5675 C CA . SER G  7  391  ? 190.721 193.444 125.988 1.00 0.00 ? 391  SER B CA 1 
ATOM 5676 C CA . LEU G  7  392  ? 189.584 196.442 128.086 1.00 0.00 ? 392  LEU B CA 1 
ATOM 5677 C CA . PRO G  7  393  ? 190.620 198.923 125.280 1.00 0.00 ? 393  PRO B CA 1 
ATOM 5678 C CA . ARG G  7  394  ? 188.428 197.066 122.752 1.00 0.00 ? 394  ARG B CA 1 
ATOM 5679 C CA . THR G  7  395  ? 185.455 196.810 125.155 1.00 0.00 ? 395  THR B CA 1 
ATOM 5680 C CA . LEU G  7  396  ? 185.707 200.339 126.628 1.00 0.00 ? 396  LEU B CA 1 
ATOM 5681 C CA . ASP G  7  397  ? 186.094 201.625 123.063 1.00 0.00 ? 397  ASP B CA 1 
ATOM 5682 C CA . GLU G  7  398  ? 182.603 200.199 122.386 1.00 0.00 ? 398  GLU B CA 1 
ATOM 5683 C CA . LEU G  7  399  ? 181.147 202.582 124.984 1.00 0.00 ? 399  LEU B CA 1 
ATOM 5684 C CA . GLY G  7  400  ? 183.398 205.372 123.724 1.00 0.00 ? 400  GLY B CA 1 
ATOM 5685 C CA . ILE G  7  401  ? 185.369 205.523 126.985 1.00 0.00 ? 401  ILE B CA 1 
ATOM 5686 C CA . HIS G  7  402  ? 188.915 206.511 125.915 1.00 0.00 ? 402  HIS B CA 1 
ATOM 5687 C CA . LEU G  7  403  ? 191.645 206.260 128.569 1.00 0.00 ? 403  LEU B CA 1 
ATOM 5688 C CA . THR G  7  404  ? 195.247 207.405 128.260 1.00 0.00 ? 404  THR B CA 1 
ATOM 5689 C CA . LYS G  7  405  ? 197.736 204.497 128.133 1.00 0.00 ? 405  LYS B CA 1 
ATOM 5690 C CA . GLU G  7  406  ? 199.111 205.507 131.570 1.00 0.00 ? 406  GLU B CA 1 
ATOM 5691 C CA . GLU G  7  407  ? 195.777 204.520 133.179 1.00 0.00 ? 407  GLU B CA 1 
ATOM 5692 C CA . LEU G  7  408  ? 196.062 200.775 132.419 1.00 0.00 ? 408  LEU B CA 1 
ATOM 5693 C CA . LYS G  7  409  ? 199.605 200.701 133.814 1.00 0.00 ? 409  LYS B CA 1 
ATOM 5694 C CA . LEU G  7  410  ? 198.112 202.042 137.045 1.00 0.00 ? 410  LEU B CA 1 
ATOM 5695 C CA . ASN G  7  411  ? 196.832 200.349 140.233 1.00 0.00 ? 411  ASN B CA 1 
ATOM 5696 C CA . ILE G  7  412  ? 193.918 197.967 140.919 1.00 0.00 ? 412  ILE B CA 1 
ATOM 5697 C CA . ARG G  7  413  ? 191.498 199.905 143.178 1.00 0.00 ? 413  ARG B CA 1 
ATOM 5698 C CA . PRO G  7  414  ? 192.429 203.401 141.805 1.00 0.00 ? 414  PRO B CA 1 
ATOM 5699 C CA . LEU G  7  415  ? 192.077 202.055 138.239 1.00 0.00 ? 415  LEU B CA 1 
ATOM 5700 C CA . LEU G  7  416  ? 188.695 200.551 139.181 1.00 0.00 ? 416  LEU B CA 1 
ATOM 5701 C CA . ARG G  7  417  ? 187.542 203.884 140.617 1.00 0.00 ? 417  ARG B CA 1 
ATOM 5702 C CA . LEU G  7  418  ? 188.612 205.539 137.340 1.00 0.00 ? 418  LEU B CA 1 
ATOM 5703 C CA . VAL G  7  419  ? 186.780 202.948 135.181 1.00 0.00 ? 419  VAL B CA 1 
ATOM 5704 C CA . CYS G  7  420  ? 183.610 202.639 137.286 1.00 0.00 ? 420  CYS B CA 1 
ATOM 5705 C CA . LYS G  7  421  ? 183.441 206.466 137.408 1.00 0.00 ? 421  LYS B CA 1 
ATOM 5706 C CA . LYS G  7  422  ? 183.739 206.686 133.593 1.00 0.00 ? 422  LYS B CA 1 
ATOM 5707 C CA . PHE G  7  423  ? 181.152 203.947 132.910 1.00 0.00 ? 423  PHE B CA 1 
ATOM 5708 C CA . PHE G  7  424  ? 178.497 204.517 135.569 1.00 0.00 ? 424  PHE B CA 1 
ATOM 5709 C CA . GLY G  7  425  ? 178.602 208.328 135.493 1.00 0.00 ? 425  GLY B CA 1 
ATOM 5710 C CA . GLU G  7  426  ? 177.091 210.452 138.228 1.00 0.00 ? 426  GLU B CA 1 
ATOM 5711 C CA . PHE G  7  427  ? 175.183 208.620 140.994 1.00 0.00 ? 427  PHE B CA 1 
ATOM 5712 C CA . THR G  7  428  ? 172.025 209.571 139.042 1.00 0.00 ? 428  THR B CA 1 
ATOM 5713 C CA . GLY G  7  429  ? 170.082 206.445 140.110 1.00 0.00 ? 429  GLY B CA 1 
ATOM 5714 C CA . PHE G  7  430  ? 170.243 207.385 143.777 1.00 0.00 ? 430  PHE B CA 1 
ATOM 5715 C CA . VAL G  7  431  ? 169.044 210.932 142.940 1.00 0.00 ? 431  VAL B CA 1 
ATOM 5716 C CA . ASP G  7  432  ? 166.113 209.652 140.874 1.00 0.00 ? 432  ASP B CA 1 
ATOM 5717 C CA . MET G  7  433  ? 165.362 207.249 143.762 1.00 0.00 ? 433  MET B CA 1 
ATOM 5718 C CA . CYS G  7  434  ? 164.884 210.044 146.254 1.00 0.00 ? 434  CYS B CA 1 
ATOM 5719 C CA . VAL G  7  435  ? 163.018 212.710 144.220 1.00 0.00 ? 435  VAL B CA 1 
ATOM 5720 C CA . GLN G  7  436  ? 160.430 210.028 143.326 1.00 0.00 ? 436  GLN B CA 1 
ATOM 5721 C CA . HIS G  7  437  ? 159.816 208.532 146.795 1.00 0.00 ? 437  HIS B CA 1 
ATOM 5722 C CA . ILE G  7  438  ? 160.876 211.205 149.317 1.00 0.00 ? 438  ILE B CA 1 
ATOM 5723 C CA . PRO G  7  439  ? 158.254 213.951 148.873 1.00 0.00 ? 439  PRO B CA 1 
ATOM 5724 C CA . SER G  7  440  ? 159.004 217.651 148.346 1.00 0.00 ? 440  SER B CA 1 
ATOM 5725 C CA . PRO G  7  441  ? 158.674 219.924 151.451 1.00 0.00 ? 441  PRO B CA 1 
ATOM 5726 C CA . LYS G  7  442  ? 155.278 221.294 150.277 1.00 0.00 ? 442  LYS B CA 1 
ATOM 5727 C CA . VAL G  7  443  ? 153.520 217.909 149.957 1.00 0.00 ? 443  VAL B CA 1 
ATOM 5728 C CA . GLY G  7  444  ? 155.028 216.691 153.265 1.00 0.00 ? 444  GLY B CA 1 
ATOM 5729 C CA . ALA G  7  445  ? 153.927 219.893 155.076 1.00 0.00 ? 445  ALA B CA 1 
ATOM 5730 C CA . LYS G  7  446  ? 150.327 218.600 155.417 1.00 0.00 ? 446  LYS B CA 1 
ATOM 5731 C CA . PRO G  7  447  ? 151.330 215.300 157.187 1.00 0.00 ? 447  PRO B CA 1 
ATOM 5732 C CA . LYS G  7  448  ? 154.393 216.686 159.015 1.00 0.00 ? 448  LYS B CA 1 
ATOM 5733 C CA . ILE G  7  449  ? 152.388 219.537 160.609 1.00 0.00 ? 449  ILE B CA 1 
ATOM 5734 C CA . GLU G  7  450  ? 149.754 217.124 161.979 1.00 0.00 ? 450  GLU B CA 1 
ATOM 5735 C CA . HIS G  7  451  ? 152.043 214.828 164.014 1.00 0.00 ? 451  HIS B CA 1 
ATOM 5736 C CA . THR G  7  452  ? 154.340 217.593 165.323 1.00 0.00 ? 452  THR B CA 1 
ATOM 5737 C CA . TYR G  7  453  ? 152.260 220.769 165.808 1.00 0.00 ? 453  TYR B CA 1 
ATOM 5738 C CA . THR G  7  454  ? 150.394 220.652 169.125 1.00 0.00 ? 454  THR B CA 1 
ATOM 5739 C CA . GLY G  7  455  ? 147.665 223.014 168.345 1.00 0.00 ? 455  GLY B CA 1 
ATOM 5740 C CA . GLY G  7  456  ? 144.749 223.617 166.124 1.00 0.00 ? 456  GLY B CA 1 
ATOM 5741 C CA . VAL G  7  457  ? 145.006 223.489 162.328 1.00 0.00 ? 457  VAL B CA 1 
ATOM 5742 C CA . ASP G  7  458  ? 142.101 225.944 161.885 1.00 0.00 ? 458  ASP B CA 1 
ATOM 5743 C CA . SER G  7  459  ? 144.195 228.847 163.275 1.00 0.00 ? 459  SER B CA 1 
ATOM 5744 C CA . ASP G  7  460  ? 146.165 231.287 161.099 1.00 0.00 ? 460  ASP B CA 1 
ATOM 5745 C CA . LEU G  7  461  ? 149.486 229.573 161.963 1.00 0.00 ? 461  LEU B CA 1 
ATOM 5746 C CA . GLY G  7  462  ? 147.824 226.209 161.281 1.00 0.00 ? 462  GLY B CA 1 
ATOM 5747 C CA . GLU G  7  463  ? 146.841 227.480 157.886 1.00 0.00 ? 463  GLU B CA 1 
ATOM 5748 C CA . ALA G  7  464  ? 150.159 229.240 157.055 1.00 0.00 ? 464  ALA B CA 1 
ATOM 5749 C CA . MET G  7  465  ? 152.052 225.965 157.616 1.00 0.00 ? 465  MET B CA 1 
ATOM 5750 C CA . SER G  7  466  ? 150.197 224.538 154.573 1.00 0.00 ? 466  SER B CA 1 
ATOM 5751 C CA . ASP G  7  467  ? 148.955 227.926 153.247 1.00 0.00 ? 467  ASP B CA 1 
ATOM 5752 C CA . CYS G  7  468  ? 150.629 230.937 151.659 1.00 0.00 ? 468  CYS B CA 1 
ATOM 5753 C CA . ASP G  7  469  ? 151.297 233.945 153.881 1.00 0.00 ? 469  ASP B CA 1 
ATOM 5754 C CA . PRO G  7  470  ? 153.505 237.024 153.007 1.00 0.00 ? 470  PRO B CA 1 
ATOM 5755 C CA . ASP G  7  471  ? 152.553 238.819 155.602 1.00 0.00 ? 471  ASP B CA 1 
ATOM 5756 C CA . GLY G  7  472  ? 152.714 235.337 156.892 1.00 0.00 ? 472  GLY B CA 1 
ATOM 5757 C CA . PRO G  7  473  ? 153.765 234.383 160.357 1.00 0.00 ? 473  PRO B CA 1 
ATOM 5758 C CA . LEU G  7  474  ? 157.335 233.168 160.633 1.00 0.00 ? 474  LEU B CA 1 
ATOM 5759 C CA . MET G  7  475  ? 157.577 229.626 162.030 1.00 0.00 ? 475  MET B CA 1 
ATOM 5760 C CA . CYS G  7  476  ? 160.733 227.577 162.601 1.00 0.00 ? 476  CYS B CA 1 
ATOM 5761 C CA . HIS G  7  477  ? 161.568 224.451 164.637 1.00 0.00 ? 477  HIS B CA 1 
ATOM 5762 C CA . THR G  7  478  ? 164.990 224.113 166.201 1.00 0.00 ? 478  THR B CA 1 
ATOM 5763 C CA . THR G  7  479  ? 166.213 220.640 167.207 1.00 0.00 ? 479  THR B CA 1 
ATOM 5764 C CA . LYS G  7  480  ? 170.035 220.549 167.322 1.00 0.00 ? 480  LYS B CA 1 
ATOM 5765 C CA . MET G  7  481  ? 172.637 223.206 168.033 1.00 0.00 ? 481  MET B CA 1 
ATOM 5766 C CA . TYR G  7  482  ? 176.108 222.889 166.532 1.00 0.00 ? 482  TYR B CA 1 
ATOM 5767 C CA . SER G  7  483  ? 179.415 223.932 168.069 1.00 0.00 ? 483  SER B CA 1 
ATOM 5768 C CA . THR G  7  484  ? 181.317 226.356 165.827 1.00 0.00 ? 484  THR B CA 1 
ATOM 5769 C CA . ASP G  7  485  ? 185.066 226.479 165.023 1.00 0.00 ? 485  ASP B CA 1 
ATOM 5770 C CA . ASP G  7  486  ? 185.552 227.702 168.623 1.00 0.00 ? 486  ASP B CA 1 
ATOM 5771 C CA . GLY G  7  487  ? 183.630 226.108 171.525 1.00 0.00 ? 487  GLY B CA 1 
ATOM 5772 C CA . VAL G  7  488  ? 182.173 229.519 172.549 1.00 0.00 ? 488  VAL B CA 1 
ATOM 5773 C CA . GLN G  7  489  ? 178.936 229.743 170.528 1.00 0.00 ? 489  GLN B CA 1 
ATOM 5774 C CA . PHE G  7  490  ? 176.109 227.587 169.197 1.00 0.00 ? 490  PHE B CA 1 
ATOM 5775 C CA . HIS G  7  491  ? 174.544 227.852 165.756 1.00 0.00 ? 491  HIS B CA 1 
ATOM 5776 C CA . ALA G  7  492  ? 170.937 226.746 165.517 1.00 0.00 ? 492  ALA B CA 1 
ATOM 5777 C CA . PHE G  7  493  ? 169.474 224.208 163.099 1.00 0.00 ? 493  PHE B CA 1 
ATOM 5778 C CA . GLY G  7  494  ? 165.786 224.787 162.372 1.00 0.00 ? 494  GLY B CA 1 
ATOM 5779 C CA . ARG G  7  495  ? 163.386 224.175 159.489 1.00 0.00 ? 495  ARG B CA 1 
ATOM 5780 C CA . VAL G  7  496  ? 161.702 227.357 158.230 1.00 0.00 ? 496  VAL B CA 1 
ATOM 5781 C CA . LEU G  7  497  ? 158.071 226.250 158.055 1.00 0.00 ? 497  LEU B CA 1 
ATOM 5782 C CA . SER G  7  498  ? 156.604 229.568 156.902 1.00 0.00 ? 498  SER B CA 1 
ATOM 5783 C CA . GLY G  7  499  ? 157.353 233.012 155.495 1.00 0.00 ? 499  GLY B CA 1 
ATOM 5784 C CA . THR G  7  500  ? 160.770 234.657 155.586 1.00 0.00 ? 500  THR B CA 1 
ATOM 5785 C CA . ILE G  7  501  ? 163.507 235.210 158.161 1.00 0.00 ? 501  ILE B CA 1 
ATOM 5786 C CA . HIS G  7  502  ? 165.971 238.104 157.860 1.00 0.00 ? 502  HIS B CA 1 
ATOM 5787 C CA . ALA G  7  503  ? 168.750 239.656 159.968 1.00 0.00 ? 503  ALA B CA 1 
ATOM 5788 C CA . GLY G  7  504  ? 167.888 241.699 163.079 1.00 0.00 ? 504  GLY B CA 1 
ATOM 5789 C CA . GLN G  7  505  ? 164.295 240.424 163.389 1.00 0.00 ? 505  GLN B CA 1 
ATOM 5790 C CA . PRO G  7  506  ? 162.742 240.337 166.891 1.00 0.00 ? 506  PRO B CA 1 
ATOM 5791 C CA . VAL G  7  507  ? 161.579 236.758 167.597 1.00 0.00 ? 507  VAL B CA 1 
ATOM 5792 C CA . LYS G  7  508  ? 159.695 234.927 170.383 1.00 0.00 ? 508  LYS B CA 1 
ATOM 5793 C CA . VAL G  7  509  ? 161.773 231.787 171.021 1.00 0.00 ? 509  VAL B CA 1 
ATOM 5794 C CA . LEU G  7  510  ? 159.512 229.307 172.812 1.00 0.00 ? 510  LEU B CA 1 
ATOM 5795 C CA . GLY G  7  511  ? 160.630 226.404 175.024 1.00 0.00 ? 511  GLY B CA 1 
ATOM 5796 C CA . GLU G  7  512  ? 159.115 223.049 175.991 1.00 0.00 ? 512  GLU B CA 1 
ATOM 5797 C CA . ASN G  7  513  ? 156.908 223.592 179.074 1.00 0.00 ? 513  ASN B CA 1 
ATOM 5798 C CA . TYR G  7  514  ? 155.257 226.610 177.367 1.00 0.00 ? 514  TYR B CA 1 
ATOM 5799 C CA . THR G  7  515  ? 151.467 226.934 177.082 1.00 0.00 ? 515  THR B CA 1 
ATOM 5800 C CA . LEU G  7  516  ? 148.873 229.666 176.389 1.00 0.00 ? 516  LEU B CA 1 
ATOM 5801 C CA . GLU G  7  517  ? 148.545 229.996 180.175 1.00 0.00 ? 517  GLU B CA 1 
ATOM 5802 C CA . ASP G  7  518  ? 152.077 231.061 181.188 1.00 0.00 ? 518  ASP B CA 1 
ATOM 5803 C CA . GLU G  7  519  ? 154.511 233.002 178.999 1.00 0.00 ? 519  GLU B CA 1 
ATOM 5804 C CA . GLU G  7  520  ? 157.556 232.239 181.169 1.00 0.00 ? 520  GLU B CA 1 
ATOM 5805 C CA . ASP G  7  521  ? 159.231 229.995 178.548 1.00 0.00 ? 521  ASP B CA 1 
ATOM 5806 C CA . SER G  7  522  ? 159.252 232.504 175.667 1.00 0.00 ? 522  SER B CA 1 
ATOM 5807 C CA . GLN G  7  523  ? 162.156 234.929 175.243 1.00 0.00 ? 523  GLN B CA 1 
ATOM 5808 C CA . ILE G  7  524  ? 162.846 237.636 172.645 1.00 0.00 ? 524  ILE B CA 1 
ATOM 5809 C CA . CYS G  7  525  ? 166.096 237.612 170.626 1.00 0.00 ? 525  CYS B CA 1 
ATOM 5810 C CA . THR G  7  526  ? 167.701 239.046 167.487 1.00 0.00 ? 526  THR B CA 1 
ATOM 5811 C CA . VAL G  7  527  ? 168.864 236.999 164.490 1.00 0.00 ? 527  VAL B CA 1 
ATOM 5812 C CA . GLY G  7  528  ? 172.578 237.768 163.975 1.00 0.00 ? 528  GLY B CA 1 
ATOM 5813 C CA . ARG G  7  529  ? 173.445 235.671 160.902 1.00 0.00 ? 529  ARG B CA 1 
ATOM 5814 C CA . LEU G  7  530  ? 171.562 233.278 158.635 1.00 0.00 ? 530  LEU B CA 1 
ATOM 5815 C CA . TRP G  7  531  ? 173.732 230.774 156.744 1.00 0.00 ? 531  TRP B CA 1 
ATOM 5816 C CA . ILE G  7  532  ? 173.236 227.681 154.593 1.00 0.00 ? 532  ILE B CA 1 
ATOM 5817 C CA . SER G  7  533  ? 175.316 224.728 155.773 1.00 0.00 ? 533  SER B CA 1 
ATOM 5818 C CA . VAL G  7  534  ? 177.662 222.524 153.794 1.00 0.00 ? 534  VAL B CA 1 
ATOM 5819 C CA . ALA G  7  535  ? 179.768 220.624 156.310 1.00 0.00 ? 535  ALA B CA 1 
ATOM 5820 C CA . ARG G  7  536  ? 183.094 222.523 156.039 1.00 0.00 ? 536  ARG B CA 1 
ATOM 5821 C CA . TYR G  7  537  ? 182.124 225.783 154.297 1.00 0.00 ? 537  TYR B CA 1 
ATOM 5822 C CA . HIS G  7  538  ? 179.024 227.889 154.888 1.00 0.00 ? 538  HIS B CA 1 
ATOM 5823 C CA . ILE G  7  539  ? 177.124 230.232 152.595 1.00 0.00 ? 539  ILE B CA 1 
ATOM 5824 C CA . GLU G  7  540  ? 176.057 233.509 154.154 1.00 0.00 ? 540  GLU B CA 1 
ATOM 5825 C CA . VAL G  7  541  ? 172.488 234.346 153.094 1.00 0.00 ? 541  VAL B CA 1 
ATOM 5826 C CA . ASN G  7  542  ? 170.486 237.507 153.832 1.00 0.00 ? 542  ASN B CA 1 
ATOM 5827 C CA . ARG G  7  543  ? 167.005 236.014 153.639 1.00 0.00 ? 543  ARG B CA 1 
ATOM 5828 C CA . VAL G  7  544  ? 165.640 232.583 154.438 1.00 0.00 ? 544  VAL B CA 1 
ATOM 5829 C CA . PRO G  7  545  ? 162.349 231.296 152.985 1.00 0.00 ? 545  PRO B CA 1 
ATOM 5830 C CA . ALA G  7  546  ? 160.006 228.460 153.941 1.00 0.00 ? 546  ALA B CA 1 
ATOM 5831 C CA . GLY G  7  547  ? 160.951 224.936 152.809 1.00 0.00 ? 547  GLY B CA 1 
ATOM 5832 C CA . ASN G  7  548  ? 164.657 225.252 153.717 1.00 0.00 ? 548  ASN B CA 1 
ATOM 5833 C CA . TRP G  7  549  ? 166.875 224.111 156.577 1.00 0.00 ? 549  TRP B CA 1 
ATOM 5834 C CA . VAL G  7  550  ? 169.184 226.788 157.991 1.00 0.00 ? 550  VAL B CA 1 
ATOM 5835 C CA . LEU G  7  551  ? 171.927 227.769 160.439 1.00 0.00 ? 551  LEU B CA 1 
ATOM 5836 C CA . ILE G  7  552  ? 170.938 230.766 162.561 1.00 0.00 ? 552  ILE B CA 1 
ATOM 5837 C CA . GLU G  7  553  ? 173.276 232.984 164.581 1.00 0.00 ? 553  GLU B CA 1 
ATOM 5838 C CA . GLY G  7  554  ? 172.419 234.692 167.866 1.00 0.00 ? 554  GLY B CA 1 
ATOM 5839 C CA . VAL G  7  555  ? 169.473 232.610 169.173 1.00 0.00 ? 555  VAL B CA 1 
ATOM 5840 C CA . ASP G  7  556  ? 171.176 230.356 171.739 1.00 0.00 ? 556  ASP B CA 1 
ATOM 5841 C CA . GLN G  7  557  ? 170.808 231.161 175.443 1.00 0.00 ? 557  GLN B CA 1 
ATOM 5842 C CA . PRO G  7  558  ? 167.013 230.472 175.784 1.00 0.00 ? 558  PRO B CA 1 
ATOM 5843 C CA . ILE G  7  559  ? 167.376 227.135 173.932 1.00 0.00 ? 559  ILE B CA 1 
ATOM 5844 C CA . VAL G  7  560  ? 168.177 223.756 175.450 1.00 0.00 ? 560  VAL B CA 1 
ATOM 5845 C CA . LYS G  7  561  ? 167.054 220.828 173.254 1.00 0.00 ? 561  LYS B CA 1 
ATOM 5846 C CA . THR G  7  562  ? 163.876 221.461 171.160 1.00 0.00 ? 562  THR B CA 1 
ATOM 5847 C CA . ALA G  7  563  ? 162.799 225.121 170.921 1.00 0.00 ? 563  ALA B CA 1 
ATOM 5848 C CA . THR G  7  564  ? 160.478 226.443 168.207 1.00 0.00 ? 564  THR B CA 1 
ATOM 5849 C CA . ILE G  7  565  ? 160.885 230.008 166.949 1.00 0.00 ? 565  ILE B CA 1 
ATOM 5850 C CA . THR G  7  566  ? 157.967 232.271 166.044 1.00 0.00 ? 566  THR B CA 1 
ATOM 5851 C CA . GLU G  7  567  ? 157.812 235.970 165.118 1.00 0.00 ? 567  GLU B CA 1 
ATOM 5852 C CA . PRO G  7  568  ? 156.854 238.431 167.961 1.00 0.00 ? 568  PRO B CA 1 
ATOM 5853 C CA . ARG G  7  569  ? 154.177 240.501 166.145 1.00 0.00 ? 569  ARG B CA 1 
ATOM 5854 C CA . GLY G  7  570  ? 151.450 237.913 165.500 1.00 0.00 ? 570  GLY B CA 1 
ATOM 5855 C CA . ASN G  7  571  ? 147.871 236.801 166.039 1.00 0.00 ? 571  ASN B CA 1 
ATOM 5856 C CA . GLU G  7  572  ? 147.335 235.370 169.507 1.00 0.00 ? 572  GLU B CA 1 
ATOM 5857 C CA . GLU G  7  573  ? 148.179 231.822 170.702 1.00 0.00 ? 573  GLU B CA 1 
ATOM 5858 C CA . ALA G  7  574  ? 151.466 230.686 169.154 1.00 0.00 ? 574  ALA B CA 1 
ATOM 5859 C CA . GLN G  7  575  ? 151.955 226.949 169.744 1.00 0.00 ? 575  GLN B CA 1 
ATOM 5860 C CA . ILE G  7  576  ? 154.972 224.678 170.189 1.00 0.00 ? 576  ILE B CA 1 
ATOM 5861 C CA . PHE G  7  577  ? 156.354 221.744 168.197 1.00 0.00 ? 577  PHE B CA 1 
ATOM 5862 C CA . ARG G  7  578  ? 156.196 218.307 169.819 1.00 0.00 ? 578  ARG B CA 1 
ATOM 5863 C CA . PRO G  7  579  ? 159.401 217.502 171.791 1.00 0.00 ? 579  PRO B CA 1 
ATOM 5864 C CA . LEU G  7  580  ? 161.307 214.803 169.835 1.00 0.00 ? 580  LEU B CA 1 
ATOM 5865 C CA . LYS G  7  581  ? 160.782 211.135 170.685 1.00 0.00 ? 581  LYS B CA 1 
ATOM 5866 C CA . PHE G  7  582  ? 164.253 209.749 171.412 1.00 0.00 ? 582  PHE B CA 1 
ATOM 5867 C CA . ASN G  7  583  ? 164.538 205.999 170.766 1.00 0.00 ? 583  ASN B CA 1 
ATOM 5868 C CA . THR G  7  584  ? 166.662 205.404 173.916 1.00 0.00 ? 584  THR B CA 1 
ATOM 5869 C CA . THR G  7  585  ? 166.593 206.563 177.509 1.00 0.00 ? 585  THR B CA 1 
ATOM 5870 C CA . SER G  7  586  ? 169.783 208.048 179.004 1.00 0.00 ? 586  SER B CA 1 
ATOM 5871 C CA . VAL G  7  587  ? 170.282 205.430 181.788 1.00 0.00 ? 587  VAL B CA 1 
ATOM 5872 C CA . ILE G  7  588  ? 174.070 205.432 182.319 1.00 0.00 ? 588  ILE B CA 1 
ATOM 5873 C CA . LYS G  7  589  ? 175.102 207.781 185.119 1.00 0.00 ? 589  LYS B CA 1 
ATOM 5874 C CA . ILE G  7  590  ? 178.423 209.468 186.021 1.00 0.00 ? 590  ILE B CA 1 
ATOM 5875 C CA . ALA G  7  591  ? 179.520 211.925 188.741 1.00 0.00 ? 591  ALA B CA 1 
ATOM 5876 C CA . VAL G  7  592  ? 181.639 214.990 187.913 1.00 0.00 ? 592  VAL B CA 1 
ATOM 5877 C CA . GLU G  7  593  ? 183.544 217.089 190.450 1.00 0.00 ? 593  GLU B CA 1 
ATOM 5878 C CA . PRO G  7  594  ? 186.284 219.540 189.316 1.00 0.00 ? 594  PRO B CA 1 
ATOM 5879 C CA . VAL G  7  595  ? 189.752 218.404 190.441 1.00 0.00 ? 595  VAL B CA 1 
ATOM 5880 C CA . ASN G  7  596  ? 190.256 221.901 191.875 1.00 0.00 ? 596  ASN B CA 1 
ATOM 5881 C CA . PRO G  7  597  ? 187.116 223.190 193.671 1.00 0.00 ? 597  PRO B CA 1 
ATOM 5882 C CA . SER G  7  598  ? 188.022 226.875 193.057 1.00 0.00 ? 598  SER B CA 1 
ATOM 5883 C CA . GLU G  7  599  ? 187.084 226.472 189.353 1.00 0.00 ? 599  GLU B CA 1 
ATOM 5884 C CA . LEU G  7  600  ? 183.558 225.097 189.944 1.00 0.00 ? 600  LEU B CA 1 
ATOM 5885 C CA . PRO G  7  601  ? 181.818 227.978 187.975 1.00 0.00 ? 601  PRO B CA 1 
ATOM 5886 C CA . LYS G  7  602  ? 183.552 227.061 184.685 1.00 0.00 ? 602  LYS B CA 1 
ATOM 5887 C CA . MET G  7  603  ? 182.680 223.348 185.002 1.00 0.00 ? 603  MET B CA 1 
ATOM 5888 C CA . LEU G  7  604  ? 179.088 224.452 185.693 1.00 0.00 ? 604  LEU B CA 1 
ATOM 5889 C CA . ASP G  7  605  ? 179.157 226.606 182.535 1.00 0.00 ? 605  ASP B CA 1 
ATOM 5890 C CA . GLY G  7  606  ? 180.615 223.622 180.636 1.00 0.00 ? 606  GLY B CA 1 
ATOM 5891 C CA . LEU G  7  607  ? 177.840 221.248 181.790 1.00 0.00 ? 607  LEU B CA 1 
ATOM 5892 C CA . ARG G  7  608  ? 175.230 223.610 180.327 1.00 0.00 ? 608  ARG B CA 1 
ATOM 5893 C CA . LYS G  7  609  ? 177.010 223.597 176.937 1.00 0.00 ? 609  LYS B CA 1 
ATOM 5894 C CA . VAL G  7  610  ? 176.954 219.808 176.766 1.00 0.00 ? 610  VAL B CA 1 
ATOM 5895 C CA . ASN G  7  611  ? 173.166 219.730 177.283 1.00 0.00 ? 611  ASN B CA 1 
ATOM 5896 C CA . LYS G  7  612  ? 172.990 222.012 174.216 1.00 0.00 ? 612  LYS B CA 1 
ATOM 5897 C CA . SER G  7  613  ? 174.990 219.781 171.816 1.00 0.00 ? 613  SER B CA 1 
ATOM 5898 C CA . TYR G  7  614  ? 174.009 216.376 173.277 1.00 0.00 ? 614  TYR B CA 1 
ATOM 5899 C CA . PRO G  7  615  ? 170.249 215.625 173.123 1.00 0.00 ? 615  PRO B CA 1 
ATOM 5900 C CA . SER G  7  616  ? 170.044 212.773 175.669 1.00 0.00 ? 616  SER B CA 1 
ATOM 5901 C CA . LEU G  7  617  ? 172.422 214.238 178.262 1.00 0.00 ? 617  LEU B CA 1 
ATOM 5902 C CA . THR G  7  618  ? 170.888 215.454 181.546 1.00 0.00 ? 618  THR B CA 1 
ATOM 5903 C CA . THR G  7  619  ? 172.596 217.383 184.352 1.00 0.00 ? 619  THR B CA 1 
ATOM 5904 C CA . LYS G  7  620  ? 171.134 217.142 187.873 1.00 0.00 ? 620  LYS B CA 1 
ATOM 5905 C CA . VAL G  7  621  ? 172.884 218.546 190.949 1.00 0.00 ? 621  VAL B CA 1 
ATOM 5906 C CA . GLU G  7  622  ? 172.793 216.266 194.000 1.00 0.00 ? 622  GLU B CA 1 
ATOM 5907 C CA . GLU G  7  623  ? 172.042 217.504 197.531 1.00 0.00 ? 623  GLU B CA 1 
ATOM 5908 C CA . SER G  7  624  ? 175.639 216.628 198.499 1.00 0.00 ? 624  SER B CA 1 
ATOM 5909 C CA . GLY G  7  625  ? 177.301 218.777 195.796 1.00 0.00 ? 625  GLY B CA 1 
ATOM 5910 C CA . GLU G  7  626  ? 178.008 216.239 193.010 1.00 0.00 ? 626  GLU B CA 1 
ATOM 5911 C CA . HIS G  7  627  ? 176.930 216.741 189.384 1.00 0.00 ? 627  HIS B CA 1 
ATOM 5912 C CA . VAL G  7  628  ? 175.532 213.456 188.116 1.00 0.00 ? 628  VAL B CA 1 
ATOM 5913 C CA . ILE G  7  629  ? 174.999 213.357 184.335 1.00 0.00 ? 629  ILE B CA 1 
ATOM 5914 C CA . LEU G  7  630  ? 173.334 210.754 182.108 1.00 0.00 ? 630  LEU B CA 1 
ATOM 5915 C CA . GLY G  7  631  ? 174.016 209.336 178.628 1.00 0.00 ? 631  GLY B CA 1 
ATOM 5916 C CA . THR G  7  632  ? 173.208 206.209 176.601 1.00 0.00 ? 632  THR B CA 1 
ATOM 5917 C CA . GLY G  7  633  ? 176.425 204.269 177.417 1.00 0.00 ? 633  GLY B CA 1 
ATOM 5918 C CA . GLU G  7  634  ? 180.220 203.958 177.537 1.00 0.00 ? 634  GLU B CA 1 
ATOM 5919 C CA . LEU G  7  635  ? 181.022 205.464 174.136 1.00 0.00 ? 635  LEU B CA 1 
ATOM 5920 C CA . TYR G  7  636  ? 178.508 208.288 174.665 1.00 0.00 ? 636  TYR B CA 1 
ATOM 5921 C CA . LEU G  7  637  ? 179.948 209.208 178.085 1.00 0.00 ? 637  LEU B CA 1 
ATOM 5922 C CA . ASP G  7  638  ? 183.510 209.202 176.748 1.00 0.00 ? 638  ASP B CA 1 
ATOM 5923 C CA . CYS G  7  639  ? 182.743 211.897 174.155 1.00 0.00 ? 639  CYS B CA 1 
ATOM 5924 C CA . VAL G  7  640  ? 180.907 214.196 176.608 1.00 0.00 ? 640  VAL B CA 1 
ATOM 5925 C CA . MET G  7  641  ? 183.739 214.022 179.162 1.00 0.00 ? 641  MET B CA 1 
ATOM 5926 C CA . HIS G  7  642  ? 186.014 214.798 176.197 1.00 0.00 ? 642  HIS B CA 1 
ATOM 5927 C CA . ASP G  7  643  ? 184.158 217.959 175.095 1.00 0.00 ? 643  ASP B CA 1 
ATOM 5928 C CA . LEU G  7  644  ? 183.543 219.433 178.539 1.00 0.00 ? 644  LEU B CA 1 
ATOM 5929 C CA . ARG G  7  645  ? 187.153 218.556 179.500 1.00 0.00 ? 645  ARG B CA 1 
ATOM 5930 C CA . LYS G  7  646  ? 188.902 220.003 176.393 1.00 0.00 ? 646  LYS B CA 1 
ATOM 5931 C CA . MET G  7  647  ? 186.411 222.006 174.266 1.00 0.00 ? 647  MET B CA 1 
ATOM 5932 C CA . TYR G  7  648  ? 183.933 223.868 176.483 1.00 0.00 ? 648  TYR B CA 1 
ATOM 5933 C CA . SER G  7  649  ? 185.723 224.238 179.825 1.00 0.00 ? 649  SER B CA 1 
ATOM 5934 C CA . GLU G  7  650  ? 189.493 223.730 179.819 1.00 0.00 ? 650  GLU B CA 1 
ATOM 5935 C CA . ILE G  7  651  ? 189.655 222.107 183.234 1.00 0.00 ? 651  ILE B CA 1 
ATOM 5936 C CA . ASP G  7  652  ? 190.615 218.875 184.970 1.00 0.00 ? 652  ASP B CA 1 
ATOM 5937 C CA . ILE G  7  653  ? 187.985 216.570 186.531 1.00 0.00 ? 653  ILE B CA 1 
ATOM 5938 C CA . LYS G  7  654  ? 187.599 213.685 188.998 1.00 0.00 ? 654  LYS B CA 1 
ATOM 5939 C CA . VAL G  7  655  ? 185.128 211.375 187.207 1.00 0.00 ? 655  VAL B CA 1 
ATOM 5940 C CA . ALA G  7  656  ? 183.459 208.644 189.276 1.00 0.00 ? 656  ALA B CA 1 
ATOM 5941 C CA . ASP G  7  657  ? 182.946 204.983 188.378 1.00 0.00 ? 657  ASP B CA 1 
ATOM 5942 C CA . PRO G  7  658  ? 179.729 204.797 186.291 1.00 0.00 ? 658  PRO B CA 1 
ATOM 5943 C CA . VAL G  7  659  ? 176.487 203.301 187.628 1.00 0.00 ? 659  VAL B CA 1 
ATOM 5944 C CA . VAL G  7  660  ? 172.949 202.774 186.310 1.00 0.00 ? 660  VAL B CA 1 
ATOM 5945 C CA . THR G  7  661  ? 169.732 204.727 186.949 1.00 0.00 ? 661  THR B CA 1 
ATOM 5946 C CA . PHE G  7  662  ? 167.396 202.522 189.016 1.00 0.00 ? 662  PHE B CA 1 
ATOM 5947 C CA . CYS G  7  663  ? 163.594 202.368 189.066 1.00 0.00 ? 663  CYS B CA 1 
ATOM 5948 C CA . GLU G  7  664  ? 161.151 201.019 191.670 1.00 0.00 ? 664  GLU B CA 1 
ATOM 5949 C CA . THR G  7  665  ? 157.944 198.961 191.634 1.00 0.00 ? 665  THR B CA 1 
ATOM 5950 C CA . VAL G  7  666  ? 155.487 196.986 193.781 1.00 0.00 ? 666  VAL B CA 1 
ATOM 5951 C CA . VAL G  7  667  ? 155.361 193.170 193.843 1.00 0.00 ? 667  VAL B CA 1 
ATOM 5952 C CA . GLU G  7  668  ? 152.066 192.283 195.559 1.00 0.00 ? 668  GLU B CA 1 
ATOM 5953 C CA . THR G  7  669  ? 148.973 193.937 197.051 1.00 0.00 ? 669  THR B CA 1 
ATOM 5954 C CA . SER G  7  670  ? 149.189 195.765 200.397 1.00 0.00 ? 670  SER B CA 1 
ATOM 5955 C CA . SER G  7  671  ? 148.038 193.779 203.463 1.00 0.00 ? 671  SER B CA 1 
ATOM 5956 C CA . LEU G  7  672  ? 146.856 196.816 205.482 1.00 0.00 ? 672  LEU B CA 1 
ATOM 5957 C CA . LYS G  7  673  ? 144.671 199.356 203.687 1.00 0.00 ? 673  LYS B CA 1 
ATOM 5958 C CA . CYS G  7  674  ? 146.003 202.925 203.781 1.00 0.00 ? 674  CYS B CA 1 
ATOM 5959 C CA . PHE G  7  675  ? 144.811 205.668 206.136 1.00 0.00 ? 675  PHE B CA 1 
ATOM 5960 C CA . ALA G  7  676  ? 145.626 209.405 205.920 1.00 0.00 ? 676  ALA B CA 1 
ATOM 5961 C CA . GLU G  7  677  ? 144.496 212.756 207.316 1.00 0.00 ? 677  GLU B CA 1 
ATOM 5962 C CA . THR G  7  678  ? 144.988 216.293 206.051 1.00 0.00 ? 678  THR B CA 1 
ATOM 5963 C CA . PRO G  7  679  ? 146.713 218.876 208.345 1.00 0.00 ? 679  PRO B CA 1 
ATOM 5964 C CA . ASN G  7  680  ? 143.249 220.425 208.839 1.00 0.00 ? 680  ASN B CA 1 
ATOM 5965 C CA . LYS G  7  681  ? 141.700 216.976 209.542 1.00 0.00 ? 681  LYS B CA 1 
ATOM 5966 C CA . LYS G  7  682  ? 138.668 217.708 207.333 1.00 0.00 ? 682  LYS B CA 1 
ATOM 5967 C CA . ASN G  7  683  ? 139.455 215.025 204.714 1.00 0.00 ? 683  ASN B CA 1 
ATOM 5968 C CA . LYS G  7  684  ? 140.538 211.360 204.800 1.00 0.00 ? 684  LYS B CA 1 
ATOM 5969 C CA . ILE G  7  685  ? 142.042 209.630 201.737 1.00 0.00 ? 685  ILE B CA 1 
ATOM 5970 C CA . THR G  7  686  ? 142.722 205.901 201.347 1.00 0.00 ? 686  THR B CA 1 
ATOM 5971 C CA . MET G  7  687  ? 143.748 203.847 198.293 1.00 0.00 ? 687  MET B CA 1 
ATOM 5972 C CA . ILE G  7  688  ? 145.070 200.377 197.485 1.00 0.00 ? 688  ILE B CA 1 
ATOM 5973 C CA . ALA G  7  689  ? 148.124 199.482 195.391 1.00 0.00 ? 689  ALA B CA 1 
ATOM 5974 C CA . GLU G  7  690  ? 148.208 196.490 193.057 1.00 0.00 ? 690  GLU B CA 1 
ATOM 5975 C CA . PRO G  7  691  ? 150.795 195.343 190.457 1.00 0.00 ? 691  PRO B CA 1 
ATOM 5976 C CA . LEU G  7  692  ? 149.917 195.455 186.742 1.00 0.00 ? 692  LEU B CA 1 
ATOM 5977 C CA . GLU G  7  693  ? 150.332 192.547 184.328 1.00 0.00 ? 693  GLU B CA 1 
ATOM 5978 C CA . LYS G  7  694  ? 153.439 192.789 182.115 1.00 0.00 ? 694  LYS B CA 1 
ATOM 5979 C CA . GLY G  7  695  ? 151.261 192.756 178.954 1.00 0.00 ? 695  GLY B CA 1 
ATOM 5980 C CA . LEU G  7  696  ? 149.757 196.118 180.001 1.00 0.00 ? 696  LEU B CA 1 
ATOM 5981 C CA . ALA G  7  697  ? 152.797 198.167 181.034 1.00 0.00 ? 697  ALA B CA 1 
ATOM 5982 C CA . GLU G  7  698  ? 154.482 197.964 177.608 1.00 0.00 ? 698  GLU B CA 1 
ATOM 5983 C CA . ASP G  7  699  ? 151.354 199.183 175.769 1.00 0.00 ? 699  ASP B CA 1 
ATOM 5984 C CA . ILE G  7  700  ? 151.295 202.562 177.553 1.00 0.00 ? 700  ILE B CA 1 
ATOM 5985 C CA . GLU G  7  701  ? 154.933 203.453 176.828 1.00 0.00 ? 701  GLU B CA 1 
ATOM 5986 C CA . ASN G  7  702  ? 154.441 202.552 173.152 1.00 0.00 ? 702  ASN B CA 1 
ATOM 5987 C CA . GLU G  7  703  ? 151.439 204.964 172.771 1.00 0.00 ? 703  GLU B CA 1 
ATOM 5988 C CA . VAL G  7  704  ? 148.565 202.524 172.180 1.00 0.00 ? 704  VAL B CA 1 
ATOM 5989 C CA . VAL G  7  705  ? 146.429 204.208 174.869 1.00 0.00 ? 705  VAL B CA 1 
ATOM 5990 C CA . GLN G  7  706  ? 146.247 207.915 175.776 1.00 0.00 ? 706  GLN B CA 1 
ATOM 5991 C CA . ILE G  7  707  ? 144.563 210.263 178.245 1.00 0.00 ? 707  ILE B CA 1 
ATOM 5992 C CA . THR G  7  708  ? 143.470 212.479 175.315 1.00 0.00 ? 708  THR B CA 1 
ATOM 5993 C CA . TRP G  7  709  ? 141.163 209.776 173.866 1.00 0.00 ? 709  TRP B CA 1 
ATOM 5994 C CA . ASN G  7  710  ? 137.520 209.531 174.933 1.00 0.00 ? 710  ASN B CA 1 
ATOM 5995 C CA . ARG G  7  711  ? 136.793 207.418 178.039 1.00 0.00 ? 711  ARG B CA 1 
ATOM 5996 C CA . LYS G  7  712  ? 134.628 205.030 175.967 1.00 0.00 ? 712  LYS B CA 1 
ATOM 5997 C CA . LYS G  7  713  ? 137.477 204.080 173.568 1.00 0.00 ? 713  LYS B CA 1 
ATOM 5998 C CA . LEU G  7  714  ? 139.905 203.596 176.480 1.00 0.00 ? 714  LEU B CA 1 
ATOM 5999 C CA . GLY G  7  715  ? 137.446 201.358 178.372 1.00 0.00 ? 715  GLY B CA 1 
ATOM 6000 C CA . GLU G  7  716  ? 137.079 199.151 175.272 1.00 0.00 ? 716  GLU B CA 1 
ATOM 6001 C CA . PHE G  7  717  ? 140.855 198.511 175.353 1.00 0.00 ? 717  PHE B CA 1 
ATOM 6002 C CA . PHE G  7  718  ? 141.119 196.972 178.853 1.00 0.00 ? 718  PHE B CA 1 
ATOM 6003 C CA . GLN G  7  719  ? 137.817 195.037 178.775 1.00 0.00 ? 719  GLN B CA 1 
ATOM 6004 C CA . THR G  7  720  ? 138.747 193.142 175.596 1.00 0.00 ? 720  THR B CA 1 
ATOM 6005 C CA . LYS G  7  721  ? 142.468 192.515 176.200 1.00 0.00 ? 721  LYS B CA 1 
ATOM 6006 C CA . TYR G  7  722  ? 142.848 191.986 179.965 1.00 0.00 ? 722  TYR B CA 1 
ATOM 6007 C CA . ASP G  7  723  ? 139.179 191.427 180.934 1.00 0.00 ? 723  ASP B CA 1 
ATOM 6008 C CA . TRP G  7  724  ? 138.628 194.324 183.354 1.00 0.00 ? 724  TRP B CA 1 
ATOM 6009 C CA . ASP G  7  725  ? 135.253 195.206 184.896 1.00 0.00 ? 725  ASP B CA 1 
ATOM 6010 C CA . LEU G  7  726  ? 132.894 197.684 183.193 1.00 0.00 ? 726  LEU B CA 1 
ATOM 6011 C CA . LEU G  7  727  ? 132.813 200.296 185.969 1.00 0.00 ? 727  LEU B CA 1 
ATOM 6012 C CA . ALA G  7  728  ? 136.512 199.734 186.721 1.00 0.00 ? 728  ALA B CA 1 
ATOM 6013 C CA . ALA G  7  729  ? 137.466 200.343 183.058 1.00 0.00 ? 729  ALA B CA 1 
ATOM 6014 C CA . ARG G  7  730  ? 135.655 203.695 182.768 1.00 0.00 ? 730  ARG B CA 1 
ATOM 6015 C CA . SER G  7  731  ? 137.008 205.005 186.099 1.00 0.00 ? 731  SER B CA 1 
ATOM 6016 C CA . ILE G  7  732  ? 140.634 205.689 185.017 1.00 0.00 ? 732  ILE B CA 1 
ATOM 6017 C CA . TRP G  7  733  ? 141.720 209.174 186.094 1.00 0.00 ? 733  TRP B CA 1 
ATOM 6018 C CA . ALA G  7  734  ? 145.167 209.743 184.536 1.00 0.00 ? 734  ALA B CA 1 
ATOM 6019 C CA . PHE G  7  735  ? 148.451 207.975 183.787 1.00 0.00 ? 735  PHE B CA 1 
ATOM 6020 C CA . GLY G  7  736  ? 151.527 208.042 185.997 1.00 0.00 ? 736  GLY B CA 1 
ATOM 6021 C CA . PRO G  7  737  ? 154.505 210.451 186.149 1.00 0.00 ? 737  PRO B CA 1 
ATOM 6022 C CA . ASP G  7  738  ? 154.123 213.027 183.354 1.00 0.00 ? 738  ASP B CA 1 
ATOM 6023 C CA . ALA G  7  739  ? 151.560 211.136 181.247 1.00 0.00 ? 739  ALA B CA 1 
ATOM 6024 C CA . THR G  7  740  ? 153.694 208.116 180.164 1.00 0.00 ? 740  THR B CA 1 
ATOM 6025 C CA . GLY G  7  741  ? 155.150 206.280 183.182 1.00 0.00 ? 741  GLY B CA 1 
ATOM 6026 C CA . PRO G  7  742  ? 153.135 203.024 183.750 1.00 0.00 ? 742  PRO B CA 1 
ATOM 6027 C CA . ASN G  7  743  ? 151.104 204.094 186.804 1.00 0.00 ? 743  ASN B CA 1 
ATOM 6028 C CA . ILE G  7  744  ? 147.304 204.425 186.882 1.00 0.00 ? 744  ILE B CA 1 
ATOM 6029 C CA . LEU G  7  745  ? 144.648 206.028 189.100 1.00 0.00 ? 745  LEU B CA 1 
ATOM 6030 C CA . VAL G  7  746  ? 141.131 204.578 189.522 1.00 0.00 ? 746  VAL B CA 1 
ATOM 6031 C CA . ASP G  7  747  ? 137.937 204.848 191.579 1.00 0.00 ? 747  ASP B CA 1 
ATOM 6032 C CA . ASP G  7  748  ? 136.724 201.953 193.755 1.00 0.00 ? 748  ASP B CA 1 
ATOM 6033 C CA . THR G  7  749  ? 133.676 203.050 195.751 1.00 0.00 ? 749  THR B CA 1 
ATOM 6034 C CA . LEU G  7  750  ? 129.902 203.621 195.716 1.00 0.00 ? 750  LEU B CA 1 
ATOM 6035 C CA . PRO G  7  751  ? 129.615 206.911 197.777 1.00 0.00 ? 751  PRO B CA 1 
ATOM 6036 C CA . SER G  7  752  ? 131.378 208.610 194.825 1.00 0.00 ? 752  SER B CA 1 
ATOM 6037 C CA . GLU G  7  753  ? 128.112 208.061 192.892 1.00 0.00 ? 753  GLU B CA 1 
ATOM 6038 C CA . VAL G  7  754  ? 126.163 209.729 195.746 1.00 0.00 ? 754  VAL B CA 1 
ATOM 6039 C CA . ASP G  7  755  ? 128.637 212.628 196.071 1.00 0.00 ? 755  ASP B CA 1 
ATOM 6040 C CA . LYS G  7  756  ? 129.826 212.835 192.466 1.00 0.00 ? 756  LYS B CA 1 
ATOM 6041 C CA . ALA G  7  757  ? 129.914 216.636 192.060 1.00 0.00 ? 757  ALA B CA 1 
ATOM 6042 C CA . LEU G  7  758  ? 131.656 216.824 195.455 1.00 0.00 ? 758  LEU B CA 1 
ATOM 6043 C CA . LEU G  7  759  ? 134.491 214.564 194.235 1.00 0.00 ? 759  LEU B CA 1 
ATOM 6044 C CA . GLY G  7  760  ? 134.557 216.539 190.947 1.00 0.00 ? 760  GLY B CA 1 
ATOM 6045 C CA . SER G  7  761  ? 135.983 219.515 192.898 1.00 0.00 ? 761  SER B CA 1 
ATOM 6046 C CA . VAL G  7  762  ? 138.927 217.282 193.955 1.00 0.00 ? 762  VAL B CA 1 
ATOM 6047 C CA . LYS G  7  763  ? 140.066 216.097 190.489 1.00 0.00 ? 763  LYS B CA 1 
ATOM 6048 C CA . ASP G  7  764  ? 143.282 218.092 190.015 1.00 0.00 ? 764  ASP B CA 1 
ATOM 6049 C CA . SER G  7  765  ? 144.218 218.152 193.717 1.00 0.00 ? 765  SER B CA 1 
ATOM 6050 C CA . ILE G  7  766  ? 144.926 214.391 193.548 1.00 0.00 ? 766  ILE B CA 1 
ATOM 6051 C CA . VAL G  7  767  ? 146.742 214.465 190.179 1.00 0.00 ? 767  VAL B CA 1 
ATOM 6052 C CA . GLN G  7  768  ? 149.084 217.326 191.165 1.00 0.00 ? 768  GLN B CA 1 
ATOM 6053 C CA . GLY G  7  769  ? 150.207 215.301 194.214 1.00 0.00 ? 769  GLY B CA 1 
ATOM 6054 C CA . PHE G  7  770  ? 150.351 212.062 192.185 1.00 0.00 ? 770  PHE B CA 1 
ATOM 6055 C CA . GLN G  7  771  ? 152.134 212.990 188.930 1.00 0.00 ? 771  GLN B CA 1 
ATOM 6056 C CA . TRP G  7  772  ? 154.565 214.994 191.106 1.00 0.00 ? 772  TRP B CA 1 
ATOM 6057 C CA . GLY G  7  773  ? 154.381 212.395 193.920 1.00 0.00 ? 773  GLY B CA 1 
ATOM 6058 C CA . THR G  7  774  ? 155.297 209.390 191.720 1.00 0.00 ? 774  THR B CA 1 
ATOM 6059 C CA . ARG G  7  775  ? 157.868 211.195 189.541 1.00 0.00 ? 775  ARG B CA 1 
ATOM 6060 C CA . GLU G  7  776  ? 159.994 210.702 192.652 1.00 0.00 ? 776  GLU B CA 1 
ATOM 6061 C CA . GLY G  7  777  ? 159.752 207.585 194.792 1.00 0.00 ? 777  GLY B CA 1 
ATOM 6062 C CA . PRO G  7  778  ? 160.044 206.384 198.432 1.00 0.00 ? 778  PRO B CA 1 
ATOM 6063 C CA . LEU G  7  779  ? 163.252 204.338 198.217 1.00 0.00 ? 779  LEU B CA 1 
ATOM 6064 C CA . CYS G  7  780  ? 165.798 206.255 196.150 1.00 0.00 ? 780  CYS B CA 1 
ATOM 6065 C CA . ASP G  7  781  ? 163.773 209.305 194.978 1.00 0.00 ? 781  ASP B CA 1 
ATOM 6066 C CA . GLU G  7  782  ? 163.323 207.683 191.547 1.00 0.00 ? 782  GLU B CA 1 
ATOM 6067 C CA . LEU G  7  783  ? 160.527 206.868 189.070 1.00 0.00 ? 783  LEU B CA 1 
ATOM 6068 C CA . ILE G  7  784  ? 157.912 204.118 189.597 1.00 0.00 ? 784  ILE B CA 1 
ATOM 6069 C CA . ARG G  7  785  ? 156.560 201.393 187.272 1.00 0.00 ? 785  ARG B CA 1 
ATOM 6070 C CA . ASN G  7  786  ? 153.466 199.151 187.037 1.00 0.00 ? 786  ASN B CA 1 
ATOM 6071 C CA . VAL G  7  787  ? 151.659 200.608 190.092 1.00 0.00 ? 787  VAL B CA 1 
ATOM 6072 C CA . LYS G  7  788  ? 147.870 200.961 190.024 1.00 0.00 ? 788  LYS B CA 1 
ATOM 6073 C CA . PHE G  7  789  ? 145.962 203.093 192.547 1.00 0.00 ? 789  PHE B CA 1 
ATOM 6074 C CA . LYS G  7  790  ? 142.375 202.604 193.779 1.00 0.00 ? 790  LYS B CA 1 
ATOM 6075 C CA . ILE G  7  791  ? 140.584 205.422 195.617 1.00 0.00 ? 791  ILE B CA 1 
ATOM 6076 C CA . LEU G  7  792  ? 138.486 203.763 198.326 1.00 0.00 ? 792  LEU B CA 1 
ATOM 6077 C CA . ASP G  7  793  ? 137.172 206.139 201.008 1.00 0.00 ? 793  ASP B CA 1 
ATOM 6078 C CA . ALA G  7  794  ? 136.961 209.928 200.789 1.00 0.00 ? 794  ALA B CA 1 
ATOM 6079 C CA . VAL G  7  795  ? 135.684 211.818 203.857 1.00 0.00 ? 795  VAL B CA 1 
ATOM 6080 C CA . VAL G  7  796  ? 134.767 215.418 203.087 1.00 0.00 ? 796  VAL B CA 1 
ATOM 6081 C CA . ALA G  7  797  ? 133.967 218.815 204.676 1.00 0.00 ? 797  ALA B CA 1 
ATOM 6082 C CA . GLN G  7  798  ? 131.362 221.532 203.850 1.00 0.00 ? 798  GLN B CA 1 
ATOM 6083 C CA . GLU G  7  799  ? 133.249 224.381 202.132 1.00 0.00 ? 799  GLU B CA 1 
ATOM 6084 C CA . PRO G  7  800  ? 135.945 224.189 199.436 1.00 0.00 ? 800  PRO B CA 1 
ATOM 6085 C CA . LEU G  7  801  ? 138.105 226.485 201.634 1.00 0.00 ? 801  LEU B CA 1 
ATOM 6086 C CA . HIS G  7  802  ? 138.732 223.531 203.955 1.00 0.00 ? 802  HIS B CA 1 
ATOM 6087 C CA . ARG G  7  803  ? 139.747 221.616 200.800 1.00 0.00 ? 803  ARG B CA 1 
ATOM 6088 C CA . GLY G  7  804  ? 142.749 223.711 199.713 1.00 0.00 ? 804  GLY B CA 1 
ATOM 6089 C CA . GLY G  7  805  ? 145.741 223.017 197.430 1.00 0.00 ? 805  GLY B CA 1 
ATOM 6090 C CA . GLY G  7  806  ? 148.185 223.311 200.365 1.00 0.00 ? 806  GLY B CA 1 
ATOM 6091 C CA . GLN G  7  807  ? 145.984 221.007 202.484 1.00 0.00 ? 807  GLN B CA 1 
ATOM 6092 C CA . ILE G  7  808  ? 145.282 218.237 199.929 1.00 0.00 ? 808  ILE B CA 1 
ATOM 6093 C CA . ILE G  7  809  ? 148.241 217.883 197.507 1.00 0.00 ? 809  ILE B CA 1 
ATOM 6094 C CA . PRO G  7  810  ? 151.000 217.222 200.144 1.00 0.00 ? 810  PRO B CA 1 
ATOM 6095 C CA . THR G  7  811  ? 148.703 214.655 201.851 1.00 0.00 ? 811  THR B CA 1 
ATOM 6096 C CA . ALA G  7  812  ? 147.347 213.081 198.629 1.00 0.00 ? 812  ALA B CA 1 
ATOM 6097 C CA . ARG G  7  813  ? 150.986 212.322 197.750 1.00 0.00 ? 813  ARG B CA 1 
ATOM 6098 C CA . ARG G  7  814  ? 151.688 210.753 201.183 1.00 0.00 ? 814  ARG B CA 1 
ATOM 6099 C CA . VAL G  7  815  ? 149.077 208.049 200.424 1.00 0.00 ? 815  VAL B CA 1 
ATOM 6100 C CA . VAL G  7  816  ? 151.250 206.530 197.653 1.00 0.00 ? 816  VAL B CA 1 
ATOM 6101 C CA . TYR G  7  817  ? 154.332 206.204 199.893 1.00 0.00 ? 817  TYR B CA 1 
ATOM 6102 C CA . SER G  7  818  ? 152.292 204.502 202.649 1.00 0.00 ? 818  SER B CA 1 
ATOM 6103 C CA . ALA G  7  819  ? 150.758 201.878 200.304 1.00 0.00 ? 819  ALA B CA 1 
ATOM 6104 C CA . PHE G  7  820  ? 154.264 201.086 198.964 1.00 0.00 ? 820  PHE B CA 1 
ATOM 6105 C CA . LEU G  7  821  ? 155.756 199.865 202.264 1.00 0.00 ? 821  LEU B CA 1 
ATOM 6106 C CA . MET G  7  822  ? 152.828 197.532 202.953 1.00 0.00 ? 822  MET B CA 1 
ATOM 6107 C CA . ALA G  7  823  ? 152.814 196.092 199.437 1.00 0.00 ? 823  ALA B CA 1 
ATOM 6108 C CA . THR G  7  824  ? 156.489 194.910 199.477 1.00 0.00 ? 824  THR B CA 1 
ATOM 6109 C CA . PRO G  7  825  ? 158.392 196.934 196.807 1.00 0.00 ? 825  PRO B CA 1 
ATOM 6110 C CA . ARG G  7  826  ? 161.551 195.969 194.873 1.00 0.00 ? 826  ARG B CA 1 
ATOM 6111 C CA . LEU G  7  827  ? 164.049 197.767 192.614 1.00 0.00 ? 827  LEU B CA 1 
ATOM 6112 C CA . MET G  7  828  ? 164.129 197.262 188.860 1.00 0.00 ? 828  MET B CA 1 
ATOM 6113 C CA . GLU G  7  829  ? 167.159 197.959 186.711 1.00 0.00 ? 829  GLU B CA 1 
ATOM 6114 C CA . PRO G  7  830  ? 167.603 198.353 182.916 1.00 0.00 ? 830  PRO B CA 1 
ATOM 6115 C CA . TYR G  7  831  ? 169.089 195.612 180.762 1.00 0.00 ? 831  TYR B CA 1 
ATOM 6116 C CA . TYR G  7  832  ? 170.198 196.183 177.178 1.00 0.00 ? 832  TYR B CA 1 
ATOM 6117 C CA . PHE G  7  833  ? 170.377 193.775 174.270 1.00 0.00 ? 833  PHE B CA 1 
ATOM 6118 C CA . VAL G  7  834  ? 173.967 192.838 173.489 1.00 0.00 ? 834  VAL B CA 1 
ATOM 6119 C CA . GLU G  7  835  ? 174.174 191.694 169.865 1.00 0.00 ? 835  GLU B CA 1 
ATOM 6120 C CA . VAL G  7  836  ? 177.559 190.129 169.355 1.00 0.00 ? 836  VAL B CA 1 
ATOM 6121 C CA . GLN G  7  837  ? 178.945 188.863 166.073 1.00 0.00 ? 837  GLN B CA 1 
ATOM 6122 C CA . ALA G  7  838  ? 181.660 186.214 166.074 1.00 0.00 ? 838  ALA B CA 1 
ATOM 6123 C CA . PRO G  7  839  ? 183.463 183.238 164.466 1.00 0.00 ? 839  PRO B CA 1 
ATOM 6124 C CA . ALA G  7  840  ? 182.403 179.745 165.632 1.00 0.00 ? 840  ALA B CA 1 
ATOM 6125 C CA . ASP G  7  841  ? 185.632 179.161 167.625 1.00 0.00 ? 841  ASP B CA 1 
ATOM 6126 C CA . CYS G  7  842  ? 185.312 182.220 169.884 1.00 0.00 ? 842  CYS B CA 1 
ATOM 6127 C CA . VAL G  7  843  ? 181.777 181.178 170.958 1.00 0.00 ? 843  VAL B CA 1 
ATOM 6128 C CA . SER G  7  844  ? 182.678 179.370 174.232 1.00 0.00 ? 844  SER B CA 1 
ATOM 6129 C CA . ALA G  7  845  ? 184.523 182.465 175.552 1.00 0.00 ? 845  ALA B CA 1 
ATOM 6130 C CA . VAL G  7  846  ? 181.420 184.651 175.002 1.00 0.00 ? 846  VAL B CA 1 
ATOM 6131 C CA . TYR G  7  847  ? 179.186 182.399 177.137 1.00 0.00 ? 847  TYR B CA 1 
ATOM 6132 C CA . THR G  7  848  ? 181.779 182.142 179.914 1.00 0.00 ? 848  THR B CA 1 
ATOM 6133 C CA . VAL G  7  849  ? 182.069 185.964 179.954 1.00 0.00 ? 849  VAL B CA 1 
ATOM 6134 C CA . LEU G  7  850  ? 178.291 186.582 179.868 1.00 0.00 ? 850  LEU B CA 1 
ATOM 6135 C CA . ALA G  7  851  ? 177.291 184.131 182.617 1.00 0.00 ? 851  ALA B CA 1 
ATOM 6136 C CA . ARG G  7  852  ? 179.564 185.930 185.124 1.00 0.00 ? 852  ARG B CA 1 
ATOM 6137 C CA . ARG G  7  853  ? 177.721 189.234 184.489 1.00 0.00 ? 853  ARG B CA 1 
ATOM 6138 C CA . ARG G  7  854  ? 174.171 187.732 184.504 1.00 0.00 ? 854  ARG B CA 1 
ATOM 6139 C CA . GLY G  7  855  ? 173.584 186.915 180.808 1.00 0.00 ? 855  GLY B CA 1 
ATOM 6140 C CA . HIS G  7  856  ? 170.599 185.252 179.101 1.00 0.00 ? 856  HIS B CA 1 
ATOM 6141 C CA . VAL G  7  857  ? 171.333 184.203 175.498 1.00 0.00 ? 857  VAL B CA 1 
ATOM 6142 C CA . THR G  7  858  ? 167.996 184.672 173.708 1.00 0.00 ? 858  THR B CA 1 
ATOM 6143 C CA . GLN G  7  859  ? 169.280 183.245 170.395 1.00 0.00 ? 859  GLN B CA 1 
ATOM 6144 C CA . ASP G  7  860  ? 172.449 181.824 168.861 1.00 0.00 ? 860  ASP B CA 1 
ATOM 6145 C CA . ALA G  7  861  ? 172.597 181.113 165.131 1.00 0.00 ? 861  ALA B CA 1 
ATOM 6146 C CA . PRO G  7  862  ? 175.099 180.999 162.240 1.00 0.00 ? 862  PRO B CA 1 
ATOM 6147 C CA . ILE G  7  863  ? 173.683 183.984 160.308 1.00 0.00 ? 863  ILE B CA 1 
ATOM 6148 C CA . PRO G  7  864  ? 173.044 183.457 156.553 1.00 0.00 ? 864  PRO B CA 1 
ATOM 6149 C CA . GLY G  7  865  ? 175.246 184.597 153.662 1.00 0.00 ? 865  GLY B CA 1 
ATOM 6150 C CA . SER G  7  866  ? 178.277 185.158 155.939 1.00 0.00 ? 866  SER B CA 1 
ATOM 6151 C CA . PRO G  7  867  ? 180.364 182.855 158.224 1.00 0.00 ? 867  PRO B CA 1 
ATOM 6152 C CA . LEU G  7  868  ? 179.367 184.560 161.514 1.00 0.00 ? 868  LEU B CA 1 
ATOM 6153 C CA . TYR G  7  869  ? 177.375 183.467 164.560 1.00 0.00 ? 869  TYR B CA 1 
ATOM 6154 C CA . THR G  7  870  ? 175.027 186.026 166.098 1.00 0.00 ? 870  THR B CA 1 
ATOM 6155 C CA . ILE G  7  871  ? 174.753 185.952 169.885 1.00 0.00 ? 871  ILE B CA 1 
ATOM 6156 C CA . LYS G  7  872  ? 171.818 188.049 170.994 1.00 0.00 ? 872  LYS B CA 1 
ATOM 6157 C CA . ALA G  7  873  ? 171.853 188.604 174.818 1.00 0.00 ? 873  ALA B CA 1 
ATOM 6158 C CA . PHE G  7  874  ? 170.690 190.718 177.751 1.00 0.00 ? 874  PHE B CA 1 
ATOM 6159 C CA . ILE G  7  875  ? 172.878 192.352 180.380 1.00 0.00 ? 875  ILE B CA 1 
ATOM 6160 C CA . PRO G  7  876  ? 172.109 194.383 183.539 1.00 0.00 ? 876  PRO B CA 1 
ATOM 6161 C CA . ALA G  7  877  ? 173.598 197.820 182.831 1.00 0.00 ? 877  ALA B CA 1 
ATOM 6162 C CA . ILE G  7  878  ? 175.520 197.781 186.151 1.00 0.00 ? 878  ILE B CA 1 
ATOM 6163 C CA . ASP G  7  879  ? 177.414 194.652 184.992 1.00 0.00 ? 879  ASP B CA 1 
ATOM 6164 C CA . SER G  7  880  ? 178.228 195.805 181.435 1.00 0.00 ? 880  SER B CA 1 
ATOM 6165 C CA . PHE G  7  881  ? 180.891 198.364 182.458 1.00 0.00 ? 881  PHE B CA 1 
ATOM 6166 C CA . GLY G  7  882  ? 183.578 197.487 179.890 1.00 0.00 ? 882  GLY B CA 1 
ATOM 6167 C CA . PHE G  7  883  ? 181.975 194.187 178.790 1.00 0.00 ? 883  PHE B CA 1 
ATOM 6168 C CA . GLU G  7  884  ? 182.805 195.332 175.239 1.00 0.00 ? 884  GLU B CA 1 
ATOM 6169 C CA . THR G  7  885  ? 186.567 195.716 175.805 1.00 0.00 ? 885  THR B CA 1 
ATOM 6170 C CA . ASP G  7  886  ? 186.826 192.201 177.305 1.00 0.00 ? 886  ASP B CA 1 
ATOM 6171 C CA . LEU G  7  887  ? 185.221 190.672 174.216 1.00 0.00 ? 887  LEU B CA 1 
ATOM 6172 C CA . ARG G  7  888  ? 187.679 192.309 171.838 1.00 0.00 ? 888  ARG B CA 1 
ATOM 6173 C CA . THR G  7  889  ? 190.708 191.366 173.978 1.00 0.00 ? 889  THR B CA 1 
ATOM 6174 C CA . HIS G  7  890  ? 189.902 187.695 174.695 1.00 0.00 ? 890  HIS B CA 1 
ATOM 6175 C CA . THR G  7  891  ? 188.777 186.881 171.131 1.00 0.00 ? 891  THR B CA 1 
ATOM 6176 C CA . GLN G  7  892  ? 191.771 188.697 169.535 1.00 0.00 ? 892  GLN B CA 1 
ATOM 6177 C CA . GLY G  7  893  ? 190.192 191.341 167.272 1.00 0.00 ? 893  GLY B CA 1 
ATOM 6178 C CA . GLN G  7  894  ? 187.204 189.086 166.439 1.00 0.00 ? 894  GLN B CA 1 
ATOM 6179 C CA . ALA G  7  895  ? 183.677 189.585 167.878 1.00 0.00 ? 895  ALA B CA 1 
ATOM 6180 C CA . PHE G  7  896  ? 181.998 193.023 167.989 1.00 0.00 ? 896  PHE B CA 1 
ATOM 6181 C CA . SER G  7  897  ? 179.182 193.934 170.379 1.00 0.00 ? 897  SER B CA 1 
ATOM 6182 C CA . LEU G  7  898  ? 176.543 196.651 170.738 1.00 0.00 ? 898  LEU B CA 1 
ATOM 6183 C CA . SER G  7  899  ? 174.168 197.543 173.582 1.00 0.00 ? 899  SER B CA 1 
ATOM 6184 C CA . VAL G  7  900  ? 170.708 198.885 172.729 1.00 0.00 ? 900  VAL B CA 1 
ATOM 6185 C CA . PHE G  7  901  ? 168.505 200.005 175.661 1.00 0.00 ? 901  PHE B CA 1 
ATOM 6186 C CA . HIS G  7  902  ? 165.652 197.562 176.291 1.00 0.00 ? 902  HIS B CA 1 
ATOM 6187 C CA . HIS G  7  903  ? 163.459 195.992 178.957 1.00 0.00 ? 903  HIS B CA 1 
ATOM 6188 C CA . TRP G  7  904  ? 163.471 196.610 182.726 1.00 0.00 ? 904  TRP B CA 1 
ATOM 6189 C CA . GLN G  7  905  ? 164.373 193.648 184.928 1.00 0.00 ? 905  GLN B CA 1 
ATOM 6190 C CA . ILE G  7  906  ? 163.580 193.442 188.657 1.00 0.00 ? 906  ILE B CA 1 
ATOM 6191 C CA . VAL G  7  907  ? 166.366 192.877 191.177 1.00 0.00 ? 907  VAL B CA 1 
ATOM 6192 C CA . PRO G  7  908  ? 166.106 189.335 192.690 1.00 0.00 ? 908  PRO B CA 1 
ATOM 6193 C CA . GLY G  7  909  ? 166.134 190.119 196.448 1.00 0.00 ? 909  GLY B CA 1 
ATOM 6194 C CA . ASP G  7  910  ? 164.186 192.494 198.668 1.00 0.00 ? 910  ASP B CA 1 
ATOM 6195 C CA . PRO G  7  911  ? 165.591 196.011 199.322 1.00 0.00 ? 911  PRO B CA 1 
ATOM 6196 C CA . LEU G  7  912  ? 164.063 196.138 202.844 1.00 0.00 ? 912  LEU B CA 1 
ATOM 6197 C CA . ASP G  7  913  ? 165.643 193.387 204.935 1.00 0.00 ? 913  ASP B CA 1 
ATOM 6198 C CA . LYS G  7  914  ? 167.702 194.065 208.078 1.00 0.00 ? 914  LYS B CA 1 
ATOM 6199 C CA . SER G  7  915  ? 169.392 190.626 208.226 1.00 0.00 ? 915  SER B CA 1 
ATOM 6200 C CA . ILE G  7  916  ? 171.365 191.032 204.964 1.00 0.00 ? 916  ILE B CA 1 
ATOM 6201 C CA . VAL G  7  917  ? 174.119 193.694 205.337 1.00 0.00 ? 917  VAL B CA 1 
ATOM 6202 C CA . ILE G  7  918  ? 177.441 192.168 204.231 1.00 0.00 ? 918  ILE B CA 1 
ATOM 6203 C CA . ARG G  7  919  ? 180.542 194.320 203.538 1.00 0.00 ? 919  ARG B CA 1 
ATOM 6204 C CA . PRO G  7  920  ? 181.367 197.548 201.627 1.00 0.00 ? 920  PRO B CA 1 
ATOM 6205 C CA . LEU G  7  921  ? 184.371 195.996 199.818 1.00 0.00 ? 921  LEU B CA 1 
ATOM 6206 C CA . GLU G  7  922  ? 183.263 192.800 198.095 1.00 0.00 ? 922  GLU B CA 1 
ATOM 6207 C CA . PRO G  7  923  ? 180.314 192.515 195.639 1.00 0.00 ? 923  PRO B CA 1 
ATOM 6208 C CA . GLN G  7  924  ? 177.035 190.678 196.173 1.00 0.00 ? 924  GLN B CA 1 
ATOM 6209 C CA . PRO G  7  925  ? 175.627 187.328 194.866 1.00 0.00 ? 925  PRO B CA 1 
ATOM 6210 C CA . ALA G  7  926  ? 171.913 186.569 195.183 1.00 0.00 ? 926  ALA B CA 1 
ATOM 6211 C CA . PRO G  7  927  ? 168.860 188.232 197.025 1.00 0.00 ? 927  PRO B CA 1 
ATOM 6212 C CA . HIS G  7  928  ? 171.364 189.964 199.321 1.00 0.00 ? 928  HIS B CA 1 
ATOM 6213 C CA . LEU G  7  929  ? 172.318 192.187 196.320 1.00 0.00 ? 929  LEU B CA 1 
ATOM 6214 C CA . ALA G  7  930  ? 169.079 194.094 196.218 1.00 0.00 ? 930  ALA B CA 1 
ATOM 6215 C CA . ARG G  7  931  ? 169.580 195.514 199.722 1.00 0.00 ? 931  ARG B CA 1 
ATOM 6216 C CA . GLU G  7  932  ? 173.170 196.439 198.768 1.00 0.00 ? 932  GLU B CA 1 
ATOM 6217 C CA . PHE G  7  933  ? 172.109 198.790 195.923 1.00 0.00 ? 933  PHE B CA 1 
ATOM 6218 C CA . MET G  7  934  ? 169.551 200.648 198.056 1.00 0.00 ? 934  MET B CA 1 
ATOM 6219 C CA . ILE G  7  935  ? 171.910 201.617 200.913 1.00 0.00 ? 935  ILE B CA 1 
ATOM 6220 C CA . LYS G  7  936  ? 174.618 202.624 198.417 1.00 0.00 ? 936  LYS B CA 1 
ATOM 6221 C CA . THR G  7  937  ? 172.213 204.668 196.255 1.00 0.00 ? 937  THR B CA 1 
ATOM 6222 C CA . ARG G  7  938  ? 170.811 206.604 199.242 1.00 0.00 ? 938  ARG B CA 1 
ATOM 6223 C CA . ARG G  7  939  ? 174.373 207.079 200.589 1.00 0.00 ? 939  ARG B CA 1 
ATOM 6224 C CA . ARG G  7  940  ? 175.281 208.966 197.386 1.00 0.00 ? 940  ARG B CA 1 
ATOM 6225 C CA . LYS G  7  941  ? 172.093 211.093 197.387 1.00 0.00 ? 941  LYS B CA 1 
ATOM 6226 C CA . GLY G  7  942  ? 172.552 212.178 201.020 1.00 0.00 ? 942  GLY B CA 1 
ATOM 6227 C CA . LEU G  7  943  ? 169.413 210.549 202.483 1.00 0.00 ? 943  LEU B CA 1 
ATOM 6228 C CA . SER G  7  944  ? 168.980 208.534 205.693 1.00 0.00 ? 944  SER B CA 1 
ATOM 6229 C CA . GLU G  7  945  ? 170.888 205.277 205.092 1.00 0.00 ? 945  GLU B CA 1 
ATOM 6230 C CA . ASP G  7  946  ? 168.787 202.834 207.117 1.00 0.00 ? 946  ASP B CA 1 
ATOM 6231 C CA . VAL G  7  947  ? 165.439 203.907 205.578 1.00 0.00 ? 947  VAL B CA 1 
ATOM 6232 C CA . SER G  7  948  ? 164.012 203.073 209.033 1.00 0.00 ? 948  SER B CA 1 
ATOM 6233 C CA . ILE G  7  949  ? 161.937 206.314 208.966 1.00 0.00 ? 949  ILE B CA 1 
ATOM 6234 C CA . SER G  7  950  ? 159.004 204.352 207.461 1.00 0.00 ? 950  SER B CA 1 
ATOM 6235 C CA . LYS G  7  951  ? 156.887 205.402 210.475 1.00 0.00 ? 951  LYS B CA 1 
ATOM 6236 C CA . PHE G  7  952  ? 156.833 209.035 209.248 1.00 0.00 ? 952  PHE B CA 1 
ATOM 6237 C CA . PHE G  7  953  ? 154.866 208.261 206.087 1.00 0.00 ? 953  PHE B CA 1 
ATOM 6238 C CA . ASP G  7  954  ? 152.719 205.476 207.553 1.00 0.00 ? 954  ASP B CA 1 
ATOM 6239 C CA . ASP G  7  955  ? 150.251 207.640 209.549 1.00 0.00 ? 955  ASP B CA 1 
ATOM 6240 C CA . PRO G  7  956  ? 149.464 206.432 213.117 1.00 0.00 ? 956  PRO B CA 1 
ATOM 6241 C CA . MET G  7  957  ? 147.693 203.237 214.229 1.00 0.00 ? 957  MET B CA 1 
ATOM 6242 C CA . SER H  8  7    ? 182.978 224.930 114.269 1.00 0.00 ? 7    SER O CA 1 
ATOM 6243 C CA . LYS H  8  8    ? 181.127 228.205 113.610 1.00 0.00 ? 8    LYS O CA 1 
ATOM 6244 C CA . MET H  8  9    ? 178.960 227.376 116.662 1.00 0.00 ? 9    MET O CA 1 
ATOM 6245 C CA . LEU H  8  10   ? 181.972 227.883 118.985 1.00 0.00 ? 10   LEU O CA 1 
ATOM 6246 C CA . GLN H  8  11   ? 182.663 231.398 117.599 1.00 0.00 ? 11   GLN O CA 1 
ATOM 6247 C CA . HIS H  8  12   ? 179.294 232.961 118.605 1.00 0.00 ? 12   HIS O CA 1 
ATOM 6248 C CA . ILE H  8  13   ? 179.330 231.615 122.193 1.00 0.00 ? 13   ILE O CA 1 
ATOM 6249 C CA . ASP H  8  14   ? 178.933 234.462 124.746 1.00 0.00 ? 14   ASP O CA 1 
ATOM 6250 C CA . TYR H  8  15   ? 177.515 236.803 122.088 1.00 0.00 ? 15   TYR O CA 1 
ATOM 6251 C CA . ARG H  8  16   ? 174.601 239.215 121.634 1.00 0.00 ? 16   ARG O CA 1 
ATOM 6252 C CA . MET H  8  17   ? 173.040 237.896 118.436 1.00 0.00 ? 17   MET O CA 1 
ATOM 6253 C CA . ARG H  8  18   ? 170.022 239.085 116.431 1.00 0.00 ? 18   ARG O CA 1 
ATOM 6254 C CA . CYS H  8  19   ? 167.486 236.361 115.838 1.00 0.00 ? 19   CYS O CA 1 
ATOM 6255 C CA . ILE H  8  20   ? 164.537 236.599 113.488 1.00 0.00 ? 20   ILE O CA 1 
ATOM 6256 C CA . LEU H  8  21   ? 161.384 234.491 113.549 1.00 0.00 ? 21   LEU O CA 1 
ATOM 6257 C CA . GLN H  8  22   ? 158.923 233.813 110.688 1.00 0.00 ? 22   GLN O CA 1 
ATOM 6258 C CA . ASP H  8  23   ? 156.440 236.372 112.111 1.00 0.00 ? 23   ASP O CA 1 
ATOM 6259 C CA . GLY H  8  24   ? 159.044 239.123 111.477 1.00 0.00 ? 24   GLY O CA 1 
ATOM 6260 C CA . ARG H  8  25   ? 159.766 239.528 115.211 1.00 0.00 ? 25   ARG O CA 1 
ATOM 6261 C CA . ILE H  8  26   ? 163.399 240.332 116.036 1.00 0.00 ? 26   ILE O CA 1 
ATOM 6262 C CA . PHE H  8  27   ? 165.166 239.062 119.182 1.00 0.00 ? 27   PHE O CA 1 
ATOM 6263 C CA . ILE H  8  28   ? 168.360 240.826 120.371 1.00 0.00 ? 28   ILE O CA 1 
ATOM 6264 C CA . GLY H  8  29   ? 170.059 239.065 123.275 1.00 0.00 ? 29   GLY O CA 1 
ATOM 6265 C CA . THR H  8  30   ? 173.052 237.295 124.770 1.00 0.00 ? 30   THR O CA 1 
ATOM 6266 C CA . PHE H  8  31   ? 173.234 234.046 122.821 1.00 0.00 ? 31   PHE O CA 1 
ATOM 6267 C CA . LYS H  8  32   ? 174.558 231.403 125.195 1.00 0.00 ? 32   LYS O CA 1 
ATOM 6268 C CA . ALA H  8  33   ? 173.044 227.984 124.277 1.00 0.00 ? 33   ALA O CA 1 
ATOM 6269 C CA . PHE H  8  34   ? 171.569 226.382 121.133 1.00 0.00 ? 34   PHE O CA 1 
ATOM 6270 C CA . ASP H  8  35   ? 170.750 222.809 120.128 1.00 0.00 ? 35   ASP O CA 1 
ATOM 6271 C CA . LYS H  8  36   ? 170.698 220.476 117.100 1.00 0.00 ? 36   LYS O CA 1 
ATOM 6272 C CA . HIS H  8  37   ? 167.150 221.718 116.362 1.00 0.00 ? 37   HIS O CA 1 
ATOM 6273 C CA . MET H  8  38   ? 168.288 225.362 116.553 1.00 0.00 ? 38   MET O CA 1 
ATOM 6274 C CA . ASN H  8  39   ? 166.367 226.174 119.727 1.00 0.00 ? 39   ASN O CA 1 
ATOM 6275 C CA . LEU H  8  40   ? 168.196 229.179 121.089 1.00 0.00 ? 40   LEU O CA 1 
ATOM 6276 C CA . ILE H  8  41   ? 168.750 230.247 124.708 1.00 0.00 ? 41   ILE O CA 1 
ATOM 6277 C CA . LEU H  8  42   ? 169.080 234.088 124.788 1.00 0.00 ? 42   LEU O CA 1 
ATOM 6278 C CA . CYS H  8  43   ? 169.951 236.330 127.787 1.00 0.00 ? 43   CYS O CA 1 
ATOM 6279 C CA . ASP H  8  44   ? 168.535 239.778 128.531 1.00 0.00 ? 44   ASP O CA 1 
ATOM 6280 C CA . CYS H  8  45   ? 166.590 239.383 125.296 1.00 0.00 ? 45   CYS O CA 1 
ATOM 6281 C CA . ASP H  8  46   ? 164.554 242.295 124.045 1.00 0.00 ? 46   ASP O CA 1 
ATOM 6282 C CA . GLU H  8  47   ? 161.564 242.164 121.662 1.00 0.00 ? 47   GLU O CA 1 
ATOM 6283 C CA . PHE H  8  48   ? 160.655 244.989 119.242 1.00 0.00 ? 48   PHE O CA 1 
ATOM 6284 C CA . ARG H  8  49   ? 157.548 246.785 117.963 1.00 0.00 ? 49   ARG O CA 1 
ATOM 6285 C CA . LYS H  8  50   ? 157.011 249.461 115.296 1.00 0.00 ? 50   LYS O CA 1 
ATOM 6286 C CA . ILE H  8  51   ? 155.291 252.860 115.908 1.00 0.00 ? 51   ILE O CA 1 
ATOM 6287 C CA . LYS H  8  52   ? 154.663 256.102 113.947 1.00 0.00 ? 52   LYS O CA 1 
ATOM 6288 C CA . PRO H  8  53   ? 154.176 259.889 114.542 1.00 0.00 ? 53   PRO O CA 1 
ATOM 6289 C CA . LYS H  8  54   ? 151.155 262.131 113.801 1.00 0.00 ? 54   LYS O CA 1 
ATOM 6290 C CA . ASN H  8  55   ? 152.612 264.896 111.577 1.00 0.00 ? 55   ASN O CA 1 
ATOM 6291 C CA . SER H  8  56   ? 155.861 264.441 109.576 1.00 0.00 ? 56   SER O CA 1 
ATOM 6292 C CA . LYS H  8  57   ? 158.116 266.121 112.199 1.00 0.00 ? 57   LYS O CA 1 
ATOM 6293 C CA . GLN H  8  58   ? 158.142 264.163 115.484 1.00 0.00 ? 58   GLN O CA 1 
ATOM 6294 C CA . ALA H  8  59   ? 160.065 261.720 117.811 1.00 0.00 ? 59   ALA O CA 1 
ATOM 6295 C CA . GLU H  8  60   ? 160.273 258.016 116.889 1.00 0.00 ? 60   GLU O CA 1 
ATOM 6296 C CA . ARG H  8  61   ? 158.828 255.543 119.408 1.00 0.00 ? 61   ARG O CA 1 
ATOM 6297 C CA . GLU H  8  62   ? 159.403 251.799 119.209 1.00 0.00 ? 62   GLU O CA 1 
ATOM 6298 C CA . GLU H  8  63   ? 157.504 249.977 121.952 1.00 0.00 ? 63   GLU O CA 1 
ATOM 6299 C CA . LYS H  8  64   ? 158.934 246.858 123.477 1.00 0.00 ? 64   LYS O CA 1 
ATOM 6300 C CA . ARG H  8  65   ? 158.461 244.175 126.042 1.00 0.00 ? 65   ARG O CA 1 
ATOM 6301 C CA . VAL H  8  66   ? 161.594 243.276 128.007 1.00 0.00 ? 66   VAL O CA 1 
ATOM 6302 C CA . LEU H  8  67   ? 161.719 239.472 128.211 1.00 0.00 ? 67   LEU O CA 1 
ATOM 6303 C CA . GLY H  8  68   ? 164.894 238.854 130.252 1.00 0.00 ? 68   GLY O CA 1 
ATOM 6304 C CA . LEU H  8  69   ? 165.822 235.158 129.921 1.00 0.00 ? 69   LEU O CA 1 
ATOM 6305 C CA . VAL H  8  70   ? 164.213 233.340 127.001 1.00 0.00 ? 70   VAL O CA 1 
ATOM 6306 C CA . LEU H  8  71   ? 164.147 230.055 125.046 1.00 0.00 ? 71   LEU O CA 1 
ATOM 6307 C CA . LEU H  8  72   ? 163.298 230.361 121.322 1.00 0.00 ? 72   LEU O CA 1 
ATOM 6308 C CA . ARG H  8  73   ? 161.997 227.546 119.087 1.00 0.00 ? 73   ARG O CA 1 
ATOM 6309 C CA . GLY H  8  74   ? 163.906 226.183 116.053 1.00 0.00 ? 74   GLY O CA 1 
ATOM 6310 C CA . GLU H  8  75   ? 160.957 225.699 113.705 1.00 0.00 ? 75   GLU O CA 1 
ATOM 6311 C CA . ASN H  8  76   ? 160.010 229.361 113.656 1.00 0.00 ? 76   ASN O CA 1 
ATOM 6312 C CA . LEU H  8  77   ? 163.551 230.807 113.245 1.00 0.00 ? 77   LEU O CA 1 
ATOM 6313 C CA . VAL H  8  78   ? 164.684 232.668 110.144 1.00 0.00 ? 78   VAL O CA 1 
ATOM 6314 C CA . SER H  8  79   ? 168.111 234.257 110.717 1.00 0.00 ? 79   SER O CA 1 
ATOM 6315 C CA . MET H  8  80   ? 170.843 235.236 113.210 1.00 0.00 ? 80   MET O CA 1 
ATOM 6316 C CA . THR H  8  81   ? 172.966 238.359 112.605 1.00 0.00 ? 81   THR O CA 1 
ATOM 6317 C CA . VAL H  8  82   ? 175.653 239.973 114.770 1.00 0.00 ? 82   VAL O CA 1 
ATOM 6318 C CA . GLU H  8  83   ? 174.045 243.197 116.016 1.00 0.00 ? 83   GLU O CA 1 
ATOM 6319 C CA . GLY H  8  84   ? 176.613 243.807 118.785 1.00 0.00 ? 84   GLY O CA 1 
ATOM 6320 C CA . PRO H  8  85   ? 180.095 242.653 119.876 1.00 0.00 ? 85   PRO O CA 1 
ATOM 6321 C CA . PRO H  8  86   ? 180.035 240.058 122.612 1.00 0.00 ? 86   PRO O CA 1 
ATOM 6322 C CA . PRO H  8  87   ? 178.548 242.168 125.452 1.00 0.00 ? 87   PRO O CA 1 
ATOM 6323 C CA . LYS H  8  88   ? 180.854 243.225 128.252 1.00 0.00 ? 88   LYS O CA 1 
ATOM 6324 C CA . ASP H  8  89   ? 178.170 245.490 129.863 1.00 0.00 ? 89   ASP O CA 1 
ATOM 6325 C CA . THR H  8  90   ? 175.916 242.536 130.688 1.00 0.00 ? 90   THR O CA 1 
ATOM 6326 C CA . GLY H  8  91   ? 179.031 240.527 131.579 1.00 0.00 ? 91   GLY O CA 1 
ATOM 6327 C CA . ILE H  8  92   ? 180.470 243.128 133.979 1.00 0.00 ? 92   ILE O CA 1 
ATOM 6328 C CA . ALA H  8  93   ? 177.051 244.321 135.263 1.00 0.00 ? 93   ALA O CA 1 
ATOM 6329 C CA . ARG H  8  94   ? 176.593 240.787 136.556 1.00 0.00 ? 94   ARG O CA 1 
ATOM 6330 C CA . VAL H  8  95   ? 180.221 239.582 137.420 1.00 0.00 ? 95   VAL O CA 1 
ATOM 6331 C CA . LYS I  9  2    ? 175.012 215.609 96.760  1.00 0.00 ? 2    LYS P CA 1 
ATOM 6332 C CA . LEU I  9  3    ? 173.479 219.107 96.543  1.00 0.00 ? 3    LEU P CA 1 
ATOM 6333 C CA . VAL I  9  4    ? 174.374 220.324 100.029 1.00 0.00 ? 4    VAL P CA 1 
ATOM 6334 C CA . ARG I  9  5    ? 177.987 219.374 99.304  1.00 0.00 ? 5    ARG P CA 1 
ATOM 6335 C CA . PHE I  9  6    ? 177.779 221.292 96.014  1.00 0.00 ? 6    PHE P CA 1 
ATOM 6336 C CA . LEU I  9  7    ? 177.062 224.581 97.881  1.00 0.00 ? 7    LEU P CA 1 
ATOM 6337 C CA . MET I  9  8    ? 179.811 223.908 100.420 1.00 0.00 ? 8    MET P CA 1 
ATOM 6338 C CA . LYS I  9  9    ? 182.443 224.620 97.696  1.00 0.00 ? 9    LYS P CA 1 
ATOM 6339 C CA . LEU I  9  10   ? 180.536 227.748 96.367  1.00 0.00 ? 10   LEU P CA 1 
ATOM 6340 C CA . SER I  9  11   ? 181.726 230.055 99.121  1.00 0.00 ? 11   SER P CA 1 
ATOM 6341 C CA . HIS I  9  12   ? 183.311 233.267 97.771  1.00 0.00 ? 12   HIS P CA 1 
ATOM 6342 C CA . GLU I  9  13   ? 180.992 234.233 94.942  1.00 0.00 ? 13   GLU P CA 1 
ATOM 6343 C CA . THR I  9  14   ? 177.956 236.433 95.603  1.00 0.00 ? 14   THR P CA 1 
ATOM 6344 C CA . VAL I  9  15   ? 174.498 234.957 96.222  1.00 0.00 ? 15   VAL P CA 1 
ATOM 6345 C CA . THR I  9  16   ? 171.037 236.369 96.862  1.00 0.00 ? 16   THR P CA 1 
ATOM 6346 C CA . ILE I  9  17   ? 168.504 234.341 98.757  1.00 0.00 ? 17   ILE P CA 1 
ATOM 6347 C CA . GLU I  9  18   ? 164.757 234.600 98.312  1.00 0.00 ? 18   GLU P CA 1 
ATOM 6348 C CA . LEU I  9  19   ? 163.017 232.790 101.200 1.00 0.00 ? 19   LEU P CA 1 
ATOM 6349 C CA . LYS I  9  20   ? 159.698 231.010 101.252 1.00 0.00 ? 20   LYS P CA 1 
ATOM 6350 C CA . ASN I  9  21   ? 158.317 234.219 102.794 1.00 0.00 ? 21   ASN P CA 1 
ATOM 6351 C CA . GLY I  9  22   ? 159.113 236.017 99.520  1.00 0.00 ? 22   GLY P CA 1 
ATOM 6352 C CA . THR I  9  23   ? 161.777 238.039 101.343 1.00 0.00 ? 23   THR P CA 1 
ATOM 6353 C CA . GLN I  9  24   ? 165.087 238.288 99.480  1.00 0.00 ? 24   GLN P CA 1 
ATOM 6354 C CA . VAL I  9  25   ? 168.425 238.372 101.300 1.00 0.00 ? 25   VAL P CA 1 
ATOM 6355 C CA . HIS I  9  26   ? 171.651 239.348 99.513  1.00 0.00 ? 26   HIS P CA 1 
ATOM 6356 C CA . GLY I  9  27   ? 175.114 238.380 100.767 1.00 0.00 ? 27   GLY P CA 1 
ATOM 6357 C CA . THR I  9  28   ? 178.321 236.362 100.572 1.00 0.00 ? 28   THR P CA 1 
ATOM 6358 C CA . ILE I  9  29   ? 178.417 232.800 101.902 1.00 0.00 ? 29   ILE P CA 1 
ATOM 6359 C CA . THR I  9  30   ? 180.578 231.627 104.806 1.00 0.00 ? 30   THR P CA 1 
ATOM 6360 C CA . GLY I  9  31   ? 179.537 227.960 105.377 1.00 0.00 ? 31   GLY P CA 1 
ATOM 6361 C CA . VAL I  9  32   ? 176.668 225.485 105.234 1.00 0.00 ? 32   VAL P CA 1 
ATOM 6362 C CA . ASP I  9  33   ? 175.769 222.409 107.322 1.00 0.00 ? 33   ASP P CA 1 
ATOM 6363 C CA . VAL I  9  34   ? 174.087 218.997 106.659 1.00 0.00 ? 34   VAL P CA 1 
ATOM 6364 C CA . SER I  9  35   ? 170.512 220.389 107.142 1.00 0.00 ? 35   SER P CA 1 
ATOM 6365 C CA . ASN I  9  37   ? 171.549 226.066 107.006 1.00 0.00 ? 37   ASN P CA 1 
ATOM 6366 C CA . THR I  9  38   ? 173.916 228.756 105.780 1.00 0.00 ? 38   THR P CA 1 
ATOM 6367 C CA . HIS I  9  39   ? 176.055 231.287 107.642 1.00 0.00 ? 39   HIS P CA 1 
ATOM 6368 C CA . LEU I  9  40   ? 176.507 234.485 105.576 1.00 0.00 ? 40   LEU P CA 1 
ATOM 6369 C CA . LYS I  9  41   ? 178.522 237.771 105.566 1.00 0.00 ? 41   LYS P CA 1 
ATOM 6370 C CA . ALA I  9  42   ? 178.138 241.239 103.964 1.00 0.00 ? 42   ALA P CA 1 
ATOM 6371 C CA . VAL I  9  43   ? 174.339 241.139 103.888 1.00 0.00 ? 43   VAL P CA 1 
ATOM 6372 C CA . LYS I  9  44   ? 171.641 243.567 102.871 1.00 0.00 ? 44   LYS P CA 1 
ATOM 6373 C CA . MET I  9  45   ? 168.078 242.427 103.416 1.00 0.00 ? 45   MET P CA 1 
ATOM 6374 C CA . THR I  9  46   ? 164.751 243.456 101.898 1.00 0.00 ? 46   THR P CA 1 
ATOM 6375 C CA . LEU I  9  47   ? 161.479 242.797 103.731 1.00 0.00 ? 47   LEU P CA 1 
ATOM 6376 C CA . LYS I  9  48   ? 158.158 242.700 101.834 1.00 0.00 ? 48   LYS P CA 1 
ATOM 6377 C CA . ASN I  9  49   ? 156.799 246.252 101.428 1.00 0.00 ? 49   ASN P CA 1 
ATOM 6378 C CA . ARG I  9  50   ? 159.709 247.577 103.589 1.00 0.00 ? 50   ARG P CA 1 
ATOM 6379 C CA . GLU I  9  51   ? 163.182 249.162 103.426 1.00 0.00 ? 51   GLU P CA 1 
ATOM 6380 C CA . PRO I  9  52   ? 166.636 247.473 103.039 1.00 0.00 ? 52   PRO P CA 1 
ATOM 6381 C CA . VAL I  9  53   ? 168.813 246.439 106.031 1.00 0.00 ? 53   VAL P CA 1 
ATOM 6382 C CA . GLN I  9  54   ? 172.653 246.257 105.844 1.00 0.00 ? 54   GLN P CA 1 
ATOM 6383 C CA . LEU I  9  55   ? 174.188 243.557 108.084 1.00 0.00 ? 55   LEU P CA 1 
ATOM 6384 C CA . GLU I  9  56   ? 177.791 242.254 108.561 1.00 0.00 ? 56   GLU P CA 1 
ATOM 6385 C CA . THR I  9  57   ? 177.001 238.553 109.317 1.00 0.00 ? 57   THR P CA 1 
ATOM 6386 C CA . LEU I  9  58   ? 173.874 236.379 109.328 1.00 0.00 ? 58   LEU P CA 1 
ATOM 6387 C CA . SER I  9  59   ? 172.443 232.802 109.548 1.00 0.00 ? 59   SER P CA 1 
ATOM 6388 C CA . ILE I  9  60   ? 169.353 231.199 107.884 1.00 0.00 ? 60   ILE P CA 1 
ATOM 6389 C CA . ARG I  9  61   ? 167.452 227.989 108.462 1.00 0.00 ? 61   ARG P CA 1 
ATOM 6390 C CA . GLY I  9  62   ? 167.660 225.777 105.359 1.00 0.00 ? 62   GLY P CA 1 
ATOM 6391 C CA . ASN I  9  63   ? 163.937 224.926 105.586 1.00 0.00 ? 63   ASN P CA 1 
ATOM 6392 C CA . ASN I  9  64   ? 163.113 228.689 105.749 1.00 0.00 ? 64   ASN P CA 1 
ATOM 6393 C CA . ILE I  9  65   ? 164.455 229.168 102.151 1.00 0.00 ? 65   ILE P CA 1 
ATOM 6394 C CA . ARG I  9  66   ? 162.884 229.172 98.659  1.00 0.00 ? 66   ARG P CA 1 
ATOM 6395 C CA . TYR I  9  67   ? 165.644 229.669 96.017  1.00 0.00 ? 67   TYR P CA 1 
ATOM 6396 C CA . PHE I  9  68   ? 169.336 230.723 96.001  1.00 0.00 ? 68   PHE P CA 1 
ATOM 6397 C CA . ILE I  9  69   ? 170.227 232.936 93.070  1.00 0.00 ? 69   ILE P CA 1 
ATOM 6398 C CA . LEU I  9  70   ? 173.328 231.160 91.681  1.00 0.00 ? 70   LEU P CA 1 
ATOM 6399 C CA . PRO I  9  71   ? 176.515 232.872 90.422  1.00 0.00 ? 71   PRO P CA 1 
ATOM 6400 C CA . ASP I  9  72   ? 176.676 233.485 86.634  1.00 0.00 ? 72   ASP P CA 1 
ATOM 6401 C CA . SER I  9  73   ? 180.247 232.223 87.042  1.00 0.00 ? 73   SER P CA 1 
ATOM 6402 C CA . LEU I  9  74   ? 179.674 229.118 89.228  1.00 0.00 ? 74   LEU P CA 1 
ATOM 6403 C CA . PRO I  9  75   ? 181.663 225.952 88.374  1.00 0.00 ? 75   PRO P CA 1 
ATOM 6404 C CA . LEU I  9  76   ? 179.200 223.060 88.031  1.00 0.00 ? 76   LEU P CA 1 
ATOM 6405 C CA . ASP I  9  77   ? 181.624 220.128 87.659  1.00 0.00 ? 77   ASP P CA 1 
ATOM 6406 C CA . THR I  9  78   ? 184.018 221.467 90.296  1.00 0.00 ? 78   THR P CA 1 
ATOM 6407 C CA . LEU I  9  79   ? 181.231 221.118 92.904  1.00 0.00 ? 79   LEU P CA 1 
ATOM 6408 C CA . LEU I  9  80   ? 179.607 217.829 91.780  1.00 0.00 ? 80   LEU P CA 1 
ATOM 6409 C CA . VAL I  9  81   ? 181.080 214.320 91.312  1.00 0.00 ? 81   VAL P CA 1 
ATOM 6410 C CA . ASP I  9  82   ? 178.235 213.265 88.989  1.00 0.00 ? 82   ASP P CA 1 
ATOM 6411 C CA . VAL I  9  83   ? 179.508 214.019 85.483  1.00 0.00 ? 83   VAL P CA 1 
ATOM 6412 C CA . GLU I  9  84   ? 176.727 213.247 82.883  1.00 0.00 ? 84   GLU P CA 1 
ATOM 6413 C CA . PRO I  9  85   ? 173.818 215.684 83.732  1.00 0.00 ? 85   PRO P CA 1 
ATOM 6414 C CA . LYS I  9  86   ? 176.095 218.303 85.262  1.00 0.00 ? 86   LYS P CA 1 
ATOM 6415 C CA . VAL I  9  87   ? 178.143 218.606 82.050  1.00 0.00 ? 87   VAL P CA 1 
ATOM 6416 C CA . LYS I  9  88   ? 175.418 218.946 79.376  1.00 0.00 ? 88   LYS P CA 1 
ATOM 6417 C CA . SER I  9  89   ? 173.486 221.436 81.452  1.00 0.00 ? 89   SER P CA 1 
ATOM 6418 C CA . LYS I  9  90   ? 176.614 223.315 82.737  1.00 0.00 ? 90   LYS P CA 1 
ATOM 6419 C CA . LYS I  9  91   ? 178.078 223.440 79.273  1.00 0.00 ? 91   LYS P CA 1 
ATOM 6420 C CA . ARG I  9  92   ? 174.867 225.135 78.127  1.00 0.00 ? 92   ARG P CA 1 
ATOM 6421 C CA . GLU I  9  93   ? 174.639 226.999 81.401  1.00 0.00 ? 93   GLU P CA 1 
ATOM 6422 C CA . ALA I  9  94   ? 178.197 227.921 82.151  1.00 0.00 ? 94   ALA P CA 1 
ATOM 6423 C CA . VAL I  9  95   ? 177.837 229.120 78.545  1.00 0.00 ? 95   VAL P CA 1 
ATOM 6424 C CA . THR J  10 26   ? 160.217 205.681 92.194  1.00 0.00 ? 26   THR Q CA 1 
ATOM 6425 C CA . GLY J  10 27   ? 158.211 206.756 89.126  1.00 0.00 ? 27   GLY Q CA 1 
ATOM 6426 C CA . PRO J  10 28   ? 158.325 210.536 89.438  1.00 0.00 ? 28   PRO Q CA 1 
ATOM 6427 C CA . LEU J  10 29   ? 162.087 211.112 89.830  1.00 0.00 ? 29   LEU Q CA 1 
ATOM 6428 C CA . SER J  10 30   ? 163.112 208.367 87.370  1.00 0.00 ? 30   SER Q CA 1 
ATOM 6429 C CA . VAL J  10 31   ? 161.174 209.988 84.541  1.00 0.00 ? 31   VAL Q CA 1 
ATOM 6430 C CA . LEU J  10 32   ? 162.153 213.477 85.665  1.00 0.00 ? 32   LEU Q CA 1 
ATOM 6431 C CA . THR J  10 33   ? 165.795 212.315 85.664  1.00 0.00 ? 33   THR Q CA 1 
ATOM 6432 C CA . GLN J  10 34   ? 165.381 210.795 82.177  1.00 0.00 ? 34   GLN Q CA 1 
ATOM 6433 C CA . SER J  10 35   ? 164.002 213.986 80.655  1.00 0.00 ? 35   SER Q CA 1 
ATOM 6434 C CA . VAL J  10 36   ? 166.850 215.883 82.461  1.00 0.00 ? 36   VAL Q CA 1 
ATOM 6435 C CA . LYS J  10 37   ? 169.270 213.358 80.980  1.00 0.00 ? 37   LYS Q CA 1 
ATOM 6436 C CA . ASN J  10 38   ? 168.123 214.455 77.502  1.00 0.00 ? 38   ASN Q CA 1 
ATOM 6437 C CA . ASN J  10 39   ? 168.033 218.199 78.244  1.00 0.00 ? 39   ASN Q CA 1 
ATOM 6438 C CA . THR J  10 40   ? 164.205 218.249 78.179  1.00 0.00 ? 40   THR Q CA 1 
ATOM 6439 C CA . GLN J  10 41   ? 162.781 221.523 79.475  1.00 0.00 ? 41   GLN Q CA 1 
ATOM 6440 C CA . VAL J  10 42   ? 160.833 221.020 82.706  1.00 0.00 ? 42   VAL Q CA 1 
ATOM 6441 C CA . LEU J  10 43   ? 157.969 223.078 84.133  1.00 0.00 ? 43   LEU Q CA 1 
ATOM 6442 C CA . ILE J  10 44   ? 157.786 223.467 87.922  1.00 0.00 ? 44   ILE Q CA 1 
ATOM 6443 C CA . ASN J  10 45   ? 154.739 224.844 89.700  1.00 0.00 ? 45   ASN Q CA 1 
ATOM 6444 C CA . CYS J  10 46   ? 155.972 226.597 92.849  1.00 0.00 ? 46   CYS Q CA 1 
ATOM 6445 C CA . ARG J  10 47   ? 154.060 226.919 96.130  1.00 0.00 ? 47   ARG Q CA 1 
ATOM 6446 C CA . ASN J  10 48   ? 152.592 230.390 95.295  1.00 0.00 ? 48   ASN Q CA 1 
ATOM 6447 C CA . ASN J  10 49   ? 151.123 229.939 91.781  1.00 0.00 ? 49   ASN Q CA 1 
ATOM 6448 C CA . LYS J  10 50   ? 154.521 230.735 90.265  1.00 0.00 ? 50   LYS Q CA 1 
ATOM 6449 C CA . LYS J  10 51   ? 155.963 228.406 87.654  1.00 0.00 ? 51   LYS Q CA 1 
ATOM 6450 C CA . LEU J  10 52   ? 159.550 227.759 86.675  1.00 0.00 ? 52   LEU Q CA 1 
ATOM 6451 C CA . LEU J  10 53   ? 160.524 226.916 83.025  1.00 0.00 ? 53   LEU Q CA 1 
ATOM 6452 C CA . GLY J  10 54   ? 163.970 225.469 82.242  1.00 0.00 ? 54   GLY Q CA 1 
ATOM 6453 C CA . ARG J  10 55   ? 166.726 222.824 82.290  1.00 0.00 ? 55   ARG Q CA 1 
ATOM 6454 C CA . VAL J  10 56   ? 167.494 220.727 85.334  1.00 0.00 ? 56   VAL Q CA 1 
ATOM 6455 C CA . LYS J  10 57   ? 171.145 220.514 86.288  1.00 0.00 ? 57   LYS Q CA 1 
ATOM 6456 C CA . ALA J  10 58   ? 171.206 218.828 89.726  1.00 0.00 ? 58   ALA Q CA 1 
ATOM 6457 C CA . PHE J  10 59   ? 168.386 217.722 92.041  1.00 0.00 ? 59   PHE Q CA 1 
ATOM 6458 C CA . ASP J  10 60   ? 168.289 215.637 95.236  1.00 0.00 ? 60   ASP Q CA 1 
ATOM 6459 C CA . ARG J  10 61   ? 165.774 213.622 97.292  1.00 0.00 ? 61   ARG Q CA 1 
ATOM 6460 C CA . HIS J  10 62   ? 164.548 216.787 99.106  1.00 0.00 ? 62   HIS Q CA 1 
ATOM 6461 C CA . CYS J  10 63   ? 163.774 217.866 95.542  1.00 0.00 ? 63   CYS Q CA 1 
ATOM 6462 C CA . ASN J  10 64   ? 166.224 220.725 95.933  1.00 0.00 ? 64   ASN Q CA 1 
ATOM 6463 C CA . MET J  10 65   ? 167.192 221.692 92.430  1.00 0.00 ? 65   MET Q CA 1 
ATOM 6464 C CA . VAL J  10 66   ? 170.077 223.367 90.581  1.00 0.00 ? 66   VAL Q CA 1 
ATOM 6465 C CA . LEU J  10 67   ? 168.425 225.050 87.577  1.00 0.00 ? 67   LEU Q CA 1 
ATOM 6466 C CA . GLU J  10 68   ? 169.427 227.162 84.688  1.00 0.00 ? 68   GLU Q CA 1 
ATOM 6467 C CA . ASN J  10 69   ? 168.294 228.982 81.515  1.00 0.00 ? 69   ASN Q CA 1 
ATOM 6468 C CA . VAL J  10 70   ? 165.295 229.538 83.709  1.00 0.00 ? 70   VAL Q CA 1 
ATOM 6469 C CA . LYS J  10 71   ? 162.346 231.787 82.984  1.00 0.00 ? 71   LYS Q CA 1 
ATOM 6470 C CA . GLU J  10 72   ? 160.243 232.111 86.114  1.00 0.00 ? 72   GLU Q CA 1 
ATOM 6471 C CA . MET J  10 73   ? 156.685 233.371 85.648  1.00 0.00 ? 73   MET Q CA 1 
ATOM 6472 C CA . TRP J  10 74   ? 155.271 234.432 88.982  1.00 0.00 ? 74   TRP Q CA 1 
ATOM 6473 C CA . THR J  10 75   ? 151.823 235.430 90.187  1.00 0.00 ? 75   THR Q CA 1 
ATOM 6474 C CA . GLU J  10 76   ? 151.579 239.213 90.490  1.00 0.00 ? 76   GLU Q CA 1 
ATOM 6475 C CA . VAL J  10 77   ? 150.210 241.521 93.110  1.00 0.00 ? 77   VAL Q CA 1 
ATOM 6476 C CA . PRO J  10 78   ? 147.691 244.398 92.633  1.00 0.00 ? 78   PRO Q CA 1 
ATOM 6477 C CA . LYS J  10 79   ? 148.374 248.029 93.586  1.00 0.00 ? 79   LYS Q CA 1 
ATOM 6478 C CA . SER J  10 80   ? 146.241 251.139 94.153  1.00 0.00 ? 80   SER Q CA 1 
ATOM 6479 C CA . GLY J  10 81   ? 146.319 254.781 92.970  1.00 0.00 ? 81   GLY Q CA 1 
ATOM 6480 C CA . LYS J  10 82   ? 144.619 257.895 94.519  1.00 0.00 ? 82   LYS Q CA 1 
ATOM 6481 C CA . GLY J  10 83   ? 143.675 259.397 91.135  1.00 0.00 ? 83   GLY Q CA 1 
ATOM 6482 C CA . LYS J  10 84   ? 141.122 256.630 90.369  1.00 0.00 ? 84   LYS Q CA 1 
ATOM 6483 C CA . LYS J  10 85   ? 143.614 254.287 88.673  1.00 0.00 ? 85   LYS Q CA 1 
ATOM 6484 C CA . LYS J  10 86   ? 144.183 250.593 89.239  1.00 0.00 ? 86   LYS Q CA 1 
ATOM 6485 C CA . SER J  10 87   ? 145.756 247.516 87.671  1.00 0.00 ? 87   SER Q CA 1 
ATOM 6486 C CA . LYS J  10 88   ? 144.557 243.935 88.443  1.00 0.00 ? 88   LYS Q CA 1 
ATOM 6487 C CA . PRO J  10 89   ? 146.657 241.501 86.322  1.00 0.00 ? 89   PRO Q CA 1 
ATOM 6488 C CA . VAL J  10 90   ? 149.709 239.188 86.679  1.00 0.00 ? 90   VAL Q CA 1 
ATOM 6489 C CA . ASN J  10 91   ? 153.391 240.002 86.008  1.00 0.00 ? 91   ASN Q CA 1 
ATOM 6490 C CA . LYS J  10 92   ? 155.752 239.287 83.104  1.00 0.00 ? 92   LYS Q CA 1 
ATOM 6491 C CA . ASP J  10 93   ? 158.072 236.281 82.436  1.00 0.00 ? 93   ASP Q CA 1 
ATOM 6492 C CA . ARG J  10 94   ? 161.437 236.725 84.110  1.00 0.00 ? 94   ARG Q CA 1 
ATOM 6493 C CA . TYR J  10 95   ? 164.794 235.264 82.928  1.00 0.00 ? 95   TYR Q CA 1 
ATOM 6494 C CA . ILE J  10 96   ? 167.347 233.836 85.427  1.00 0.00 ? 96   ILE Q CA 1 
ATOM 6495 C CA . SER J  10 97   ? 170.597 232.249 84.167  1.00 0.00 ? 97   SER Q CA 1 
ATOM 6496 C CA . LYS J  10 98   ? 171.335 230.046 87.205  1.00 0.00 ? 98   LYS Q CA 1 
ATOM 6497 C CA . MET J  10 99   ? 169.032 228.866 90.045  1.00 0.00 ? 99   MET Q CA 1 
ATOM 6498 C CA . PHE J  10 100  ? 169.008 226.554 93.043  1.00 0.00 ? 100  PHE Q CA 1 
ATOM 6499 C CA . LEU J  10 101  ? 165.516 225.604 94.321  1.00 0.00 ? 101  LEU Q CA 1 
ATOM 6500 C CA . ARG J  10 102  ? 163.919 224.423 97.593  1.00 0.00 ? 102  ARG Q CA 1 
ATOM 6501 C CA . GLY J  10 103  ? 161.686 221.366 97.076  1.00 0.00 ? 103  GLY Q CA 1 
ATOM 6502 C CA . ASP J  10 104  ? 159.159 222.340 99.780  1.00 0.00 ? 104  ASP Q CA 1 
ATOM 6503 C CA . SER J  10 105  ? 157.735 224.984 97.442  1.00 0.00 ? 105  SER Q CA 1 
ATOM 6504 C CA . VAL J  10 106  ? 157.393 222.303 94.726  1.00 0.00 ? 106  VAL Q CA 1 
ATOM 6505 C CA . ILE J  10 107  ? 153.831 221.089 94.082  1.00 0.00 ? 107  ILE Q CA 1 
ATOM 6506 C CA . VAL J  10 108  ? 154.277 219.635 90.594  1.00 0.00 ? 108  VAL Q CA 1 
ATOM 6507 C CA . VAL J  10 109  ? 156.842 218.973 87.831  1.00 0.00 ? 109  VAL Q CA 1 
ATOM 6508 C CA . LEU J  10 110  ? 155.927 218.562 84.128  1.00 0.00 ? 110  LEU Q CA 1 
ATOM 6509 C CA . ARG J  10 111  ? 157.377 217.012 80.957  1.00 0.00 ? 111  ARG Q CA 1 
ATOM 6510 C CA . ASN J  10 112  ? 157.400 218.654 77.563  1.00 0.00 ? 112  ASN Q CA 1 
ATOM 6511 C CA . PRO J  10 113  ? 154.246 218.133 75.541  1.00 0.00 ? 113  PRO Q CA 1 
ATOM 6512 C CA . LEU J  10 114  ? 156.660 216.497 73.139  1.00 0.00 ? 114  LEU Q CA 1 
ATOM 6513 C CA . GLY K  11 4    ? 172.969 220.309 131.027 1.00 0.00 ? 4    GLY R CA 1 
ATOM 6514 C CA . VAL K  11 5    ? 171.249 219.228 127.822 1.00 0.00 ? 5    VAL R CA 1 
ATOM 6515 C CA . PRO K  11 6    ? 168.221 221.489 127.073 1.00 0.00 ? 6    PRO R CA 1 
ATOM 6516 C CA . ILE K  11 7    ? 166.026 218.652 128.406 1.00 0.00 ? 7    ILE R CA 1 
ATOM 6517 C CA . LYS K  11 8    ? 167.954 218.554 131.728 1.00 0.00 ? 8    LYS R CA 1 
ATOM 6518 C CA . VAL K  11 9    ? 167.692 222.336 132.131 1.00 0.00 ? 9    VAL R CA 1 
ATOM 6519 C CA . LEU K  11 10   ? 163.915 222.135 131.481 1.00 0.00 ? 10   LEU R CA 1 
ATOM 6520 C CA . HIS K  11 11   ? 163.597 219.284 134.027 1.00 0.00 ? 11   HIS R CA 1 
ATOM 6521 C CA . GLU K  11 12   ? 165.199 221.444 136.720 1.00 0.00 ? 12   GLU R CA 1 
ATOM 6522 C CA . ALA K  11 13   ? 162.469 224.093 136.006 1.00 0.00 ? 13   ALA R CA 1 
ATOM 6523 C CA . GLU K  11 14   ? 159.809 221.672 137.276 1.00 0.00 ? 14   GLU R CA 1 
ATOM 6524 C CA . GLY K  11 15   ? 157.945 223.046 140.325 1.00 0.00 ? 15   GLY R CA 1 
ATOM 6525 C CA . HIS K  11 16   ? 159.139 226.538 139.305 1.00 0.00 ? 16   HIS R CA 1 
ATOM 6526 C CA . ILE K  11 17   ? 157.281 229.526 137.913 1.00 0.00 ? 17   ILE R CA 1 
ATOM 6527 C CA . VAL K  11 18   ? 157.459 230.039 134.150 1.00 0.00 ? 18   VAL R CA 1 
ATOM 6528 C CA . THR K  11 19   ? 155.445 231.740 131.380 1.00 0.00 ? 19   THR R CA 1 
ATOM 6529 C CA . CYS K  11 20   ? 154.311 229.989 128.188 1.00 0.00 ? 20   CYS R CA 1 
ATOM 6530 C CA . GLU K  11 21   ? 153.127 232.020 125.224 1.00 0.00 ? 21   GLU R CA 1 
ATOM 6531 C CA . THR K  11 22   ? 151.561 229.770 122.587 1.00 0.00 ? 22   THR R CA 1 
ATOM 6532 C CA . ASN K  11 23   ? 151.669 230.171 118.782 1.00 0.00 ? 23   ASN R CA 1 
ATOM 6533 C CA . THR K  11 24   ? 148.160 231.703 118.935 1.00 0.00 ? 24   THR R CA 1 
ATOM 6534 C CA . GLY K  11 25   ? 149.082 234.293 121.546 1.00 0.00 ? 25   GLY R CA 1 
ATOM 6535 C CA . GLU K  11 26   ? 147.788 232.701 124.758 1.00 0.00 ? 26   GLU R CA 1 
ATOM 6536 C CA . VAL K  11 27   ? 149.956 233.501 127.764 1.00 0.00 ? 27   VAL R CA 1 
ATOM 6537 C CA . TYR K  11 28   ? 150.221 230.697 130.355 1.00 0.00 ? 28   TYR R CA 1 
ATOM 6538 C CA . ARG K  11 29   ? 151.915 231.485 133.689 1.00 0.00 ? 29   ARG R CA 1 
ATOM 6539 C CA . GLY K  11 30   ? 152.166 228.914 136.504 1.00 0.00 ? 30   GLY R CA 1 
ATOM 6540 C CA . LYS K  11 31   ? 154.392 226.243 138.018 1.00 0.00 ? 31   LYS R CA 1 
ATOM 6541 C CA . LEU K  11 32   ? 155.953 223.673 135.701 1.00 0.00 ? 32   LEU R CA 1 
ATOM 6542 C CA . ILE K  11 33   ? 155.072 220.240 137.083 1.00 0.00 ? 33   ILE R CA 1 
ATOM 6543 C CA . GLU K  11 34   ? 156.933 218.238 134.417 1.00 0.00 ? 34   GLU R CA 1 
ATOM 6544 C CA . ALA K  11 35   ? 158.520 219.079 130.987 1.00 0.00 ? 35   ALA R CA 1 
ATOM 6545 C CA . GLU K  11 36   ? 158.350 216.028 128.622 1.00 0.00 ? 36   GLU R CA 1 
ATOM 6546 C CA . ASP K  11 37   ? 161.042 214.754 126.159 1.00 0.00 ? 37   ASP R CA 1 
ATOM 6547 C CA . ASN K  11 38   ? 159.156 216.314 123.217 1.00 0.00 ? 38   ASN R CA 1 
ATOM 6548 C CA . MET K  11 39   ? 158.464 219.705 124.823 1.00 0.00 ? 39   MET R CA 1 
ATOM 6549 C CA . ASN K  11 40   ? 154.997 218.807 126.048 1.00 0.00 ? 40   ASN R CA 1 
ATOM 6550 C CA . CYS K  11 41   ? 154.470 220.407 129.487 1.00 0.00 ? 41   CYS R CA 1 
ATOM 6551 C CA . GLN K  11 42   ? 152.199 220.070 132.489 1.00 0.00 ? 42   GLN R CA 1 
ATOM 6552 C CA . MET K  11 43   ? 151.338 223.104 134.655 1.00 0.00 ? 43   MET R CA 1 
ATOM 6553 C CA . SER K  11 44   ? 149.273 223.749 137.773 1.00 0.00 ? 44   SER R CA 1 
ATOM 6554 C CA . ASN K  11 45   ? 147.902 226.967 139.330 1.00 0.00 ? 45   ASN R CA 1 
ATOM 6555 C CA . ILE K  11 46   ? 148.043 228.621 135.931 1.00 0.00 ? 46   ILE R CA 1 
ATOM 6556 C CA . THR K  11 47   ? 146.967 232.060 134.696 1.00 0.00 ? 47   THR R CA 1 
ATOM 6557 C CA . VAL K  11 48   ? 145.890 232.377 131.047 1.00 0.00 ? 48   VAL R CA 1 
ATOM 6558 C CA . THR K  11 49   ? 145.090 235.650 129.196 1.00 0.00 ? 49   THR R CA 1 
ATOM 6559 C CA . TYR K  11 50   ? 143.239 235.366 125.900 1.00 0.00 ? 50   TYR R CA 1 
ATOM 6560 C CA . ARG K  11 51   ? 143.408 237.804 122.971 1.00 0.00 ? 51   ARG R CA 1 
ATOM 6561 C CA . ASP K  11 52   ? 140.338 239.474 124.369 1.00 0.00 ? 52   ASP R CA 1 
ATOM 6562 C CA . GLY K  11 53   ? 141.857 240.071 127.836 1.00 0.00 ? 53   GLY R CA 1 
ATOM 6563 C CA . ARG K  11 54   ? 139.776 237.302 129.350 1.00 0.00 ? 54   ARG R CA 1 
ATOM 6564 C CA . VAL K  11 55   ? 141.898 235.693 132.069 1.00 0.00 ? 55   VAL R CA 1 
ATOM 6565 C CA . ALA K  11 56   ? 141.025 232.084 132.688 1.00 0.00 ? 56   ALA R CA 1 
ATOM 6566 C CA . GLN K  11 57   ? 142.609 230.741 135.873 1.00 0.00 ? 57   GLN R CA 1 
ATOM 6567 C CA . LEU K  11 58   ? 143.102 226.969 135.481 1.00 0.00 ? 58   LEU R CA 1 
ATOM 6568 C CA . GLU K  11 59   ? 144.137 224.573 138.246 1.00 0.00 ? 59   GLU R CA 1 
ATOM 6569 C CA . GLN K  11 60   ? 145.908 222.612 135.478 1.00 0.00 ? 60   GLN R CA 1 
ATOM 6570 C CA . VAL K  11 61   ? 146.927 222.934 131.780 1.00 0.00 ? 61   VAL R CA 1 
ATOM 6571 C CA . TYR K  11 62   ? 148.656 220.668 129.276 1.00 0.00 ? 62   TYR R CA 1 
ATOM 6572 C CA . ILE K  11 63   ? 150.574 222.698 126.631 1.00 0.00 ? 63   ILE R CA 1 
ATOM 6573 C CA . ARG K  11 64   ? 151.906 220.705 123.673 1.00 0.00 ? 64   ARG R CA 1 
ATOM 6574 C CA . GLY K  11 65   ? 155.565 221.258 122.801 1.00 0.00 ? 65   GLY R CA 1 
ATOM 6575 C CA . SER K  11 66   ? 154.847 222.399 119.261 1.00 0.00 ? 66   SER R CA 1 
ATOM 6576 C CA . LYS K  11 67   ? 152.239 224.824 120.609 1.00 0.00 ? 67   LYS R CA 1 
ATOM 6577 C CA . ILE K  11 68   ? 155.023 226.795 122.370 1.00 0.00 ? 68   ILE R CA 1 
ATOM 6578 C CA . ARG K  11 69   ? 156.206 230.074 120.723 1.00 0.00 ? 69   ARG R CA 1 
ATOM 6579 C CA . PHE K  11 70   ? 158.643 230.608 123.607 1.00 0.00 ? 70   PHE R CA 1 
ATOM 6580 C CA . LEU K  11 71   ? 159.174 230.082 127.344 1.00 0.00 ? 71   LEU R CA 1 
ATOM 6581 C CA . ILE K  11 72   ? 160.215 232.689 129.944 1.00 0.00 ? 72   ILE R CA 1 
ATOM 6582 C CA . LEU K  11 73   ? 162.312 230.785 132.492 1.00 0.00 ? 73   LEU R CA 1 
ATOM 6583 C CA . PRO K  11 74   ? 163.470 231.863 136.003 1.00 0.00 ? 74   PRO R CA 1 
ATOM 6584 C CA . ASP K  11 75   ? 166.981 233.344 136.316 1.00 0.00 ? 75   ASP R CA 1 
ATOM 6585 C CA . MET K  11 76   ? 168.320 232.096 139.737 1.00 0.00 ? 76   MET R CA 1 
ATOM 6586 C CA . LEU K  11 77   ? 169.309 228.701 138.277 1.00 0.00 ? 77   LEU R CA 1 
ATOM 6587 C CA . LYS K  11 78   ? 172.636 227.154 137.213 1.00 0.00 ? 78   LYS R CA 1 
ATOM 6588 C CA . ASN K  11 79   ? 173.874 225.862 133.805 1.00 0.00 ? 79   ASN R CA 1 
ATOM 6589 C CA . ALA K  11 80   ? 176.609 223.239 133.603 1.00 0.00 ? 80   ALA R CA 1 
ATOM 6590 C CA . PRO K  11 81   ? 180.305 224.363 133.475 1.00 0.00 ? 81   PRO R CA 1 
ATOM 6591 C CA . MET K  11 82   ? 179.299 228.051 133.482 1.00 0.00 ? 82   MET R CA 1 
ATOM 6592 C CA . LEU K  11 83   ? 179.061 229.587 136.969 1.00 0.00 ? 83   LEU R CA 1 
ATOM 6593 C CA . LYS K  11 84   ? 176.306 232.113 137.672 1.00 0.00 ? 84   LYS R CA 1 
ATOM 6594 C CA . SER K  11 85   ? 176.922 232.566 141.399 1.00 0.00 ? 85   SER R CA 1 
ATOM 6595 C CA . MET K  11 86   ? 178.560 236.023 140.975 1.00 0.00 ? 86   MET R CA 1 
ATOM 6596 C CA . LYS K  11 87   ? 175.848 237.261 138.588 1.00 0.00 ? 87   LYS R CA 1 
ATOM 6597 C CA . ASN K  11 88   ? 172.781 236.446 140.689 1.00 0.00 ? 88   ASN R CA 1 
ATOM 6598 C CA . LYS K  11 89   ? 173.812 238.238 143.891 1.00 0.00 ? 89   LYS R CA 1 
ATOM 6599 C CA . ASN K  11 90   ? 174.121 241.659 142.117 1.00 0.00 ? 90   ASN R CA 1 
ATOM 6600 C CA . GLN K  11 91   ? 170.425 241.390 141.226 1.00 0.00 ? 91   GLN R CA 1 
ATOM 6601 C CA . VAL L  12 15   ? 141.104 192.402 128.105 1.00 0.00 ? 15   VAL S CA 1 
ATOM 6602 C CA . GLN L  12 16   ? 141.645 196.037 129.207 1.00 0.00 ? 16   GLN S CA 1 
ATOM 6603 C CA . PRO L  12 17   ? 143.462 197.394 126.081 1.00 0.00 ? 17   PRO S CA 1 
ATOM 6604 C CA . ILE L  12 18   ? 144.556 201.010 126.768 1.00 0.00 ? 18   ILE S CA 1 
ATOM 6605 C CA . ASN L  12 19   ? 147.841 201.321 124.864 1.00 0.00 ? 19   ASN S CA 1 
ATOM 6606 C CA . LEU L  12 20   ? 146.651 202.238 121.335 1.00 0.00 ? 20   LEU S CA 1 
ATOM 6607 C CA . ILE L  12 21   ? 143.632 202.972 119.107 1.00 0.00 ? 21   ILE S CA 1 
ATOM 6608 C CA . PHE L  12 22   ? 144.829 201.032 116.027 1.00 0.00 ? 22   PHE S CA 1 
ATOM 6609 C CA . ARG L  12 23   ? 143.164 198.120 117.683 1.00 0.00 ? 23   ARG S CA 1 
ATOM 6610 C CA . TYR L  12 24   ? 140.172 200.466 117.773 1.00 0.00 ? 24   TYR S CA 1 
ATOM 6611 C CA . LEU L  12 25   ? 139.918 200.320 113.976 1.00 0.00 ? 25   LEU S CA 1 
ATOM 6612 C CA . GLN L  12 26   ? 140.075 196.527 113.513 1.00 0.00 ? 26   GLN S CA 1 
ATOM 6613 C CA . ASN L  12 27   ? 136.737 195.960 115.336 1.00 0.00 ? 27   ASN S CA 1 
ATOM 6614 C CA . ARG L  12 28   ? 135.449 198.979 113.474 1.00 0.00 ? 28   ARG S CA 1 
ATOM 6615 C CA . SER L  12 29   ? 136.278 197.488 110.070 1.00 0.00 ? 29   SER S CA 1 
ATOM 6616 C CA . ARG L  12 30   ? 133.163 197.382 107.823 1.00 0.00 ? 30   ARG S CA 1 
ATOM 6617 C CA . ILE L  12 31   ? 131.275 199.696 110.252 1.00 0.00 ? 31   ILE S CA 1 
ATOM 6618 C CA . GLN L  12 32   ? 129.800 203.097 109.328 1.00 0.00 ? 32   GLN S CA 1 
ATOM 6619 C CA . VAL L  12 33   ? 132.389 205.834 109.830 1.00 0.00 ? 33   VAL S CA 1 
ATOM 6620 C CA . TRP L  12 34   ? 132.725 209.673 109.701 1.00 0.00 ? 34   TRP S CA 1 
ATOM 6621 C CA . LEU L  12 35   ? 135.632 211.867 108.303 1.00 0.00 ? 35   LEU S CA 1 
ATOM 6622 C CA . TYR L  12 36   ? 136.597 215.322 109.572 1.00 0.00 ? 36   TYR S CA 1 
ATOM 6623 C CA . GLU L  12 37   ? 139.026 217.766 107.890 1.00 0.00 ? 37   GLU S CA 1 
ATOM 6624 C CA . GLN L  12 38   ? 140.694 221.151 108.707 1.00 0.00 ? 38   GLN S CA 1 
ATOM 6625 C CA . VAL L  12 39   ? 139.136 222.533 105.460 1.00 0.00 ? 39   VAL S CA 1 
ATOM 6626 C CA . ASN L  12 40   ? 135.635 222.616 107.034 1.00 0.00 ? 40   ASN S CA 1 
ATOM 6627 C CA . MET L  12 41   ? 134.490 219.698 104.831 1.00 0.00 ? 41   MET S CA 1 
ATOM 6628 C CA . ARG L  12 42   ? 133.805 216.048 105.494 1.00 0.00 ? 42   ARG S CA 1 
ATOM 6629 C CA . ILE L  12 43   ? 133.149 212.547 104.162 1.00 0.00 ? 43   ILE S CA 1 
ATOM 6630 C CA . GLU L  12 44   ? 130.919 209.559 105.126 1.00 0.00 ? 44   GLU S CA 1 
ATOM 6631 C CA . GLY L  12 45   ? 131.872 205.913 104.228 1.00 0.00 ? 45   GLY S CA 1 
ATOM 6632 C CA . CYS L  12 46   ? 132.341 202.190 105.123 1.00 0.00 ? 46   CYS S CA 1 
ATOM 6633 C CA . ILE L  12 47   ? 136.041 201.620 106.084 1.00 0.00 ? 47   ILE S CA 1 
ATOM 6634 C CA . ILE L  12 48   ? 137.683 198.698 104.267 1.00 0.00 ? 48   ILE S CA 1 
ATOM 6635 C CA . GLY L  12 49   ? 141.462 198.946 105.086 1.00 0.00 ? 49   GLY S CA 1 
ATOM 6636 C CA . PHE L  12 50   ? 144.057 201.134 106.818 1.00 0.00 ? 50   PHE S CA 1 
ATOM 6637 C CA . ASP L  12 51   ? 147.770 201.676 107.477 1.00 0.00 ? 51   ASP S CA 1 
ATOM 6638 C CA . GLU L  12 52   ? 149.690 202.974 110.545 1.00 0.00 ? 52   GLU S CA 1 
ATOM 6639 C CA . TYR L  12 53   ? 150.034 206.457 108.975 1.00 0.00 ? 53   TYR S CA 1 
ATOM 6640 C CA . MET L  12 54   ? 146.226 206.639 109.458 1.00 0.00 ? 54   MET S CA 1 
ATOM 6641 C CA . ASN L  12 55   ? 145.586 206.370 105.741 1.00 0.00 ? 55   ASN S CA 1 
ATOM 6642 C CA . LEU L  12 56   ? 142.213 204.760 105.253 1.00 0.00 ? 56   LEU S CA 1 
ATOM 6643 C CA . VAL L  12 57   ? 140.213 203.291 102.394 1.00 0.00 ? 57   VAL S CA 1 
ATOM 6644 C CA . LEU L  12 58   ? 136.467 204.097 102.362 1.00 0.00 ? 58   LEU S CA 1 
ATOM 6645 C CA . ASP L  12 59   ? 133.648 202.793 100.046 1.00 0.00 ? 59   ASP S CA 1 
ATOM 6646 C CA . ASP L  12 60   ? 130.229 204.337 99.505  1.00 0.00 ? 60   ASP S CA 1 
ATOM 6647 C CA . ALA L  12 61   ? 131.612 207.817 100.400 1.00 0.00 ? 61   ALA S CA 1 
ATOM 6648 C CA . GLU L  12 62   ? 129.667 211.125 100.318 1.00 0.00 ? 62   GLU S CA 1 
ATOM 6649 C CA . GLU L  12 63   ? 131.579 214.434 100.413 1.00 0.00 ? 63   GLU S CA 1 
ATOM 6650 C CA . ILE L  12 64   ? 130.014 216.933 102.827 1.00 0.00 ? 64   ILE S CA 1 
ATOM 6651 C CA . HIS L  12 65   ? 130.211 220.743 102.718 1.00 0.00 ? 65   HIS S CA 1 
ATOM 6652 C CA . SER L  12 66   ? 130.278 223.406 105.478 1.00 0.00 ? 66   SER S CA 1 
ATOM 6653 C CA . LYS L  12 67   ? 127.079 224.913 103.977 1.00 0.00 ? 67   LYS S CA 1 
ATOM 6654 C CA . THR L  12 68   ? 125.513 221.584 105.138 1.00 0.00 ? 68   THR S CA 1 
ATOM 6655 C CA . LYS L  12 69   ? 125.279 220.414 101.515 1.00 0.00 ? 69   LYS S CA 1 
ATOM 6656 C CA . SER L  12 70   ? 126.729 217.030 100.728 1.00 0.00 ? 70   SER S CA 1 
ATOM 6657 C CA . ARG L  12 71   ? 128.920 217.699 97.716  1.00 0.00 ? 71   ARG S CA 1 
ATOM 6658 C CA . LYS L  12 72   ? 129.209 214.226 96.051  1.00 0.00 ? 72   LYS S CA 1 
ATOM 6659 C CA . GLN L  12 73   ? 129.233 210.407 96.602  1.00 0.00 ? 73   GLN S CA 1 
ATOM 6660 C CA . LEU L  12 74   ? 132.242 208.376 95.412  1.00 0.00 ? 74   LEU S CA 1 
ATOM 6661 C CA . GLY L  12 75   ? 132.996 204.781 94.621  1.00 0.00 ? 75   GLY S CA 1 
ATOM 6662 C CA . ARG L  12 76   ? 136.419 204.157 96.090  1.00 0.00 ? 76   ARG S CA 1 
ATOM 6663 C CA . ILE L  12 77   ? 138.489 206.646 98.071  1.00 0.00 ? 77   ILE S CA 1 
ATOM 6664 C CA . MET L  12 78   ? 141.979 206.290 99.621  1.00 0.00 ? 78   MET S CA 1 
ATOM 6665 C CA . LEU L  12 79   ? 142.805 209.056 102.082 1.00 0.00 ? 79   LEU S CA 1 
ATOM 6666 C CA . LYS L  12 80   ? 146.180 210.614 103.192 1.00 0.00 ? 80   LYS S CA 1 
ATOM 6667 C CA . GLY L  12 81   ? 146.704 210.360 106.923 1.00 0.00 ? 81   GLY S CA 1 
ATOM 6668 C CA . ASP L  12 82   ? 148.302 213.772 107.326 1.00 0.00 ? 82   ASP S CA 1 
ATOM 6669 C CA . ASN L  12 83   ? 145.090 215.460 106.231 1.00 0.00 ? 83   ASN S CA 1 
ATOM 6670 C CA . ILE L  12 84   ? 142.841 213.576 108.704 1.00 0.00 ? 84   ILE S CA 1 
ATOM 6671 C CA . THR L  12 85   ? 141.691 215.647 111.700 1.00 0.00 ? 85   THR S CA 1 
ATOM 6672 C CA . LEU L  12 86   ? 138.768 213.765 113.298 1.00 0.00 ? 86   LEU S CA 1 
ATOM 6673 C CA . LEU L  12 87   ? 136.664 210.636 112.726 1.00 0.00 ? 87   LEU S CA 1 
ATOM 6674 C CA . GLN L  12 88   ? 133.466 209.541 114.434 1.00 0.00 ? 88   GLN S CA 1 
ATOM 6675 C CA . SER L  12 89   ? 131.265 206.455 114.396 1.00 0.00 ? 89   SER S CA 1 
ATOM 6676 C CA . VAL L  12 90   ? 127.909 205.252 115.871 1.00 0.00 ? 90   VAL S CA 1 
ATOM 6677 C CA . SER L  12 91   ? 126.492 208.813 115.694 1.00 0.00 ? 91   SER S CA 1 
ATOM 6678 C CA . ASN L  12 92   ? 122.826 209.544 114.890 1.00 0.00 ? 92   ASN S CA 1 
ATOM 6679 C CA . PRO M  13 4    ? 154.579 193.415 103.547 1.00 0.00 ? 4    PRO T CA 1 
ATOM 6680 C CA . LEU M  13 5    ? 155.445 197.076 104.309 1.00 0.00 ? 5    LEU T CA 1 
ATOM 6681 C CA . ASN M  13 6    ? 153.353 200.125 103.293 1.00 0.00 ? 6    ASN T CA 1 
ATOM 6682 C CA . PRO M  13 7    ? 155.503 201.625 100.467 1.00 0.00 ? 7    PRO T CA 1 
ATOM 6683 C CA . LYS M  13 8    ? 156.289 198.778 98.034  1.00 0.00 ? 8    LYS T CA 1 
ATOM 6684 C CA . PRO M  13 9    ? 152.853 196.991 97.731  1.00 0.00 ? 9    PRO T CA 1 
ATOM 6685 C CA . PHE M  13 10   ? 150.923 199.949 96.392  1.00 0.00 ? 10   PHE T CA 1 
ATOM 6686 C CA . LEU M  13 11   ? 152.963 200.373 93.220  1.00 0.00 ? 11   LEU T CA 1 
ATOM 6687 C CA . ASN M  13 12   ? 151.942 196.943 91.814  1.00 0.00 ? 12   ASN T CA 1 
ATOM 6688 C CA . GLY M  13 13   ? 148.188 197.272 92.454  1.00 0.00 ? 13   GLY T CA 1 
ATOM 6689 C CA . LEU M  13 14   ? 147.774 200.769 90.980  1.00 0.00 ? 14   LEU T CA 1 
ATOM 6690 C CA . THR M  13 15   ? 149.999 200.514 87.866  1.00 0.00 ? 15   THR T CA 1 
ATOM 6691 C CA . GLY M  13 16   ? 148.337 201.784 84.670  1.00 0.00 ? 16   GLY T CA 1 
ATOM 6692 C CA . LYS M  13 17   ? 145.098 202.878 86.404  1.00 0.00 ? 17   LYS T CA 1 
ATOM 6693 C CA . PRO M  13 18   ? 142.794 205.870 85.767  1.00 0.00 ? 18   PRO T CA 1 
ATOM 6694 C CA . VAL M  13 19   ? 141.942 208.124 88.729  1.00 0.00 ? 19   VAL T CA 1 
ATOM 6695 C CA . MET M  13 20   ? 140.847 211.575 89.790  1.00 0.00 ? 20   MET T CA 1 
ATOM 6696 C CA . VAL M  13 21   ? 143.226 213.112 92.359  1.00 0.00 ? 21   VAL T CA 1 
ATOM 6697 C CA . LYS M  13 22   ? 142.323 215.832 94.913  1.00 0.00 ? 22   LYS T CA 1 
ATOM 6698 C CA . LEU M  13 23   ? 144.816 218.148 96.534  1.00 0.00 ? 23   LEU T CA 1 
ATOM 6699 C CA . LYS M  13 24   ? 144.610 219.933 99.953  1.00 0.00 ? 24   LYS T CA 1 
ATOM 6700 C CA . TRP M  13 25   ? 144.705 223.138 97.882  1.00 0.00 ? 25   TRP T CA 1 
ATOM 6701 C CA . GLY M  13 26   ? 141.475 221.899 96.274  1.00 0.00 ? 26   GLY T CA 1 
ATOM 6702 C CA . MET M  13 27   ? 142.887 221.536 92.814  1.00 0.00 ? 27   MET T CA 1 
ATOM 6703 C CA . GLU M  13 28   ? 142.066 218.299 90.960  1.00 0.00 ? 28   GLU T CA 1 
ATOM 6704 C CA . TYR M  13 29   ? 144.161 216.284 88.462  1.00 0.00 ? 29   TYR T CA 1 
ATOM 6705 C CA . LYS M  13 30   ? 142.803 213.322 86.521  1.00 0.00 ? 30   LYS T CA 1 
ATOM 6706 C CA . GLY M  13 31   ? 144.854 210.958 84.357  1.00 0.00 ? 31   GLY T CA 1 
ATOM 6707 C CA . TYR M  13 32   ? 146.413 207.522 84.143  1.00 0.00 ? 32   TYR T CA 1 
ATOM 6708 C CA . LEU M  13 33   ? 148.487 206.458 87.190  1.00 0.00 ? 33   LEU T CA 1 
ATOM 6709 C CA . VAL M  13 34   ? 151.837 205.059 86.048  1.00 0.00 ? 34   VAL T CA 1 
ATOM 6710 C CA . SER M  13 35   ? 153.800 204.949 89.323  1.00 0.00 ? 35   SER T CA 1 
ATOM 6711 C CA . VAL M  13 36   ? 154.063 205.775 93.048  1.00 0.00 ? 36   VAL T CA 1 
ATOM 6712 C CA . ASP M  13 37   ? 156.779 205.847 95.753  1.00 0.00 ? 37   ASP T CA 1 
ATOM 6713 C CA . GLY M  13 38   ? 157.104 205.692 99.626  1.00 0.00 ? 38   GLY T CA 1 
ATOM 6714 C CA . TYR M  13 39   ? 155.895 209.300 100.195 1.00 0.00 ? 39   TYR T CA 1 
ATOM 6715 C CA . MET M  13 40   ? 152.667 208.698 98.155  1.00 0.00 ? 40   MET T CA 1 
ATOM 6716 C CA . ASN M  13 41   ? 154.245 210.914 95.459  1.00 0.00 ? 41   ASN T CA 1 
ATOM 6717 C CA . MET M  13 42   ? 152.410 209.920 92.295  1.00 0.00 ? 42   MET T CA 1 
ATOM 6718 C CA . GLN M  13 43   ? 153.065 210.229 88.560  1.00 0.00 ? 43   GLN T CA 1 
ATOM 6719 C CA . LEU M  13 44   ? 150.162 210.518 86.079  1.00 0.00 ? 44   LEU T CA 1 
ATOM 6720 C CA . ALA M  13 45   ? 150.045 210.232 82.223  1.00 0.00 ? 45   ALA T CA 1 
ATOM 6721 C CA . ASN M  13 46   ? 147.634 212.139 79.955  1.00 0.00 ? 46   ASN T CA 1 
ATOM 6722 C CA . THR M  13 47   ? 146.818 214.048 83.125  1.00 0.00 ? 47   THR T CA 1 
ATOM 6723 C CA . GLU M  13 48   ? 144.027 216.662 83.303  1.00 0.00 ? 48   GLU T CA 1 
ATOM 6724 C CA . GLU M  13 49   ? 143.820 219.641 85.667  1.00 0.00 ? 49   GLU T CA 1 
ATOM 6725 C CA . TYR M  13 50   ? 140.520 220.988 86.827  1.00 0.00 ? 50   TYR T CA 1 
ATOM 6726 C CA . ILE M  13 51   ? 139.835 224.283 88.594  1.00 0.00 ? 51   ILE T CA 1 
ATOM 6727 C CA . ASP M  13 52   ? 136.449 225.042 90.237  1.00 0.00 ? 52   ASP T CA 1 
ATOM 6728 C CA . GLY M  13 53   ? 135.001 221.916 88.597  1.00 0.00 ? 53   GLY T CA 1 
ATOM 6729 C CA . ALA M  13 54   ? 136.027 222.883 85.006  1.00 0.00 ? 54   ALA T CA 1 
ATOM 6730 C CA . LEU M  13 55   ? 138.839 221.637 82.762  1.00 0.00 ? 55   LEU T CA 1 
ATOM 6731 C CA . SER M  13 56   ? 141.413 224.482 82.936  1.00 0.00 ? 56   SER T CA 1 
ATOM 6732 C CA . GLY M  13 57   ? 144.459 222.672 81.447  1.00 0.00 ? 57   GLY T CA 1 
ATOM 6733 C CA . HIS M  13 58   ? 146.271 219.423 80.637  1.00 0.00 ? 58   HIS T CA 1 
ATOM 6734 C CA . LEU M  13 59   ? 149.718 217.941 80.000  1.00 0.00 ? 59   LEU T CA 1 
ATOM 6735 C CA . GLY M  13 60   ? 151.548 214.787 78.855  1.00 0.00 ? 60   GLY T CA 1 
ATOM 6736 C CA . GLU M  13 61   ? 153.140 213.780 82.185  1.00 0.00 ? 61   GLU T CA 1 
ATOM 6737 C CA . VAL M  13 62   ? 153.128 215.119 85.709  1.00 0.00 ? 62   VAL T CA 1 
ATOM 6738 C CA . LEU M  13 63   ? 154.789 214.792 89.112  1.00 0.00 ? 63   LEU T CA 1 
ATOM 6739 C CA . ILE M  13 64   ? 152.956 215.618 92.374  1.00 0.00 ? 64   ILE T CA 1 
ATOM 6740 C CA . ARG M  13 65   ? 154.850 216.152 95.694  1.00 0.00 ? 65   ARG T CA 1 
ATOM 6741 C CA . CYS M  13 66   ? 152.420 214.208 97.848  1.00 0.00 ? 66   CYS T CA 1 
ATOM 6742 C CA . ASN M  13 67   ? 152.089 216.714 100.713 1.00 0.00 ? 67   ASN T CA 1 
ATOM 6743 C CA . ASN M  13 68   ? 149.602 218.385 98.296  1.00 0.00 ? 68   ASN T CA 1 
ATOM 6744 C CA . VAL M  13 69   ? 147.858 214.997 97.687  1.00 0.00 ? 69   VAL T CA 1 
ATOM 6745 C CA . LEU M  13 70   ? 144.762 214.512 99.885  1.00 0.00 ? 70   LEU T CA 1 
ATOM 6746 C CA . TYR M  13 71   ? 143.231 211.367 98.417  1.00 0.00 ? 71   TYR T CA 1 
ATOM 6747 C CA . ILE M  13 72   ? 142.524 209.309 95.265  1.00 0.00 ? 72   ILE T CA 1 
ATOM 6748 C CA . ARG M  13 73   ? 139.192 208.381 93.627  1.00 0.00 ? 73   ARG T CA 1 
ATOM 6749 C CA . GLY M  13 74   ? 138.855 205.982 90.698  1.00 0.00 ? 74   GLY T CA 1 
ATOM 6750 C CA . VAL M  13 75   ? 135.400 206.607 89.221  1.00 0.00 ? 75   VAL T CA 1 
ATOM 6751 C CA . GLU M  13 76   ? 136.574 206.879 85.576  1.00 0.00 ? 76   GLU T CA 1 
ATOM 6752 C CA . ALA N  14 4    ? 155.811 210.665 128.081 1.00 0.00 ? 4    ALA U CA 1 
ATOM 6753 C CA . HIS N  14 5    ? 152.585 209.075 126.720 1.00 0.00 ? 5    HIS U CA 1 
ATOM 6754 C CA . PRO N  14 6    ? 151.028 206.746 129.496 1.00 0.00 ? 6    PRO U CA 1 
ATOM 6755 C CA . PRO N  14 7    ? 151.815 209.027 132.456 1.00 0.00 ? 7    PRO U CA 1 
ATOM 6756 C CA . GLU N  14 8    ? 149.721 211.585 130.517 1.00 0.00 ? 8    GLU U CA 1 
ATOM 6757 C CA . LEU N  14 9    ? 147.232 208.713 129.910 1.00 0.00 ? 9    LEU U CA 1 
ATOM 6758 C CA . LYS N  14 10   ? 147.063 207.166 133.446 1.00 0.00 ? 10   LYS U CA 1 
ATOM 6759 C CA . LYS N  14 11   ? 146.215 210.511 135.031 1.00 0.00 ? 11   LYS U CA 1 
ATOM 6760 C CA . PHE N  14 12   ? 143.227 211.184 132.724 1.00 0.00 ? 12   PHE U CA 1 
ATOM 6761 C CA . MET N  14 13   ? 141.935 208.056 130.996 1.00 0.00 ? 13   MET U CA 1 
ATOM 6762 C CA . ASP N  14 14   ? 138.328 207.246 131.968 1.00 0.00 ? 14   ASP U CA 1 
ATOM 6763 C CA . LYS N  14 15   ? 137.617 210.752 133.360 1.00 0.00 ? 15   LYS U CA 1 
ATOM 6764 C CA . LYS N  14 16   ? 135.871 213.879 132.068 1.00 0.00 ? 16   LYS U CA 1 
ATOM 6765 C CA . LEU N  14 17   ? 138.523 215.820 130.039 1.00 0.00 ? 17   LEU U CA 1 
ATOM 6766 C CA . SER N  14 18   ? 138.388 219.182 128.147 1.00 0.00 ? 18   SER U CA 1 
ATOM 6767 C CA . LEU N  14 19   ? 140.185 219.724 124.811 1.00 0.00 ? 19   LEU U CA 1 
ATOM 6768 C CA . LYS N  14 20   ? 140.743 223.036 122.956 1.00 0.00 ? 20   LYS U CA 1 
ATOM 6769 C CA . LEU N  14 21   ? 141.832 222.697 119.354 1.00 0.00 ? 21   LEU U CA 1 
ATOM 6770 C CA . ASN N  14 22   ? 143.104 224.983 116.624 1.00 0.00 ? 22   ASN U CA 1 
ATOM 6771 C CA . GLY N  14 23   ? 139.668 224.506 115.086 1.00 0.00 ? 23   GLY U CA 1 
ATOM 6772 C CA . GLY N  14 24   ? 138.737 227.087 117.710 1.00 0.00 ? 24   GLY U CA 1 
ATOM 6773 C CA . ARG N  14 25   ? 136.151 224.730 119.136 1.00 0.00 ? 25   ARG U CA 1 
ATOM 6774 C CA . HIS N  14 26   ? 135.841 223.451 122.661 1.00 0.00 ? 26   HIS U CA 1 
ATOM 6775 C CA . VAL N  14 27   ? 135.224 219.745 123.050 1.00 0.00 ? 27   VAL U CA 1 
ATOM 6776 C CA . GLN N  14 28   ? 134.761 217.681 126.225 1.00 0.00 ? 28   GLN U CA 1 
ATOM 6777 C CA . GLY N  14 29   ? 134.850 213.931 126.458 1.00 0.00 ? 29   GLY U CA 1 
ATOM 6778 C CA . ILE N  14 30   ? 135.975 210.753 128.181 1.00 0.00 ? 30   ILE U CA 1 
ATOM 6779 C CA . LEU N  14 31   ? 139.488 209.661 127.235 1.00 0.00 ? 31   LEU U CA 1 
ATOM 6780 C CA . ARG N  14 32   ? 139.423 206.025 126.167 1.00 0.00 ? 32   ARG U CA 1 
ATOM 6781 C CA . GLY N  14 33   ? 142.434 205.681 123.848 1.00 0.00 ? 33   GLY U CA 1 
ATOM 6782 C CA . PHE N  14 34   ? 145.865 207.256 123.410 1.00 0.00 ? 34   PHE U CA 1 
ATOM 6783 C CA . ASP N  14 35   ? 149.079 206.945 121.348 1.00 0.00 ? 35   ASP U CA 1 
ATOM 6784 C CA . PRO N  14 36   ? 152.687 208.460 121.007 1.00 0.00 ? 36   PRO U CA 1 
ATOM 6785 C CA . PHE N  14 37   ? 151.694 211.140 118.420 1.00 0.00 ? 37   PHE U CA 1 
ATOM 6786 C CA . MET N  14 38   ? 149.182 212.456 121.053 1.00 0.00 ? 38   MET U CA 1 
ATOM 6787 C CA . ASN N  14 39   ? 146.268 211.009 119.048 1.00 0.00 ? 39   ASN U CA 1 
ATOM 6788 C CA . LEU N  14 40   ? 143.205 210.634 121.324 1.00 0.00 ? 40   LEU U CA 1 
ATOM 6789 C CA . VAL N  14 41   ? 139.912 208.653 121.128 1.00 0.00 ? 41   VAL U CA 1 
ATOM 6790 C CA . ILE N  14 42   ? 137.027 210.095 123.084 1.00 0.00 ? 42   ILE U CA 1 
ATOM 6791 C CA . ASP N  14 43   ? 133.872 208.435 124.294 1.00 0.00 ? 43   ASP U CA 1 
ATOM 6792 C CA . GLU N  14 44   ? 130.757 210.585 124.653 1.00 0.00 ? 44   GLU U CA 1 
ATOM 6793 C CA . CYS N  14 45   ? 132.173 213.831 123.259 1.00 0.00 ? 45   CYS U CA 1 
ATOM 6794 C CA . VAL N  14 46   ? 130.543 217.203 122.447 1.00 0.00 ? 46   VAL U CA 1 
ATOM 6795 C CA . GLU N  14 47   ? 131.668 219.937 119.956 1.00 0.00 ? 47   GLU U CA 1 
ATOM 6796 C CA . MET N  14 48   ? 130.836 223.671 120.006 1.00 0.00 ? 48   MET U CA 1 
ATOM 6797 C CA . ALA N  14 49   ? 131.320 225.998 116.991 1.00 0.00 ? 49   ALA U CA 1 
ATOM 6798 C CA . THR N  14 50   ? 130.304 229.620 117.244 1.00 0.00 ? 50   THR U CA 1 
ATOM 6799 C CA . SER N  14 51   ? 130.179 228.908 120.987 1.00 0.00 ? 51   SER U CA 1 
ATOM 6800 C CA . GLY N  14 52   ? 126.974 226.975 120.508 1.00 0.00 ? 52   GLY U CA 1 
ATOM 6801 C CA . GLN N  14 53   ? 126.814 223.375 121.591 1.00 0.00 ? 53   GLN U CA 1 
ATOM 6802 C CA . GLN N  14 54   ? 126.306 222.084 118.088 1.00 0.00 ? 54   GLN U CA 1 
ATOM 6803 C CA . ASN N  14 55   ? 127.201 218.326 118.103 1.00 0.00 ? 55   ASN U CA 1 
ATOM 6804 C CA . ASN N  14 56   ? 127.452 215.111 120.230 1.00 0.00 ? 56   ASN U CA 1 
ATOM 6805 C CA . ILE N  14 57   ? 129.229 211.840 119.285 1.00 0.00 ? 57   ILE U CA 1 
ATOM 6806 C CA . GLY N  14 58   ? 129.551 208.479 121.084 1.00 0.00 ? 58   GLY U CA 1 
ATOM 6807 C CA . MET N  14 59   ? 133.054 207.548 119.939 1.00 0.00 ? 59   MET U CA 1 
ATOM 6808 C CA . VAL N  14 60   ? 135.612 209.655 118.044 1.00 0.00 ? 60   VAL U CA 1 
ATOM 6809 C CA . VAL N  14 61   ? 139.300 209.554 116.930 1.00 0.00 ? 61   VAL U CA 1 
ATOM 6810 C CA . ILE N  14 62   ? 141.590 212.596 117.090 1.00 0.00 ? 62   ILE U CA 1 
ATOM 6811 C CA . ARG N  14 63   ? 145.052 213.648 115.879 1.00 0.00 ? 63   ARG U CA 1 
ATOM 6812 C CA . GLY N  14 64   ? 147.527 215.021 118.468 1.00 0.00 ? 64   GLY U CA 1 
ATOM 6813 C CA . ASN N  14 65   ? 149.009 217.446 115.950 1.00 0.00 ? 65   ASN U CA 1 
ATOM 6814 C CA . SER N  14 66   ? 145.802 219.557 116.144 1.00 0.00 ? 66   SER U CA 1 
ATOM 6815 C CA . ILE N  14 67   ? 145.732 219.461 120.000 1.00 0.00 ? 67   ILE U CA 1 
ATOM 6816 C CA . ILE N  14 68   ? 146.697 222.716 121.750 1.00 0.00 ? 68   ILE U CA 1 
ATOM 6817 C CA . MET N  14 69   ? 146.050 221.779 125.346 1.00 0.00 ? 69   MET U CA 1 
ATOM 6818 C CA . LEU N  14 70   ? 144.038 219.503 127.626 1.00 0.00 ? 70   LEU U CA 1 
ATOM 6819 C CA . GLU N  14 71   ? 142.102 220.187 130.873 1.00 0.00 ? 71   GLU U CA 1 
ATOM 6820 C CA . ALA N  14 72   ? 139.916 218.094 133.257 1.00 0.00 ? 72   ALA U CA 1 
ATOM 6821 C CA . LEU N  14 73   ? 136.623 219.066 135.000 1.00 0.00 ? 73   LEU U CA 1 
ATOM 6822 C CA . GLU N  14 74   ? 135.039 217.332 138.025 1.00 0.00 ? 74   GLU U CA 1 
ATOM 6823 C CA . ARG N  14 75   ? 131.993 217.772 140.287 1.00 0.00 ? 75   ARG U CA 1 
ATOM 6824 C CA . VAL N  14 76   ? 129.924 219.164 137.341 1.00 0.00 ? 76   VAL U CA 1 
ATOM 6825 C CA . ALA O  15 4    ? 325.248 287.131 259.602 1.00 0.00 ? 4    ALA 8 CA 1 
ATOM 6826 C CA . LEU O  15 5    ? 326.246 289.415 256.693 1.00 0.00 ? 5    LEU 8 CA 1 
ATOM 6827 C CA . GLU O  15 6    ? 324.868 292.436 258.596 1.00 0.00 ? 6    GLU 8 CA 1 
ATOM 6828 C CA . ASN O  15 7    ? 328.262 294.104 259.208 1.00 0.00 ? 7    ASN 8 CA 1 
ATOM 6829 C CA . TYR O  15 8    ? 328.807 294.150 255.413 1.00 0.00 ? 8    TYR 8 CA 1 
ATOM 6830 C CA . ILE O  15 9    ? 325.753 296.189 254.328 1.00 0.00 ? 9    ILE 8 CA 1 
ATOM 6831 C CA . ASN O  15 10   ? 326.607 299.230 252.161 1.00 0.00 ? 10   ASN 8 CA 1 
ATOM 6832 C CA . ARG O  15 11   ? 330.340 298.387 252.320 1.00 0.00 ? 11   ARG 8 CA 1 
ATOM 6833 C CA . THR O  15 12   ? 332.391 297.199 249.339 1.00 0.00 ? 12   THR 8 CA 1 
ATOM 6834 C CA . VAL O  15 13   ? 333.003 293.450 249.217 1.00 0.00 ? 13   VAL 8 CA 1 
ATOM 6835 C CA . ALA O  15 14   ? 334.972 290.745 247.440 1.00 0.00 ? 14   ALA 8 CA 1 
ATOM 6836 C CA . VAL O  15 15   ? 332.799 287.852 246.271 1.00 0.00 ? 15   VAL 8 CA 1 
ATOM 6837 C CA . ILE O  15 16   ? 333.981 284.410 245.223 1.00 0.00 ? 16   ILE 8 CA 1 
ATOM 6838 C CA . THR O  15 17   ? 331.469 282.242 243.406 1.00 0.00 ? 17   THR 8 CA 1 
ATOM 6839 C CA . SER O  15 18   ? 331.564 278.414 243.640 1.00 0.00 ? 18   SER 8 CA 1 
ATOM 6840 C CA . ASP O  15 19   ? 333.000 278.226 240.095 1.00 0.00 ? 19   ASP 8 CA 1 
ATOM 6841 C CA . GLY O  15 20   ? 336.056 280.196 241.358 1.00 0.00 ? 20   GLY 8 CA 1 
ATOM 6842 C CA . ARG O  15 21   ? 335.083 283.479 239.613 1.00 0.00 ? 21   ARG 8 CA 1 
ATOM 6843 C CA . MET O  15 22   ? 335.589 286.754 241.486 1.00 0.00 ? 22   MET 8 CA 1 
ATOM 6844 C CA . ILE O  15 23   ? 333.557 289.976 241.676 1.00 0.00 ? 23   ILE 8 CA 1 
ATOM 6845 C CA . VAL O  15 24   ? 333.847 293.292 243.533 1.00 0.00 ? 24   VAL 8 CA 1 
ATOM 6846 C CA . GLY O  15 25   ? 330.763 295.324 244.494 1.00 0.00 ? 25   GLY 8 CA 1 
ATOM 6847 C CA . THR O  15 26   ? 328.632 297.150 247.041 1.00 0.00 ? 26   THR 8 CA 1 
ATOM 6848 C CA . LEU O  15 27   ? 326.570 294.698 249.097 1.00 0.00 ? 27   LEU 8 CA 1 
ATOM 6849 C CA . LYS O  15 28   ? 323.108 296.283 249.367 1.00 0.00 ? 28   LYS 8 CA 1 
ATOM 6850 C CA . GLY O  15 29   ? 320.682 293.444 250.218 1.00 0.00 ? 29   GLY 8 CA 1 
ATOM 6851 C CA . PHE O  15 30   ? 320.919 289.817 251.363 1.00 0.00 ? 30   PHE 8 CA 1 
ATOM 6852 C CA . ASP O  15 31   ? 318.399 287.234 252.567 1.00 0.00 ? 31   ASP 8 CA 1 
ATOM 6853 C CA . GLN O  15 32   ? 318.478 283.978 254.578 1.00 0.00 ? 32   GLN 8 CA 1 
ATOM 6854 C CA . THR O  15 33   ? 319.253 281.928 251.440 1.00 0.00 ? 33   THR 8 CA 1 
ATOM 6855 C CA . ILE O  15 34   ? 322.286 284.239 250.809 1.00 0.00 ? 34   ILE 8 CA 1 
ATOM 6856 C CA . ASN O  15 35   ? 320.672 285.890 247.759 1.00 0.00 ? 35   ASN 8 CA 1 
ATOM 6857 C CA . LEU O  15 36   ? 322.779 289.045 247.477 1.00 0.00 ? 36   LEU 8 CA 1 
ATOM 6858 C CA . ILE O  15 37   ? 321.667 292.376 246.033 1.00 0.00 ? 37   ILE 8 CA 1 
ATOM 6859 C CA . LEU O  15 38   ? 324.608 294.126 244.492 1.00 0.00 ? 38   LEU 8 CA 1 
ATOM 6860 C CA . ASP O  15 39   ? 325.489 297.521 243.049 1.00 0.00 ? 39   ASP 8 CA 1 
ATOM 6861 C CA . GLU O  15 40   ? 328.456 298.744 240.943 1.00 0.00 ? 40   GLU 8 CA 1 
ATOM 6862 C CA . SER O  15 41   ? 329.923 295.357 240.123 1.00 0.00 ? 41   SER 8 CA 1 
ATOM 6863 C CA . HIS O  15 42   ? 333.105 294.370 238.405 1.00 0.00 ? 42   HIS 8 CA 1 
ATOM 6864 C CA . GLU O  15 43   ? 335.149 291.291 237.533 1.00 0.00 ? 43   GLU 8 CA 1 
ATOM 6865 C CA . ARG O  15 44   ? 337.956 291.337 240.132 1.00 0.00 ? 44   ARG 8 CA 1 
ATOM 6866 C CA . VAL O  15 45   ? 340.425 289.769 237.615 1.00 0.00 ? 45   VAL 8 CA 1 
ATOM 6867 C CA . PHE O  15 46   ? 340.384 288.671 233.969 1.00 0.00 ? 46   PHE 8 CA 1 
ATOM 6868 C CA . SER O  15 47   ? 342.687 286.850 231.504 1.00 0.00 ? 47   SER 8 CA 1 
ATOM 6869 C CA . SER O  15 48   ? 343.343 290.171 229.750 1.00 0.00 ? 48   SER 8 CA 1 
ATOM 6870 C CA . SER O  15 49   ? 345.013 293.055 231.603 1.00 0.00 ? 49   SER 8 CA 1 
ATOM 6871 C CA . GLN O  15 50   ? 342.383 295.511 230.259 1.00 0.00 ? 50   GLN 8 CA 1 
ATOM 6872 C CA . GLY O  15 51   ? 339.063 295.597 232.114 1.00 0.00 ? 51   GLY 8 CA 1 
ATOM 6873 C CA . VAL O  15 52   ? 340.671 293.268 234.727 1.00 0.00 ? 52   VAL 8 CA 1 
ATOM 6874 C CA . GLU O  15 53   ? 338.324 295.167 236.204 1.00 0.00 ? 53   GLU 8 CA 1 
ATOM 6875 C CA . GLN O  15 54   ? 335.286 295.004 233.897 1.00 0.00 ? 54   GLN 8 CA 1 
ATOM 6876 C CA . VAL O  15 55   ? 331.953 296.612 234.825 1.00 0.00 ? 55   VAL 8 CA 1 
ATOM 6877 C CA . VAL O  15 56   ? 329.308 293.919 234.656 1.00 0.00 ? 56   VAL 8 CA 1 
ATOM 6878 C CA . LEU O  15 57   ? 326.450 296.222 235.877 1.00 0.00 ? 57   LEU 8 CA 1 
ATOM 6879 C CA . GLY O  15 58   ? 325.163 299.030 238.093 1.00 0.00 ? 58   GLY 8 CA 1 
ATOM 6880 C CA . LEU O  15 59   ? 322.741 296.673 239.861 1.00 0.00 ? 59   LEU 8 CA 1 
ATOM 6881 C CA . TYR O  15 60   ? 322.490 292.888 239.828 1.00 0.00 ? 60   TYR 8 CA 1 
ATOM 6882 C CA . ILE O  15 61   ? 320.980 290.107 241.919 1.00 0.00 ? 61   ILE 8 CA 1 
ATOM 6883 C CA . VAL O  15 62   ? 322.970 286.960 242.670 1.00 0.00 ? 62   VAL 8 CA 1 
ATOM 6884 C CA . ARG O  15 63   ? 321.741 283.594 243.918 1.00 0.00 ? 63   ARG 8 CA 1 
ATOM 6885 C CA . GLY O  15 64   ? 323.011 282.204 247.234 1.00 0.00 ? 64   GLY 8 CA 1 
ATOM 6886 C CA . ASP O  15 65   ? 323.754 278.944 245.363 1.00 0.00 ? 65   ASP 8 CA 1 
ATOM 6887 C CA . ASN O  15 66   ? 326.615 280.709 243.519 1.00 0.00 ? 66   ASN 8 CA 1 
ATOM 6888 C CA . VAL O  15 67   ? 328.206 282.277 246.592 1.00 0.00 ? 67   VAL 8 CA 1 
ATOM 6889 C CA . ALA O  15 68   ? 331.186 280.410 247.985 1.00 0.00 ? 68   ALA 8 CA 1 
ATOM 6890 C CA . VAL O  15 69   ? 332.525 283.295 250.063 1.00 0.00 ? 69   VAL 8 CA 1 
ATOM 6891 C CA . ILE O  15 70   ? 332.266 286.985 250.843 1.00 0.00 ? 70   ILE 8 CA 1 
ATOM 6892 C CA . GLY O  15 71   ? 335.095 289.212 252.081 1.00 0.00 ? 71   GLY 8 CA 1 
ATOM 6893 C CA . GLU O  15 72   ? 335.028 292.724 253.543 1.00 0.00 ? 72   GLU 8 CA 1 
ATOM 6894 C CA . ILE O  15 73   ? 337.430 295.168 251.839 1.00 0.00 ? 73   ILE 8 CA 1 
ATOM 6895 C CA . THR P  16 7    ? 303.467 251.822 249.344 1.00 0.00 ? 7    THR 6 CA 1 
ATOM 6896 C CA . PRO P  16 8    ? 307.318 252.337 249.258 1.00 0.00 ? 8    PRO 6 CA 1 
ATOM 6897 C CA . SER P  16 9    ? 307.483 252.066 253.091 1.00 0.00 ? 9    SER 6 CA 1 
ATOM 6898 C CA . ASP P  16 10   ? 305.861 248.616 252.974 1.00 0.00 ? 10   ASP 6 CA 1 
ATOM 6899 C CA . PHE P  16 11   ? 308.622 247.751 250.482 1.00 0.00 ? 11   PHE 6 CA 1 
ATOM 6900 C CA . LEU P  16 12   ? 311.385 249.128 252.776 1.00 0.00 ? 12   LEU 6 CA 1 
ATOM 6901 C CA . LYS P  16 13   ? 310.110 246.753 255.476 1.00 0.00 ? 13   LYS 6 CA 1 
ATOM 6902 C CA . GLN P  16 14   ? 309.353 243.839 253.103 1.00 0.00 ? 14   GLN 6 CA 1 
ATOM 6903 C CA . ILE P  16 15   ? 312.925 243.338 251.872 1.00 0.00 ? 15   ILE 6 CA 1 
ATOM 6904 C CA . ILE P  16 16   ? 314.985 244.007 255.050 1.00 0.00 ? 16   ILE 6 CA 1 
ATOM 6905 C CA . GLY P  16 17   ? 317.150 240.903 255.581 1.00 0.00 ? 17   GLY 6 CA 1 
ATOM 6906 C CA . ARG P  16 18   ? 316.946 240.082 251.850 1.00 0.00 ? 18   ARG 6 CA 1 
ATOM 6907 C CA . PRO P  16 19   ? 320.055 240.400 249.613 1.00 0.00 ? 19   PRO 6 CA 1 
ATOM 6908 C CA . VAL P  16 20   ? 319.913 243.691 247.689 1.00 0.00 ? 20   VAL 6 CA 1 
ATOM 6909 C CA . VAL P  16 21   ? 321.856 245.746 245.168 1.00 0.00 ? 21   VAL 6 CA 1 
ATOM 6910 C CA . VAL P  16 22   ? 322.092 249.466 245.935 1.00 0.00 ? 22   VAL 6 CA 1 
ATOM 6911 C CA . LYS P  16 23   ? 323.244 251.788 243.145 1.00 0.00 ? 23   LYS 6 CA 1 
ATOM 6912 C CA . LEU P  16 24   ? 324.544 255.290 243.863 1.00 0.00 ? 24   LEU 6 CA 1 
ATOM 6913 C CA . ASN P  16 25   ? 324.408 258.419 241.692 1.00 0.00 ? 25   ASN 6 CA 1 
ATOM 6914 C CA . SER P  16 26   ? 328.002 257.716 240.584 1.00 0.00 ? 26   SER 6 CA 1 
ATOM 6915 C CA . GLY P  16 27   ? 327.045 254.254 239.196 1.00 0.00 ? 27   GLY 6 CA 1 
ATOM 6916 C CA . VAL P  16 28   ? 328.829 252.341 242.024 1.00 0.00 ? 28   VAL 6 CA 1 
ATOM 6917 C CA . ASP P  16 29   ? 326.819 249.377 243.207 1.00 0.00 ? 29   ASP 6 CA 1 
ATOM 6918 C CA . TYR P  16 30   ? 326.760 247.656 246.619 1.00 0.00 ? 30   TYR 6 CA 1 
ATOM 6919 C CA . ARG P  16 31   ? 325.535 244.068 246.954 1.00 0.00 ? 31   ARG 6 CA 1 
ATOM 6920 C CA . GLY P  16 32   ? 324.766 242.743 250.442 1.00 0.00 ? 32   GLY 6 CA 1 
ATOM 6921 C CA . VAL P  16 33   ? 322.138 242.288 253.181 1.00 0.00 ? 33   VAL 6 CA 1 
ATOM 6922 C CA . LEU P  16 34   ? 319.695 245.033 254.067 1.00 0.00 ? 34   LEU 6 CA 1 
ATOM 6923 C CA . ALA P  16 35   ? 320.166 245.808 257.782 1.00 0.00 ? 35   ALA 6 CA 1 
ATOM 6924 C CA . CYS P  16 36   ? 317.787 248.849 257.808 1.00 0.00 ? 36   CYS 6 CA 1 
ATOM 6925 C CA . LEU P  16 37   ? 316.681 252.063 255.988 1.00 0.00 ? 37   LEU 6 CA 1 
ATOM 6926 C CA . ASP P  16 38   ? 315.076 255.373 256.974 1.00 0.00 ? 38   ASP 6 CA 1 
ATOM 6927 C CA . GLY P  16 39   ? 312.879 258.167 255.530 1.00 0.00 ? 39   GLY 6 CA 1 
ATOM 6928 C CA . TYR P  16 40   ? 315.927 259.883 253.974 1.00 0.00 ? 40   TYR 6 CA 1 
ATOM 6929 C CA . MET P  16 41   ? 316.948 256.810 251.919 1.00 0.00 ? 41   MET 6 CA 1 
ATOM 6930 C CA . ASN P  16 42   ? 319.880 256.063 254.280 1.00 0.00 ? 42   ASN 6 CA 1 
ATOM 6931 C CA . ILE P  16 43   ? 320.866 252.417 254.045 1.00 0.00 ? 43   ILE 6 CA 1 
ATOM 6932 C CA . ALA P  16 44   ? 322.601 249.783 256.173 1.00 0.00 ? 44   ALA 6 CA 1 
ATOM 6933 C CA . LEU P  16 45   ? 324.160 246.740 254.447 1.00 0.00 ? 45   LEU 6 CA 1 
ATOM 6934 C CA . GLU P  16 46   ? 327.310 244.515 254.339 1.00 0.00 ? 46   GLU 6 CA 1 
ATOM 6935 C CA . GLN P  16 47   ? 329.723 243.574 251.454 1.00 0.00 ? 47   GLN 6 CA 1 
ATOM 6936 C CA . THR P  16 48   ? 330.740 244.205 248.373 1.00 0.00 ? 48   THR 6 CA 1 
ATOM 6937 C CA . GLU P  16 49   ? 331.185 247.110 245.915 1.00 0.00 ? 49   GLU 6 CA 1 
ATOM 6938 C CA . GLU P  16 50   ? 331.240 246.901 242.076 1.00 0.00 ? 50   GLU 6 CA 1 
ATOM 6939 C CA . TYR P  16 51   ? 331.122 249.508 239.268 1.00 0.00 ? 51   TYR 6 CA 1 
ATOM 6940 C CA . VAL P  16 52   ? 330.644 249.505 235.459 1.00 0.00 ? 52   VAL 6 CA 1 
ATOM 6941 C CA . ASN P  16 53   ? 334.394 250.349 235.406 1.00 0.00 ? 53   ASN 6 CA 1 
ATOM 6942 C CA . GLY P  16 54   ? 335.245 248.853 238.827 1.00 0.00 ? 54   GLY 6 CA 1 
ATOM 6943 C CA . GLN P  16 55   ? 334.690 245.825 241.202 1.00 0.00 ? 55   GLN 6 CA 1 
ATOM 6944 C CA . LEU P  16 56   ? 336.607 246.917 244.062 1.00 0.00 ? 56   LEU 6 CA 1 
ATOM 6945 C CA . LYS P  16 57   ? 336.027 246.195 247.766 1.00 0.00 ? 57   LYS 6 CA 1 
ATOM 6946 C CA . ASN P  16 58   ? 334.654 243.701 250.296 1.00 0.00 ? 58   ASN 6 CA 1 
ATOM 6947 C CA . LYS P  16 59   ? 333.494 245.271 253.570 1.00 0.00 ? 59   LYS 6 CA 1 
ATOM 6948 C CA . TYR P  16 60   ? 333.368 242.716 256.413 1.00 0.00 ? 60   TYR 6 CA 1 
ATOM 6949 C CA . GLY P  16 61   ? 332.008 245.514 258.599 1.00 0.00 ? 61   GLY 6 CA 1 
ATOM 6950 C CA . ASP P  16 62   ? 328.495 246.893 258.076 1.00 0.00 ? 62   ASP 6 CA 1 
ATOM 6951 C CA . ALA P  16 63   ? 328.307 249.632 255.439 1.00 0.00 ? 63   ALA 6 CA 1 
ATOM 6952 C CA . PHE P  16 64   ? 326.323 252.828 255.496 1.00 0.00 ? 64   PHE 6 CA 1 
ATOM 6953 C CA . ILE P  16 65   ? 325.331 254.537 252.306 1.00 0.00 ? 65   ILE 6 CA 1 
ATOM 6954 C CA . ARG P  16 66   ? 324.101 258.089 252.327 1.00 0.00 ? 66   ARG 6 CA 1 
ATOM 6955 C CA . GLY P  16 67   ? 320.462 258.501 251.323 1.00 0.00 ? 67   GLY 6 CA 1 
ATOM 6956 C CA . ASN P  16 68   ? 321.008 261.439 248.953 1.00 0.00 ? 68   ASN 6 CA 1 
ATOM 6957 C CA . ASN P  16 69   ? 323.383 259.375 246.772 1.00 0.00 ? 69   ASN 6 CA 1 
ATOM 6958 C CA . VAL P  16 70   ? 321.151 256.300 246.273 1.00 0.00 ? 70   VAL 6 CA 1 
ATOM 6959 C CA . LEU P  16 71   ? 319.531 255.834 242.894 1.00 0.00 ? 71   LEU 6 CA 1 
ATOM 6960 C CA . TYR P  16 72   ? 317.866 252.492 243.680 1.00 0.00 ? 72   TYR 6 CA 1 
ATOM 6961 C CA . ILE P  16 73   ? 317.565 249.568 246.086 1.00 0.00 ? 73   ILE 6 CA 1 
ATOM 6962 C CA . SER P  16 74   ? 316.868 246.322 244.213 1.00 0.00 ? 74   SER 6 CA 1 
ATOM 6963 C CA . THR P  16 75   ? 316.570 242.625 245.169 1.00 0.00 ? 75   THR 6 CA 1 
ATOM 6964 C CA . GLN P  16 76   ? 317.936 239.568 243.330 1.00 0.00 ? 76   GLN 6 CA 1 
ATOM 6965 C CA . SER Q  17 10   ? 288.264 268.655 233.649 1.00 0.00 ? 10   SER 5 CA 1 
ATOM 6966 C CA . GLN Q  17 11   ? 292.042 268.873 234.327 1.00 0.00 ? 11   GLN 5 CA 1 
ATOM 6967 C CA . LEU Q  17 12   ? 294.100 265.688 234.094 1.00 0.00 ? 12   LEU 5 CA 1 
ATOM 6968 C CA . LEU Q  17 13   ? 296.249 265.262 237.190 1.00 0.00 ? 13   LEU 5 CA 1 
ATOM 6969 C CA . PRO Q  17 14   ? 299.727 263.749 236.525 1.00 0.00 ? 14   PRO 5 CA 1 
ATOM 6970 C CA . LEU Q  17 15   ? 299.531 261.532 239.656 1.00 0.00 ? 15   LEU 5 CA 1 
ATOM 6971 C CA . GLU Q  17 16   ? 296.298 260.083 238.286 1.00 0.00 ? 16   GLU 5 CA 1 
ATOM 6972 C CA . LEU Q  17 17   ? 298.184 259.250 235.084 1.00 0.00 ? 17   LEU 5 CA 1 
ATOM 6973 C CA . VAL Q  17 18   ? 300.895 257.402 237.045 1.00 0.00 ? 18   VAL 5 CA 1 
ATOM 6974 C CA . ASP Q  17 19   ? 298.205 255.623 239.090 1.00 0.00 ? 19   ASP 5 CA 1 
ATOM 6975 C CA . LYS Q  17 20   ? 296.570 254.164 235.965 1.00 0.00 ? 20   LYS 5 CA 1 
ATOM 6976 C CA . CYS Q  17 21   ? 299.874 252.867 234.532 1.00 0.00 ? 21   CYS 5 CA 1 
ATOM 6977 C CA . ILE Q  17 22   ? 300.315 250.717 237.682 1.00 0.00 ? 22   ILE 5 CA 1 
ATOM 6978 C CA . GLY Q  17 23   ? 300.526 247.018 236.747 1.00 0.00 ? 23   GLY 5 CA 1 
ATOM 6979 C CA . SER Q  17 24   ? 301.554 248.120 233.221 1.00 0.00 ? 24   SER 5 CA 1 
ATOM 6980 C CA . ARG Q  17 25   ? 304.949 248.366 231.520 1.00 0.00 ? 25   ARG 5 CA 1 
ATOM 6981 C CA . ILE Q  17 26   ? 306.676 251.702 232.089 1.00 0.00 ? 26   ILE 5 CA 1 
ATOM 6982 C CA . HIS Q  17 27   ? 309.831 253.473 230.998 1.00 0.00 ? 27   HIS 5 CA 1 
ATOM 6983 C CA . ILE Q  17 28   ? 311.433 255.732 233.607 1.00 0.00 ? 28   ILE 5 CA 1 
ATOM 6984 C CA . VAL Q  17 29   ? 313.975 258.258 232.434 1.00 0.00 ? 29   VAL 5 CA 1 
ATOM 6985 C CA . MET Q  17 30   ? 316.386 259.696 234.938 1.00 0.00 ? 30   MET 5 CA 1 
ATOM 6986 C CA . LYS Q  17 31   ? 317.725 263.270 234.561 1.00 0.00 ? 31   LYS 5 CA 1 
ATOM 6987 C CA . SER Q  17 32   ? 320.938 261.496 233.505 1.00 0.00 ? 32   SER 5 CA 1 
ATOM 6988 C CA . ASP Q  17 33   ? 321.506 259.131 230.530 1.00 0.00 ? 33   ASP 5 CA 1 
ATOM 6989 C CA . LYS Q  17 34   ? 319.934 256.212 232.418 1.00 0.00 ? 34   LYS 5 CA 1 
ATOM 6990 C CA . GLU Q  17 35   ? 316.615 254.524 231.744 1.00 0.00 ? 35   GLU 5 CA 1 
ATOM 6991 C CA . ILE Q  17 36   ? 314.660 251.585 233.090 1.00 0.00 ? 36   ILE 5 CA 1 
ATOM 6992 C CA . VAL Q  17 37   ? 311.661 249.608 231.837 1.00 0.00 ? 37   VAL 5 CA 1 
ATOM 6993 C CA . GLY Q  17 38   ? 309.677 247.185 233.988 1.00 0.00 ? 38   GLY 5 CA 1 
ATOM 6994 C CA . THR Q  17 39   ? 306.191 246.728 235.454 1.00 0.00 ? 39   THR 5 CA 1 
ATOM 6995 C CA . LEU Q  17 40   ? 305.028 249.703 237.507 1.00 0.00 ? 40   LEU 5 CA 1 
ATOM 6996 C CA . LEU Q  17 41   ? 304.053 248.175 240.858 1.00 0.00 ? 41   LEU 5 CA 1 
ATOM 6997 C CA . GLY Q  17 42   ? 303.422 251.466 242.778 1.00 0.00 ? 42   GLY 5 CA 1 
ATOM 6998 C CA . PHE Q  17 43   ? 304.561 254.992 243.670 1.00 0.00 ? 43   PHE 5 CA 1 
ATOM 6999 C CA . ASP Q  17 44   ? 304.270 257.579 246.460 1.00 0.00 ? 44   ASP 5 CA 1 
ATOM 7000 C CA . ASP Q  17 45   ? 303.748 261.385 246.599 1.00 0.00 ? 45   ASP 5 CA 1 
ATOM 7001 C CA . PHE Q  17 46   ? 307.481 262.051 246.203 1.00 0.00 ? 46   PHE 5 CA 1 
ATOM 7002 C CA . VAL Q  17 47   ? 307.156 259.849 243.080 1.00 0.00 ? 47   VAL 5 CA 1 
ATOM 7003 C CA . ASN Q  17 48   ? 309.610 257.258 244.399 1.00 0.00 ? 48   ASN 5 CA 1 
ATOM 7004 C CA . MET Q  17 49   ? 308.927 254.221 242.248 1.00 0.00 ? 49   MET 5 CA 1 
ATOM 7005 C CA . VAL Q  17 50   ? 308.620 250.447 242.573 1.00 0.00 ? 50   VAL 5 CA 1 
ATOM 7006 C CA . LEU Q  17 51   ? 309.462 248.509 239.444 1.00 0.00 ? 51   LEU 5 CA 1 
ATOM 7007 C CA . GLU Q  17 52   ? 309.376 244.808 238.803 1.00 0.00 ? 52   GLU 5 CA 1 
ATOM 7008 C CA . ASP Q  17 53   ? 311.857 242.915 236.626 1.00 0.00 ? 53   ASP 5 CA 1 
ATOM 7009 C CA . VAL Q  17 54   ? 313.397 246.076 235.250 1.00 0.00 ? 54   VAL 5 CA 1 
ATOM 7010 C CA . THR Q  17 55   ? 315.904 246.465 232.480 1.00 0.00 ? 55   THR 5 CA 1 
ATOM 7011 C CA . GLU Q  17 56   ? 318.493 249.169 233.128 1.00 0.00 ? 56   GLU 5 CA 1 
ATOM 7012 C CA . PHE Q  17 57   ? 319.939 251.136 230.244 1.00 0.00 ? 57   PHE 5 CA 1 
ATOM 7013 C CA . GLU Q  17 58   ? 322.661 253.645 229.577 1.00 0.00 ? 58   GLU 5 CA 1 
ATOM 7014 C CA . ILE Q  17 59   ? 322.934 252.779 225.897 1.00 0.00 ? 59   ILE 5 CA 1 
ATOM 7015 C CA . THR Q  17 60   ? 320.184 251.471 223.562 1.00 0.00 ? 60   THR 5 CA 1 
ATOM 7016 C CA . PRO Q  17 61   ? 322.563 248.990 221.789 1.00 0.00 ? 61   PRO 5 CA 1 
ATOM 7017 C CA . GLU Q  17 62   ? 323.335 247.784 225.340 1.00 0.00 ? 62   GLU 5 CA 1 
ATOM 7018 C CA . GLY Q  17 63   ? 321.640 247.159 228.724 1.00 0.00 ? 63   GLY 5 CA 1 
ATOM 7019 C CA . ARG Q  17 64   ? 323.469 247.344 232.057 1.00 0.00 ? 64   ARG 5 CA 1 
ATOM 7020 C CA . ARG Q  17 65   ? 321.375 244.971 234.157 1.00 0.00 ? 65   ARG 5 CA 1 
ATOM 7021 C CA . ILE Q  17 66   ? 321.735 241.383 233.105 1.00 0.00 ? 66   ILE 5 CA 1 
ATOM 7022 C CA . THR Q  17 67   ? 318.355 241.083 234.853 1.00 0.00 ? 67   THR 5 CA 1 
ATOM 7023 C CA . LYS Q  17 68   ? 316.667 243.067 237.653 1.00 0.00 ? 68   LYS 5 CA 1 
ATOM 7024 C CA . LEU Q  17 69   ? 314.644 240.221 239.153 1.00 0.00 ? 69   LEU 5 CA 1 
ATOM 7025 C CA . ASP Q  17 70   ? 312.147 241.005 241.929 1.00 0.00 ? 70   ASP 5 CA 1 
ATOM 7026 C CA . GLN Q  17 71   ? 311.404 244.590 243.006 1.00 0.00 ? 71   GLN 5 CA 1 
ATOM 7027 C CA . ILE Q  17 72   ? 313.383 247.766 242.735 1.00 0.00 ? 72   ILE 5 CA 1 
ATOM 7028 C CA . LEU Q  17 73   ? 312.794 250.951 244.638 1.00 0.00 ? 73   LEU 5 CA 1 
ATOM 7029 C CA . LEU Q  17 74   ? 313.775 253.756 242.314 1.00 0.00 ? 74   LEU 5 CA 1 
ATOM 7030 C CA . ASN Q  17 75   ? 314.475 257.030 244.100 1.00 0.00 ? 75   ASN 5 CA 1 
ATOM 7031 C CA . GLY Q  17 76   ? 312.077 259.701 242.778 1.00 0.00 ? 76   GLY 5 CA 1 
ATOM 7032 C CA . ASN Q  17 77   ? 314.878 262.244 243.310 1.00 0.00 ? 77   ASN 5 CA 1 
ATOM 7033 C CA . ASN Q  17 78   ? 316.593 261.645 239.940 1.00 0.00 ? 78   ASN 5 CA 1 
ATOM 7034 C CA . ILE Q  17 79   ? 313.452 260.866 237.882 1.00 0.00 ? 79   ILE 5 CA 1 
ATOM 7035 C CA . THR Q  17 80   ? 312.621 263.260 235.041 1.00 0.00 ? 80   THR 5 CA 1 
ATOM 7036 C CA . MET Q  17 81   ? 310.081 261.564 232.773 1.00 0.00 ? 81   MET 5 CA 1 
ATOM 7037 C CA . LEU Q  17 82   ? 307.634 258.673 233.082 1.00 0.00 ? 82   LEU 5 CA 1 
ATOM 7038 C CA . VAL Q  17 83   ? 306.423 256.853 229.974 1.00 0.00 ? 83   VAL 5 CA 1 
ATOM 7039 C CA . PRO Q  17 84   ? 303.537 254.310 230.144 1.00 0.00 ? 84   PRO 5 CA 1 
ATOM 7040 C CA . GLY Q  17 85   ? 304.369 251.503 227.680 1.00 0.00 ? 85   GLY 5 CA 1 
ATOM 7041 C CA . MET R  18 1    ? 316.409 295.894 250.571 1.00 0.00 ? 1    MET 4 CA 1 
ATOM 7042 C CA . LEU R  18 2    ? 315.861 292.147 250.175 1.00 0.00 ? 2    LEU 4 CA 1 
ATOM 7043 C CA . PRO R  18 3    ? 316.329 290.515 246.732 1.00 0.00 ? 3    PRO 4 CA 1 
ATOM 7044 C CA . LEU R  18 4    ? 312.789 289.149 246.722 1.00 0.00 ? 4    LEU 4 CA 1 
ATOM 7045 C CA . SER R  18 5    ? 311.174 292.506 247.626 1.00 0.00 ? 5    SER 4 CA 1 
ATOM 7046 C CA . LEU R  18 6    ? 313.326 294.131 244.911 1.00 0.00 ? 6    LEU 4 CA 1 
ATOM 7047 C CA . LEU R  18 7    ? 311.954 291.719 242.293 1.00 0.00 ? 7    LEU 4 CA 1 
ATOM 7048 C CA . LYS R  18 8    ? 308.406 291.927 243.653 1.00 0.00 ? 8    LYS 4 CA 1 
ATOM 7049 C CA . THR R  18 9    ? 308.205 295.639 242.760 1.00 0.00 ? 9    THR 4 CA 1 
ATOM 7050 C CA . ALA R  18 10   ? 310.496 295.430 239.692 1.00 0.00 ? 10   ALA 4 CA 1 
ATOM 7051 C CA . GLN R  18 11   ? 307.352 293.955 238.035 1.00 0.00 ? 11   GLN 4 CA 1 
ATOM 7052 C CA . ASN R  18 12   ? 307.075 295.545 234.534 1.00 0.00 ? 12   ASN 4 CA 1 
ATOM 7053 C CA . HIS R  18 13   ? 310.820 296.267 234.235 1.00 0.00 ? 13   HIS 4 CA 1 
ATOM 7054 C CA . PRO R  18 14   ? 313.239 294.790 231.659 1.00 0.00 ? 14   PRO 4 CA 1 
ATOM 7055 C CA . MET R  18 15   ? 315.993 292.462 232.996 1.00 0.00 ? 15   MET 4 CA 1 
ATOM 7056 C CA . LEU R  18 16   ? 318.522 289.866 231.849 1.00 0.00 ? 16   LEU 4 CA 1 
ATOM 7057 C CA . VAL R  18 17   ? 318.739 286.472 233.588 1.00 0.00 ? 17   VAL 4 CA 1 
ATOM 7058 C CA . GLU R  18 18   ? 321.658 284.078 233.475 1.00 0.00 ? 18   GLU 4 CA 1 
ATOM 7059 C CA . LEU R  18 19   ? 320.835 280.403 233.879 1.00 0.00 ? 19   LEU 4 CA 1 
ATOM 7060 C CA . LYS R  18 20   ? 322.917 277.668 235.476 1.00 0.00 ? 20   LYS 4 CA 1 
ATOM 7061 C CA . ASN R  18 21   ? 322.745 276.215 231.957 1.00 0.00 ? 21   ASN 4 CA 1 
ATOM 7062 C CA . GLY R  18 22   ? 324.702 279.151 230.456 1.00 0.00 ? 22   GLY 4 CA 1 
ATOM 7063 C CA . GLU R  18 23   ? 321.706 280.648 228.657 1.00 0.00 ? 23   GLU 4 CA 1 
ATOM 7064 C CA . THR R  18 24   ? 320.963 284.414 228.678 1.00 0.00 ? 24   THR 4 CA 1 
ATOM 7065 C CA . TYR R  18 25   ? 317.351 285.585 228.761 1.00 0.00 ? 25   TYR 4 CA 1 
ATOM 7066 C CA . ASN R  18 26   ? 316.275 289.116 228.049 1.00 0.00 ? 26   ASN 4 CA 1 
ATOM 7067 C CA . GLY R  18 27   ? 312.686 290.061 228.868 1.00 0.00 ? 27   GLY 4 CA 1 
ATOM 7068 C CA . HIS R  18 28   ? 310.311 292.158 230.951 1.00 0.00 ? 28   HIS 4 CA 1 
ATOM 7069 C CA . LEU R  18 29   ? 309.349 290.794 234.366 1.00 0.00 ? 29   LEU 4 CA 1 
ATOM 7070 C CA . VAL R  18 30   ? 305.713 289.761 234.880 1.00 0.00 ? 30   VAL 4 CA 1 
ATOM 7071 C CA . SER R  18 31   ? 305.619 287.713 238.131 1.00 0.00 ? 31   SER 4 CA 1 
ATOM 7072 C CA . CYS R  18 32   ? 307.778 286.443 240.993 1.00 0.00 ? 32   CYS 4 CA 1 
ATOM 7073 C CA . ASP R  18 33   ? 307.127 284.171 243.971 1.00 0.00 ? 33   ASP 4 CA 1 
ATOM 7074 C CA . ASN R  18 34   ? 309.105 283.210 247.107 1.00 0.00 ? 34   ASN 4 CA 1 
ATOM 7075 C CA . TRP R  18 35   ? 311.018 280.448 245.294 1.00 0.00 ? 35   TRP 4 CA 1 
ATOM 7076 C CA . MET R  18 36   ? 312.100 283.256 242.902 1.00 0.00 ? 36   MET 4 CA 1 
ATOM 7077 C CA . ASN R  18 37   ? 310.231 281.503 240.046 1.00 0.00 ? 37   ASN 4 CA 1 
ATOM 7078 C CA . ILE R  18 38   ? 309.796 284.097 237.299 1.00 0.00 ? 38   ILE 4 CA 1 
ATOM 7079 C CA . ASN R  18 39   ? 307.476 284.757 234.388 1.00 0.00 ? 39   ASN 4 CA 1 
ATOM 7080 C CA . LEU R  18 40   ? 308.697 287.200 231.715 1.00 0.00 ? 40   LEU 4 CA 1 
ATOM 7081 C CA . ARG R  18 41   ? 307.031 288.709 228.657 1.00 0.00 ? 41   ARG 4 CA 1 
ATOM 7082 C CA . GLU R  18 42   ? 308.601 290.044 225.446 1.00 0.00 ? 42   GLU 4 CA 1 
ATOM 7083 C CA . VAL R  18 43   ? 311.371 287.432 225.724 1.00 0.00 ? 43   VAL 4 CA 1 
ATOM 7084 C CA . ILE R  18 44   ? 314.526 286.675 223.757 1.00 0.00 ? 44   ILE 4 CA 1 
ATOM 7085 C CA . CYS R  18 45   ? 316.700 283.735 224.791 1.00 0.00 ? 45   CYS 4 CA 1 
ATOM 7086 C CA . THR R  18 46   ? 320.279 283.089 223.670 1.00 0.00 ? 46   THR 4 CA 1 
ATOM 7087 C CA . SER R  18 47   ? 321.923 279.649 223.565 1.00 0.00 ? 47   SER 4 CA 1 
ATOM 7088 C CA . ARG R  18 48   ? 325.524 279.044 224.695 1.00 0.00 ? 48   ARG 4 CA 1 
ATOM 7089 C CA . ASP R  18 49   ? 326.315 277.535 221.245 1.00 0.00 ? 49   ASP 4 CA 1 
ATOM 7090 C CA . GLY R  18 50   ? 324.928 279.177 218.093 1.00 0.00 ? 50   GLY 4 CA 1 
ATOM 7091 C CA . ASP R  18 51   ? 322.382 281.947 217.602 1.00 0.00 ? 51   ASP 4 CA 1 
ATOM 7092 C CA . LYS R  18 52   ? 319.168 280.876 219.342 1.00 0.00 ? 52   LYS 4 CA 1 
ATOM 7093 C CA . PHE R  18 53   ? 317.443 284.045 218.002 1.00 0.00 ? 53   PHE 4 CA 1 
ATOM 7094 C CA . TRP R  18 54   ? 314.428 282.792 219.927 1.00 0.00 ? 54   TRP 4 CA 1 
ATOM 7095 C CA . ARG R  18 55   ? 311.739 285.386 220.567 1.00 0.00 ? 55   ARG 4 CA 1 
ATOM 7096 C CA . MET R  18 56   ? 308.926 284.242 222.876 1.00 0.00 ? 56   MET 4 CA 1 
ATOM 7097 C CA . PRO R  18 57   ? 305.613 285.729 224.126 1.00 0.00 ? 57   PRO 4 CA 1 
ATOM 7098 C CA . GLU R  18 58   ? 306.108 284.469 227.701 1.00 0.00 ? 58   GLU 4 CA 1 
ATOM 7099 C CA . CYS R  18 59   ? 308.544 282.321 229.663 1.00 0.00 ? 59   CYS 4 CA 1 
ATOM 7100 C CA . TYR R  18 60   ? 308.565 280.672 233.097 1.00 0.00 ? 60   TYR 4 CA 1 
ATOM 7101 C CA . ILE R  18 61   ? 311.820 280.004 234.988 1.00 0.00 ? 61   ILE 4 CA 1 
ATOM 7102 C CA . ARG R  18 62   ? 312.273 277.919 238.137 1.00 0.00 ? 62   ARG 4 CA 1 
ATOM 7103 C CA . GLY R  18 63   ? 314.159 279.899 240.829 1.00 0.00 ? 63   GLY 4 CA 1 
ATOM 7104 C CA . SER R  18 64   ? 316.751 277.137 241.434 1.00 0.00 ? 64   SER 4 CA 1 
ATOM 7105 C CA . THR R  18 65   ? 318.123 277.469 237.869 1.00 0.00 ? 65   THR 4 CA 1 
ATOM 7106 C CA . ILE R  18 66   ? 319.050 281.166 237.939 1.00 0.00 ? 66   ILE 4 CA 1 
ATOM 7107 C CA . LYS R  18 67   ? 322.675 282.180 238.516 1.00 0.00 ? 67   LYS 4 CA 1 
ATOM 7108 C CA . TYR R  18 68   ? 322.251 285.968 238.572 1.00 0.00 ? 68   TYR 4 CA 1 
ATOM 7109 C CA . LEU R  18 69   ? 319.994 288.718 237.226 1.00 0.00 ? 69   LEU 4 CA 1 
ATOM 7110 C CA . ARG R  18 70   ? 321.194 291.840 235.504 1.00 0.00 ? 70   ARG 4 CA 1 
ATOM 7111 C CA . ILE R  18 71   ? 318.787 294.646 236.447 1.00 0.00 ? 71   ILE 4 CA 1 
ATOM 7112 C CA . PRO R  18 72   ? 318.183 297.998 234.652 1.00 0.00 ? 72   PRO 4 CA 1 
ATOM 7113 C CA . ASP R  18 73   ? 319.983 300.854 236.387 1.00 0.00 ? 73   ASP 4 CA 1 
ATOM 7114 C CA . GLU R  18 74   ? 316.705 302.681 237.006 1.00 0.00 ? 74   GLU 4 CA 1 
ATOM 7115 C CA . ILE R  18 75   ? 315.850 299.865 239.514 1.00 0.00 ? 75   ILE 4 CA 1 
ATOM 7116 C CA . ILE R  18 76   ? 316.434 301.679 242.822 1.00 0.00 ? 76   ILE 4 CA 1 
ATOM 7117 C CA . ASP R  18 77   ? 314.267 304.651 241.840 1.00 0.00 ? 77   ASP 4 CA 1 
ATOM 7118 C CA . MET R  18 78   ? 311.543 302.615 240.125 1.00 0.00 ? 78   MET 4 CA 1 
ATOM 7119 C CA . VAL R  18 79   ? 310.651 300.290 243.048 1.00 0.00 ? 79   VAL 4 CA 1 
ATOM 7120 C CA . LYS R  18 80   ? 311.437 302.850 245.765 1.00 0.00 ? 80   LYS 4 CA 1 
ATOM 7121 C CA . GLU S  19 16   ? 318.029 253.129 262.388 1.00 0.00 ? 16   GLU 3 CA 1 
ATOM 7122 C CA . PRO S  19 17   ? 320.974 253.340 259.860 1.00 0.00 ? 17   PRO 3 CA 1 
ATOM 7123 C CA . LEU S  19 18   ? 322.101 256.420 261.836 1.00 0.00 ? 18   LEU 3 CA 1 
ATOM 7124 C CA . ASP S  19 19   ? 322.119 254.459 265.101 1.00 0.00 ? 19   ASP 3 CA 1 
ATOM 7125 C CA . LEU S  19 20   ? 324.240 251.611 263.720 1.00 0.00 ? 20   LEU 3 CA 1 
ATOM 7126 C CA . ILE S  19 21   ? 326.850 254.375 263.281 1.00 0.00 ? 21   ILE 3 CA 1 
ATOM 7127 C CA . ARG S  19 22   ? 326.676 255.248 267.014 1.00 0.00 ? 22   ARG 3 CA 1 
ATOM 7128 C CA . LEU S  19 23   ? 327.666 251.647 267.274 1.00 0.00 ? 23   LEU 3 CA 1 
ATOM 7129 C CA . SER S  19 24   ? 331.227 252.452 266.125 1.00 0.00 ? 24   SER 3 CA 1 
ATOM 7130 C CA . LEU S  19 25   ? 331.933 255.638 268.157 1.00 0.00 ? 25   LEU 3 CA 1 
ATOM 7131 C CA . ASP S  19 26   ? 335.601 255.721 269.222 1.00 0.00 ? 26   ASP 3 CA 1 
ATOM 7132 C CA . GLU S  19 27   ? 336.140 252.999 266.581 1.00 0.00 ? 27   GLU 3 CA 1 
ATOM 7133 C CA . ARG S  19 28   ? 338.260 253.420 263.456 1.00 0.00 ? 28   ARG 3 CA 1 
ATOM 7134 C CA . ILE S  19 29   ? 336.183 254.239 260.367 1.00 0.00 ? 29   ILE 3 CA 1 
ATOM 7135 C CA . TYR S  19 30   ? 336.599 254.365 256.595 1.00 0.00 ? 30   TYR 3 CA 1 
ATOM 7136 C CA . VAL S  19 31   ? 334.747 257.104 254.721 1.00 0.00 ? 31   VAL 3 CA 1 
ATOM 7137 C CA . LYS S  19 32   ? 334.284 257.692 251.013 1.00 0.00 ? 32   LYS 3 CA 1 
ATOM 7138 C CA . MET S  19 33   ? 333.577 261.227 249.741 1.00 0.00 ? 33   MET 3 CA 1 
ATOM 7139 C CA . ARG S  19 34   ? 332.630 262.641 246.322 1.00 0.00 ? 34   ARG 3 CA 1 
ATOM 7140 C CA . ASN S  19 35   ? 335.690 263.443 244.125 1.00 0.00 ? 35   ASN 3 CA 1 
ATOM 7141 C CA . ASP S  19 36   ? 337.546 260.129 244.709 1.00 0.00 ? 36   ASP 3 CA 1 
ATOM 7142 C CA . ARG S  19 37   ? 338.745 261.062 248.224 1.00 0.00 ? 37   ARG 3 CA 1 
ATOM 7143 C CA . GLU S  19 38   ? 338.868 258.584 251.106 1.00 0.00 ? 38   GLU 3 CA 1 
ATOM 7144 C CA . LEU S  19 39   ? 339.347 259.309 254.791 1.00 0.00 ? 39   LEU 3 CA 1 
ATOM 7145 C CA . ARG S  19 40   ? 340.232 256.953 257.626 1.00 0.00 ? 40   ARG 3 CA 1 
ATOM 7146 C CA . GLY S  19 41   ? 340.166 258.068 261.271 1.00 0.00 ? 41   GLY 3 CA 1 
ATOM 7147 C CA . ARG S  19 42   ? 338.513 257.620 264.676 1.00 0.00 ? 42   ARG 3 CA 1 
ATOM 7148 C CA . LEU S  19 43   ? 334.846 258.604 264.745 1.00 0.00 ? 43   LEU 3 CA 1 
ATOM 7149 C CA . HIS S  19 44   ? 334.243 261.335 267.276 1.00 0.00 ? 44   HIS 3 CA 1 
ATOM 7150 C CA . ALA S  19 45   ? 330.826 262.672 266.134 1.00 0.00 ? 45   ALA 3 CA 1 
ATOM 7151 C CA . TYR S  19 46   ? 328.203 262.625 263.456 1.00 0.00 ? 46   TYR 3 CA 1 
ATOM 7152 C CA . ASP S  19 47   ? 324.774 264.049 262.822 1.00 0.00 ? 47   ASP 3 CA 1 
ATOM 7153 C CA . GLN S  19 48   ? 321.772 263.071 260.632 1.00 0.00 ? 48   GLN 3 CA 1 
ATOM 7154 C CA . HIS S  19 49   ? 323.332 265.080 257.779 1.00 0.00 ? 49   HIS 3 CA 1 
ATOM 7155 C CA . LEU S  19 50   ? 326.221 262.652 258.337 1.00 0.00 ? 50   LEU 3 CA 1 
ATOM 7156 C CA . ASN S  19 51   ? 328.477 265.584 259.221 1.00 0.00 ? 51   ASN 3 CA 1 
ATOM 7157 C CA . MET S  19 52   ? 331.514 264.078 260.911 1.00 0.00 ? 52   MET 3 CA 1 
ATOM 7158 C CA . ILE S  19 53   ? 334.368 264.853 263.219 1.00 0.00 ? 53   ILE 3 CA 1 
ATOM 7159 C CA . LEU S  19 54   ? 337.365 262.534 263.021 1.00 0.00 ? 54   LEU 3 CA 1 
ATOM 7160 C CA . GLY S  19 55   ? 340.728 262.511 264.775 1.00 0.00 ? 55   GLY 3 CA 1 
ATOM 7161 C CA . ASP S  19 56   ? 344.113 261.078 263.759 1.00 0.00 ? 56   ASP 3 CA 1 
ATOM 7162 C CA . VAL S  19 57   ? 342.683 260.853 260.240 1.00 0.00 ? 57   VAL 3 CA 1 
ATOM 7163 C CA . GLU S  19 58   ? 344.442 260.447 256.933 1.00 0.00 ? 58   GLU 3 CA 1 
ATOM 7164 C CA . GLU S  19 59   ? 342.914 261.482 253.606 1.00 0.00 ? 59   GLU 3 CA 1 
ATOM 7165 C CA . THR S  19 60   ? 343.854 260.058 250.217 1.00 0.00 ? 60   THR 3 CA 1 
ATOM 7166 C CA . VAL S  19 61   ? 342.951 261.962 247.058 1.00 0.00 ? 61   VAL 3 CA 1 
ATOM 7167 C CA . THR S  19 62   ? 343.006 260.090 243.805 1.00 0.00 ? 62   THR 3 CA 1 
ATOM 7168 C CA . THR S  19 63   ? 343.613 262.293 240.817 1.00 0.00 ? 63   THR 3 CA 1 
ATOM 7169 C CA . ILE S  19 64   ? 343.967 261.319 237.147 1.00 0.00 ? 64   ILE 3 CA 1 
ATOM 7170 C CA . GLU S  19 65   ? 343.295 264.668 235.467 1.00 0.00 ? 65   GLU 3 CA 1 
ATOM 7171 C CA . ILE S  19 66   ? 343.516 266.670 238.689 1.00 0.00 ? 66   ILE 3 CA 1 
ATOM 7172 C CA . ASP S  19 67   ? 347.317 266.839 238.641 1.00 0.00 ? 67   ASP 3 CA 1 
ATOM 7173 C CA . GLU S  19 68   ? 348.058 264.616 235.656 1.00 0.00 ? 68   GLU 3 CA 1 
ATOM 7174 C CA . GLU S  19 69   ? 348.145 263.487 232.585 1.00 0.00 ? 69   GLU 3 CA 1 
ATOM 7175 C CA . THR S  19 70   ? 346.308 260.255 231.707 1.00 0.00 ? 70   THR 3 CA 1 
ATOM 7176 C CA . TYR S  19 71   ? 342.875 258.963 230.663 1.00 0.00 ? 71   TYR 3 CA 1 
ATOM 7177 C CA . GLU S  19 72   ? 343.482 255.280 229.863 1.00 0.00 ? 72   GLU 3 CA 1 
ATOM 7178 C CA . GLU S  19 73   ? 346.289 254.767 232.385 1.00 0.00 ? 73   GLU 3 CA 1 
ATOM 7179 C CA . ILE S  19 74   ? 346.387 255.666 235.992 1.00 0.00 ? 74   ILE 3 CA 1 
ATOM 7180 C CA . TYR S  19 75   ? 346.882 257.927 238.268 1.00 0.00 ? 75   TYR 3 CA 1 
ATOM 7181 C CA . LYS S  19 76   ? 348.419 259.265 241.393 1.00 0.00 ? 76   LYS 3 CA 1 
ATOM 7182 C CA . SER S  19 77   ? 347.257 259.434 244.990 1.00 0.00 ? 77   SER 3 CA 1 
ATOM 7183 C CA . THR S  19 78   ? 348.120 262.282 247.366 1.00 0.00 ? 78   THR 3 CA 1 
ATOM 7184 C CA . LYS S  19 79   ? 347.854 262.079 251.160 1.00 0.00 ? 79   LYS 3 CA 1 
ATOM 7185 C CA . ARG S  19 80   ? 346.952 264.566 253.915 1.00 0.00 ? 80   ARG 3 CA 1 
ATOM 7186 C CA . ASN S  19 81   ? 347.204 264.087 257.697 1.00 0.00 ? 81   ASN 3 CA 1 
ATOM 7187 C CA . ILE S  19 82   ? 345.239 265.938 260.399 1.00 0.00 ? 82   ILE 3 CA 1 
ATOM 7188 C CA . PRO S  19 83   ? 344.894 265.506 264.211 1.00 0.00 ? 83   PRO 3 CA 1 
ATOM 7189 C CA . MET S  19 84   ? 341.239 266.655 264.117 1.00 0.00 ? 84   MET 3 CA 1 
ATOM 7190 C CA . LEU S  19 85   ? 338.879 267.449 261.244 1.00 0.00 ? 85   LEU 3 CA 1 
ATOM 7191 C CA . PHE S  19 86   ? 335.224 268.218 260.706 1.00 0.00 ? 86   PHE 3 CA 1 
ATOM 7192 C CA . VAL S  19 87   ? 333.623 267.062 257.434 1.00 0.00 ? 87   VAL 3 CA 1 
ATOM 7193 C CA . ARG S  19 88   ? 330.500 268.422 255.799 1.00 0.00 ? 88   ARG 3 CA 1 
ATOM 7194 C CA . GLY S  19 89   ? 327.916 265.642 255.427 1.00 0.00 ? 89   GLY 3 CA 1 
ATOM 7195 C CA . ASP S  19 90   ? 326.819 266.515 251.857 1.00 0.00 ? 90   ASP 3 CA 1 
ATOM 7196 C CA . GLY S  19 91   ? 330.167 265.268 250.413 1.00 0.00 ? 91   GLY 3 CA 1 
ATOM 7197 C CA . VAL S  19 92   ? 329.768 261.900 252.174 1.00 0.00 ? 92   VAL 3 CA 1 
ATOM 7198 C CA . VAL S  19 93   ? 328.974 258.714 250.240 1.00 0.00 ? 93   VAL 3 CA 1 
ATOM 7199 C CA . LEU S  19 94   ? 329.973 255.695 252.390 1.00 0.00 ? 94   LEU 3 CA 1 
ATOM 7200 C CA . VAL S  19 95   ? 330.757 255.210 256.086 1.00 0.00 ? 95   VAL 3 CA 1 
ATOM 7201 C CA . ALA S  19 96   ? 332.276 251.841 256.975 1.00 0.00 ? 96   ALA 3 CA 1 
ATOM 7202 C CA . PRO S  19 97   ? 335.247 250.479 259.016 1.00 0.00 ? 97   PRO 3 CA 1 
ATOM 7203 C CA . PRO S  19 98   ? 338.778 249.794 257.614 1.00 0.00 ? 98   PRO 3 CA 1 
ATOM 7204 C CA . MET T  20 1    ? 321.632 271.167 265.926 1.00 0.00 ? 1    MET 2 CA 1 
ATOM 7205 C CA . LEU T  20 2    ? 324.662 269.427 267.488 1.00 0.00 ? 2    LEU 2 CA 1 
ATOM 7206 C CA . PHE T  20 3    ? 327.479 270.712 265.219 1.00 0.00 ? 3    PHE 2 CA 1 
ATOM 7207 C CA . TYR T  20 4    ? 326.209 274.276 265.805 1.00 0.00 ? 4    TYR 2 CA 1 
ATOM 7208 C CA . SER T  20 5    ? 326.922 273.863 269.562 1.00 0.00 ? 5    SER 2 CA 1 
ATOM 7209 C CA . PHE T  20 6    ? 330.304 272.347 268.644 1.00 0.00 ? 6    PHE 2 CA 1 
ATOM 7210 C CA . PHE T  20 7    ? 331.342 275.299 266.478 1.00 0.00 ? 7    PHE 2 CA 1 
ATOM 7211 C CA . LYS T  20 8    ? 330.132 277.718 269.180 1.00 0.00 ? 8    LYS 2 CA 1 
ATOM 7212 C CA . SER T  20 9    ? 332.694 276.012 271.470 1.00 0.00 ? 9    SER 2 CA 1 
ATOM 7213 C CA . LEU T  20 10   ? 335.371 276.813 268.818 1.00 0.00 ? 10   LEU 2 CA 1 
ATOM 7214 C CA . VAL T  20 11   ? 335.153 280.641 268.771 1.00 0.00 ? 11   VAL 2 CA 1 
ATOM 7215 C CA . GLY T  20 12   ? 338.378 282.674 268.954 1.00 0.00 ? 12   GLY 2 CA 1 
ATOM 7216 C CA . LYS T  20 13   ? 340.306 279.567 267.835 1.00 0.00 ? 13   LYS 2 CA 1 
ATOM 7217 C CA . ASP T  20 14   ? 342.595 279.441 264.805 1.00 0.00 ? 14   ASP 2 CA 1 
ATOM 7218 C CA . VAL T  20 15   ? 341.241 277.062 262.165 1.00 0.00 ? 15   VAL 2 CA 1 
ATOM 7219 C CA . VAL T  20 16   ? 342.051 276.087 258.589 1.00 0.00 ? 16   VAL 2 CA 1 
ATOM 7220 C CA . VAL T  20 17   ? 339.071 275.782 256.242 1.00 0.00 ? 17   VAL 2 CA 1 
ATOM 7221 C CA . GLU T  20 18   ? 339.024 273.912 252.941 1.00 0.00 ? 18   GLU 2 CA 1 
ATOM 7222 C CA . LEU T  20 19   ? 336.285 274.743 250.459 1.00 0.00 ? 19   LEU 2 CA 1 
ATOM 7223 C CA . LYS T  20 20   ? 335.056 272.373 247.721 1.00 0.00 ? 20   LYS 2 CA 1 
ATOM 7224 C CA . ASN T  20 21   ? 336.673 274.497 244.959 1.00 0.00 ? 21   ASN 2 CA 1 
ATOM 7225 C CA . ASP T  20 22   ? 340.238 273.826 246.255 1.00 0.00 ? 22   ASP 2 CA 1 
ATOM 7226 C CA . LEU T  20 23   ? 340.464 277.061 248.260 1.00 0.00 ? 23   LEU 2 CA 1 
ATOM 7227 C CA . SER T  20 24   ? 342.201 276.971 251.652 1.00 0.00 ? 24   SER 2 CA 1 
ATOM 7228 C CA . ILE T  20 25   ? 341.916 279.728 254.280 1.00 0.00 ? 25   ILE 2 CA 1 
ATOM 7229 C CA . CYS T  20 26   ? 343.393 279.996 257.779 1.00 0.00 ? 26   CYS 2 CA 1 
ATOM 7230 C CA . GLY T  20 27   ? 341.844 282.423 260.291 1.00 0.00 ? 27   GLY 2 CA 1 
ATOM 7231 C CA . THR T  20 28   ? 340.171 283.031 263.638 1.00 0.00 ? 28   THR 2 CA 1 
ATOM 7232 C CA . LEU T  20 29   ? 336.622 281.700 263.964 1.00 0.00 ? 29   LEU 2 CA 1 
ATOM 7233 C CA . HIS T  20 30   ? 334.634 284.771 265.033 1.00 0.00 ? 30   HIS 2 CA 1 
ATOM 7234 C CA . SER T  20 31   ? 331.060 283.565 264.375 1.00 0.00 ? 31   SER 2 CA 1 
ATOM 7235 C CA . VAL T  20 32   ? 328.988 280.448 263.594 1.00 0.00 ? 32   VAL 2 CA 1 
ATOM 7236 C CA . ASP T  20 33   ? 325.359 279.998 262.500 1.00 0.00 ? 33   ASP 2 CA 1 
ATOM 7237 C CA . GLN T  20 34   ? 322.703 277.271 261.995 1.00 0.00 ? 34   GLN 2 CA 1 
ATOM 7238 C CA . TYR T  20 35   ? 323.752 276.565 258.380 1.00 0.00 ? 35   TYR 2 CA 1 
ATOM 7239 C CA . LEU T  20 36   ? 327.310 276.280 259.767 1.00 0.00 ? 36   LEU 2 CA 1 
ATOM 7240 C CA . ASN T  20 37   ? 328.266 279.460 257.900 1.00 0.00 ? 37   ASN 2 CA 1 
ATOM 7241 C CA . ILE T  20 38   ? 331.564 280.716 259.265 1.00 0.00 ? 38   ILE 2 CA 1 
ATOM 7242 C CA . LYS T  20 39   ? 333.023 284.185 259.692 1.00 0.00 ? 39   LYS 2 CA 1 
ATOM 7243 C CA . LEU T  20 40   ? 336.790 284.419 259.992 1.00 0.00 ? 40   LEU 2 CA 1 
ATOM 7244 C CA . THR T  20 41   ? 338.885 287.361 261.183 1.00 0.00 ? 41   THR 2 CA 1 
ATOM 7245 C CA . ASP T  20 42   ? 342.558 287.820 260.237 1.00 0.00 ? 42   ASP 2 CA 1 
ATOM 7246 C CA . ILE T  20 43   ? 342.484 285.877 256.933 1.00 0.00 ? 43   ILE 2 CA 1 
ATOM 7247 C CA . SER T  20 44   ? 345.785 284.253 255.980 1.00 0.00 ? 44   SER 2 CA 1 
ATOM 7248 C CA . VAL T  20 45   ? 347.296 281.859 253.410 1.00 0.00 ? 45   VAL 2 CA 1 
ATOM 7249 C CA . THR T  20 46   ? 347.961 278.271 254.533 1.00 0.00 ? 46   THR 2 CA 1 
ATOM 7250 C CA . ASP T  20 47   ? 348.948 277.054 251.047 1.00 0.00 ? 47   ASP 2 CA 1 
ATOM 7251 C CA . PRO T  20 48   ? 350.762 278.765 248.108 1.00 0.00 ? 48   PRO 2 CA 1 
ATOM 7252 C CA . GLU T  20 49   ? 348.689 277.501 245.135 1.00 0.00 ? 49   GLU 2 CA 1 
ATOM 7253 C CA . LYS T  20 50   ? 345.092 276.952 246.328 1.00 0.00 ? 50   LYS 2 CA 1 
ATOM 7254 C CA . TYR T  20 51   ? 344.761 280.319 248.039 1.00 0.00 ? 51   TYR 2 CA 1 
ATOM 7255 C CA . PRO T  20 52   ? 342.336 282.574 246.112 1.00 0.00 ? 52   PRO 2 CA 1 
ATOM 7256 C CA . HIS T  20 53   ? 342.770 286.180 244.957 1.00 0.00 ? 53   HIS 2 CA 1 
ATOM 7257 C CA . MET T  20 54   ? 342.698 288.412 248.033 1.00 0.00 ? 54   MET 2 CA 1 
ATOM 7258 C CA . LEU T  20 55   ? 345.191 290.480 250.114 1.00 0.00 ? 55   LEU 2 CA 1 
ATOM 7259 C CA . SER T  20 56   ? 343.909 293.526 252.032 1.00 0.00 ? 56   SER 2 CA 1 
ATOM 7260 C CA . VAL T  20 57   ? 340.672 291.863 253.172 1.00 0.00 ? 57   VAL 2 CA 1 
ATOM 7261 C CA . LYS T  20 58   ? 340.993 290.399 256.679 1.00 0.00 ? 58   LYS 2 CA 1 
ATOM 7262 C CA . ASN T  20 59   ? 337.427 289.231 257.373 1.00 0.00 ? 59   ASN 2 CA 1 
ATOM 7263 C CA . CYS T  20 60   ? 335.377 286.766 255.365 1.00 0.00 ? 60   CYS 2 CA 1 
ATOM 7264 C CA . PHE T  20 61   ? 331.955 285.156 255.427 1.00 0.00 ? 61   PHE 2 CA 1 
ATOM 7265 C CA . ILE T  20 62   ? 332.065 281.608 254.159 1.00 0.00 ? 62   ILE 2 CA 1 
ATOM 7266 C CA . ARG T  20 63   ? 328.909 279.840 252.987 1.00 0.00 ? 63   ARG 2 CA 1 
ATOM 7267 C CA . GLY T  20 64   ? 328.509 276.584 254.978 1.00 0.00 ? 64   GLY 2 CA 1 
ATOM 7268 C CA . SER T  20 65   ? 327.472 274.605 251.873 1.00 0.00 ? 65   SER 2 CA 1 
ATOM 7269 C CA . VAL T  20 66   ? 330.877 275.338 250.212 1.00 0.00 ? 66   VAL 2 CA 1 
ATOM 7270 C CA . VAL T  20 67   ? 333.155 273.910 252.960 1.00 0.00 ? 67   VAL 2 CA 1 
ATOM 7271 C CA . ARG T  20 68   ? 334.496 270.352 252.719 1.00 0.00 ? 68   ARG 2 CA 1 
ATOM 7272 C CA . TYR T  20 69   ? 336.816 270.216 255.742 1.00 0.00 ? 69   TYR 2 CA 1 
ATOM 7273 C CA . VAL T  20 70   ? 337.441 272.176 258.919 1.00 0.00 ? 70   VAL 2 CA 1 
ATOM 7274 C CA . GLN T  20 71   ? 340.890 271.512 260.427 1.00 0.00 ? 71   GLN 2 CA 1 
ATOM 7275 C CA . LEU T  20 72   ? 341.086 271.285 264.227 1.00 0.00 ? 72   LEU 2 CA 1 
ATOM 7276 C CA . PRO T  20 73   ? 343.791 270.422 266.782 1.00 0.00 ? 73   PRO 2 CA 1 
ATOM 7277 C CA . ALA T  20 74   ? 343.089 267.803 269.462 1.00 0.00 ? 74   ALA 2 CA 1 
ATOM 7278 C CA . ASP T  20 75   ? 343.491 270.506 272.160 1.00 0.00 ? 75   ASP 2 CA 1 
ATOM 7279 C CA . GLU T  20 76   ? 340.432 272.481 270.942 1.00 0.00 ? 76   GLU 2 CA 1 
ATOM 7280 C CA . VAL T  20 77   ? 337.943 269.678 271.486 1.00 0.00 ? 77   VAL 2 CA 1 
ATOM 7281 C CA . ASP T  20 78   ? 336.767 267.440 274.320 1.00 0.00 ? 78   ASP 2 CA 1 
ATOM 7282 C CA . THR T  20 79   ? 336.289 264.025 272.664 1.00 0.00 ? 79   THR 2 CA 1 
ATOM 7283 C CA . GLN T  20 80   ? 334.236 262.324 275.441 1.00 0.00 ? 80   GLN 2 CA 1 
ATOM 7284 C CA . LEU T  20 81   ? 331.767 265.243 275.518 1.00 0.00 ? 81   LEU 2 CA 1 
ATOM 7285 C CA . LEU T  20 82   ? 331.314 264.859 271.760 1.00 0.00 ? 82   LEU 2 CA 1 
ATOM 7286 C CA . GLN T  20 83   ? 330.870 261.092 271.902 1.00 0.00 ? 83   GLN 2 CA 1 
ATOM 7287 C CA . ASP T  20 84   ? 328.146 261.070 274.564 1.00 0.00 ? 84   ASP 2 CA 1 
ATOM 7288 C CA . ALA T  20 85   ? 326.377 264.043 272.915 1.00 0.00 ? 85   ALA 2 CA 1 
ATOM 7289 C CA . ALA T  20 86   ? 326.469 262.179 269.562 1.00 0.00 ? 86   ALA 2 CA 1 
ATOM 7290 C CA . ARG T  20 87   ? 324.946 259.184 271.373 1.00 0.00 ? 87   ARG 2 CA 1 
ATOM 7291 C CA . LYS T  20 88   ? 322.378 261.580 272.876 1.00 0.00 ? 88   LYS 2 CA 1 
ATOM 7292 C CA . GLU T  20 89   ? 320.891 262.612 269.500 1.00 0.00 ? 89   GLU 2 CA 1 
ATOM 7293 C CA . ALA T  20 90   ? 317.925 260.931 267.773 1.00 0.00 ? 90   ALA 2 CA 1 
ATOM 7294 C CA . SER U  21 11   ? 301.576 280.668 237.545 1.00 0.00 ? 11   SER 7 CA 1 
ATOM 7295 C CA . ILE U  21 12   ? 299.110 277.834 238.285 1.00 0.00 ? 12   ILE 7 CA 1 
ATOM 7296 C CA . LEU U  21 13   ? 296.842 280.305 236.429 1.00 0.00 ? 13   LEU 7 CA 1 
ATOM 7297 C CA . ASP U  21 14   ? 299.391 281.196 233.707 1.00 0.00 ? 14   ASP 7 CA 1 
ATOM 7298 C CA . LEU U  21 15   ? 299.747 277.551 232.561 1.00 0.00 ? 15   LEU 7 CA 1 
ATOM 7299 C CA . SER U  21 16   ? 295.978 277.153 232.045 1.00 0.00 ? 16   SER 7 CA 1 
ATOM 7300 C CA . LYS U  21 17   ? 296.360 279.673 229.176 1.00 0.00 ? 17   LYS 7 CA 1 
ATOM 7301 C CA . TYR U  21 18   ? 298.434 277.023 227.312 1.00 0.00 ? 18   TYR 7 CA 1 
ATOM 7302 C CA . ILE U  21 19   ? 296.060 274.065 227.949 1.00 0.00 ? 19   ILE 7 CA 1 
ATOM 7303 C CA . ASP U  21 20   ? 295.655 271.806 224.866 1.00 0.00 ? 20   ASP 7 CA 1 
ATOM 7304 C CA . LYS U  21 21   ? 298.528 273.667 223.133 1.00 0.00 ? 21   LYS 7 CA 1 
ATOM 7305 C CA . THR U  21 22   ? 302.007 272.374 222.315 1.00 0.00 ? 22   THR 7 CA 1 
ATOM 7306 C CA . ILE U  21 23   ? 304.795 273.554 224.621 1.00 0.00 ? 23   ILE 7 CA 1 
ATOM 7307 C CA . ARG U  21 24   ? 308.565 273.128 224.993 1.00 0.00 ? 24   ARG 7 CA 1 
ATOM 7308 C CA . VAL U  21 25   ? 310.142 271.833 228.215 1.00 0.00 ? 25   VAL 7 CA 1 
ATOM 7309 C CA . LYS U  21 26   ? 313.699 271.738 229.569 1.00 0.00 ? 26   LYS 7 CA 1 
ATOM 7310 C CA . PHE U  21 27   ? 314.884 269.503 232.413 1.00 0.00 ? 27   PHE 7 CA 1 
ATOM 7311 C CA . GLN U  21 28   ? 317.926 269.673 234.685 1.00 0.00 ? 28   GLN 7 CA 1 
ATOM 7312 C CA . GLY U  21 29   ? 320.552 267.460 233.026 1.00 0.00 ? 29   GLY 7 CA 1 
ATOM 7313 C CA . GLY U  21 30   ? 319.843 268.995 229.589 1.00 0.00 ? 30   GLY 7 CA 1 
ATOM 7314 C CA . ARG U  21 31   ? 316.879 266.978 228.193 1.00 0.00 ? 31   ARG 7 CA 1 
ATOM 7315 C CA . GLU U  21 32   ? 314.438 268.909 226.030 1.00 0.00 ? 32   GLU 7 CA 1 
ATOM 7316 C CA . ALA U  21 33   ? 310.971 267.766 224.967 1.00 0.00 ? 33   ALA 7 CA 1 
ATOM 7317 C CA . SER U  21 34   ? 307.864 269.115 223.222 1.00 0.00 ? 34   SER 7 CA 1 
ATOM 7318 C CA . GLY U  21 35   ? 304.271 267.977 223.846 1.00 0.00 ? 35   GLY 7 CA 1 
ATOM 7319 C CA . ILE U  21 36   ? 300.635 269.010 224.274 1.00 0.00 ? 36   ILE 7 CA 1 
ATOM 7320 C CA . LEU U  21 37   ? 299.732 270.314 227.679 1.00 0.00 ? 37   LEU 7 CA 1 
ATOM 7321 C CA . LYS U  21 38   ? 297.005 267.923 228.882 1.00 0.00 ? 38   LYS 7 CA 1 
ATOM 7322 C CA . GLY U  21 39   ? 297.085 268.717 232.652 1.00 0.00 ? 39   GLY 7 CA 1 
ATOM 7323 C CA . PHE U  21 40   ? 299.303 269.754 235.557 1.00 0.00 ? 40   PHE 7 CA 1 
ATOM 7324 C CA . ASP U  21 41   ? 299.324 270.274 239.314 1.00 0.00 ? 41   ASP 7 CA 1 
ATOM 7325 C CA . PRO U  21 42   ? 300.796 273.067 241.615 1.00 0.00 ? 42   PRO 7 CA 1 
ATOM 7326 C CA . LEU U  21 43   ? 304.022 270.993 241.912 1.00 0.00 ? 43   LEU 7 CA 1 
ATOM 7327 C CA . LEU U  21 44   ? 304.609 271.433 238.116 1.00 0.00 ? 44   LEU 7 CA 1 
ATOM 7328 C CA . ASN U  21 45   ? 304.022 267.742 237.341 1.00 0.00 ? 45   ASN 7 CA 1 
ATOM 7329 C CA . LEU U  21 46   ? 302.705 267.746 233.767 1.00 0.00 ? 46   LEU 7 CA 1 
ATOM 7330 C CA . VAL U  21 47   ? 300.687 265.454 231.515 1.00 0.00 ? 47   VAL 7 CA 1 
ATOM 7331 C CA . LEU U  21 48   ? 301.993 265.910 227.969 1.00 0.00 ? 48   LEU 7 CA 1 
ATOM 7332 C CA . ASP U  21 49   ? 300.567 264.147 224.915 1.00 0.00 ? 49   ASP 7 CA 1 
ATOM 7333 C CA . GLY U  21 50   ? 302.399 263.216 221.686 1.00 0.00 ? 50   GLY 7 CA 1 
ATOM 7334 C CA . THR U  21 51   ? 305.744 264.225 223.228 1.00 0.00 ? 51   THR 7 CA 1 
ATOM 7335 C CA . ILE U  21 52   ? 308.881 264.338 221.112 1.00 0.00 ? 52   ILE 7 CA 1 
ATOM 7336 C CA . GLU U  21 53   ? 312.264 264.526 222.888 1.00 0.00 ? 53   GLU 7 CA 1 
ATOM 7337 C CA . TYR U  21 54   ? 314.818 266.563 220.925 1.00 0.00 ? 54   TYR 7 CA 1 
ATOM 7338 C CA . MET U  21 55   ? 317.939 264.483 220.792 1.00 0.00 ? 55   MET 7 CA 1 
ATOM 7339 C CA . ARG U  21 56   ? 321.215 266.058 221.628 1.00 0.00 ? 56   ARG 7 CA 1 
ATOM 7340 C CA . ASP U  21 57   ? 324.784 265.484 220.283 1.00 0.00 ? 57   ASP 7 CA 1 
ATOM 7341 C CA . PRO U  21 58   ? 326.414 262.794 222.541 1.00 0.00 ? 58   PRO 7 CA 1 
ATOM 7342 C CA . ASP U  21 59   ? 329.417 264.942 223.588 1.00 0.00 ? 59   ASP 7 CA 1 
ATOM 7343 C CA . ASP U  21 60   ? 330.313 268.661 224.021 1.00 0.00 ? 60   ASP 7 CA 1 
ATOM 7344 C CA . GLN U  21 61   ? 327.460 268.827 226.590 1.00 0.00 ? 61   GLN 7 CA 1 
ATOM 7345 C CA . TYR U  21 62   ? 325.067 268.280 223.644 1.00 0.00 ? 62   TYR 7 CA 1 
ATOM 7346 C CA . LYS U  21 63   ? 323.810 270.485 220.858 1.00 0.00 ? 63   LYS 7 CA 1 
ATOM 7347 C CA . LEU U  21 64   ? 320.365 269.700 219.365 1.00 0.00 ? 64   LEU 7 CA 1 
ATOM 7348 C CA . THR U  21 65   ? 320.972 267.271 216.503 1.00 0.00 ? 65   THR 7 CA 1 
ATOM 7349 C CA . GLU U  21 66   ? 317.544 268.044 214.851 1.00 0.00 ? 66   GLU 7 CA 1 
ATOM 7350 C CA . ASP U  21 67   ? 316.525 264.370 215.334 1.00 0.00 ? 67   ASP 7 CA 1 
ATOM 7351 C CA . THR U  21 68   ? 313.353 263.545 217.282 1.00 0.00 ? 68   THR 7 CA 1 
ATOM 7352 C CA . ARG U  21 69   ? 312.289 260.626 219.492 1.00 0.00 ? 69   ARG 7 CA 1 
ATOM 7353 C CA . GLN U  21 70   ? 308.590 259.817 220.096 1.00 0.00 ? 70   GLN 7 CA 1 
ATOM 7354 C CA . LEU U  21 71   ? 307.347 259.067 223.612 1.00 0.00 ? 71   LEU 7 CA 1 
ATOM 7355 C CA . GLY U  21 72   ? 303.560 259.614 223.349 1.00 0.00 ? 72   GLY 7 CA 1 
ATOM 7356 C CA . LEU U  21 73   ? 301.569 260.262 226.538 1.00 0.00 ? 73   LEU 7 CA 1 
ATOM 7357 C CA . VAL U  21 74   ? 303.961 261.212 229.372 1.00 0.00 ? 74   VAL 7 CA 1 
ATOM 7358 C CA . VAL U  21 75   ? 303.958 262.394 233.001 1.00 0.00 ? 75   VAL 7 CA 1 
ATOM 7359 C CA . CYS U  21 76   ? 306.656 265.057 233.465 1.00 0.00 ? 76   CYS 7 CA 1 
ATOM 7360 C CA . ARG U  21 77   ? 308.143 265.305 236.959 1.00 0.00 ? 77   ARG 7 CA 1 
ATOM 7361 C CA . GLY U  21 78   ? 308.181 268.758 238.585 1.00 0.00 ? 78   GLY 7 CA 1 
ATOM 7362 C CA . THR U  21 79   ? 311.378 267.841 240.480 1.00 0.00 ? 79   THR 7 CA 1 
ATOM 7363 C CA . SER U  21 80   ? 313.477 267.945 237.253 1.00 0.00 ? 80   SER 7 CA 1 
ATOM 7364 C CA . VAL U  21 81   ? 311.505 270.559 235.232 1.00 0.00 ? 81   VAL 7 CA 1 
ATOM 7365 C CA . VAL U  21 82   ? 313.351 273.853 234.710 1.00 0.00 ? 82   VAL 7 CA 1 
ATOM 7366 C CA . LEU U  21 83   ? 311.594 275.652 231.854 1.00 0.00 ? 83   LEU 7 CA 1 
ATOM 7367 C CA . ILE U  21 84   ? 308.271 275.540 230.021 1.00 0.00 ? 84   ILE 7 CA 1 
ATOM 7368 C CA . CYS U  21 85   ? 307.613 277.775 226.995 1.00 0.00 ? 85   CYS 7 CA 1 
ATOM 7369 C CA . PRO U  21 86   ? 304.987 278.024 224.192 1.00 0.00 ? 86   PRO 7 CA 1 
ATOM 7370 C CA . GLN U  21 87   ? 305.770 277.795 220.468 1.00 0.00 ? 87   GLN 7 CA 1 
ATOM 7371 C CA . ASP U  21 88   ? 307.171 280.850 218.638 1.00 0.00 ? 88   ASP 7 CA 1 
ATOM 7372 C CA . GLY U  21 89   ? 304.046 282.949 217.877 1.00 0.00 ? 89   GLY 7 CA 1 
ATOM 7373 C CA . GLN V  22 539  ? 289.890 279.831 244.247 1.00 0.00 ? 539  GLN K CA 1 
ATOM 7374 C CA . GLY V  22 540  ? 286.799 281.440 245.751 1.00 0.00 ? 540  GLY K CA 1 
ATOM 7375 C CA . VAL V  22 541  ? 286.004 280.750 249.361 1.00 0.00 ? 541  VAL K CA 1 
ATOM 7376 C CA . HIS V  22 542  ? 282.668 280.485 251.144 1.00 0.00 ? 542  HIS K CA 1 
ATOM 7377 C CA . ILE V  22 543  ? 282.193 283.064 253.859 1.00 0.00 ? 543  ILE K CA 1 
ATOM 7378 C CA . SER V  22 544  ? 279.875 283.715 256.760 1.00 0.00 ? 544  SER K CA 1 
ATOM 7379 C CA . VAL V  22 545  ? 279.491 286.606 259.145 1.00 0.00 ? 545  VAL K CA 1 
ATOM 7380 C CA . TYR V  22 546  ? 277.944 286.622 262.617 1.00 0.00 ? 546  TYR K CA 1 
ATOM 7381 C CA . ARG V  22 547  ? 277.451 289.156 265.362 1.00 0.00 ? 547  ARG K CA 1 
ATOM 7382 C CA . VAL V  22 548  ? 277.240 288.673 269.146 1.00 0.00 ? 548  VAL K CA 1 
ATOM 7383 C CA . ARG V  22 549  ? 276.080 290.972 271.940 1.00 0.00 ? 549  ARG K CA 1 
ATOM 7384 C CA . ASN V  22 550  ? 278.502 289.744 274.560 1.00 0.00 ? 550  ASN K CA 1 
ATOM 7385 C CA . LEU V  22 551  ? 281.500 287.439 274.525 1.00 0.00 ? 551  LEU K CA 1 
ATOM 7386 C CA . SER V  22 552  ? 282.948 287.046 277.975 1.00 0.00 ? 552  SER K CA 1 
ATOM 7387 C CA . ASN V  22 553  ? 282.495 283.352 278.608 1.00 0.00 ? 553  ASN K CA 1 
ATOM 7388 C CA . PRO V  22 554  ? 285.951 281.766 278.246 1.00 0.00 ? 554  PRO K CA 1 
ATOM 7389 C CA . ALA V  22 555  ? 284.540 278.344 277.435 1.00 0.00 ? 555  ALA K CA 1 
ATOM 7390 C CA . LYS V  22 556  ? 283.032 279.996 274.376 1.00 0.00 ? 556  LYS K CA 1 
ATOM 7391 C CA . LYS V  22 557  ? 286.071 282.028 273.290 1.00 0.00 ? 557  LYS K CA 1 
ATOM 7392 C CA . PHE V  22 558  ? 288.091 278.819 273.602 1.00 0.00 ? 558  PHE K CA 1 
ATOM 7393 C CA . LYS V  22 559  ? 285.525 276.893 271.531 1.00 0.00 ? 559  LYS K CA 1 
ATOM 7394 C CA . ILE V  22 560  ? 285.596 279.676 268.944 1.00 0.00 ? 560  ILE K CA 1 
ATOM 7395 C CA . GLU V  22 561  ? 289.387 279.730 268.628 1.00 0.00 ? 561  GLU K CA 1 
ATOM 7396 C CA . ALA V  22 562  ? 289.871 275.973 268.596 1.00 0.00 ? 562  ALA K CA 1 
ATOM 7397 C CA . ASN V  22 563  ? 287.102 275.256 266.148 1.00 0.00 ? 563  ASN K CA 1 
ATOM 7398 C CA . ALA V  22 564  ? 288.376 277.986 263.824 1.00 0.00 ? 564  ALA K CA 1 
ATOM 7399 C CA . GLY V  22 565  ? 291.895 276.597 263.802 1.00 0.00 ? 565  GLY K CA 1 
ATOM 7400 C CA . GLN V  22 566  ? 290.857 272.935 263.502 1.00 0.00 ? 566  GLN K CA 1 
ATOM 7401 C CA . LEU V  22 567  ? 288.786 273.692 260.391 1.00 0.00 ? 567  LEU K CA 1 
ATOM 7402 C CA . TYR V  22 568  ? 291.455 275.910 258.833 1.00 0.00 ? 568  TYR K CA 1 
ATOM 7403 C CA . LEU V  22 569  ? 288.812 278.643 258.671 1.00 0.00 ? 569  LEU K CA 1 
ATOM 7404 C CA . THR V  22 570  ? 290.413 281.997 258.182 1.00 0.00 ? 570  THR K CA 1 
ATOM 7405 C CA . GLY V  22 571  ? 288.865 285.221 259.275 1.00 0.00 ? 571  GLY K CA 1 
ATOM 7406 C CA . VAL V  22 572  ? 288.554 286.670 262.770 1.00 0.00 ? 572  VAL K CA 1 
ATOM 7407 C CA . VAL V  22 573  ? 286.447 287.517 265.832 1.00 0.00 ? 573  VAL K CA 1 
ATOM 7408 C CA . VAL V  22 574  ? 286.373 291.032 267.256 1.00 0.00 ? 574  VAL K CA 1 
ATOM 7409 C CA . LEU V  22 575  ? 284.535 292.963 270.029 1.00 0.00 ? 575  LEU K CA 1 
ATOM 7410 C CA . HIS V  22 576  ? 284.599 296.433 271.605 1.00 0.00 ? 576  HIS K CA 1 
ATOM 7411 C CA . LYS V  22 577  ? 286.071 296.232 275.147 1.00 0.00 ? 577  LYS K CA 1 
ATOM 7412 C CA . ASP V  22 578  ? 286.092 292.851 276.915 1.00 0.00 ? 578  ASP K CA 1 
ATOM 7413 C CA . VAL V  22 579  ? 279.563 293.049 271.361 1.00 0.00 ? 579  VAL K CA 1 
ATOM 7414 C CA . ASN V  22 580  ? 281.353 292.071 268.184 1.00 0.00 ? 580  ASN K CA 1 
ATOM 7415 C CA . VAL V  22 581  ? 281.632 290.040 265.018 1.00 0.00 ? 581  VAL K CA 1 
ATOM 7416 C CA . VAL V  22 582  ? 282.829 286.696 263.706 1.00 0.00 ? 582  VAL K CA 1 
ATOM 7417 C CA . VAL V  22 583  ? 283.937 286.124 260.134 1.00 0.00 ? 583  VAL K CA 1 
ATOM 7418 C CA . VAL V  22 584  ? 284.776 282.632 258.971 1.00 0.00 ? 584  VAL K CA 1 
ATOM 7419 C CA . GLU V  22 585  ? 286.178 282.010 255.496 1.00 0.00 ? 585  GLU K CA 1 
ATOM 7420 C CA . GLY V  22 586  ? 286.655 278.499 254.172 1.00 0.00 ? 586  GLY K CA 1 
ATOM 7421 C CA . GLY V  22 587  ? 285.139 275.619 252.266 1.00 0.00 ? 587  GLY K CA 1 
ATOM 7422 C CA . PRO V  22 588  ? 281.410 275.074 252.555 1.00 0.00 ? 588  PRO K CA 1 
ATOM 7423 C CA . LYS V  22 589  ? 281.277 272.156 255.011 1.00 0.00 ? 589  LYS K CA 1 
ATOM 7424 C CA . ALA V  22 590  ? 283.653 273.860 257.486 1.00 0.00 ? 590  ALA K CA 1 
ATOM 7425 C CA . GLN V  22 591  ? 281.705 277.124 257.500 1.00 0.00 ? 591  GLN K CA 1 
ATOM 7426 C CA . LYS V  22 592  ? 278.396 275.291 257.658 1.00 0.00 ? 592  LYS K CA 1 
ATOM 7427 C CA . LYS V  22 593  ? 279.717 273.159 260.498 1.00 0.00 ? 593  LYS K CA 1 
ATOM 7428 C CA . PHE V  22 594  ? 280.961 276.247 262.347 1.00 0.00 ? 594  PHE K CA 1 
ATOM 7429 C CA . LYS V  22 595  ? 277.648 277.920 261.718 1.00 0.00 ? 595  LYS K CA 1 
ATOM 7430 C CA . ARG V  22 596  ? 275.790 274.956 263.191 1.00 0.00 ? 596  ARG K CA 1 
ATOM 7431 C CA . LEU V  22 597  ? 278.270 275.207 266.032 1.00 0.00 ? 597  LEU K CA 1 
ATOM 7432 C CA . MET V  22 598  ? 277.758 278.853 266.885 1.00 0.00 ? 598  MET K CA 1 
ATOM 7433 C CA . LEU V  22 599  ? 274.000 278.945 266.269 1.00 0.00 ? 599  LEU K CA 1 
ATOM 7434 C CA . HIS V  22 600  ? 272.927 275.578 267.640 1.00 0.00 ? 600  HIS K CA 1 
ATOM 7435 C CA . ARG V  22 601  ? 275.604 274.226 269.968 1.00 0.00 ? 601  ARG K CA 1 
ATOM 7436 C CA . ILE V  22 602  ? 276.888 277.233 271.885 1.00 0.00 ? 602  ILE K CA 1 
ATOM 7437 C CA . LYS V  22 603  ? 274.182 278.526 274.225 1.00 0.00 ? 603  LYS K CA 1 
ATOM 7438 C CA . TRP V  22 604  ? 275.092 282.198 274.759 1.00 0.00 ? 604  TRP K CA 1 
ATOM 7439 C CA . ASP V  22 605  ? 271.918 282.665 276.824 1.00 0.00 ? 605  ASP K CA 1 
ATOM 7440 C CA . GLU V  22 606  ? 273.116 280.869 279.943 1.00 0.00 ? 606  GLU K CA 1 
ATOM 7441 C CA . GLN V  22 607  ? 274.593 282.846 282.796 1.00 0.00 ? 607  GLN K CA 1 
ATOM 7442 C CA . THR V  22 608  ? 277.893 281.511 284.108 1.00 0.00 ? 608  THR K CA 1 
ATOM 7443 C CA . SER V  22 609  ? 280.489 282.141 286.807 1.00 0.00 ? 609  SER K CA 1 
ATOM 7444 C CA . ASN V  22 610  ? 283.804 283.773 286.051 1.00 0.00 ? 610  ASN K CA 1 
ATOM 7445 C CA . THR V  22 611  ? 286.567 282.576 288.347 1.00 0.00 ? 611  THR K CA 1 
ATOM 7446 C CA . ASP V  22 616  ? 288.840 285.533 289.087 1.00 0.00 ? 616  ASP K CA 1 
ATOM 7447 C CA . GLU V  22 617  ? 291.915 286.727 291.004 1.00 0.00 ? 617  GLU K CA 1 
ATOM 7448 C CA . GLU V  22 618  ? 289.505 288.050 293.652 1.00 0.00 ? 618  GLU K CA 1 
ATOM 7449 C CA . SER V  22 619  ? 286.942 285.242 293.534 1.00 0.00 ? 619  SER K CA 1 
ATOM 7450 C CA . ASP V  22 620  ? 283.980 283.944 291.531 1.00 0.00 ? 620  ASP K CA 1 
ATOM 7451 C CA . GLU V  22 621  ? 281.553 286.380 289.973 1.00 0.00 ? 621  GLU K CA 1 
ATOM 7452 C CA . GLU V  22 622  ? 278.046 285.582 288.768 1.00 0.00 ? 622  GLU K CA 1 
ATOM 7453 C CA . ALA V  22 623  ? 277.996 286.623 285.113 1.00 0.00 ? 623  ALA K CA 1 
ATOM 7454 C CA . VAL V  22 624  ? 274.600 287.609 283.666 1.00 0.00 ? 624  VAL K CA 1 
ATOM 7455 C CA . LYS V  22 625  ? 274.426 286.133 280.163 1.00 0.00 ? 625  LYS K CA 1 
ATOM 7456 C CA . LYS V  22 626  ? 270.668 286.344 279.828 1.00 0.00 ? 626  LYS K CA 1 
ATOM 7457 C CA . THR V  22 627  ? 270.533 289.139 277.256 1.00 0.00 ? 627  THR K CA 1 
ATOM 7458 C CA . ASN V  22 628  ? 273.181 287.676 274.998 1.00 0.00 ? 628  ASN K CA 1 
ATOM 7459 C CA . LYS V  22 629  ? 272.514 286.653 271.426 1.00 0.00 ? 629  LYS K CA 1 
ATOM 7460 C CA . CYS V  22 630  ? 274.262 285.580 268.243 1.00 0.00 ? 630  CYS K CA 1 
ATOM 7461 C CA . VAL V  22 631  ? 272.945 285.974 264.735 1.00 0.00 ? 631  VAL K CA 1 
ATOM 7462 C CA . LEU V  22 632  ? 274.241 285.392 261.204 1.00 0.00 ? 632  LEU K CA 1 
ATOM 7463 C CA . VAL V  22 633  ? 274.573 288.709 259.345 1.00 0.00 ? 633  VAL K CA 1 
ATOM 7464 C CA . TRP V  22 634  ? 276.052 287.329 256.091 1.00 0.00 ? 634  TRP K CA 1 
ATOM 7465 C CA . GLU V  22 635  ? 276.991 284.368 253.996 1.00 0.00 ? 635  GLU K CA 1 
ATOM 7466 C CA . GLY V  22 636  ? 278.194 283.940 250.424 1.00 0.00 ? 636  GLY K CA 1 
ATOM 7467 C CA . THR V  22 637  ? 281.303 283.786 248.292 1.00 0.00 ? 637  THR K CA 1 
ATOM 7468 C CA . ALA V  22 638  ? 284.573 285.612 248.363 1.00 0.00 ? 638  ALA K CA 1 
ATOM 7469 C CA . LYS V  22 639  ? 286.997 286.281 245.541 1.00 0.00 ? 639  LYS K CA 1 
ATOM 7470 C CA . ASP V  22 640  ? 290.126 286.276 247.693 1.00 0.00 ? 640  ASP K CA 1 
ATOM 7471 C CA . ARG V  22 641  ? 290.583 286.714 251.442 1.00 0.00 ? 641  ARG K CA 1 
ATOM 7472 C CA . SER V  22 642  ? 293.368 288.935 252.781 1.00 0.00 ? 642  SER K CA 1 
ATOM 7473 C CA . PHE V  22 643  ? 292.638 287.103 255.990 1.00 0.00 ? 643  PHE K CA 1 
ATOM 7474 C CA . GLY V  22 644  ? 295.895 285.355 256.826 1.00 0.00 ? 644  GLY K CA 1 
ATOM 7475 C CA . GLU V  22 645  ? 295.119 283.200 259.831 1.00 0.00 ? 645  GLU K CA 1 
ATOM 7476 C CA . MET V  22 646  ? 292.264 283.581 262.340 1.00 0.00 ? 646  MET K CA 1 
ATOM 7477 C CA . LYS V  22 647  ? 292.365 285.479 265.586 1.00 0.00 ? 647  LYS K CA 1 
ATOM 7478 C CA . PHE V  22 648  ? 290.317 287.047 268.393 1.00 0.00 ? 648  PHE K CA 1 
ATOM 7479 C CA . LYS V  22 649  ? 290.955 290.710 269.119 1.00 0.00 ? 649  LYS K CA 1 
ATOM 7480 C CA . GLN V  22 650  ? 289.255 293.054 271.584 1.00 0.00 ? 650  GLN K CA 1 
ATOM 7481 C CA . CYS V  22 651  ? 289.055 296.597 270.212 1.00 0.00 ? 651  CYS K CA 1 
ATOM 7482 C CA . PRO V  22 652  ? 289.245 299.868 272.163 1.00 0.00 ? 652  PRO K CA 1 
ATOM 7483 C CA . THR V  22 653  ? 286.479 301.833 270.439 1.00 0.00 ? 653  THR K CA 1 
ATOM 7484 C CA . GLU V  22 654  ? 284.244 300.946 267.494 1.00 0.00 ? 654  GLU K CA 1 
ATOM 7485 C CA . ASN V  22 655  ? 286.620 302.949 265.325 1.00 0.00 ? 655  ASN K CA 1 
ATOM 7486 C CA . MET V  22 656  ? 289.421 300.564 266.223 1.00 0.00 ? 656  MET K CA 1 
ATOM 7487 C CA . ALA V  22 657  ? 287.157 297.667 265.280 1.00 0.00 ? 657  ALA K CA 1 
ATOM 7488 C CA . ARG V  22 658  ? 286.398 299.212 261.919 1.00 0.00 ? 658  ARG K CA 1 
ATOM 7489 C CA . GLU V  22 659  ? 290.057 299.990 261.192 1.00 0.00 ? 659  GLU K CA 1 
ATOM 7490 C CA . HIS V  22 660  ? 291.004 296.440 262.151 1.00 0.00 ? 660  HIS K CA 1 
ATOM 7491 C CA . PHE V  22 661  ? 288.436 295.325 259.588 1.00 0.00 ? 661  PHE K CA 1 
ATOM 7492 C CA . LYS V  22 662  ? 289.831 297.917 257.166 1.00 0.00 ? 662  LYS K CA 1 
ATOM 7493 C CA . LYS V  22 663  ? 293.148 296.223 256.953 1.00 0.00 ? 663  LYS K CA 1 
ATOM 7494 C CA . HIS V  22 664  ? 291.135 293.414 255.395 1.00 0.00 ? 664  HIS K CA 1 
ATOM 7495 C CA . GLY V  22 665  ? 288.425 295.359 253.557 1.00 0.00 ? 665  GLY K CA 1 
ATOM 7496 C CA . ALA V  22 666  ? 285.523 293.807 255.475 1.00 0.00 ? 666  ALA K CA 1 
ATOM 7497 C CA . GLU V  22 667  ? 284.191 296.774 257.425 1.00 0.00 ? 667  GLU K CA 1 
ATOM 7498 C CA . HIS V  22 668  ? 281.211 296.409 255.160 1.00 0.00 ? 668  HIS K CA 1 
ATOM 7499 C CA . TYR V  22 669  ? 280.229 293.365 257.219 1.00 0.00 ? 669  TYR K CA 1 
ATOM 7500 C CA . TRP V  22 670  ? 279.857 295.492 260.353 1.00 0.00 ? 670  TRP K CA 1 
ATOM 7501 C CA . ASP V  22 671  ? 276.424 296.581 261.537 1.00 0.00 ? 671  ASP K CA 1 
ATOM 7502 C CA . LEU V  22 672  ? 277.398 299.164 264.242 1.00 0.00 ? 672  LEU K CA 1 
ATOM 7503 C CA . ALA V  22 673  ? 275.789 299.601 267.689 1.00 0.00 ? 673  ALA K CA 1 
ATOM 7504 C CA . LYS W  23 215  ? 242.480 300.436 241.074 1.00 0.00 ? 216  LYS L CA 1 
ATOM 7505 C CA . SER W  23 216  ? 243.173 300.705 244.805 1.00 0.00 ? 217  SER L CA 1 
ATOM 7506 C CA . LEU W  23 217  ? 245.772 303.312 245.793 1.00 0.00 ? 218  LEU L CA 1 
ATOM 7507 C CA . ARG W  23 218  ? 247.702 302.606 248.982 1.00 0.00 ? 219  ARG L CA 1 
ATOM 7508 C CA . SER W  23 219  ? 249.411 304.867 251.532 1.00 0.00 ? 220  SER L CA 1 
ATOM 7509 C CA . LEU W  23 220  ? 251.569 304.863 254.742 1.00 0.00 ? 221  LEU L CA 1 
ATOM 7510 C CA . ASN W  23 221  ? 252.908 306.946 257.697 1.00 0.00 ? 222  ASN L CA 1 
ATOM 7511 C CA . ASN W  23 222  ? 256.207 307.315 259.609 1.00 0.00 ? 223  ASN L CA 1 
ATOM 7512 C CA . PHE W  23 223  ? 257.455 304.840 262.196 1.00 0.00 ? 224  PHE L CA 1 
ATOM 7513 C CA . CYS W  23 224  ? 261.110 305.256 263.068 1.00 0.00 ? 225  CYS L CA 1 
ATOM 7514 C CA . SER W  23 225  ? 263.140 308.443 263.141 1.00 0.00 ? 226  SER L CA 1 
ATOM 7515 C CA . GLN W  23 226  ? 266.916 308.171 263.237 1.00 0.00 ? 227  GLN L CA 1 
ATOM 7516 C CA . ILE W  23 227  ? 268.822 311.060 264.655 1.00 0.00 ? 228  ILE L CA 1 
ATOM 7517 C CA . GLY W  23 228  ? 272.482 311.414 265.364 1.00 0.00 ? 229  GLY L CA 1 
ATOM 7518 C CA . ASP W  23 229  ? 273.860 312.982 262.197 1.00 0.00 ? 230  ASP L CA 1 
ATOM 7519 C CA . ASP W  23 230  ? 275.376 316.387 262.851 1.00 0.00 ? 231  ASP L CA 1 
ATOM 7520 C CA . ARG W  23 231  ? 274.491 317.904 259.487 1.00 0.00 ? 232  ARG L CA 1 
ATOM 7521 C CA . PRO W  23 232  ? 272.276 317.174 256.505 1.00 0.00 ? 233  PRO L CA 1 
ATOM 7522 C CA . ILE W  23 233  ? 271.856 313.595 255.368 1.00 0.00 ? 234  ILE L CA 1 
ATOM 7523 C CA . SER W  23 234  ? 273.002 313.155 251.779 1.00 0.00 ? 235  SER L CA 1 
ATOM 7524 C CA . TYR W  23 235  ? 272.318 309.497 250.997 1.00 0.00 ? 236  TYR L CA 1 
ATOM 7525 C CA . CYS W  23 236  ? 271.246 306.174 252.460 1.00 0.00 ? 237  CYS L CA 1 
ATOM 7526 C CA . HIS W  23 237  ? 271.074 302.534 251.378 1.00 0.00 ? 238  HIS L CA 1 
ATOM 7527 C CA . PHE W  23 238  ? 269.501 299.475 253.012 1.00 0.00 ? 239  PHE L CA 1 
ATOM 7528 C CA . SER W  23 239  ? 271.286 296.271 253.917 1.00 0.00 ? 240  SER L CA 1 
ATOM 7529 C CA . PRO W  23 240  ? 269.872 293.138 252.363 1.00 0.00 ? 241  PRO L CA 1 
ATOM 7530 C CA . ASN W  23 241  ? 269.123 292.235 256.001 1.00 0.00 ? 242  ASN L CA 1 
ATOM 7531 C CA . SER W  23 242  ? 266.187 294.581 255.481 1.00 0.00 ? 243  SER L CA 1 
ATOM 7532 C CA . LYS W  23 243  ? 266.951 296.235 258.829 1.00 0.00 ? 244  LYS L CA 1 
ATOM 7533 C CA . MET W  23 244  ? 270.433 297.758 258.680 1.00 0.00 ? 245  MET L CA 1 
ATOM 7534 C CA . LEU W  23 245  ? 270.925 301.046 256.861 1.00 0.00 ? 246  LEU L CA 1 
ATOM 7535 C CA . ALA W  23 246  ? 273.971 303.073 255.994 1.00 0.00 ? 247  ALA L CA 1 
ATOM 7536 C CA . THR W  23 247  ? 273.700 306.842 255.815 1.00 0.00 ? 248  THR L CA 1 
ATOM 7537 C CA . ALA W  23 248  ? 276.129 309.675 255.136 1.00 0.00 ? 249  ALA L CA 1 
ATOM 7538 C CA . CYS W  23 249  ? 276.211 313.335 256.085 1.00 0.00 ? 250  CYS L CA 1 
ATOM 7539 C CA . TRP W  23 250  ? 277.662 316.664 254.951 1.00 0.00 ? 251  TRP L CA 1 
ATOM 7540 C CA . SER W  23 251  ? 279.761 316.542 258.154 1.00 0.00 ? 252  SER L CA 1 
ATOM 7541 C CA . GLY W  23 252  ? 281.692 313.623 256.662 1.00 0.00 ? 253  GLY L CA 1 
ATOM 7542 C CA . LEU W  23 253  ? 280.114 311.163 259.130 1.00 0.00 ? 254  LEU L CA 1 
ATOM 7543 C CA . CYS W  23 254  ? 278.777 307.817 257.976 1.00 0.00 ? 255  CYS L CA 1 
ATOM 7544 C CA . LYS W  23 255  ? 276.594 305.782 260.284 1.00 0.00 ? 256  LYS L CA 1 
ATOM 7545 C CA . LEU W  23 256  ? 275.351 302.224 260.084 1.00 0.00 ? 257  LEU L CA 1 
ATOM 7546 C CA . TRP W  23 257  ? 272.138 301.787 262.012 1.00 0.00 ? 258  TRP L CA 1 
ATOM 7547 C CA . SER W  23 258  ? 269.916 298.902 262.855 1.00 0.00 ? 259  SER L CA 1 
ATOM 7548 C CA . VAL W  23 259  ? 266.851 300.858 261.846 1.00 0.00 ? 260  VAL L CA 1 
ATOM 7549 C CA . PRO W  23 260  ? 264.328 298.732 263.687 1.00 0.00 ? 261  PRO L CA 1 
ATOM 7550 C CA . ASP W  23 261  ? 266.207 299.141 267.019 1.00 0.00 ? 262  ASP L CA 1 
ATOM 7551 C CA . CYS W  23 262  ? 267.521 302.545 265.848 1.00 0.00 ? 263  CYS L CA 1 
ATOM 7552 C CA . ASN W  23 263  ? 270.830 301.600 267.508 1.00 0.00 ? 264  ASN L CA 1 
ATOM 7553 C CA . LEU W  23 264  ? 274.056 302.624 265.810 1.00 0.00 ? 265  LEU L CA 1 
ATOM 7554 C CA . LEU W  23 265  ? 276.278 299.653 264.969 1.00 0.00 ? 266  LEU L CA 1 
ATOM 7555 C CA . HIS W  23 266  ? 279.082 301.576 263.285 1.00 0.00 ? 267  HIS L CA 1 
ATOM 7556 C CA . THR W  23 267  ? 280.194 305.149 262.771 1.00 0.00 ? 268  THR L CA 1 
ATOM 7557 C CA . LEU W  23 268  ? 283.058 306.410 260.654 1.00 0.00 ? 269  LEU L CA 1 
ATOM 7558 C CA . ARG W  23 269  ? 284.447 309.871 260.031 1.00 0.00 ? 270  ARG L CA 1 
ATOM 7559 C CA . GLY W  23 270  ? 285.537 310.365 256.450 1.00 0.00 ? 271  GLY L CA 1 
ATOM 7560 C CA . HIS W  23 271  ? 288.572 312.505 255.715 1.00 0.00 ? 272  HIS L CA 1 
ATOM 7561 C CA . ASN W  23 272  ? 286.406 314.957 253.782 1.00 0.00 ? 273  ASN L CA 1 
ATOM 7562 C CA . THR W  23 273  ? 282.975 316.438 254.163 1.00 0.00 ? 274  THR L CA 1 
ATOM 7563 C CA . ASN W  23 274  ? 279.850 316.299 252.023 1.00 0.00 ? 275  ASN L CA 1 
ATOM 7564 C CA . VAL W  23 275  ? 279.807 312.513 251.587 1.00 0.00 ? 276  VAL L CA 1 
ATOM 7565 C CA . GLY W  23 276  ? 277.189 312.460 248.843 1.00 0.00 ? 277  GLY L CA 1 
ATOM 7566 C CA . ALA W  23 277  ? 277.163 308.717 248.220 1.00 0.00 ? 278  ALA L CA 1 
ATOM 7567 C CA . ILE W  23 278  ? 276.996 305.556 250.282 1.00 0.00 ? 279  ILE L CA 1 
ATOM 7568 C CA . VAL W  23 279  ? 276.175 301.963 249.427 1.00 0.00 ? 280  VAL L CA 1 
ATOM 7569 C CA . PHE W  23 280  ? 275.750 298.720 251.296 1.00 0.00 ? 281  PHE L CA 1 
ATOM 7570 C CA . HIS W  23 281  ? 277.488 295.564 249.982 1.00 0.00 ? 282  HIS L CA 1 
ATOM 7571 C CA . PRO W  23 282  ? 274.694 293.472 248.493 1.00 0.00 ? 283  PRO L CA 1 
ATOM 7572 C CA . LYS W  23 283  ? 276.512 290.238 247.758 1.00 0.00 ? 284  LYS L CA 1 
ATOM 7573 C CA . SER W  23 284  ? 276.530 289.202 251.356 1.00 0.00 ? 285  SER L CA 1 
ATOM 7574 C CA . THR W  23 285  ? 273.197 288.100 252.718 1.00 0.00 ? 286  THR L CA 1 
ATOM 7575 C CA . VAL W  23 286  ? 273.804 291.377 254.482 1.00 0.00 ? 287  VAL L CA 1 
ATOM 7576 C CA . SER W  23 287  ? 277.220 292.834 254.836 1.00 0.00 ? 288  SER L CA 1 
ATOM 7577 C CA . LEU W  23 288  ? 277.636 290.988 258.115 1.00 0.00 ? 289  LEU L CA 1 
ATOM 7578 C CA . ASP W  23 289  ? 280.375 289.641 260.304 1.00 0.00 ? 290  ASP L CA 1 
ATOM 7579 C CA . PRO W  23 290  ? 279.519 286.153 259.113 1.00 0.00 ? 291  PRO L CA 1 
ATOM 7580 C CA . LYS W  23 291  ? 280.385 286.341 255.443 1.00 0.00 ? 292  LYS L CA 1 
ATOM 7581 C CA . ASP W  23 292  ? 281.889 289.637 254.364 1.00 0.00 ? 293  ASP L CA 1 
ATOM 7582 C CA . VAL W  23 293  ? 280.396 292.991 255.282 1.00 0.00 ? 294  VAL L CA 1 
ATOM 7583 C CA . ASN W  23 294  ? 281.169 296.219 253.488 1.00 0.00 ? 295  ASN L CA 1 
ATOM 7584 C CA . LEU W  23 295  ? 280.100 299.823 253.076 1.00 0.00 ? 296  LEU L CA 1 
ATOM 7585 C CA . ALA W  23 296  ? 281.226 302.114 250.226 1.00 0.00 ? 297  ALA L CA 1 
ATOM 7586 C CA . SER W  23 297  ? 281.105 305.903 250.306 1.00 0.00 ? 298  SER L CA 1 
ATOM 7587 C CA . CYS W  23 298  ? 282.726 309.233 249.507 1.00 0.00 ? 299  CYS L CA 1 
ATOM 7588 C CA . ALA W  23 299  ? 282.088 312.495 247.688 1.00 0.00 ? 300  ALA L CA 1 
ATOM 7589 C CA . ALA W  23 300  ? 284.054 315.720 248.044 1.00 0.00 ? 301  ALA L CA 1 
ATOM 7590 C CA . ASP W  23 301  ? 287.196 313.629 248.383 1.00 0.00 ? 302  ASP L CA 1 
ATOM 7591 C CA . GLY W  23 302  ? 286.731 312.698 244.719 1.00 0.00 ? 303  GLY L CA 1 
ATOM 7592 C CA . SER W  23 303  ? 287.053 309.019 245.542 1.00 0.00 ? 304  SER L CA 1 
ATOM 7593 C CA . VAL W  23 304  ? 284.951 306.123 246.661 1.00 0.00 ? 305  VAL L CA 1 
ATOM 7594 C CA . LYS W  23 305  ? 286.258 303.987 249.467 1.00 0.00 ? 306  LYS L CA 1 
ATOM 7595 C CA . LEU W  23 306  ? 285.242 300.654 250.877 1.00 0.00 ? 307  LEU L CA 1 
ATOM 7596 C CA . TRP W  23 307  ? 285.012 300.006 254.599 1.00 0.00 ? 308  TRP L CA 1 
ATOM 7597 C CA . SER W  23 308  ? 284.507 296.539 256.013 1.00 0.00 ? 309  SER L CA 1 
ATOM 7598 C CA . LEU W  23 309  ? 282.354 296.217 259.073 1.00 0.00 ? 310  LEU L CA 1 
ATOM 7599 C CA . ASP W  23 310  ? 284.491 295.089 261.958 1.00 0.00 ? 311  ASP L CA 1 
ATOM 7600 C CA . SER W  23 311  ? 286.006 296.847 264.955 1.00 0.00 ? 312  SER L CA 1 
ATOM 7601 C CA . ASP W  23 312  ? 288.916 298.503 263.114 1.00 0.00 ? 313  ASP L CA 1 
ATOM 7602 C CA . GLU W  23 313  ? 289.258 300.800 260.112 1.00 0.00 ? 314  GLU L CA 1 
ATOM 7603 C CA . PRO W  23 314  ? 290.196 299.117 256.896 1.00 0.00 ? 315  PRO L CA 1 
ATOM 7604 C CA . VAL W  23 315  ? 289.484 302.180 254.651 1.00 0.00 ? 316  VAL L CA 1 
ATOM 7605 C CA . ALA W  23 316  ? 290.634 301.470 251.111 1.00 0.00 ? 317  ALA L CA 1 
ATOM 7606 C CA . ASP W  23 317  ? 290.371 303.979 248.289 1.00 0.00 ? 318  ASP L CA 1 
ATOM 7607 C CA . ILE W  23 318  ? 288.882 302.110 245.353 1.00 0.00 ? 319  ILE L CA 1 
ATOM 7608 C CA . GLU W  23 319  ? 287.819 304.830 242.932 1.00 0.00 ? 320  GLU L CA 1 
ATOM 7609 C CA . GLY W  23 320  ? 289.505 308.043 242.000 1.00 0.00 ? 321  GLY L CA 1 
ATOM 7610 C CA . HIS W  23 321  ? 287.857 310.654 239.835 1.00 0.00 ? 322  HIS L CA 1 
ATOM 7611 C CA . THR W  23 322  ? 288.990 314.105 238.896 1.00 0.00 ? 323  THR L CA 1 
ATOM 7612 C CA . VAL W  23 323  ? 286.131 315.636 240.851 1.00 0.00 ? 324  VAL L CA 1 
ATOM 7613 C CA . ARG W  23 324  ? 283.326 314.898 243.367 1.00 0.00 ? 325  ARG L CA 1 
ATOM 7614 C CA . VAL W  23 325  ? 281.606 311.550 243.566 1.00 0.00 ? 326  VAL L CA 1 
ATOM 7615 C CA . ALA W  23 326  ? 277.833 311.863 243.272 1.00 0.00 ? 327  ALA L CA 1 
ATOM 7616 C CA . ARG W  23 327  ? 276.840 308.195 243.705 1.00 0.00 ? 328  ARG L CA 1 
ATOM 7617 C CA . VAL W  23 328  ? 278.158 304.679 243.946 1.00 0.00 ? 329  VAL L CA 1 
ATOM 7618 C CA . MET W  23 329  ? 276.876 301.139 244.169 1.00 0.00 ? 330  MET L CA 1 
ATOM 7619 C CA . TRP W  23 330  ? 278.267 297.652 244.414 1.00 0.00 ? 331  TRP L CA 1 
ATOM 7620 C CA . HIS W  23 331  ? 277.819 295.408 241.431 1.00 0.00 ? 332  HIS L CA 1 
ATOM 7621 C CA . PRO W  23 332  ? 276.535 291.877 241.944 1.00 0.00 ? 333  PRO L CA 1 
ATOM 7622 C CA . SER W  23 333  ? 279.472 291.240 244.293 1.00 0.00 ? 334  SER L CA 1 
ATOM 7623 C CA . GLY W  23 334  ? 281.475 292.897 247.034 1.00 0.00 ? 335  GLY L CA 1 
ATOM 7624 C CA . ARG W  23 335  ? 284.382 293.021 244.618 1.00 0.00 ? 336  ARG L CA 1 
ATOM 7625 C CA . PHE W  23 336  ? 283.170 295.584 242.047 1.00 0.00 ? 337  PHE L CA 1 
ATOM 7626 C CA . LEU W  23 337  ? 281.828 299.122 242.406 1.00 0.00 ? 338  LEU L CA 1 
ATOM 7627 C CA . GLY W  23 338  ? 280.180 301.572 240.005 1.00 0.00 ? 339  GLY L CA 1 
ATOM 7628 C CA . THR W  23 339  ? 280.704 305.287 240.541 1.00 0.00 ? 340  THR L CA 1 
ATOM 7629 C CA . THR W  23 340  ? 279.249 308.467 239.090 1.00 0.00 ? 341  THR L CA 1 
ATOM 7630 C CA . CYS W  23 341  ? 280.957 311.838 239.281 1.00 0.00 ? 342  CYS L CA 1 
ATOM 7631 C CA . TYR W  23 342  ? 280.840 315.549 238.679 1.00 0.00 ? 343  TYR L CA 1 
ATOM 7632 C CA . ASP W  23 343  ? 283.755 314.948 236.297 1.00 0.00 ? 344  ASP L CA 1 
ATOM 7633 C CA . ARG W  23 344  ? 280.952 313.827 233.933 1.00 0.00 ? 345  ARG L CA 1 
ATOM 7634 C CA . SER W  23 345  ? 281.856 310.143 233.877 1.00 0.00 ? 346  SER L CA 1 
ATOM 7635 C CA . TRP W  23 346  ? 280.699 306.891 235.416 1.00 0.00 ? 347  TRP L CA 1 
ATOM 7636 C CA . ARG W  23 347  ? 283.258 304.150 236.023 1.00 0.00 ? 348  ARG L CA 1 
ATOM 7637 C CA . LEU W  23 348  ? 283.375 300.515 237.088 1.00 0.00 ? 349  LEU L CA 1 
ATOM 7638 C CA . TRP W  23 349  ? 286.182 299.571 239.439 1.00 0.00 ? 350  TRP L CA 1 
ATOM 7639 C CA . ASP W  23 350  ? 287.851 296.516 240.917 1.00 0.00 ? 351  ASP L CA 1 
ATOM 7640 C CA . LEU W  23 351  ? 287.744 296.810 244.706 1.00 0.00 ? 352  LEU L CA 1 
ATOM 7641 C CA . GLU W  23 352  ? 290.869 294.800 245.519 1.00 0.00 ? 353  GLU L CA 1 
ATOM 7642 C CA . ALA W  23 353  ? 293.006 296.246 242.715 1.00 0.00 ? 354  ALA L CA 1 
ATOM 7643 C CA . GLN W  23 354  ? 291.474 299.761 242.675 1.00 0.00 ? 355  GLN L CA 1 
ATOM 7644 C CA . GLU W  23 355  ? 291.861 299.135 238.927 1.00 0.00 ? 356  GLU L CA 1 
ATOM 7645 C CA . GLU W  23 356  ? 289.464 301.007 236.684 1.00 0.00 ? 357  GLU L CA 1 
ATOM 7646 C CA . ILE W  23 357  ? 287.740 298.428 234.537 1.00 0.00 ? 358  ILE L CA 1 
ATOM 7647 C CA . LEU W  23 358  ? 285.656 300.733 232.397 1.00 0.00 ? 359  LEU L CA 1 
ATOM 7648 C CA . HIS W  23 359  ? 284.801 304.381 232.037 1.00 0.00 ? 360  HIS L CA 1 
ATOM 7649 C CA . GLN W  23 360  ? 281.478 305.605 230.694 1.00 0.00 ? 361  GLN L CA 1 
ATOM 7650 C CA . GLU W  23 361  ? 281.683 308.819 228.674 1.00 0.00 ? 362  GLU L CA 1 
ATOM 7651 C CA . GLY W  23 362  ? 278.805 310.595 227.005 1.00 0.00 ? 363  GLY L CA 1 
ATOM 7652 C CA . HIS W  23 363  ? 277.215 312.825 229.629 1.00 0.00 ? 364  HIS L CA 1 
ATOM 7653 C CA . SER W  23 364  ? 277.915 316.416 228.672 1.00 0.00 ? 365  SER L CA 1 
ATOM 7654 C CA . MET W  23 365  ? 277.806 317.335 232.344 1.00 0.00 ? 366  MET L CA 1 
ATOM 7655 C CA . GLY W  23 366  ? 278.255 316.262 235.943 1.00 0.00 ? 367  GLY L CA 1 
ATOM 7656 C CA . VAL W  23 367  ? 276.488 313.024 236.621 1.00 0.00 ? 368  VAL L CA 1 
ATOM 7657 C CA . TYR W  23 368  ? 274.194 312.878 239.650 1.00 0.00 ? 369  TYR L CA 1 
ATOM 7658 C CA . ASP W  23 369  ? 272.886 309.358 239.935 1.00 0.00 ? 370  ASP L CA 1 
ATOM 7659 C CA . ILE W  23 370  ? 273.004 305.744 238.797 1.00 0.00 ? 371  ILE L CA 1 
ATOM 7660 C CA . ALA W  23 371  ? 271.110 302.473 239.248 1.00 0.00 ? 372  ALA L CA 1 
ATOM 7661 C CA . PHE W  23 372  ? 272.144 298.929 238.404 1.00 0.00 ? 373  PHE L CA 1 
ATOM 7662 C CA . HIS W  23 373  ? 270.684 295.395 238.355 1.00 0.00 ? 374  HIS L CA 1 
ATOM 7663 C CA . GLN W  23 374  ? 272.103 292.099 239.582 1.00 0.00 ? 375  GLN L CA 1 
ATOM 7664 C CA . ASP W  23 375  ? 271.126 290.243 236.434 1.00 0.00 ? 376  ASP L CA 1 
ATOM 7665 C CA . GLY W  23 376  ? 272.574 291.835 233.359 1.00 0.00 ? 377  GLY L CA 1 
ATOM 7666 C CA . SER W  23 377  ? 275.389 294.086 232.366 1.00 0.00 ? 378  SER L CA 1 
ATOM 7667 C CA . LEU W  23 378  ? 273.315 297.227 232.223 1.00 0.00 ? 379  LEU L CA 1 
ATOM 7668 C CA . ALA W  23 379  ? 272.995 300.356 234.311 1.00 0.00 ? 380  ALA L CA 1 
ATOM 7669 C CA . GLY W  23 380  ? 271.295 303.726 234.029 1.00 0.00 ? 381  GLY L CA 1 
ATOM 7670 C CA . THR W  23 381  ? 272.646 307.134 234.974 1.00 0.00 ? 382  THR L CA 1 
ATOM 7671 C CA . GLY W  23 382  ? 271.356 310.664 234.951 1.00 0.00 ? 383  GLY L CA 1 
ATOM 7672 C CA . GLY W  23 383  ? 272.900 314.103 235.094 1.00 0.00 ? 384  GLY L CA 1 
ATOM 7673 C CA . LEU W  23 384  ? 273.109 317.830 234.321 1.00 0.00 ? 385  LEU L CA 1 
ATOM 7674 C CA . ASP W  23 385  ? 272.919 317.126 230.542 1.00 0.00 ? 386  ASP L CA 1 
ATOM 7675 C CA . ALA W  23 386  ? 269.261 316.477 231.480 1.00 0.00 ? 387  ALA L CA 1 
ATOM 7676 C CA . PHE W  23 387  ? 269.587 313.023 229.945 1.00 0.00 ? 388  PHE L CA 1 
ATOM 7677 C CA . GLY W  23 388  ? 269.366 309.558 231.394 1.00 0.00 ? 389  GLY L CA 1 
ATOM 7678 C CA . ARG W  23 389  ? 271.595 307.048 229.641 1.00 0.00 ? 390  ARG L CA 1 
ATOM 7679 C CA . VAL W  23 390  ? 271.636 303.275 229.704 1.00 0.00 ? 391  VAL L CA 1 
ATOM 7680 C CA . TRP W  23 391  ? 275.096 301.740 229.434 1.00 0.00 ? 392  TRP L CA 1 
ATOM 7681 C CA . ASP W  23 392  ? 276.505 298.362 228.549 1.00 0.00 ? 393  ASP L CA 1 
ATOM 7682 C CA . LEU W  23 393  ? 279.142 297.618 231.157 1.00 0.00 ? 394  LEU L CA 1 
ATOM 7683 C CA . ARG W  23 394  ? 281.197 295.373 228.898 1.00 0.00 ? 395  ARG L CA 1 
ATOM 7684 C CA . THR W  23 395  ? 281.370 297.811 225.981 1.00 0.00 ? 396  THR L CA 1 
ATOM 7685 C CA . GLY W  23 396  ? 281.272 301.144 227.810 1.00 0.00 ? 397  GLY L CA 1 
ATOM 7686 C CA . ARG W  23 397  ? 278.919 302.467 225.189 1.00 0.00 ? 398  ARG L CA 1 
ATOM 7687 C CA . CYS W  23 398  ? 275.506 303.978 225.792 1.00 0.00 ? 399  CYS L CA 1 
ATOM 7688 C CA . ILE W  23 399  ? 272.810 301.734 224.355 1.00 0.00 ? 400  ILE L CA 1 
ATOM 7689 C CA . MET W  23 400  ? 269.914 304.169 224.747 1.00 0.00 ? 401  MET L CA 1 
ATOM 7690 C CA . PHE W  23 401  ? 269.553 307.726 225.895 1.00 0.00 ? 402  PHE L CA 1 
ATOM 7691 C CA . LEU W  23 402  ? 266.502 309.602 227.041 1.00 0.00 ? 403  LEU L CA 1 
ATOM 7692 C CA . GLU W  23 403  ? 265.914 313.303 226.855 1.00 0.00 ? 404  GLU L CA 1 
ATOM 7693 C CA . GLY W  23 404  ? 262.694 315.002 227.763 1.00 0.00 ? 405  GLY L CA 1 
ATOM 7694 C CA . HIS W  23 405  ? 263.473 316.390 231.201 1.00 0.00 ? 406  HIS L CA 1 
ATOM 7695 C CA . LEU W  23 406  ? 263.528 320.186 231.305 1.00 0.00 ? 407  LEU L CA 1 
ATOM 7696 C CA . LYS W  23 407  ? 266.237 320.253 233.992 1.00 0.00 ? 408  LYS L CA 1 
ATOM 7697 C CA . GLU W  23 408  ? 268.964 318.146 235.554 1.00 0.00 ? 409  GLU L CA 1 
ATOM 7698 C CA . ILE W  23 409  ? 268.116 314.590 236.443 1.00 0.00 ? 410  ILE L CA 1 
ATOM 7699 C CA . TYR W  23 410  ? 268.785 314.009 240.124 1.00 0.00 ? 411  TYR L CA 1 
ATOM 7700 C CA . GLY W  23 411  ? 267.631 310.405 240.497 1.00 0.00 ? 412  GLY L CA 1 
ATOM 7701 C CA . ILE W  23 412  ? 267.219 307.243 238.400 1.00 0.00 ? 413  ILE L CA 1 
ATOM 7702 C CA . ASN W  23 413  ? 265.767 303.897 239.395 1.00 0.00 ? 414  ASN L CA 1 
ATOM 7703 C CA . PHE W  23 414  ? 264.804 300.792 237.497 1.00 0.00 ? 415  PHE L CA 1 
ATOM 7704 C CA . SER W  23 415  ? 261.361 299.403 237.833 1.00 0.00 ? 416  SER L CA 1 
ATOM 7705 C CA . PRO W  23 416  ? 261.495 295.935 239.370 1.00 0.00 ? 417  PRO L CA 1 
ATOM 7706 C CA . ASN W  23 417  ? 261.117 294.097 236.030 1.00 0.00 ? 418  ASN L CA 1 
ATOM 7707 C CA . GLY W  23 418  ? 264.110 295.930 234.624 1.00 0.00 ? 419  GLY L CA 1 
ATOM 7708 C CA . TYR W  23 419  ? 262.002 296.765 231.560 1.00 0.00 ? 420  TYR L CA 1 
ATOM 7709 C CA . HIS W  23 420  ? 261.508 300.391 232.568 1.00 0.00 ? 421  HIS L CA 1 
ATOM 7710 C CA . ILE W  23 421  ? 263.055 303.037 234.789 1.00 0.00 ? 422  ILE L CA 1 
ATOM 7711 C CA . ALA W  23 422  ? 261.938 306.203 236.475 1.00 0.00 ? 423  ALA L CA 1 
ATOM 7712 C CA . THR W  23 423  ? 263.737 309.427 236.967 1.00 0.00 ? 424  THR L CA 1 
ATOM 7713 C CA . GLY W  23 424  ? 263.327 312.467 239.175 1.00 0.00 ? 425  GLY L CA 1 
ATOM 7714 C CA . SER W  23 425  ? 264.408 315.902 238.032 1.00 0.00 ? 426  SER L CA 1 
ATOM 7715 C CA . GLY W  23 426  ? 264.972 319.475 239.076 1.00 0.00 ? 427  GLY L CA 1 
ATOM 7716 C CA . ASP W  23 427  ? 262.165 320.356 236.738 1.00 0.00 ? 428  ASP L CA 1 
ATOM 7717 C CA . ASN W  23 428  ? 259.913 318.994 239.545 1.00 0.00 ? 429  ASN L CA 1 
ATOM 7718 C CA . THR W  23 429  ? 258.712 316.034 237.528 1.00 0.00 ? 430  THR L CA 1 
ATOM 7719 C CA . CYS W  23 430  ? 259.247 312.321 237.686 1.00 0.00 ? 431  CYS L CA 1 
ATOM 7720 C CA . LYS W  23 431  ? 259.040 310.353 234.460 1.00 0.00 ? 432  LYS L CA 1 
ATOM 7721 C CA . VAL W  23 432  ? 258.809 306.696 233.564 1.00 0.00 ? 433  VAL L CA 1 
ATOM 7722 C CA . TRP W  23 433  ? 260.529 305.325 230.503 1.00 0.00 ? 434  TRP L CA 1 
ATOM 7723 C CA . ASP W  23 434  ? 259.778 302.046 228.794 1.00 0.00 ? 435  ASP L CA 1 
ATOM 7724 C CA . LEU W  23 435  ? 263.021 300.404 227.637 1.00 0.00 ? 436  LEU L CA 1 
ATOM 7725 C CA . ARG W  23 436  ? 261.371 297.893 225.304 1.00 0.00 ? 437  ARG L CA 1 
ATOM 7726 C CA . GLN W  23 437  ? 259.215 300.496 223.528 1.00 0.00 ? 438  GLN L CA 1 
ATOM 7727 C CA . ARG W  23 438  ? 262.031 303.015 224.045 1.00 0.00 ? 439  ARG L CA 1 
ATOM 7728 C CA . ARG W  23 439  ? 259.698 305.897 224.891 1.00 0.00 ? 440  ARG L CA 1 
ATOM 7729 C CA . CYS W  23 440  ? 258.622 307.798 227.966 1.00 0.00 ? 441  CYS L CA 1 
ATOM 7730 C CA . VAL W  23 441  ? 255.214 306.600 229.002 1.00 0.00 ? 442  VAL L CA 1 
ATOM 7731 C CA . TYR W  23 442  ? 254.512 308.550 232.142 1.00 0.00 ? 443  TYR L CA 1 
ATOM 7732 C CA . THR W  23 443  ? 255.059 311.974 233.587 1.00 0.00 ? 444  THR L CA 1 
ATOM 7733 C CA . ILE W  23 444  ? 254.086 312.801 237.096 1.00 0.00 ? 445  ILE L CA 1 
ATOM 7734 C CA . PRO W  23 445  ? 253.527 316.474 237.623 1.00 0.00 ? 446  PRO L CA 1 
ATOM 7735 C CA . ALA W  23 446  ? 252.263 318.584 240.547 1.00 0.00 ? 447  ALA L CA 1 
ATOM 7736 C CA . HIS W  23 447  ? 254.183 320.980 242.854 1.00 0.00 ? 448  HIS L CA 1 
ATOM 7737 C CA . GLN W  23 448  ? 257.026 322.729 241.124 1.00 0.00 ? 449  GLN L CA 1 
ATOM 7738 C CA . ASN W  23 449  ? 259.747 321.554 243.513 1.00 0.00 ? 450  ASN L CA 1 
ATOM 7739 C CA . LEU W  23 450  ? 262.879 319.621 242.473 1.00 0.00 ? 451  LEU L CA 1 
ATOM 7740 C CA . VAL W  23 451  ? 262.713 315.846 242.917 1.00 0.00 ? 452  VAL L CA 1 
ATOM 7741 C CA . THR W  23 452  ? 265.886 314.665 244.618 1.00 0.00 ? 453  THR L CA 1 
ATOM 7742 C CA . GLY W  23 453  ? 265.242 310.912 244.676 1.00 0.00 ? 454  GLY L CA 1 
ATOM 7743 C CA . VAL W  23 454  ? 262.792 308.247 243.583 1.00 0.00 ? 455  VAL L CA 1 
ATOM 7744 C CA . LYS W  23 455  ? 262.189 304.564 244.259 1.00 0.00 ? 456  LYS L CA 1 
ATOM 7745 C CA . PHE W  23 456  ? 259.462 302.012 243.614 1.00 0.00 ? 457  PHE L CA 1 
ATOM 7746 C CA . GLU W  23 457  ? 257.468 299.730 245.833 1.00 0.00 ? 458  GLU L CA 1 
ATOM 7747 C CA . PRO W  23 458  ? 259.185 296.417 245.355 1.00 0.00 ? 459  PRO L CA 1 
ATOM 7748 C CA . ILE W  23 459  ? 255.892 294.601 245.666 1.00 0.00 ? 460  ILE L CA 1 
ATOM 7749 C CA . HIS W  23 460  ? 254.903 295.602 242.173 1.00 0.00 ? 461  HIS L CA 1 
ATOM 7750 C CA . GLY W  23 461  ? 256.515 298.876 241.188 1.00 0.00 ? 462  GLY L CA 1 
ATOM 7751 C CA . ASN W  23 462  ? 252.998 300.273 241.470 1.00 0.00 ? 463  ASN L CA 1 
ATOM 7752 C CA . PHE W  23 463  ? 254.082 303.167 243.611 1.00 0.00 ? 464  PHE L CA 1 
ATOM 7753 C CA . LEU W  23 464  ? 256.849 305.635 243.055 1.00 0.00 ? 465  LEU L CA 1 
ATOM 7754 C CA . LEU W  23 465  ? 257.971 307.525 246.110 1.00 0.00 ? 466  LEU L CA 1 
ATOM 7755 C CA . THR W  23 466  ? 259.860 310.718 245.554 1.00 0.00 ? 467  THR L CA 1 
ATOM 7756 C CA . GLY W  23 467  ? 261.524 313.193 247.865 1.00 0.00 ? 468  GLY L CA 1 
ATOM 7757 C CA . ALA W  23 468  ? 261.519 316.875 247.039 1.00 0.00 ? 469  ALA L CA 1 
ATOM 7758 C CA . TYR W  23 469  ? 263.290 320.140 247.681 1.00 0.00 ? 470  TYR L CA 1 
ATOM 7759 C CA . ASP W  23 470  ? 260.138 321.461 249.335 1.00 0.00 ? 471  ASP L CA 1 
ATOM 7760 C CA . ASN W  23 471  ? 260.698 319.060 252.254 1.00 0.00 ? 472  ASN L CA 1 
ATOM 7761 C CA . THR W  23 472  ? 257.857 316.824 251.137 1.00 0.00 ? 473  THR L CA 1 
ATOM 7762 C CA . ALA W  23 473  ? 257.492 313.338 249.793 1.00 0.00 ? 474  ALA L CA 1 
ATOM 7763 C CA . LYS W  23 474  ? 255.020 312.707 247.041 1.00 0.00 ? 475  LYS L CA 1 
ATOM 7764 C CA . ILE W  23 475  ? 253.791 309.268 246.187 1.00 0.00 ? 476  ILE L CA 1 
ATOM 7765 C CA . TRP W  23 476  ? 252.775 308.670 242.640 1.00 0.00 ? 477  TRP L CA 1 
ATOM 7766 C CA . THR W  23 477  ? 250.745 305.906 241.203 1.00 0.00 ? 478  THR L CA 1 
ATOM 7767 C CA . HIS W  23 478  ? 252.943 304.582 238.474 1.00 0.00 ? 479  HIS L CA 1 
ATOM 7768 C CA . PRO W  23 479  ? 249.860 302.994 236.913 1.00 0.00 ? 480  PRO L CA 1 
ATOM 7769 C CA . GLY W  23 480  ? 247.478 305.899 237.849 1.00 0.00 ? 481  GLY L CA 1 
ATOM 7770 C CA . TRP W  23 481  ? 249.398 308.599 236.951 1.00 0.00 ? 482  TRP L CA 1 
ATOM 7771 C CA . SER W  23 482  ? 247.839 310.589 239.693 1.00 0.00 ? 483  SER L CA 1 
ATOM 7772 C CA . PRO W  23 483  ? 249.511 311.606 242.895 1.00 0.00 ? 484  PRO L CA 1 
ATOM 7773 C CA . LEU W  23 484  ? 248.420 309.346 245.700 1.00 0.00 ? 485  LEU L CA 1 
ATOM 7774 C CA . LYS W  23 485  ? 249.389 311.759 248.447 1.00 0.00 ? 486  LYS L CA 1 
ATOM 7775 C CA . THR W  23 486  ? 251.881 314.137 249.932 1.00 0.00 ? 487  THR L CA 1 
ATOM 7776 C CA . LEU W  23 487  ? 253.736 313.322 253.109 1.00 0.00 ? 488  LEU L CA 1 
ATOM 7777 C CA . ALA W  23 488  ? 254.954 315.980 255.481 1.00 0.00 ? 489  ALA L CA 1 
ATOM 7778 C CA . GLY W  23 489  ? 257.194 315.833 258.499 1.00 0.00 ? 490  GLY L CA 1 
ATOM 7779 C CA . HIS W  23 490  ? 260.740 316.664 257.365 1.00 0.00 ? 491  HIS L CA 1 
ATOM 7780 C CA . GLU W  23 491  ? 262.061 320.064 258.400 1.00 0.00 ? 492  GLU L CA 1 
ATOM 7781 C CA . GLY W  23 492  ? 264.356 320.372 255.363 1.00 0.00 ? 493  GLY L CA 1 
ATOM 7782 C CA . LYS W  23 493  ? 264.782 319.004 251.847 1.00 0.00 ? 494  LYS L CA 1 
ATOM 7783 C CA . VAL W  23 494  ? 264.405 315.288 251.364 1.00 0.00 ? 495  VAL L CA 1 
ATOM 7784 C CA . MET W  23 495  ? 267.745 314.343 249.807 1.00 0.00 ? 496  MET L CA 1 
ATOM 7785 C CA . GLY W  23 496  ? 267.390 310.562 249.508 1.00 0.00 ? 497  GLY L CA 1 
ATOM 7786 C CA . LEU W  23 497  ? 264.717 307.900 249.542 1.00 0.00 ? 498  LEU L CA 1 
ATOM 7787 C CA . ASP W  23 498  ? 264.873 304.171 249.116 1.00 0.00 ? 499  ASP L CA 1 
ATOM 7788 C CA . ILE W  23 499  ? 262.380 301.389 249.602 1.00 0.00 ? 500  ILE L CA 1 
ATOM 7789 C CA . SER W  23 500  ? 263.416 298.519 251.855 1.00 0.00 ? 501  SER L CA 1 
ATOM 7790 C CA . SER W  23 501  ? 264.616 295.192 250.446 1.00 0.00 ? 502  SER L CA 1 
ATOM 7791 C CA . ASP W  23 502  ? 261.484 293.323 251.564 1.00 0.00 ? 503  ASP L CA 1 
ATOM 7792 C CA . GLY W  23 503  ? 259.250 296.196 250.462 1.00 0.00 ? 504  GLY L CA 1 
ATOM 7793 C CA . GLN W  23 504  ? 257.792 296.582 253.909 1.00 0.00 ? 505  GLN L CA 1 
ATOM 7794 C CA . LEU W  23 505  ? 258.906 300.193 254.327 1.00 0.00 ? 506  LEU L CA 1 
ATOM 7795 C CA . ILE W  23 506  ? 260.823 303.103 252.844 1.00 0.00 ? 507  ILE L CA 1 
ATOM 7796 C CA . ALA W  23 507  ? 263.450 305.390 254.300 1.00 0.00 ? 508  ALA L CA 1 
ATOM 7797 C CA . THR W  23 508  ? 263.825 309.060 253.607 1.00 0.00 ? 509  THR L CA 1 
ATOM 7798 C CA . CYS W  23 509  ? 266.876 311.119 254.490 1.00 0.00 ? 510  CYS L CA 1 
ATOM 7799 C CA . SER W  23 510  ? 266.777 314.861 254.922 1.00 0.00 ? 511  SER L CA 1 
ATOM 7800 C CA . TYR W  23 511  ? 268.685 318.095 255.244 1.00 0.00 ? 512  TYR L CA 1 
ATOM 7801 C CA . ASP W  23 512  ? 266.978 318.274 258.643 1.00 0.00 ? 513  ASP L CA 1 
ATOM 7802 C CA . ARG W  23 513  ? 269.748 315.798 259.639 1.00 0.00 ? 514  ARG L CA 1 
ATOM 7803 C CA . THR W  23 514  ? 267.321 312.948 260.283 1.00 0.00 ? 515  THR L CA 1 
ATOM 7804 C CA . PHE W  23 515  ? 266.168 309.795 258.566 1.00 0.00 ? 516  PHE L CA 1 
ATOM 7805 C CA . LYS W  23 516  ? 262.649 308.484 258.749 1.00 0.00 ? 517  LYS L CA 1 
ATOM 7806 C CA . LEU W  23 517  ? 261.260 305.043 258.096 1.00 0.00 ? 518  LEU L CA 1 
ATOM 7807 C CA . TRP W  23 518  ? 257.735 304.996 256.846 1.00 0.00 ? 519  TRP L CA 1 
ATOM 7808 C CA . MET W  23 519  ? 255.447 302.003 256.776 1.00 0.00 ? 520  MET L CA 1 
ATOM 7809 C CA . ALA W  23 520  ? 251.763 301.210 256.507 1.00 0.00 ? 521  ALA L CA 1 
ATOM 7810 C CA . GLU W  23 521  ? 249.415 298.838 258.226 1.00 0.00 ? 522  GLU L CA 1 
ATOM 7811 C CA . GLU X  24 85   ? 242.182 292.822 243.464 1.00 0.00 ? 85   GLU J CA 1 
ATOM 7812 C CA . ALA X  24 86   ? 239.254 295.121 244.396 1.00 0.00 ? 86   ALA J CA 1 
ATOM 7813 C CA . ALA X  24 87   ? 235.929 293.814 243.021 1.00 0.00 ? 87   ALA J CA 1 
ATOM 7814 C CA . PRO X  24 88   ? 237.270 291.166 240.566 1.00 0.00 ? 88   PRO J CA 1 
ATOM 7815 C CA . GLU X  24 89   ? 235.086 290.212 237.592 1.00 0.00 ? 89   GLU J CA 1 
ATOM 7816 C CA . TYR X  24 90   ? 234.916 286.466 238.253 1.00 0.00 ? 90   TYR J CA 1 
ATOM 7817 C CA . ARG X  24 91   ? 232.759 287.043 241.319 1.00 0.00 ? 91   ARG J CA 1 
ATOM 7818 C CA . VAL X  24 92   ? 230.136 288.933 239.307 1.00 0.00 ? 92   VAL J CA 1 
ATOM 7819 C CA . ILE X  24 93   ? 230.010 286.163 236.746 1.00 0.00 ? 93   ILE J CA 1 
ATOM 7820 C CA . VAL X  24 94   ? 229.883 283.454 239.445 1.00 0.00 ? 94   VAL J CA 1 
ATOM 7821 C CA . ASP X  24 95   ? 226.858 285.097 240.971 1.00 0.00 ? 95   ASP J CA 1 
ATOM 7822 C CA . ALA X  24 96   ? 225.187 285.701 237.574 1.00 0.00 ? 96   ALA J CA 1 
ATOM 7823 C CA . ASN X  24 97   ? 225.664 282.061 236.789 1.00 0.00 ? 97   ASN J CA 1 
ATOM 7824 C CA . ASN X  24 98   ? 224.112 281.235 240.093 1.00 0.00 ? 98   ASN J CA 1 
ATOM 7825 C CA . LEU X  24 99   ? 220.947 283.136 239.178 1.00 0.00 ? 99   LEU J CA 1 
ATOM 7826 C CA . THR X  24 100  ? 220.269 280.771 236.271 1.00 0.00 ? 100  THR J CA 1 
ATOM 7827 C CA . VAL X  24 101  ? 220.394 277.980 238.832 1.00 0.00 ? 101  VAL J CA 1 
ATOM 7828 C CA . GLU X  24 102  ? 217.841 279.815 240.974 1.00 0.00 ? 102  GLU J CA 1 
ATOM 7829 C CA . ILE X  24 103  ? 215.842 280.498 237.789 1.00 0.00 ? 103  ILE J CA 1 
ATOM 7830 C CA . GLU X  24 104  ? 215.741 276.757 236.926 1.00 0.00 ? 104  GLU J CA 1 
ATOM 7831 C CA . ASN X  24 105  ? 214.521 275.955 240.445 1.00 0.00 ? 105  ASN J CA 1 
ATOM 7832 C CA . GLU X  24 106  ? 211.645 278.427 240.068 1.00 0.00 ? 106  GLU J CA 1 
ATOM 7833 C CA . LEU X  24 107  ? 210.977 277.222 236.565 1.00 0.00 ? 107  LEU J CA 1 
ATOM 7834 C CA . ASN X  24 108  ? 210.217 273.690 237.594 1.00 0.00 ? 108  ASN J CA 1 
ATOM 7835 C CA . ILE X  24 109  ? 208.322 274.650 240.692 1.00 0.00 ? 109  ILE J CA 1 
ATOM 7836 C CA . ILE X  24 110  ? 206.130 276.578 238.225 1.00 0.00 ? 110  ILE J CA 1 
ATOM 7837 C CA . HIS X  24 111  ? 205.941 273.566 235.900 1.00 0.00 ? 111  HIS J CA 1 
ATOM 7838 C CA . LYS X  24 112  ? 204.841 271.401 238.859 1.00 0.00 ? 112  LYS J CA 1 
ATOM 7839 C CA . PHE X  24 113  ? 202.290 274.000 239.774 1.00 0.00 ? 113  PHE J CA 1 
ATOM 7840 C CA . ILE X  24 114  ? 200.928 274.395 236.249 1.00 0.00 ? 114  ILE J CA 1 
ATOM 7841 C CA . ARG X  24 115  ? 200.707 270.638 235.692 1.00 0.00 ? 115  ARG J CA 1 
ATOM 7842 C CA . ASP X  24 116  ? 198.849 270.281 239.003 1.00 0.00 ? 116  ASP J CA 1 
ATOM 7843 C CA . LYS X  24 117  ? 196.298 273.026 238.247 1.00 0.00 ? 117  LYS J CA 1 
ATOM 7844 C CA . TYR X  24 118  ? 195.748 272.200 234.580 1.00 0.00 ? 118  TYR J CA 1 
ATOM 7845 C CA . SER X  24 119  ? 195.092 268.561 235.590 1.00 0.00 ? 119  SER J CA 1 
ATOM 7846 C CA . LYS X  24 120  ? 191.550 269.650 236.582 1.00 0.00 ? 120  LYS J CA 1 
ATOM 7847 C CA . ARG X  24 121  ? 190.924 270.491 232.931 1.00 0.00 ? 121  ARG J CA 1 
ATOM 7848 C CA . PHE X  24 122  ? 192.859 267.892 230.984 1.00 0.00 ? 122  PHE J CA 1 
ATOM 7849 C CA . PRO X  24 123  ? 194.430 265.322 233.329 1.00 0.00 ? 123  PRO J CA 1 
ATOM 7850 C CA . GLU X  24 124  ? 195.869 263.237 230.501 1.00 0.00 ? 124  GLU J CA 1 
ATOM 7851 C CA . LEU X  24 125  ? 197.878 265.992 228.831 1.00 0.00 ? 125  LEU J CA 1 
ATOM 7852 C CA . GLU X  24 126  ? 200.843 265.734 231.181 1.00 0.00 ? 126  GLU J CA 1 
ATOM 7853 C CA . SER X  24 127  ? 201.714 262.142 230.126 1.00 0.00 ? 127  SER J CA 1 
ATOM 7854 C CA . LEU X  24 128  ? 201.335 262.998 226.420 1.00 0.00 ? 128  LEU J CA 1 
ATOM 7855 C CA . VAL X  24 129  ? 203.582 266.084 226.647 1.00 0.00 ? 129  VAL J CA 1 
ATOM 7856 C CA . PRO X  24 130  ? 206.460 265.264 229.062 1.00 0.00 ? 130  PRO J CA 1 
ATOM 7857 C CA . ASN X  24 131  ? 208.742 268.239 228.167 1.00 0.00 ? 131  ASN J CA 1 
ATOM 7858 C CA . ALA X  24 132  ? 208.103 271.204 230.505 1.00 0.00 ? 132  ALA J CA 1 
ATOM 7859 C CA . LEU X  24 133  ? 208.274 274.032 227.956 1.00 0.00 ? 133  LEU J CA 1 
ATOM 7860 C CA . ASP X  24 134  ? 206.092 272.286 225.412 1.00 0.00 ? 134  ASP J CA 1 
ATOM 7861 C CA . TYR X  24 135  ? 203.543 271.525 228.103 1.00 0.00 ? 135  TYR J CA 1 
ATOM 7862 C CA . ILE X  24 136  ? 203.404 275.090 229.388 1.00 0.00 ? 136  ILE J CA 1 
ATOM 7863 C CA . ARG X  24 137  ? 203.158 276.419 225.839 1.00 0.00 ? 137  ARG J CA 1 
ATOM 7864 C CA . THR X  24 138  ? 200.352 273.926 225.191 1.00 0.00 ? 138  THR J CA 1 
ATOM 7865 C CA . VAL X  24 139  ? 198.182 274.813 228.198 1.00 0.00 ? 139  VAL J CA 1 
ATOM 7866 C CA . LYS X  24 140  ? 198.725 278.475 227.383 1.00 0.00 ? 140  LYS J CA 1 
ATOM 7867 C CA . GLU X  24 141  ? 197.586 277.785 223.821 1.00 0.00 ? 141  GLU J CA 1 
ATOM 7868 C CA . LEU X  24 142  ? 194.528 275.633 224.714 1.00 0.00 ? 142  LEU J CA 1 
ATOM 7869 C CA . GLY X  24 143  ? 193.111 277.126 227.953 1.00 0.00 ? 143  GLY J CA 1 
ATOM 7870 C CA . ASN X  24 144  ? 189.562 275.875 228.538 1.00 0.00 ? 144  ASN J CA 1 
ATOM 7871 C CA . SER X  24 145  ? 188.808 275.260 224.883 1.00 0.00 ? 145  SER J CA 1 
ATOM 7872 C CA . LEU X  24 146  ? 190.121 271.792 223.981 1.00 0.00 ? 146  LEU J CA 1 
ATOM 7873 C CA . ASP X  24 147  ? 188.691 271.928 220.463 1.00 0.00 ? 147  ASP J CA 1 
ATOM 7874 C CA . LYS X  24 148  ? 191.374 274.438 219.565 1.00 0.00 ? 148  LYS J CA 1 
ATOM 7875 C CA . CYS X  24 149  ? 193.297 271.215 218.762 1.00 0.00 ? 149  CYS J CA 1 
ATOM 7876 C CA . LYS X  24 150  ? 192.198 270.708 215.168 1.00 0.00 ? 150  LYS J CA 1 
ATOM 7877 C CA . ASN X  24 151  ? 194.044 272.685 212.472 1.00 0.00 ? 151  ASN J CA 1 
ATOM 7878 C CA . ASN X  24 152  ? 195.706 275.094 214.907 1.00 0.00 ? 152  ASN J CA 1 
ATOM 7879 C CA . GLU X  24 153  ? 198.733 276.772 213.337 1.00 0.00 ? 153  GLU J CA 1 
ATOM 7880 C CA . ASN X  24 154  ? 200.045 277.955 216.713 1.00 0.00 ? 154  ASN J CA 1 
ATOM 7881 C CA . LEU X  24 155  ? 199.796 274.413 218.119 1.00 0.00 ? 155  LEU J CA 1 
ATOM 7882 C CA . GLN X  24 156  ? 201.871 273.131 215.186 1.00 0.00 ? 156  GLN J CA 1 
ATOM 7883 C CA . GLN X  24 157  ? 204.704 275.368 216.420 1.00 0.00 ? 157  GLN J CA 1 
ATOM 7884 C CA . ILE X  24 158  ? 204.731 273.528 219.748 1.00 0.00 ? 158  ILE J CA 1 
ATOM 7885 C CA . LEU X  24 159  ? 203.786 269.903 219.117 1.00 0.00 ? 159  LEU J CA 1 
ATOM 7886 C CA . THR X  24 160  ? 204.530 267.167 216.582 1.00 0.00 ? 160  THR J CA 1 
ATOM 7887 C CA . ASN X  24 161  ? 201.656 266.711 214.159 1.00 0.00 ? 161  ASN J CA 1 
ATOM 7888 C CA . ALA X  24 162  ? 201.497 263.068 215.309 1.00 0.00 ? 162  ALA J CA 1 
ATOM 7889 C CA . THR X  24 163  ? 201.320 264.042 218.989 1.00 0.00 ? 163  THR J CA 1 
ATOM 7890 C CA . ILE X  24 164  ? 198.735 266.730 218.153 1.00 0.00 ? 164  ILE J CA 1 
ATOM 7891 C CA . MET X  24 165  ? 196.269 264.089 216.851 1.00 0.00 ? 165  MET J CA 1 
ATOM 7892 C CA . VAL X  24 166  ? 196.941 261.780 219.813 1.00 0.00 ? 166  VAL J CA 1 
ATOM 7893 C CA . VAL X  24 167  ? 196.019 264.680 222.220 1.00 0.00 ? 167  VAL J CA 1 
ATOM 7894 C CA . SER X  24 168  ? 193.075 265.707 220.013 1.00 0.00 ? 168  SER J CA 1 
ATOM 7895 C CA . VAL X  24 169  ? 191.771 262.112 220.329 1.00 0.00 ? 169  VAL J CA 1 
ATOM 7896 C CA . THR X  24 170  ? 192.424 262.028 224.065 1.00 0.00 ? 170  THR J CA 1 
ATOM 7897 C CA . ALA X  24 171  ? 190.724 265.453 224.360 1.00 0.00 ? 171  ALA J CA 1 
ATOM 7898 C CA . SER X  24 172  ? 187.117 264.284 223.673 1.00 0.00 ? 172  SER J CA 1 
ATOM 7899 C CA . THR X  24 173  ? 187.279 261.144 225.884 1.00 0.00 ? 173  THR J CA 1 
ATOM 7900 C CA . THR X  24 174  ? 188.406 263.451 228.621 1.00 0.00 ? 174  THR J CA 1 
ATOM 7901 C CA . GLN X  24 175  ? 187.371 263.250 232.326 1.00 0.00 ? 175  GLN J CA 1 
ATOM 7902 C CA . GLY X  24 176  ? 188.449 266.771 233.429 1.00 0.00 ? 176  GLY J CA 1 
ATOM 7903 C CA . GLN X  24 177  ? 186.087 269.742 233.448 1.00 0.00 ? 177  GLN J CA 1 
ATOM 7904 C CA . GLN X  24 178  ? 186.064 273.493 232.827 1.00 0.00 ? 178  GLN J CA 1 
ATOM 7905 C CA . LEU X  24 179  ? 187.893 275.997 235.013 1.00 0.00 ? 179  LEU J CA 1 
ATOM 7906 C CA . SER X  24 180  ? 186.593 279.214 236.491 1.00 0.00 ? 180  SER J CA 1 
ATOM 7907 C CA . GLU X  24 181  ? 187.790 282.542 235.101 1.00 0.00 ? 181  GLU J CA 1 
ATOM 7908 C CA . GLU X  24 182  ? 189.873 282.809 238.253 1.00 0.00 ? 182  GLU J CA 1 
ATOM 7909 C CA . GLU X  24 183  ? 191.410 279.356 237.760 1.00 0.00 ? 183  GLU J CA 1 
ATOM 7910 C CA . LEU X  24 184  ? 192.401 280.412 234.229 1.00 0.00 ? 184  LEU J CA 1 
ATOM 7911 C CA . GLU X  24 185  ? 193.976 283.700 235.348 1.00 0.00 ? 185  GLU J CA 1 
ATOM 7912 C CA . ARG X  24 186  ? 196.082 281.681 237.796 1.00 0.00 ? 186  ARG J CA 1 
ATOM 7913 C CA . LEU X  24 187  ? 197.469 279.424 235.029 1.00 0.00 ? 187  LEU J CA 1 
ATOM 7914 C CA . GLU X  24 188  ? 197.860 282.084 232.380 1.00 0.00 ? 188  GLU J CA 1 
ATOM 7915 C CA . GLU X  24 189  ? 199.938 284.254 234.713 1.00 0.00 ? 189  GLU J CA 1 
ATOM 7916 C CA . ALA X  24 190  ? 202.084 281.261 235.704 1.00 0.00 ? 190  ALA J CA 1 
ATOM 7917 C CA . CYS X  24 191  ? 202.621 280.294 232.027 1.00 0.00 ? 191  CYS J CA 1 
ATOM 7918 C CA . ASP X  24 192  ? 203.611 283.868 231.102 1.00 0.00 ? 192  ASP J CA 1 
ATOM 7919 C CA . MET X  24 193  ? 206.024 284.064 234.027 1.00 0.00 ? 193  MET J CA 1 
ATOM 7920 C CA . ALA X  24 194  ? 207.593 280.705 233.186 1.00 0.00 ? 194  ALA J CA 1 
ATOM 7921 C CA . LEU X  24 195  ? 208.147 281.817 229.543 1.00 0.00 ? 195  LEU J CA 1 
ATOM 7922 C CA . GLU X  24 196  ? 209.609 285.056 230.772 1.00 0.00 ? 196  GLU J CA 1 
ATOM 7923 C CA . LEU X  24 197  ? 211.922 283.181 233.175 1.00 0.00 ? 197  LEU J CA 1 
ATOM 7924 C CA . ASN X  24 198  ? 213.059 280.867 230.459 1.00 0.00 ? 198  ASN J CA 1 
ATOM 7925 C CA . ALA X  24 199  ? 214.101 283.742 228.233 1.00 0.00 ? 199  ALA J CA 1 
ATOM 7926 C CA . SER X  24 200  ? 215.984 285.429 231.147 1.00 0.00 ? 200  SER J CA 1 
ATOM 7927 C CA . LYS X  24 201  ? 217.961 282.275 231.848 1.00 0.00 ? 201  LYS J CA 1 
ATOM 7928 C CA . HIS X  24 202  ? 219.131 282.337 228.227 1.00 0.00 ? 202  HIS J CA 1 
ATOM 7929 C CA . ARG X  24 203  ? 220.045 286.009 228.335 1.00 0.00 ? 203  ARG J CA 1 
ATOM 7930 C CA . ILE X  24 204  ? 221.978 285.581 231.583 1.00 0.00 ? 204  ILE J CA 1 
ATOM 7931 C CA . TYR X  24 205  ? 223.830 282.486 230.276 1.00 0.00 ? 205  TYR J CA 1 
ATOM 7932 C CA . GLU X  24 206  ? 224.866 284.426 227.164 1.00 0.00 ? 206  GLU J CA 1 
ATOM 7933 C CA . TYR X  24 207  ? 226.528 286.925 229.463 1.00 0.00 ? 207  TYR J CA 1 
ATOM 7934 C CA . VAL X  24 208  ? 228.147 284.155 231.463 1.00 0.00 ? 208  VAL J CA 1 
ATOM 7935 C CA . GLU X  24 209  ? 229.445 282.390 228.328 1.00 0.00 ? 209  GLU J CA 1 
ATOM 7936 C CA . SER X  24 210  ? 230.691 285.670 226.942 1.00 0.00 ? 210  SER J CA 1 
ATOM 7937 C CA . ARG X  24 211  ? 232.636 286.681 230.082 1.00 0.00 ? 211  ARG J CA 1 
ATOM 7938 C CA . MET X  24 212  ? 233.922 283.239 231.026 1.00 0.00 ? 212  MET J CA 1 
ATOM 7939 C CA . SER X  24 213  ? 235.518 283.020 227.636 1.00 0.00 ? 213  SER J CA 1 
ATOM 7940 C CA . PHE X  24 214  ? 237.546 286.080 228.573 1.00 0.00 ? 214  PHE J CA 1 
ATOM 7941 C CA . ILE X  24 215  ? 238.289 285.117 232.152 1.00 0.00 ? 215  ILE J CA 1 
ATOM 7942 C CA . ALA X  24 216  ? 239.041 284.822 230.293 1.00 0.00 ? 216  ALA J CA 1 
ATOM 7943 C CA . PRO X  24 217  ? 238.301 281.307 225.523 1.00 0.00 ? 217  PRO J CA 1 
ATOM 7944 C CA . ASN X  24 218  ? 240.295 278.111 226.123 1.00 0.00 ? 218  ASN J CA 1 
ATOM 7945 C CA . LEU X  24 219  ? 238.007 276.957 228.945 1.00 0.00 ? 219  LEU J CA 1 
ATOM 7946 C CA . SER X  24 220  ? 234.901 277.784 226.872 1.00 0.00 ? 220  SER J CA 1 
ATOM 7947 C CA . ILE X  24 221  ? 236.032 275.754 223.904 1.00 0.00 ? 221  ILE J CA 1 
ATOM 7948 C CA . ILE X  24 222  ? 236.170 272.593 226.005 1.00 0.00 ? 222  ILE J CA 1 
ATOM 7949 C CA . ILE X  24 223  ? 232.976 272.726 228.131 1.00 0.00 ? 223  ILE J CA 1 
ATOM 7950 C CA . GLY X  24 224  ? 230.899 275.363 226.305 1.00 0.00 ? 224  GLY J CA 1 
ATOM 7951 C CA . ALA X  24 225  ? 230.308 278.903 227.586 1.00 0.00 ? 225  ALA J CA 1 
ATOM 7952 C CA . SER X  24 226  ? 227.406 277.886 229.842 1.00 0.00 ? 226  SER J CA 1 
ATOM 7953 C CA . THR X  24 227  ? 229.331 275.278 231.892 1.00 0.00 ? 227  THR J CA 1 
ATOM 7954 C CA . ALA X  24 228  ? 232.418 277.542 231.945 1.00 0.00 ? 228  ALA J CA 1 
ATOM 7955 C CA . ALA X  24 229  ? 230.395 280.371 233.353 1.00 0.00 ? 229  ALA J CA 1 
ATOM 7956 C CA . LYS X  24 230  ? 228.774 278.144 235.956 1.00 0.00 ? 230  LYS J CA 1 
ATOM 7957 C CA . ILE X  24 231  ? 232.094 276.948 237.390 1.00 0.00 ? 231  ILE J CA 1 
ATOM 7958 C CA . MET X  24 232  ? 233.663 280.404 237.168 1.00 0.00 ? 232  MET J CA 1 
ATOM 7959 C CA . GLY X  24 233  ? 230.723 281.708 239.202 1.00 0.00 ? 233  GLY J CA 1 
ATOM 7960 C CA . VAL X  24 234  ? 231.022 279.213 242.029 1.00 0.00 ? 234  VAL J CA 1 
ATOM 7961 C CA . ALA X  24 235  ? 234.819 279.651 242.083 1.00 0.00 ? 235  ALA J CA 1 
ATOM 7962 C CA . GLY X  24 236  ? 234.541 283.435 242.255 1.00 0.00 ? 236  GLY J CA 1 
ATOM 7963 C CA . GLY X  24 237  ? 236.386 284.176 239.054 1.00 0.00 ? 237  GLY J CA 1 
ATOM 7964 C CA . LEU X  24 238  ? 239.257 282.986 236.923 1.00 0.00 ? 238  LEU J CA 1 
ATOM 7965 C CA . THR X  24 239  ? 242.167 283.645 239.272 1.00 0.00 ? 239  THR J CA 1 
ATOM 7966 C CA . ASN X  24 240  ? 240.472 281.656 242.045 1.00 0.00 ? 240  ASN J CA 1 
ATOM 7967 C CA . LEU X  24 241  ? 239.463 278.895 239.671 1.00 0.00 ? 241  LEU J CA 1 
ATOM 7968 C CA . SER X  24 242  ? 242.983 278.647 238.269 1.00 0.00 ? 242  SER J CA 1 
ATOM 7969 C CA . LYS X  24 243  ? 244.488 277.939 241.727 1.00 0.00 ? 243  LYS J CA 1 
ATOM 7970 C CA . MET X  24 244  ? 242.260 274.998 242.425 1.00 0.00 ? 244  MET J CA 1 
ATOM 7971 C CA . PRO X  24 245  ? 243.377 271.446 241.767 1.00 0.00 ? 245  PRO J CA 1 
ATOM 7972 C CA . ALA X  24 246  ? 241.619 269.569 238.959 1.00 0.00 ? 246  ALA J CA 1 
ATOM 7973 C CA . CYS X  24 247  ? 240.003 267.209 241.506 1.00 0.00 ? 247  CYS J CA 1 
ATOM 7974 C CA . ASN X  24 248  ? 238.071 270.069 243.159 1.00 0.00 ? 248  ASN J CA 1 
ATOM 7975 C CA . ILE X  24 249  ? 237.153 271.769 239.906 1.00 0.00 ? 249  ILE J CA 1 
ATOM 7976 C CA . MET X  24 250  ? 235.588 268.413 239.022 1.00 0.00 ? 250  MET J CA 1 
ATOM 7977 C CA . LEU X  24 251  ? 233.293 268.773 242.055 1.00 0.00 ? 251  LEU J CA 1 
ATOM 7978 C CA . LEU X  24 252  ? 232.264 272.439 241.564 1.00 0.00 ? 252  LEU J CA 1 
ATOM 7979 C CA . GLY X  24 253  ? 228.511 272.789 241.773 1.00 0.00 ? 253  GLY J CA 1 
ATOM 7980 C CA . ALA X  24 254  ? 228.058 269.394 243.453 1.00 0.00 ? 254  ALA J CA 1 
ATOM 7981 C CA . GLN X  24 255  ? 224.767 269.109 245.452 1.00 0.00 ? 255  GLN J CA 1 
ATOM 7982 C CA . SER X  24 266  ? 218.988 262.347 246.405 1.00 0.00 ? 266  SER J CA 1 
ATOM 7983 C CA . VAL X  24 267  ? 220.806 262.210 242.987 1.00 0.00 ? 267  VAL J CA 1 
ATOM 7984 C CA . LEU X  24 268  ? 224.364 261.114 242.034 1.00 0.00 ? 268  LEU J CA 1 
ATOM 7985 C CA . PRO X  24 269  ? 227.354 261.323 244.402 1.00 0.00 ? 269  PRO J CA 1 
ATOM 7986 C CA . HIS X  24 270  ? 230.535 263.197 243.428 1.00 0.00 ? 270  HIS J CA 1 
ATOM 7987 C CA . THR X  24 271  ? 229.212 264.917 240.280 1.00 0.00 ? 271  THR J CA 1 
ATOM 7988 C CA . GLY X  24 272  ? 229.626 268.607 239.473 1.00 0.00 ? 272  GLY J CA 1 
ATOM 7989 C CA . TYR X  24 273  ? 228.783 271.031 236.691 1.00 0.00 ? 273  TYR J CA 1 
ATOM 7990 C CA . ILE X  24 274  ? 231.451 269.294 234.613 1.00 0.00 ? 274  ILE J CA 1 
ATOM 7991 C CA . TYR X  24 275  ? 229.754 265.891 234.952 1.00 0.00 ? 275  TYR J CA 1 
ATOM 7992 C CA . HIS X  24 276  ? 226.511 267.408 233.750 1.00 0.00 ? 276  HIS J CA 1 
ATOM 7993 C CA . SER X  24 277  ? 228.030 269.310 230.811 1.00 0.00 ? 277  SER J CA 1 
ATOM 7994 C CA . ASP X  24 278  ? 226.829 268.544 227.302 1.00 0.00 ? 278  ASP J CA 1 
ATOM 7995 C CA . ILE X  24 279  ? 230.204 266.975 226.363 1.00 0.00 ? 279  ILE J CA 1 
ATOM 7996 C CA . VAL X  24 280  ? 230.296 264.447 229.254 1.00 0.00 ? 280  VAL J CA 1 
ATOM 7997 C CA . GLN X  24 281  ? 226.593 263.680 229.036 1.00 0.00 ? 281  GLN J CA 1 
ATOM 7998 C CA . SER X  24 282  ? 227.074 262.927 225.321 1.00 0.00 ? 282  SER J CA 1 
ATOM 7999 C CA . LEU X  24 283  ? 228.707 259.667 226.391 1.00 0.00 ? 283  LEU J CA 1 
ATOM 8000 C CA . PRO X  24 284  ? 227.219 256.332 227.522 1.00 0.00 ? 284  PRO J CA 1 
ATOM 8001 C CA . PRO X  24 285  ? 226.460 256.379 231.300 1.00 0.00 ? 285  PRO J CA 1 
ATOM 8002 C CA . ASP X  24 286  ? 229.350 253.985 232.125 1.00 0.00 ? 286  ASP J CA 1 
ATOM 8003 C CA . LEU X  24 287  ? 231.952 256.298 230.568 1.00 0.00 ? 287  LEU J CA 1 
ATOM 8004 C CA . ARG X  24 288  ? 230.799 259.489 232.299 1.00 0.00 ? 288  ARG J CA 1 
ATOM 8005 C CA . ARG X  24 289  ? 232.710 259.486 235.623 1.00 0.00 ? 289  ARG J CA 1 
ATOM 8006 C CA . LYS X  24 290  ? 235.872 258.803 233.689 1.00 0.00 ? 290  LYS J CA 1 
ATOM 8007 C CA . ALA X  24 291  ? 234.979 261.482 231.147 1.00 0.00 ? 291  ALA J CA 1 
ATOM 8008 C CA . ALA X  24 292  ? 234.418 264.057 233.880 1.00 0.00 ? 292  ALA J CA 1 
ATOM 8009 C CA . ARG X  24 293  ? 237.861 263.283 235.239 1.00 0.00 ? 293  ARG J CA 1 
ATOM 8010 C CA . LEU X  24 294  ? 239.465 263.819 231.875 1.00 0.00 ? 294  LEU J CA 1 
ATOM 8011 C CA . VAL X  24 295  ? 237.428 266.907 231.100 1.00 0.00 ? 295  VAL J CA 1 
ATOM 8012 C CA . ALA X  24 296  ? 238.051 268.299 234.587 1.00 0.00 ? 296  ALA J CA 1 
ATOM 8013 C CA . ALA X  24 297  ? 241.803 267.802 234.218 1.00 0.00 ? 297  ALA J CA 1 
ATOM 8014 C CA . LYS X  24 298  ? 242.004 269.602 230.883 1.00 0.00 ? 298  LYS J CA 1 
ATOM 8015 C CA . CYS X  24 299  ? 239.647 272.363 232.047 1.00 0.00 ? 299  CYS J CA 1 
ATOM 8016 C CA . THR X  24 300  ? 242.059 273.104 234.859 1.00 0.00 ? 300  THR J CA 1 
ATOM 8017 C CA . LEU X  24 301  ? 244.911 273.368 232.377 1.00 0.00 ? 301  LEU J CA 1 
ATOM 8018 C CA . ALA X  24 302  ? 242.830 275.666 230.106 1.00 0.00 ? 302  ALA J CA 1 
ATOM 8019 C CA . ALA X  24 303  ? 241.697 277.784 233.038 1.00 0.00 ? 303  ALA J CA 1 
ATOM 8020 C CA . ARG X  24 304  ? 245.264 278.501 234.023 1.00 0.00 ? 304  ARG J CA 1 
ATOM 8021 C CA . VAL X  24 305  ? 246.142 279.544 230.482 1.00 0.00 ? 305  VAL J CA 1 
ATOM 8022 C CA . ASP X  24 306  ? 243.108 281.865 230.461 1.00 0.00 ? 306  ASP J CA 1 
ATOM 8023 C CA . SER X  24 307  ? 243.985 283.271 233.879 1.00 0.00 ? 307  SER J CA 1 
ATOM 8024 C CA . PHE X  24 308  ? 247.170 284.618 232.330 1.00 0.00 ? 308  PHE J CA 1 
ATOM 8025 C CA . HIS X  24 309  ? 245.360 285.829 229.191 1.00 0.00 ? 309  HIS J CA 1 
ATOM 8026 C CA . GLU X  24 310  ? 247.482 283.699 226.858 1.00 0.00 ? 310  GLU J CA 1 
ATOM 8027 C CA . SER X  24 311  ? 246.493 281.670 223.783 1.00 0.00 ? 311  SER J CA 1 
ATOM 8028 C CA . THR X  24 312  ? 243.644 284.154 223.202 1.00 0.00 ? 312  THR J CA 1 
ATOM 8029 C CA . GLU X  24 313  ? 242.704 282.697 219.834 1.00 0.00 ? 313  GLU J CA 1 
ATOM 8030 C CA . GLY X  24 314  ? 242.012 279.417 221.582 1.00 0.00 ? 314  GLY J CA 1 
ATOM 8031 C CA . LYS X  24 315  ? 244.988 277.390 220.319 1.00 0.00 ? 315  LYS J CA 1 
ATOM 8032 C CA . VAL X  24 316  ? 245.320 275.529 223.665 1.00 0.00 ? 316  VAL J CA 1 
ATOM 8033 C CA . GLY X  24 317  ? 241.535 274.893 224.034 1.00 0.00 ? 317  GLY J CA 1 
ATOM 8034 C CA . TYR X  24 318  ? 241.135 273.421 220.547 1.00 0.00 ? 318  TYR J CA 1 
ATOM 8035 C CA . GLU X  24 319  ? 244.198 271.220 221.183 1.00 0.00 ? 319  GLU J CA 1 
ATOM 8036 C CA . LEU X  24 320  ? 242.780 269.927 224.456 1.00 0.00 ? 320  LEU J CA 1 
ATOM 8037 C CA . LYS X  24 321  ? 239.377 269.480 222.789 1.00 0.00 ? 321  LYS J CA 1 
ATOM 8038 C CA . ASP X  24 322  ? 240.994 267.396 220.055 1.00 0.00 ? 322  ASP J CA 1 
ATOM 8039 C CA . GLU X  24 323  ? 242.857 265.387 222.677 1.00 0.00 ? 323  GLU J CA 1 
ATOM 8040 C CA . ILE X  24 324  ? 239.654 264.690 224.574 1.00 0.00 ? 324  ILE J CA 1 
ATOM 8041 C CA . GLU X  24 325  ? 237.706 263.690 221.449 1.00 0.00 ? 325  GLU J CA 1 
ATOM 8042 C CA . ARG X  24 326  ? 240.410 261.200 220.465 1.00 0.00 ? 326  ARG J CA 1 
ATOM 8043 C CA . LYS X  24 327  ? 240.276 259.618 223.954 1.00 0.00 ? 327  LYS J CA 1 
ATOM 8044 C CA . PHE X  24 328  ? 236.449 259.345 223.785 1.00 0.00 ? 328  PHE J CA 1 
ATOM 8045 C CA . ASP X  24 329  ? 236.743 257.652 220.372 1.00 0.00 ? 329  ASP J CA 1 
ATOM 8046 C CA . LYS X  24 330  ? 239.307 255.225 221.780 1.00 0.00 ? 330  LYS J CA 1 
ATOM 8047 C CA . TRP X  24 331  ? 237.086 254.302 224.755 1.00 0.00 ? 331  TRP J CA 1 
ATOM 8048 C CA . GLN X  24 332  ? 234.110 253.528 222.480 1.00 0.00 ? 332  GLN J CA 1 
ATOM 8049 C CA . GLU X  24 333  ? 233.134 251.233 219.551 1.00 0.00 ? 333  GLU J CA 1 
ATOM 8050 C CA . GLU Y  25 3    ? 266.953 275.949 219.547 1.00 0.00 ? 3    GLU I CA 1 
ATOM 8051 C CA . ALA Y  25 4    ? 265.149 276.723 221.644 1.00 0.00 ? 4    ALA I CA 1 
ATOM 8052 C CA . ASP Y  25 5    ? 265.492 277.425 225.403 1.00 0.00 ? 5    ASP I CA 1 
ATOM 8053 C CA . VAL Y  25 6    ? 264.312 278.984 227.709 1.00 0.00 ? 6    VAL I CA 1 
ATOM 8054 C CA . ASN Y  25 7    ? 261.085 280.749 228.765 1.00 0.00 ? 7    ASN I CA 1 
ATOM 8055 C CA . PRO Y  25 8    ? 262.010 284.025 230.557 1.00 0.00 ? 8    PRO I CA 1 
ATOM 8056 C CA . LYS Y  25 9    ? 258.958 283.538 232.753 1.00 0.00 ? 9    LYS I CA 1 
ATOM 8057 C CA . ALA Y  25 10   ? 260.498 280.431 234.351 1.00 0.00 ? 10   ALA I CA 1 
ATOM 8058 C CA . TYR Y  25 11   ? 262.021 282.546 237.124 1.00 0.00 ? 11   TYR I CA 1 
ATOM 8059 C CA . PRO Y  25 12   ? 264.098 281.726 239.119 1.00 0.00 ? 12   PRO I CA 1 
ATOM 8060 C CA . LEU Y  25 13   ? 266.052 279.157 237.130 1.00 0.00 ? 13   LEU I CA 1 
ATOM 8061 C CA . ALA Y  25 14   ? 268.637 276.937 238.767 1.00 0.00 ? 14   ALA I CA 1 
ATOM 8062 C CA . ASP Y  25 15   ? 272.106 276.621 237.325 1.00 0.00 ? 15   ASP I CA 1 
ATOM 8063 C CA . ALA Y  25 16   ? 273.701 273.228 236.670 1.00 0.00 ? 16   ALA I CA 1 
ATOM 8064 C CA . HIS Y  25 17   ? 275.081 272.881 240.253 1.00 0.00 ? 17   HIS I CA 1 
ATOM 8065 C CA . LEU Y  25 18   ? 271.846 273.828 241.984 1.00 0.00 ? 18   LEU I CA 1 
ATOM 8066 C CA . THR Y  25 19   ? 269.738 271.641 239.629 1.00 0.00 ? 19   THR I CA 1 
ATOM 8067 C CA . LYS Y  25 20   ? 271.926 268.681 240.674 1.00 0.00 ? 20   LYS I CA 1 
ATOM 8068 C CA . LYS Y  25 21   ? 271.372 269.442 244.383 1.00 0.00 ? 21   LYS I CA 1 
ATOM 8069 C CA . LEU Y  25 22   ? 267.622 269.963 243.902 1.00 0.00 ? 22   LEU I CA 1 
ATOM 8070 C CA . LEU Y  25 23   ? 267.134 266.682 242.042 1.00 0.00 ? 23   LEU I CA 1 
ATOM 8071 C CA . ASP Y  25 24   ? 269.182 264.831 244.662 1.00 0.00 ? 24   ASP I CA 1 
ATOM 8072 C CA . LEU Y  25 25   ? 267.061 266.216 247.417 1.00 0.00 ? 25   LEU I CA 1 
ATOM 8073 C CA . VAL Y  25 26   ? 263.884 265.548 245.474 1.00 0.00 ? 26   VAL I CA 1 
ATOM 8074 C CA . GLN Y  25 27   ? 265.043 261.929 245.153 1.00 0.00 ? 27   GLN I CA 1 
ATOM 8075 C CA . GLN Y  25 28   ? 265.689 261.706 248.931 1.00 0.00 ? 28   GLN I CA 1 
ATOM 8076 C CA . SER Y  25 29   ? 262.335 263.342 249.711 1.00 0.00 ? 29   SER I CA 1 
ATOM 8077 C CA . CYS Y  25 30   ? 260.775 260.577 247.723 1.00 0.00 ? 30   CYS I CA 1 
ATOM 8078 C CA . ASN Y  25 31   ? 262.664 257.863 249.631 1.00 0.00 ? 31   ASN I CA 1 
ATOM 8079 C CA . TYR Y  25 32   ? 261.697 259.484 252.945 1.00 0.00 ? 32   TYR I CA 1 
ATOM 8080 C CA . LYS Y  25 33   ? 257.946 259.870 252.096 1.00 0.00 ? 33   LYS I CA 1 
ATOM 8081 C CA . GLN Y  25 34   ? 258.092 263.673 251.944 1.00 0.00 ? 34   GLN I CA 1 
ATOM 8082 C CA . LEU Y  25 35   ? 257.198 264.208 248.292 1.00 0.00 ? 35   LEU I CA 1 
ATOM 8083 C CA . ARG Y  25 36   ? 254.089 265.227 246.385 1.00 0.00 ? 36   ARG I CA 1 
ATOM 8084 C CA . LYS Y  25 37   ? 254.327 264.780 242.620 1.00 0.00 ? 37   LYS I CA 1 
ATOM 8085 C CA . GLY Y  25 38   ? 252.244 266.884 240.271 1.00 0.00 ? 38   GLY I CA 1 
ATOM 8086 C CA . ALA Y  25 39   ? 251.042 270.458 239.921 1.00 0.00 ? 39   ALA I CA 1 
ATOM 8087 C CA . ASN Y  25 40   ? 247.617 269.534 241.246 1.00 0.00 ? 40   ASN I CA 1 
ATOM 8088 C CA . GLU Y  25 41   ? 249.020 267.937 244.431 1.00 0.00 ? 41   GLU I CA 1 
ATOM 8089 C CA . ALA Y  25 42   ? 251.585 270.782 244.759 1.00 0.00 ? 42   ALA I CA 1 
ATOM 8090 C CA . THR Y  25 43   ? 248.666 273.207 244.731 1.00 0.00 ? 43   THR I CA 1 
ATOM 8091 C CA . LYS Y  25 44   ? 247.087 271.250 247.576 1.00 0.00 ? 44   LYS I CA 1 
ATOM 8092 C CA . THR Y  25 45   ? 250.296 271.376 249.649 1.00 0.00 ? 45   THR I CA 1 
ATOM 8093 C CA . LEU Y  25 46   ? 250.515 275.162 249.357 1.00 0.00 ? 46   LEU I CA 1 
ATOM 8094 C CA . ASN Y  25 47   ? 246.808 275.769 250.186 1.00 0.00 ? 47   ASN I CA 1 
ATOM 8095 C CA . ARG Y  25 48   ? 247.345 273.569 253.262 1.00 0.00 ? 48   ARG I CA 1 
ATOM 8096 C CA . GLY Y  25 49   ? 250.697 275.098 254.317 1.00 0.00 ? 49   GLY I CA 1 
ATOM 8097 C CA . ILE Y  25 50   ? 252.624 271.836 254.332 1.00 0.00 ? 50   ILE I CA 1 
ATOM 8098 C CA . SER Y  25 51   ? 255.176 272.714 251.659 1.00 0.00 ? 51   SER I CA 1 
ATOM 8099 C CA . GLU Y  25 52   ? 258.870 273.163 252.380 1.00 0.00 ? 52   GLU I CA 1 
ATOM 8100 C CA . PHE Y  25 53   ? 259.580 274.290 248.786 1.00 0.00 ? 53   PHE I CA 1 
ATOM 8101 C CA . ILE Y  25 54   ? 258.363 273.785 245.213 1.00 0.00 ? 54   ILE I CA 1 
ATOM 8102 C CA . VAL Y  25 55   ? 260.309 272.638 242.155 1.00 0.00 ? 55   VAL I CA 1 
ATOM 8103 C CA . MET Y  25 56   ? 258.815 273.178 238.713 1.00 0.00 ? 56   MET I CA 1 
ATOM 8104 C CA . ALA Y  25 57   ? 259.893 272.342 235.168 1.00 0.00 ? 57   ALA I CA 1 
ATOM 8105 C CA . ALA Y  25 58   ? 260.816 275.204 232.768 1.00 0.00 ? 58   ALA I CA 1 
ATOM 8106 C CA . ASP Y  25 59   ? 259.782 273.219 229.720 1.00 0.00 ? 59   ASP I CA 1 
ATOM 8107 C CA . ALA Y  25 60   ? 256.144 272.712 230.766 1.00 0.00 ? 60   ALA I CA 1 
ATOM 8108 C CA . GLU Y  25 61   ? 254.089 273.570 227.669 1.00 0.00 ? 61   GLU I CA 1 
ATOM 8109 C CA . PRO Y  25 62   ? 252.420 275.897 227.905 1.00 0.00 ? 62   PRO I CA 1 
ATOM 8110 C CA . LEU Y  25 63   ? 254.344 277.262 230.845 1.00 0.00 ? 63   LEU I CA 1 
ATOM 8111 C CA . GLU Y  25 64   ? 251.177 278.878 232.241 1.00 0.00 ? 64   GLU I CA 1 
ATOM 8112 C CA . ILE Y  25 65   ? 249.775 275.574 233.388 1.00 0.00 ? 65   ILE I CA 1 
ATOM 8113 C CA . ILE Y  25 66   ? 252.023 276.035 236.470 1.00 0.00 ? 66   ILE I CA 1 
ATOM 8114 C CA . LEU Y  25 67   ? 252.565 279.769 236.718 1.00 0.00 ? 67   LEU I CA 1 
ATOM 8115 C CA . HIS Y  25 68   ? 249.845 279.873 239.418 1.00 0.00 ? 68   HIS I CA 1 
ATOM 8116 C CA . LEU Y  25 69   ? 252.299 278.113 241.732 1.00 0.00 ? 69   LEU I CA 1 
ATOM 8117 C CA . PRO Y  25 70   ? 254.746 281.075 242.105 1.00 0.00 ? 70   PRO I CA 1 
ATOM 8118 C CA . LEU Y  25 71   ? 251.766 283.276 242.864 1.00 0.00 ? 71   LEU I CA 1 
ATOM 8119 C CA . LEU Y  25 72   ? 250.561 280.775 245.503 1.00 0.00 ? 72   LEU I CA 1 
ATOM 8120 C CA . CYS Y  25 73   ? 254.069 280.510 246.933 1.00 0.00 ? 73   CYS I CA 1 
ATOM 8121 C CA . GLU Y  25 74   ? 254.358 284.302 247.190 1.00 0.00 ? 74   GLU I CA 1 
ATOM 8122 C CA . ASP Y  25 75   ? 251.140 284.177 249.203 1.00 0.00 ? 75   ASP I CA 1 
ATOM 8123 C CA . LYS Y  25 76   ? 252.486 281.566 251.577 1.00 0.00 ? 76   LYS I CA 1 
ATOM 8124 C CA . ASN Y  25 77   ? 256.114 282.779 251.795 1.00 0.00 ? 77   ASN I CA 1 
ATOM 8125 C CA . VAL Y  25 78   ? 257.280 279.512 250.246 1.00 0.00 ? 78   VAL I CA 1 
ATOM 8126 C CA . PRO Y  25 79   ? 260.455 279.067 248.161 1.00 0.00 ? 79   PRO I CA 1 
ATOM 8127 C CA . TYR Y  25 80   ? 260.093 277.862 244.566 1.00 0.00 ? 80   TYR I CA 1 
ATOM 8128 C CA . VAL Y  25 81   ? 262.520 277.203 241.727 1.00 0.00 ? 81   VAL I CA 1 
ATOM 8129 C CA . PHE Y  25 82   ? 262.577 276.006 238.147 1.00 0.00 ? 82   PHE I CA 1 
ATOM 8130 C CA . VAL Y  25 83   ? 264.717 273.307 236.613 1.00 0.00 ? 83   VAL I CA 1 
ATOM 8131 C CA . ARG Y  25 84   ? 265.149 272.967 232.853 1.00 0.00 ? 84   ARG I CA 1 
ATOM 8132 C CA . SER Y  25 85   ? 263.779 269.471 232.307 1.00 0.00 ? 85   SER I CA 1 
ATOM 8133 C CA . LYS Y  25 86   ? 260.468 267.785 233.260 1.00 0.00 ? 86   LYS I CA 1 
ATOM 8134 C CA . GLN Y  25 87   ? 261.953 264.485 232.169 1.00 0.00 ? 87   GLN I CA 1 
ATOM 8135 C CA . ALA Y  25 88   ? 264.695 264.906 234.790 1.00 0.00 ? 88   ALA I CA 1 
ATOM 8136 C CA . LEU Y  25 89   ? 262.254 266.008 237.522 1.00 0.00 ? 89   LEU I CA 1 
ATOM 8137 C CA . GLY Y  25 90   ? 260.055 262.937 236.929 1.00 0.00 ? 90   GLY I CA 1 
ATOM 8138 C CA . ARG Y  25 91   ? 263.190 260.824 236.964 1.00 0.00 ? 91   ARG I CA 1 
ATOM 8139 C CA . ALA Y  25 92   ? 264.051 262.418 240.331 1.00 0.00 ? 92   ALA I CA 1 
ATOM 8140 C CA . CYS Y  25 93   ? 260.491 261.863 241.513 1.00 0.00 ? 93   CYS I CA 1 
ATOM 8141 C CA . GLY Y  25 94   ? 260.889 258.077 241.102 1.00 0.00 ? 94   GLY I CA 1 
ATOM 8142 C CA . VAL Y  25 95   ? 258.216 258.299 238.406 1.00 0.00 ? 95   VAL I CA 1 
ATOM 8143 C CA . SER Y  25 96   ? 258.166 256.909 234.897 1.00 0.00 ? 96   SER I CA 1 
ATOM 8144 C CA . ARG Y  25 97   ? 256.746 260.046 233.176 1.00 0.00 ? 97   ARG I CA 1 
ATOM 8145 C CA . PRO Y  25 98   ? 257.705 263.729 233.170 1.00 0.00 ? 98   PRO I CA 1 
ATOM 8146 C CA . VAL Y  25 99   ? 256.744 265.843 236.166 1.00 0.00 ? 99   VAL I CA 1 
ATOM 8147 C CA . ILE Y  25 100  ? 256.212 269.537 235.750 1.00 0.00 ? 100  ILE I CA 1 
ATOM 8148 C CA . ALA Y  25 101  ? 255.925 270.438 239.436 1.00 0.00 ? 101  ALA I CA 1 
ATOM 8149 C CA . CYS Y  25 102  ? 256.480 268.840 242.812 1.00 0.00 ? 102  CYS I CA 1 
ATOM 8150 C CA . SER Y  25 103  ? 256.468 269.688 246.448 1.00 0.00 ? 103  SER I CA 1 
ATOM 8151 C CA . VAL Y  25 104  ? 258.662 268.574 249.298 1.00 0.00 ? 104  VAL I CA 1 
ATOM 8152 C CA . THR Y  25 105  ? 256.412 268.454 252.366 1.00 0.00 ? 105  THR I CA 1 
ATOM 8153 C CA . ILE Y  25 106  ? 256.891 269.506 256.006 1.00 0.00 ? 106  ILE I CA 1 
ATOM 8154 C CA . LYS Y  25 107  ? 257.534 266.520 258.224 1.00 0.00 ? 107  LYS I CA 1 
ATOM 8155 C CA . GLU Y  25 108  ? 258.252 266.963 261.935 1.00 0.00 ? 108  GLU I CA 1 
ATOM 8156 C CA . GLY Y  25 109  ? 261.584 265.330 262.889 1.00 0.00 ? 109  GLY I CA 1 
ATOM 8157 C CA . SER Y  25 110  ? 262.565 264.665 259.272 1.00 0.00 ? 110  SER I CA 1 
ATOM 8158 C CA . GLN Y  25 111  ? 266.095 263.284 258.931 1.00 0.00 ? 111  GLN I CA 1 
ATOM 8159 C CA . LEU Y  25 112  ? 266.185 265.732 256.021 1.00 0.00 ? 112  LEU I CA 1 
ATOM 8160 C CA . LYS Y  25 113  ? 265.565 269.014 257.970 1.00 0.00 ? 113  LYS I CA 1 
ATOM 8161 C CA . GLN Y  25 114  ? 269.141 270.103 257.495 1.00 0.00 ? 114  GLN I CA 1 
ATOM 8162 C CA . GLN Y  25 115  ? 269.299 269.448 253.755 1.00 0.00 ? 115  GLN I CA 1 
ATOM 8163 C CA . ILE Y  25 116  ? 265.858 270.995 253.228 1.00 0.00 ? 116  ILE I CA 1 
ATOM 8164 C CA . GLN Y  25 117  ? 266.836 274.051 255.218 1.00 0.00 ? 117  GLN I CA 1 
ATOM 8165 C CA . SER Y  25 118  ? 269.968 274.279 253.098 1.00 0.00 ? 118  SER I CA 1 
ATOM 8166 C CA . ILE Y  25 119  ? 268.086 274.145 249.829 1.00 0.00 ? 119  ILE I CA 1 
ATOM 8167 C CA . GLN Y  25 120  ? 265.624 276.747 251.037 1.00 0.00 ? 120  GLN I CA 1 
ATOM 8168 C CA . GLN Y  25 121  ? 268.517 279.127 251.579 1.00 0.00 ? 121  GLN I CA 1 
ATOM 8169 C CA . SER Y  25 122  ? 269.942 278.240 248.140 1.00 0.00 ? 122  SER I CA 1 
ATOM 8170 C CA . ILE Y  25 123  ? 266.572 279.110 246.607 1.00 0.00 ? 123  ILE I CA 1 
ATOM 8171 C CA . GLU Y  25 124  ? 265.961 282.219 248.714 1.00 0.00 ? 124  GLU I CA 1 
ATOM 8172 C CA . ARG Y  25 125  ? 269.161 283.853 247.480 1.00 0.00 ? 125  ARG I CA 1 
ATOM 8173 C CA . LEU Y  25 126  ? 268.074 283.669 243.865 1.00 0.00 ? 126  LEU I CA 1 
ATOM 8174 C CA . LEU Y  25 127  ? 264.659 285.176 244.670 1.00 0.00 ? 127  LEU I CA 1 
ATOM 8175 C CA . VAL Y  25 128  ? 266.896 287.898 246.185 1.00 0.00 ? 128  VAL I CA 1 
ATOM 8176 C CA . SER Z  8  7    ? 314.021 170.686 245.126 1.00 0.00 ? 7    SER o CA 1 
ATOM 8177 C CA . LYS Z  8  8    ? 313.056 173.386 247.650 1.00 0.00 ? 8    LYS o CA 1 
ATOM 8178 C CA . MET Z  8  9    ? 313.262 170.669 250.348 1.00 0.00 ? 9    MET o CA 1 
ATOM 8179 C CA . LEU Z  8  10   ? 317.062 170.443 249.886 1.00 0.00 ? 10   LEU o CA 1 
ATOM 8180 C CA . GLN Z  8  11   ? 317.525 174.214 250.444 1.00 0.00 ? 11   GLN o CA 1 
ATOM 8181 C CA . HIS Z  8  12   ? 316.122 174.324 254.026 1.00 0.00 ? 12   HIS o CA 1 
ATOM 8182 C CA . ILE Z  8  13   ? 318.138 171.323 255.295 1.00 0.00 ? 13   ILE o CA 1 
ATOM 8183 C CA . ASP Z  8  14   ? 320.196 172.252 258.409 1.00 0.00 ? 14   ASP o CA 1 
ATOM 8184 C CA . TYR Z  8  15   ? 318.026 175.317 259.070 1.00 0.00 ? 15   TYR o CA 1 
ATOM 8185 C CA . ARG Z  8  16   ? 316.215 176.989 261.977 1.00 0.00 ? 16   ARG o CA 1 
ATOM 8186 C CA . MET Z  8  17   ? 312.696 177.289 260.583 1.00 0.00 ? 17   MET o CA 1 
ATOM 8187 C CA . ARG Z  8  18   ? 309.509 178.747 262.084 1.00 0.00 ? 18   ARG o CA 1 
ATOM 8188 C CA . CYS Z  8  19   ? 306.626 176.319 262.060 1.00 0.00 ? 19   CYS o CA 1 
ATOM 8189 C CA . ILE Z  8  20   ? 303.034 177.189 262.842 1.00 0.00 ? 20   ILE o CA 1 
ATOM 8190 C CA . LEU Z  8  21   ? 300.279 174.804 263.900 1.00 0.00 ? 21   LEU o CA 1 
ATOM 8191 C CA . GLN Z  8  22   ? 296.487 175.280 263.613 1.00 0.00 ? 22   GLN o CA 1 
ATOM 8192 C CA . ASP Z  8  23   ? 296.236 176.166 267.340 1.00 0.00 ? 23   ASP o CA 1 
ATOM 8193 C CA . GLY Z  8  24   ? 298.381 179.278 266.659 1.00 0.00 ? 24   GLY o CA 1 
ATOM 8194 C CA . ARG Z  8  25   ? 301.416 177.779 268.441 1.00 0.00 ? 25   ARG o CA 1 
ATOM 8195 C CA . ILE Z  8  26   ? 304.771 178.707 266.891 1.00 0.00 ? 26   ILE o CA 1 
ATOM 8196 C CA . PHE Z  8  27   ? 307.772 176.337 266.808 1.00 0.00 ? 27   PHE o CA 1 
ATOM 8197 C CA . ILE Z  8  28   ? 311.281 177.785 266.237 1.00 0.00 ? 28   ILE o CA 1 
ATOM 8198 C CA . GLY Z  8  29   ? 313.955 175.122 265.816 1.00 0.00 ? 29   GLY o CA 1 
ATOM 8199 C CA . THR Z  8  30   ? 316.651 173.447 263.758 1.00 0.00 ? 30   THR o CA 1 
ATOM 8200 C CA . PHE Z  8  31   ? 314.731 171.825 260.917 1.00 0.00 ? 31   PHE o CA 1 
ATOM 8201 C CA . LYS Z  8  32   ? 316.577 168.641 260.008 1.00 0.00 ? 32   LYS o CA 1 
ATOM 8202 C CA . ALA Z  8  33   ? 314.054 166.006 258.774 1.00 0.00 ? 33   ALA o CA 1 
ATOM 8203 C CA . PHE Z  8  34   ? 310.565 166.060 257.210 1.00 0.00 ? 34   PHE o CA 1 
ATOM 8204 C CA . ASP Z  8  35   ? 308.449 163.477 255.389 1.00 0.00 ? 35   ASP o CA 1 
ATOM 8205 C CA . LYS Z  8  36   ? 305.886 163.138 252.573 1.00 0.00 ? 36   LYS o CA 1 
ATOM 8206 C CA . HIS Z  8  37   ? 303.147 163.871 255.151 1.00 0.00 ? 37   HIS o CA 1 
ATOM 8207 C CA . MET Z  8  38   ? 304.982 167.002 256.349 1.00 0.00 ? 38   MET o CA 1 
ATOM 8208 C CA . ASN Z  8  39   ? 305.844 165.627 259.781 1.00 0.00 ? 39   ASN o CA 1 
ATOM 8209 C CA . LEU Z  8  40   ? 308.781 167.742 260.840 1.00 0.00 ? 40   LEU o CA 1 
ATOM 8210 C CA . ILE Z  8  41   ? 311.782 166.822 263.007 1.00 0.00 ? 41   ILE o CA 1 
ATOM 8211 C CA . LEU Z  8  42   ? 313.008 170.019 264.778 1.00 0.00 ? 42   LEU o CA 1 
ATOM 8212 C CA . CYS Z  8  43   ? 316.125 170.457 266.986 1.00 0.00 ? 43   CYS o CA 1 
ATOM 8213 C CA . ASP Z  8  44   ? 316.424 172.639 270.083 1.00 0.00 ? 44   ASP o CA 1 
ATOM 8214 C CA . CYS Z  8  45   ? 312.831 173.647 269.391 1.00 0.00 ? 45   CYS o CA 1 
ATOM 8215 C CA . ASP Z  8  46   ? 311.262 176.323 271.529 1.00 0.00 ? 46   ASP o CA 1 
ATOM 8216 C CA . GLU Z  8  47   ? 307.527 176.897 272.134 1.00 0.00 ? 47   GLU o CA 1 
ATOM 8217 C CA . PHE Z  8  48   ? 305.997 180.336 272.837 1.00 0.00 ? 48   PHE o CA 1 
ATOM 8218 C CA . ARG Z  8  49   ? 303.363 181.897 275.103 1.00 0.00 ? 49   ARG o CA 1 
ATOM 8219 C CA . LYS Z  8  50   ? 301.905 185.415 275.347 1.00 0.00 ? 50   LYS o CA 1 
ATOM 8220 C CA . ILE Z  8  51   ? 301.886 187.569 278.548 1.00 0.00 ? 51   ILE o CA 1 
ATOM 8221 C CA . LYS Z  8  52   ? 300.957 191.165 279.526 1.00 0.00 ? 52   LYS o CA 1 
ATOM 8222 C CA . PRO Z  8  53   ? 301.914 193.888 282.096 1.00 0.00 ? 53   PRO o CA 1 
ATOM 8223 C CA . LYS Z  8  54   ? 299.800 195.551 284.828 1.00 0.00 ? 54   LYS o CA 1 
ATOM 8224 C CA . ASN Z  8  55   ? 300.090 199.292 284.040 1.00 0.00 ? 55   ASN o CA 1 
ATOM 8225 C CA . SER Z  8  56   ? 301.036 200.600 280.551 1.00 0.00 ? 56   SER o CA 1 
ATOM 8226 C CA . LYS Z  8  57   ? 304.770 201.039 281.350 1.00 0.00 ? 57   LYS o CA 1 
ATOM 8227 C CA . GLN Z  8  58   ? 306.435 197.689 282.150 1.00 0.00 ? 58   GLN o CA 1 
ATOM 8228 C CA . ALA Z  8  59   ? 308.732 194.812 280.918 1.00 0.00 ? 59   ALA o CA 1 
ATOM 8229 C CA . GLU Z  8  60   ? 307.381 192.276 278.395 1.00 0.00 ? 60   GLU o CA 1 
ATOM 8230 C CA . ARG Z  8  61   ? 307.362 188.621 279.487 1.00 0.00 ? 61   ARG o CA 1 
ATOM 8231 C CA . GLU Z  8  62   ? 306.735 185.742 277.100 1.00 0.00 ? 62   GLU o CA 1 
ATOM 8232 C CA . GLU Z  8  63   ? 306.689 182.420 278.948 1.00 0.00 ? 63   GLU o CA 1 
ATOM 8233 C CA . LYS Z  8  64   ? 307.947 179.312 277.257 1.00 0.00 ? 64   LYS o CA 1 
ATOM 8234 C CA . ARG Z  8  65   ? 308.606 175.647 277.623 1.00 0.00 ? 65   ARG o CA 1 
ATOM 8235 C CA . VAL Z  8  66   ? 311.922 174.469 276.172 1.00 0.00 ? 66   VAL o CA 1 
ATOM 8236 C CA . LEU Z  8  67   ? 311.215 171.240 274.274 1.00 0.00 ? 67   LEU o CA 1 
ATOM 8237 C CA . GLY Z  8  68   ? 314.679 170.265 272.977 1.00 0.00 ? 68   GLY o CA 1 
ATOM 8238 C CA . LEU Z  8  69   ? 314.233 167.562 270.307 1.00 0.00 ? 69   LEU o CA 1 
ATOM 8239 C CA . VAL Z  8  70   ? 310.739 167.292 268.845 1.00 0.00 ? 70   VAL o CA 1 
ATOM 8240 C CA . LEU Z  8  71   ? 308.625 165.596 266.149 1.00 0.00 ? 71   LEU o CA 1 
ATOM 8241 C CA . LEU Z  8  72   ? 305.678 167.652 264.817 1.00 0.00 ? 72   LEU o CA 1 
ATOM 8242 C CA . ARG Z  8  73   ? 302.606 166.254 263.023 1.00 0.00 ? 73   ARG o CA 1 
ATOM 8243 C CA . GLY Z  8  74   ? 301.693 167.100 259.395 1.00 0.00 ? 74   GLY o CA 1 
ATOM 8244 C CA . GLU Z  8  75   ? 297.925 167.369 259.814 1.00 0.00 ? 75   GLU o CA 1 
ATOM 8245 C CA . ASN Z  8  76   ? 298.102 170.241 262.271 1.00 0.00 ? 76   ASN o CA 1 
ATOM 8246 C CA . LEU Z  8  77   ? 300.750 172.337 260.429 1.00 0.00 ? 77   LEU o CA 1 
ATOM 8247 C CA . VAL Z  8  78   ? 300.019 175.733 258.912 1.00 0.00 ? 78   VAL o CA 1 
ATOM 8248 C CA . SER Z  8  79   ? 303.255 177.405 257.758 1.00 0.00 ? 79   SER o CA 1 
ATOM 8249 C CA . MET Z  8  80   ? 307.081 177.425 257.814 1.00 0.00 ? 80   MET o CA 1 
ATOM 8250 C CA . THR Z  8  81   ? 308.987 180.736 257.656 1.00 0.00 ? 81   THR o CA 1 
ATOM 8251 C CA . VAL Z  8  82   ? 312.723 181.445 257.883 1.00 0.00 ? 82   VAL o CA 1 
ATOM 8252 C CA . GLU Z  8  83   ? 313.154 183.143 261.270 1.00 0.00 ? 83   GLU o CA 1 
ATOM 8253 C CA . GLY Z  8  84   ? 316.949 182.680 261.399 1.00 0.00 ? 84   GLY o CA 1 
ATOM 8254 C CA . PRO Z  8  85   ? 319.889 181.821 259.106 1.00 0.00 ? 85   PRO o CA 1 
ATOM 8255 C CA . PRO Z  8  86   ? 320.979 178.218 259.336 1.00 0.00 ? 86   PRO o CA 1 
ATOM 8256 C CA . PRO Z  8  87   ? 322.257 178.175 262.956 1.00 0.00 ? 87   PRO o CA 1 
ATOM 8257 C CA . LYS Z  8  88   ? 325.991 178.016 263.502 1.00 0.00 ? 88   LYS o CA 1 
ATOM 8258 C CA . ASP Z  8  89   ? 325.645 178.520 267.318 1.00 0.00 ? 89   ASP o CA 1 
ATOM 8259 C CA . THR Z  8  90   ? 323.828 175.205 267.771 1.00 0.00 ? 90   THR o CA 1 
ATOM 8260 C CA . GLY Z  8  91   ? 326.165 173.675 265.177 1.00 0.00 ? 91   GLY o CA 1 
ATOM 8261 C CA . ILE Z  8  92   ? 329.391 174.836 266.862 1.00 0.00 ? 92   ILE o CA 1 
ATOM 8262 C CA . ALA Z  8  93   ? 328.041 174.484 270.441 1.00 0.00 ? 93   ALA o CA 1 
ATOM 8263 C CA . ARG Z  8  94   ? 327.682 170.791 269.667 1.00 0.00 ? 94   ARG o CA 1 
ATOM 8264 C CA . VAL Z  8  95   ? 330.569 170.037 267.124 1.00 0.00 ? 95   VAL o CA 1 
ATOM 8265 C CA . LYS AA 9  2    ? 294.668 170.693 236.048 1.00 0.00 ? 2    LYS p CA 1 
ATOM 8266 C CA . LEU AA 9  3    ? 294.275 173.404 238.718 1.00 0.00 ? 3    LEU p CA 1 
ATOM 8267 C CA . VAL AA 9  4    ? 297.471 172.740 240.660 1.00 0.00 ? 4    VAL p CA 1 
ATOM 8268 C CA . ARG AA 9  5    ? 299.382 173.036 237.383 1.00 0.00 ? 5    ARG p CA 1 
ATOM 8269 C CA . PHE AA 9  6    ? 297.575 176.319 236.681 1.00 0.00 ? 6    PHE p CA 1 
ATOM 8270 C CA . LEU AA 9  7    ? 299.066 177.915 239.851 1.00 0.00 ? 7    LEU p CA 1 
ATOM 8271 C CA . MET AA 9  8    ? 302.531 176.547 239.084 1.00 0.00 ? 8    MET p CA 1 
ATOM 8272 C CA . LYS AA 9  9    ? 302.848 179.083 236.198 1.00 0.00 ? 9    LYS p CA 1 
ATOM 8273 C CA . LEU AA 9  10   ? 301.373 182.003 238.317 1.00 0.00 ? 10   LEU p CA 1 
ATOM 8274 C CA . SER AA 9  11   ? 304.576 182.684 240.214 1.00 0.00 ? 11   SER p CA 1 
ATOM 8275 C CA . HIS AA 9  12   ? 305.635 186.360 240.045 1.00 0.00 ? 12   HIS p CA 1 
ATOM 8276 C CA . GLU AA 9  13   ? 302.366 188.205 240.515 1.00 0.00 ? 13   GLU p CA 1 
ATOM 8277 C CA . THR AA 9  14   ? 301.136 189.090 244.009 1.00 0.00 ? 14   THR p CA 1 
ATOM 8278 C CA . VAL AA 9  15   ? 298.675 186.874 245.895 1.00 0.00 ? 15   VAL p CA 1 
ATOM 8279 C CA . THR AA 9  16   ? 296.933 187.036 249.260 1.00 0.00 ? 16   THR p CA 1 
ATOM 8280 C CA . ILE AA 9  17   ? 295.830 183.868 250.955 1.00 0.00 ? 17   ILE p CA 1 
ATOM 8281 C CA . GLU AA 9  18   ? 292.896 183.596 253.328 1.00 0.00 ? 18   GLU p CA 1 
ATOM 8282 C CA . LEU AA 9  19   ? 293.064 180.238 255.155 1.00 0.00 ? 19   LEU p CA 1 
ATOM 8283 C CA . LYS AA 9  20   ? 290.263 178.097 256.484 1.00 0.00 ? 20   LYS p CA 1 
ATOM 8284 C CA . ASN AA 9  21   ? 291.045 179.670 259.875 1.00 0.00 ? 21   ASN p CA 1 
ATOM 8285 C CA . GLY AA 9  22   ? 289.943 183.040 258.456 1.00 0.00 ? 22   GLY p CA 1 
ATOM 8286 C CA . THR AA 9  23   ? 293.541 184.263 258.716 1.00 0.00 ? 23   THR p CA 1 
ATOM 8287 C CA . GLN AA 9  24   ? 294.791 186.091 255.620 1.00 0.00 ? 24   GLN p CA 1 
ATOM 8288 C CA . VAL AA 9  25   ? 298.401 185.844 254.450 1.00 0.00 ? 25   VAL p CA 1 
ATOM 8289 C CA . HIS AA 9  26   ? 299.817 188.218 251.821 1.00 0.00 ? 26   HIS p CA 1 
ATOM 8290 C CA . GLY AA 9  27   ? 302.894 187.421 249.722 1.00 0.00 ? 27   GLY p CA 1 
ATOM 8291 C CA . THR AA 9  28   ? 304.593 186.476 246.465 1.00 0.00 ? 28   THR p CA 1 
ATOM 8292 C CA . ILE AA 9  29   ? 304.651 182.847 245.330 1.00 0.00 ? 29   ILE p CA 1 
ATOM 8293 C CA . THR AA 9  30   ? 307.805 180.759 244.901 1.00 0.00 ? 30   THR p CA 1 
ATOM 8294 C CA . GLY AA 9  31   ? 306.526 177.225 244.048 1.00 0.00 ? 31   GLY p CA 1 
ATOM 8295 C CA . VAL AA 9  32   ? 303.756 174.700 244.619 1.00 0.00 ? 32   VAL p CA 1 
ATOM 8296 C CA . ASP AA 9  33   ? 303.704 170.881 244.806 1.00 0.00 ? 33   ASP p CA 1 
ATOM 8297 C CA . VAL AA 9  34   ? 301.226 168.085 243.827 1.00 0.00 ? 34   VAL p CA 1 
ATOM 8298 C CA . SER AA 9  35   ? 299.294 168.291 247.172 1.00 0.00 ? 35   SER p CA 1 
ATOM 8299 C CA . MET AA 9  36   ? 298.765 172.059 246.693 1.00 0.00 ? 36   MET p CA 1 
ATOM 8300 C CA . ASN AA 9  37   ? 301.342 173.256 249.284 1.00 0.00 ? 37   ASN p CA 1 
ATOM 8301 C CA . THR AA 9  38   ? 302.917 176.585 248.402 1.00 0.00 ? 38   THR p CA 1 
ATOM 8302 C CA . HIS AA 9  39   ? 306.286 178.108 249.291 1.00 0.00 ? 39   HIS p CA 1 
ATOM 8303 C CA . LEU AA 9  40   ? 306.058 181.929 249.474 1.00 0.00 ? 40   LEU p CA 1 
ATOM 8304 C CA . LYS AA 9  41   ? 308.311 185.041 249.795 1.00 0.00 ? 41   LYS p CA 1 
ATOM 8305 C CA . ALA AA 9  42   ? 307.845 188.681 250.925 1.00 0.00 ? 42   ALA p CA 1 
ATOM 8306 C CA . VAL AA 9  43   ? 305.025 187.906 253.353 1.00 0.00 ? 43   VAL p CA 1 
ATOM 8307 C CA . LYS AA 9  44   ? 303.011 189.930 255.814 1.00 0.00 ? 44   LYS p CA 1 
ATOM 8308 C CA . MET AA 9  45   ? 300.508 188.012 257.900 1.00 0.00 ? 45   MET p CA 1 
ATOM 8309 C CA . THR AA 9  46   ? 297.374 189.021 259.793 1.00 0.00 ? 46   THR p CA 1 
ATOM 8310 C CA . LEU AA 9  47   ? 296.032 186.878 262.639 1.00 0.00 ? 47   LEU p CA 1 
ATOM 8311 C CA . LYS AA 9  48   ? 292.381 187.158 263.749 1.00 0.00 ? 48   LYS p CA 1 
ATOM 8312 C CA . ASN AA 9  49   ? 292.004 190.046 266.227 1.00 0.00 ? 49   ASN p CA 1 
ATOM 8313 C CA . ARG AA 9  50   ? 295.829 190.563 266.157 1.00 0.00 ? 50   ARG p CA 1 
ATOM 8314 C CA . GLU AA 9  51   ? 298.620 192.630 264.566 1.00 0.00 ? 51   GLU p CA 1 
ATOM 8315 C CA . PRO AA 9  52   ? 300.455 192.105 261.207 1.00 0.00 ? 52   PRO p CA 1 
ATOM 8316 C CA . VAL AA 9  53   ? 303.709 190.089 260.886 1.00 0.00 ? 53   VAL p CA 1 
ATOM 8317 C CA . GLN AA 9  54   ? 306.321 190.778 258.142 1.00 0.00 ? 54   GLN p CA 1 
ATOM 8318 C CA . LEU AA 9  55   ? 308.218 187.658 256.990 1.00 0.00 ? 55   LEU p CA 1 
ATOM 8319 C CA . GLU AA 9  56   ? 310.814 187.025 254.201 1.00 0.00 ? 56   GLU p CA 1 
ATOM 8320 C CA . THR AA 9  57   ? 309.827 183.412 253.266 1.00 0.00 ? 57   THR p CA 1 
ATOM 8321 C CA . LEU AA 9  58   ? 307.043 181.005 254.247 1.00 0.00 ? 58   LEU p CA 1 
ATOM 8322 C CA . SER AA 9  59   ? 305.276 177.656 253.504 1.00 0.00 ? 59   SER p CA 1 
ATOM 8323 C CA . ILE AA 9  60   ? 301.575 176.613 253.826 1.00 0.00 ? 60   ILE p CA 1 
ATOM 8324 C CA . ARG AA 9  61   ? 299.790 173.287 253.779 1.00 0.00 ? 61   ARG p CA 1 
ATOM 8325 C CA . GLY AA 9  62   ? 297.396 173.137 250.811 1.00 0.00 ? 62   GLY p CA 1 
ATOM 8326 C CA . ASN AA 9  63   ? 294.643 171.596 252.976 1.00 0.00 ? 63   ASN p CA 1 
ATOM 8327 C CA . ASN AA 9  64   ? 295.072 174.461 255.518 1.00 0.00 ? 64   ASN p CA 1 
ATOM 8328 C CA . ILE AA 9  65   ? 293.833 177.016 252.890 1.00 0.00 ? 65   ILE p CA 1 
ATOM 8329 C CA . ARG AA 9  66   ? 290.442 178.564 252.011 1.00 0.00 ? 66   ARG p CA 1 
ATOM 8330 C CA . TYR AA 9  67   ? 290.851 180.901 248.978 1.00 0.00 ? 67   TYR p CA 1 
ATOM 8331 C CA . PHE AA 9  68   ? 293.767 182.495 247.052 1.00 0.00 ? 68   PHE p CA 1 
ATOM 8332 C CA . ILE AA 9  69   ? 293.058 186.044 245.969 1.00 0.00 ? 69   ILE p CA 1 
ATOM 8333 C CA . LEU AA 9  70   ? 293.967 185.909 242.248 1.00 0.00 ? 70   LEU p CA 1 
ATOM 8334 C CA . PRO AA 9  71   ? 295.875 188.605 240.308 1.00 0.00 ? 71   PRO p CA 1 
ATOM 8335 C CA . ASP AA 9  72   ? 293.694 191.144 238.426 1.00 0.00 ? 72   ASP p CA 1 
ATOM 8336 C CA . SER AA 9  73   ? 296.230 190.574 235.642 1.00 0.00 ? 73   SER p CA 1 
ATOM 8337 C CA . LEU AA 9  74   ? 296.471 186.740 235.653 1.00 0.00 ? 74   LEU p CA 1 
ATOM 8338 C CA . PRO AA 9  75   ? 296.583 184.958 232.258 1.00 0.00 ? 75   PRO p CA 1 
ATOM 8339 C CA . LEU AA 9  76   ? 293.876 182.273 232.238 1.00 0.00 ? 76   LEU p CA 1 
ATOM 8340 C CA . ASP AA 9  77   ? 294.670 180.514 228.940 1.00 0.00 ? 77   ASP p CA 1 
ATOM 8341 C CA . THR AA 9  78   ? 298.431 180.690 229.482 1.00 0.00 ? 78   THR p CA 1 
ATOM 8342 C CA . LEU AA 9  79   ? 298.018 178.486 232.590 1.00 0.00 ? 79   LEU p CA 1 
ATOM 8343 C CA . LEU AA 9  80   ? 295.314 176.046 231.383 1.00 0.00 ? 80   LEU p CA 1 
ATOM 8344 C CA . VAL AA 9  81   ? 295.218 173.676 228.369 1.00 0.00 ? 81   VAL p CA 1 
ATOM 8345 C CA . ASP AA 9  82   ? 291.403 173.482 228.443 1.00 0.00 ? 82   ASP p CA 1 
ATOM 8346 C CA . VAL AA 9  83   ? 290.241 176.204 226.052 1.00 0.00 ? 83   VAL p CA 1 
ATOM 8347 C CA . GLU AA 9  84   ? 286.362 176.403 226.073 1.00 0.00 ? 84   GLU p CA 1 
ATOM 8348 C CA . PRO AA 9  85   ? 285.404 177.407 229.705 1.00 0.00 ? 85   PRO p CA 1 
ATOM 8349 C CA . LYS AA 9  86   ? 288.678 179.205 230.364 1.00 0.00 ? 86   LYS p CA 1 
ATOM 8350 C CA . VAL AA 9  87   ? 288.156 181.546 227.389 1.00 0.00 ? 87   VAL p CA 1 
ATOM 8351 C CA . LYS AA 9  88   ? 284.542 182.714 227.897 1.00 0.00 ? 88   LYS p CA 1 
ATOM 8352 C CA . SER AA 9  89   ? 285.095 183.303 231.584 1.00 0.00 ? 89   SER p CA 1 
ATOM 8353 C CA . LYS AA 9  90   ? 288.646 184.782 231.168 1.00 0.00 ? 90   LYS p CA 1 
ATOM 8354 C CA . LYS AA 9  91   ? 287.496 186.998 228.353 1.00 0.00 ? 91   LYS p CA 1 
ATOM 8355 C CA . ARG AA 9  92   ? 284.848 188.385 230.711 1.00 0.00 ? 92   ARG p CA 1 
ATOM 8356 C CA . GLU AA 9  93   ? 287.254 188.153 233.609 1.00 0.00 ? 93   GLU p CA 1 
ATOM 8357 C CA . ALA AA 9  94   ? 290.536 189.204 232.129 1.00 0.00 ? 94   ALA p CA 1 
ATOM 8358 C CA . VAL AA 9  95   ? 288.239 192.031 230.990 1.00 0.00 ? 95   VAL p CA 1 
ATOM 8359 C CA . THR BA 10 26   ? 278.598 162.040 238.320 1.00 0.00 ? 26   THR q CA 1 
ATOM 8360 C CA . GLY BA 10 27   ? 275.428 164.164 238.505 1.00 0.00 ? 27   GLY q CA 1 
ATOM 8361 C CA . PRO BA 10 28   ? 276.633 167.145 240.516 1.00 0.00 ? 28   PRO q CA 1 
ATOM 8362 C CA . LEU BA 10 29   ? 279.748 168.141 238.529 1.00 0.00 ? 29   LEU q CA 1 
ATOM 8363 C CA . SER BA 10 30   ? 278.228 167.369 235.103 1.00 0.00 ? 30   SER q CA 1 
ATOM 8364 C CA . VAL BA 10 31   ? 275.395 169.831 235.653 1.00 0.00 ? 31   VAL q CA 1 
ATOM 8365 C CA . LEU BA 10 32   ? 277.681 172.309 237.390 1.00 0.00 ? 32   LEU q CA 1 
ATOM 8366 C CA . THR BA 10 33   ? 280.030 172.051 234.384 1.00 0.00 ? 33   THR q CA 1 
ATOM 8367 C CA . GLN BA 10 34   ? 277.106 172.558 231.970 1.00 0.00 ? 34   GLN q CA 1 
ATOM 8368 C CA . SER BA 10 35   ? 275.903 175.734 233.662 1.00 0.00 ? 35   SER q CA 1 
ATOM 8369 C CA . VAL BA 10 36   ? 279.593 176.897 233.730 1.00 0.00 ? 36   VAL q CA 1 
ATOM 8370 C CA . LYS BA 10 37   ? 279.769 176.059 230.029 1.00 0.00 ? 37   LYS q CA 1 
ATOM 8371 C CA . ASN BA 10 38   ? 276.960 178.583 229.431 1.00 0.00 ? 38   ASN q CA 1 
ATOM 8372 C CA . ASN BA 10 39   ? 278.289 181.269 231.796 1.00 0.00 ? 39   ASN q CA 1 
ATOM 8373 C CA . THR BA 10 40   ? 275.491 180.606 234.325 1.00 0.00 ? 40   THR q CA 1 
ATOM 8374 C CA . GLN BA 10 41   ? 276.100 182.353 237.641 1.00 0.00 ? 41   GLN q CA 1 
ATOM 8375 C CA . VAL BA 10 42   ? 276.658 179.855 240.458 1.00 0.00 ? 42   VAL q CA 1 
ATOM 8376 C CA . LEU BA 10 43   ? 276.012 180.250 244.188 1.00 0.00 ? 43   LEU q CA 1 
ATOM 8377 C CA . ILE BA 10 44   ? 278.422 178.535 246.591 1.00 0.00 ? 44   ILE q CA 1 
ATOM 8378 C CA . ASN BA 10 45   ? 277.705 178.146 250.290 1.00 0.00 ? 45   ASN q CA 1 
ATOM 8379 C CA . CYS BA 10 46   ? 281.060 178.170 252.093 1.00 0.00 ? 46   CYS q CA 1 
ATOM 8380 C CA . ARG BA 10 47   ? 281.878 176.334 255.332 1.00 0.00 ? 47   ARG q CA 1 
ATOM 8381 C CA . ASN BA 10 48   ? 281.124 179.361 257.606 1.00 0.00 ? 48   ASN q CA 1 
ATOM 8382 C CA . ASN BA 10 49   ? 277.681 180.560 256.416 1.00 0.00 ? 49   ASN q CA 1 
ATOM 8383 C CA . LYS BA 10 50   ? 279.353 182.676 253.731 1.00 0.00 ? 50   LYS q CA 1 
ATOM 8384 C CA . LYS BA 10 51   ? 278.139 182.408 250.156 1.00 0.00 ? 51   LYS q CA 1 
ATOM 8385 C CA . LEU BA 10 52   ? 279.941 183.082 246.909 1.00 0.00 ? 52   LEU q CA 1 
ATOM 8386 C CA . LEU BA 10 53   ? 278.079 184.502 243.825 1.00 0.00 ? 53   LEU q CA 1 
ATOM 8387 C CA . GLY BA 10 54   ? 279.710 184.384 240.376 1.00 0.00 ? 54   GLY q CA 1 
ATOM 8388 C CA . ARG BA 10 55   ? 281.088 182.704 237.233 1.00 0.00 ? 55   ARG q CA 1 
ATOM 8389 C CA . VAL BA 10 56   ? 283.100 179.510 237.337 1.00 0.00 ? 56   VAL q CA 1 
ATOM 8390 C CA . LYS BA 10 57   ? 286.303 179.535 235.332 1.00 0.00 ? 57   LYS q CA 1 
ATOM 8391 C CA . ALA BA 10 58   ? 288.156 176.335 236.332 1.00 0.00 ? 58   ALA q CA 1 
ATOM 8392 C CA . PHE BA 10 59   ? 287.345 173.654 238.916 1.00 0.00 ? 59   PHE q CA 1 
ATOM 8393 C CA . ASP BA 10 60   ? 288.830 170.223 239.683 1.00 0.00 ? 60   ASP q CA 1 
ATOM 8394 C CA . ARG BA 10 61   ? 287.848 166.985 241.463 1.00 0.00 ? 61   ARG q CA 1 
ATOM 8395 C CA . HIS BA 10 62   ? 288.910 168.407 244.878 1.00 0.00 ? 62   HIS q CA 1 
ATOM 8396 C CA . CYS BA 10 63   ? 286.309 171.034 243.976 1.00 0.00 ? 63   CYS q CA 1 
ATOM 8397 C CA . ASN BA 10 64   ? 289.031 173.664 244.014 1.00 0.00 ? 64   ASN q CA 1 
ATOM 8398 C CA . MET BA 10 65   ? 287.702 176.501 241.933 1.00 0.00 ? 65   MET q CA 1 
ATOM 8399 C CA . VAL BA 10 66   ? 289.001 179.419 239.851 1.00 0.00 ? 66   VAL q CA 1 
ATOM 8400 C CA . LEU BA 10 67   ? 286.278 182.079 240.145 1.00 0.00 ? 67   LEU q CA 1 
ATOM 8401 C CA . GLU BA 10 68   ? 285.651 185.545 238.960 1.00 0.00 ? 68   GLU q CA 1 
ATOM 8402 C CA . ASN BA 10 69   ? 283.226 188.507 238.886 1.00 0.00 ? 69   ASN q CA 1 
ATOM 8403 C CA . VAL BA 10 70   ? 282.612 187.229 242.367 1.00 0.00 ? 70   VAL q CA 1 
ATOM 8404 C CA . LYS BA 10 71   ? 280.559 188.902 245.063 1.00 0.00 ? 71   LYS q CA 1 
ATOM 8405 C CA . GLU BA 10 72   ? 281.143 187.112 248.346 1.00 0.00 ? 72   GLU q CA 1 
ATOM 8406 C CA . MET BA 10 73   ? 278.577 187.713 251.087 1.00 0.00 ? 73   MET q CA 1 
ATOM 8407 C CA . TRP BA 10 74   ? 279.968 186.554 254.399 1.00 0.00 ? 74   TRP q CA 1 
ATOM 8408 C CA . THR BA 10 75   ? 278.499 186.078 257.856 1.00 0.00 ? 75   THR q CA 1 
ATOM 8409 C CA . GLU BA 10 76   ? 279.442 188.999 260.101 1.00 0.00 ? 76   GLU q CA 1 
ATOM 8410 C CA . VAL BA 10 77   ? 280.709 189.260 263.621 1.00 0.00 ? 77   VAL q CA 1 
ATOM 8411 C CA . PRO BA 10 78   ? 279.282 191.404 266.488 1.00 0.00 ? 78   PRO q CA 1 
ATOM 8412 C CA . LYS BA 10 79   ? 281.280 194.034 268.399 1.00 0.00 ? 79   LYS q CA 1 
ATOM 8413 C CA . SER BA 10 80   ? 280.863 195.894 271.704 1.00 0.00 ? 80   SER q CA 1 
ATOM 8414 C CA . GLY BA 10 81   ? 281.044 199.546 272.846 1.00 0.00 ? 81   GLY q CA 1 
ATOM 8415 C CA . LYS BA 10 82   ? 281.578 200.973 276.403 1.00 0.00 ? 82   LYS q CA 1 
ATOM 8416 C CA . GLY BA 10 83   ? 279.074 203.822 275.927 1.00 0.00 ? 83   GLY q CA 1 
ATOM 8417 C CA . LYS BA 10 84   ? 276.058 201.447 275.796 1.00 0.00 ? 84   LYS q CA 1 
ATOM 8418 C CA . LYS BA 10 85   ? 276.192 200.885 272.022 1.00 0.00 ? 85   LYS q CA 1 
ATOM 8419 C CA . LYS BA 10 86   ? 276.067 197.642 270.085 1.00 0.00 ? 86   LYS q CA 1 
ATOM 8420 C CA . SER BA 10 87   ? 275.439 196.229 266.620 1.00 0.00 ? 87   SER q CA 1 
ATOM 8421 C CA . LYS BA 10 88   ? 274.195 192.629 266.026 1.00 0.00 ? 88   LYS q CA 1 
ATOM 8422 C CA . PRO BA 10 89   ? 273.748 192.142 262.231 1.00 0.00 ? 89   PRO q CA 1 
ATOM 8423 C CA . VAL BA 10 90   ? 275.620 190.631 259.231 1.00 0.00 ? 90   VAL q CA 1 
ATOM 8424 C CA . ASN BA 10 91   ? 278.047 192.369 256.831 1.00 0.00 ? 91   ASN q CA 1 
ATOM 8425 C CA . LYS BA 10 92   ? 277.703 193.767 253.304 1.00 0.00 ? 92   LYS q CA 1 
ATOM 8426 C CA . ASP BA 10 93   ? 278.213 192.083 249.873 1.00 0.00 ? 93   ASP q CA 1 
ATOM 8427 C CA . ARG BA 10 94   ? 281.837 192.214 248.788 1.00 0.00 ? 94   ARG q CA 1 
ATOM 8428 C CA . TYR BA 10 95   ? 283.143 192.280 245.170 1.00 0.00 ? 95   TYR q CA 1 
ATOM 8429 C CA . ILE BA 10 96   ? 286.255 190.270 244.129 1.00 0.00 ? 96   ILE q CA 1 
ATOM 8430 C CA . SER BA 10 97   ? 287.402 190.252 240.474 1.00 0.00 ? 97   SER q CA 1 
ATOM 8431 C CA . LYS BA 10 98   ? 289.362 186.967 240.540 1.00 0.00 ? 98   LYS q CA 1 
ATOM 8432 C CA . MET BA 10 99   ? 289.244 184.047 243.035 1.00 0.00 ? 99   MET q CA 1 
ATOM 8433 C CA . PHE BA 10 100  ? 290.599 180.546 243.530 1.00 0.00 ? 100  PHE q CA 1 
ATOM 8434 C CA . LEU BA 10 101  ? 288.669 178.412 246.069 1.00 0.00 ? 101  LEU q CA 1 
ATOM 8435 C CA . ARG BA 10 102  ? 289.340 175.401 248.332 1.00 0.00 ? 102  ARG q CA 1 
ATOM 8436 C CA . GLY BA 10 103  ? 286.645 172.714 247.980 1.00 0.00 ? 103  GLY q CA 1 
ATOM 8437 C CA . ASP BA 10 104  ? 286.806 171.604 251.638 1.00 0.00 ? 104  ASP q CA 1 
ATOM 8438 C CA . SER BA 10 105  ? 284.910 174.749 252.636 1.00 0.00 ? 105  SER q CA 1 
ATOM 8439 C CA . VAL BA 10 106  ? 282.253 173.902 250.009 1.00 0.00 ? 106  VAL q CA 1 
ATOM 8440 C CA . ILE BA 10 107  ? 278.964 172.550 251.402 1.00 0.00 ? 107  ILE q CA 1 
ATOM 8441 C CA . VAL BA 10 108  ? 276.677 173.278 248.448 1.00 0.00 ? 108  VAL q CA 1 
ATOM 8442 C CA . VAL BA 10 109  ? 276.584 174.685 244.890 1.00 0.00 ? 109  VAL q CA 1 
ATOM 8443 C CA . LEU BA 10 110  ? 273.429 176.125 243.250 1.00 0.00 ? 110  LEU q CA 1 
ATOM 8444 C CA . ARG BA 10 111  ? 272.048 176.798 239.757 1.00 0.00 ? 111  ARG q CA 1 
ATOM 8445 C CA . ASN BA 10 112  ? 270.273 179.954 238.706 1.00 0.00 ? 112  ASN q CA 1 
ATOM 8446 C CA . PRO BA 10 113  ? 266.559 179.982 239.421 1.00 0.00 ? 113  PRO q CA 1 
ATOM 8447 C CA . LEU BA 10 114  ? 266.352 180.364 235.668 1.00 0.00 ? 114  LEU q CA 1 
ATOM 8448 C CA . GLY CA 11 4    ? 316.488 156.081 258.651 1.00 0.00 ? 4    GLY r CA 1 
ATOM 8449 C CA . VAL CA 11 5    ? 312.909 156.548 257.480 1.00 0.00 ? 5    VAL r CA 1 
ATOM 8450 C CA . PRO CA 11 6    ? 310.788 158.229 260.222 1.00 0.00 ? 6    PRO r CA 1 
ATOM 8451 C CA . ILE CA 11 7    ? 309.370 154.756 260.976 1.00 0.00 ? 7    ILE r CA 1 
ATOM 8452 C CA . LYS CA 11 8    ? 312.887 153.291 261.475 1.00 0.00 ? 8    LYS r CA 1 
ATOM 8453 C CA . VAL CA 11 9    ? 313.881 156.154 263.787 1.00 0.00 ? 9    VAL r CA 1 
ATOM 8454 C CA . LEU CA 11 10   ? 310.681 155.602 265.833 1.00 0.00 ? 10   LEU r CA 1 
ATOM 8455 C CA . HIS CA 11 11   ? 311.402 151.839 266.003 1.00 0.00 ? 11   HIS r CA 1 
ATOM 8456 C CA . GLU CA 11 12   ? 314.828 152.511 267.517 1.00 0.00 ? 12   GLU r CA 1 
ATOM 8457 C CA . ALA CA 11 13   ? 313.040 154.552 270.276 1.00 0.00 ? 13   ALA r CA 1 
ATOM 8458 C CA . GLU CA 11 14   ? 311.346 151.366 271.514 1.00 0.00 ? 14   GLU r CA 1 
ATOM 8459 C CA . GLY CA 11 15   ? 312.304 150.532 275.124 1.00 0.00 ? 15   GLY r CA 1 
ATOM 8460 C CA . HIS CA 11 16   ? 313.361 154.188 275.540 1.00 0.00 ? 16   HIS r CA 1 
ATOM 8461 C CA . ILE CA 11 17   ? 311.849 157.037 277.520 1.00 0.00 ? 17   ILE r CA 1 
ATOM 8462 C CA . VAL CA 11 18   ? 309.671 159.482 275.591 1.00 0.00 ? 18   VAL r CA 1 
ATOM 8463 C CA . THR CA 11 19   ? 306.839 161.962 276.263 1.00 0.00 ? 19   THR r CA 1 
ATOM 8464 C CA . CYS CA 11 20   ? 303.529 161.984 274.372 1.00 0.00 ? 20   CYS r CA 1 
ATOM 8465 C CA . GLU CA 11 21   ? 301.253 165.000 274.554 1.00 0.00 ? 21   GLU r CA 1 
ATOM 8466 C CA . THR CA 11 22   ? 297.868 164.231 273.002 1.00 0.00 ? 22   THR r CA 1 
ATOM 8467 C CA . ASN CA 11 23   ? 295.584 166.593 271.037 1.00 0.00 ? 23   ASN r CA 1 
ATOM 8468 C CA . THR CA 11 24   ? 293.519 167.102 274.226 1.00 0.00 ? 24   THR r CA 1 
ATOM 8469 C CA . GLY CA 11 25   ? 296.507 168.041 276.363 1.00 0.00 ? 25   GLY r CA 1 
ATOM 8470 C CA . GLU CA 11 26   ? 297.259 164.778 278.183 1.00 0.00 ? 26   GLU r CA 1 
ATOM 8471 C CA . VAL CA 11 27   ? 300.964 164.271 278.806 1.00 0.00 ? 27   VAL r CA 1 
ATOM 8472 C CA . TYR CA 11 28   ? 302.144 160.634 278.636 1.00 0.00 ? 28   TYR r CA 1 
ATOM 8473 C CA . ARG CA 11 29   ? 305.717 159.851 279.748 1.00 0.00 ? 29   ARG r CA 1 
ATOM 8474 C CA . GLY CA 11 30   ? 307.091 156.288 279.829 1.00 0.00 ? 30   GLY r CA 1 
ATOM 8475 C CA . LYS CA 11 31   ? 309.025 153.708 277.832 1.00 0.00 ? 31   LYS r CA 1 
ATOM 8476 C CA . LEU CA 11 32   ? 308.029 153.108 274.219 1.00 0.00 ? 32   LEU r CA 1 
ATOM 8477 C CA . ILE CA 11 33   ? 307.447 149.370 273.824 1.00 0.00 ? 33   ILE r CA 1 
ATOM 8478 C CA . GLU CA 11 34   ? 306.580 149.482 270.108 1.00 0.00 ? 34   GLU r CA 1 
ATOM 8479 C CA . ALA CA 11 35   ? 305.716 152.297 267.592 1.00 0.00 ? 35   ALA r CA 1 
ATOM 8480 C CA . GLU CA 11 36   ? 303.320 150.991 264.856 1.00 0.00 ? 36   GLU r CA 1 
ATOM 8481 C CA . ASP CA 11 37   ? 303.363 151.757 261.069 1.00 0.00 ? 37   ASP r CA 1 
ATOM 8482 C CA . ASN CA 11 38   ? 300.478 154.238 261.492 1.00 0.00 ? 38   ASN r CA 1 
ATOM 8483 C CA . MET CA 11 39   ? 301.844 156.060 264.553 1.00 0.00 ? 39   MET r CA 1 
ATOM 8484 C CA . ASN CA 11 40   ? 299.910 154.000 267.073 1.00 0.00 ? 40   ASN r CA 1 
ATOM 8485 C CA . CYS CA 11 41   ? 302.142 153.406 270.126 1.00 0.00 ? 41   CYS r CA 1 
ATOM 8486 C CA . GLN CA 11 42   ? 302.359 151.102 273.114 1.00 0.00 ? 42   GLN r CA 1 
ATOM 8487 C CA . MET CA 11 43   ? 303.878 152.300 276.416 1.00 0.00 ? 43   MET r CA 1 
ATOM 8488 C CA . SER CA 11 44   ? 304.557 150.787 279.829 1.00 0.00 ? 44   SER r CA 1 
ATOM 8489 C CA . ASN CA 11 45   ? 305.359 152.360 283.227 1.00 0.00 ? 45   ASN r CA 1 
ATOM 8490 C CA . ILE CA 11 46   ? 303.667 155.552 282.099 1.00 0.00 ? 46   ILE r CA 1 
ATOM 8491 C CA . THR CA 11 47   ? 302.932 158.840 283.875 1.00 0.00 ? 47   THR r CA 1 
ATOM 8492 C CA . VAL CA 11 48   ? 299.872 160.822 282.742 1.00 0.00 ? 48   VAL r CA 1 
ATOM 8493 C CA . THR CA 11 49   ? 298.896 164.351 283.911 1.00 0.00 ? 49   THR r CA 1 
ATOM 8494 C CA . TYR CA 11 50   ? 295.359 165.501 283.180 1.00 0.00 ? 50   TYR r CA 1 
ATOM 8495 C CA . ARG CA 11 51   ? 294.184 169.097 282.692 1.00 0.00 ? 51   ARG r CA 1 
ATOM 8496 C CA . ASP CA 11 52   ? 293.275 169.147 286.344 1.00 0.00 ? 52   ASP r CA 1 
ATOM 8497 C CA . GLY CA 11 53   ? 296.760 168.102 287.548 1.00 0.00 ? 53   GLY r CA 1 
ATOM 8498 C CA . ARG CA 11 54   ? 295.558 164.610 288.360 1.00 0.00 ? 54   ARG r CA 1 
ATOM 8499 C CA . VAL CA 11 55   ? 298.457 162.253 287.635 1.00 0.00 ? 55   VAL r CA 1 
ATOM 8500 C CA . ALA CA 11 56   ? 297.345 158.773 286.724 1.00 0.00 ? 56   ALA r CA 1 
ATOM 8501 C CA . GLN CA 11 57   ? 300.220 156.286 286.747 1.00 0.00 ? 57   GLN r CA 1 
ATOM 8502 C CA . LEU CA 11 58   ? 299.402 153.470 284.291 1.00 0.00 ? 58   LEU r CA 1 
ATOM 8503 C CA . GLU CA 11 59   ? 301.352 150.227 283.915 1.00 0.00 ? 59   GLU r CA 1 
ATOM 8504 C CA . GLN CA 11 60   ? 300.364 150.409 280.222 1.00 0.00 ? 60   GLN r CA 1 
ATOM 8505 C CA . VAL CA 11 61   ? 298.790 152.828 277.673 1.00 0.00 ? 61   VAL r CA 1 
ATOM 8506 C CA . TYR CA 11 62   ? 297.867 152.610 273.999 1.00 0.00 ? 62   TYR r CA 1 
ATOM 8507 C CA . ILE CA 11 63   ? 298.042 156.056 272.299 1.00 0.00 ? 63   ILE r CA 1 
ATOM 8508 C CA . ARG CA 11 64   ? 296.605 156.229 268.777 1.00 0.00 ? 64   ARG r CA 1 
ATOM 8509 C CA . GLY CA 11 65   ? 298.821 157.852 266.150 1.00 0.00 ? 65   GLY r CA 1 
ATOM 8510 C CA . SER CA 11 66   ? 296.292 160.527 265.255 1.00 0.00 ? 66   SER r CA 1 
ATOM 8511 C CA . LYS CA 11 67   ? 295.871 161.317 268.956 1.00 0.00 ? 67   LYS r CA 1 
ATOM 8512 C CA . ILE CA 11 68   ? 299.503 162.554 269.077 1.00 0.00 ? 68   ILE r CA 1 
ATOM 8513 C CA . ARG CA 11 69   ? 300.094 166.361 269.048 1.00 0.00 ? 69   ARG r CA 1 
ATOM 8514 C CA . PHE CA 11 70   ? 303.851 165.752 269.288 1.00 0.00 ? 70   PHE r CA 1 
ATOM 8515 C CA . LEU CA 11 71   ? 306.523 163.444 270.728 1.00 0.00 ? 71   LEU r CA 1 
ATOM 8516 C CA . ILE CA 11 72   ? 309.593 164.427 272.789 1.00 0.00 ? 72   ILE r CA 1 
ATOM 8517 C CA . LEU CA 11 73   ? 312.288 161.912 271.836 1.00 0.00 ? 73   LEU r CA 1 
ATOM 8518 C CA . PRO CA 11 74   ? 315.660 161.171 273.547 1.00 0.00 ? 74   PRO r CA 1 
ATOM 8519 C CA . ASP CA 11 75   ? 318.760 162.908 272.140 1.00 0.00 ? 75   ASP r CA 1 
ATOM 8520 C CA . MET CA 11 76   ? 321.636 160.328 272.504 1.00 0.00 ? 76   MET r CA 1 
ATOM 8521 C CA . LEU CA 11 77   ? 320.578 158.482 269.323 1.00 0.00 ? 77   LEU r CA 1 
ATOM 8522 C CA . LYS CA 11 78   ? 321.917 158.408 265.746 1.00 0.00 ? 78   LYS r CA 1 
ATOM 8523 C CA . ASN CA 11 79   ? 320.293 159.378 262.393 1.00 0.00 ? 79   ASN r CA 1 
ATOM 8524 C CA . ALA CA 11 80   ? 321.499 157.844 259.139 1.00 0.00 ? 80   ALA r CA 1 
ATOM 8525 C CA . PRO CA 11 81   ? 324.364 159.556 257.186 1.00 0.00 ? 81   PRO r CA 1 
ATOM 8526 C CA . MET CA 11 82   ? 324.541 162.407 259.725 1.00 0.00 ? 82   MET r CA 1 
ATOM 8527 C CA . LEU CA 11 83   ? 326.999 161.789 262.581 1.00 0.00 ? 83   LEU r CA 1 
ATOM 8528 C CA . LYS CA 11 84   ? 326.077 162.974 266.077 1.00 0.00 ? 84   LYS r CA 1 
ATOM 8529 C CA . SER CA 11 85   ? 329.043 161.497 267.948 1.00 0.00 ? 85   SER r CA 1 
ATOM 8530 C CA . MET CA 11 86   ? 330.797 164.897 268.381 1.00 0.00 ? 86   MET r CA 1 
ATOM 8531 C CA . LYS CA 11 87   ? 327.596 166.658 269.494 1.00 0.00 ? 87   LYS r CA 1 
ATOM 8532 C CA . ASN CA 11 88   ? 326.536 164.281 272.271 1.00 0.00 ? 88   ASN r CA 1 
ATOM 8533 C CA . LYS CA 11 89   ? 329.790 164.270 274.259 1.00 0.00 ? 89   LYS r CA 1 
ATOM 8534 C CA . ASN CA 11 90   ? 329.703 168.096 274.811 1.00 0.00 ? 90   ASN r CA 1 
ATOM 8535 C CA . GLN CA 11 91   ? 326.391 167.631 276.636 1.00 0.00 ? 91   GLN r CA 1 
ATOM 8536 C CA . VAL DA 12 15   ? 284.747 128.400 264.042 1.00 0.00 ? 15   VAL s CA 1 
ATOM 8537 C CA . GLN DA 12 16   ? 286.738 130.929 266.133 1.00 0.00 ? 16   GLN s CA 1 
ATOM 8538 C CA . PRO DA 12 17   ? 286.362 134.052 263.893 1.00 0.00 ? 17   PRO s CA 1 
ATOM 8539 C CA . ILE DA 12 18   ? 288.480 136.890 265.378 1.00 0.00 ? 18   ILE s CA 1 
ATOM 8540 C CA . ASN DA 12 19   ? 289.701 138.787 262.308 1.00 0.00 ? 19   ASN s CA 1 
ATOM 8541 C CA . LEU DA 12 20   ? 286.784 141.180 261.619 1.00 0.00 ? 20   LEU s CA 1 
ATOM 8542 C CA . ILE DA 12 21   ? 283.340 142.382 262.767 1.00 0.00 ? 21   ILE s CA 1 
ATOM 8543 C CA . PHE DA 12 22   ? 281.741 142.636 259.295 1.00 0.00 ? 22   PHE s CA 1 
ATOM 8544 C CA . ARG DA 12 23   ? 280.897 139.032 259.835 1.00 0.00 ? 23   ARG s CA 1 
ATOM 8545 C CA . TYR DA 12 24   ? 279.366 140.347 263.059 1.00 0.00 ? 24   TYR s CA 1 
ATOM 8546 C CA . LEU DA 12 25   ? 276.691 142.183 261.063 1.00 0.00 ? 25   LEU s CA 1 
ATOM 8547 C CA . GLN DA 12 26   ? 275.579 139.322 258.782 1.00 0.00 ? 26   GLN s CA 1 
ATOM 8548 C CA . ASN DA 12 27   ? 274.206 137.245 261.712 1.00 0.00 ? 27   ASN s CA 1 
ATOM 8549 C CA . ARG DA 12 28   ? 272.809 140.477 263.073 1.00 0.00 ? 28   ARG s CA 1 
ATOM 8550 C CA . SER DA 12 29   ? 270.845 141.203 259.893 1.00 0.00 ? 29   SER s CA 1 
ATOM 8551 C CA . ARG DA 12 30   ? 267.113 141.701 260.667 1.00 0.00 ? 30   ARG s CA 1 
ATOM 8552 C CA . ILE DA 12 31   ? 267.884 141.967 264.431 1.00 0.00 ? 31   ILE s CA 1 
ATOM 8553 C CA . GLN DA 12 32   ? 267.051 144.982 266.623 1.00 0.00 ? 32   GLN s CA 1 
ATOM 8554 C CA . VAL DA 12 33   ? 269.917 147.479 266.569 1.00 0.00 ? 33   VAL s CA 1 
ATOM 8555 C CA . TRP DA 12 34   ? 271.013 150.786 268.221 1.00 0.00 ? 34   TRP s CA 1 
ATOM 8556 C CA . LEU DA 12 35   ? 272.748 153.900 266.634 1.00 0.00 ? 35   LEU s CA 1 
ATOM 8557 C CA . TYR DA 12 36   ? 275.108 156.272 268.442 1.00 0.00 ? 36   TYR s CA 1 
ATOM 8558 C CA . GLU DA 12 37   ? 276.374 159.651 267.144 1.00 0.00 ? 37   GLU s CA 1 
ATOM 8559 C CA . GLN DA 12 38   ? 278.936 162.341 268.201 1.00 0.00 ? 38   GLN s CA 1 
ATOM 8560 C CA . VAL DA 12 39   ? 276.047 164.897 268.147 1.00 0.00 ? 39   VAL s CA 1 
ATOM 8561 C CA . ASN DA 12 40   ? 274.555 163.460 271.378 1.00 0.00 ? 40   ASN s CA 1 
ATOM 8562 C CA . MET DA 12 41   ? 271.590 161.988 269.446 1.00 0.00 ? 41   MET s CA 1 
ATOM 8563 C CA . ARG DA 12 42   ? 270.631 158.489 268.418 1.00 0.00 ? 42   ARG s CA 1 
ATOM 8564 C CA . ILE DA 12 43   ? 268.442 156.172 266.345 1.00 0.00 ? 43   ILE s CA 1 
ATOM 8565 C CA . GLU DA 12 44   ? 266.723 152.760 266.843 1.00 0.00 ? 44   GLU s CA 1 
ATOM 8566 C CA . GLY DA 12 45   ? 265.941 150.404 263.867 1.00 0.00 ? 45   GLY s CA 1 
ATOM 8567 C CA . CYS DA 12 46   ? 265.949 146.944 262.163 1.00 0.00 ? 46   CYS s CA 1 
ATOM 8568 C CA . ILE DA 12 47   ? 269.106 146.678 259.948 1.00 0.00 ? 47   ILE s CA 1 
ATOM 8569 C CA . ILE DA 12 48   ? 268.405 145.540 256.378 1.00 0.00 ? 48   ILE s CA 1 
ATOM 8570 C CA . GLY DA 12 49   ? 271.726 146.042 254.448 1.00 0.00 ? 49   GLY s CA 1 
ATOM 8571 C CA . PHE DA 12 50   ? 275.256 147.436 254.788 1.00 0.00 ? 50   PHE s CA 1 
ATOM 8572 C CA . ASP DA 12 51   ? 278.499 148.253 252.963 1.00 0.00 ? 51   ASP s CA 1 
ATOM 8573 C CA . GLU DA 12 52   ? 282.187 148.075 254.035 1.00 0.00 ? 52   GLU s CA 1 
ATOM 8574 C CA . TYR DA 12 53   ? 282.272 151.852 254.707 1.00 0.00 ? 53   TYR s CA 1 
ATOM 8575 C CA . MET DA 12 54   ? 279.875 151.012 257.592 1.00 0.00 ? 54   MET s CA 1 
ATOM 8576 C CA . ASN DA 12 55   ? 276.944 152.629 255.832 1.00 0.00 ? 55   ASN s CA 1 
ATOM 8577 C CA . LEU DA 12 56   ? 273.797 150.904 256.987 1.00 0.00 ? 56   LEU s CA 1 
ATOM 8578 C CA . VAL DA 12 57   ? 270.146 150.816 255.995 1.00 0.00 ? 57   VAL s CA 1 
ATOM 8579 C CA . LEU DA 12 58   ? 267.613 150.776 258.872 1.00 0.00 ? 58   LEU s CA 1 
ATOM 8580 C CA . ASP DA 12 59   ? 263.759 150.377 258.806 1.00 0.00 ? 59   ASP s CA 1 
ATOM 8581 C CA . ASP DA 12 60   ? 261.315 151.280 261.559 1.00 0.00 ? 60   ASP s CA 1 
ATOM 8582 C CA . ALA DA 12 61   ? 263.743 153.950 262.897 1.00 0.00 ? 61   ALA s CA 1 
ATOM 8583 C CA . GLU DA 12 62   ? 263.093 156.353 265.819 1.00 0.00 ? 62   GLU s CA 1 
ATOM 8584 C CA . GLU DA 12 63   ? 265.345 159.408 266.278 1.00 0.00 ? 63   GLU s CA 1 
ATOM 8585 C CA . ILE DA 12 64   ? 266.384 159.898 269.912 1.00 0.00 ? 64   ILE s CA 1 
ATOM 8586 C CA . HIS DA 12 65   ? 267.386 163.143 271.652 1.00 0.00 ? 65   HIS s CA 1 
ATOM 8587 C CA . SER DA 12 66   ? 269.869 163.899 274.478 1.00 0.00 ? 66   SER s CA 1 
ATOM 8588 C CA . LYS DA 12 67   ? 266.955 165.322 276.535 1.00 0.00 ? 67   LYS s CA 1 
ATOM 8589 C CA . THR DA 12 68   ? 265.760 161.654 276.527 1.00 0.00 ? 68   THR s CA 1 
ATOM 8590 C CA . LYS DA 12 69   ? 262.963 162.555 274.095 1.00 0.00 ? 69   LYS s CA 1 
ATOM 8591 C CA . SER DA 12 70   ? 262.676 160.453 270.984 1.00 0.00 ? 70   SER s CA 1 
ATOM 8592 C CA . ARG DA 12 71   ? 262.477 163.020 268.211 1.00 0.00 ? 71   ARG s CA 1 
ATOM 8593 C CA . LYS DA 12 72   ? 260.761 161.084 265.345 1.00 0.00 ? 72   LYS s CA 1 
ATOM 8594 C CA . GLN DA 12 73   ? 260.202 157.639 263.697 1.00 0.00 ? 73   GLN s CA 1 
ATOM 8595 C CA . LEU DA 12 74   ? 261.112 157.171 260.016 1.00 0.00 ? 74   LEU s CA 1 
ATOM 8596 C CA . GLY DA 12 75   ? 260.269 154.761 257.258 1.00 0.00 ? 75   GLY s CA 1 
ATOM 8597 C CA . ARG DA 12 76   ? 263.538 154.130 255.481 1.00 0.00 ? 76   ARG s CA 1 
ATOM 8598 C CA . ILE DA 12 77   ? 266.924 155.540 256.459 1.00 0.00 ? 77   ILE s CA 1 
ATOM 8599 C CA . MET DA 12 78   ? 270.362 155.102 254.817 1.00 0.00 ? 78   MET s CA 1 
ATOM 8600 C CA . LEU DA 12 79   ? 273.225 156.247 257.025 1.00 0.00 ? 79   LEU s CA 1 
ATOM 8601 C CA . LYS DA 12 80   ? 276.763 157.599 256.187 1.00 0.00 ? 80   LYS s CA 1 
ATOM 8602 C CA . GLY DA 12 81   ? 279.492 155.520 257.764 1.00 0.00 ? 81   GLY s CA 1 
ATOM 8603 C CA . ASP DA 12 82   ? 281.739 158.436 258.655 1.00 0.00 ? 82   ASP s CA 1 
ATOM 8604 C CA . ASN DA 12 83   ? 279.123 159.790 261.039 1.00 0.00 ? 83   ASN s CA 1 
ATOM 8605 C CA . ILE DA 12 84   ? 278.636 156.493 262.938 1.00 0.00 ? 84   ILE s CA 1 
ATOM 8606 C CA . THR DA 12 85   ? 280.245 156.400 266.399 1.00 0.00 ? 85   THR s CA 1 
ATOM 8607 C CA . LEU DA 12 86   ? 278.706 153.435 268.264 1.00 0.00 ? 86   LEU s CA 1 
ATOM 8608 C CA . LEU DA 12 87   ? 276.051 150.744 267.761 1.00 0.00 ? 87   LEU s CA 1 
ATOM 8609 C CA . GLN DA 12 88   ? 274.576 148.319 270.267 1.00 0.00 ? 88   GLN s CA 1 
ATOM 8610 C CA . SER DA 12 89   ? 272.206 145.364 270.143 1.00 0.00 ? 89   SER s CA 1 
ATOM 8611 C CA . VAL DA 12 90   ? 270.439 142.943 272.572 1.00 0.00 ? 90   VAL s CA 1 
ATOM 8612 C CA . SER DA 12 91   ? 270.171 145.706 275.220 1.00 0.00 ? 91   SER s CA 1 
ATOM 8613 C CA . ASN DA 12 92   ? 267.180 146.028 277.580 1.00 0.00 ? 92   ASN s CA 1 
ATOM 8614 C CA . PRO EA 13 4    ? 278.863 144.813 242.096 1.00 0.00 ? 4    PRO t CA 1 
ATOM 8615 C CA . LEU EA 13 5    ? 280.875 147.605 243.795 1.00 0.00 ? 5    LEU t CA 1 
ATOM 8616 C CA . ASN EA 13 6    ? 279.452 150.258 246.169 1.00 0.00 ? 6    ASN t CA 1 
ATOM 8617 C CA . PRO EA 13 7    ? 279.544 153.406 243.946 1.00 0.00 ? 7    PRO t CA 1 
ATOM 8618 C CA . LYS EA 13 8    ? 277.845 152.490 240.642 1.00 0.00 ? 8    LYS t CA 1 
ATOM 8619 C CA . PRO EA 13 9    ? 274.729 150.508 241.849 1.00 0.00 ? 9    PRO t CA 1 
ATOM 8620 C CA . PHE EA 13 10   ? 273.192 153.289 243.892 1.00 0.00 ? 10   PHE t CA 1 
ATOM 8621 C CA . LEU EA 13 11   ? 272.719 155.710 241.007 1.00 0.00 ? 11   LEU t CA 1 
ATOM 8622 C CA . ASN EA 13 12   ? 270.235 153.420 239.173 1.00 0.00 ? 12   ASN t CA 1 
ATOM 8623 C CA . GLY EA 13 13   ? 268.015 152.629 242.184 1.00 0.00 ? 13   GLY t CA 1 
ATOM 8624 C CA . LEU EA 13 14   ? 267.617 156.220 243.416 1.00 0.00 ? 14   LEU t CA 1 
ATOM 8625 C CA . THR EA 13 15   ? 267.151 158.084 240.097 1.00 0.00 ? 15   THR t CA 1 
ATOM 8626 C CA . GLY EA 13 16   ? 264.195 160.501 240.085 1.00 0.00 ? 16   GLY t CA 1 
ATOM 8627 C CA . LYS EA 13 17   ? 263.240 159.865 243.743 1.00 0.00 ? 17   LYS t CA 1 
ATOM 8628 C CA . PRO EA 13 18   ? 261.894 162.231 246.436 1.00 0.00 ? 18   PRO t CA 1 
ATOM 8629 C CA . VAL EA 13 19   ? 263.744 162.365 249.773 1.00 0.00 ? 19   VAL t CA 1 
ATOM 8630 C CA . MET EA 13 20   ? 264.480 164.446 252.832 1.00 0.00 ? 20   MET t CA 1 
ATOM 8631 C CA . VAL EA 13 21   ? 268.236 164.819 253.447 1.00 0.00 ? 21   VAL t CA 1 
ATOM 8632 C CA . LYS EA 13 22   ? 269.898 165.544 256.832 1.00 0.00 ? 22   LYS t CA 1 
ATOM 8633 C CA . LEU EA 13 23   ? 273.313 167.084 257.242 1.00 0.00 ? 23   LEU t CA 1 
ATOM 8634 C CA . LYS EA 13 24   ? 275.810 166.713 260.168 1.00 0.00 ? 24   LYS t CA 1 
ATOM 8635 C CA . TRP EA 13 25   ? 275.323 170.476 260.587 1.00 0.00 ? 25   TRP t CA 1 
ATOM 8636 C CA . GLY EA 13 26   ? 271.646 169.678 261.216 1.00 0.00 ? 26   GLY t CA 1 
ATOM 8637 C CA . MET EA 13 27   ? 270.342 171.478 258.191 1.00 0.00 ? 27   MET t CA 1 
ATOM 8638 C CA . GLU EA 13 28   ? 267.761 169.623 256.076 1.00 0.00 ? 28   GLU t CA 1 
ATOM 8639 C CA . TYR EA 13 29   ? 267.169 169.681 252.288 1.00 0.00 ? 29   TYR t CA 1 
ATOM 8640 C CA . LYS EA 13 30   ? 264.207 167.995 250.620 1.00 0.00 ? 30   LYS t CA 1 
ATOM 8641 C CA . GLY EA 13 31   ? 263.715 167.580 246.869 1.00 0.00 ? 31   GLY t CA 1 
ATOM 8642 C CA . TYR EA 13 32   ? 263.864 165.153 243.977 1.00 0.00 ? 32   TYR t CA 1 
ATOM 8643 C CA . LEU EA 13 33   ? 267.073 163.064 243.740 1.00 0.00 ? 33   LEU t CA 1 
ATOM 8644 C CA . VAL EA 13 34   ? 268.415 163.157 240.180 1.00 0.00 ? 34   VAL t CA 1 
ATOM 8645 C CA . SER EA 13 35   ? 271.924 161.714 240.625 1.00 0.00 ? 35   SER t CA 1 
ATOM 8646 C CA . VAL EA 13 36   ? 274.723 160.479 242.920 1.00 0.00 ? 36   VAL t CA 1 
ATOM 8647 C CA . ASP EA 13 37   ? 278.453 159.634 242.643 1.00 0.00 ? 37   ASP t CA 1 
ATOM 8648 C CA . GLY EA 13 38   ? 281.154 157.522 244.482 1.00 0.00 ? 38   GLY t CA 1 
ATOM 8649 C CA . TYR EA 13 39   ? 281.529 159.973 247.426 1.00 0.00 ? 39   TYR t CA 1 
ATOM 8650 C CA . MET EA 13 40   ? 277.729 159.930 248.139 1.00 0.00 ? 40   MET t CA 1 
ATOM 8651 C CA . ASN EA 13 41   ? 277.668 163.490 246.730 1.00 0.00 ? 41   ASN t CA 1 
ATOM 8652 C CA . MET EA 13 42   ? 274.054 163.986 245.702 1.00 0.00 ? 42   MET t CA 1 
ATOM 8653 C CA . GLN EA 13 43   ? 272.189 166.341 243.368 1.00 0.00 ? 43   GLN t CA 1 
ATOM 8654 C CA . LEU EA 13 44   ? 268.558 167.330 244.074 1.00 0.00 ? 44   LEU t CA 1 
ATOM 8655 C CA . ALA EA 13 45   ? 265.911 169.108 241.885 1.00 0.00 ? 45   ALA t CA 1 
ATOM 8656 C CA . ASN EA 13 46   ? 263.168 171.419 243.202 1.00 0.00 ? 46   ASN t CA 1 
ATOM 8657 C CA . THR EA 13 47   ? 265.094 171.165 246.455 1.00 0.00 ? 47   THR t CA 1 
ATOM 8658 C CA . GLU EA 13 48   ? 263.829 172.693 249.729 1.00 0.00 ? 48   GLU t CA 1 
ATOM 8659 C CA . GLU EA 13 49   ? 265.935 173.867 252.677 1.00 0.00 ? 49   GLU t CA 1 
ATOM 8660 C CA . TYR EA 13 50   ? 264.628 173.731 256.188 1.00 0.00 ? 50   TYR t CA 1 
ATOM 8661 C CA . ILE EA 13 51   ? 266.081 175.390 259.285 1.00 0.00 ? 51   ILE t CA 1 
ATOM 8662 C CA . ASP EA 13 52   ? 264.879 174.496 262.821 1.00 0.00 ? 52   ASP t CA 1 
ATOM 8663 C CA . GLY EA 13 53   ? 262.008 172.498 261.293 1.00 0.00 ? 53   GLY t CA 1 
ATOM 8664 C CA . ALA EA 13 54   ? 260.666 175.394 259.126 1.00 0.00 ? 54   ALA t CA 1 
ATOM 8665 C CA . LEU EA 13 55   ? 260.943 176.091 255.394 1.00 0.00 ? 55   LEU t CA 1 
ATOM 8666 C CA . SER EA 13 56   ? 263.612 178.848 255.223 1.00 0.00 ? 56   SER t CA 1 
ATOM 8667 C CA . GLY EA 13 57   ? 264.408 178.726 251.466 1.00 0.00 ? 57   GLY t CA 1 
ATOM 8668 C CA . HIS EA 13 58   ? 264.403 176.817 248.171 1.00 0.00 ? 58   HIS t CA 1 
ATOM 8669 C CA . LEU EA 13 59   ? 266.121 176.595 244.781 1.00 0.00 ? 59   LEU t CA 1 
ATOM 8670 C CA . GLY EA 13 60   ? 265.933 174.944 241.340 1.00 0.00 ? 60   GLY t CA 1 
ATOM 8671 C CA . GLU EA 13 61   ? 268.990 172.659 241.608 1.00 0.00 ? 61   GLU t CA 1 
ATOM 8672 C CA . VAL EA 13 62   ? 271.587 171.902 244.234 1.00 0.00 ? 62   VAL t CA 1 
ATOM 8673 C CA . LEU EA 13 63   ? 274.907 170.155 244.840 1.00 0.00 ? 63   LEU t CA 1 
ATOM 8674 C CA . ILE EA 13 64   ? 275.890 168.760 248.270 1.00 0.00 ? 64   ILE t CA 1 
ATOM 8675 C CA . ARG EA 13 65   ? 279.537 167.813 249.112 1.00 0.00 ? 65   ARG t CA 1 
ATOM 8676 C CA . CYS EA 13 66   ? 278.698 164.599 250.925 1.00 0.00 ? 66   CYS t CA 1 
ATOM 8677 C CA . ASN EA 13 67   ? 280.923 165.092 253.992 1.00 0.00 ? 67   ASN t CA 1 
ATOM 8678 C CA . ASN EA 13 68   ? 277.970 167.273 255.158 1.00 0.00 ? 68   ASN t CA 1 
ATOM 8679 C CA . VAL EA 13 69   ? 275.488 164.457 254.263 1.00 0.00 ? 69   VAL t CA 1 
ATOM 8680 C CA . LEU EA 13 70   ? 274.551 162.297 257.282 1.00 0.00 ? 70   LEU t CA 1 
ATOM 8681 C CA . TYR EA 13 71   ? 271.729 160.175 255.895 1.00 0.00 ? 71   TYR t CA 1 
ATOM 8682 C CA . ILE EA 13 72   ? 268.678 160.004 253.587 1.00 0.00 ? 72   ILE t CA 1 
ATOM 8683 C CA . ARG EA 13 73   ? 264.984 159.459 254.425 1.00 0.00 ? 73   ARG t CA 1 
ATOM 8684 C CA . GLY EA 13 74   ? 262.261 158.959 251.820 1.00 0.00 ? 74   GLY t CA 1 
ATOM 8685 C CA . VAL EA 13 75   ? 258.961 159.587 253.617 1.00 0.00 ? 75   VAL t CA 1 
ATOM 8686 C CA . GLU EA 13 76   ? 257.520 161.964 250.968 1.00 0.00 ? 76   GLU t CA 1 
ATOM 8687 C CA . GLU EA 13 77   ? 257.348 159.327 248.178 1.00 0.00 ? 77   GLU t CA 1 
ATOM 8688 C CA . GLU EA 13 78   ? 253.648 158.630 248.819 1.00 0.00 ? 78   GLU t CA 1 
ATOM 8689 C CA . GLU EA 13 79   ? 252.868 162.345 249.255 1.00 0.00 ? 79   GLU t CA 1 
ATOM 8690 C CA . GLU EA 13 80   ? 254.119 163.317 245.779 1.00 0.00 ? 80   GLU t CA 1 
ATOM 8691 C CA . ASP EA 13 81   ? 251.847 160.737 244.122 1.00 0.00 ? 81   ASP t CA 1 
ATOM 8692 C CA . GLY EA 13 82   ? 248.751 161.810 246.079 1.00 0.00 ? 82   GLY t CA 1 
ATOM 8693 C CA . GLU EA 13 83   ? 249.119 165.521 245.511 1.00 0.00 ? 83   GLU t CA 1 
ATOM 8694 C CA . MET EA 13 84   ? 249.101 165.017 241.630 1.00 0.00 ? 84   MET t CA 1 
ATOM 8695 C CA . ARG EA 13 85   ? 245.875 162.974 241.826 1.00 0.00 ? 85   ARG t CA 1 
ATOM 8696 C CA . GLU EA 13 86   ? 244.188 165.802 243.744 1.00 0.00 ? 86   GLU t CA 1 
ATOM 8697 C CA . ALA FA 14 4    ? 299.824 146.352 263.527 1.00 0.00 ? 4    ALA u CA 1 
ATOM 8698 C CA . HIS FA 14 5    ? 296.224 145.132 264.111 1.00 0.00 ? 5    HIS u CA 1 
ATOM 8699 C CA . PRO FA 14 6    ? 296.323 141.441 265.494 1.00 0.00 ? 6    PRO u CA 1 
ATOM 8700 C CA . PRO FA 14 7    ? 299.363 141.915 267.755 1.00 0.00 ? 7    PRO u CA 1 
ATOM 8701 C CA . GLU FA 14 8    ? 297.221 144.650 269.374 1.00 0.00 ? 8    GLU u CA 1 
ATOM 8702 C CA . LEU FA 14 9    ? 294.328 142.115 269.236 1.00 0.00 ? 9    LEU u CA 1 
ATOM 8703 C CA . LYS FA 14 10   ? 296.113 138.936 270.512 1.00 0.00 ? 10   LYS u CA 1 
ATOM 8704 C CA . LYS FA 14 11   ? 297.342 140.700 273.641 1.00 0.00 ? 11   LYS u CA 1 
ATOM 8705 C CA . PHE FA 14 12   ? 293.855 141.898 274.695 1.00 0.00 ? 12   PHE u CA 1 
ATOM 8706 C CA . MET FA 14 13   ? 291.040 139.976 273.015 1.00 0.00 ? 13   MET u CA 1 
ATOM 8707 C CA . ASP FA 14 14   ? 288.863 138.098 275.533 1.00 0.00 ? 14   ASP u CA 1 
ATOM 8708 C CA . LYS FA 14 15   ? 290.104 140.123 278.548 1.00 0.00 ? 15   LYS u CA 1 
ATOM 8709 C CA . LYS FA 14 16   ? 288.772 143.055 280.578 1.00 0.00 ? 16   LYS u CA 1 
ATOM 8710 C CA . LEU FA 14 17   ? 289.852 146.243 278.686 1.00 0.00 ? 17   LEU u CA 1 
ATOM 8711 C CA . SER FA 14 18   ? 289.352 149.996 279.437 1.00 0.00 ? 18   SER u CA 1 
ATOM 8712 C CA . LEU FA 14 19   ? 288.626 152.554 276.682 1.00 0.00 ? 19   LEU u CA 1 
ATOM 8713 C CA . LYS FA 14 20   ? 288.641 156.380 276.969 1.00 0.00 ? 20   LYS u CA 1 
ATOM 8714 C CA . LEU FA 14 21   ? 287.017 158.213 274.091 1.00 0.00 ? 21   LEU u CA 1 
ATOM 8715 C CA . ASN FA 14 22   ? 286.731 161.790 272.903 1.00 0.00 ? 22   ASN u CA 1 
ATOM 8716 C CA . GLY FA 14 23   ? 283.136 161.546 274.095 1.00 0.00 ? 23   GLY u CA 1 
ATOM 8717 C CA . GLY FA 14 24   ? 284.788 162.113 277.465 1.00 0.00 ? 24   GLY u CA 1 
ATOM 8718 C CA . ARG FA 14 25   ? 283.265 158.913 278.772 1.00 0.00 ? 25   ARG u CA 1 
ATOM 8719 C CA . HIS FA 14 26   ? 285.008 155.933 280.270 1.00 0.00 ? 26   HIS u CA 1 
ATOM 8720 C CA . VAL FA 14 27   ? 283.908 152.544 279.015 1.00 0.00 ? 27   VAL u CA 1 
ATOM 8721 C CA . GLN FA 14 28   ? 285.121 149.071 280.025 1.00 0.00 ? 28   GLN u CA 1 
ATOM 8722 C CA . GLY FA 14 29   ? 284.420 145.864 278.193 1.00 0.00 ? 29   GLY u CA 1 
ATOM 8723 C CA . ILE FA 14 30   ? 285.572 142.543 276.786 1.00 0.00 ? 30   ILE u CA 1 
ATOM 8724 C CA . LEU FA 14 31   ? 287.231 142.818 273.382 1.00 0.00 ? 31   LEU u CA 1 
ATOM 8725 C CA . ARG FA 14 32   ? 285.606 140.363 270.994 1.00 0.00 ? 32   ARG u CA 1 
ATOM 8726 C CA . GLY FA 14 33   ? 286.200 141.885 267.545 1.00 0.00 ? 33   GLY u CA 1 
ATOM 8727 C CA . PHE FA 14 34   ? 288.783 144.082 265.825 1.00 0.00 ? 34   PHE u CA 1 
ATOM 8728 C CA . ASP FA 14 35   ? 289.697 145.534 262.400 1.00 0.00 ? 35   ASP u CA 1 
ATOM 8729 C CA . PRO FA 14 36   ? 292.455 147.663 260.588 1.00 0.00 ? 36   PRO u CA 1 
ATOM 8730 C CA . PHE FA 14 37   ? 290.720 151.053 261.180 1.00 0.00 ? 37   PHE u CA 1 
ATOM 8731 C CA . MET FA 14 38   ? 290.926 150.267 264.962 1.00 0.00 ? 38   MET u CA 1 
ATOM 8732 C CA . ASN FA 14 39   ? 287.171 149.566 265.059 1.00 0.00 ? 39   ASN u CA 1 
ATOM 8733 C CA . LEU FA 14 40   ? 286.336 147.462 268.154 1.00 0.00 ? 40   LEU u CA 1 
ATOM 8734 C CA . VAL FA 14 41   ? 283.345 145.293 269.226 1.00 0.00 ? 41   VAL u CA 1 
ATOM 8735 C CA . ILE FA 14 42   ? 282.877 144.894 272.948 1.00 0.00 ? 42   ILE u CA 1 
ATOM 8736 C CA . ASP FA 14 43   ? 280.972 142.275 274.867 1.00 0.00 ? 43   ASP u CA 1 
ATOM 8737 C CA . GLU FA 14 44   ? 279.477 143.261 278.220 1.00 0.00 ? 44   GLU u CA 1 
ATOM 8738 C CA . CYS FA 14 45   ? 280.393 146.955 278.158 1.00 0.00 ? 45   CYS u CA 1 
ATOM 8739 C CA . VAL FA 14 46   ? 279.513 149.857 280.500 1.00 0.00 ? 46   VAL u CA 1 
ATOM 8740 C CA . GLU FA 14 47   ? 279.384 153.651 279.768 1.00 0.00 ? 47   GLU u CA 1 
ATOM 8741 C CA . MET FA 14 48   ? 279.727 156.551 282.239 1.00 0.00 ? 48   MET u CA 1 
ATOM 8742 C CA . ALA FA 14 49   ? 278.697 160.162 281.438 1.00 0.00 ? 49   ALA u CA 1 
ATOM 8743 C CA . THR FA 14 50   ? 279.010 162.826 284.086 1.00 0.00 ? 50   THR u CA 1 
ATOM 8744 C CA . SER FA 14 51   ? 281.165 160.235 285.869 1.00 0.00 ? 51   SER u CA 1 
ATOM 8745 C CA . GLY FA 14 52   ? 278.067 158.273 286.752 1.00 0.00 ? 52   GLY u CA 1 
ATOM 8746 C CA . GLN FA 14 53   ? 277.772 154.692 285.631 1.00 0.00 ? 53   GLN u CA 1 
ATOM 8747 C CA . GLN FA 14 54   ? 274.824 155.379 283.385 1.00 0.00 ? 54   GLN u CA 1 
ATOM 8748 C CA . ASN FA 14 55   ? 274.564 152.436 280.896 1.00 0.00 ? 55   ASN u CA 1 
ATOM 8749 C CA . ASN FA 14 56   ? 275.334 148.703 280.271 1.00 0.00 ? 56   ASN u CA 1 
ATOM 8750 C CA . ILE FA 14 57   ? 275.209 146.840 276.913 1.00 0.00 ? 57   ILE u CA 1 
ATOM 8751 C CA . GLY FA 14 58   ? 275.784 143.173 275.988 1.00 0.00 ? 58   GLY u CA 1 
ATOM 8752 C CA . MET FA 14 59   ? 277.348 143.684 272.562 1.00 0.00 ? 59   MET u CA 1 
ATOM 8753 C CA . VAL FA 14 60   ? 278.487 146.920 270.888 1.00 0.00 ? 60   VAL u CA 1 
ATOM 8754 C CA . VAL FA 14 61   ? 280.409 148.138 267.778 1.00 0.00 ? 61   VAL u CA 1 
ATOM 8755 C CA . ILE FA 14 62   ? 282.911 151.011 267.887 1.00 0.00 ? 62   ILE u CA 1 
ATOM 8756 C CA . ARG FA 14 63   ? 284.889 153.188 265.456 1.00 0.00 ? 63   ARG u CA 1 
ATOM 8757 C CA . GLY FA 14 64   ? 288.687 153.434 265.938 1.00 0.00 ? 64   GLY u CA 1 
ATOM 8758 C CA . ASN FA 14 65   ? 288.723 157.055 264.795 1.00 0.00 ? 65   ASN u CA 1 
ATOM 8759 C CA . SER FA 14 66   ? 287.046 158.078 268.100 1.00 0.00 ? 66   SER u CA 1 
ATOM 8760 C CA . ILE FA 14 67   ? 289.462 155.949 270.220 1.00 0.00 ? 67   ILE u CA 1 
ATOM 8761 C CA . ILE FA 14 68   ? 292.087 157.901 272.193 1.00 0.00 ? 68   ILE u CA 1 
ATOM 8762 C CA . MET FA 14 69   ? 293.714 155.102 274.127 1.00 0.00 ? 69   MET u CA 1 
ATOM 8763 C CA . LEU FA 14 70   ? 293.178 151.627 275.565 1.00 0.00 ? 70   LEU u CA 1 
ATOM 8764 C CA . GLU FA 14 71   ? 294.044 150.104 278.983 1.00 0.00 ? 71   GLU u CA 1 
ATOM 8765 C CA . ALA FA 14 72   ? 293.493 146.691 280.685 1.00 0.00 ? 72   ALA u CA 1 
ATOM 8766 C CA . LEU FA 14 73   ? 292.478 145.940 284.322 1.00 0.00 ? 73   LEU u CA 1 
ATOM 8767 C CA . GLU FA 14 74   ? 292.862 142.602 286.161 1.00 0.00 ? 74   GLU u CA 1 
ATOM 8768 C CA . ARG FA 14 75   ? 292.231 141.184 289.649 1.00 0.00 ? 75   ARG u CA 1 
ATOM 8769 C CA . VAL FA 14 76   ? 289.170 143.490 290.105 1.00 0.00 ? 76   VAL u CA 1 
ATOM 8770 C CA . CYS GA 26 105  ? 150.116 239.677 200.310 1.00 0.00 ? 105  CYS V CA 1 
ATOM 8771 C CA . PRO GA 26 106  ? 149.401 237.349 203.324 1.00 0.00 ? 106  PRO V CA 1 
ATOM 8772 C CA . TYR GA 26 107  ? 152.549 235.359 202.454 1.00 0.00 ? 107  TYR V CA 1 
ATOM 8773 C CA . LEU GA 26 108  ? 154.834 238.426 202.651 1.00 0.00 ? 108  LEU V CA 1 
ATOM 8774 C CA . ASP GA 26 109  ? 155.227 237.964 206.409 1.00 0.00 ? 109  ASP V CA 1 
ATOM 8775 C CA . THR GA 26 110  ? 156.990 234.668 205.569 1.00 0.00 ? 110  THR V CA 1 
ATOM 8776 C CA . ILE GA 26 111  ? 159.869 236.453 203.773 1.00 0.00 ? 111  ILE V CA 1 
ATOM 8777 C CA . ASN GA 26 112  ? 163.190 236.420 205.648 1.00 0.00 ? 112  ASN V CA 1 
ATOM 8778 C CA . ARG GA 26 113  ? 165.507 239.128 204.270 1.00 0.00 ? 113  ARG V CA 1 
ATOM 8779 C CA . SER GA 26 114  ? 168.417 238.038 206.507 1.00 0.00 ? 114  SER V CA 1 
ATOM 8780 C CA . VAL GA 26 115  ? 168.660 234.832 204.430 1.00 0.00 ? 115  VAL V CA 1 
ATOM 8781 C CA . LEU GA 26 116  ? 168.828 236.657 201.074 1.00 0.00 ? 116  LEU V CA 1 
ATOM 8782 C CA . ASP GA 26 117  ? 172.236 236.950 199.425 1.00 0.00 ? 117  ASP V CA 1 
ATOM 8783 C CA . PHE GA 26 118  ? 172.360 237.961 195.745 1.00 0.00 ? 118  PHE V CA 1 
ATOM 8784 C CA . ASP GA 26 119  ? 176.159 237.788 195.334 1.00 0.00 ? 119  ASP V CA 1 
ATOM 8785 C CA . PHE GA 26 120  ? 176.067 234.005 194.735 1.00 0.00 ? 120  PHE V CA 1 
ATOM 8786 C CA . GLU GA 26 121  ? 176.431 232.212 191.422 1.00 0.00 ? 121  GLU V CA 1 
ATOM 8787 C CA . LYS GA 26 122  ? 173.046 232.320 189.696 1.00 0.00 ? 122  LYS V CA 1 
ATOM 8788 C CA . LEU GA 26 123  ? 172.425 228.564 189.401 1.00 0.00 ? 123  LEU V CA 1 
ATOM 8789 C CA . CYS GA 26 124  ? 169.678 226.188 190.544 1.00 0.00 ? 124  CYS V CA 1 
ATOM 8790 C CA . SER GA 26 125  ? 170.875 224.321 193.652 1.00 0.00 ? 125  SER V CA 1 
ATOM 8791 C CA . ILE GA 26 126  ? 169.117 221.182 192.382 1.00 0.00 ? 126  ILE V CA 1 
ATOM 8792 C CA . SER GA 26 127  ? 169.901 220.966 188.645 1.00 0.00 ? 127  SER V CA 1 
ATOM 8793 C CA . LEU GA 26 128  ? 172.890 223.348 188.672 1.00 0.00 ? 128  LEU V CA 1 
ATOM 8794 C CA . SER GA 26 129  ? 171.255 225.018 185.661 1.00 0.00 ? 129  SER V CA 1 
ATOM 8795 C CA . HIS GA 26 130  ? 171.746 228.767 185.068 1.00 0.00 ? 130  HIS V CA 1 
ATOM 8796 C CA . ILE GA 26 131  ? 168.519 229.071 183.149 1.00 0.00 ? 131  ILE V CA 1 
ATOM 8797 C CA . ASN GA 26 132  ? 165.388 230.647 184.641 1.00 0.00 ? 132  ASN V CA 1 
ATOM 8798 C CA . ALA GA 26 133  ? 166.688 230.718 188.220 1.00 0.00 ? 133  ALA V CA 1 
ATOM 8799 C CA . TYR GA 26 134  ? 164.500 231.942 191.083 1.00 0.00 ? 134  TYR V CA 1 
ATOM 8800 C CA . ALA GA 26 135  ? 165.440 232.828 194.653 1.00 0.00 ? 135  ALA V CA 1 
ATOM 8801 C CA . CYS GA 26 136  ? 163.138 231.514 197.373 1.00 0.00 ? 136  CYS V CA 1 
ATOM 8802 C CA . LEU GA 26 137  ? 162.523 234.537 199.595 1.00 0.00 ? 137  LEU V CA 1 
ATOM 8803 C CA . VAL GA 26 138  ? 161.880 232.361 202.643 1.00 0.00 ? 138  VAL V CA 1 
ATOM 8804 C CA . CYS GA 26 139  ? 165.082 230.280 202.782 1.00 0.00 ? 139  CYS V CA 1 
ATOM 8805 C CA . GLY GA 26 140  ? 167.249 232.125 200.218 1.00 0.00 ? 140  GLY V CA 1 
ATOM 8806 C CA . LYS GA 26 141  ? 168.201 229.057 198.123 1.00 0.00 ? 141  LYS V CA 1 
ATOM 8807 C CA . TYR GA 26 142  ? 167.997 229.268 194.313 1.00 0.00 ? 142  TYR V CA 1 
ATOM 8808 C CA . PHE GA 26 143  ? 165.775 227.028 192.181 1.00 0.00 ? 143  PHE V CA 1 
ATOM 8809 C CA . GLN GA 26 144  ? 164.961 226.777 188.473 1.00 0.00 ? 144  GLN V CA 1 
ATOM 8810 C CA . GLY GA 26 145  ? 161.307 227.620 187.862 1.00 0.00 ? 145  GLY V CA 1 
ATOM 8811 C CA . ARG GA 26 146  ? 158.536 228.057 187.554 1.00 0.00 ? 146  ARG V CA 1 
ATOM 8812 C CA . GLY GA 26 147  ? 156.274 225.550 185.761 1.00 0.00 ? 147  GLY V CA 1 
ATOM 8813 C CA . LEU GA 26 148  ? 155.005 222.398 187.503 1.00 0.00 ? 148  LEU V CA 1 
ATOM 8814 C CA . LYS GA 26 149  ? 157.733 219.771 187.949 1.00 0.00 ? 149  LYS V CA 1 
ATOM 8815 C CA . SER GA 26 150  ? 160.403 222.531 188.071 1.00 0.00 ? 150  SER V CA 1 
ATOM 8816 C CA . HIS GA 26 151  ? 162.560 222.586 191.229 1.00 0.00 ? 151  HIS V CA 1 
ATOM 8817 C CA . ALA GA 26 152  ? 161.068 225.921 192.315 1.00 0.00 ? 152  ALA V CA 1 
ATOM 8818 C CA . TYR GA 26 153  ? 157.477 224.694 192.000 1.00 0.00 ? 153  TYR V CA 1 
ATOM 8819 C CA . ILE GA 26 154  ? 158.295 221.458 193.860 1.00 0.00 ? 154  ILE V CA 1 
ATOM 8820 C CA . HIS GA 26 155  ? 160.207 223.438 196.504 1.00 0.00 ? 155  HIS V CA 1 
ATOM 8821 C CA . SER GA 26 156  ? 157.151 225.650 197.066 1.00 0.00 ? 156  SER V CA 1 
ATOM 8822 C CA . VAL GA 26 157  ? 154.846 222.709 197.836 1.00 0.00 ? 157  VAL V CA 1 
ATOM 8823 C CA . GLN GA 26 158  ? 157.248 220.408 199.718 1.00 0.00 ? 158  GLN V CA 1 
ATOM 8824 C CA . PHE GA 26 159  ? 158.989 223.123 201.779 1.00 0.00 ? 159  PHE V CA 1 
ATOM 8825 C CA . SER GA 26 160  ? 155.929 225.364 202.065 1.00 0.00 ? 160  SER V CA 1 
ATOM 8826 C CA . HIS GA 26 161  ? 157.826 228.433 200.800 1.00 0.00 ? 161  HIS V CA 1 
ATOM 8827 C CA . HIS GA 26 162  ? 155.682 230.478 198.433 1.00 0.00 ? 162  HIS V CA 1 
ATOM 8828 C CA . VAL GA 26 163  ? 157.365 233.808 197.548 1.00 0.00 ? 163  VAL V CA 1 
ATOM 8829 C CA . PHE GA 26 164  ? 160.025 233.867 194.804 1.00 0.00 ? 164  PHE V CA 1 
ATOM 8830 C CA . LEU GA 26 165  ? 162.115 236.398 192.891 1.00 0.00 ? 165  LEU V CA 1 
ATOM 8831 C CA . ASN GA 26 166  ? 163.053 235.712 189.265 1.00 0.00 ? 166  ASN V CA 1 
ATOM 8832 C CA . LEU GA 26 167  ? 166.768 236.562 189.318 1.00 0.00 ? 167  LEU V CA 1 
ATOM 8833 C CA . HIS GA 26 168  ? 166.802 237.563 185.640 1.00 0.00 ? 168  HIS V CA 1 
ATOM 8834 C CA . THR GA 26 169  ? 163.668 239.704 185.216 1.00 0.00 ? 169  THR V CA 1 
ATOM 8835 C CA . LEU GA 26 170  ? 163.377 240.735 188.880 1.00 0.00 ? 170  LEU V CA 1 
ATOM 8836 C CA . LYS GA 26 171  ? 159.648 240.014 188.949 1.00 0.00 ? 171  LYS V CA 1 
ATOM 8837 C CA . PHE GA 26 172  ? 158.103 238.445 192.070 1.00 0.00 ? 172  PHE V CA 1 
ATOM 8838 C CA . TYR GA 26 173  ? 155.930 235.319 191.950 1.00 0.00 ? 173  TYR V CA 1 
ATOM 8839 C CA . CYS GA 26 174  ? 153.768 233.256 194.256 1.00 0.00 ? 174  CYS V CA 1 
ATOM 8840 C CA . LEU GA 26 175  ? 154.062 229.488 193.846 1.00 0.00 ? 175  LEU V CA 1 
ATOM 8841 C CA . PRO GA 26 176  ? 152.361 227.169 193.403 1.00 0.00 ? 176  PRO V CA 1 
ATOM 8842 C CA . ASP GA 26 177  ? 149.715 229.735 192.454 1.00 0.00 ? 177  ASP V CA 1 
ATOM 8843 C CA . ASN GA 26 178  ? 152.141 230.815 189.705 1.00 0.00 ? 178  ASN V CA 1 
ATOM 8844 C CA . TYR GA 26 179  ? 150.939 234.438 189.538 1.00 0.00 ? 179  TYR V CA 1 
ATOM 8845 C CA . GLU GA 26 180  ? 153.153 237.538 189.402 1.00 0.00 ? 180  GLU V CA 1 
ATOM 8846 C CA . ILE GA 26 181  ? 152.952 239.912 192.382 1.00 0.00 ? 181  ILE V CA 1 
ATOM 8847 C CA . ILE GA 26 182  ? 151.948 243.167 190.666 1.00 0.00 ? 182  ILE V CA 1 
ATOM 8848 C CA . ASP GA 26 183  ? 152.657 245.046 193.914 1.00 0.00 ? 183  ASP V CA 1 
ATOM 8849 C CA . SER GA 26 184  ? 156.284 245.190 195.091 1.00 0.00 ? 184  SER V CA 1 
ATOM 8850 C CA . SER GA 26 185  ? 156.994 245.790 198.870 1.00 0.00 ? 185  SER V CA 1 
ATOM 8851 C CA . LEU GA 26 186  ? 159.526 244.018 197.929 1.00 0.00 ? 186  LEU V CA 1 
ATOM 8852 C CA . GLU GA 26 187  ? 161.202 247.295 196.933 1.00 0.00 ? 187  GLU V CA 1 
ATOM 8853 C CA . ASP GA 26 188  ? 163.895 246.514 199.527 1.00 0.00 ? 188  ASP V CA 1 
ATOM 8854 C CA . ILE GA 26 189  ? 164.492 243.019 198.104 1.00 0.00 ? 189  ILE V CA 1 
ATOM 8855 C CA . THR GA 26 190  ? 164.588 244.180 194.476 1.00 0.00 ? 190  THR V CA 1 
ATOM 8856 C CA . TYR GA 26 191  ? 167.084 246.855 195.509 1.00 0.00 ? 191  TYR V CA 1 
ATOM 8857 C CA . VAL GA 26 192  ? 169.350 244.284 197.152 1.00 0.00 ? 192  VAL V CA 1 
ATOM 8858 C CA . LEU GA 26 193  ? 169.430 242.344 193.878 1.00 0.00 ? 193  LEU V CA 1 
ATOM 8859 C CA . LYS GA 26 194  ? 169.896 245.438 191.681 1.00 0.00 ? 194  LYS V CA 1 
ATOM 8860 C CA . PRO GA 26 195  ? 170.536 248.794 193.416 1.00 0.00 ? 195  PRO V CA 1 
ATOM 8861 C CA . THR GA 26 196  ? 169.085 251.820 191.614 1.00 0.00 ? 196  THR V CA 1 
ATOM 8862 C CA . PHE GA 26 197  ? 170.064 255.491 191.881 1.00 0.00 ? 197  PHE V CA 1 
ATOM 8863 C CA . THR GA 26 198  ? 169.101 258.946 190.630 1.00 0.00 ? 198  THR V CA 1 
ATOM 8864 C CA . LYS GA 26 199  ? 171.523 261.875 190.282 1.00 0.00 ? 199  LYS V CA 1 
ATOM 8865 C CA . GLN GA 26 200  ? 170.368 263.473 193.566 1.00 0.00 ? 200  GLN V CA 1 
ATOM 8866 C CA . GLN GA 26 201  ? 171.199 260.353 195.612 1.00 0.00 ? 201  GLN V CA 1 
ATOM 8867 C CA . ILE GA 26 202  ? 174.862 260.735 194.622 1.00 0.00 ? 202  ILE V CA 1 
ATOM 8868 C CA . ALA GA 26 203  ? 175.046 264.269 196.077 1.00 0.00 ? 203  ALA V CA 1 
ATOM 8869 C CA . ASN GA 26 204  ? 172.583 264.743 198.924 1.00 0.00 ? 204  ASN V CA 1 
ATOM 8870 C CA . LEU GA 26 205  ? 172.795 267.720 201.275 1.00 0.00 ? 205  LEU V CA 1 
ATOM 8871 C CA . ASP GA 26 206  ? 175.555 267.199 203.870 1.00 0.00 ? 206  ASP V CA 1 
ATOM 8872 C CA . LYS GA 26 207  ? 176.553 263.853 202.318 1.00 0.00 ? 207  LYS V CA 1 
ATOM 8873 C CA . GLN GA 26 208  ? 179.800 262.298 200.975 1.00 0.00 ? 208  GLN V CA 1 
ATOM 8874 C CA . ALA GA 26 209  ? 178.968 258.666 201.055 1.00 0.00 ? 209  ALA V CA 1 
ATOM 8875 C CA . LYS GA 26 210  ? 176.966 258.602 204.299 1.00 0.00 ? 210  LYS V CA 1 
ATOM 8876 C CA . LEU GA 26 211  ? 176.733 256.417 207.434 1.00 0.00 ? 211  LEU V CA 1 
ATOM 8877 C CA . SER GA 26 212  ? 174.302 253.552 206.824 1.00 0.00 ? 212  SER V CA 1 
ATOM 8878 C CA . ARG GA 26 213  ? 173.079 250.516 208.764 1.00 0.00 ? 213  ARG V CA 1 
ATOM 8879 C CA . ALA GA 26 214  ? 172.699 246.914 207.600 1.00 0.00 ? 214  ALA V CA 1 
ATOM 8880 C CA . TYR GA 26 215  ? 169.918 244.551 208.722 1.00 0.00 ? 215  TYR V CA 1 
ATOM 8881 C CA . ASP GA 26 216  ? 171.962 243.631 211.829 1.00 0.00 ? 216  ASP V CA 1 
ATOM 8882 C CA . GLY GA 26 217  ? 172.323 247.355 212.610 1.00 0.00 ? 217  GLY V CA 1 
ATOM 8883 C CA . THR GA 26 218  ? 176.072 247.282 211.858 1.00 0.00 ? 218  THR V CA 1 
ATOM 8884 C CA . THR GA 26 219  ? 176.945 250.771 210.594 1.00 0.00 ? 219  THR V CA 1 
ATOM 8885 C CA . TYR GA 26 220  ? 179.055 251.387 207.475 1.00 0.00 ? 220  TYR V CA 1 
ATOM 8886 C CA . LEU GA 26 221  ? 180.041 254.217 205.165 1.00 0.00 ? 221  LEU V CA 1 
ATOM 8887 C CA . PRO GA 26 222  ? 178.464 253.309 201.735 1.00 0.00 ? 222  PRO V CA 1 
ATOM 8888 C CA . GLY GA 26 223  ? 181.065 252.833 199.047 1.00 0.00 ? 223  GLY V CA 1 
ATOM 8889 C CA . ILE GA 26 224  ? 183.655 252.047 201.733 1.00 0.00 ? 224  ILE V CA 1 
ATOM 8890 C CA . VAL GA 26 225  ? 182.894 248.414 202.488 1.00 0.00 ? 225  VAL V CA 1 
ATOM 8891 C CA . GLY GA 26 226  ? 184.942 245.197 202.450 1.00 0.00 ? 226  GLY V CA 1 
ATOM 8892 C CA . LEU GA 26 227  ? 184.524 241.734 200.907 1.00 0.00 ? 227  LEU V CA 1 
ATOM 8893 C CA . ASN GA 26 228  ? 184.583 238.097 202.021 1.00 0.00 ? 228  ASN V CA 1 
ATOM 8894 C CA . ASN GA 26 229  ? 187.419 235.701 201.093 1.00 0.00 ? 229  ASN V CA 1 
ATOM 8895 C CA . ILE GA 26 230  ? 190.126 238.196 200.716 1.00 0.00 ? 230  ILE V CA 1 
ATOM 8896 C CA . LYS GA 26 231  ? 192.417 235.189 201.187 1.00 0.00 ? 231  LYS V CA 1 
ATOM 8897 C CA . ALA GA 26 232  ? 191.567 234.325 197.567 1.00 0.00 ? 232  ALA V CA 1 
ATOM 8898 C CA . ASN GA 26 233  ? 190.354 237.568 195.931 1.00 0.00 ? 233  ASN V CA 1 
ATOM 8899 C CA . ASP GA 26 234  ? 191.983 240.495 197.791 1.00 0.00 ? 234  ASP V CA 1 
ATOM 8900 C CA . TYR GA 26 235  ? 193.761 241.691 194.596 1.00 0.00 ? 235  TYR V CA 1 
ATOM 8901 C CA . ALA GA 26 236  ? 190.361 241.887 192.869 1.00 0.00 ? 236  ALA V CA 1 
ATOM 8902 C CA . ASN GA 26 237  ? 188.690 243.650 195.807 1.00 0.00 ? 237  ASN V CA 1 
ATOM 8903 C CA . ALA GA 26 238  ? 191.366 246.341 195.604 1.00 0.00 ? 238  ALA V CA 1 
ATOM 8904 C CA . VAL GA 26 239  ? 190.828 246.979 191.904 1.00 0.00 ? 239  VAL V CA 1 
ATOM 8905 C CA . LEU GA 26 240  ? 187.025 247.033 192.185 1.00 0.00 ? 240  LEU V CA 1 
ATOM 8906 C CA . GLN GA 26 241  ? 187.242 249.593 194.994 1.00 0.00 ? 241  GLN V CA 1 
ATOM 8907 C CA . ALA GA 26 242  ? 189.725 251.730 193.031 1.00 0.00 ? 242  ALA V CA 1 
ATOM 8908 C CA . LEU GA 26 243  ? 187.572 251.916 189.902 1.00 0.00 ? 243  LEU V CA 1 
ATOM 8909 C CA . SER GA 26 244  ? 184.306 252.355 191.846 1.00 0.00 ? 244  SER V CA 1 
ATOM 8910 C CA . ASN GA 26 245  ? 185.851 255.326 193.693 1.00 0.00 ? 245  ASN V CA 1 
ATOM 8911 C CA . VAL GA 26 246  ? 186.669 257.212 190.515 1.00 0.00 ? 246  VAL V CA 1 
ATOM 8912 C CA . PRO GA 26 247  ? 183.603 259.513 190.397 1.00 0.00 ? 247  PRO V CA 1 
ATOM 8913 C CA . PRO GA 26 248  ? 183.236 259.798 186.554 1.00 0.00 ? 248  PRO V CA 1 
ATOM 8914 C CA . LEU GA 26 249  ? 183.385 256.027 186.118 1.00 0.00 ? 249  LEU V CA 1 
ATOM 8915 C CA . ARG GA 26 250  ? 181.351 255.296 189.249 1.00 0.00 ? 250  ARG V CA 1 
ATOM 8916 C CA . ASN GA 26 251  ? 178.578 257.729 188.277 1.00 0.00 ? 251  ASN V CA 1 
ATOM 8917 C CA . TYR GA 26 252  ? 178.322 256.180 184.802 1.00 0.00 ? 252  TYR V CA 1 
ATOM 8918 C CA . PHE GA 26 253  ? 177.880 252.707 186.307 1.00 0.00 ? 253  PHE V CA 1 
ATOM 8919 C CA . LEU GA 26 254  ? 175.388 253.817 188.974 1.00 0.00 ? 254  LEU V CA 1 
ATOM 8920 C CA . GLU GA 26 255  ? 173.048 255.806 186.727 1.00 0.00 ? 255  GLU V CA 1 
ATOM 8921 C CA . GLU GA 26 256  ? 173.012 253.651 183.576 1.00 0.00 ? 256  GLU V CA 1 
ATOM 8922 C CA . ASP GA 26 257  ? 169.690 251.939 184.360 1.00 0.00 ? 257  ASP V CA 1 
ATOM 8923 C CA . ASN GA 26 258  ? 169.148 251.290 180.632 1.00 0.00 ? 258  ASN V CA 1 
ATOM 8924 C CA . TYR GA 26 259  ? 171.948 248.787 180.029 1.00 0.00 ? 259  TYR V CA 1 
ATOM 8925 C CA . LYS GA 26 260  ? 171.665 245.000 179.281 1.00 0.00 ? 260  LYS V CA 1 
ATOM 8926 C CA . ASN GA 26 261  ? 168.133 243.634 179.743 1.00 0.00 ? 261  ASN V CA 1 
ATOM 8927 C CA . ILE GA 26 262  ? 165.681 241.224 178.177 1.00 0.00 ? 262  ILE V CA 1 
ATOM 8928 C CA . LYS GA 26 263  ? 164.076 242.370 174.905 1.00 0.00 ? 263  LYS V CA 1 
ATOM 8929 C CA . ARG GA 26 264  ? 165.890 245.665 175.522 1.00 0.00 ? 264  ARG V CA 1 
ATOM 8930 C CA . PRO GA 26 265  ? 165.274 248.384 172.900 1.00 0.00 ? 265  PRO V CA 1 
ATOM 8931 C CA . PRO GA 26 266  ? 168.080 249.510 170.546 1.00 0.00 ? 266  PRO V CA 1 
ATOM 8932 C CA . GLY GA 26 267  ? 170.604 251.974 171.994 1.00 0.00 ? 267  GLY V CA 1 
ATOM 8933 C CA . ASP GA 26 268  ? 171.406 249.811 175.048 1.00 0.00 ? 268  ASP V CA 1 
ATOM 8934 C CA . ILE GA 26 269  ? 173.463 246.581 175.042 1.00 0.00 ? 269  ILE V CA 1 
ATOM 8935 C CA . MET GA 26 270  ? 176.383 245.752 176.175 1.00 0.00 ? 270  MET V CA 1 
ATOM 8936 C CA . PHE GA 26 271  ? 177.243 242.126 177.003 1.00 0.00 ? 271  PHE V CA 1 
ATOM 8937 C CA . LEU GA 26 272  ? 177.493 239.937 180.125 1.00 0.00 ? 272  LEU V CA 1 
ATOM 8938 C CA . LEU GA 26 273  ? 180.913 241.100 181.377 1.00 0.00 ? 273  LEU V CA 1 
ATOM 8939 C CA . VAL GA 26 274  ? 179.870 244.714 181.537 1.00 0.00 ? 274  VAL V CA 1 
ATOM 8940 C CA . GLN GA 26 275  ? 176.462 243.959 183.017 1.00 0.00 ? 275  GLN V CA 1 
ATOM 8941 C CA . ARG GA 26 276  ? 178.065 241.933 185.797 1.00 0.00 ? 276  ARG V CA 1 
ATOM 8942 C CA . PHE GA 26 277  ? 180.700 244.614 186.501 1.00 0.00 ? 277  PHE V CA 1 
ATOM 8943 C CA . GLY GA 26 278  ? 178.011 247.292 186.579 1.00 0.00 ? 278  GLY V CA 1 
ATOM 8944 C CA . GLU GA 26 279  ? 176.149 245.309 189.254 1.00 0.00 ? 279  GLU V CA 1 
ATOM 8945 C CA . LEU GA 26 280  ? 179.291 244.941 191.378 1.00 0.00 ? 280  LEU V CA 1 
ATOM 8946 C CA . MET GA 26 281  ? 179.793 248.714 191.321 1.00 0.00 ? 281  MET V CA 1 
ATOM 8947 C CA . ARG GA 26 282  ? 176.108 249.356 192.099 1.00 0.00 ? 282  ARG V CA 1 
ATOM 8948 C CA . LYS GA 26 283  ? 176.392 247.044 195.127 1.00 0.00 ? 283  LYS V CA 1 
ATOM 8949 C CA . LEU GA 26 284  ? 179.646 248.648 196.337 1.00 0.00 ? 284  LEU V CA 1 
ATOM 8950 C CA . TRP GA 26 285  ? 177.760 251.935 196.753 1.00 0.00 ? 285  TRP V CA 1 
ATOM 8951 C CA . ASN GA 26 286  ? 174.418 250.557 197.984 1.00 0.00 ? 286  ASN V CA 1 
ATOM 8952 C CA . PRO GA 26 287  ? 173.231 252.487 201.080 1.00 0.00 ? 287  PRO V CA 1 
ATOM 8953 C CA . ARG GA 26 288  ? 170.757 249.673 201.928 1.00 0.00 ? 288  ARG V CA 1 
ATOM 8954 C CA . ASN GA 26 289  ? 172.903 246.490 202.048 1.00 0.00 ? 289  ASN V CA 1 
ATOM 8955 C CA . PHE GA 26 290  ? 171.452 243.620 204.101 1.00 0.00 ? 290  PHE V CA 1 
ATOM 8956 C CA . LYS GA 26 291  ? 174.955 242.914 205.362 1.00 0.00 ? 291  LYS V CA 1 
ATOM 8957 C CA . ALA GA 26 292  ? 177.787 245.459 205.310 1.00 0.00 ? 292  ALA V CA 1 
ATOM 8958 C CA . HIS GA 26 293  ? 180.044 243.458 202.959 1.00 0.00 ? 293  HIS V CA 1 
ATOM 8959 C CA . VAL GA 26 294  ? 180.039 241.791 199.551 1.00 0.00 ? 294  VAL V CA 1 
ATOM 8960 C CA . SER GA 26 295  ? 181.210 238.621 197.822 1.00 0.00 ? 295  SER V CA 1 
ATOM 8961 C CA . PRO GA 26 296  ? 182.634 238.943 194.296 1.00 0.00 ? 296  PRO V CA 1 
ATOM 8962 C CA . HIS GA 26 297  ? 183.850 235.305 194.164 1.00 0.00 ? 297  HIS V CA 1 
ATOM 8963 C CA . GLU GA 26 298  ? 181.373 234.390 191.424 1.00 0.00 ? 298  GLU V CA 1 
ATOM 8964 C CA . MET GA 26 299  ? 182.202 237.527 189.429 1.00 0.00 ? 299  MET V CA 1 
ATOM 8965 C CA . LEU GA 26 300  ? 185.946 236.852 189.511 1.00 0.00 ? 300  LEU V CA 1 
ATOM 8966 C CA . GLN GA 26 301  ? 185.387 233.128 188.842 1.00 0.00 ? 301  GLN V CA 1 
ATOM 8967 C CA . ALA GA 26 302  ? 183.264 234.161 185.838 1.00 0.00 ? 302  ALA V CA 1 
ATOM 8968 C CA . VAL GA 26 303  ? 186.239 236.139 184.518 1.00 0.00 ? 303  VAL V CA 1 
ATOM 8969 C CA . VAL GA 26 304  ? 188.425 233.082 184.519 1.00 0.00 ? 304  VAL V CA 1 
ATOM 8970 C CA . LEU GA 26 305  ? 185.828 230.628 183.221 1.00 0.00 ? 305  LEU V CA 1 
ATOM 8971 C CA . CYS GA 26 306  ? 184.117 232.764 180.548 1.00 0.00 ? 306  CYS V CA 1 
ATOM 8972 C CA . SER GA 26 307  ? 185.468 232.428 177.001 1.00 0.00 ? 307  SER V CA 1 
ATOM 8973 C CA . LYS GA 26 308  ? 185.221 236.215 176.660 1.00 0.00 ? 308  LYS V CA 1 
ATOM 8974 C CA . LYS GA 26 309  ? 187.109 236.713 179.907 1.00 0.00 ? 309  LYS V CA 1 
ATOM 8975 C CA . THR GA 26 310  ? 189.882 234.051 179.681 1.00 0.00 ? 310  THR V CA 1 
ATOM 8976 C CA . PHE GA 26 311  ? 191.395 235.661 182.806 1.00 0.00 ? 311  PHE V CA 1 
ATOM 8977 C CA . GLN GA 26 312  ? 194.318 233.369 183.423 1.00 0.00 ? 312  GLN V CA 1 
ATOM 8978 C CA . ILE GA 26 313  ? 197.249 235.469 184.693 1.00 0.00 ? 313  ILE V CA 1 
ATOM 8979 C CA . THR GA 26 314  ? 199.443 233.609 187.191 1.00 0.00 ? 314  THR V CA 1 
ATOM 8980 C CA . LYS GA 26 315  ? 202.960 233.861 188.680 1.00 0.00 ? 315  LYS V CA 1 
ATOM 8981 C CA . GLN GA 26 316  ? 201.600 237.402 189.105 1.00 0.00 ? 316  GLN V CA 1 
ATOM 8982 C CA . GLY GA 26 317  ? 197.952 237.850 189.983 1.00 0.00 ? 317  GLY V CA 1 
ATOM 8983 C CA . ASP GA 26 318  ? 198.202 241.287 191.629 1.00 0.00 ? 318  ASP V CA 1 
ATOM 8984 C CA . GLY GA 26 319  ? 196.367 244.622 191.861 1.00 0.00 ? 319  GLY V CA 1 
ATOM 8985 C CA . VAL GA 26 320  ? 198.356 246.064 188.920 1.00 0.00 ? 320  VAL V CA 1 
ATOM 8986 C CA . ASP GA 26 321  ? 198.003 243.159 186.472 1.00 0.00 ? 321  ASP V CA 1 
ATOM 8987 C CA . PHE GA 26 322  ? 194.299 242.827 187.265 1.00 0.00 ? 322  PHE V CA 1 
ATOM 8988 C CA . LEU GA 26 323  ? 193.653 246.572 186.989 1.00 0.00 ? 323  LEU V CA 1 
ATOM 8989 C CA . SER GA 26 324  ? 195.316 246.626 183.556 1.00 0.00 ? 324  SER V CA 1 
ATOM 8990 C CA . TRP GA 26 325  ? 193.375 243.526 182.479 1.00 0.00 ? 325  TRP V CA 1 
ATOM 8991 C CA . PHE GA 26 326  ? 190.111 245.045 183.724 1.00 0.00 ? 326  PHE V CA 1 
ATOM 8992 C CA . LEU GA 26 327  ? 190.642 248.476 182.112 1.00 0.00 ? 327  LEU V CA 1 
ATOM 8993 C CA . ASN GA 26 328  ? 191.454 246.792 178.788 1.00 0.00 ? 328  ASN V CA 1 
ATOM 8994 C CA . ALA GA 26 329  ? 188.434 244.475 179.078 1.00 0.00 ? 329  ALA V CA 1 
ATOM 8995 C CA . LEU GA 26 330  ? 186.139 247.435 179.809 1.00 0.00 ? 330  LEU V CA 1 
ATOM 8996 C CA . HIS GA 26 331  ? 187.484 249.354 176.806 1.00 0.00 ? 331  HIS V CA 1 
ATOM 8997 C CA . SER GA 26 332  ? 186.955 246.429 174.420 1.00 0.00 ? 332  SER V CA 1 
ATOM 8998 C CA . ALA GA 26 333  ? 183.437 245.793 175.758 1.00 0.00 ? 333  ALA V CA 1 
ATOM 8999 C CA . LEU GA 26 334  ? 181.953 249.304 176.097 1.00 0.00 ? 334  LEU V CA 1 
ATOM 9000 C CA . GLY GA 26 335  ? 182.675 252.146 173.717 1.00 0.00 ? 335  GLY V CA 1 
ATOM 9001 C CA . GLY GA 26 336  ? 182.181 253.660 170.285 1.00 0.00 ? 336  GLY V CA 1 
ATOM 9002 C CA . THR GA 26 337  ? 178.559 253.709 169.105 1.00 0.00 ? 337  THR V CA 1 
ATOM 9003 C CA . LYS GA 26 338  ? 177.639 251.318 171.923 1.00 0.00 ? 338  LYS V CA 1 
ATOM 9004 C CA . LYS GA 26 339  ? 178.749 252.725 175.065 1.00 0.00 ? 339  LYS V CA 1 
ATOM 9005 C CA . LYS GA 26 340  ? 180.822 254.670 176.576 1.00 0.00 ? 340  LYS V CA 1 
ATOM 9006 C CA . LYS GA 26 341  ? 183.195 253.404 179.280 1.00 0.00 ? 341  LYS V CA 1 
ATOM 9007 C CA . LYS GA 26 342  ? 186.150 253.292 176.866 1.00 0.00 ? 342  LYS V CA 1 
ATOM 9008 C CA . THR GA 26 343  ? 185.681 257.017 176.169 1.00 0.00 ? 343  THR V CA 1 
ATOM 9009 C CA . ILE GA 26 344  ? 185.383 257.835 179.888 1.00 0.00 ? 344  ILE V CA 1 
ATOM 9010 C CA . VAL GA 26 345  ? 188.475 255.860 180.956 1.00 0.00 ? 345  VAL V CA 1 
ATOM 9011 C CA . THR GA 26 346  ? 190.488 257.190 177.995 1.00 0.00 ? 346  THR V CA 1 
ATOM 9012 C CA . ASP GA 26 347  ? 189.617 260.783 178.936 1.00 0.00 ? 347  ASP V CA 1 
ATOM 9013 C CA . VAL GA 26 348  ? 189.961 260.513 182.691 1.00 0.00 ? 348  VAL V CA 1 
ATOM 9014 C CA . PHE GA 26 349  ? 192.633 257.870 183.382 1.00 0.00 ? 349  PHE V CA 1 
ATOM 9015 C CA . GLN GA 26 350  ? 194.895 257.639 180.345 1.00 0.00 ? 350  GLN V CA 1 
ATOM 9016 C CA . GLY GA 26 351  ? 198.141 259.593 180.708 1.00 0.00 ? 351  GLY V CA 1 
ATOM 9017 C CA . SER GA 26 352  ? 200.961 259.949 178.185 1.00 0.00 ? 352  SER V CA 1 
ATOM 9018 C CA . MET GA 26 353  ? 204.735 260.049 178.571 1.00 0.00 ? 353  MET V CA 1 
ATOM 9019 C CA . ARG GA 26 354  ? 205.720 262.071 175.981 1.00 0.00 ? 354  ARG V CA 1 
ATOM 9020 C CA . ILE GA 26 355  ? 209.331 260.983 176.000 1.00 0.00 ? 355  ILE V CA 1 
ATOM 9021 C CA . PHE GA 26 356  ? 212.005 263.253 174.620 1.00 0.00 ? 356  PHE V CA 1 
ATOM 9022 C CA . THR GA 26 357  ? 214.764 261.110 173.226 1.00 0.00 ? 357  THR V CA 1 
ATOM 9023 C CA . LYS GA 26 358  ? 218.238 262.340 172.254 1.00 0.00 ? 358  LYS V CA 1 
ATOM 9024 C CA . ALA GA 26 367  ? 232.373 260.346 168.330 1.00 0.00 ? 367  ALA V CA 1 
ATOM 9025 C CA . GLU GA 26 368  ? 230.847 256.937 169.154 1.00 0.00 ? 368  GLU V CA 1 
ATOM 9026 C CA . GLU GA 26 369  ? 227.518 258.415 170.142 1.00 0.00 ? 369  GLU V CA 1 
ATOM 9027 C CA . LYS GA 26 370  ? 227.694 260.888 167.248 1.00 0.00 ? 370  LYS V CA 1 
ATOM 9028 C CA . GLU GA 26 371  ? 227.561 257.841 164.969 1.00 0.00 ? 371  GLU V CA 1 
ATOM 9029 C CA . GLN GA 26 372  ? 224.684 256.375 167.000 1.00 0.00 ? 372  GLN V CA 1 
ATOM 9030 C CA . GLN GA 26 380  ? 218.083 264.006 166.902 1.00 0.00 ? 380  GLN V CA 1 
ATOM 9031 C CA . GLU GA 26 381  ? 215.462 264.968 169.445 1.00 0.00 ? 381  GLU V CA 1 
ATOM 9032 C CA . THR GA 26 382  ? 212.434 262.716 168.861 1.00 0.00 ? 382  THR V CA 1 
ATOM 9033 C CA . MET GA 26 383  ? 209.071 262.639 170.637 1.00 0.00 ? 383  MET V CA 1 
ATOM 9034 C CA . VAL GA 26 384  ? 207.670 259.262 171.734 1.00 0.00 ? 384  VAL V CA 1 
ATOM 9035 C CA . GLU GA 26 385  ? 204.683 259.046 172.982 1.00 0.00 ? 385  GLU V CA 1 
ATOM 9036 C CA . SER GA 26 386  ? 203.402 256.183 175.128 1.00 0.00 ? 386  SER V CA 1 
ATOM 9037 C CA . THR GA 26 387  ? 199.927 256.229 176.657 1.00 0.00 ? 387  THR V CA 1 
ATOM 9038 C CA . PHE GA 26 388  ? 199.602 254.563 180.066 1.00 0.00 ? 388  PHE V CA 1 
ATOM 9039 C CA . MET GA 26 389  ? 196.822 253.585 182.441 1.00 0.00 ? 389  MET V CA 1 
ATOM 9040 C CA . TYR GA 26 390  ? 199.369 253.036 185.224 1.00 0.00 ? 390  TYR V CA 1 
ATOM 9041 C CA . LEU GA 26 391  ? 202.745 254.770 185.503 1.00 0.00 ? 391  LEU V CA 1 
ATOM 9042 C CA . THR GA 26 392  ? 205.446 252.522 186.962 1.00 0.00 ? 392  THR V CA 1 
ATOM 9043 C CA . LEU GA 26 393  ? 207.989 254.268 189.193 1.00 0.00 ? 393  LEU V CA 1 
ATOM 9044 C CA . ASP GA 26 394  ? 211.219 252.307 189.597 1.00 0.00 ? 394  ASP V CA 1 
ATOM 9045 C CA . LEU GA 26 395  ? 212.664 252.211 193.104 1.00 0.00 ? 395  LEU V CA 1 
ATOM 9046 C CA . PRO GA 26 396  ? 216.394 252.584 193.902 1.00 0.00 ? 396  PRO V CA 1 
ATOM 9047 C CA . THR GA 26 397  ? 218.280 249.266 194.014 1.00 0.00 ? 397  THR V CA 1 
ATOM 9048 C CA . ALA GA 26 398  ? 217.487 247.286 197.166 1.00 0.00 ? 398  ALA V CA 1 
ATOM 9049 C CA . PRO GA 26 399  ? 219.392 244.434 198.869 1.00 0.00 ? 399  PRO V CA 1 
ATOM 9050 C CA . LEU GA 26 400  ? 217.052 242.078 200.748 1.00 0.00 ? 400  LEU V CA 1 
ATOM 9051 C CA . TYR GA 26 401  ? 219.963 240.833 202.879 1.00 0.00 ? 401  TYR V CA 1 
ATOM 9052 C CA . LYS GA 26 402  ? 220.673 244.148 204.626 1.00 0.00 ? 402  LYS V CA 1 
ATOM 9053 C CA . ASP GA 26 403  ? 219.086 244.248 208.082 1.00 0.00 ? 403  ASP V CA 1 
ATOM 9054 C CA . GLU GA 26 404  ? 218.858 247.043 210.612 1.00 0.00 ? 404  GLU V CA 1 
ATOM 9055 C CA . LYS GA 26 405  ? 217.099 248.204 213.792 1.00 0.00 ? 405  LYS V CA 1 
ATOM 9056 C CA . GLU GA 26 406  ? 215.869 251.725 212.975 1.00 0.00 ? 406  GLU V CA 1 
ATOM 9057 C CA . GLN GA 26 407  ? 214.085 253.373 210.014 1.00 0.00 ? 407  GLN V CA 1 
ATOM 9058 C CA . LEU GA 26 408  ? 217.166 255.586 209.455 1.00 0.00 ? 408  LEU V CA 1 
ATOM 9059 C CA . ILE GA 26 409  ? 219.123 252.447 208.714 1.00 0.00 ? 409  ILE V CA 1 
ATOM 9060 C CA . ILE GA 26 410  ? 216.656 251.404 206.023 1.00 0.00 ? 410  ILE V CA 1 
ATOM 9061 C CA . PRO GA 26 411  ? 216.514 252.921 202.497 1.00 0.00 ? 411  PRO V CA 1 
ATOM 9062 C CA . GLN GA 26 412  ? 214.022 255.767 202.024 1.00 0.00 ? 412  GLN V CA 1 
ATOM 9063 C CA . VAL GA 26 413  ? 212.933 257.882 199.054 1.00 0.00 ? 413  VAL V CA 1 
ATOM 9064 C CA . PRO GA 26 414  ? 210.351 260.655 198.682 1.00 0.00 ? 414  PRO V CA 1 
ATOM 9065 C CA . LEU GA 26 415  ? 207.777 260.236 195.915 1.00 0.00 ? 415  LEU V CA 1 
ATOM 9066 C CA . PHE GA 26 416  ? 208.740 263.658 194.475 1.00 0.00 ? 416  PHE V CA 1 
ATOM 9067 C CA . ASN GA 26 417  ? 212.253 262.265 193.877 1.00 0.00 ? 417  ASN V CA 1 
ATOM 9068 C CA . ILE GA 26 418  ? 210.823 259.294 191.948 1.00 0.00 ? 418  ILE V CA 1 
ATOM 9069 C CA . LEU GA 26 419  ? 209.106 261.814 189.648 1.00 0.00 ? 419  LEU V CA 1 
ATOM 9070 C CA . ALA GA 26 420  ? 212.315 263.804 189.001 1.00 0.00 ? 420  ALA V CA 1 
ATOM 9071 C CA . LYS GA 26 421  ? 212.577 261.877 185.712 1.00 0.00 ? 421  LYS V CA 1 
ATOM 9072 C CA . PHE GA 26 422  ? 209.669 264.006 184.436 1.00 0.00 ? 422  PHE V CA 1 
ATOM 9073 C CA . ASN GA 26 423  ? 210.189 267.275 186.340 1.00 0.00 ? 423  ASN V CA 1 
ATOM 9074 C CA . GLY GA 26 424  ? 213.929 267.957 185.960 1.00 0.00 ? 424  GLY V CA 1 
ATOM 9075 C CA . LYS GA 26 431  ? 218.361 259.719 184.398 1.00 0.00 ? 431  LYS V CA 1 
ATOM 9076 C CA . THR GA 26 432  ? 216.436 257.784 181.743 1.00 0.00 ? 432  THR V CA 1 
ATOM 9077 C CA . TYR GA 26 433  ? 218.760 259.320 179.225 1.00 0.00 ? 433  TYR V CA 1 
ATOM 9078 C CA . LYS GA 26 434  ? 221.358 256.805 180.321 1.00 0.00 ? 434  LYS V CA 1 
ATOM 9079 C CA . GLU GA 26 435  ? 219.613 254.268 178.041 1.00 0.00 ? 435  GLU V CA 1 
ATOM 9080 C CA . ASN GA 26 436  ? 220.826 256.352 175.074 1.00 0.00 ? 436  ASN V CA 1 
ATOM 9081 C CA . PHE GA 26 437  ? 223.205 254.748 172.581 1.00 0.00 ? 437  PHE V CA 1 
ATOM 9082 C CA . LEU GA 26 438  ? 220.816 262.716 175.989 1.00 0.00 ? 438  LEU V CA 1 
ATOM 9083 C CA . LYS GA 26 439  ? 217.290 261.533 176.716 1.00 0.00 ? 439  LYS V CA 1 
ATOM 9084 C CA . ARG GA 26 440  ? 214.389 263.440 178.292 1.00 0.00 ? 440  ARG V CA 1 
ATOM 9085 C CA . PHE GA 26 441  ? 211.119 262.242 179.837 1.00 0.00 ? 441  PHE V CA 1 
ATOM 9086 C CA . GLN GA 26 442  ? 207.929 264.305 180.077 1.00 0.00 ? 442  GLN V CA 1 
ATOM 9087 C CA . LEU GA 26 443  ? 204.331 263.663 181.094 1.00 0.00 ? 443  LEU V CA 1 
ATOM 9088 C CA . THR GA 26 444  ? 202.598 265.303 178.129 1.00 0.00 ? 444  THR V CA 1 
ATOM 9089 C CA . LYS GA 26 445  ? 199.095 264.208 179.193 1.00 0.00 ? 445  LYS V CA 1 
ATOM 9090 C CA . LEU GA 26 446  ? 198.198 264.526 182.873 1.00 0.00 ? 446  LEU V CA 1 
ATOM 9091 C CA . PRO GA 26 447  ? 194.909 262.655 183.406 1.00 0.00 ? 447  PRO V CA 1 
ATOM 9092 C CA . PRO GA 26 448  ? 192.257 263.617 186.007 1.00 0.00 ? 448  PRO V CA 1 
ATOM 9093 C CA . TYR GA 26 449  ? 193.242 260.325 187.686 1.00 0.00 ? 449  TYR V CA 1 
ATOM 9094 C CA . LEU GA 26 450  ? 196.971 259.588 187.719 1.00 0.00 ? 450  LEU V CA 1 
ATOM 9095 C CA . ILE GA 26 451  ? 197.730 256.021 188.820 1.00 0.00 ? 451  ILE V CA 1 
ATOM 9096 C CA . PHE GA 26 452  ? 201.201 255.057 190.070 1.00 0.00 ? 452  PHE V CA 1 
ATOM 9097 C CA . CYS GA 26 453  ? 202.694 251.606 190.532 1.00 0.00 ? 453  CYS V CA 1 
ATOM 9098 C CA . ILE GA 26 454  ? 205.806 251.174 192.670 1.00 0.00 ? 454  ILE V CA 1 
ATOM 9099 C CA . LYS GA 26 455  ? 207.922 248.392 191.179 1.00 0.00 ? 455  LYS V CA 1 
ATOM 9100 C CA . ARG GA 26 456  ? 208.247 246.132 194.238 1.00 0.00 ? 456  ARG V CA 1 
ATOM 9101 C CA . PHE GA 26 457  ? 208.570 242.791 192.444 1.00 0.00 ? 457  PHE V CA 1 
ATOM 9102 C CA . THR GA 26 458  ? 211.220 241.173 190.299 1.00 0.00 ? 458  THR V CA 1 
ATOM 9103 C CA . LYS GA 26 459  ? 209.037 238.288 189.137 1.00 0.00 ? 459  LYS V CA 1 
ATOM 9104 C CA . ASN GA 26 460  ? 211.861 236.854 187.015 1.00 0.00 ? 460  ASN V CA 1 
ATOM 9105 C CA . ASN GA 26 461  ? 213.934 236.163 190.158 1.00 0.00 ? 461  ASN V CA 1 
ATOM 9106 C CA . PHE GA 26 462  ? 213.013 233.366 192.608 1.00 0.00 ? 462  PHE V CA 1 
ATOM 9107 C CA . PHE GA 26 463  ? 210.097 234.496 194.725 1.00 0.00 ? 463  PHE V CA 1 
ATOM 9108 C CA . VAL GA 26 464  ? 211.637 237.762 195.791 1.00 0.00 ? 464  VAL V CA 1 
ATOM 9109 C CA . GLU GA 26 465  ? 213.154 239.463 197.712 1.00 0.00 ? 465  GLU V CA 1 
ATOM 9110 C CA . LYS GA 26 466  ? 210.907 242.444 196.937 1.00 0.00 ? 466  LYS V CA 1 
ATOM 9111 C CA . ASN GA 26 467  ? 212.164 246.008 196.983 1.00 0.00 ? 467  ASN V CA 1 
ATOM 9112 C CA . PRO GA 26 468  ? 211.105 247.242 200.465 1.00 0.00 ? 468  PRO V CA 1 
ATOM 9113 C CA . THR GA 26 469  ? 212.409 250.826 200.031 1.00 0.00 ? 469  THR V CA 1 
ATOM 9114 C CA . ILE GA 26 470  ? 210.254 253.130 202.166 1.00 0.00 ? 470  ILE V CA 1 
ATOM 9115 C CA . VAL GA 26 471  ? 208.384 255.492 199.848 1.00 0.00 ? 471  VAL V CA 1 
ATOM 9116 C CA . ASN GA 26 472  ? 207.501 258.755 201.583 1.00 0.00 ? 472  ASN V CA 1 
ATOM 9117 C CA . PHE GA 26 473  ? 204.531 260.862 200.454 1.00 0.00 ? 473  PHE V CA 1 
ATOM 9118 C CA . PRO GA 26 474  ? 202.231 261.372 203.602 1.00 0.00 ? 474  PRO V CA 1 
ATOM 9119 C CA . ILE GA 26 475  ? 202.913 264.602 205.316 1.00 0.00 ? 475  ILE V CA 1 
ATOM 9120 C CA . THR GA 26 476  ? 201.496 266.302 208.414 1.00 0.00 ? 476  THR V CA 1 
ATOM 9121 C CA . ASN GA 26 477  ? 200.147 269.785 207.778 1.00 0.00 ? 477  ASN V CA 1 
ATOM 9122 C CA . VAL GA 26 478  ? 199.942 271.706 211.044 1.00 0.00 ? 478  VAL V CA 1 
ATOM 9123 C CA . ASP GA 26 479  ? 198.478 275.007 212.200 1.00 0.00 ? 479  ASP V CA 1 
ATOM 9124 C CA . LEU GA 26 480  ? 195.398 275.449 214.430 1.00 0.00 ? 480  LEU V CA 1 
ATOM 9125 C CA . ARG GA 26 481  ? 194.446 272.111 212.943 1.00 0.00 ? 481  ARG V CA 1 
ATOM 9126 C CA . GLU GA 26 482  ? 196.024 268.754 212.257 1.00 0.00 ? 482  GLU V CA 1 
ATOM 9127 C CA . TYR GA 26 483  ? 195.735 267.588 208.648 1.00 0.00 ? 483  TYR V CA 1 
ATOM 9128 C CA . LEU GA 26 484  ? 197.357 265.195 206.211 1.00 0.00 ? 484  LEU V CA 1 
ATOM 9129 C CA . SER GA 26 485  ? 199.045 265.850 202.921 1.00 0.00 ? 485  SER V CA 1 
ATOM 9130 C CA . GLU GA 26 486  ? 198.485 263.924 200.585 1.00 0.00 ? 486  GLU V CA 1 
ATOM 9131 C CA . GLU GA 26 487  ? 199.613 266.505 198.019 1.00 0.00 ? 487  GLU V CA 1 
ATOM 9132 C CA . VAL GA 26 488  ? 201.946 266.455 195.008 1.00 0.00 ? 488  VAL V CA 1 
ATOM 9133 C CA . GLN GA 26 489  ? 202.765 268.911 192.210 1.00 0.00 ? 489  GLN V CA 1 
ATOM 9134 C CA . ALA GA 26 490  ? 204.976 269.082 189.114 1.00 0.00 ? 490  ALA V CA 1 
ATOM 9135 C CA . VAL GA 26 491  ? 208.543 270.115 189.944 1.00 0.00 ? 491  VAL V CA 1 
ATOM 9136 C CA . HIS GA 26 492  ? 209.117 271.688 186.549 1.00 0.00 ? 492  HIS V CA 1 
ATOM 9137 C CA . LYS GA 26 493  ? 205.623 273.246 186.396 1.00 0.00 ? 493  LYS V CA 1 
ATOM 9138 C CA . ASN GA 26 494  ? 202.494 273.330 188.331 1.00 0.00 ? 494  ASN V CA 1 
ATOM 9139 C CA . THR GA 26 495  ? 199.767 270.642 188.177 1.00 0.00 ? 495  THR V CA 1 
ATOM 9140 C CA . THR GA 26 496  ? 198.502 269.757 191.672 1.00 0.00 ? 496  THR V CA 1 
ATOM 9141 C CA . TYR GA 26 497  ? 197.236 266.316 192.697 1.00 0.00 ? 497  TYR V CA 1 
ATOM 9142 C CA . ASP GA 26 498  ? 195.759 264.915 195.910 1.00 0.00 ? 498  ASP V CA 1 
ATOM 9143 C CA . LEU GA 26 499  ? 196.001 261.273 196.985 1.00 0.00 ? 499  LEU V CA 1 
ATOM 9144 C CA . ILE GA 26 500  ? 192.650 259.444 196.951 1.00 0.00 ? 500  ILE V CA 1 
ATOM 9145 C CA . ALA GA 26 501  ? 193.585 255.745 197.174 1.00 0.00 ? 501  ALA V CA 1 
ATOM 9146 C CA . ASN GA 26 502  ? 196.500 253.679 198.331 1.00 0.00 ? 502  ASN V CA 1 
ATOM 9147 C CA . ILE GA 26 503  ? 196.829 249.933 197.796 1.00 0.00 ? 503  ILE V CA 1 
ATOM 9148 C CA . VAL GA 26 504  ? 199.190 248.364 200.306 1.00 0.00 ? 504  VAL V CA 1 
ATOM 9149 C CA . HIS GA 26 505  ? 201.155 245.118 200.214 1.00 0.00 ? 505  HIS V CA 1 
ATOM 9150 C CA . ASP GA 26 506  ? 201.243 242.988 203.357 1.00 0.00 ? 506  ASP V CA 1 
ATOM 9151 C CA . GLY GA 26 507  ? 203.058 239.676 203.874 1.00 0.00 ? 507  GLY V CA 1 
ATOM 9152 C CA . LYS GA 26 508  ? 201.385 236.667 205.420 1.00 0.00 ? 508  LYS V CA 1 
ATOM 9153 C CA . PRO GA 26 509  ? 202.348 233.019 205.993 1.00 0.00 ? 509  PRO V CA 1 
ATOM 9154 C CA . SER GA 26 510  ? 199.320 231.851 203.974 1.00 0.00 ? 510  SER V CA 1 
ATOM 9155 C CA . GLU GA 26 511  ? 197.924 235.294 203.106 1.00 0.00 ? 511  GLU V CA 1 
ATOM 9156 C CA . GLY GA 26 512  ? 199.975 237.097 200.419 1.00 0.00 ? 512  GLY V CA 1 
ATOM 9157 C CA . SER GA 26 513  ? 197.908 240.159 201.033 1.00 0.00 ? 513  SER V CA 1 
ATOM 9158 C CA . TYR GA 26 514  ? 196.550 243.367 199.525 1.00 0.00 ? 514  TYR V CA 1 
ATOM 9159 C CA . ARG GA 26 515  ? 194.592 245.952 201.464 1.00 0.00 ? 515  ARG V CA 1 
ATOM 9160 C CA . ILE GA 26 516  ? 193.037 249.178 200.247 1.00 0.00 ? 516  ILE V CA 1 
ATOM 9161 C CA . HIS GA 26 517  ? 192.884 252.608 201.816 1.00 0.00 ? 517  HIS V CA 1 
ATOM 9162 C CA . VAL GA 26 518  ? 190.448 255.120 200.355 1.00 0.00 ? 518  VAL V CA 1 
ATOM 9163 C CA . LEU GA 26 519  ? 189.848 258.793 201.030 1.00 0.00 ? 519  LEU V CA 1 
ATOM 9164 C CA . HIS GA 26 520  ? 186.445 260.313 201.780 1.00 0.00 ? 520  HIS V CA 1 
ATOM 9165 C CA . HIS GA 26 521  ? 186.511 264.001 200.823 1.00 0.00 ? 521  HIS V CA 1 
ATOM 9166 C CA . GLY GA 26 522  ? 183.449 264.663 202.872 1.00 0.00 ? 522  GLY V CA 1 
ATOM 9167 C CA . THR GA 26 523  ? 184.354 263.542 206.327 1.00 0.00 ? 523  THR V CA 1 
ATOM 9168 C CA . GLY GA 26 524  ? 188.049 263.987 205.398 1.00 0.00 ? 524  GLY V CA 1 
ATOM 9169 C CA . LYS GA 26 525  ? 188.912 260.536 206.626 1.00 0.00 ? 525  LYS V CA 1 
ATOM 9170 C CA . TRP GA 26 526  ? 190.954 257.610 205.302 1.00 0.00 ? 526  TRP V CA 1 
ATOM 9171 C CA . TYR GA 26 527  ? 189.293 254.202 205.554 1.00 0.00 ? 527  TYR V CA 1 
ATOM 9172 C CA . GLU GA 26 528  ? 191.341 251.020 205.345 1.00 0.00 ? 528  GLU V CA 1 
ATOM 9173 C CA . LEU GA 26 529  ? 189.550 247.980 203.937 1.00 0.00 ? 529  LEU V CA 1 
ATOM 9174 C CA . GLN GA 26 530  ? 191.242 244.719 204.890 1.00 0.00 ? 530  GLN V CA 1 
ATOM 9175 C CA . ASP GA 26 531  ? 188.883 241.848 204.220 1.00 0.00 ? 531  ASP V CA 1 
ATOM 9176 C CA . LEU GA 26 532  ? 185.504 242.703 205.707 1.00 0.00 ? 532  LEU V CA 1 
ATOM 9177 C CA . GLN GA 26 533  ? 187.193 244.939 208.303 1.00 0.00 ? 533  GLN V CA 1 
ATOM 9178 C CA . VAL GA 26 534  ? 187.338 248.728 207.970 1.00 0.00 ? 534  VAL V CA 1 
ATOM 9179 C CA . THR GA 26 535  ? 189.448 251.030 210.141 1.00 0.00 ? 535  THR V CA 1 
ATOM 9180 C CA . ASP GA 26 536  ? 190.122 254.777 210.035 1.00 0.00 ? 536  ASP V CA 1 
ATOM 9181 C CA . ILE GA 26 537  ? 193.777 255.644 209.444 1.00 0.00 ? 537  ILE V CA 1 
ATOM 9182 C CA . LEU GA 26 538  ? 195.680 258.831 210.144 1.00 0.00 ? 538  LEU V CA 1 
ATOM 9183 C CA . PRO GA 26 539  ? 196.506 260.231 206.943 1.00 0.00 ? 539  PRO V CA 1 
ATOM 9184 C CA . GLN GA 26 540  ? 200.094 261.474 207.703 1.00 0.00 ? 540  GLN V CA 1 
ATOM 9185 C CA . MET GA 26 541  ? 201.102 257.912 208.618 1.00 0.00 ? 541  MET V CA 1 
ATOM 9186 C CA . ILE GA 26 542  ? 199.747 256.118 205.520 1.00 0.00 ? 542  ILE V CA 1 
ATOM 9187 C CA . THR GA 26 543  ? 203.248 255.803 204.039 1.00 0.00 ? 543  THR V CA 1 
ATOM 9188 C CA . LEU GA 26 544  ? 204.512 253.604 206.834 1.00 0.00 ? 544  LEU V CA 1 
ATOM 9189 C CA . SER GA 26 545  ? 202.923 250.655 205.006 1.00 0.00 ? 545  SER V CA 1 
ATOM 9190 C CA . GLU GA 26 546  ? 204.354 249.279 201.740 1.00 0.00 ? 546  GLU V CA 1 
ATOM 9191 C CA . ALA GA 26 547  ? 202.465 251.206 199.025 1.00 0.00 ? 547  ALA V CA 1 
ATOM 9192 C CA . TYR GA 26 548  ? 202.064 249.358 195.698 1.00 0.00 ? 548  TYR V CA 1 
ATOM 9193 C CA . ILE GA 26 549  ? 199.499 251.410 193.736 1.00 0.00 ? 549  ILE V CA 1 
ATOM 9194 C CA . GLN GA 26 550  ? 198.170 254.890 194.302 1.00 0.00 ? 550  GLN V CA 1 
ATOM 9195 C CA . ILE GA 26 551  ? 195.465 256.955 192.641 1.00 0.00 ? 551  ILE V CA 1 
ATOM 9196 C CA . TRP GA 26 552  ? 195.955 260.723 192.605 1.00 0.00 ? 552  TRP V CA 1 
ATOM 9197 C CA . LYS GA 26 553  ? 193.228 263.136 191.494 1.00 0.00 ? 553  LYS V CA 1 
ATOM 9198 C CA . ARG GA 26 554  ? 194.059 266.416 189.755 1.00 0.00 ? 554  ARG V CA 1 
ATOM 9199 C CA . ARG GA 26 555  ? 192.993 269.580 191.583 1.00 0.00 ? 555  ARG V CA 1 
ATOM 9200 C CA . ASP GA 26 556  ? 191.713 272.832 190.078 1.00 0.00 ? 556  ASP V CA 1 
ATOM 9201 P P  . A   HA 27 1    ? 289.361 254.571 260.446 1.00 0.00 ? 1    A   M P  1 
ATOM 9202 P P  . G   HA 27 2    ? 285.019 252.118 262.808 1.00 0.00 ? 2    G   M P  1 
ATOM 9203 P P  . C   HA 27 3    ? 279.427 250.536 264.331 1.00 0.00 ? 3    C   M P  1 
ATOM 9204 P P  . U   HA 27 4    ? 273.848 250.751 263.418 1.00 0.00 ? 4    U   M P  1 
ATOM 9205 P P  . U   HA 27 5    ? 269.289 251.662 259.887 1.00 0.00 ? 5    U   M P  1 
ATOM 9206 P P  . U   HA 27 6    ? 266.794 252.492 254.669 1.00 0.00 ? 6    U   M P  1 
ATOM 9207 P P  . G   HA 27 7    ? 266.810 251.972 248.927 1.00 0.00 ? 7    G   M P  1 
ATOM 9208 P P  . C   HA 27 8    ? 269.094 248.041 244.574 1.00 0.00 ? 8    C   M P  1 
ATOM 9209 P P  . G   HA 27 9    ? 272.270 244.124 241.954 1.00 0.00 ? 9    G   M P  1 
ATOM 9210 P P  . C   HA 27 10   ? 274.598 238.768 242.376 1.00 0.00 ? 10   C   M P  1 
ATOM 9211 P P  . A   HA 27 11   ? 275.875 233.876 244.576 1.00 0.00 ? 11   A   M P  1 
ATOM 9212 P P  . G   HA 27 12   ? 273.491 229.758 247.873 1.00 0.00 ? 12   G   M P  1 
ATOM 9213 P P  . U   HA 27 13   ? 269.523 227.172 250.823 1.00 0.00 ? 13   U   M P  1 
ATOM 9214 P P  . G   HA 27 14   ? 264.148 226.193 252.671 1.00 0.00 ? 14   G   M P  1 
ATOM 9215 P P  . G   HA 27 15   ? 258.604 226.761 252.266 1.00 0.00 ? 15   G   M P  1 
ATOM 9216 P P  . C   HA 27 16   ? 253.944 228.244 248.781 1.00 0.00 ? 16   C   M P  1 
ATOM 9217 P P  . U   HA 27 21   ? 249.561 235.966 241.897 1.00 0.00 ? 21   U   M P  1 
ATOM 9218 P P  . C   HA 27 22   ? 255.110 237.833 240.513 1.00 0.00 ? 22   C   M P  1 
ATOM 9219 P P  . G   HA 27 23   ? 259.067 240.790 237.407 1.00 0.00 ? 23   G   M P  1 
ATOM 9220 P P  . U   HA 27 24   ? 260.631 244.974 234.158 1.00 0.00 ? 24   U   M P  1 
ATOM 9221 P P  . A   HA 27 25   ? 259.919 245.959 229.700 1.00 0.00 ? 25   A   M P  1 
ATOM 9222 P P  . G   HA 27 26   ? 257.252 249.952 226.183 1.00 0.00 ? 26   G   M P  1 
ATOM 9223 P P  . C   HA 27 27   ? 253.946 253.942 223.778 1.00 0.00 ? 27   C   M P  1 
ATOM 9224 P P  . C   HA 27 28   ? 249.952 258.091 224.526 1.00 0.00 ? 28   C   M P  1 
ATOM 9225 P P  . A   HA 27 29   ? 248.112 262.073 227.570 1.00 0.00 ? 29   A   M P  1 
ATOM 9226 P P  . A   HA 27 30   ? 249.967 265.246 232.230 1.00 0.00 ? 30   A   M P  1 
ATOM 9227 P P  . U   HA 27 31   ? 251.419 269.922 235.822 1.00 0.00 ? 31   U   M P  1 
ATOM 9228 P P  . G   HA 27 32   ? 245.186 268.828 233.247 1.00 0.00 ? 32   G   M P  1 
ATOM 9229 P P  . A   HA 27 33   ? 243.207 262.665 233.863 1.00 0.00 ? 33   A   M P  1 
ATOM 9230 P P  . G   HA 27 34   ? 239.970 258.721 234.850 1.00 0.00 ? 34   G   M P  1 
ATOM 9231 P P  . G   HA 27 35   ? 236.156 255.381 238.685 1.00 0.00 ? 35   G   M P  1 
ATOM 9232 P P  . U   HA 27 36   ? 232.720 256.299 243.452 1.00 0.00 ? 36   U   M P  1 
ATOM 9233 P P  . U   HA 27 37   ? 232.722 258.798 248.414 1.00 0.00 ? 37   U   M P  1 
ATOM 9234 P P  . U   HA 27 38   ? 232.601 259.693 255.232 1.00 0.00 ? 38   U   M P  1 
ATOM 9235 P P  . A   HA 27 39   ? 232.150 265.534 252.735 1.00 0.00 ? 39   A   M P  1 
ATOM 9236 P P  . U   HA 27 40   ? 231.671 270.804 248.980 1.00 0.00 ? 40   U   M P  1 
ATOM 9237 P P  . C   HA 27 41   ? 238.196 272.175 249.815 1.00 0.00 ? 41   C   M P  1 
ATOM 9238 P P  . C   HA 27 42   ? 242.224 268.340 250.040 1.00 0.00 ? 42   C   M P  1 
ATOM 9239 P P  . G   HA 27 43   ? 246.493 265.178 249.164 1.00 0.00 ? 43   G   M P  1 
ATOM 9240 P P  . A   HA 27 44   ? 249.946 260.002 245.837 1.00 0.00 ? 44   A   M P  1 
ATOM 9241 P P  . G   HA 27 45   ? 250.411 253.892 243.262 1.00 0.00 ? 45   G   M P  1 
ATOM 9242 P P  . G   HA 27 46   ? 245.671 250.967 239.107 1.00 0.00 ? 46   G   M P  1 
ATOM 9243 P P  . C   HA 27 47   ? 242.167 249.241 234.489 1.00 0.00 ? 47   C   M P  1 
ATOM 9244 P P  . G   HA 27 48   ? 242.729 244.252 234.119 1.00 0.00 ? 48   G   M P  1 
ATOM 9245 P P  . C   HA 27 49   ? 244.373 243.061 228.719 1.00 0.00 ? 49   C   M P  1 
ATOM 9246 P P  . G   HA 27 50   ? 247.490 239.926 224.962 1.00 0.00 ? 50   G   M P  1 
ATOM 9247 P P  . A   HA 27 54   ? 251.414 235.592 224.183 1.00 0.00 ? 51   A   M P  1 
ATOM 9248 P P  . U   HA 27 55   ? 254.432 230.946 226.756 1.00 0.00 ? 52   U   M P  1 
ATOM 9249 P P  . U   HA 27 56   ? 273.901 220.359 229.428 1.00 0.00 ? 56   U   M P  1 
ATOM 9250 P P  . G   HA 27 57   ? 276.413 216.561 233.021 1.00 0.00 ? 57   G   M P  1 
ATOM 9251 P P  . C   HA 27 58   ? 275.717 211.765 236.302 1.00 0.00 ? 58   C   M P  1 
ATOM 9252 P P  . U   HA 27 59   ? 272.900 207.202 238.598 1.00 0.00 ? 59   U   M P  1 
ATOM 9253 P P  . A   HA 27 60   ? 268.941 203.149 238.909 1.00 0.00 ? 60   A   M P  1 
ATOM 9254 P P  . A   HA 27 61   ? 265.662 199.783 234.859 1.00 0.00 ? 61   A   M P  1 
ATOM 9255 P P  . U   HA 27 62   ? 263.300 198.216 229.687 1.00 0.00 ? 62   U   M P  1 
ATOM 9256 P P  . C   HA 27 83   ? 307.171 155.895 247.535 1.00 0.00 ? 86   C   M P  1 
ATOM 9257 P P  . C   HA 27 84   ? 305.162 150.923 243.268 1.00 0.00 ? 87   C   M P  1 
ATOM 9258 P P  . G   HA 27 85   ? 302.101 148.326 237.297 1.00 0.00 ? 88   G   M P  1 
ATOM 9259 P P  . U   HA 27 89   ? 304.731 144.181 235.213 1.00 0.00 ? 89   U   M P  1 
ATOM 9260 P P  . G   HA 27 90   ? 310.495 142.149 234.450 1.00 0.00 ? 90   G   M P  1 
ATOM 9261 P P  . A   HA 27 91   ? 315.789 141.693 234.852 1.00 0.00 ? 91   A   M P  1 
ATOM 9262 P P  . C   HA 27 92   ? 322.827 142.439 235.431 1.00 0.00 ? 92   C   M P  1 
ATOM 9263 P P  . G   HA 27 93   ? 325.109 140.880 239.919 1.00 0.00 ? 93   G   M P  1 
ATOM 9264 P P  . A   HA 27 94   ? 328.587 138.439 243.756 1.00 0.00 ? 94   A   M P  1 
ATOM 9265 P P  . C   HA 27 95   ? 329.120 136.121 248.639 1.00 0.00 ? 95   C   M P  1 
ATOM 9266 P P  . U   HA 27 96   ? 327.188 133.560 254.055 1.00 0.00 ? 96   U   M P  1 
ATOM 9267 P P  . A   HA 27 105  ? 308.375 136.952 248.759 1.00 0.00 ? 105  A   M P  1 
ATOM 9268 P P  . G   HA 27 106  ? 312.465 141.143 251.801 1.00 0.00 ? 106  G   M P  1 
ATOM 9269 P P  . U   HA 27 107  ? 315.941 145.141 253.971 1.00 0.00 ? 107  U   M P  1 
ATOM 9270 P P  . C   HA 27 108  ? 320.123 149.168 254.193 1.00 0.00 ? 108  C   M P  1 
ATOM 9271 P P  . G   HA 27 109  ? 324.043 152.885 252.653 1.00 0.00 ? 109  G   M P  1 
ATOM 9272 P P  . G   HA 27 110  ? 324.970 156.533 248.033 1.00 0.00 ? 110  G   M P  1 
ATOM 9273 P P  . C   HA 27 111  ? 321.370 158.209 242.413 1.00 0.00 ? 111  C   M P  1 
ATOM 9274 P P  . A   HA 27 112  ? 318.025 159.437 236.999 1.00 0.00 ? 112  A   M P  1 
ATOM 9275 P P  . U   HA 27 113  ? 312.363 159.526 233.718 1.00 0.00 ? 113  U   M P  1 
ATOM 9276 P P  . U   HA 27 114  ? 307.588 159.096 229.517 1.00 0.00 ? 114  U   M P  1 
ATOM 9277 P P  . G   HA 27 115  ? 301.194 156.915 229.733 1.00 0.00 ? 115  G   M P  1 
ATOM 9278 P P  . G   HA 27 116  ? 295.553 157.913 232.236 1.00 0.00 ? 116  G   M P  1 
ATOM 9279 P P  . C   HA 27 117  ? 291.086 159.130 236.969 1.00 0.00 ? 117  C   M P  1 
ATOM 9280 P P  . A   HA 27 118  ? 289.996 161.065 241.598 1.00 0.00 ? 118  A   M P  1 
ATOM 9281 P P  . A   HA 27 119  ? 285.541 159.296 246.164 1.00 0.00 ? 119  A   M P  1 
ATOM 9282 P P  . U   HA 27 120  ? 287.745 156.506 252.077 1.00 0.00 ? 120  U   M P  1 
ATOM 9283 P P  . U   HA 27 121  ? 291.040 155.917 255.318 1.00 0.00 ? 121  U   M P  1 
ATOM 9284 P P  . U   HA 27 122  ? 295.118 158.017 256.110 1.00 0.00 ? 122  U   M P  1 
ATOM 9285 P P  . U   HA 27 123  ? 295.975 164.646 257.710 1.00 0.00 ? 123  U   M P  1 
ATOM 9286 P P  . U   HA 27 124  ? 295.676 163.834 251.535 1.00 0.00 ? 124  U   M P  1 
ATOM 9287 P P  . G   HA 27 125  ? 292.261 166.254 251.945 1.00 0.00 ? 125  G   M P  1 
ATOM 9288 P P  . A   HA 27 126  ? 289.143 165.263 256.207 1.00 0.00 ? 126  A   M P  1 
ATOM 9289 P P  . C   HA 27 127  ? 289.423 169.201 260.810 1.00 0.00 ? 127  C   M P  1 
ATOM 9290 P P  . A   HA 27 128  ? 288.007 175.042 264.459 1.00 0.00 ? 128  A   M P  1 
ATOM 9291 P P  . G   HA 27 129  ? 285.343 179.826 266.208 1.00 0.00 ? 129  G   M P  1 
ATOM 9292 P P  . U   HA 27 130  ? 282.004 183.399 269.916 1.00 0.00 ? 130  U   M P  1 
ATOM 9293 P P  . C   HA 27 131  ? 279.679 185.401 274.531 1.00 0.00 ? 131  C   M P  1 
ATOM 9294 P P  . U   HA 27 132  ? 279.205 186.077 280.429 1.00 0.00 ? 132  U   M P  1 
ATOM 9295 P P  . C   HA 27 133  ? 280.941 185.627 286.090 1.00 0.00 ? 133  C   M P  1 
ATOM 9296 P P  . G   HA 27 138  ? 296.479 179.065 279.277 1.00 0.00 ? 138  G   M P  1 
ATOM 9297 P P  . A   HA 27 139  ? 293.136 174.780 281.220 1.00 0.00 ? 139  A   M P  1 
ATOM 9298 P P  . G   HA 27 140  ? 288.132 171.782 282.048 1.00 0.00 ? 140  G   M P  1 
ATOM 9299 P P  . A   HA 27 141  ? 282.459 170.254 281.428 1.00 0.00 ? 141  A   M P  1 
ATOM 9300 P P  . C   HA 27 142  ? 277.092 169.806 278.572 1.00 0.00 ? 142  C   M P  1 
ATOM 9301 P P  . U   HA 27 143  ? 273.154 171.097 273.816 1.00 0.00 ? 143  U   M P  1 
ATOM 9302 P P  . G   HA 27 144  ? 271.678 173.609 267.796 1.00 0.00 ? 144  G   M P  1 
ATOM 9303 P P  . G   HA 27 145  ? 271.257 169.684 264.345 1.00 0.00 ? 145  G   M P  1 
AT