data_3JUE
# 
_entry.id   3JUE 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3JUE         
RCSB  RCSB055171   
WWPDB D_1000055171 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3JUE 
_pdbx_database_status.recvd_initial_deposition_date   2009-09-15 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Pang, X.'  1 
'Zhang, K.' 2 
'Ma, J.'    3 
'Zhou, Q.'  4 
'Sun, F.'   5 
# 
_citation.id                        primary 
_citation.title                     'Mechanistic insights into regulated cargo binding by ACAP1 protein' 
_citation.journal_abbrev            J.Biol.Chem. 
_citation.journal_volume            287 
_citation.page_first                28675 
_citation.page_last                 28685 
_citation.year                      2012 
_citation.journal_id_ASTM           JBCHA3 
_citation.country                   US 
_citation.journal_id_ISSN           0021-9258 
_citation.journal_id_CSD            0071 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   22645133 
_citation.pdbx_database_id_DOI      10.1074/jbc.M112.378810 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Bai, M.'   1 
primary 'Pang, X.'  2 
primary 'Lou, J.'   3 
primary 'Zhou, Q.'  4 
primary 'Zhang, K.' 5 
primary 'Ma, J.'    6 
primary 'Li, J.'    7 
primary 'Sun, F.'   8 
primary 'Hsu, V.W.' 9 
# 
_cell.entry_id           3JUE 
_cell.length_a           107.809 
_cell.length_b           163.473 
_cell.length_c           41.092 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3JUE 
_symmetry.space_group_name_H-M             'P 21 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                18 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'ARFGAP with coiled-coil, ANK repeat and PH domain-containing protein 1' 39160.461 2   ? ? 
'ArfGAP and ANK repeat domain, residues 378-740' ? 
2 non-polymer syn 'ZINC ION'                                                               65.409    2   ? ? ? ? 
3 non-polymer syn 'SULFATE ION'                                                            96.063    3   ? ? ? ? 
4 water       nat water                                                                    18.015    133 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Centaurin-beta-1, Cnt-b1' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GPLGSGSGHLAIGSAATLGSGGMARGREPGGVGHVVAQVQSVDGNAQCCDCREPAPEWASINLGVTLCIQCSGIHRSLGV
HFSKVRSLTLDSWEPELVKLMCELGNVIINQIYEARVEAMAVKKPGPSCSRQEKEAWIHAKYVEKKFLTKLPEIRGRRGG
RGRPRGQPPVPPKPSIRPRPGSLRSKPEPPSEDLGSLHPGALLFRASGHPPSLPTMADALAHGADVNWVNGGQDNATPLI
QATAANSLLACEFLLQNGANVNQADSAGRGPLHHATILGHTGLACLFLKRGADLGARDSEGRDPLTIAMETANADIVTLL
RLAKMREAEAAQGQAGDETYLDIFRDFSLMASDDPEKLSRRSHDLHTL
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GPLGSGSGHLAIGSAATLGSGGMARGREPGGVGHVVAQVQSVDGNAQCCDCREPAPEWASINLGVTLCIQCSGIHRSLGV
HFSKVRSLTLDSWEPELVKLMCELGNVIINQIYEARVEAMAVKKPGPSCSRQEKEAWIHAKYVEKKFLTKLPEIRGRRGG
RGRPRGQPPVPPKPSIRPRPGSLRSKPEPPSEDLGSLHPGALLFRASGHPPSLPTMADALAHGADVNWVNGGQDNATPLI
QATAANSLLACEFLLQNGANVNQADSAGRGPLHHATILGHTGLACLFLKRGADLGARDSEGRDPLTIAMETANADIVTLL
RLAKMREAEAAQGQAGDETYLDIFRDFSLMASDDPEKLSRRSHDLHTL
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   LEU n 
1 4   GLY n 
1 5   SER n 
1 6   GLY n 
1 7   SER n 
1 8   GLY n 
1 9   HIS n 
1 10  LEU n 
1 11  ALA n 
1 12  ILE n 
1 13  GLY n 
1 14  SER n 
1 15  ALA n 
1 16  ALA n 
1 17  THR n 
1 18  LEU n 
1 19  GLY n 
1 20  SER n 
1 21  GLY n 
1 22  GLY n 
1 23  MET n 
1 24  ALA n 
1 25  ARG n 
1 26  GLY n 
1 27  ARG n 
1 28  GLU n 
1 29  PRO n 
1 30  GLY n 
1 31  GLY n 
1 32  VAL n 
1 33  GLY n 
1 34  HIS n 
1 35  VAL n 
1 36  VAL n 
1 37  ALA n 
1 38  GLN n 
1 39  VAL n 
1 40  GLN n 
1 41  SER n 
1 42  VAL n 
1 43  ASP n 
1 44  GLY n 
1 45  ASN n 
1 46  ALA n 
1 47  GLN n 
1 48  CYS n 
1 49  CYS n 
1 50  ASP n 
1 51  CYS n 
1 52  ARG n 
1 53  GLU n 
1 54  PRO n 
1 55  ALA n 
1 56  PRO n 
1 57  GLU n 
1 58  TRP n 
1 59  ALA n 
1 60  SER n 
1 61  ILE n 
1 62  ASN n 
1 63  LEU n 
1 64  GLY n 
1 65  VAL n 
1 66  THR n 
1 67  LEU n 
1 68  CYS n 
1 69  ILE n 
1 70  GLN n 
1 71  CYS n 
1 72  SER n 
1 73  GLY n 
1 74  ILE n 
1 75  HIS n 
1 76  ARG n 
1 77  SER n 
1 78  LEU n 
1 79  GLY n 
1 80  VAL n 
1 81  HIS n 
1 82  PHE n 
1 83  SER n 
1 84  LYS n 
1 85  VAL n 
1 86  ARG n 
1 87  SER n 
1 88  LEU n 
1 89  THR n 
1 90  LEU n 
1 91  ASP n 
1 92  SER n 
1 93  TRP n 
1 94  GLU n 
1 95  PRO n 
1 96  GLU n 
1 97  LEU n 
1 98  VAL n 
1 99  LYS n 
1 100 LEU n 
1 101 MET n 
1 102 CYS n 
1 103 GLU n 
1 104 LEU n 
1 105 GLY n 
1 106 ASN n 
1 107 VAL n 
1 108 ILE n 
1 109 ILE n 
1 110 ASN n 
1 111 GLN n 
1 112 ILE n 
1 113 TYR n 
1 114 GLU n 
1 115 ALA n 
1 116 ARG n 
1 117 VAL n 
1 118 GLU n 
1 119 ALA n 
1 120 MET n 
1 121 ALA n 
1 122 VAL n 
1 123 LYS n 
1 124 LYS n 
1 125 PRO n 
1 126 GLY n 
1 127 PRO n 
1 128 SER n 
1 129 CYS n 
1 130 SER n 
1 131 ARG n 
1 132 GLN n 
1 133 GLU n 
1 134 LYS n 
1 135 GLU n 
1 136 ALA n 
1 137 TRP n 
1 138 ILE n 
1 139 HIS n 
1 140 ALA n 
1 141 LYS n 
1 142 TYR n 
1 143 VAL n 
1 144 GLU n 
1 145 LYS n 
1 146 LYS n 
1 147 PHE n 
1 148 LEU n 
1 149 THR n 
1 150 LYS n 
1 151 LEU n 
1 152 PRO n 
1 153 GLU n 
1 154 ILE n 
1 155 ARG n 
1 156 GLY n 
1 157 ARG n 
1 158 ARG n 
1 159 GLY n 
1 160 GLY n 
1 161 ARG n 
1 162 GLY n 
1 163 ARG n 
1 164 PRO n 
1 165 ARG n 
1 166 GLY n 
1 167 GLN n 
1 168 PRO n 
1 169 PRO n 
1 170 VAL n 
1 171 PRO n 
1 172 PRO n 
1 173 LYS n 
1 174 PRO n 
1 175 SER n 
1 176 ILE n 
1 177 ARG n 
1 178 PRO n 
1 179 ARG n 
1 180 PRO n 
1 181 GLY n 
1 182 SER n 
1 183 LEU n 
1 184 ARG n 
1 185 SER n 
1 186 LYS n 
1 187 PRO n 
1 188 GLU n 
1 189 PRO n 
1 190 PRO n 
1 191 SER n 
1 192 GLU n 
1 193 ASP n 
1 194 LEU n 
1 195 GLY n 
1 196 SER n 
1 197 LEU n 
1 198 HIS n 
1 199 PRO n 
1 200 GLY n 
1 201 ALA n 
1 202 LEU n 
1 203 LEU n 
1 204 PHE n 
1 205 ARG n 
1 206 ALA n 
1 207 SER n 
1 208 GLY n 
1 209 HIS n 
1 210 PRO n 
1 211 PRO n 
1 212 SER n 
1 213 LEU n 
1 214 PRO n 
1 215 THR n 
1 216 MET n 
1 217 ALA n 
1 218 ASP n 
1 219 ALA n 
1 220 LEU n 
1 221 ALA n 
1 222 HIS n 
1 223 GLY n 
1 224 ALA n 
1 225 ASP n 
1 226 VAL n 
1 227 ASN n 
1 228 TRP n 
1 229 VAL n 
1 230 ASN n 
1 231 GLY n 
1 232 GLY n 
1 233 GLN n 
1 234 ASP n 
1 235 ASN n 
1 236 ALA n 
1 237 THR n 
1 238 PRO n 
1 239 LEU n 
1 240 ILE n 
1 241 GLN n 
1 242 ALA n 
1 243 THR n 
1 244 ALA n 
1 245 ALA n 
1 246 ASN n 
1 247 SER n 
1 248 LEU n 
1 249 LEU n 
1 250 ALA n 
1 251 CYS n 
1 252 GLU n 
1 253 PHE n 
1 254 LEU n 
1 255 LEU n 
1 256 GLN n 
1 257 ASN n 
1 258 GLY n 
1 259 ALA n 
1 260 ASN n 
1 261 VAL n 
1 262 ASN n 
1 263 GLN n 
1 264 ALA n 
1 265 ASP n 
1 266 SER n 
1 267 ALA n 
1 268 GLY n 
1 269 ARG n 
1 270 GLY n 
1 271 PRO n 
1 272 LEU n 
1 273 HIS n 
1 274 HIS n 
1 275 ALA n 
1 276 THR n 
1 277 ILE n 
1 278 LEU n 
1 279 GLY n 
1 280 HIS n 
1 281 THR n 
1 282 GLY n 
1 283 LEU n 
1 284 ALA n 
1 285 CYS n 
1 286 LEU n 
1 287 PHE n 
1 288 LEU n 
1 289 LYS n 
1 290 ARG n 
1 291 GLY n 
1 292 ALA n 
1 293 ASP n 
1 294 LEU n 
1 295 GLY n 
1 296 ALA n 
1 297 ARG n 
1 298 ASP n 
1 299 SER n 
1 300 GLU n 
1 301 GLY n 
1 302 ARG n 
1 303 ASP n 
1 304 PRO n 
1 305 LEU n 
1 306 THR n 
1 307 ILE n 
1 308 ALA n 
1 309 MET n 
1 310 GLU n 
1 311 THR n 
1 312 ALA n 
1 313 ASN n 
1 314 ALA n 
1 315 ASP n 
1 316 ILE n 
1 317 VAL n 
1 318 THR n 
1 319 LEU n 
1 320 LEU n 
1 321 ARG n 
1 322 LEU n 
1 323 ALA n 
1 324 LYS n 
1 325 MET n 
1 326 ARG n 
1 327 GLU n 
1 328 ALA n 
1 329 GLU n 
1 330 ALA n 
1 331 ALA n 
1 332 GLN n 
1 333 GLY n 
1 334 GLN n 
1 335 ALA n 
1 336 GLY n 
1 337 ASP n 
1 338 GLU n 
1 339 THR n 
1 340 TYR n 
1 341 LEU n 
1 342 ASP n 
1 343 ILE n 
1 344 PHE n 
1 345 ARG n 
1 346 ASP n 
1 347 PHE n 
1 348 SER n 
1 349 LEU n 
1 350 MET n 
1 351 ALA n 
1 352 SER n 
1 353 ASP n 
1 354 ASP n 
1 355 PRO n 
1 356 GLU n 
1 357 LYS n 
1 358 LEU n 
1 359 SER n 
1 360 ARG n 
1 361 ARG n 
1 362 SER n 
1 363 HIS n 
1 364 ASP n 
1 365 LEU n 
1 366 HIS n 
1 367 THR n 
1 368 LEU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'ACAP1, CENTB1, KIAA0050' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     511693 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               BL21 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          PLASMID 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pGEX-6p-1 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    ACAP1_HUMAN 
_struct_ref.pdbx_db_accession          Q15027 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;GSGHLAIGSAATLGSGGMARGREPGGVGHVVAQVQSVDGNAQCCDCREPAPEWASINLGVTLCIQCSGIHRSLGVHFSKV
RSLTLDSWEPELVKLMCELGNVIINQIYEARVEAMAVKKPGPSCSRQEKEAWIHAKYVEKKFLTKLPEIRGRRGGRGRPR
GQPPVPPKPSIRPRPGSLRSKPEPPSEDLGSLHPGALLFRASGHPPSLPTMADALAHGADVNWVNGGQDNATPLIQATAA
NSLLACEFLLQNGANVNQADSAGRGPLHHATILGHTGLACLFLKRGADLGARDSEGRDPLTIAMETANADIVTLLRLAKM
REAEAAQGQAGDETYLDIFRDFSLMASDDPEKLSRRSHDLHTL
;
_struct_ref.pdbx_align_begin           378 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3JUE A 6 ? 368 ? Q15027 378 ? 740 ? 378 740 
2 1 3JUE B 6 ? 368 ? Q15027 378 ? 740 ? 378 740 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3JUE GLY A 1 ? UNP Q15027 ? ? 'EXPRESSION TAG' 373 1  
1 3JUE PRO A 2 ? UNP Q15027 ? ? 'EXPRESSION TAG' 374 2  
1 3JUE LEU A 3 ? UNP Q15027 ? ? 'EXPRESSION TAG' 375 3  
1 3JUE GLY A 4 ? UNP Q15027 ? ? 'EXPRESSION TAG' 376 4  
1 3JUE SER A 5 ? UNP Q15027 ? ? 'EXPRESSION TAG' 377 5  
2 3JUE GLY B 1 ? UNP Q15027 ? ? 'EXPRESSION TAG' 373 6  
2 3JUE PRO B 2 ? UNP Q15027 ? ? 'EXPRESSION TAG' 374 7  
2 3JUE LEU B 3 ? UNP Q15027 ? ? 'EXPRESSION TAG' 375 8  
2 3JUE GLY B 4 ? UNP Q15027 ? ? 'EXPRESSION TAG' 376 9  
2 3JUE SER B 5 ? UNP Q15027 ? ? 'EXPRESSION TAG' 377 10 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
_exptl.entry_id          3JUE 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.31 
_exptl_crystal.density_percent_sol   46.79 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            289 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.1 
_exptl_crystal_grow.pdbx_details    
'0.2M ammonium sulfate, 14% PEG 3350, 0.1M Sodium Citrate, pH 5.1, VAPOR DIFFUSION, HANGING DROP, temperature 289K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 270' 
_diffrn_detector.pdbx_collection_date   2008-11-10 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Numerical link type Si(111)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.28 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'PHOTON FACTORY BEAMLINE BL-17A' 
_diffrn_source.pdbx_synchrotron_site       'Photon Factory' 
_diffrn_source.pdbx_synchrotron_beamline   BL-17A 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.28 
# 
_reflns.entry_id                     3JUE 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             48.63 
_reflns.d_resolution_high            2.2 
_reflns.number_obs                   36997 
_reflns.number_all                   38024 
_reflns.percent_possible_obs         97.3 
_reflns.pdbx_Rmerge_I_obs            0.067 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        19.9 
_reflns.B_iso_Wilson_estimate        41 
_reflns.pdbx_redundancy              5.6 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             2.20 
_reflns_shell.d_res_low              2.28 
_reflns_shell.percent_possible_all   81.8 
_reflns_shell.Rmerge_I_obs           0.351 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    1.58 
_reflns_shell.pdbx_redundancy        3.3 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      3765 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3JUE 
_refine.ls_number_reflns_obs                     31334 
_refine.ls_number_reflns_all                     33244 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             45.0 
_refine.ls_d_res_high                            2.30 
_refine.ls_percent_reflns_obs                    99.20 
_refine.ls_R_factor_obs                          0.20321 
_refine.ls_R_factor_all                          0.20321 
_refine.ls_R_factor_R_work                       0.20239 
_refine.ls_R_factor_R_free                       0.21936 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.0 
_refine.ls_number_reflns_R_free                  1652 
_refine.ls_number_reflns_R_work                  ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.correlation_coeff_Fo_to_Fc               0.943 
_refine.correlation_coeff_Fo_to_Fc_free          0.942 
_refine.B_iso_mean                               38.467 
_refine.aniso_B[1][1]                            -1.59 
_refine.aniso_B[2][2]                            -1.24 
_refine.aniso_B[3][3]                            2.83 
_refine.aniso_B[1][2]                            0.00 
_refine.aniso_B[1][3]                            0.00 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    MASK 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             1.20 
_refine.pdbx_solvent_ion_probe_radii             0.80 
_refine.pdbx_solvent_shrinkage_radii             0.80 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          SAD 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       0.240 
_refine.pdbx_overall_ESU_R_Free                  0.183 
_refine.overall_SU_ML                            0.117 
_refine.overall_SU_B                             10.765 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                48.46 
_refine.B_iso_min                                2.00 
_refine.pdbx_overall_phase_error                 ? 
_refine.occupancy_max                            1.00 
_refine.occupancy_min                            0.50 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        3782 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         17 
_refine_hist.number_atoms_solvent             133 
_refine_hist.number_atoms_total               3932 
_refine_hist.d_res_high                       2.30 
_refine_hist.d_res_low                        45.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d       0.011  0.021  ? 3900 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg    1.272  1.962  ? 5303 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg 5.372  5.000  ? 508  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg 27.858 24.465 ? 159  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg 15.133 15.000 ? 645  'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg 15.937 15.000 ? 23   'X-RAY DIFFRACTION' ? 
r_chiral_restr         0.087  0.200  ? 608  'X-RAY DIFFRACTION' ? 
r_gen_planes_refined   0.006  0.021  ? 2929 'X-RAY DIFFRACTION' ? 
r_mcbond_it            0.523  1.500  ? 2526 'X-RAY DIFFRACTION' ? 
r_mcangle_it           1.026  2.000  ? 4039 'X-RAY DIFFRACTION' ? 
r_scbond_it            1.759  3.000  ? 1374 'X-RAY DIFFRACTION' ? 
r_scangle_it           2.922  4.500  ? 1264 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.d_res_high                       2.300 
_refine_ls_shell.d_res_low                        2.360 
_refine_ls_shell.number_reflns_R_work             2141 
_refine_ls_shell.R_factor_R_work                  0.261 
_refine_ls_shell.percent_reflns_obs               94.25 
_refine_ls_shell.R_factor_R_free                  0.280 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             105 
_refine_ls_shell.number_reflns_all                2246 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                2141 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3JUE 
_struct.title                     'Crystal Structure of ArfGAP and ANK repeat domain of ACAP1' 
_struct.pdbx_descriptor           'ARFGAP with coiled-coil, ANK repeat and PH domain-containing protein 1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3JUE 
_struct_keywords.pdbx_keywords   'PROTEIN TRANSPORT/ENDOCYTOSIS' 
_struct_keywords.text            
;ArfGAP domain, ANK repeat, zinc-binding module, GTPase activation, Metal-binding, Nitration, Phosphoprotein, Protein transport, Transport, Zinc-finger, PROTEIN TRANSPORT-ENDOCYTOSIS COMPLEX
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
F N N 2 ? 
G N N 3 ? 
H N N 4 ? 
I N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  HIS A 34  ? SER A 41  ? HIS A 406 SER A 413 1 ? 8  
HELX_P HELX_P2  2  CYS A 68  ? GLY A 79  ? CYS A 440 GLY A 451 1 ? 12 
HELX_P HELX_P3  3  GLU A 94  ? LEU A 104 ? GLU A 466 LEU A 476 1 ? 11 
HELX_P HELX_P4  4  GLY A 105 ? GLU A 114 ? GLY A 477 GLU A 486 1 ? 10 
HELX_P HELX_P5  5  SER A 130 ? VAL A 143 ? SER A 502 VAL A 515 1 ? 14 
HELX_P HELX_P6  6  HIS A 198 ? SER A 207 ? HIS A 570 SER A 579 1 ? 10 
HELX_P HELX_P7  7  SER A 212 ? HIS A 222 ? SER A 584 HIS A 594 1 ? 11 
HELX_P HELX_P8  8  THR A 237 ? ALA A 245 ? THR A 609 ALA A 617 1 ? 9  
HELX_P HELX_P9  9  SER A 247 ? ASN A 257 ? SER A 619 ASN A 629 1 ? 11 
HELX_P HELX_P10 10 GLY A 270 ? GLY A 279 ? GLY A 642 GLY A 651 1 ? 10 
HELX_P HELX_P11 11 HIS A 280 ? ARG A 290 ? HIS A 652 ARG A 662 1 ? 11 
HELX_P HELX_P12 12 ASP A 303 ? THR A 311 ? ASP A 675 THR A 683 1 ? 9  
HELX_P HELX_P13 13 ASN A 313 ? MET A 325 ? ASN A 685 MET A 697 1 ? 13 
HELX_P HELX_P14 14 GLY B 33  ? SER B 41  ? GLY B 405 SER B 413 1 ? 9  
HELX_P HELX_P15 15 CYS B 68  ? GLY B 79  ? CYS B 440 GLY B 451 1 ? 12 
HELX_P HELX_P16 16 GLU B 94  ? LEU B 104 ? GLU B 466 LEU B 476 1 ? 11 
HELX_P HELX_P17 17 GLY B 105 ? GLU B 114 ? GLY B 477 GLU B 486 1 ? 10 
HELX_P HELX_P18 18 ARG B 116 ? ALA B 121 ? ARG B 488 ALA B 493 1 ? 6  
HELX_P HELX_P19 19 SER B 130 ? VAL B 143 ? SER B 502 VAL B 515 1 ? 14 
HELX_P HELX_P20 20 HIS B 198 ? GLY B 208 ? HIS B 570 GLY B 580 1 ? 11 
HELX_P HELX_P21 21 SER B 212 ? HIS B 222 ? SER B 584 HIS B 594 1 ? 11 
HELX_P HELX_P22 22 THR B 237 ? ALA B 245 ? THR B 609 ALA B 617 1 ? 9  
HELX_P HELX_P23 23 SER B 247 ? ASN B 257 ? SER B 619 ASN B 629 1 ? 11 
HELX_P HELX_P24 24 GLY B 270 ? LEU B 278 ? GLY B 642 LEU B 650 1 ? 9  
HELX_P HELX_P25 25 HIS B 280 ? ARG B 290 ? HIS B 652 ARG B 662 1 ? 11 
HELX_P HELX_P26 26 ASP B 303 ? THR B 311 ? ASP B 675 THR B 683 1 ? 9  
HELX_P HELX_P27 27 ASN B 313 ? ALA B 328 ? ASN B 685 ALA B 700 1 ? 16 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? A CYS 48 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 420 A ZN 999 1_555 ? ? ? ? ? ? ? 2.403 ? 
metalc2 metalc ? ? A CYS 51 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 423 A ZN 999 1_555 ? ? ? ? ? ? ? 2.375 ? 
metalc3 metalc ? ? A CYS 68 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 440 A ZN 999 1_555 ? ? ? ? ? ? ? 2.396 ? 
metalc4 metalc ? ? A CYS 71 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 443 A ZN 999 1_555 ? ? ? ? ? ? ? 2.365 ? 
metalc5 metalc ? ? B CYS 48 SG ? ? ? 1_555 F ZN . ZN ? ? B CYS 420 B ZN 999 1_555 ? ? ? ? ? ? ? 2.346 ? 
metalc6 metalc ? ? B CYS 51 SG ? ? ? 1_555 F ZN . ZN ? ? B CYS 423 B ZN 999 1_555 ? ? ? ? ? ? ? 2.357 ? 
metalc7 metalc ? ? B CYS 68 SG ? ? ? 1_555 F ZN . ZN ? ? B CYS 440 B ZN 999 1_555 ? ? ? ? ? ? ? 2.386 ? 
metalc8 metalc ? ? B CYS 71 SG ? ? ? 1_555 F ZN . ZN ? ? B CYS 443 B ZN 999 1_555 ? ? ? ? ? ? ? 2.308 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 HIS 209 A . ? HIS 581 A PRO 210 A ? PRO 582 A 1 -13.76 
2 HIS 209 B . ? HIS 581 B PRO 210 B ? PRO 582 B 1 -11.33 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 3 ? 
B ? 3 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 VAL A 65 ? LEU A 67 ? VAL A 437 LEU A 439 
A 2 TRP A 58 ? SER A 60 ? TRP A 430 SER A 432 
A 3 VAL A 85 ? SER A 87 ? VAL A 457 SER A 459 
B 1 VAL B 65 ? LEU B 67 ? VAL B 437 LEU B 439 
B 2 TRP B 58 ? SER B 60 ? TRP B 430 SER B 432 
B 3 VAL B 85 ? SER B 87 ? VAL B 457 SER B 459 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 O VAL A 65 ? O VAL A 437 N SER A 60 ? N SER A 432 
A 2 3 N ALA A 59 ? N ALA A 431 O ARG A 86 ? O ARG A 458 
B 1 2 O VAL B 65 ? O VAL B 437 N SER B 60 ? N SER B 432 
B 2 3 N ALA B 59 ? N ALA B 431 O ARG B 86 ? O ARG B 458 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN A 999'   
AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SO4 A 1133' 
AC3 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE SO4 A 1135' 
AC4 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE ZN B 999'   
AC5 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE SO4 B 1134' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4 CYS A 48  ? CYS A 420  . ? 1_555 ? 
2  AC1 4 CYS A 51  ? CYS A 423  . ? 1_555 ? 
3  AC1 4 CYS A 68  ? CYS A 440  . ? 1_555 ? 
4  AC1 4 CYS A 71  ? CYS A 443  . ? 1_555 ? 
5  AC2 5 HIS A 198 ? HIS A 570  . ? 1_555 ? 
6  AC2 5 PRO A 199 ? PRO A 571  . ? 1_555 ? 
7  AC2 5 GLY A 200 ? GLY A 572  . ? 1_555 ? 
8  AC2 5 ALA A 201 ? ALA A 573  . ? 1_555 ? 
9  AC2 5 TRP A 228 ? TRP A 600  . ? 1_555 ? 
10 AC3 7 TRP A 58  ? TRP A 430  . ? 1_555 ? 
11 AC3 7 ILE A 69  ? ILE A 441  . ? 1_555 ? 
12 AC3 7 SER A 72  ? SER A 444  . ? 1_555 ? 
13 AC3 7 GLY A 73  ? GLY A 445  . ? 1_555 ? 
14 AC3 7 ARG A 76  ? ARG A 448  . ? 1_555 ? 
15 AC3 7 GLN B 40  ? GLN B 412  . ? 1_555 ? 
16 AC3 7 SER B 41  ? SER B 413  . ? 1_555 ? 
17 AC4 4 CYS B 48  ? CYS B 420  . ? 1_555 ? 
18 AC4 4 CYS B 51  ? CYS B 423  . ? 1_555 ? 
19 AC4 4 CYS B 68  ? CYS B 440  . ? 1_555 ? 
20 AC4 4 CYS B 71  ? CYS B 443  . ? 1_555 ? 
21 AC5 6 HIS B 198 ? HIS B 570  . ? 1_555 ? 
22 AC5 6 PRO B 199 ? PRO B 571  . ? 1_555 ? 
23 AC5 6 GLY B 200 ? GLY B 572  . ? 1_555 ? 
24 AC5 6 ALA B 201 ? ALA B 573  . ? 1_555 ? 
25 AC5 6 TRP B 228 ? TRP B 600  . ? 1_555 ? 
26 AC5 6 HOH I .   ? HOH B 1042 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3JUE 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3JUE 
_atom_sites.fract_transf_matrix[1][1]   0.009276 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.006117 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.024336 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . VAL A 1 32  ? 11.552 -46.466 5.715   1.00 73.17  ? 404  VAL A N   1 
ATOM   2    C  CA  . VAL A 1 32  ? 10.843 -45.159 5.906   1.00 75.05  ? 404  VAL A CA  1 
ATOM   3    C  C   . VAL A 1 32  ? 10.841 -44.679 7.376   1.00 76.04  ? 404  VAL A C   1 
ATOM   4    O  O   . VAL A 1 32  ? 11.109 -43.499 7.638   1.00 76.15  ? 404  VAL A O   1 
ATOM   5    C  CB  . VAL A 1 32  ? 9.391  -45.156 5.292   1.00 78.93  ? 404  VAL A CB  1 
ATOM   6    C  CG1 . VAL A 1 32  ? 9.431  -45.425 3.776   1.00 77.60  ? 404  VAL A CG1 1 
ATOM   7    C  CG2 . VAL A 1 32  ? 8.450  -46.146 6.022   1.00 82.40  ? 404  VAL A CG2 1 
ATOM   8    N  N   . GLY A 1 33  ? 10.542 -45.590 8.315   1.00 77.02  ? 405  GLY A N   1 
ATOM   9    C  CA  . GLY A 1 33  ? 10.602 -45.304 9.764   1.00 77.15  ? 405  GLY A CA  1 
ATOM   10   C  C   . GLY A 1 33  ? 11.982 -44.747 10.038  1.00 72.62  ? 405  GLY A C   1 
ATOM   11   O  O   . GLY A 1 33  ? 12.983 -45.372 9.652   1.00 69.87  ? 405  GLY A O   1 
ATOM   12   N  N   . HIS A 1 34  ? 12.059 -43.580 10.680  1.00 71.87  ? 406  HIS A N   1 
ATOM   13   C  CA  . HIS A 1 34  ? 13.232 -42.738 10.452  1.00 67.17  ? 406  HIS A CA  1 
ATOM   14   C  C   . HIS A 1 34  ? 14.533 -43.504 10.301  1.00 61.73  ? 406  HIS A C   1 
ATOM   15   O  O   . HIS A 1 34  ? 15.127 -43.998 11.267  1.00 61.00  ? 406  HIS A O   1 
ATOM   16   C  CB  . HIS A 1 34  ? 13.360 -41.564 11.391  1.00 69.18  ? 406  HIS A CB  1 
ATOM   17   C  CG  . HIS A 1 34  ? 13.499 -40.269 10.664  1.00 70.99  ? 406  HIS A CG  1 
ATOM   18   N  ND1 . HIS A 1 34  ? 12.497 -39.765 9.855   1.00 75.84  ? 406  HIS A ND1 1 
ATOM   19   C  CD2 . HIS A 1 34  ? 14.519 -39.381 10.601  1.00 71.34  ? 406  HIS A CD2 1 
ATOM   20   C  CE1 . HIS A 1 34  ? 12.889 -38.616 9.334   1.00 75.69  ? 406  HIS A CE1 1 
ATOM   21   N  NE2 . HIS A 1 34  ? 14.114 -38.360 9.771   1.00 74.29  ? 406  HIS A NE2 1 
ATOM   22   N  N   . VAL A 1 35  ? 14.926 -43.595 9.036   1.00 57.03  ? 407  VAL A N   1 
ATOM   23   C  CA  . VAL A 1 35  ? 16.056 -44.365 8.604   1.00 51.66  ? 407  VAL A CA  1 
ATOM   24   C  C   . VAL A 1 35  ? 17.293 -43.867 9.329   1.00 49.23  ? 407  VAL A C   1 
ATOM   25   O  O   . VAL A 1 35  ? 17.999 -44.669 9.930   1.00 47.98  ? 407  VAL A O   1 
ATOM   26   C  CB  . VAL A 1 35  ? 16.187 -44.306 7.073   1.00 49.98  ? 407  VAL A CB  1 
ATOM   27   C  CG1 . VAL A 1 35  ? 17.511 -44.892 6.605   1.00 45.93  ? 407  VAL A CG1 1 
ATOM   28   C  CG2 . VAL A 1 35  ? 15.004 -45.025 6.421   1.00 50.40  ? 407  VAL A CG2 1 
ATOM   29   N  N   . VAL A 1 36  ? 17.510 -42.549 9.318   1.00 48.15  ? 408  VAL A N   1 
ATOM   30   C  CA  . VAL A 1 36  ? 18.701 -41.941 9.924   1.00 45.94  ? 408  VAL A CA  1 
ATOM   31   C  C   . VAL A 1 36  ? 18.777 -42.166 11.437  1.00 47.51  ? 408  VAL A C   1 
ATOM   32   O  O   . VAL A 1 36  ? 19.870 -42.332 11.985  1.00 46.41  ? 408  VAL A O   1 
ATOM   33   C  CB  . VAL A 1 36  ? 18.838 -40.425 9.591   1.00 46.31  ? 408  VAL A CB  1 
ATOM   34   C  CG1 . VAL A 1 36  ? 17.791 -39.580 10.328  1.00 50.01  ? 408  VAL A CG1 1 
ATOM   35   C  CG2 . VAL A 1 36  ? 20.230 -39.934 9.925   1.00 43.72  ? 408  VAL A CG2 1 
ATOM   36   N  N   . ALA A 1 37  ? 17.622 -42.186 12.096  1.00 49.47  ? 409  ALA A N   1 
ATOM   37   C  CA  . ALA A 1 37  ? 17.560 -42.481 13.521  1.00 51.68  ? 409  ALA A CA  1 
ATOM   38   C  C   . ALA A 1 37  ? 17.927 -43.932 13.784  1.00 50.22  ? 409  ALA A C   1 
ATOM   39   O  O   . ALA A 1 37  ? 18.741 -44.219 14.657  1.00 50.52  ? 409  ALA A O   1 
ATOM   40   C  CB  . ALA A 1 37  ? 16.158 -42.164 14.098  1.00 55.47  ? 409  ALA A CB  1 
ATOM   41   N  N   . GLN A 1 38  ? 17.321 -44.835 13.022  1.00 49.32  ? 410  GLN A N   1 
ATOM   42   C  CA  . GLN A 1 38  ? 17.531 -46.267 13.180  1.00 48.79  ? 410  GLN A CA  1 
ATOM   43   C  C   . GLN A 1 38  ? 18.971 -46.686 12.831  1.00 44.75  ? 410  GLN A C   1 
ATOM   44   O  O   . GLN A 1 38  ? 19.624 -47.368 13.624  1.00 44.24  ? 410  GLN A O   1 
ATOM   45   C  CB  . GLN A 1 38  ? 16.496 -47.041 12.355  1.00 50.10  ? 410  GLN A CB  1 
ATOM   46   C  CG  . GLN A 1 38  ? 16.708 -48.559 12.292  1.00 51.58  ? 410  GLN A CG  1 
ATOM   47   C  CD  . GLN A 1 38  ? 15.410 -49.330 12.044  1.00 57.60  ? 410  GLN A CD  1 
ATOM   48   O  OE1 . GLN A 1 38  ? 14.398 -48.763 11.601  1.00 59.32  ? 410  GLN A OE1 1 
ATOM   49   N  NE2 . GLN A 1 38  ? 15.432 -50.631 12.339  1.00 58.68  ? 410  GLN A NE2 1 
ATOM   50   N  N   . VAL A 1 39  ? 19.462 -46.248 11.670  1.00 41.57  ? 411  VAL A N   1 
ATOM   51   C  CA  . VAL A 1 39  ? 20.818 -46.579 11.213  1.00 38.26  ? 411  VAL A CA  1 
ATOM   52   C  C   . VAL A 1 39  ? 21.919 -45.957 12.093  1.00 38.53  ? 411  VAL A C   1 
ATOM   53   O  O   . VAL A 1 39  ? 22.930 -46.608 12.382  1.00 37.19  ? 411  VAL A O   1 
ATOM   54   C  CB  . VAL A 1 39  ? 21.038 -46.227 9.724   1.00 35.90  ? 411  VAL A CB  1 
ATOM   55   C  CG1 . VAL A 1 39  ? 22.479 -46.486 9.322   1.00 32.71  ? 411  VAL A CG1 1 
ATOM   56   C  CG2 . VAL A 1 39  ? 20.106 -47.040 8.838   1.00 35.55  ? 411  VAL A CG2 1 
ATOM   57   N  N   . GLN A 1 40  ? 21.713 -44.712 12.531  1.00 40.42  ? 412  GLN A N   1 
ATOM   58   C  CA  . GLN A 1 40  ? 22.633 -44.069 13.482  1.00 41.10  ? 412  GLN A CA  1 
ATOM   59   C  C   . GLN A 1 40  ? 22.590 -44.672 14.882  1.00 43.61  ? 412  GLN A C   1 
ATOM   60   O  O   . GLN A 1 40  ? 23.542 -44.537 15.637  1.00 44.35  ? 412  GLN A O   1 
ATOM   61   C  CB  . GLN A 1 40  ? 22.408 -42.556 13.558  1.00 42.18  ? 412  GLN A CB  1 
ATOM   62   C  CG  . GLN A 1 40  ? 23.042 -41.755 12.407  1.00 40.25  ? 412  GLN A CG  1 
ATOM   63   C  CD  . GLN A 1 40  ? 22.747 -40.258 12.486  1.00 42.03  ? 412  GLN A CD  1 
ATOM   64   O  OE1 . GLN A 1 40  ? 21.954 -39.807 13.324  1.00 47.15  ? 412  GLN A OE1 1 
ATOM   65   N  NE2 . GLN A 1 40  ? 23.378 -39.484 11.614  1.00 39.67  ? 412  GLN A NE2 1 
ATOM   66   N  N   . SER A 1 41  ? 21.513 -45.357 15.234  1.00 45.95  ? 413  SER A N   1 
ATOM   67   C  CA  . SER A 1 41  ? 21.415 -45.946 16.581  1.00 49.23  ? 413  SER A CA  1 
ATOM   68   C  C   . SER A 1 41  ? 22.176 -47.277 16.720  1.00 48.53  ? 413  SER A C   1 
ATOM   69   O  O   . SER A 1 41  ? 22.301 -47.826 17.813  1.00 50.63  ? 413  SER A O   1 
ATOM   70   C  CB  . SER A 1 41  ? 19.957 -46.125 16.981  1.00 52.23  ? 413  SER A CB  1 
ATOM   71   O  OG  . SER A 1 41  ? 19.458 -47.337 16.442  1.00 53.42  ? 413  SER A OG  1 
ATOM   72   N  N   . VAL A 1 42  ? 22.684 -47.778 15.603  1.00 46.35  ? 414  VAL A N   1 
ATOM   73   C  CA  . VAL A 1 42  ? 23.515 -48.976 15.572  1.00 46.13  ? 414  VAL A CA  1 
ATOM   74   C  C   . VAL A 1 42  ? 24.922 -48.689 16.121  1.00 46.11  ? 414  VAL A C   1 
ATOM   75   O  O   . VAL A 1 42  ? 25.422 -47.563 16.025  1.00 45.55  ? 414  VAL A O   1 
ATOM   76   C  CB  . VAL A 1 42  ? 23.618 -49.510 14.116  1.00 43.63  ? 414  VAL A CB  1 
ATOM   77   C  CG1 . VAL A 1 42  ? 24.659 -50.632 13.994  1.00 42.48  ? 414  VAL A CG1 1 
ATOM   78   C  CG2 . VAL A 1 42  ? 22.252 -49.971 13.634  1.00 44.05  ? 414  VAL A CG2 1 
ATOM   79   N  N   . ASP A 1 43  ? 25.550 -49.734 16.665  1.00 47.44  ? 415  ASP A N   1 
ATOM   80   C  CA  . ASP A 1 43  ? 26.904 -49.705 17.255  1.00 47.26  ? 415  ASP A CA  1 
ATOM   81   C  C   . ASP A 1 43  ? 27.946 -48.927 16.461  1.00 43.66  ? 415  ASP A C   1 
ATOM   82   O  O   . ASP A 1 43  ? 28.376 -49.346 15.358  1.00 42.06  ? 415  ASP A O   1 
ATOM   83   C  CB  . ASP A 1 43  ? 27.401 -51.138 17.494  1.00 48.77  ? 415  ASP A CB  1 
ATOM   84   C  CG  . ASP A 1 43  ? 28.477 -51.215 18.579  1.00 52.82  ? 415  ASP A CG  1 
ATOM   85   O  OD1 . ASP A 1 43  ? 28.897 -50.138 19.078  1.00 57.13  ? 415  ASP A OD1 1 
ATOM   86   O  OD2 . ASP A 1 43  ? 28.905 -52.343 18.924  1.00 53.99  ? 415  ASP A OD2 1 
ATOM   87   N  N   . GLY A 1 44  ? 28.325 -47.773 17.016  1.00 43.11  ? 416  GLY A N   1 
ATOM   88   C  CA  . GLY A 1 44  ? 29.348 -46.919 16.415  1.00 39.38  ? 416  GLY A CA  1 
ATOM   89   C  C   . GLY A 1 44  ? 28.938 -46.209 15.129  1.00 36.13  ? 416  GLY A C   1 
ATOM   90   O  O   . GLY A 1 44  ? 29.781 -45.658 14.441  1.00 34.36  ? 416  GLY A O   1 
ATOM   91   N  N   . ASN A 1 45  ? 27.649 -46.209 14.805  1.00 35.74  ? 417  ASN A N   1 
ATOM   92   C  CA  . ASN A 1 45  ? 27.170 -45.579 13.561  1.00 33.90  ? 417  ASN A CA  1 
ATOM   93   C  C   . ASN A 1 45  ? 26.957 -44.068 13.656  1.00 34.57  ? 417  ASN A C   1 
ATOM   94   O  O   . ASN A 1 45  ? 26.736 -43.419 12.632  1.00 33.61  ? 417  ASN A O   1 
ATOM   95   C  CB  . ASN A 1 45  ? 25.910 -46.272 13.027  1.00 33.96  ? 417  ASN A CB  1 
ATOM   96   C  CG  . ASN A 1 45  ? 26.234 -47.457 12.093  1.00 33.58  ? 417  ASN A CG  1 
ATOM   97   O  OD1 . ASN A 1 45  ? 27.384 -47.914 12.013  1.00 32.61  ? 417  ASN A OD1 1 
ATOM   98   N  ND2 . ASN A 1 45  ? 25.219 -47.950 11.385  1.00 30.74  ? 417  ASN A ND2 1 
ATOM   99   N  N   . ALA A 1 46  ? 27.061 -43.521 14.871  1.00 36.07  ? 418  ALA A N   1 
ATOM   100  C  CA  . ALA A 1 46  ? 26.945 -42.078 15.105  1.00 37.56  ? 418  ALA A CA  1 
ATOM   101  C  C   . ALA A 1 46  ? 28.289 -41.327 15.013  1.00 37.18  ? 418  ALA A C   1 
ATOM   102  O  O   . ALA A 1 46  ? 28.342 -40.128 15.256  1.00 39.22  ? 418  ALA A O   1 
ATOM   103  C  CB  . ALA A 1 46  ? 26.269 -41.814 16.458  1.00 40.36  ? 418  ALA A CB  1 
ATOM   104  N  N   . GLN A 1 47  ? 29.367 -42.044 14.714  1.00 35.47  ? 419  GLN A N   1 
ATOM   105  C  CA  . GLN A 1 47  ? 30.636 -41.442 14.279  1.00 35.43  ? 419  GLN A CA  1 
ATOM   106  C  C   . GLN A 1 47  ? 30.897 -41.888 12.829  1.00 32.52  ? 419  GLN A C   1 
ATOM   107  O  O   . GLN A 1 47  ? 30.698 -43.060 12.497  1.00 31.86  ? 419  GLN A O   1 
ATOM   108  C  CB  . GLN A 1 47  ? 31.810 -41.920 15.152  1.00 35.87  ? 419  GLN A CB  1 
ATOM   109  C  CG  . GLN A 1 47  ? 31.898 -41.311 16.557  1.00 40.22  ? 419  GLN A CG  1 
ATOM   110  C  CD  . GLN A 1 47  ? 30.837 -41.854 17.492  1.00 41.97  ? 419  GLN A CD  1 
ATOM   111  O  OE1 . GLN A 1 47  ? 30.642 -43.060 17.568  1.00 42.53  ? 419  GLN A OE1 1 
ATOM   112  N  NE2 . GLN A 1 47  ? 30.131 -40.963 18.194  1.00 41.87  ? 419  GLN A NE2 1 
ATOM   113  N  N   . CYS A 1 48  ? 31.365 -40.984 11.979  1.00 31.90  ? 420  CYS A N   1 
ATOM   114  C  CA  . CYS A 1 48  ? 31.740 -41.353 10.609  1.00 29.89  ? 420  CYS A CA  1 
ATOM   115  C  C   . CYS A 1 48  ? 32.719 -42.516 10.636  1.00 29.13  ? 420  CYS A C   1 
ATOM   116  O  O   . CYS A 1 48  ? 33.628 -42.540 11.475  1.00 29.51  ? 420  CYS A O   1 
ATOM   117  C  CB  . CYS A 1 48  ? 32.396 -40.181 9.874   1.00 29.88  ? 420  CYS A CB  1 
ATOM   118  S  SG  . CYS A 1 48  ? 33.098 -40.683 8.277   1.00 29.91  ? 420  CYS A SG  1 
ATOM   119  N  N   . CYS A 1 49  ? 32.545 -43.466 9.711   1.00 27.74  ? 421  CYS A N   1 
ATOM   120  C  CA  . CYS A 1 49  ? 33.366 -44.688 9.679   1.00 27.44  ? 421  CYS A CA  1 
ATOM   121  C  C   . CYS A 1 49  ? 34.851 -44.366 9.452   1.00 27.81  ? 421  CYS A C   1 
ATOM   122  O  O   . CYS A 1 49  ? 35.751 -44.995 10.039  1.00 29.02  ? 421  CYS A O   1 
ATOM   123  C  CB  . CYS A 1 49  ? 32.872 -45.634 8.575   1.00 25.90  ? 421  CYS A CB  1 
ATOM   124  S  SG  . CYS A 1 49  ? 33.593 -47.318 8.643   1.00 27.52  ? 421  CYS A SG  1 
ATOM   125  N  N   . ASP A 1 50  ? 35.112 -43.365 8.618   1.00 27.18  ? 422  ASP A N   1 
ATOM   126  C  CA  . ASP A 1 50  ? 36.480 -43.111 8.219   1.00 27.57  ? 422  ASP A CA  1 
ATOM   127  C  C   . ASP A 1 50  ? 37.220 -42.031 9.031   1.00 29.12  ? 422  ASP A C   1 
ATOM   128  O  O   . ASP A 1 50  ? 38.447 -42.069 9.107   1.00 29.70  ? 422  ASP A O   1 
ATOM   129  C  CB  . ASP A 1 50  ? 36.538 -42.857 6.720   1.00 27.08  ? 422  ASP A CB  1 
ATOM   130  C  CG  . ASP A 1 50  ? 35.964 -44.025 5.907   1.00 26.78  ? 422  ASP A CG  1 
ATOM   131  O  OD1 . ASP A 1 50  ? 36.009 -45.191 6.372   1.00 24.09  ? 422  ASP A OD1 1 
ATOM   132  O  OD2 . ASP A 1 50  ? 35.475 -43.769 4.785   1.00 28.67  ? 422  ASP A OD2 1 
ATOM   133  N  N   . CYS A 1 51  ? 36.481 -41.108 9.656   1.00 29.09  ? 423  CYS A N   1 
ATOM   134  C  CA  . CYS A 1 51  ? 37.099 -39.973 10.373  1.00 31.50  ? 423  CYS A CA  1 
ATOM   135  C  C   . CYS A 1 51  ? 36.445 -39.602 11.710  1.00 32.86  ? 423  CYS A C   1 
ATOM   136  O  O   . CYS A 1 51  ? 36.874 -38.651 12.345  1.00 35.76  ? 423  CYS A O   1 
ATOM   137  C  CB  . CYS A 1 51  ? 37.136 -38.730 9.487   1.00 32.26  ? 423  CYS A CB  1 
ATOM   138  S  SG  . CYS A 1 51  ? 35.589 -37.812 9.456   1.00 30.98  ? 423  CYS A SG  1 
ATOM   139  N  N   . ARG A 1 52  ? 35.410 -40.345 12.112  1.00 31.74  ? 424  ARG A N   1 
ATOM   140  C  CA  . ARG A 1 52  ? 34.712 -40.169 13.401  1.00 33.48  ? 424  ARG A CA  1 
ATOM   141  C  C   . ARG A 1 52  ? 33.966 -38.855 13.552  1.00 34.79  ? 424  ARG A C   1 
ATOM   142  O  O   . ARG A 1 52  ? 33.605 -38.478 14.666  1.00 36.82  ? 424  ARG A O   1 
ATOM   143  C  CB  . ARG A 1 52  ? 35.643 -40.417 14.606  1.00 34.65  ? 424  ARG A CB  1 
ATOM   144  C  CG  . ARG A 1 52  ? 36.286 -41.794 14.559  1.00 34.69  ? 424  ARG A CG  1 
ATOM   145  C  CD  . ARG A 1 52  ? 37.170 -42.081 15.748  1.00 38.50  ? 424  ARG A CD  1 
ATOM   146  N  NE  . ARG A 1 52  ? 36.397 -42.109 16.982  1.00 42.69  ? 424  ARG A NE  1 
ATOM   147  C  CZ  . ARG A 1 52  ? 35.581 -43.094 17.348  1.00 42.44  ? 424  ARG A CZ  1 
ATOM   148  N  NH1 . ARG A 1 52  ? 35.424 -44.159 16.574  1.00 40.40  ? 424  ARG A NH1 1 
ATOM   149  N  NH2 . ARG A 1 52  ? 34.911 -43.008 18.492  1.00 44.37  ? 424  ARG A NH2 1 
ATOM   150  N  N   . GLU A 1 53  ? 33.764 -38.154 12.439  1.00 33.81  ? 425  GLU A N   1 
ATOM   151  C  CA  . GLU A 1 53  ? 32.898 -36.987 12.415  1.00 35.29  ? 425  GLU A CA  1 
ATOM   152  C  C   . GLU A 1 53  ? 31.533 -37.417 12.971  1.00 34.75  ? 425  GLU A C   1 
ATOM   153  O  O   . GLU A 1 53  ? 30.993 -38.443 12.567  1.00 32.90  ? 425  GLU A O   1 
ATOM   154  C  CB  . GLU A 1 53  ? 32.763 -36.449 10.983  1.00 34.64  ? 425  GLU A CB  1 
ATOM   155  C  CG  . GLU A 1 53  ? 31.701 -35.335 10.802  1.00 37.39  ? 425  GLU A CG  1 
ATOM   156  C  CD  . GLU A 1 53  ? 32.220 -33.965 11.166  1.00 44.76  ? 425  GLU A CD  1 
ATOM   157  O  OE1 . GLU A 1 53  ? 33.401 -33.678 10.847  1.00 46.60  ? 425  GLU A OE1 1 
ATOM   158  O  OE2 . GLU A 1 53  ? 31.451 -33.166 11.765  1.00 48.22  ? 425  GLU A OE2 1 
ATOM   159  N  N   . PRO A 1 54  ? 30.994 -36.653 13.927  1.00 37.33  ? 426  PRO A N   1 
ATOM   160  C  CA  . PRO A 1 54  ? 29.714 -37.015 14.542  1.00 37.69  ? 426  PRO A CA  1 
ATOM   161  C  C   . PRO A 1 54  ? 28.522 -36.832 13.612  1.00 36.48  ? 426  PRO A C   1 
ATOM   162  O  O   . PRO A 1 54  ? 28.551 -35.985 12.741  1.00 36.26  ? 426  PRO A O   1 
ATOM   163  C  CB  . PRO A 1 54  ? 29.589 -36.056 15.740  1.00 41.43  ? 426  PRO A CB  1 
ATOM   164  C  CG  . PRO A 1 54  ? 30.799 -35.219 15.765  1.00 42.37  ? 426  PRO A CG  1 
ATOM   165  C  CD  . PRO A 1 54  ? 31.667 -35.524 14.602  1.00 40.10  ? 426  PRO A CD  1 
ATOM   166  N  N   . ALA A 1 55  ? 27.479 -37.625 13.840  1.00 36.16  ? 427  ALA A N   1 
ATOM   167  C  CA  . ALA A 1 55  ? 26.195 -37.549 13.136  1.00 35.50  ? 427  ALA A CA  1 
ATOM   168  C  C   . ALA A 1 55  ? 26.298 -37.693 11.621  1.00 33.19  ? 427  ALA A C   1 
ATOM   169  O  O   . ALA A 1 55  ? 25.744 -36.891 10.879  1.00 34.22  ? 427  ALA A O   1 
ATOM   170  C  CB  . ALA A 1 55  ? 25.414 -36.300 13.533  1.00 38.00  ? 427  ALA A CB  1 
ATOM   171  N  N   . PRO A 1 56  ? 26.975 -38.742 11.150  1.00 31.05  ? 428  PRO A N   1 
ATOM   172  C  CA  . PRO A 1 56  ? 27.080 -38.918 9.695   1.00 29.59  ? 428  PRO A CA  1 
ATOM   173  C  C   . PRO A 1 56  ? 25.690 -39.182 9.088   1.00 30.28  ? 428  PRO A C   1 
ATOM   174  O  O   . PRO A 1 56  ? 24.915 -39.985 9.630   1.00 30.12  ? 428  PRO A O   1 
ATOM   175  C  CB  . PRO A 1 56  ? 27.971 -40.158 9.570   1.00 27.40  ? 428  PRO A CB  1 
ATOM   176  C  CG  . PRO A 1 56  ? 27.674 -40.940 10.802  1.00 27.06  ? 428  PRO A CG  1 
ATOM   177  C  CD  . PRO A 1 56  ? 27.449 -39.929 11.886  1.00 29.99  ? 428  PRO A CD  1 
ATOM   178  N  N   . GLU A 1 57  ? 25.371 -38.492 7.997   1.00 30.76  ? 429  GLU A N   1 
ATOM   179  C  CA  . GLU A 1 57  ? 24.058 -38.642 7.381   1.00 32.12  ? 429  GLU A CA  1 
ATOM   180  C  C   . GLU A 1 57  ? 24.129 -39.356 6.042   1.00 29.92  ? 429  GLU A C   1 
ATOM   181  O  O   . GLU A 1 57  ? 23.137 -39.422 5.331   1.00 30.42  ? 429  GLU A O   1 
ATOM   182  C  CB  . GLU A 1 57  ? 23.377 -37.282 7.223   1.00 35.05  ? 429  GLU A CB  1 
ATOM   183  C  CG  . GLU A 1 57  ? 22.928 -36.703 8.553   1.00 40.70  ? 429  GLU A CG  1 
ATOM   184  C  CD  . GLU A 1 57  ? 22.092 -35.443 8.398   1.00 47.75  ? 429  GLU A CD  1 
ATOM   185  O  OE1 . GLU A 1 57  ? 22.440 -34.583 7.551   1.00 48.22  ? 429  GLU A OE1 1 
ATOM   186  O  OE2 . GLU A 1 57  ? 21.087 -35.319 9.141   1.00 52.20  ? 429  GLU A OE2 1 
ATOM   187  N  N   . TRP A 1 58  ? 25.304 -39.882 5.709   1.00 27.95  ? 430  TRP A N   1 
ATOM   188  C  CA  . TRP A 1 58  ? 25.494 -40.604 4.443   1.00 26.96  ? 430  TRP A CA  1 
ATOM   189  C  C   . TRP A 1 58  ? 25.836 -42.063 4.716   1.00 25.90  ? 430  TRP A C   1 
ATOM   190  O  O   . TRP A 1 58  ? 26.077 -42.471 5.871   1.00 25.69  ? 430  TRP A O   1 
ATOM   191  C  CB  . TRP A 1 58  ? 26.551 -39.916 3.566   1.00 26.51  ? 430  TRP A CB  1 
ATOM   192  C  CG  . TRP A 1 58  ? 26.097 -38.555 3.178   1.00 28.03  ? 430  TRP A CG  1 
ATOM   193  C  CD1 . TRP A 1 58  ? 26.257 -37.399 3.897   1.00 30.62  ? 430  TRP A CD1 1 
ATOM   194  C  CD2 . TRP A 1 58  ? 25.312 -38.208 2.031   1.00 28.17  ? 430  TRP A CD2 1 
ATOM   195  N  NE1 . TRP A 1 58  ? 25.648 -36.352 3.247   1.00 32.34  ? 430  TRP A NE1 1 
ATOM   196  C  CE2 . TRP A 1 58  ? 25.057 -36.816 2.104   1.00 30.65  ? 430  TRP A CE2 1 
ATOM   197  C  CE3 . TRP A 1 58  ? 24.807 -38.933 0.945   1.00 27.23  ? 430  TRP A CE3 1 
ATOM   198  C  CZ2 . TRP A 1 58  ? 24.326 -36.127 1.118   1.00 34.22  ? 430  TRP A CZ2 1 
ATOM   199  C  CZ3 . TRP A 1 58  ? 24.083 -38.245 -0.046  1.00 30.10  ? 430  TRP A CZ3 1 
ATOM   200  C  CH2 . TRP A 1 58  ? 23.851 -36.859 0.051   1.00 32.43  ? 430  TRP A CH2 1 
ATOM   201  N  N   . ALA A 1 59  ? 25.801 -42.872 3.674   1.00 25.18  ? 431  ALA A N   1 
ATOM   202  C  CA  . ALA A 1 59  ? 26.066 -44.284 3.867   1.00 24.71  ? 431  ALA A CA  1 
ATOM   203  C  C   . ALA A 1 59  ? 26.679 -44.922 2.648   1.00 24.73  ? 431  ALA A C   1 
ATOM   204  O  O   . ALA A 1 59  ? 26.481 -44.457 1.524   1.00 25.32  ? 431  ALA A O   1 
ATOM   205  C  CB  . ALA A 1 59  ? 24.785 -45.024 4.279   1.00 25.28  ? 431  ALA A CB  1 
ATOM   206  N  N   . SER A 1 60  ? 27.412 -46.008 2.877   1.00 24.69  ? 432  SER A N   1 
ATOM   207  C  CA  . SER A 1 60  ? 27.827 -46.884 1.801   1.00 24.71  ? 432  SER A CA  1 
ATOM   208  C  C   . SER A 1 60  ? 27.046 -48.152 2.031   1.00 25.19  ? 432  SER A C   1 
ATOM   209  O  O   . SER A 1 60  ? 27.166 -48.783 3.109   1.00 25.64  ? 432  SER A O   1 
ATOM   210  C  CB  . SER A 1 60  ? 29.323 -47.173 1.857   1.00 24.66  ? 432  SER A CB  1 
ATOM   211  O  OG  . SER A 1 60  ? 29.678 -48.003 0.767   1.00 28.36  ? 432  SER A OG  1 
ATOM   212  N  N   . ILE A 1 61  ? 26.234 -48.522 1.037   1.00 25.48  ? 433  ILE A N   1 
ATOM   213  C  CA  . ILE A 1 61  ? 25.275 -49.618 1.201   1.00 26.05  ? 433  ILE A CA  1 
ATOM   214  C  C   . ILE A 1 61  ? 25.811 -51.023 0.848   1.00 27.48  ? 433  ILE A C   1 
ATOM   215  O  O   . ILE A 1 61  ? 25.197 -52.036 1.224   1.00 28.08  ? 433  ILE A O   1 
ATOM   216  C  CB  . ILE A 1 61  ? 23.910 -49.343 0.480   1.00 27.22  ? 433  ILE A CB  1 
ATOM   217  C  CG1 . ILE A 1 61  ? 24.075 -49.220 -1.039  1.00 24.96  ? 433  ILE A CG1 1 
ATOM   218  C  CG2 . ILE A 1 61  ? 23.216 -48.129 1.095   1.00 26.50  ? 433  ILE A CG2 1 
ATOM   219  C  CD1 . ILE A 1 61  ? 22.747 -49.202 -1.802  1.00 25.35  ? 433  ILE A CD1 1 
ATOM   220  N  N   . ASN A 1 62  ? 26.924 -51.087 0.117   1.00 27.23  ? 434  ASN A N   1 
ATOM   221  C  CA  . ASN A 1 62  ? 27.621 -52.361 -0.077  1.00 28.05  ? 434  ASN A CA  1 
ATOM   222  C  C   . ASN A 1 62  ? 28.610 -52.630 1.050   1.00 27.22  ? 434  ASN A C   1 
ATOM   223  O  O   . ASN A 1 62  ? 28.843 -53.775 1.427   1.00 28.24  ? 434  ASN A O   1 
ATOM   224  C  CB  . ASN A 1 62  ? 28.313 -52.428 -1.438  1.00 29.54  ? 434  ASN A CB  1 
ATOM   225  C  CG  . ASN A 1 62  ? 29.305 -51.295 -1.657  1.00 29.56  ? 434  ASN A CG  1 
ATOM   226  O  OD1 . ASN A 1 62  ? 29.042 -50.129 -1.335  1.00 32.42  ? 434  ASN A OD1 1 
ATOM   227  N  ND2 . ASN A 1 62  ? 30.452 -51.638 -2.187  1.00 30.71  ? 434  ASN A ND2 1 
ATOM   228  N  N   . LEU A 1 63  ? 29.176 -51.574 1.607   1.00 25.83  ? 435  LEU A N   1 
ATOM   229  C  CA  . LEU A 1 63  ? 30.061 -51.731 2.742   1.00 25.16  ? 435  LEU A CA  1 
ATOM   230  C  C   . LEU A 1 63  ? 29.307 -51.878 4.046   1.00 25.10  ? 435  LEU A C   1 
ATOM   231  O  O   . LEU A 1 63  ? 29.759 -52.584 4.933   1.00 26.47  ? 435  LEU A O   1 
ATOM   232  C  CB  . LEU A 1 63  ? 31.020 -50.560 2.818   1.00 25.00  ? 435  LEU A CB  1 
ATOM   233  C  CG  . LEU A 1 63  ? 32.082 -50.576 1.730   1.00 25.86  ? 435  LEU A CG  1 
ATOM   234  C  CD1 . LEU A 1 63  ? 32.772 -49.234 1.636   1.00 25.18  ? 435  LEU A CD1 1 
ATOM   235  C  CD2 . LEU A 1 63  ? 33.094 -51.731 1.981   1.00 28.79  ? 435  LEU A CD2 1 
ATOM   236  N  N   . GLY A 1 64  ? 28.155 -51.225 4.169   1.00 24.84  ? 436  GLY A N   1 
ATOM   237  C  CA  . GLY A 1 64  ? 27.347 -51.316 5.398   1.00 24.65  ? 436  GLY A CA  1 
ATOM   238  C  C   . GLY A 1 64  ? 27.743 -50.315 6.472   1.00 23.80  ? 436  GLY A C   1 
ATOM   239  O  O   . GLY A 1 64  ? 27.655 -50.605 7.678   1.00 24.33  ? 436  GLY A O   1 
ATOM   240  N  N   . VAL A 1 65  ? 28.181 -49.135 6.027   1.00 23.00  ? 437  VAL A N   1 
ATOM   241  C  CA  . VAL A 1 65  ? 28.684 -48.083 6.916   1.00 22.75  ? 437  VAL A CA  1 
ATOM   242  C  C   . VAL A 1 65  ? 28.097 -46.685 6.669   1.00 23.48  ? 437  VAL A C   1 
ATOM   243  O  O   . VAL A 1 65  ? 27.684 -46.342 5.528   1.00 23.34  ? 437  VAL A O   1 
ATOM   244  C  CB  . VAL A 1 65  ? 30.242 -47.941 6.828   1.00 22.33  ? 437  VAL A CB  1 
ATOM   245  C  CG1 . VAL A 1 65  ? 30.919 -49.232 7.250   1.00 20.43  ? 437  VAL A CG1 1 
ATOM   246  C  CG2 . VAL A 1 65  ? 30.685 -47.458 5.425   1.00 20.57  ? 437  VAL A CG2 1 
ATOM   247  N  N   . THR A 1 66  ? 28.138 -45.879 7.730   1.00 23.85  ? 438  THR A N   1 
ATOM   248  C  CA  . THR A 1 66  ? 27.767 -44.452 7.689   1.00 24.82  ? 438  THR A CA  1 
ATOM   249  C  C   . THR A 1 66  ? 28.989 -43.527 7.558   1.00 25.00  ? 438  THR A C   1 
ATOM   250  O  O   . THR A 1 66  ? 30.078 -43.805 8.079   1.00 25.60  ? 438  THR A O   1 
ATOM   251  C  CB  . THR A 1 66  ? 26.997 -44.036 8.929   1.00 25.65  ? 438  THR A CB  1 
ATOM   252  O  OG1 . THR A 1 66  ? 27.824 -44.272 10.069  1.00 26.60  ? 438  THR A OG1 1 
ATOM   253  C  CG2 . THR A 1 66  ? 25.699 -44.825 9.065   1.00 25.05  ? 438  THR A CG2 1 
ATOM   254  N  N   . LEU A 1 67  ? 28.781 -42.422 6.853   1.00 25.43  ? 439  LEU A N   1 
ATOM   255  C  CA  . LEU A 1 67  ? 29.842 -41.526 6.437   1.00 25.06  ? 439  LEU A CA  1 
ATOM   256  C  C   . LEU A 1 67  ? 29.334 -40.096 6.525   1.00 26.65  ? 439  LEU A C   1 
ATOM   257  O  O   . LEU A 1 67  ? 28.118 -39.855 6.370   1.00 26.70  ? 439  LEU A O   1 
ATOM   258  C  CB  . LEU A 1 67  ? 30.257 -41.823 4.992   1.00 23.82  ? 439  LEU A CB  1 
ATOM   259  C  CG  . LEU A 1 67  ? 30.634 -43.274 4.706   1.00 22.62  ? 439  LEU A CG  1 
ATOM   260  C  CD1 . LEU A 1 67  ? 30.592 -43.554 3.195   1.00 23.13  ? 439  LEU A CD1 1 
ATOM   261  C  CD2 . LEU A 1 67  ? 32.011 -43.640 5.312   1.00 22.08  ? 439  LEU A CD2 1 
ATOM   262  N  N   . CYS A 1 68  ? 30.268 -39.170 6.789   1.00 27.21  ? 440  CYS A N   1 
ATOM   263  C  CA  . CYS A 1 68  ? 29.994 -37.762 6.822   1.00 29.13  ? 440  CYS A CA  1 
ATOM   264  C  C   . CYS A 1 68  ? 30.010 -37.225 5.399   1.00 29.89  ? 440  CYS A C   1 
ATOM   265  O  O   . CYS A 1 68  ? 30.277 -37.974 4.441   1.00 28.87  ? 440  CYS A O   1 
ATOM   266  C  CB  . CYS A 1 68  ? 31.029 -37.038 7.701   1.00 30.44  ? 440  CYS A CB  1 
ATOM   267  S  SG  . CYS A 1 68  ? 32.748 -36.983 7.065   1.00 30.64  ? 440  CYS A SG  1 
ATOM   268  N  N   . ILE A 1 69  ? 29.719 -35.929 5.266   1.00 32.16  ? 441  ILE A N   1 
ATOM   269  C  CA  . ILE A 1 69  ? 29.661 -35.247 3.978   1.00 32.95  ? 441  ILE A CA  1 
ATOM   270  C  C   . ILE A 1 69  ? 30.989 -35.427 3.252   1.00 33.14  ? 441  ILE A C   1 
ATOM   271  O  O   . ILE A 1 69  ? 31.028 -35.913 2.106   1.00 32.26  ? 441  ILE A O   1 
ATOM   272  C  CB  . ILE A 1 69  ? 29.359 -33.718 4.139   1.00 35.81  ? 441  ILE A CB  1 
ATOM   273  C  CG1 . ILE A 1 69  ? 28.031 -33.487 4.879   1.00 37.51  ? 441  ILE A CG1 1 
ATOM   274  C  CG2 . ILE A 1 69  ? 29.366 -33.000 2.781   1.00 36.54  ? 441  ILE A CG2 1 
ATOM   275  C  CD1 . ILE A 1 69  ? 27.558 -32.001 4.930   1.00 36.81  ? 441  ILE A CD1 1 
ATOM   276  N  N   . GLN A 1 70  ? 32.067 -35.050 3.936   1.00 33.92  ? 442  GLN A N   1 
ATOM   277  C  CA  . GLN A 1 70  ? 33.427 -35.107 3.393   1.00 34.57  ? 442  GLN A CA  1 
ATOM   278  C  C   . GLN A 1 70  ? 33.831 -36.524 2.944   1.00 32.63  ? 442  GLN A C   1 
ATOM   279  O  O   . GLN A 1 70  ? 34.225 -36.716 1.798   1.00 33.02  ? 442  GLN A O   1 
ATOM   280  C  CB  . GLN A 1 70  ? 34.428 -34.556 4.420   1.00 35.96  ? 442  GLN A CB  1 
ATOM   281  C  CG  . GLN A 1 70  ? 35.770 -34.205 3.820   1.00 38.14  ? 442  GLN A CG  1 
ATOM   282  C  CD  . GLN A 1 70  ? 36.588 -33.272 4.682   1.00 40.51  ? 442  GLN A CD  1 
ATOM   283  O  OE1 . GLN A 1 70  ? 36.629 -33.397 5.908   1.00 40.21  ? 442  GLN A OE1 1 
ATOM   284  N  NE2 . GLN A 1 70  ? 37.270 -32.344 4.040   1.00 43.09  ? 442  GLN A NE2 1 
ATOM   285  N  N   . CYS A 1 71  ? 33.735 -37.514 3.839   1.00 30.75  ? 443  CYS A N   1 
ATOM   286  C  CA  . CYS A 1 71  ? 34.131 -38.872 3.472   1.00 29.15  ? 443  CYS A CA  1 
ATOM   287  C  C   . CYS A 1 71  ? 33.229 -39.544 2.420   1.00 27.56  ? 443  CYS A C   1 
ATOM   288  O  O   . CYS A 1 71  ? 33.731 -40.337 1.608   1.00 27.39  ? 443  CYS A O   1 
ATOM   289  C  CB  . CYS A 1 71  ? 34.288 -39.760 4.701   1.00 28.27  ? 443  CYS A CB  1 
ATOM   290  S  SG  . CYS A 1 71  ? 35.640 -39.209 5.777   1.00 32.02  ? 443  CYS A SG  1 
ATOM   291  N  N   . SER A 1 72  ? 31.923 -39.252 2.428   1.00 26.41  ? 444  SER A N   1 
ATOM   292  C  CA  . SER A 1 72  ? 31.040 -39.825 1.405   1.00 25.77  ? 444  SER A CA  1 
ATOM   293  C  C   . SER A 1 72  ? 31.397 -39.287 0.020   1.00 26.50  ? 444  SER A C   1 
ATOM   294  O  O   . SER A 1 72  ? 31.343 -40.026 -0.968  1.00 26.61  ? 444  SER A O   1 
ATOM   295  C  CB  . SER A 1 72  ? 29.561 -39.569 1.714   1.00 25.63  ? 444  SER A CB  1 
ATOM   296  O  OG  . SER A 1 72  ? 29.302 -38.182 1.851   1.00 29.47  ? 444  SER A OG  1 
ATOM   297  N  N   . GLY A 1 73  ? 31.752 -38.002 -0.033  1.00 27.57  ? 445  GLY A N   1 
ATOM   298  C  CA  . GLY A 1 73  ? 32.225 -37.355 -1.254  1.00 29.63  ? 445  GLY A CA  1 
ATOM   299  C  C   . GLY A 1 73  ? 33.450 -38.066 -1.797  1.00 30.23  ? 445  GLY A C   1 
ATOM   300  O  O   . GLY A 1 73  ? 33.534 -38.322 -2.995  1.00 31.34  ? 445  GLY A O   1 
ATOM   301  N  N   . ILE A 1 74  ? 34.386 -38.409 -0.908  1.00 29.67  ? 446  ILE A N   1 
ATOM   302  C  CA  . ILE A 1 74  ? 35.569 -39.197 -1.288  1.00 30.20  ? 446  ILE A CA  1 
ATOM   303  C  C   . ILE A 1 74  ? 35.186 -40.609 -1.759  1.00 28.76  ? 446  ILE A C   1 
ATOM   304  O  O   . ILE A 1 74  ? 35.668 -41.058 -2.792  1.00 29.79  ? 446  ILE A O   1 
ATOM   305  C  CB  . ILE A 1 74  ? 36.651 -39.252 -0.144  1.00 30.24  ? 446  ILE A CB  1 
ATOM   306  C  CG1 . ILE A 1 74  ? 37.183 -37.834 0.164   1.00 31.82  ? 446  ILE A CG1 1 
ATOM   307  C  CG2 . ILE A 1 74  ? 37.823 -40.147 -0.539  1.00 30.01  ? 446  ILE A CG2 1 
ATOM   308  C  CD1 . ILE A 1 74  ? 37.828 -37.662 1.532   1.00 31.56  ? 446  ILE A CD1 1 
ATOM   309  N  N   . HIS A 1 75  ? 34.321 -41.302 -1.018  1.00 26.68  ? 447  HIS A N   1 
ATOM   310  C  CA  . HIS A 1 75  ? 33.805 -42.595 -1.493  1.00 26.12  ? 447  HIS A CA  1 
ATOM   311  C  C   . HIS A 1 75  ? 33.255 -42.513 -2.932  1.00 26.83  ? 447  HIS A C   1 
ATOM   312  O  O   . HIS A 1 75  ? 33.330 -43.484 -3.668  1.00 27.19  ? 447  HIS A O   1 
ATOM   313  C  CB  . HIS A 1 75  ? 32.722 -43.155 -0.577  1.00 24.56  ? 447  HIS A CB  1 
ATOM   314  C  CG  . HIS A 1 75  ? 33.241 -43.923 0.606   1.00 24.90  ? 447  HIS A CG  1 
ATOM   315  N  ND1 . HIS A 1 75  ? 34.043 -43.358 1.577   1.00 26.40  ? 447  HIS A ND1 1 
ATOM   316  C  CD2 . HIS A 1 75  ? 33.010 -45.195 1.009   1.00 22.47  ? 447  HIS A CD2 1 
ATOM   317  C  CE1 . HIS A 1 75  ? 34.317 -44.263 2.503   1.00 23.67  ? 447  HIS A CE1 1 
ATOM   318  N  NE2 . HIS A 1 75  ? 33.701 -45.385 2.181   1.00 24.22  ? 447  HIS A NE2 1 
ATOM   319  N  N   . ARG A 1 76  ? 32.706 -41.368 -3.330  1.00 27.63  ? 448  ARG A N   1 
ATOM   320  C  CA  . ARG A 1 76  ? 32.107 -41.251 -4.670  1.00 29.44  ? 448  ARG A CA  1 
ATOM   321  C  C   . ARG A 1 76  ? 33.189 -41.339 -5.738  1.00 32.02  ? 448  ARG A C   1 
ATOM   322  O  O   . ARG A 1 76  ? 32.924 -41.698 -6.877  1.00 33.11  ? 448  ARG A O   1 
ATOM   323  C  CB  . ARG A 1 76  ? 31.361 -39.922 -4.849  1.00 30.24  ? 448  ARG A CB  1 
ATOM   324  C  CG  . ARG A 1 76  ? 30.123 -39.751 -4.005  1.00 27.77  ? 448  ARG A CG  1 
ATOM   325  C  CD  . ARG A 1 76  ? 29.520 -38.352 -4.218  1.00 27.86  ? 448  ARG A CD  1 
ATOM   326  N  NE  . ARG A 1 76  ? 28.499 -38.080 -3.216  1.00 26.52  ? 448  ARG A NE  1 
ATOM   327  C  CZ  . ARG A 1 76  ? 27.272 -38.605 -3.217  1.00 26.51  ? 448  ARG A CZ  1 
ATOM   328  N  NH1 . ARG A 1 76  ? 26.877 -39.431 -4.173  1.00 27.46  ? 448  ARG A NH1 1 
ATOM   329  N  NH2 . ARG A 1 76  ? 26.435 -38.318 -2.242  1.00 28.46  ? 448  ARG A NH2 1 
ATOM   330  N  N   . SER A 1 77  ? 34.404 -40.984 -5.334  1.00 33.38  ? 449  SER A N   1 
ATOM   331  C  CA  . SER A 1 77  ? 35.599 -41.057 -6.164  1.00 36.84  ? 449  SER A CA  1 
ATOM   332  C  C   . SER A 1 77  ? 36.016 -42.469 -6.522  1.00 36.49  ? 449  SER A C   1 
ATOM   333  O  O   . SER A 1 77  ? 36.629 -42.673 -7.555  1.00 38.45  ? 449  SER A O   1 
ATOM   334  C  CB  . SER A 1 77  ? 36.774 -40.398 -5.442  1.00 36.68  ? 449  SER A CB  1 
ATOM   335  O  OG  . SER A 1 77  ? 36.906 -39.107 -5.943  1.00 42.64  ? 449  SER A OG  1 
ATOM   336  N  N   . LEU A 1 78  ? 35.706 -43.419 -5.647  1.00 34.50  ? 450  LEU A N   1 
ATOM   337  C  CA  . LEU A 1 78  ? 36.218 -44.777 -5.788  1.00 35.50  ? 450  LEU A CA  1 
ATOM   338  C  C   . LEU A 1 78  ? 35.512 -45.569 -6.877  1.00 36.70  ? 450  LEU A C   1 
ATOM   339  O  O   . LEU A 1 78  ? 36.103 -46.460 -7.472  1.00 37.93  ? 450  LEU A O   1 
ATOM   340  C  CB  . LEU A 1 78  ? 36.119 -45.521 -4.459  1.00 33.14  ? 450  LEU A CB  1 
ATOM   341  C  CG  . LEU A 1 78  ? 36.677 -44.791 -3.237  1.00 32.55  ? 450  LEU A CG  1 
ATOM   342  C  CD1 . LEU A 1 78  ? 36.396 -45.567 -1.980  1.00 27.73  ? 450  LEU A CD1 1 
ATOM   343  C  CD2 . LEU A 1 78  ? 38.190 -44.503 -3.407  1.00 33.32  ? 450  LEU A CD2 1 
ATOM   344  N  N   . GLY A 1 79  ? 34.248 -45.237 -7.136  1.00 36.99  ? 451  GLY A N   1 
ATOM   345  C  CA  . GLY A 1 79  ? 33.436 -45.993 -8.083  1.00 38.66  ? 451  GLY A CA  1 
ATOM   346  C  C   . GLY A 1 79  ? 32.640 -47.076 -7.375  1.00 37.64  ? 451  GLY A C   1 
ATOM   347  O  O   . GLY A 1 79  ? 32.952 -47.452 -6.223  1.00 35.99  ? 451  GLY A O   1 
ATOM   348  N  N   . VAL A 1 80  ? 31.636 -47.601 -8.079  1.00 39.36  ? 452  VAL A N   1 
ATOM   349  C  CA  . VAL A 1 80  ? 30.596 -48.456 -7.482  1.00 38.92  ? 452  VAL A CA  1 
ATOM   350  C  C   . VAL A 1 80  ? 31.120 -49.809 -7.029  1.00 39.41  ? 452  VAL A C   1 
ATOM   351  O  O   . VAL A 1 80  ? 30.571 -50.398 -6.095  1.00 38.56  ? 452  VAL A O   1 
ATOM   352  C  CB  . VAL A 1 80  ? 29.331 -48.617 -8.393  1.00 40.74  ? 452  VAL A CB  1 
ATOM   353  C  CG1 . VAL A 1 80  ? 28.577 -47.275 -8.499  1.00 40.86  ? 452  VAL A CG1 1 
ATOM   354  C  CG2 . VAL A 1 80  ? 29.701 -49.138 -9.779  1.00 42.00  ? 452  VAL A CG2 1 
ATOM   355  N  N   . HIS A 1 81  ? 32.199 -50.275 -7.659  1.00 41.68  ? 453  HIS A N   1 
ATOM   356  C  CA  . HIS A 1 81  ? 32.872 -51.501 -7.231  1.00 42.41  ? 453  HIS A CA  1 
ATOM   357  C  C   . HIS A 1 81  ? 33.365 -51.443 -5.789  1.00 39.29  ? 453  HIS A C   1 
ATOM   358  O  O   . HIS A 1 81  ? 33.377 -52.461 -5.099  1.00 39.33  ? 453  HIS A O   1 
ATOM   359  C  CB  . HIS A 1 81  ? 34.047 -51.865 -8.144  1.00 45.88  ? 453  HIS A CB  1 
ATOM   360  C  CG  . HIS A 1 81  ? 34.723 -53.139 -7.738  1.00 51.01  ? 453  HIS A CG  1 
ATOM   361  N  ND1 . HIS A 1 81  ? 35.882 -53.164 -6.985  1.00 54.48  ? 453  HIS A ND1 1 
ATOM   362  C  CD2 . HIS A 1 81  ? 34.367 -54.435 -7.925  1.00 54.92  ? 453  HIS A CD2 1 
ATOM   363  C  CE1 . HIS A 1 81  ? 36.226 -54.420 -6.753  1.00 56.34  ? 453  HIS A CE1 1 
ATOM   364  N  NE2 . HIS A 1 81  ? 35.322 -55.210 -7.310  1.00 57.23  ? 453  HIS A NE2 1 
ATOM   365  N  N   . PHE A 1 82  ? 33.770 -50.260 -5.332  1.00 37.08  ? 454  PHE A N   1 
ATOM   366  C  CA  . PHE A 1 82  ? 34.233 -50.115 -3.957  1.00 33.86  ? 454  PHE A CA  1 
ATOM   367  C  C   . PHE A 1 82  ? 33.142 -49.619 -3.014  1.00 31.86  ? 454  PHE A C   1 
ATOM   368  O  O   . PHE A 1 82  ? 33.080 -50.035 -1.848  1.00 30.90  ? 454  PHE A O   1 
ATOM   369  C  CB  . PHE A 1 82  ? 35.478 -49.221 -3.888  1.00 33.93  ? 454  PHE A CB  1 
ATOM   370  C  CG  . PHE A 1 82  ? 36.678 -49.823 -4.562  1.00 34.56  ? 454  PHE A CG  1 
ATOM   371  C  CD1 . PHE A 1 82  ? 37.450 -50.790 -3.910  1.00 33.40  ? 454  PHE A CD1 1 
ATOM   372  C  CD2 . PHE A 1 82  ? 37.015 -49.454 -5.861  1.00 34.90  ? 454  PHE A CD2 1 
ATOM   373  C  CE1 . PHE A 1 82  ? 38.558 -51.373 -4.540  1.00 34.55  ? 454  PHE A CE1 1 
ATOM   374  C  CE2 . PHE A 1 82  ? 38.115 -50.030 -6.510  1.00 38.15  ? 454  PHE A CE2 1 
ATOM   375  C  CZ  . PHE A 1 82  ? 38.891 -50.994 -5.851  1.00 37.69  ? 454  PHE A CZ  1 
ATOM   376  N  N   . SER A 1 83  ? 32.279 -48.734 -3.505  1.00 31.12  ? 455  SER A N   1 
ATOM   377  C  CA  . SER A 1 83  ? 31.356 -48.055 -2.612  1.00 29.16  ? 455  SER A CA  1 
ATOM   378  C  C   . SER A 1 83  ? 30.137 -47.454 -3.318  1.00 29.45  ? 455  SER A C   1 
ATOM   379  O  O   . SER A 1 83  ? 30.267 -46.810 -4.363  1.00 29.80  ? 455  SER A O   1 
ATOM   380  C  CB  . SER A 1 83  ? 32.110 -46.966 -1.830  1.00 28.72  ? 455  SER A CB  1 
ATOM   381  O  OG  . SER A 1 83  ? 31.393 -46.595 -0.671  1.00 27.37  ? 455  SER A OG  1 
ATOM   382  N  N   . LYS A 1 84  ? 28.962 -47.684 -2.731  1.00 28.67  ? 456  LYS A N   1 
ATOM   383  C  CA  . LYS A 1 84  ? 27.697 -47.163 -3.246  1.00 29.16  ? 456  LYS A CA  1 
ATOM   384  C  C   . LYS A 1 84  ? 27.137 -46.231 -2.192  1.00 27.46  ? 456  LYS A C   1 
ATOM   385  O  O   . LYS A 1 84  ? 26.676 -46.686 -1.131  1.00 26.95  ? 456  LYS A O   1 
ATOM   386  C  CB  . LYS A 1 84  ? 26.703 -48.286 -3.504  1.00 30.32  ? 456  LYS A CB  1 
ATOM   387  C  CG  . LYS A 1 84  ? 27.128 -49.302 -4.520  1.00 33.53  ? 456  LYS A CG  1 
ATOM   388  C  CD  . LYS A 1 84  ? 26.065 -50.405 -4.617  1.00 38.17  ? 456  LYS A CD  1 
ATOM   389  C  CE  . LYS A 1 84  ? 26.233 -51.240 -5.888  1.00 42.05  ? 456  LYS A CE  1 
ATOM   390  N  NZ  . LYS A 1 84  ? 27.593 -51.853 -5.950  1.00 43.48  ? 456  LYS A NZ  1 
ATOM   391  N  N   . VAL A 1 85  ? 27.189 -44.933 -2.490  1.00 26.89  ? 457  VAL A N   1 
ATOM   392  C  CA  . VAL A 1 85  ? 26.868 -43.876 -1.535  1.00 25.64  ? 457  VAL A CA  1 
ATOM   393  C  C   . VAL A 1 85  ? 25.383 -43.504 -1.603  1.00 25.89  ? 457  VAL A C   1 
ATOM   394  O  O   . VAL A 1 85  ? 24.835 -43.322 -2.668  1.00 26.50  ? 457  VAL A O   1 
ATOM   395  C  CB  . VAL A 1 85  ? 27.756 -42.613 -1.783  1.00 26.56  ? 457  VAL A CB  1 
ATOM   396  C  CG1 . VAL A 1 85  ? 27.427 -41.496 -0.793  1.00 24.48  ? 457  VAL A CG1 1 
ATOM   397  C  CG2 . VAL A 1 85  ? 29.247 -42.985 -1.701  1.00 26.57  ? 457  VAL A CG2 1 
ATOM   398  N  N   . ARG A 1 86  ? 24.747 -43.405 -0.446  1.00 25.81  ? 458  ARG A N   1 
ATOM   399  C  CA  . ARG A 1 86  ? 23.326 -43.079 -0.355  1.00 27.18  ? 458  ARG A CA  1 
ATOM   400  C  C   . ARG A 1 86  ? 23.150 -42.145 0.811   1.00 27.63  ? 458  ARG A C   1 
ATOM   401  O  O   . ARG A 1 86  ? 23.969 -42.161 1.719   1.00 27.61  ? 458  ARG A O   1 
ATOM   402  C  CB  . ARG A 1 86  ? 22.496 -44.349 -0.120  1.00 26.93  ? 458  ARG A CB  1 
ATOM   403  C  CG  . ARG A 1 86  ? 22.561 -45.363 -1.274  1.00 26.91  ? 458  ARG A CG  1 
ATOM   404  C  CD  . ARG A 1 86  ? 21.941 -44.755 -2.527  1.00 26.82  ? 458  ARG A CD  1 
ATOM   405  N  NE  . ARG A 1 86  ? 21.887 -45.666 -3.660  1.00 27.69  ? 458  ARG A NE  1 
ATOM   406  C  CZ  . ARG A 1 86  ? 22.874 -45.853 -4.534  1.00 29.17  ? 458  ARG A CZ  1 
ATOM   407  N  NH1 . ARG A 1 86  ? 24.024 -45.203 -4.411  1.00 29.23  ? 458  ARG A NH1 1 
ATOM   408  N  NH2 . ARG A 1 86  ? 22.707 -46.696 -5.543  1.00 30.13  ? 458  ARG A NH2 1 
ATOM   409  N  N   . SER A 1 87  ? 22.088 -41.341 0.782   1.00 29.38  ? 459  SER A N   1 
ATOM   410  C  CA  . SER A 1 87  ? 21.739 -40.443 1.878   1.00 30.49  ? 459  SER A CA  1 
ATOM   411  C  C   . SER A 1 87  ? 20.794 -41.147 2.834   1.00 30.89  ? 459  SER A C   1 
ATOM   412  O  O   . SER A 1 87  ? 19.792 -41.714 2.406   1.00 31.42  ? 459  SER A O   1 
ATOM   413  C  CB  . SER A 1 87  ? 21.058 -39.176 1.332   1.00 32.73  ? 459  SER A CB  1 
ATOM   414  O  OG  . SER A 1 87  ? 20.475 -38.410 2.389   1.00 36.19  ? 459  SER A OG  1 
ATOM   415  N  N   . LEU A 1 88  ? 21.105 -41.094 4.127   1.00 30.87  ? 460  LEU A N   1 
ATOM   416  C  CA  . LEU A 1 88  ? 20.195 -41.578 5.159   1.00 32.65  ? 460  LEU A CA  1 
ATOM   417  C  C   . LEU A 1 88  ? 18.898 -40.758 5.259   1.00 35.38  ? 460  LEU A C   1 
ATOM   418  O  O   . LEU A 1 88  ? 17.859 -41.270 5.695   1.00 37.25  ? 460  LEU A O   1 
ATOM   419  C  CB  . LEU A 1 88  ? 20.902 -41.598 6.518   1.00 32.51  ? 460  LEU A CB  1 
ATOM   420  C  CG  . LEU A 1 88  ? 22.009 -42.647 6.701   1.00 31.45  ? 460  LEU A CG  1 
ATOM   421  C  CD1 . LEU A 1 88  ? 22.673 -42.491 8.091   1.00 30.62  ? 460  LEU A CD1 1 
ATOM   422  C  CD2 . LEU A 1 88  ? 21.438 -44.061 6.529   1.00 29.92  ? 460  LEU A CD2 1 
ATOM   423  N  N   . THR A 1 89  ? 18.953 -39.492 4.862   1.00 36.38  ? 461  THR A N   1 
ATOM   424  C  CA  . THR A 1 89  ? 17.804 -38.598 5.045   1.00 40.03  ? 461  THR A CA  1 
ATOM   425  C  C   . THR A 1 89  ? 17.076 -38.237 3.759   1.00 41.31  ? 461  THR A C   1 
ATOM   426  O  O   . THR A 1 89  ? 15.880 -37.968 3.791   1.00 43.70  ? 461  THR A O   1 
ATOM   427  C  CB  . THR A 1 89  ? 18.215 -37.295 5.741   1.00 41.38  ? 461  THR A CB  1 
ATOM   428  O  OG1 . THR A 1 89  ? 19.295 -36.698 5.006   1.00 40.82  ? 461  THR A OG1 1 
ATOM   429  C  CG2 . THR A 1 89  ? 18.672 -37.591 7.174   1.00 41.05  ? 461  THR A CG2 1 
ATOM   430  N  N   . LEU A 1 90  ? 17.790 -38.240 2.635   1.00 39.75  ? 462  LEU A N   1 
ATOM   431  C  CA  . LEU A 1 90  ? 17.229 -37.744 1.374   1.00 41.22  ? 462  LEU A CA  1 
ATOM   432  C  C   . LEU A 1 90  ? 16.817 -38.822 0.370   1.00 41.02  ? 462  LEU A C   1 
ATOM   433  O  O   . LEU A 1 90  ? 16.097 -38.521 -0.574  1.00 43.40  ? 462  LEU A O   1 
ATOM   434  C  CB  . LEU A 1 90  ? 18.196 -36.763 0.694   1.00 40.66  ? 462  LEU A CB  1 
ATOM   435  C  CG  . LEU A 1 90  ? 18.762 -35.613 1.535   1.00 41.57  ? 462  LEU A CG  1 
ATOM   436  C  CD1 . LEU A 1 90  ? 19.949 -34.972 0.828   1.00 41.83  ? 462  LEU A CD1 1 
ATOM   437  C  CD2 . LEU A 1 90  ? 17.692 -34.573 1.895   1.00 43.60  ? 462  LEU A CD2 1 
ATOM   438  N  N   . ASP A 1 91  ? 17.285 -40.055 0.555   1.00 38.84  ? 463  ASP A N   1 
ATOM   439  C  CA  . ASP A 1 91  ? 16.958 -41.153 -0.357  1.00 38.81  ? 463  ASP A CA  1 
ATOM   440  C  C   . ASP A 1 91  ? 15.981 -42.123 0.306   1.00 40.16  ? 463  ASP A C   1 
ATOM   441  O  O   . ASP A 1 91  ? 15.958 -42.223 1.528   1.00 39.65  ? 463  ASP A O   1 
ATOM   442  C  CB  . ASP A 1 91  ? 18.236 -41.927 -0.758  1.00 36.09  ? 463  ASP A CB  1 
ATOM   443  C  CG  . ASP A 1 91  ? 19.219 -41.090 -1.584  1.00 34.79  ? 463  ASP A CG  1 
ATOM   444  O  OD1 . ASP A 1 91  ? 18.778 -40.228 -2.382  1.00 34.72  ? 463  ASP A OD1 1 
ATOM   445  O  OD2 . ASP A 1 91  ? 20.446 -41.316 -1.444  1.00 30.97  ? 463  ASP A OD2 1 
ATOM   446  N  N   . SER A 1 92  ? 15.191 -42.840 -0.496  1.00 42.04  ? 464  SER A N   1 
ATOM   447  C  CA  . SER A 1 92  ? 14.348 -43.929 0.022   1.00 43.85  ? 464  SER A CA  1 
ATOM   448  C  C   . SER A 1 92  ? 15.142 -45.197 0.346   1.00 41.96  ? 464  SER A C   1 
ATOM   449  O  O   . SER A 1 92  ? 16.163 -45.468 -0.288  1.00 40.14  ? 464  SER A O   1 
ATOM   450  C  CB  . SER A 1 92  ? 13.248 -44.274 -0.957  1.00 46.44  ? 464  SER A CB  1 
ATOM   451  O  OG  . SER A 1 92  ? 12.155 -43.417 -0.743  1.00 51.41  ? 464  SER A OG  1 
ATOM   452  N  N   . TRP A 1 93  ? 14.657 -45.961 1.329   1.00 42.55  ? 465  TRP A N   1 
ATOM   453  C  CA  . TRP A 1 93  ? 15.313 -47.191 1.787   1.00 41.32  ? 465  TRP A CA  1 
ATOM   454  C  C   . TRP A 1 93  ? 14.349 -48.372 1.871   1.00 43.91  ? 465  TRP A C   1 
ATOM   455  O  O   . TRP A 1 93  ? 13.346 -48.338 2.588   1.00 46.31  ? 465  TRP A O   1 
ATOM   456  C  CB  . TRP A 1 93  ? 15.987 -46.983 3.152   1.00 39.54  ? 465  TRP A CB  1 
ATOM   457  C  CG  . TRP A 1 93  ? 17.180 -46.082 3.106   1.00 36.92  ? 465  TRP A CG  1 
ATOM   458  C  CD1 . TRP A 1 93  ? 17.183 -44.724 2.915   1.00 37.38  ? 465  TRP A CD1 1 
ATOM   459  C  CD2 . TRP A 1 93  ? 18.554 -46.468 3.256   1.00 33.72  ? 465  TRP A CD2 1 
ATOM   460  N  NE1 . TRP A 1 93  ? 18.480 -44.248 2.932   1.00 35.43  ? 465  TRP A NE1 1 
ATOM   461  C  CE2 . TRP A 1 93  ? 19.335 -45.296 3.144   1.00 32.36  ? 465  TRP A CE2 1 
ATOM   462  C  CE3 . TRP A 1 93  ? 19.201 -47.693 3.481   1.00 31.86  ? 465  TRP A CE3 1 
ATOM   463  C  CZ2 . TRP A 1 93  ? 20.722 -45.315 3.236   1.00 31.06  ? 465  TRP A CZ2 1 
ATOM   464  C  CZ3 . TRP A 1 93  ? 20.571 -47.709 3.596   1.00 29.44  ? 465  TRP A CZ3 1 
ATOM   465  C  CH2 . TRP A 1 93  ? 21.324 -46.530 3.470   1.00 29.62  ? 465  TRP A CH2 1 
ATOM   466  N  N   . GLU A 1 94  ? 14.675 -49.420 1.128   1.00 44.17  ? 466  GLU A N   1 
ATOM   467  C  CA  . GLU A 1 94  ? 13.987 -50.704 1.212   1.00 46.68  ? 466  GLU A CA  1 
ATOM   468  C  C   . GLU A 1 94  ? 14.220 -51.302 2.620   1.00 45.66  ? 466  GLU A C   1 
ATOM   469  O  O   . GLU A 1 94  ? 15.338 -51.251 3.136   1.00 42.55  ? 466  GLU A O   1 
ATOM   470  C  CB  . GLU A 1 94  ? 14.568 -51.622 0.133   1.00 46.79  ? 466  GLU A CB  1 
ATOM   471  C  CG  . GLU A 1 94  ? 13.602 -52.623 -0.455  1.00 53.41  ? 466  GLU A CG  1 
ATOM   472  C  CD  . GLU A 1 94  ? 12.741 -52.033 -1.539  1.00 58.47  ? 466  GLU A CD  1 
ATOM   473  O  OE1 . GLU A 1 94  ? 13.200 -51.071 -2.181  1.00 59.90  ? 466  GLU A OE1 1 
ATOM   474  O  OE2 . GLU A 1 94  ? 11.613 -52.524 -1.749  1.00 62.01  ? 466  GLU A OE2 1 
ATOM   475  N  N   . PRO A 1 95  ? 13.166 -51.853 3.257   1.00 48.38  ? 467  PRO A N   1 
ATOM   476  C  CA  . PRO A 1 95  ? 13.310 -52.378 4.635   1.00 48.51  ? 467  PRO A CA  1 
ATOM   477  C  C   . PRO A 1 95  ? 14.418 -53.425 4.825   1.00 46.52  ? 467  PRO A C   1 
ATOM   478  O  O   . PRO A 1 95  ? 15.155 -53.349 5.807   1.00 45.14  ? 467  PRO A O   1 
ATOM   479  C  CB  . PRO A 1 95  ? 11.930 -52.954 4.957   1.00 52.80  ? 467  PRO A CB  1 
ATOM   480  C  CG  . PRO A 1 95  ? 11.165 -52.939 3.674   1.00 54.77  ? 467  PRO A CG  1 
ATOM   481  C  CD  . PRO A 1 95  ? 11.774 -51.911 2.789   1.00 51.72  ? 467  PRO A CD  1 
ATOM   482  N  N   . GLU A 1 96  ? 14.559 -54.367 3.894   1.00 46.54  ? 468  GLU A N   1 
ATOM   483  C  CA  . GLU A 1 96  ? 15.707 -55.287 3.908   1.00 45.33  ? 468  GLU A CA  1 
ATOM   484  C  C   . GLU A 1 96  ? 17.048 -54.550 4.023   1.00 40.83  ? 468  GLU A C   1 
ATOM   485  O  O   . GLU A 1 96  ? 17.968 -55.007 4.697   1.00 39.79  ? 468  GLU A O   1 
ATOM   486  C  CB  . GLU A 1 96  ? 15.755 -56.141 2.639   1.00 46.43  ? 468  GLU A CB  1 
ATOM   487  C  CG  . GLU A 1 96  ? 14.415 -56.650 2.154   1.00 54.24  ? 468  GLU A CG  1 
ATOM   488  C  CD  . GLU A 1 96  ? 13.827 -55.805 1.034   1.00 57.31  ? 468  GLU A CD  1 
ATOM   489  O  OE1 . GLU A 1 96  ? 14.558 -55.518 0.052   1.00 57.01  ? 468  GLU A OE1 1 
ATOM   490  O  OE2 . GLU A 1 96  ? 12.635 -55.443 1.140   1.00 60.13  ? 468  GLU A OE2 1 
ATOM   491  N  N   . LEU A 1 97  ? 17.166 -53.427 3.330   1.00 38.46  ? 469  LEU A N   1 
ATOM   492  C  CA  . LEU A 1 97  ? 18.431 -52.710 3.271   1.00 35.03  ? 469  LEU A CA  1 
ATOM   493  C  C   . LEU A 1 97  ? 18.735 -52.015 4.589   1.00 34.00  ? 469  LEU A C   1 
ATOM   494  O  O   . LEU A 1 97  ? 19.869 -52.027 5.029   1.00 32.29  ? 469  LEU A O   1 
ATOM   495  C  CB  . LEU A 1 97  ? 18.438 -51.721 2.107   1.00 33.89  ? 469  LEU A CB  1 
ATOM   496  C  CG  . LEU A 1 97  ? 19.760 -51.061 1.748   1.00 31.51  ? 469  LEU A CG  1 
ATOM   497  C  CD1 . LEU A 1 97  ? 20.832 -52.099 1.572   1.00 30.58  ? 469  LEU A CD1 1 
ATOM   498  C  CD2 . LEU A 1 97  ? 19.602 -50.231 0.482   1.00 32.09  ? 469  LEU A CD2 1 
ATOM   499  N  N   . VAL A 1 98  ? 17.717 -51.428 5.219   1.00 35.91  ? 470  VAL A N   1 
ATOM   500  C  CA  . VAL A 1 98  ? 17.864 -50.870 6.568   1.00 36.09  ? 470  VAL A CA  1 
ATOM   501  C  C   . VAL A 1 98  ? 18.335 -51.967 7.535   1.00 36.79  ? 470  VAL A C   1 
ATOM   502  O  O   . VAL A 1 98  ? 19.276 -51.766 8.308   1.00 35.05  ? 470  VAL A O   1 
ATOM   503  C  CB  . VAL A 1 98  ? 16.536 -50.223 7.090   1.00 38.67  ? 470  VAL A CB  1 
ATOM   504  C  CG1 . VAL A 1 98  ? 16.688 -49.763 8.534   1.00 38.71  ? 470  VAL A CG1 1 
ATOM   505  C  CG2 . VAL A 1 98  ? 16.111 -49.057 6.206   1.00 38.04  ? 470  VAL A CG2 1 
ATOM   506  N  N   . LYS A 1 99  ? 17.695 -53.133 7.465   1.00 39.51  ? 471  LYS A N   1 
ATOM   507  C  CA  . LYS A 1 99  ? 18.017 -54.232 8.371   1.00 41.67  ? 471  LYS A CA  1 
ATOM   508  C  C   . LYS A 1 99  ? 19.437 -54.699 8.118   1.00 39.31  ? 471  LYS A C   1 
ATOM   509  O  O   . LYS A 1 99  ? 20.191 -54.989 9.055   1.00 38.70  ? 471  LYS A O   1 
ATOM   510  C  CB  . LYS A 1 99  ? 17.028 -55.394 8.222   1.00 45.18  ? 471  LYS A CB  1 
ATOM   511  C  CG  . LYS A 1 99  ? 15.581 -55.061 8.585   1.00 51.40  ? 471  LYS A CG  1 
ATOM   512  C  CD  . LYS A 1 99  ? 15.348 -54.872 10.101  1.00 58.10  ? 471  LYS A CD  1 
ATOM   513  C  CE  . LYS A 1 99  ? 13.924 -54.344 10.403  1.00 63.10  ? 471  LYS A CE  1 
ATOM   514  N  NZ  . LYS A 1 99  ? 13.730 -52.918 9.916   1.00 62.29  ? 471  LYS A NZ  1 
ATOM   515  N  N   . LEU A 1 100 ? 19.807 -54.745 6.840   1.00 38.04  ? 472  LEU A N   1 
ATOM   516  C  CA  . LEU A 1 100 ? 21.161 -55.114 6.477   1.00 36.42  ? 472  LEU A CA  1 
ATOM   517  C  C   . LEU A 1 100 ? 22.162 -54.148 7.106   1.00 34.17  ? 472  LEU A C   1 
ATOM   518  O  O   . LEU A 1 100 ? 23.146 -54.607 7.690   1.00 33.33  ? 472  LEU A O   1 
ATOM   519  C  CB  . LEU A 1 100 ? 21.347 -55.205 4.951   1.00 36.01  ? 472  LEU A CB  1 
ATOM   520  C  CG  . LEU A 1 100 ? 22.773 -55.550 4.472   1.00 35.27  ? 472  LEU A CG  1 
ATOM   521  C  CD1 . LEU A 1 100 ? 23.268 -56.927 4.999   1.00 35.31  ? 472  LEU A CD1 1 
ATOM   522  C  CD2 . LEU A 1 100 ? 22.881 -55.475 2.950   1.00 34.88  ? 472  LEU A CD2 1 
ATOM   523  N  N   A MET A 1 101 ? 21.908 -52.840 6.994   0.50 33.16  ? 473  MET A N   1 
ATOM   524  N  N   B MET A 1 101 ? 21.918 -52.837 6.993   0.50 32.92  ? 473  MET A N   1 
ATOM   525  C  CA  A MET A 1 101 ? 22.773 -51.830 7.628   0.50 31.95  ? 473  MET A CA  1 
ATOM   526  C  CA  B MET A 1 101 ? 22.800 -51.840 7.631   0.50 31.50  ? 473  MET A CA  1 
ATOM   527  C  C   A MET A 1 101 ? 22.906 -52.071 9.131   0.50 32.95  ? 473  MET A C   1 
ATOM   528  C  C   B MET A 1 101 ? 22.910 -52.069 9.139   0.50 32.71  ? 473  MET A C   1 
ATOM   529  O  O   A MET A 1 101 ? 23.983 -51.865 9.699   0.50 32.11  ? 473  MET A O   1 
ATOM   530  O  O   B MET A 1 101 ? 23.980 -51.856 9.718   0.50 31.89  ? 473  MET A O   1 
ATOM   531  C  CB  A MET A 1 101 ? 22.257 -50.404 7.388   0.50 31.93  ? 473  MET A CB  1 
ATOM   532  C  CB  B MET A 1 101 ? 22.342 -50.398 7.360   0.50 31.16  ? 473  MET A CB  1 
ATOM   533  C  CG  A MET A 1 101 ? 22.097 -50.000 5.925   0.50 31.13  ? 473  MET A CG  1 
ATOM   534  C  CG  B MET A 1 101 ? 22.427 -49.942 5.901   0.50 28.80  ? 473  MET A CG  1 
ATOM   535  S  SD  A MET A 1 101 ? 23.643 -49.882 5.005   0.50 31.57  ? 473  MET A SD  1 
ATOM   536  S  SD  B MET A 1 101 ? 24.087 -49.505 5.312   0.50 27.54  ? 473  MET A SD  1 
ATOM   537  C  CE  A MET A 1 101 ? 23.702 -51.500 4.241   0.50 32.27  ? 473  MET A CE  1 
ATOM   538  C  CE  B MET A 1 101 ? 24.572 -48.196 6.429   0.50 21.74  ? 473  MET A CE  1 
ATOM   539  N  N   . CYS A 1 102 ? 21.812 -52.508 9.760   1.00 34.85  ? 474  CYS A N   1 
ATOM   540  C  CA  . CYS A 1 102 ? 21.789 -52.809 11.209  1.00 36.97  ? 474  CYS A CA  1 
ATOM   541  C  C   . CYS A 1 102 ? 22.524 -54.080 11.657  1.00 37.81  ? 474  CYS A C   1 
ATOM   542  O  O   . CYS A 1 102 ? 22.807 -54.239 12.846  1.00 38.83  ? 474  CYS A O   1 
ATOM   543  C  CB  . CYS A 1 102 ? 20.357 -52.841 11.741  1.00 39.78  ? 474  CYS A CB  1 
ATOM   544  S  SG  . CYS A 1 102 ? 19.539 -51.250 11.589  1.00 41.24  ? 474  CYS A SG  1 
ATOM   545  N  N   . GLU A 1 103 ? 22.829 -54.986 10.725  1.00 37.17  ? 475  GLU A N   1 
ATOM   546  C  CA  . GLU A 1 103 ? 23.622 -56.174 11.067  1.00 37.83  ? 475  GLU A CA  1 
ATOM   547  C  C   . GLU A 1 103 ? 25.092 -55.927 10.771  1.00 35.14  ? 475  GLU A C   1 
ATOM   548  O  O   . GLU A 1 103 ? 25.947 -56.724 11.136  1.00 35.83  ? 475  GLU A O   1 
ATOM   549  C  CB  . GLU A 1 103 ? 23.165 -57.411 10.295  1.00 39.38  ? 475  GLU A CB  1 
ATOM   550  C  CG  . GLU A 1 103 ? 21.711 -57.805 10.501  1.00 44.38  ? 475  GLU A CG  1 
ATOM   551  C  CD  . GLU A 1 103 ? 21.366 -58.264 11.918  1.00 50.48  ? 475  GLU A CD  1 
ATOM   552  O  OE1 . GLU A 1 103 ? 22.199 -58.909 12.608  1.00 50.79  ? 475  GLU A OE1 1 
ATOM   553  O  OE2 . GLU A 1 103 ? 20.219 -57.983 12.329  1.00 55.00  ? 475  GLU A OE2 1 
ATOM   554  N  N   . LEU A 1 104 ? 25.396 -54.835 10.091  1.00 32.27  ? 476  LEU A N   1 
ATOM   555  C  CA  . LEU A 1 104 ? 26.789 -54.521 9.878   1.00 30.47  ? 476  LEU A CA  1 
ATOM   556  C  C   . LEU A 1 104 ? 27.180 -53.339 10.756  1.00 29.68  ? 476  LEU A C   1 
ATOM   557  O  O   . LEU A 1 104 ? 27.140 -53.443 11.984  1.00 30.96  ? 476  LEU A O   1 
ATOM   558  C  CB  . LEU A 1 104 ? 27.080 -54.308 8.404   1.00 28.92  ? 476  LEU A CB  1 
ATOM   559  C  CG  . LEU A 1 104 ? 26.971 -55.613 7.602   1.00 30.71  ? 476  LEU A CG  1 
ATOM   560  C  CD1 . LEU A 1 104 ? 27.009 -55.308 6.101   1.00 27.81  ? 476  LEU A CD1 1 
ATOM   561  C  CD2 . LEU A 1 104 ? 28.076 -56.615 8.017   1.00 29.51  ? 476  LEU A CD2 1 
ATOM   562  N  N   . GLY A 1 105 ? 27.547 -52.223 10.152  1.00 27.97  ? 477  GLY A N   1 
ATOM   563  C  CA  . GLY A 1 105 ? 27.859 -51.040 10.951  1.00 27.97  ? 477  GLY A CA  1 
ATOM   564  C  C   . GLY A 1 105 ? 29.345 -50.795 11.090  1.00 26.89  ? 477  GLY A C   1 
ATOM   565  O  O   . GLY A 1 105 ? 30.150 -51.683 10.873  1.00 26.97  ? 477  GLY A O   1 
ATOM   566  N  N   . ASN A 1 106 ? 29.681 -49.569 11.460  1.00 26.69  ? 478  ASN A N   1 
ATOM   567  C  CA  . ASN A 1 106 ? 31.047 -49.080 11.550  1.00 26.28  ? 478  ASN A CA  1 
ATOM   568  C  C   . ASN A 1 106 ? 31.969 -49.894 12.446  1.00 27.26  ? 478  ASN A C   1 
ATOM   569  O  O   . ASN A 1 106 ? 33.127 -50.165 12.082  1.00 27.72  ? 478  ASN A O   1 
ATOM   570  C  CB  . ASN A 1 106 ? 31.038 -47.624 12.038  1.00 27.01  ? 478  ASN A CB  1 
ATOM   571  C  CG  . ASN A 1 106 ? 30.345 -46.679 11.073  1.00 26.65  ? 478  ASN A CG  1 
ATOM   572  O  OD1 . ASN A 1 106 ? 30.049 -45.530 11.429  1.00 32.27  ? 478  ASN A OD1 1 
ATOM   573  N  ND2 . ASN A 1 106 ? 30.102 -47.134 9.851   1.00 21.71  ? 478  ASN A ND2 1 
ATOM   574  N  N   . VAL A 1 107 ? 31.481 -50.290 13.607  1.00 27.35  ? 479  VAL A N   1 
ATOM   575  C  CA  . VAL A 1 107 ? 32.314 -51.062 14.499  1.00 28.49  ? 479  VAL A CA  1 
ATOM   576  C  C   . VAL A 1 107 ? 32.708 -52.393 13.846  1.00 28.83  ? 479  VAL A C   1 
ATOM   577  O  O   . VAL A 1 107 ? 33.893 -52.758 13.845  1.00 28.55  ? 479  VAL A O   1 
ATOM   578  C  CB  . VAL A 1 107 ? 31.663 -51.240 15.895  1.00 30.82  ? 479  VAL A CB  1 
ATOM   579  C  CG1 . VAL A 1 107 ? 32.310 -52.425 16.681  1.00 31.08  ? 479  VAL A CG1 1 
ATOM   580  C  CG2 . VAL A 1 107 ? 31.768 -49.939 16.677  1.00 29.41  ? 479  VAL A CG2 1 
ATOM   581  N  N   A ILE A 1 108 ? 31.720 -53.096 13.288  0.50 28.93  ? 480  ILE A N   1 
ATOM   582  N  N   B ILE A 1 108 ? 31.729 -53.098 13.278  0.50 28.67  ? 480  ILE A N   1 
ATOM   583  C  CA  A ILE A 1 108 ? 31.951 -54.379 12.619  0.50 29.27  ? 480  ILE A CA  1 
ATOM   584  C  CA  B ILE A 1 108 ? 31.988 -54.394 12.648  0.50 28.83  ? 480  ILE A CA  1 
ATOM   585  C  C   A ILE A 1 108 ? 32.905 -54.209 11.442  0.50 27.85  ? 480  ILE A C   1 
ATOM   586  C  C   B ILE A 1 108 ? 32.876 -54.255 11.407  0.50 27.59  ? 480  ILE A C   1 
ATOM   587  O  O   A ILE A 1 108 ? 33.924 -54.890 11.358  0.50 28.61  ? 480  ILE A O   1 
ATOM   588  O  O   B ILE A 1 108 ? 33.833 -55.007 11.250  0.50 28.42  ? 480  ILE A O   1 
ATOM   589  C  CB  A ILE A 1 108 ? 30.632 -55.037 12.149  0.50 29.66  ? 480  ILE A CB  1 
ATOM   590  C  CB  B ILE A 1 108 ? 30.686 -55.176 12.346  0.50 29.30  ? 480  ILE A CB  1 
ATOM   591  C  CG1 A ILE A 1 108 ? 29.891 -55.662 13.336  0.50 32.40  ? 480  ILE A CG1 1 
ATOM   592  C  CG1 B ILE A 1 108 ? 30.161 -55.843 13.627  0.50 30.86  ? 480  ILE A CG1 1 
ATOM   593  C  CG2 A ILE A 1 108 ? 30.901 -56.105 11.089  0.50 29.81  ? 480  ILE A CG2 1 
ATOM   594  C  CG2 B ILE A 1 108 ? 30.923 -56.239 11.277  0.50 29.48  ? 480  ILE A CG2 1 
ATOM   595  C  CD1 A ILE A 1 108 ? 30.744 -56.577 14.167  0.50 34.24  ? 480  ILE A CD1 1 
ATOM   596  C  CD1 B ILE A 1 108 ? 28.702 -56.286 13.559  0.50 28.62  ? 480  ILE A CD1 1 
ATOM   597  N  N   . ILE A 1 109 ? 32.590 -53.272 10.558  1.00 26.32  ? 481  ILE A N   1 
ATOM   598  C  CA  . ILE A 1 109 ? 33.380 -53.068 9.338   1.00 26.13  ? 481  ILE A CA  1 
ATOM   599  C  C   . ILE A 1 109 ? 34.828 -52.584 9.626   1.00 26.59  ? 481  ILE A C   1 
ATOM   600  O  O   . ILE A 1 109 ? 35.773 -53.062 8.995   1.00 27.92  ? 481  ILE A O   1 
ATOM   601  C  CB  . ILE A 1 109 ? 32.624 -52.180 8.321   1.00 24.33  ? 481  ILE A CB  1 
ATOM   602  C  CG1 . ILE A 1 109 ? 31.324 -52.863 7.831   1.00 24.93  ? 481  ILE A CG1 1 
ATOM   603  C  CG2 . ILE A 1 109 ? 33.528 -51.729 7.170   1.00 25.24  ? 481  ILE A CG2 1 
ATOM   604  C  CD1 . ILE A 1 109 ? 31.467 -54.290 7.229   1.00 25.09  ? 481  ILE A CD1 1 
ATOM   605  N  N   . ASN A 1 110 ? 34.988 -51.656 10.565  1.00 26.78  ? 482  ASN A N   1 
ATOM   606  C  CA  . ASN A 1 110 ? 36.305 -51.273 11.059  1.00 28.25  ? 482  ASN A CA  1 
ATOM   607  C  C   . ASN A 1 110 ? 37.117 -52.388 11.742  1.00 30.23  ? 482  ASN A C   1 
ATOM   608  O  O   . ASN A 1 110 ? 38.355 -52.371 11.690  1.00 31.21  ? 482  ASN A O   1 
ATOM   609  C  CB  . ASN A 1 110 ? 36.215 -50.046 11.962  1.00 28.75  ? 482  ASN A CB  1 
ATOM   610  C  CG  . ASN A 1 110 ? 35.972 -48.787 11.172  1.00 28.96  ? 482  ASN A CG  1 
ATOM   611  O  OD1 . ASN A 1 110 ? 36.284 -48.738 9.981   1.00 27.90  ? 482  ASN A OD1 1 
ATOM   612  N  ND2 . ASN A 1 110 ? 35.400 -47.764 11.814  1.00 27.43  ? 482  ASN A ND2 1 
ATOM   613  N  N   . GLN A 1 111 ? 36.446 -53.350 12.371  1.00 30.59  ? 483  GLN A N   1 
ATOM   614  C  CA  . GLN A 1 111 ? 37.157 -54.509 12.903  1.00 33.24  ? 483  GLN A CA  1 
ATOM   615  C  C   . GLN A 1 111 ? 37.876 -55.258 11.786  1.00 32.54  ? 483  GLN A C   1 
ATOM   616  O  O   . GLN A 1 111 ? 38.924 -55.862 12.000  1.00 33.54  ? 483  GLN A O   1 
ATOM   617  C  CB  . GLN A 1 111 ? 36.217 -55.444 13.654  1.00 34.33  ? 483  GLN A CB  1 
ATOM   618  C  CG  . GLN A 1 111 ? 36.020 -55.022 15.082  1.00 40.07  ? 483  GLN A CG  1 
ATOM   619  C  CD  . GLN A 1 111 ? 35.007 -55.883 15.842  1.00 46.78  ? 483  GLN A CD  1 
ATOM   620  O  OE1 . GLN A 1 111 ? 34.710 -55.605 17.008  1.00 48.75  ? 483  GLN A OE1 1 
ATOM   621  N  NE2 . GLN A 1 111 ? 34.473 -56.923 15.186  1.00 47.65  ? 483  GLN A NE2 1 
ATOM   622  N  N   . ILE A 1 112 ? 37.287 -55.197 10.595  1.00 30.85  ? 484  ILE A N   1 
ATOM   623  C  CA  . ILE A 1 112 ? 37.849 -55.787 9.402   1.00 30.19  ? 484  ILE A CA  1 
ATOM   624  C  C   . ILE A 1 112 ? 38.838 -54.806 8.758   1.00 29.53  ? 484  ILE A C   1 
ATOM   625  O  O   . ILE A 1 112 ? 40.033 -55.083 8.733   1.00 30.94  ? 484  ILE A O   1 
ATOM   626  C  CB  . ILE A 1 112 ? 36.722 -56.211 8.407   1.00 29.73  ? 484  ILE A CB  1 
ATOM   627  C  CG1 . ILE A 1 112 ? 35.855 -57.316 9.022   1.00 30.45  ? 484  ILE A CG1 1 
ATOM   628  C  CG2 . ILE A 1 112 ? 37.298 -56.692 7.071   1.00 28.93  ? 484  ILE A CG2 1 
ATOM   629  C  CD1 . ILE A 1 112 ? 34.471 -57.436 8.381   1.00 29.77  ? 484  ILE A CD1 1 
ATOM   630  N  N   . TYR A 1 113 ? 38.353 -53.657 8.284   1.00 27.73  ? 485  TYR A N   1 
ATOM   631  C  CA  . TYR A 1 113 ? 39.154 -52.774 7.416   1.00 27.70  ? 485  TYR A CA  1 
ATOM   632  C  C   . TYR A 1 113 ? 40.245 -51.958 8.119   1.00 28.45  ? 485  TYR A C   1 
ATOM   633  O  O   . TYR A 1 113 ? 41.093 -51.377 7.452   1.00 28.59  ? 485  TYR A O   1 
ATOM   634  C  CB  . TYR A 1 113 ? 38.270 -51.840 6.586   1.00 26.83  ? 485  TYR A CB  1 
ATOM   635  C  CG  . TYR A 1 113 ? 37.653 -52.489 5.371   1.00 27.30  ? 485  TYR A CG  1 
ATOM   636  C  CD1 . TYR A 1 113 ? 38.319 -52.498 4.140   1.00 29.87  ? 485  TYR A CD1 1 
ATOM   637  C  CD2 . TYR A 1 113 ? 36.403 -53.104 5.454   1.00 28.33  ? 485  TYR A CD2 1 
ATOM   638  C  CE1 . TYR A 1 113 ? 37.740 -53.106 3.013   1.00 30.57  ? 485  TYR A CE1 1 
ATOM   639  C  CE2 . TYR A 1 113 ? 35.825 -53.705 4.360   1.00 28.35  ? 485  TYR A CE2 1 
ATOM   640  C  CZ  . TYR A 1 113 ? 36.490 -53.697 3.141   1.00 30.22  ? 485  TYR A CZ  1 
ATOM   641  O  OH  . TYR A 1 113 ? 35.892 -54.301 2.064   1.00 32.70  ? 485  TYR A OH  1 
ATOM   642  N  N   . GLU A 1 114 ? 40.209 -51.909 9.451   1.00 28.59  ? 486  GLU A N   1 
ATOM   643  C  CA  . GLU A 1 114 ? 41.180 -51.152 10.226  1.00 29.61  ? 486  GLU A CA  1 
ATOM   644  C  C   . GLU A 1 114 ? 41.795 -52.062 11.270  1.00 31.34  ? 486  GLU A C   1 
ATOM   645  O  O   . GLU A 1 114 ? 42.337 -51.603 12.265  1.00 32.23  ? 486  GLU A O   1 
ATOM   646  C  CB  . GLU A 1 114 ? 40.537 -49.902 10.862  1.00 29.38  ? 486  GLU A CB  1 
ATOM   647  C  CG  . GLU A 1 114 ? 40.195 -48.805 9.822   1.00 29.44  ? 486  GLU A CG  1 
ATOM   648  C  CD  . GLU A 1 114 ? 39.600 -47.527 10.413  1.00 33.33  ? 486  GLU A CD  1 
ATOM   649  O  OE1 . GLU A 1 114 ? 39.302 -47.503 11.630  1.00 36.34  ? 486  GLU A OE1 1 
ATOM   650  O  OE2 . GLU A 1 114 ? 39.411 -46.543 9.650   1.00 33.06  ? 486  GLU A OE2 1 
ATOM   651  N  N   . ALA A 1 115 ? 41.712 -53.365 11.017  1.00 31.52  ? 487  ALA A N   1 
ATOM   652  C  CA  . ALA A 1 115 ? 42.196 -54.374 11.945  1.00 33.63  ? 487  ALA A CA  1 
ATOM   653  C  C   . ALA A 1 115 ? 43.627 -54.176 12.434  1.00 35.90  ? 487  ALA A C   1 
ATOM   654  O  O   . ALA A 1 115 ? 43.898 -54.431 13.597  1.00 37.08  ? 487  ALA A O   1 
ATOM   655  C  CB  . ALA A 1 115 ? 42.054 -55.756 11.346  1.00 34.02  ? 487  ALA A CB  1 
ATOM   656  N  N   . ARG A 1 116 ? 44.532 -53.756 11.550  1.00 36.44  ? 488  ARG A N   1 
ATOM   657  C  CA  . ARG A 1 116 ? 45.962 -53.710 11.892  1.00 39.57  ? 488  ARG A CA  1 
ATOM   658  C  C   . ARG A 1 116 ? 46.500 -52.326 12.204  1.00 40.52  ? 488  ARG A C   1 
ATOM   659  O  O   . ARG A 1 116 ? 47.685 -52.179 12.500  1.00 44.12  ? 488  ARG A O   1 
ATOM   660  C  CB  . ARG A 1 116 ? 46.820 -54.382 10.814  1.00 40.67  ? 488  ARG A CB  1 
ATOM   661  C  CG  . ARG A 1 116 ? 46.585 -55.885 10.676  1.00 40.34  ? 488  ARG A CG  1 
ATOM   662  C  CD  . ARG A 1 116 ? 47.573 -56.516 9.718   1.00 40.52  ? 488  ARG A CD  1 
ATOM   663  N  NE  . ARG A 1 116 ? 48.879 -56.600 10.346  1.00 43.98  ? 488  ARG A NE  1 
ATOM   664  C  CZ  . ARG A 1 116 ? 49.916 -55.816 10.061  1.00 45.89  ? 488  ARG A CZ  1 
ATOM   665  N  NH1 . ARG A 1 116 ? 49.826 -54.887 9.114   1.00 42.84  ? 488  ARG A NH1 1 
ATOM   666  N  NH2 . ARG A 1 116 ? 51.060 -55.979 10.722  1.00 49.26  ? 488  ARG A NH2 1 
ATOM   667  N  N   . VAL A 1 117 ? 45.619 -51.330 12.176  1.00 38.67  ? 489  VAL A N   1 
ATOM   668  C  CA  . VAL A 1 117 ? 45.949 -49.946 12.495  1.00 39.55  ? 489  VAL A CA  1 
ATOM   669  C  C   . VAL A 1 117 ? 46.722 -49.775 13.805  1.00 42.99  ? 489  VAL A C   1 
ATOM   670  O  O   . VAL A 1 117 ? 47.738 -49.088 13.851  1.00 44.75  ? 489  VAL A O   1 
ATOM   671  C  CB  . VAL A 1 117 ? 44.673 -49.091 12.545  1.00 37.07  ? 489  VAL A CB  1 
ATOM   672  C  CG1 . VAL A 1 117 ? 44.964 -47.705 13.156  1.00 37.70  ? 489  VAL A CG1 1 
ATOM   673  C  CG2 . VAL A 1 117 ? 44.096 -48.968 11.157  1.00 34.29  ? 489  VAL A CG2 1 
ATOM   674  N  N   . GLU A 1 118 ? 46.234 -50.408 14.860  1.00 44.49  ? 490  GLU A N   1 
ATOM   675  C  CA  . GLU A 1 118 ? 46.847 -50.290 16.162  1.00 48.84  ? 490  GLU A CA  1 
ATOM   676  C  C   . GLU A 1 118 ? 48.242 -50.909 16.118  1.00 52.11  ? 490  GLU A C   1 
ATOM   677  O  O   . GLU A 1 118 ? 49.204 -50.321 16.621  1.00 54.84  ? 490  GLU A O   1 
ATOM   678  C  CB  . GLU A 1 118 ? 45.971 -50.966 17.211  1.00 49.13  ? 490  GLU A CB  1 
ATOM   679  C  CG  . GLU A 1 118 ? 46.331 -50.632 18.658  1.00 55.79  ? 490  GLU A CG  1 
ATOM   680  C  CD  . GLU A 1 118 ? 45.218 -51.007 19.631  1.00 58.97  ? 490  GLU A CD  1 
ATOM   681  O  OE1 . GLU A 1 118 ? 44.028 -50.872 19.256  1.00 58.30  ? 490  GLU A OE1 1 
ATOM   682  O  OE2 . GLU A 1 118 ? 45.529 -51.434 20.761  1.00 61.55  ? 490  GLU A OE2 1 
ATOM   683  N  N   . ALA A 1 119 ? 48.353 -52.072 15.474  1.00 52.48  ? 491  ALA A N   1 
ATOM   684  C  CA  . ALA A 1 119 ? 49.626 -52.788 15.393  1.00 55.83  ? 491  ALA A CA  1 
ATOM   685  C  C   . ALA A 1 119 ? 50.612 -52.073 14.469  1.00 57.17  ? 491  ALA A C   1 
ATOM   686  O  O   . ALA A 1 119 ? 51.810 -52.115 14.700  1.00 60.39  ? 491  ALA A O   1 
ATOM   687  C  CB  . ALA A 1 119 ? 49.405 -54.229 14.940  1.00 55.38  ? 491  ALA A CB  1 
ATOM   688  N  N   . MET A 1 120 ? 50.103 -51.425 13.422  1.00 55.11  ? 492  MET A N   1 
ATOM   689  C  CA  . MET A 1 120 ? 50.947 -50.649 12.513  1.00 56.68  ? 492  MET A CA  1 
ATOM   690  C  C   . MET A 1 120 ? 51.365 -49.296 13.088  1.00 58.63  ? 492  MET A C   1 
ATOM   691  O  O   . MET A 1 120 ? 52.152 -48.575 12.464  1.00 60.62  ? 492  MET A O   1 
ATOM   692  C  CB  . MET A 1 120 ? 50.241 -50.428 11.182  1.00 53.85  ? 492  MET A CB  1 
ATOM   693  C  CG  . MET A 1 120 ? 50.309 -51.604 10.246  1.00 53.93  ? 492  MET A CG  1 
ATOM   694  S  SD  . MET A 1 120 ? 48.958 -51.574 9.062   1.00 51.21  ? 492  MET A SD  1 
ATOM   695  C  CE  . MET A 1 120 ? 49.619 -50.533 7.770   1.00 53.30  ? 492  MET A CE  1 
ATOM   696  N  N   . ALA A 1 121 ? 50.831 -48.956 14.265  1.00 58.49  ? 493  ALA A N   1 
ATOM   697  C  CA  . ALA A 1 121 ? 51.094 -47.671 14.929  1.00 60.20  ? 493  ALA A CA  1 
ATOM   698  C  C   . ALA A 1 121 ? 50.762 -46.443 14.063  1.00 58.87  ? 493  ALA A C   1 
ATOM   699  O  O   . ALA A 1 121 ? 51.277 -45.352 14.303  1.00 61.17  ? 493  ALA A O   1 
ATOM   700  C  CB  . ALA A 1 121 ? 52.551 -47.606 15.452  1.00 64.35  ? 493  ALA A CB  1 
ATOM   701  N  N   . VAL A 1 122 ? 49.896 -46.622 13.069  1.00 55.55  ? 494  VAL A N   1 
ATOM   702  C  CA  . VAL A 1 122 ? 49.533 -45.532 12.164  1.00 54.63  ? 494  VAL A CA  1 
ATOM   703  C  C   . VAL A 1 122 ? 48.277 -44.799 12.689  1.00 52.80  ? 494  VAL A C   1 
ATOM   704  O  O   . VAL A 1 122 ? 47.504 -45.367 13.462  1.00 51.59  ? 494  VAL A O   1 
ATOM   705  C  CB  . VAL A 1 122 ? 49.405 -46.035 10.682  1.00 53.05  ? 494  VAL A CB  1 
ATOM   706  C  CG1 . VAL A 1 122 ? 48.052 -46.685 10.408  1.00 48.91  ? 494  VAL A CG1 1 
ATOM   707  C  CG2 . VAL A 1 122 ? 49.672 -44.909 9.696   1.00 54.12  ? 494  VAL A CG2 1 
ATOM   708  N  N   . LYS A 1 123 ? 48.096 -43.535 12.298  1.00 53.13  ? 495  LYS A N   1 
ATOM   709  C  CA  . LYS A 1 123 ? 47.041 -42.695 12.884  1.00 51.94  ? 495  LYS A CA  1 
ATOM   710  C  C   . LYS A 1 123 ? 45.886 -42.372 11.940  1.00 48.30  ? 495  LYS A C   1 
ATOM   711  O  O   . LYS A 1 123 ? 46.066 -41.759 10.893  1.00 48.54  ? 495  LYS A O   1 
ATOM   712  C  CB  . LYS A 1 123 ? 47.632 -41.404 13.476  1.00 55.49  ? 495  LYS A CB  1 
ATOM   713  C  CG  . LYS A 1 123 ? 46.790 -40.818 14.624  1.00 56.85  ? 495  LYS A CG  1 
ATOM   714  C  CD  . LYS A 1 123 ? 47.611 -39.887 15.522  1.00 63.50  ? 495  LYS A CD  1 
ATOM   715  C  CE  . LYS A 1 123 ? 48.512 -40.663 16.503  1.00 65.84  ? 495  LYS A CE  1 
ATOM   716  N  NZ  . LYS A 1 123 ? 49.500 -39.756 17.175  1.00 70.27  ? 495  LYS A NZ  1 
ATOM   717  N  N   . LYS A 1 124 ? 44.699 -42.804 12.341  1.00 45.51  ? 496  LYS A N   1 
ATOM   718  C  CA  . LYS A 1 124 ? 43.446 -42.545 11.638  1.00 42.08  ? 496  LYS A CA  1 
ATOM   719  C  C   . LYS A 1 124 ? 43.137 -41.047 11.630  1.00 42.75  ? 496  LYS A C   1 
ATOM   720  O  O   . LYS A 1 124 ? 43.484 -40.344 12.580  1.00 45.37  ? 496  LYS A O   1 
ATOM   721  C  CB  . LYS A 1 124 ? 42.336 -43.309 12.362  1.00 40.30  ? 496  LYS A CB  1 
ATOM   722  C  CG  . LYS A 1 124 ? 40.941 -43.118 11.818  1.00 38.30  ? 496  LYS A CG  1 
ATOM   723  C  CD  . LYS A 1 124 ? 39.963 -44.060 12.463  1.00 35.97  ? 496  LYS A CD  1 
ATOM   724  C  CE  . LYS A 1 124 ? 38.636 -43.991 11.737  1.00 33.46  ? 496  LYS A CE  1 
ATOM   725  N  NZ  . LYS A 1 124 ? 37.857 -45.246 11.926  1.00 30.46  ? 496  LYS A NZ  1 
ATOM   726  N  N   . PRO A 1 125 ? 42.492 -40.543 10.564  1.00 41.20  ? 497  PRO A N   1 
ATOM   727  C  CA  . PRO A 1 125 ? 42.124 -39.132 10.608  1.00 42.39  ? 497  PRO A CA  1 
ATOM   728  C  C   . PRO A 1 125 ? 40.997 -38.861 11.611  1.00 41.75  ? 497  PRO A C   1 
ATOM   729  O  O   . PRO A 1 125 ? 40.160 -39.740 11.864  1.00 40.09  ? 497  PRO A O   1 
ATOM   730  C  CB  . PRO A 1 125 ? 41.613 -38.848 9.178   1.00 40.99  ? 497  PRO A CB  1 
ATOM   731  C  CG  . PRO A 1 125 ? 41.838 -40.089 8.382   1.00 38.86  ? 497  PRO A CG  1 
ATOM   732  C  CD  . PRO A 1 125 ? 41.936 -41.203 9.366   1.00 39.07  ? 497  PRO A CD  1 
ATOM   733  N  N   . GLY A 1 126 ? 40.992 -37.654 12.168  1.00 43.45  ? 498  GLY A N   1 
ATOM   734  C  CA  . GLY A 1 126 ? 39.863 -37.149 12.946  1.00 43.26  ? 498  GLY A CA  1 
ATOM   735  C  C   . GLY A 1 126 ? 39.002 -36.203 12.114  1.00 42.58  ? 498  GLY A C   1 
ATOM   736  O  O   . GLY A 1 126 ? 39.354 -35.878 10.976  1.00 42.01  ? 498  GLY A O   1 
ATOM   737  N  N   . PRO A 1 127 ? 37.879 -35.726 12.686  1.00 42.82  ? 499  PRO A N   1 
ATOM   738  C  CA  . PRO A 1 127 ? 36.908 -34.913 11.935  1.00 42.43  ? 499  PRO A CA  1 
ATOM   739  C  C   . PRO A 1 127 ? 37.511 -33.688 11.260  1.00 44.79  ? 499  PRO A C   1 
ATOM   740  O  O   . PRO A 1 127 ? 37.078 -33.331 10.162  1.00 44.09  ? 499  PRO A O   1 
ATOM   741  C  CB  . PRO A 1 127 ? 35.900 -34.479 13.010  1.00 43.73  ? 499  PRO A CB  1 
ATOM   742  C  CG  . PRO A 1 127 ? 36.044 -35.495 14.102  1.00 43.24  ? 499  PRO A CG  1 
ATOM   743  C  CD  . PRO A 1 127 ? 37.479 -35.904 14.095  1.00 43.72  ? 499  PRO A CD  1 
ATOM   744  N  N   . SER A 1 128 ? 38.495 -33.066 11.915  1.00 48.17  ? 500  SER A N   1 
ATOM   745  C  CA  . SER A 1 128 ? 39.080 -31.784 11.491  1.00 51.68  ? 500  SER A CA  1 
ATOM   746  C  C   . SER A 1 128 ? 40.158 -31.899 10.429  1.00 51.94  ? 500  SER A C   1 
ATOM   747  O  O   . SER A 1 128 ? 40.654 -30.885 9.958   1.00 54.80  ? 500  SER A O   1 
ATOM   748  C  CB  . SER A 1 128 ? 39.688 -31.052 12.686  1.00 55.39  ? 500  SER A CB  1 
ATOM   749  O  OG  . SER A 1 128 ? 38.685 -30.573 13.554  1.00 57.29  ? 500  SER A OG  1 
ATOM   750  N  N   . CYS A 1 129 ? 40.536 -33.121 10.072  1.00 49.67  ? 501  CYS A N   1 
ATOM   751  C  CA  . CYS A 1 129 ? 41.628 -33.330 9.129   1.00 50.80  ? 501  CYS A CA  1 
ATOM   752  C  C   . CYS A 1 129 ? 41.345 -32.830 7.706   1.00 50.66  ? 501  CYS A C   1 
ATOM   753  O  O   . CYS A 1 129 ? 40.192 -32.659 7.293   1.00 48.62  ? 501  CYS A O   1 
ATOM   754  C  CB  . CYS A 1 129 ? 42.071 -34.794 9.127   1.00 48.38  ? 501  CYS A CB  1 
ATOM   755  S  SG  . CYS A 1 129 ? 43.087 -35.219 10.568  1.00 54.16  ? 501  CYS A SG  1 
ATOM   756  N  N   . SER A 1 130 ? 42.439 -32.559 7.000   1.00 53.24  ? 502  SER A N   1 
ATOM   757  C  CA  . SER A 1 130 ? 42.468 -32.221 5.582   1.00 54.23  ? 502  SER A CA  1 
ATOM   758  C  C   . SER A 1 130 ? 41.702 -33.225 4.690   1.00 50.84  ? 502  SER A C   1 
ATOM   759  O  O   . SER A 1 130 ? 41.670 -34.426 4.988   1.00 47.99  ? 502  SER A O   1 
ATOM   760  C  CB  . SER A 1 130 ? 43.935 -32.184 5.163   1.00 56.75  ? 502  SER A CB  1 
ATOM   761  O  OG  . SER A 1 130 ? 44.066 -32.058 3.766   1.00 59.14  ? 502  SER A OG  1 
ATOM   762  N  N   . ARG A 1 131 ? 41.093 -32.730 3.605   1.00 51.57  ? 503  ARG A N   1 
ATOM   763  C  CA  . ARG A 1 131 ? 40.482 -33.606 2.595   1.00 49.69  ? 503  ARG A CA  1 
ATOM   764  C  C   . ARG A 1 131 ? 41.532 -34.585 2.077   1.00 49.72  ? 503  ARG A C   1 
ATOM   765  O  O   . ARG A 1 131 ? 41.257 -35.772 1.912   1.00 47.34  ? 503  ARG A O   1 
ATOM   766  C  CB  . ARG A 1 131 ? 39.850 -32.840 1.413   1.00 50.76  ? 503  ARG A CB  1 
ATOM   767  C  CG  . ARG A 1 131 ? 39.186 -33.805 0.413   1.00 50.39  ? 503  ARG A CG  1 
ATOM   768  C  CD  . ARG A 1 131 ? 38.483 -33.223 -0.839  1.00 54.95  ? 503  ARG A CD  1 
ATOM   769  N  NE  . ARG A 1 131 ? 37.523 -34.235 -1.344  1.00 56.45  ? 503  ARG A NE  1 
ATOM   770  C  CZ  . ARG A 1 131 ? 36.900 -34.231 -2.533  1.00 57.84  ? 503  ARG A CZ  1 
ATOM   771  N  NH1 . ARG A 1 131 ? 36.051 -35.220 -2.842  1.00 53.15  ? 503  ARG A NH1 1 
ATOM   772  N  NH2 . ARG A 1 131 ? 37.108 -33.251 -3.411  1.00 60.15  ? 503  ARG A NH2 1 
ATOM   773  N  N   . GLN A 1 132 ? 42.740 -34.078 1.849   1.00 53.16  ? 504  GLN A N   1 
ATOM   774  C  CA  . GLN A 1 132 ? 43.832 -34.891 1.335   1.00 54.09  ? 504  GLN A CA  1 
ATOM   775  C  C   . GLN A 1 132 ? 44.175 -36.053 2.252   1.00 51.10  ? 504  GLN A C   1 
ATOM   776  O  O   . GLN A 1 132 ? 44.406 -37.160 1.784   1.00 49.88  ? 504  GLN A O   1 
ATOM   777  C  CB  . GLN A 1 132 ? 45.070 -34.032 1.066   1.00 58.37  ? 504  GLN A CB  1 
ATOM   778  C  CG  . GLN A 1 132 ? 45.084 -33.413 -0.328  1.00 64.58  ? 504  GLN A CG  1 
ATOM   779  C  CD  . GLN A 1 132 ? 44.263 -32.112 -0.454  1.00 70.72  ? 504  GLN A CD  1 
ATOM   780  O  OE1 . GLN A 1 132 ? 43.851 -31.501 0.552   1.00 71.56  ? 504  GLN A OE1 1 
ATOM   781  N  NE2 . GLN A 1 132 ? 44.031 -31.684 -1.703  1.00 73.10  ? 504  GLN A NE2 1 
ATOM   782  N  N   . GLU A 1 133 ? 44.201 -35.781 3.553   1.00 50.43  ? 505  GLU A N   1 
ATOM   783  C  CA  . GLU A 1 133 ? 44.551 -36.775 4.554   1.00 48.72  ? 505  GLU A CA  1 
ATOM   784  C  C   . GLU A 1 133 ? 43.465 -37.848 4.658   1.00 44.13  ? 505  GLU A C   1 
ATOM   785  O  O   . GLU A 1 133 ? 43.765 -39.038 4.756   1.00 42.49  ? 505  GLU A O   1 
ATOM   786  C  CB  . GLU A 1 133 ? 44.808 -36.107 5.910   1.00 50.33  ? 505  GLU A CB  1 
ATOM   787  C  CG  . GLU A 1 133 ? 45.106 -37.091 7.034   1.00 51.05  ? 505  GLU A CG  1 
ATOM   788  C  CD  . GLU A 1 133 ? 45.766 -36.444 8.237   1.00 56.13  ? 505  GLU A CD  1 
ATOM   789  O  OE1 . GLU A 1 133 ? 46.068 -35.221 8.198   1.00 60.42  ? 505  GLU A OE1 1 
ATOM   790  O  OE2 . GLU A 1 133 ? 45.993 -37.173 9.224   1.00 55.94  ? 505  GLU A OE2 1 
ATOM   791  N  N   . LYS A 1 134 ? 42.208 -37.419 4.624   1.00 41.99  ? 506  LYS A N   1 
ATOM   792  C  CA  . LYS A 1 134 ? 41.083 -38.357 4.545   1.00 37.97  ? 506  LYS A CA  1 
ATOM   793  C  C   . LYS A 1 134 ? 41.109 -39.186 3.241   1.00 37.04  ? 506  LYS A C   1 
ATOM   794  O  O   . LYS A 1 134 ? 40.888 -40.399 3.296   1.00 35.17  ? 506  LYS A O   1 
ATOM   795  C  CB  . LYS A 1 134 ? 39.737 -37.644 4.760   1.00 36.76  ? 506  LYS A CB  1 
ATOM   796  C  CG  . LYS A 1 134 ? 39.592 -37.029 6.141   1.00 36.34  ? 506  LYS A CG  1 
ATOM   797  C  CD  . LYS A 1 134 ? 38.268 -36.343 6.371   1.00 34.83  ? 506  LYS A CD  1 
ATOM   798  C  CE  . LYS A 1 134 ? 38.271 -35.670 7.745   1.00 37.69  ? 506  LYS A CE  1 
ATOM   799  N  NZ  . LYS A 1 134 ? 36.946 -35.115 8.161   1.00 35.81  ? 506  LYS A NZ  1 
ATOM   800  N  N   . GLU A 1 135 ? 41.412 -38.540 2.102   1.00 38.23  ? 507  GLU A N   1 
ATOM   801  C  CA  . GLU A 1 135 ? 41.570 -39.216 0.796   1.00 38.28  ? 507  GLU A CA  1 
ATOM   802  C  C   . GLU A 1 135 ? 42.590 -40.355 0.864   1.00 38.25  ? 507  GLU A C   1 
ATOM   803  O  O   . GLU A 1 135 ? 42.301 -41.488 0.443   1.00 36.71  ? 507  GLU A O   1 
ATOM   804  C  CB  . GLU A 1 135 ? 42.007 -38.237 -0.296  1.00 41.39  ? 507  GLU A CB  1 
ATOM   805  C  CG  . GLU A 1 135 ? 40.888 -37.569 -1.094  1.00 44.30  ? 507  GLU A CG  1 
ATOM   806  C  CD  . GLU A 1 135 ? 41.361 -36.357 -1.929  1.00 52.48  ? 507  GLU A CD  1 
ATOM   807  O  OE1 . GLU A 1 135 ? 42.592 -36.122 -2.058  1.00 56.05  ? 507  GLU A OE1 1 
ATOM   808  O  OE2 . GLU A 1 135 ? 40.489 -35.620 -2.453  1.00 54.48  ? 507  GLU A OE2 1 
ATOM   809  N  N   . ALA A 1 136 ? 43.772 -40.048 1.404   1.00 39.22  ? 508  ALA A N   1 
ATOM   810  C  CA  . ALA A 1 136 ? 44.842 -41.022 1.531   1.00 39.47  ? 508  ALA A CA  1 
ATOM   811  C  C   . ALA A 1 136 ? 44.432 -42.196 2.431   1.00 36.53  ? 508  ALA A C   1 
ATOM   812  O  O   . ALA A 1 136 ? 44.733 -43.352 2.136   1.00 36.79  ? 508  ALA A O   1 
ATOM   813  C  CB  . ALA A 1 136 ? 46.138 -40.348 2.037   1.00 42.60  ? 508  ALA A CB  1 
ATOM   814  N  N   . TRP A 1 137 ? 43.728 -41.899 3.515   1.00 34.43  ? 509  TRP A N   1 
ATOM   815  C  CA  . TRP A 1 137 ? 43.277 -42.918 4.432   1.00 31.61  ? 509  TRP A CA  1 
ATOM   816  C  C   . TRP A 1 137 ? 42.235 -43.822 3.777   1.00 29.75  ? 509  TRP A C   1 
ATOM   817  O  O   . TRP A 1 137 ? 42.339 -45.047 3.849   1.00 28.74  ? 509  TRP A O   1 
ATOM   818  C  CB  . TRP A 1 137 ? 42.679 -42.287 5.686   1.00 30.75  ? 509  TRP A CB  1 
ATOM   819  C  CG  . TRP A 1 137 ? 42.350 -43.317 6.748   1.00 27.85  ? 509  TRP A CG  1 
ATOM   820  C  CD1 . TRP A 1 137 ? 41.132 -43.861 7.023   1.00 23.03  ? 509  TRP A CD1 1 
ATOM   821  C  CD2 . TRP A 1 137 ? 43.280 -43.922 7.652   1.00 28.45  ? 509  TRP A CD2 1 
ATOM   822  N  NE1 . TRP A 1 137 ? 41.243 -44.781 8.049   1.00 24.96  ? 509  TRP A NE1 1 
ATOM   823  C  CE2 . TRP A 1 137 ? 42.552 -44.824 8.461   1.00 27.90  ? 509  TRP A CE2 1 
ATOM   824  C  CE3 . TRP A 1 137 ? 44.659 -43.764 7.878   1.00 30.10  ? 509  TRP A CE3 1 
ATOM   825  C  CZ2 . TRP A 1 137 ? 43.161 -45.580 9.474   1.00 28.50  ? 509  TRP A CZ2 1 
ATOM   826  C  CZ3 . TRP A 1 137 ? 45.264 -44.517 8.863   1.00 31.46  ? 509  TRP A CZ3 1 
ATOM   827  C  CH2 . TRP A 1 137 ? 44.516 -45.415 9.660   1.00 30.27  ? 509  TRP A CH2 1 
ATOM   828  N  N   . ILE A 1 138 ? 41.223 -43.208 3.162   1.00 29.76  ? 510  ILE A N   1 
ATOM   829  C  CA  . ILE A 1 138 ? 40.130 -43.939 2.500   1.00 28.29  ? 510  ILE A CA  1 
ATOM   830  C  C   . ILE A 1 138 ? 40.661 -44.852 1.382   1.00 29.89  ? 510  ILE A C   1 
ATOM   831  O  O   . ILE A 1 138 ? 40.298 -46.013 1.315   1.00 29.97  ? 510  ILE A O   1 
ATOM   832  C  CB  . ILE A 1 138 ? 38.980 -42.983 2.064   1.00 27.37  ? 510  ILE A CB  1 
ATOM   833  C  CG1 . ILE A 1 138 ? 38.286 -42.419 3.312   1.00 26.27  ? 510  ILE A CG1 1 
ATOM   834  C  CG2 . ILE A 1 138 ? 37.927 -43.702 1.210   1.00 26.06  ? 510  ILE A CG2 1 
ATOM   835  C  CD1 . ILE A 1 138 ? 37.361 -41.267 3.059   1.00 25.48  ? 510  ILE A CD1 1 
ATOM   836  N  N   . HIS A 1 139 ? 41.570 -44.340 0.558   1.00 32.78  ? 511  HIS A N   1 
ATOM   837  C  CA  . HIS A 1 139 ? 42.206 -45.124 -0.495  1.00 34.85  ? 511  HIS A CA  1 
ATOM   838  C  C   . HIS A 1 139 ? 43.073 -46.278 0.032   1.00 35.34  ? 511  HIS A C   1 
ATOM   839  O  O   . HIS A 1 139 ? 43.091 -47.356 -0.558  1.00 36.34  ? 511  HIS A O   1 
ATOM   840  C  CB  . HIS A 1 139 ? 43.053 -44.213 -1.388  1.00 37.92  ? 511  HIS A CB  1 
ATOM   841  C  CG  . HIS A 1 139 ? 43.487 -44.858 -2.660  1.00 42.44  ? 511  HIS A CG  1 
ATOM   842  N  ND1 . HIS A 1 139 ? 44.673 -45.558 -2.775  1.00 47.31  ? 511  HIS A ND1 1 
ATOM   843  C  CD2 . HIS A 1 139 ? 42.898 -44.907 -3.880  1.00 44.72  ? 511  HIS A CD2 1 
ATOM   844  C  CE1 . HIS A 1 139 ? 44.798 -46.006 -4.013  1.00 49.62  ? 511  HIS A CE1 1 
ATOM   845  N  NE2 . HIS A 1 139 ? 43.736 -45.624 -4.703  1.00 49.49  ? 511  HIS A NE2 1 
ATOM   846  N  N   . ALA A 1 140 ? 43.805 -46.045 1.115   1.00 35.01  ? 512  ALA A N   1 
ATOM   847  C  CA  . ALA A 1 140 ? 44.605 -47.093 1.732   1.00 35.69  ? 512  ALA A CA  1 
ATOM   848  C  C   . ALA A 1 140 ? 43.707 -48.165 2.338   1.00 33.20  ? 512  ALA A C   1 
ATOM   849  O  O   . ALA A 1 140 ? 43.971 -49.363 2.216   1.00 34.37  ? 512  ALA A O   1 
ATOM   850  C  CB  . ALA A 1 140 ? 45.543 -46.496 2.805   1.00 36.71  ? 512  ALA A CB  1 
ATOM   851  N  N   . LYS A 1 141 ? 42.632 -47.712 2.974   1.00 31.10  ? 513  LYS A N   1 
ATOM   852  C  CA  . LYS A 1 141 ? 41.705 -48.562 3.690   1.00 28.94  ? 513  LYS A CA  1 
ATOM   853  C  C   . LYS A 1 141 ? 40.947 -49.503 2.734   1.00 28.57  ? 513  LYS A C   1 
ATOM   854  O  O   . LYS A 1 141 ? 41.023 -50.720 2.885   1.00 28.80  ? 513  LYS A O   1 
ATOM   855  C  CB  . LYS A 1 141 ? 40.744 -47.679 4.475   1.00 27.42  ? 513  LYS A CB  1 
ATOM   856  C  CG  . LYS A 1 141 ? 39.734 -48.411 5.343   1.00 26.36  ? 513  LYS A CG  1 
ATOM   857  C  CD  . LYS A 1 141 ? 39.037 -47.424 6.249   1.00 24.56  ? 513  LYS A CD  1 
ATOM   858  C  CE  . LYS A 1 141 ? 37.888 -48.078 6.995   1.00 23.81  ? 513  LYS A CE  1 
ATOM   859  N  NZ  . LYS A 1 141 ? 37.320 -47.069 7.954   1.00 23.27  ? 513  LYS A NZ  1 
ATOM   860  N  N   . TYR A 1 142 ? 40.268 -48.934 1.740   1.00 27.70  ? 514  TYR A N   1 
ATOM   861  C  CA  . TYR A 1 142 ? 39.339 -49.689 0.888   1.00 27.71  ? 514  TYR A CA  1 
ATOM   862  C  C   . TYR A 1 142 ? 39.883 -50.157 -0.472  1.00 29.45  ? 514  TYR A C   1 
ATOM   863  O  O   . TYR A 1 142 ? 39.438 -51.179 -0.988  1.00 30.21  ? 514  TYR A O   1 
ATOM   864  C  CB  . TYR A 1 142 ? 38.057 -48.891 0.654   1.00 25.56  ? 514  TYR A CB  1 
ATOM   865  C  CG  . TYR A 1 142 ? 37.297 -48.493 1.910   1.00 26.00  ? 514  TYR A CG  1 
ATOM   866  C  CD1 . TYR A 1 142 ? 37.243 -47.142 2.326   1.00 25.60  ? 514  TYR A CD1 1 
ATOM   867  C  CD2 . TYR A 1 142 ? 36.614 -49.445 2.670   1.00 22.60  ? 514  TYR A CD2 1 
ATOM   868  C  CE1 . TYR A 1 142 ? 36.528 -46.770 3.471   1.00 24.35  ? 514  TYR A CE1 1 
ATOM   869  C  CE2 . TYR A 1 142 ? 35.897 -49.079 3.822   1.00 23.08  ? 514  TYR A CE2 1 
ATOM   870  C  CZ  . TYR A 1 142 ? 35.845 -47.742 4.208   1.00 24.00  ? 514  TYR A CZ  1 
ATOM   871  O  OH  . TYR A 1 142 ? 35.130 -47.383 5.344   1.00 22.56  ? 514  TYR A OH  1 
ATOM   872  N  N   . VAL A 1 143 ? 40.812 -49.413 -1.064  1.00 31.12  ? 515  VAL A N   1 
ATOM   873  C  CA  . VAL A 1 143 ? 41.340 -49.782 -2.378  1.00 33.36  ? 515  VAL A CA  1 
ATOM   874  C  C   . VAL A 1 143 ? 42.595 -50.624 -2.212  1.00 36.10  ? 515  VAL A C   1 
ATOM   875  O  O   . VAL A 1 143 ? 42.708 -51.728 -2.752  1.00 37.87  ? 515  VAL A O   1 
ATOM   876  C  CB  . VAL A 1 143 ? 41.650 -48.534 -3.255  1.00 34.70  ? 515  VAL A CB  1 
ATOM   877  C  CG1 . VAL A 1 143 ? 42.242 -48.946 -4.616  1.00 36.85  ? 515  VAL A CG1 1 
ATOM   878  C  CG2 . VAL A 1 143 ? 40.402 -47.679 -3.438  1.00 31.09  ? 515  VAL A CG2 1 
ATOM   879  N  N   . GLU A 1 144 ? 43.534 -50.086 -1.447  1.00 36.95  ? 516  GLU A N   1 
ATOM   880  C  CA  . GLU A 1 144 ? 44.811 -50.718 -1.183  1.00 39.41  ? 516  GLU A CA  1 
ATOM   881  C  C   . GLU A 1 144 ? 44.655 -51.886 -0.195  1.00 38.36  ? 516  GLU A C   1 
ATOM   882  O  O   . GLU A 1 144 ? 45.459 -52.822 -0.204  1.00 39.72  ? 516  GLU A O   1 
ATOM   883  C  CB  . GLU A 1 144 ? 45.749 -49.658 -0.620  1.00 40.44  ? 516  GLU A CB  1 
ATOM   884  C  CG  . GLU A 1 144 ? 47.212 -49.955 -0.766  1.00 46.49  ? 516  GLU A CG  1 
ATOM   885  C  CD  . GLU A 1 144 ? 48.104 -48.902 -0.095  1.00 51.05  ? 516  GLU A CD  1 
ATOM   886  O  OE1 . GLU A 1 144 ? 47.694 -47.706 -0.040  1.00 51.00  ? 516  GLU A OE1 1 
ATOM   887  O  OE2 . GLU A 1 144 ? 49.217 -49.279 0.359   1.00 53.39  ? 516  GLU A OE2 1 
ATOM   888  N  N   . LYS A 1 145 ? 43.612 -51.822 0.645   1.00 35.69  ? 517  LYS A N   1 
ATOM   889  C  CA  . LYS A 1 145 ? 43.327 -52.849 1.681   1.00 35.13  ? 517  LYS A CA  1 
ATOM   890  C  C   . LYS A 1 145 ? 44.510 -52.986 2.645   1.00 36.04  ? 517  LYS A C   1 
ATOM   891  O  O   . LYS A 1 145 ? 44.867 -54.079 3.088   1.00 36.67  ? 517  LYS A O   1 
ATOM   892  C  CB  . LYS A 1 145 ? 42.984 -54.211 1.058   1.00 36.26  ? 517  LYS A CB  1 
ATOM   893  C  CG  . LYS A 1 145 ? 41.923 -54.187 -0.050  1.00 37.25  ? 517  LYS A CG  1 
ATOM   894  C  CD  . LYS A 1 145 ? 40.512 -54.311 0.479   1.00 37.64  ? 517  LYS A CD  1 
ATOM   895  C  CE  . LYS A 1 145 ? 39.578 -54.788 -0.630  1.00 40.84  ? 517  LYS A CE  1 
ATOM   896  N  NZ  . LYS A 1 145 ? 39.195 -53.706 -1.600  1.00 41.78  ? 517  LYS A NZ  1 
ATOM   897  N  N   . LYS A 1 146 ? 45.095 -51.839 2.966   1.00 36.04  ? 518  LYS A N   1 
ATOM   898  C  CA  . LYS A 1 146 ? 46.386 -51.762 3.644   1.00 37.67  ? 518  LYS A CA  1 
ATOM   899  C  C   . LYS A 1 146 ? 46.341 -52.199 5.103   1.00 36.64  ? 518  LYS A C   1 
ATOM   900  O  O   . LYS A 1 146 ? 47.365 -52.582 5.651   1.00 38.77  ? 518  LYS A O   1 
ATOM   901  C  CB  . LYS A 1 146 ? 46.924 -50.331 3.541   1.00 38.31  ? 518  LYS A CB  1 
ATOM   902  C  CG  . LYS A 1 146 ? 48.379 -50.182 3.870   1.00 41.76  ? 518  LYS A CG  1 
ATOM   903  C  CD  . LYS A 1 146 ? 48.830 -48.741 3.815   1.00 42.27  ? 518  LYS A CD  1 
ATOM   904  C  CE  . LYS A 1 146 ? 50.343 -48.701 3.783   1.00 45.97  ? 518  LYS A CE  1 
ATOM   905  N  NZ  . LYS A 1 146 ? 50.848 -47.343 4.077   1.00 48.84  ? 518  LYS A NZ  1 
ATOM   906  N  N   . PHE A 1 147 ? 45.168 -52.156 5.729   1.00 33.96  ? 519  PHE A N   1 
ATOM   907  C  CA  . PHE A 1 147 ? 45.095 -52.409 7.176   1.00 33.74  ? 519  PHE A CA  1 
ATOM   908  C  C   . PHE A 1 147 ? 44.475 -53.758 7.536   1.00 33.82  ? 519  PHE A C   1 
ATOM   909  O  O   . PHE A 1 147 ? 44.244 -54.057 8.720   1.00 34.16  ? 519  PHE A O   1 
ATOM   910  C  CB  . PHE A 1 147 ? 44.379 -51.260 7.895   1.00 31.52  ? 519  PHE A CB  1 
ATOM   911  C  CG  . PHE A 1 147 ? 44.864 -49.895 7.483   1.00 31.84  ? 519  PHE A CG  1 
ATOM   912  C  CD1 . PHE A 1 147 ? 43.993 -48.975 6.923   1.00 28.58  ? 519  PHE A CD1 1 
ATOM   913  C  CD2 . PHE A 1 147 ? 46.208 -49.533 7.650   1.00 33.58  ? 519  PHE A CD2 1 
ATOM   914  C  CE1 . PHE A 1 147 ? 44.436 -47.722 6.537   1.00 28.95  ? 519  PHE A CE1 1 
ATOM   915  C  CE2 . PHE A 1 147 ? 46.661 -48.285 7.257   1.00 33.00  ? 519  PHE A CE2 1 
ATOM   916  C  CZ  . PHE A 1 147 ? 45.775 -47.373 6.699   1.00 31.60  ? 519  PHE A CZ  1 
ATOM   917  N  N   . LEU A 1 148 ? 44.226 -54.567 6.510   1.00 34.14  ? 520  LEU A N   1 
ATOM   918  C  CA  . LEU A 1 148 ? 43.641 -55.902 6.663   1.00 35.28  ? 520  LEU A CA  1 
ATOM   919  C  C   . LEU A 1 148 ? 44.599 -56.868 7.343   1.00 37.94  ? 520  LEU A C   1 
ATOM   920  O  O   . LEU A 1 148 ? 45.810 -56.751 7.180   1.00 40.05  ? 520  LEU A O   1 
ATOM   921  C  CB  . LEU A 1 148 ? 43.288 -56.465 5.285   1.00 35.03  ? 520  LEU A CB  1 
ATOM   922  C  CG  . LEU A 1 148 ? 41.866 -56.425 4.733   1.00 34.12  ? 520  LEU A CG  1 
ATOM   923  C  CD1 . LEU A 1 148 ? 41.151 -55.092 4.903   1.00 32.04  ? 520  LEU A CD1 1 
ATOM   924  C  CD2 . LEU A 1 148 ? 41.897 -56.860 3.276   1.00 35.59  ? 520  LEU A CD2 1 
ATOM   925  N  N   . THR A 1 149 ? 44.062 -57.829 8.096   1.00 38.56  ? 521  THR A N   1 
ATOM   926  C  CA  . THR A 1 149 ? 44.867 -58.981 8.503   1.00 41.25  ? 521  THR A CA  1 
ATOM   927  C  C   . THR A 1 149 ? 45.192 -59.778 7.231   1.00 43.24  ? 521  THR A C   1 
ATOM   928  O  O   . THR A 1 149 ? 44.575 -59.563 6.179   1.00 42.01  ? 521  THR A O   1 
ATOM   929  C  CB  . THR A 1 149 ? 44.158 -59.894 9.549   1.00 41.92  ? 521  THR A CB  1 
ATOM   930  O  OG1 . THR A 1 149 ? 42.906 -60.372 9.032   1.00 39.21  ? 521  THR A OG1 1 
ATOM   931  C  CG2 . THR A 1 149 ? 43.932 -59.158 10.874  1.00 40.46  ? 521  THR A CG2 1 
ATOM   932  N  N   . LYS A 1 150 ? 46.166 -60.673 7.315   1.00 46.71  ? 522  LYS A N   1 
ATOM   933  C  CA  . LYS A 1 150 ? 46.549 -61.490 6.167   1.00 49.51  ? 522  LYS A CA  1 
ATOM   934  C  C   . LYS A 1 150 ? 45.379 -62.390 5.745   1.00 49.23  ? 522  LYS A C   1 
ATOM   935  O  O   . LYS A 1 150 ? 45.044 -62.470 4.565   1.00 49.04  ? 522  LYS A O   1 
ATOM   936  C  CB  . LYS A 1 150 ? 47.796 -62.328 6.494   1.00 53.09  ? 522  LYS A CB  1 
ATOM   937  C  CG  . LYS A 1 150 ? 48.409 -63.063 5.299   1.00 57.07  ? 522  LYS A CG  1 
ATOM   938  C  CD  . LYS A 1 150 ? 49.663 -63.847 5.721   1.00 63.56  ? 522  LYS A CD  1 
ATOM   939  C  CE  . LYS A 1 150 ? 50.416 -64.398 4.517   1.00 67.22  ? 522  LYS A CE  1 
ATOM   940  N  NZ  . LYS A 1 150 ? 51.470 -65.376 4.917   1.00 72.39  ? 522  LYS A NZ  1 
ATOM   941  N  N   . LEU A 1 151 ? 44.772 -63.054 6.732   1.00 49.74  ? 523  LEU A N   1 
ATOM   942  C  CA  . LEU A 1 151 ? 43.694 -64.025 6.518   1.00 50.23  ? 523  LEU A CA  1 
ATOM   943  C  C   . LEU A 1 151 ? 42.361 -63.506 7.096   1.00 47.43  ? 523  LEU A C   1 
ATOM   944  O  O   . LEU A 1 151 ? 42.367 -62.876 8.163   1.00 46.19  ? 523  LEU A O   1 
ATOM   945  C  CB  . LEU A 1 151 ? 44.078 -65.353 7.164   1.00 53.45  ? 523  LEU A CB  1 
ATOM   946  C  CG  . LEU A 1 151 ? 44.918 -66.395 6.405   1.00 58.43  ? 523  LEU A CG  1 
ATOM   947  C  CD1 . LEU A 1 151 ? 45.758 -65.844 5.243   1.00 58.87  ? 523  LEU A CD1 1 
ATOM   948  C  CD2 . LEU A 1 151 ? 45.812 -67.150 7.388   1.00 61.67  ? 523  LEU A CD2 1 
ATOM   949  N  N   . PRO A 1 152 ? 41.224 -63.756 6.385   1.00 46.31  ? 524  PRO A N   1 
ATOM   950  C  CA  . PRO A 1 152 ? 39.865 -63.333 6.790   1.00 43.90  ? 524  PRO A CA  1 
ATOM   951  C  C   . PRO A 1 152 ? 39.309 -64.107 7.980   1.00 44.87  ? 524  PRO A C   1 
ATOM   952  O  O   . PRO A 1 152 ? 39.880 -65.128 8.358   1.00 47.93  ? 524  PRO A O   1 
ATOM   953  C  CB  . PRO A 1 152 ? 39.020 -63.633 5.548   1.00 43.79  ? 524  PRO A CB  1 
ATOM   954  C  CG  . PRO A 1 152 ? 39.752 -64.748 4.859   1.00 46.77  ? 524  PRO A CG  1 
ATOM   955  C  CD  . PRO A 1 152 ? 41.205 -64.461 5.087   1.00 47.90  ? 524  PRO A CD  1 
ATOM   956  N  N   . LEU A 1 197 ? 42.519 -69.017 4.606   1.00 51.56  ? 569  LEU A N   1 
ATOM   957  C  CA  . LEU A 1 197 ? 43.317 -69.336 3.421   1.00 52.94  ? 569  LEU A CA  1 
ATOM   958  C  C   . LEU A 1 197 ? 42.488 -69.350 2.137   1.00 51.43  ? 569  LEU A C   1 
ATOM   959  O  O   . LEU A 1 197 ? 43.031 -69.199 1.038   1.00 52.21  ? 569  LEU A O   1 
ATOM   960  C  CB  . LEU A 1 197 ? 44.057 -70.675 3.585   1.00 56.22  ? 569  LEU A CB  1 
ATOM   961  C  CG  . LEU A 1 197 ? 45.346 -70.709 4.434   1.00 59.21  ? 569  LEU A CG  1 
ATOM   962  C  CD1 . LEU A 1 197 ? 45.907 -72.132 4.514   1.00 62.03  ? 569  LEU A CD1 1 
ATOM   963  C  CD2 . LEU A 1 197 ? 46.424 -69.733 3.918   1.00 59.16  ? 569  LEU A CD2 1 
ATOM   964  N  N   . HIS A 1 198 ? 41.180 -69.537 2.267   1.00 49.32  ? 570  HIS A N   1 
ATOM   965  C  CA  . HIS A 1 198 ? 40.318 -69.554 1.096   1.00 47.86  ? 570  HIS A CA  1 
ATOM   966  C  C   . HIS A 1 198 ? 39.111 -68.613 1.266   1.00 44.74  ? 570  HIS A C   1 
ATOM   967  O  O   . HIS A 1 198 ? 38.085 -68.999 1.834   1.00 44.14  ? 570  HIS A O   1 
ATOM   968  C  CB  . HIS A 1 198 ? 39.909 -70.986 0.759   1.00 49.23  ? 570  HIS A CB  1 
ATOM   969  C  CG  . HIS A 1 198 ? 41.069 -71.865 0.413   1.00 53.47  ? 570  HIS A CG  1 
ATOM   970  N  ND1 . HIS A 1 198 ? 41.555 -71.984 -0.873  1.00 54.70  ? 570  HIS A ND1 1 
ATOM   971  C  CD2 . HIS A 1 198 ? 41.869 -72.632 1.192   1.00 56.84  ? 570  HIS A CD2 1 
ATOM   972  C  CE1 . HIS A 1 198 ? 42.589 -72.806 -0.874  1.00 58.62  ? 570  HIS A CE1 1 
ATOM   973  N  NE2 . HIS A 1 198 ? 42.803 -73.209 0.367   1.00 60.25  ? 570  HIS A NE2 1 
ATOM   974  N  N   . PRO A 1 199 ? 39.253 -67.363 0.786   1.00 42.93  ? 571  PRO A N   1 
ATOM   975  C  CA  . PRO A 1 199 ? 38.228 -66.334 0.985   1.00 40.02  ? 571  PRO A CA  1 
ATOM   976  C  C   . PRO A 1 199 ? 36.913 -66.664 0.302   1.00 38.19  ? 571  PRO A C   1 
ATOM   977  O  O   . PRO A 1 199 ? 35.862 -66.426 0.883   1.00 36.51  ? 571  PRO A O   1 
ATOM   978  C  CB  . PRO A 1 199 ? 38.867 -65.083 0.375   1.00 39.58  ? 571  PRO A CB  1 
ATOM   979  C  CG  . PRO A 1 199 ? 40.355 -65.329 0.527   1.00 41.89  ? 571  PRO A CG  1 
ATOM   980  C  CD  . PRO A 1 199 ? 40.504 -66.792 0.242   1.00 43.63  ? 571  PRO A CD  1 
ATOM   981  N  N   . GLY A 1 200 ? 36.978 -67.212 -0.911  1.00 37.92  ? 572  GLY A N   1 
ATOM   982  C  CA  . GLY A 1 200 ? 35.783 -67.594 -1.655  1.00 36.74  ? 572  GLY A CA  1 
ATOM   983  C  C   . GLY A 1 200 ? 34.973 -68.665 -0.932  1.00 37.15  ? 572  GLY A C   1 
ATOM   984  O  O   . GLY A 1 200 ? 33.765 -68.500 -0.680  1.00 35.99  ? 572  GLY A O   1 
ATOM   985  N  N   . ALA A 1 201 ? 35.644 -69.759 -0.578  1.00 38.44  ? 573  ALA A N   1 
ATOM   986  C  CA  . ALA A 1 201 ? 35.026 -70.838 0.186   1.00 38.75  ? 573  ALA A CA  1 
ATOM   987  C  C   . ALA A 1 201 ? 34.486 -70.355 1.528   1.00 37.86  ? 573  ALA A C   1 
ATOM   988  O  O   . ALA A 1 201 ? 33.419 -70.803 1.968   1.00 37.80  ? 573  ALA A O   1 
ATOM   989  C  CB  . ALA A 1 201 ? 35.990 -72.000 0.370   1.00 41.02  ? 573  ALA A CB  1 
ATOM   990  N  N   . LEU A 1 202 ? 35.203 -69.431 2.166   1.00 37.29  ? 574  LEU A N   1 
ATOM   991  C  CA  . LEU A 1 202 ? 34.731 -68.853 3.426   1.00 36.60  ? 574  LEU A CA  1 
ATOM   992  C  C   . LEU A 1 202 ? 33.433 -68.083 3.201   1.00 34.39  ? 574  LEU A C   1 
ATOM   993  O  O   . LEU A 1 202 ? 32.491 -68.210 3.978   1.00 34.94  ? 574  LEU A O   1 
ATOM   994  C  CB  . LEU A 1 202 ? 35.792 -67.940 4.074   1.00 36.96  ? 574  LEU A CB  1 
ATOM   995  C  CG  . LEU A 1 202 ? 35.388 -67.309 5.425   1.00 35.89  ? 574  LEU A CG  1 
ATOM   996  C  CD1 . LEU A 1 202 ? 34.977 -68.365 6.431   1.00 36.22  ? 574  LEU A CD1 1 
ATOM   997  C  CD2 . LEU A 1 202 ? 36.492 -66.419 5.999   1.00 35.16  ? 574  LEU A CD2 1 
ATOM   998  N  N   . LEU A 1 203 ? 33.391 -67.298 2.130   1.00 32.40  ? 575  LEU A N   1 
ATOM   999  C  CA  . LEU A 1 203 ? 32.203 -66.545 1.787   1.00 30.22  ? 575  LEU A CA  1 
ATOM   1000 C  C   . LEU A 1 203 ? 31.028 -67.494 1.563   1.00 30.94  ? 575  LEU A C   1 
ATOM   1001 O  O   . LEU A 1 203 ? 29.938 -67.264 2.080   1.00 30.13  ? 575  LEU A O   1 
ATOM   1002 C  CB  . LEU A 1 203 ? 32.441 -65.678 0.548   1.00 28.74  ? 575  LEU A CB  1 
ATOM   1003 C  CG  . LEU A 1 203 ? 31.211 -64.946 -0.009  1.00 25.18  ? 575  LEU A CG  1 
ATOM   1004 C  CD1 . LEU A 1 203 ? 30.690 -63.960 1.005   1.00 22.26  ? 575  LEU A CD1 1 
ATOM   1005 C  CD2 . LEU A 1 203 ? 31.538 -64.236 -1.315  1.00 22.59  ? 575  LEU A CD2 1 
ATOM   1006 N  N   . PHE A 1 204 ? 31.276 -68.548 0.779   1.00 32.50  ? 576  PHE A N   1 
ATOM   1007 C  CA  . PHE A 1 204 ? 30.299 -69.586 0.479   1.00 33.48  ? 576  PHE A CA  1 
ATOM   1008 C  C   . PHE A 1 204 ? 29.738 -70.185 1.773   1.00 34.68  ? 576  PHE A C   1 
ATOM   1009 O  O   . PHE A 1 204 ? 28.528 -70.187 1.963   1.00 34.21  ? 576  PHE A O   1 
ATOM   1010 C  CB  . PHE A 1 204 ? 30.932 -70.673 -0.400  1.00 35.07  ? 576  PHE A CB  1 
ATOM   1011 C  CG  . PHE A 1 204 ? 29.960 -71.717 -0.884  1.00 36.17  ? 576  PHE A CG  1 
ATOM   1012 C  CD1 . PHE A 1 204 ? 29.748 -72.877 -0.151  1.00 38.05  ? 576  PHE A CD1 1 
ATOM   1013 C  CD2 . PHE A 1 204 ? 29.286 -71.551 -2.088  1.00 36.36  ? 576  PHE A CD2 1 
ATOM   1014 C  CE1 . PHE A 1 204 ? 28.845 -73.852 -0.595  1.00 39.74  ? 576  PHE A CE1 1 
ATOM   1015 C  CE2 . PHE A 1 204 ? 28.384 -72.513 -2.545  1.00 37.41  ? 576  PHE A CE2 1 
ATOM   1016 C  CZ  . PHE A 1 204 ? 28.167 -73.670 -1.795  1.00 38.63  ? 576  PHE A CZ  1 
ATOM   1017 N  N   . ARG A 1 205 ? 30.620 -70.658 2.660   1.00 36.63  ? 577  ARG A N   1 
ATOM   1018 C  CA  . ARG A 1 205 ? 30.217 -71.207 3.962   1.00 38.28  ? 577  ARG A CA  1 
ATOM   1019 C  C   . ARG A 1 205 ? 29.419 -70.210 4.800   1.00 37.32  ? 577  ARG A C   1 
ATOM   1020 O  O   . ARG A 1 205 ? 28.391 -70.573 5.368   1.00 37.69  ? 577  ARG A O   1 
ATOM   1021 C  CB  . ARG A 1 205 ? 31.423 -71.743 4.757   1.00 40.14  ? 577  ARG A CB  1 
ATOM   1022 C  CG  . ARG A 1 205 ? 31.921 -73.124 4.280   1.00 44.70  ? 577  ARG A CG  1 
ATOM   1023 C  CD  . ARG A 1 205 ? 33.164 -73.650 5.059   1.00 49.96  ? 577  ARG A CD  1 
ATOM   1024 N  NE  . ARG A 1 205 ? 34.427 -73.017 4.649   1.00 52.21  ? 577  ARG A NE  1 
ATOM   1025 C  CZ  . ARG A 1 205 ? 35.267 -72.387 5.476   1.00 54.88  ? 577  ARG A CZ  1 
ATOM   1026 N  NH1 . ARG A 1 205 ? 34.992 -72.312 6.778   1.00 56.22  ? 577  ARG A NH1 1 
ATOM   1027 N  NH2 . ARG A 1 205 ? 36.392 -71.833 5.010   1.00 53.98  ? 577  ARG A NH2 1 
ATOM   1028 N  N   . ALA A 1 206 ? 29.881 -68.957 4.870   1.00 36.25  ? 578  ALA A N   1 
ATOM   1029 C  CA  . ALA A 1 206 ? 29.252 -67.958 5.762   1.00 35.27  ? 578  ALA A CA  1 
ATOM   1030 C  C   . ALA A 1 206 ? 27.885 -67.473 5.247   1.00 34.05  ? 578  ALA A C   1 
ATOM   1031 O  O   . ALA A 1 206 ? 27.100 -66.934 6.026   1.00 33.46  ? 578  ALA A O   1 
ATOM   1032 C  CB  . ALA A 1 206 ? 30.186 -66.776 5.997   1.00 34.22  ? 578  ALA A CB  1 
ATOM   1033 N  N   . SER A 1 207 ? 27.629 -67.658 3.946   1.00 33.10  ? 579  SER A N   1 
ATOM   1034 C  CA  . SER A 1 207 ? 26.359 -67.285 3.310   1.00 33.18  ? 579  SER A CA  1 
ATOM   1035 C  C   . SER A 1 207 ? 25.249 -68.303 3.547   1.00 35.08  ? 579  SER A C   1 
ATOM   1036 O  O   . SER A 1 207 ? 24.085 -68.023 3.267   1.00 34.68  ? 579  SER A O   1 
ATOM   1037 C  CB  . SER A 1 207 ? 26.525 -67.129 1.802   1.00 31.97  ? 579  SER A CB  1 
ATOM   1038 O  OG  . SER A 1 207 ? 27.546 -66.210 1.459   1.00 31.45  ? 579  SER A OG  1 
ATOM   1039 N  N   . GLY A 1 208 ? 25.614 -69.488 4.037   1.00 37.66  ? 580  GLY A N   1 
ATOM   1040 C  CA  . GLY A 1 208 ? 24.662 -70.582 4.234   1.00 40.33  ? 580  GLY A CA  1 
ATOM   1041 C  C   . GLY A 1 208 ? 24.108 -70.556 5.645   1.00 42.78  ? 580  GLY A C   1 
ATOM   1042 O  O   . GLY A 1 208 ? 24.628 -69.829 6.502   1.00 43.37  ? 580  GLY A O   1 
ATOM   1043 N  N   . HIS A 1 209 ? 23.059 -71.343 5.891   1.00 44.50  ? 581  HIS A N   1 
ATOM   1044 C  CA  . HIS A 1 209 ? 22.406 -71.373 7.208   1.00 47.19  ? 581  HIS A CA  1 
ATOM   1045 C  C   . HIS A 1 209 ? 23.373 -71.808 8.314   1.00 48.87  ? 581  HIS A C   1 
ATOM   1046 O  O   . HIS A 1 209 ? 24.090 -72.797 8.146   1.00 50.15  ? 581  HIS A O   1 
ATOM   1047 C  CB  . HIS A 1 209 ? 21.172 -72.289 7.200   1.00 48.56  ? 581  HIS A CB  1 
ATOM   1048 C  CG  . HIS A 1 209 ? 20.475 -72.360 8.524   1.00 53.54  ? 581  HIS A CG  1 
ATOM   1049 N  ND1 . HIS A 1 209 ? 19.698 -71.330 9.014   1.00 56.16  ? 581  HIS A ND1 1 
ATOM   1050 C  CD2 . HIS A 1 209 ? 20.469 -73.322 9.479   1.00 58.29  ? 581  HIS A CD2 1 
ATOM   1051 C  CE1 . HIS A 1 209 ? 19.234 -71.658 10.208  1.00 59.00  ? 581  HIS A CE1 1 
ATOM   1052 N  NE2 . HIS A 1 209 ? 19.689 -72.861 10.514  1.00 60.80  ? 581  HIS A NE2 1 
ATOM   1053 N  N   . PRO A 1 210 ? 23.445 -71.039 9.420   1.00 49.41  ? 582  PRO A N   1 
ATOM   1054 C  CA  . PRO A 1 210 ? 22.904 -69.678 9.558   1.00 48.09  ? 582  PRO A CA  1 
ATOM   1055 C  C   . PRO A 1 210 ? 23.949 -68.645 9.092   1.00 45.57  ? 582  PRO A C   1 
ATOM   1056 O  O   . PRO A 1 210 ? 25.124 -68.773 9.441   1.00 46.50  ? 582  PRO A O   1 
ATOM   1057 C  CB  . PRO A 1 210 ? 22.656 -69.559 11.067  1.00 50.04  ? 582  PRO A CB  1 
ATOM   1058 C  CG  . PRO A 1 210 ? 23.724 -70.439 11.688  1.00 52.14  ? 582  PRO A CG  1 
ATOM   1059 C  CD  . PRO A 1 210 ? 24.026 -71.535 10.688  1.00 51.55  ? 582  PRO A CD  1 
ATOM   1060 N  N   . PRO A 1 211 ? 23.538 -67.637 8.306   1.00 42.93  ? 583  PRO A N   1 
ATOM   1061 C  CA  . PRO A 1 211 ? 24.581 -66.784 7.724   1.00 41.12  ? 583  PRO A CA  1 
ATOM   1062 C  C   . PRO A 1 211 ? 25.260 -65.860 8.734   1.00 40.89  ? 583  PRO A C   1 
ATOM   1063 O  O   . PRO A 1 211 ? 24.624 -65.406 9.684   1.00 42.33  ? 583  PRO A O   1 
ATOM   1064 C  CB  . PRO A 1 211 ? 23.839 -65.977 6.640   1.00 39.58  ? 583  PRO A CB  1 
ATOM   1065 C  CG  . PRO A 1 211 ? 22.484 -66.632 6.509   1.00 40.68  ? 583  PRO A CG  1 
ATOM   1066 C  CD  . PRO A 1 211 ? 22.197 -67.239 7.858   1.00 41.96  ? 583  PRO A CD  1 
ATOM   1067 N  N   . SER A 1 212 ? 26.557 -65.628 8.553   1.00 39.28  ? 584  SER A N   1 
ATOM   1068 C  CA  . SER A 1 212 ? 27.262 -64.640 9.365   1.00 38.54  ? 584  SER A CA  1 
ATOM   1069 C  C   . SER A 1 212 ? 27.694 -63.488 8.469   1.00 36.49  ? 584  SER A C   1 
ATOM   1070 O  O   . SER A 1 212 ? 28.708 -63.590 7.779   1.00 36.03  ? 584  SER A O   1 
ATOM   1071 C  CB  . SER A 1 212 ? 28.472 -65.253 10.070  1.00 39.46  ? 584  SER A CB  1 
ATOM   1072 O  OG  . SER A 1 212 ? 29.231 -64.244 10.727  1.00 39.44  ? 584  SER A OG  1 
ATOM   1073 N  N   . LEU A 1 213 ? 26.917 -62.402 8.490   1.00 35.06  ? 585  LEU A N   1 
ATOM   1074 C  CA  . LEU A 1 213 ? 27.193 -61.226 7.668   1.00 33.21  ? 585  LEU A CA  1 
ATOM   1075 C  C   . LEU A 1 213 ? 28.558 -60.585 7.957   1.00 31.98  ? 585  LEU A C   1 
ATOM   1076 O  O   . LEU A 1 213 ? 29.196 -60.135 7.023   1.00 30.75  ? 585  LEU A O   1 
ATOM   1077 C  CB  . LEU A 1 213 ? 26.050 -60.197 7.739   1.00 33.79  ? 585  LEU A CB  1 
ATOM   1078 C  CG  . LEU A 1 213 ? 24.678 -60.688 7.242   1.00 36.50  ? 585  LEU A CG  1 
ATOM   1079 C  CD1 . LEU A 1 213 ? 23.546 -59.891 7.872   1.00 40.62  ? 585  LEU A CD1 1 
ATOM   1080 C  CD2 . LEU A 1 213 ? 24.570 -60.634 5.726   1.00 37.53  ? 585  LEU A CD2 1 
ATOM   1081 N  N   . PRO A 1 214 ? 29.007 -60.548 9.239   1.00 32.54  ? 586  PRO A N   1 
ATOM   1082 C  CA  . PRO A 1 214 ? 30.386 -60.098 9.497   1.00 32.33  ? 586  PRO A CA  1 
ATOM   1083 C  C   . PRO A 1 214 ? 31.444 -60.981 8.824   1.00 31.47  ? 586  PRO A C   1 
ATOM   1084 O  O   . PRO A 1 214 ? 32.431 -60.468 8.318   1.00 30.88  ? 586  PRO A O   1 
ATOM   1085 C  CB  . PRO A 1 214 ? 30.500 -60.179 11.024  1.00 33.87  ? 586  PRO A CB  1 
ATOM   1086 C  CG  . PRO A 1 214 ? 29.110 -59.936 11.495  1.00 34.68  ? 586  PRO A CG  1 
ATOM   1087 C  CD  . PRO A 1 214 ? 28.251 -60.675 10.503  1.00 33.89  ? 586  PRO A CD  1 
ATOM   1088 N  N   . THR A 1 215 ? 31.220 -62.292 8.794   1.00 31.27  ? 587  THR A N   1 
ATOM   1089 C  CA  . THR A 1 215 ? 32.147 -63.189 8.128   1.00 30.21  ? 587  THR A CA  1 
ATOM   1090 C  C   . THR A 1 215 ? 32.104 -62.998 6.607   1.00 28.73  ? 587  THR A C   1 
ATOM   1091 O  O   . THR A 1 215 ? 33.165 -62.947 5.976   1.00 28.54  ? 587  THR A O   1 
ATOM   1092 C  CB  . THR A 1 215 ? 31.925 -64.646 8.536   1.00 31.66  ? 587  THR A CB  1 
ATOM   1093 O  OG1 . THR A 1 215 ? 31.957 -64.752 9.971   1.00 32.32  ? 587  THR A OG1 1 
ATOM   1094 C  CG2 . THR A 1 215 ? 33.007 -65.543 7.944   1.00 31.43  ? 587  THR A CG2 1 
ATOM   1095 N  N   . MET A 1 216 ? 30.909 -62.863 6.023   1.00 26.88  ? 588  MET A N   1 
ATOM   1096 C  CA  . MET A 1 216 ? 30.812 -62.559 4.588   1.00 26.26  ? 588  MET A CA  1 
ATOM   1097 C  C   . MET A 1 216 ? 31.574 -61.273 4.239   1.00 25.94  ? 588  MET A C   1 
ATOM   1098 O  O   . MET A 1 216 ? 32.274 -61.214 3.210   1.00 25.44  ? 588  MET A O   1 
ATOM   1099 C  CB  . MET A 1 216 ? 29.345 -62.456 4.105   1.00 25.40  ? 588  MET A CB  1 
ATOM   1100 C  CG  . MET A 1 216 ? 28.476 -63.696 4.402   1.00 26.39  ? 588  MET A CG  1 
ATOM   1101 S  SD  . MET A 1 216 ? 26.699 -63.435 4.092   1.00 25.30  ? 588  MET A SD  1 
ATOM   1102 C  CE  . MET A 1 216 ? 26.686 -62.967 2.334   1.00 21.74  ? 588  MET A CE  1 
ATOM   1103 N  N   . ALA A 1 217 ? 31.446 -60.260 5.108   1.00 25.92  ? 589  ALA A N   1 
ATOM   1104 C  CA  . ALA A 1 217 ? 32.104 -58.956 4.908   1.00 26.47  ? 589  ALA A CA  1 
ATOM   1105 C  C   . ALA A 1 217 ? 33.634 -59.115 4.937   1.00 27.02  ? 589  ALA A C   1 
ATOM   1106 O  O   . ALA A 1 217 ? 34.348 -58.534 4.112   1.00 26.71  ? 589  ALA A O   1 
ATOM   1107 C  CB  . ALA A 1 217 ? 31.638 -57.959 5.977   1.00 26.06  ? 589  ALA A CB  1 
ATOM   1108 N  N   . ASP A 1 218 ? 34.111 -59.913 5.894   1.00 28.28  ? 590  ASP A N   1 
ATOM   1109 C  CA  . ASP A 1 218 ? 35.537 -60.204 6.076   1.00 30.02  ? 590  ASP A CA  1 
ATOM   1110 C  C   . ASP A 1 218 ? 36.088 -60.968 4.856   1.00 30.21  ? 590  ASP A C   1 
ATOM   1111 O  O   . ASP A 1 218 ? 37.112 -60.598 4.290   1.00 30.05  ? 590  ASP A O   1 
ATOM   1112 C  CB  . ASP A 1 218 ? 35.739 -60.992 7.370   1.00 31.47  ? 590  ASP A CB  1 
ATOM   1113 C  CG  . ASP A 1 218 ? 37.169 -60.947 7.876   1.00 35.51  ? 590  ASP A CG  1 
ATOM   1114 O  OD1 . ASP A 1 218 ? 38.061 -60.395 7.187   1.00 38.81  ? 590  ASP A OD1 1 
ATOM   1115 O  OD2 . ASP A 1 218 ? 37.410 -61.471 8.981   1.00 37.34  ? 590  ASP A OD2 1 
ATOM   1116 N  N   . ALA A 1 219 ? 35.369 -61.996 4.416   1.00 30.07  ? 591  ALA A N   1 
ATOM   1117 C  CA  . ALA A 1 219 ? 35.780 -62.736 3.222   1.00 30.14  ? 591  ALA A CA  1 
ATOM   1118 C  C   . ALA A 1 219 ? 35.862 -61.839 1.990   1.00 29.42  ? 591  ALA A C   1 
ATOM   1119 O  O   . ALA A 1 219 ? 36.833 -61.914 1.240   1.00 30.52  ? 591  ALA A O   1 
ATOM   1120 C  CB  . ALA A 1 219 ? 34.857 -63.926 2.975   1.00 29.06  ? 591  ALA A CB  1 
ATOM   1121 N  N   . LEU A 1 220 ? 34.855 -60.988 1.784   1.00 28.74  ? 592  LEU A N   1 
ATOM   1122 C  CA  . LEU A 1 220 ? 34.825 -60.072 0.614   1.00 27.92  ? 592  LEU A CA  1 
ATOM   1123 C  C   . LEU A 1 220 ? 35.952 -59.065 0.624   1.00 28.03  ? 592  LEU A C   1 
ATOM   1124 O  O   . LEU A 1 220 ? 36.602 -58.860 -0.399  1.00 27.31  ? 592  LEU A O   1 
ATOM   1125 C  CB  . LEU A 1 220 ? 33.487 -59.326 0.512   1.00 27.14  ? 592  LEU A CB  1 
ATOM   1126 C  CG  . LEU A 1 220 ? 32.391 -60.160 -0.148  1.00 27.51  ? 592  LEU A CG  1 
ATOM   1127 C  CD1 . LEU A 1 220 ? 31.072 -59.579 0.250   1.00 31.04  ? 592  LEU A CD1 1 
ATOM   1128 C  CD2 . LEU A 1 220 ? 32.531 -60.197 -1.678  1.00 27.44  ? 592  LEU A CD2 1 
ATOM   1129 N  N   . ALA A 1 221 ? 36.182 -58.444 1.785   1.00 28.13  ? 593  ALA A N   1 
ATOM   1130 C  CA  . ALA A 1 221 ? 37.342 -57.550 1.969   1.00 29.36  ? 593  ALA A CA  1 
ATOM   1131 C  C   . ALA A 1 221 ? 38.669 -58.248 1.616   1.00 30.88  ? 593  ALA A C   1 
ATOM   1132 O  O   . ALA A 1 221 ? 39.585 -57.609 1.104   1.00 32.15  ? 593  ALA A O   1 
ATOM   1133 C  CB  . ALA A 1 221 ? 37.395 -57.013 3.389   1.00 29.35  ? 593  ALA A CB  1 
ATOM   1134 N  N   . HIS A 1 222 ? 38.764 -59.555 1.868   1.00 31.06  ? 594  HIS A N   1 
ATOM   1135 C  CA  . HIS A 1 222 ? 39.969 -60.323 1.504   1.00 32.54  ? 594  HIS A CA  1 
ATOM   1136 C  C   . HIS A 1 222 ? 39.969 -60.880 0.088   1.00 33.37  ? 594  HIS A C   1 
ATOM   1137 O  O   . HIS A 1 222 ? 40.736 -61.787 -0.211  1.00 35.42  ? 594  HIS A O   1 
ATOM   1138 C  CB  . HIS A 1 222 ? 40.224 -61.431 2.520   1.00 32.73  ? 594  HIS A CB  1 
ATOM   1139 C  CG  . HIS A 1 222 ? 40.570 -60.912 3.873   1.00 32.18  ? 594  HIS A CG  1 
ATOM   1140 N  ND1 . HIS A 1 222 ? 41.873 -60.782 4.308   1.00 33.99  ? 594  HIS A ND1 1 
ATOM   1141 C  CD2 . HIS A 1 222 ? 39.788 -60.427 4.866   1.00 30.43  ? 594  HIS A CD2 1 
ATOM   1142 C  CE1 . HIS A 1 222 ? 41.873 -60.279 5.533   1.00 34.24  ? 594  HIS A CE1 1 
ATOM   1143 N  NE2 . HIS A 1 222 ? 40.620 -60.056 5.894   1.00 32.74  ? 594  HIS A NE2 1 
ATOM   1144 N  N   . GLY A 1 223 ? 39.108 -60.349 -0.780  1.00 32.86  ? 595  GLY A N   1 
ATOM   1145 C  CA  . GLY A 1 223 ? 39.154 -60.669 -2.203  1.00 32.83  ? 595  GLY A CA  1 
ATOM   1146 C  C   . GLY A 1 223 ? 38.260 -61.819 -2.631  1.00 33.38  ? 595  GLY A C   1 
ATOM   1147 O  O   . GLY A 1 223 ? 38.323 -62.247 -3.786  1.00 33.40  ? 595  GLY A O   1 
ATOM   1148 N  N   . ALA A 1 224 ? 37.433 -62.338 -1.719  1.00 32.68  ? 596  ALA A N   1 
ATOM   1149 C  CA  . ALA A 1 224 ? 36.476 -63.398 -2.092  1.00 32.60  ? 596  ALA A CA  1 
ATOM   1150 C  C   . ALA A 1 224 ? 35.665 -62.981 -3.322  1.00 32.45  ? 596  ALA A C   1 
ATOM   1151 O  O   . ALA A 1 224 ? 35.135 -61.868 -3.381  1.00 32.17  ? 596  ALA A O   1 
ATOM   1152 C  CB  . ALA A 1 224 ? 35.556 -63.731 -0.938  1.00 30.82  ? 596  ALA A CB  1 
ATOM   1153 N  N   . ASP A 1 225 ? 35.611 -63.865 -4.315  1.00 33.29  ? 597  ASP A N   1 
ATOM   1154 C  CA  . ASP A 1 225 ? 34.765 -63.690 -5.496  1.00 33.16  ? 597  ASP A CA  1 
ATOM   1155 C  C   . ASP A 1 225 ? 33.318 -63.827 -5.033  1.00 31.37  ? 597  ASP A C   1 
ATOM   1156 O  O   . ASP A 1 225 ? 32.943 -64.825 -4.423  1.00 31.38  ? 597  ASP A O   1 
ATOM   1157 C  CB  . ASP A 1 225 ? 35.125 -64.756 -6.543  1.00 34.74  ? 597  ASP A CB  1 
ATOM   1158 C  CG  . ASP A 1 225 ? 34.351 -64.620 -7.862  1.00 37.12  ? 597  ASP A CG  1 
ATOM   1159 O  OD1 . ASP A 1 225 ? 33.312 -63.929 -7.936  1.00 38.11  ? 597  ASP A OD1 1 
ATOM   1160 O  OD2 . ASP A 1 225 ? 34.786 -65.255 -8.852  1.00 41.79  ? 597  ASP A OD2 1 
ATOM   1161 N  N   . VAL A 1 226 ? 32.521 -62.795 -5.290  1.00 30.51  ? 598  VAL A N   1 
ATOM   1162 C  CA  . VAL A 1 226 ? 31.117 -62.769 -4.860  1.00 29.34  ? 598  VAL A CA  1 
ATOM   1163 C  C   . VAL A 1 226 ? 30.313 -63.851 -5.626  1.00 29.32  ? 598  VAL A C   1 
ATOM   1164 O  O   . VAL A 1 226 ? 29.302 -64.338 -5.136  1.00 28.12  ? 598  VAL A O   1 
ATOM   1165 C  CB  . VAL A 1 226 ? 30.494 -61.327 -5.000  1.00 28.68  ? 598  VAL A CB  1 
ATOM   1166 C  CG1 . VAL A 1 226 ? 30.392 -60.897 -6.459  1.00 27.88  ? 598  VAL A CG1 1 
ATOM   1167 C  CG2 . VAL A 1 226 ? 29.151 -61.241 -4.318  1.00 27.34  ? 598  VAL A CG2 1 
ATOM   1168 N  N   . ASN A 1 227 ? 30.828 -64.231 -6.794  1.00 29.99  ? 599  ASN A N   1 
ATOM   1169 C  CA  . ASN A 1 227 ? 30.258 -65.273 -7.651  1.00 30.75  ? 599  ASN A CA  1 
ATOM   1170 C  C   . ASN A 1 227 ? 31.047 -66.576 -7.631  1.00 31.79  ? 599  ASN A C   1 
ATOM   1171 O  O   . ASN A 1 227 ? 31.073 -67.317 -8.634  1.00 32.18  ? 599  ASN A O   1 
ATOM   1172 C  CB  . ASN A 1 227 ? 30.152 -64.768 -9.093  1.00 30.91  ? 599  ASN A CB  1 
ATOM   1173 C  CG  . ASN A 1 227 ? 29.223 -63.577 -9.223  1.00 31.87  ? 599  ASN A CG  1 
ATOM   1174 O  OD1 . ASN A 1 227 ? 29.536 -62.611 -9.913  1.00 35.94  ? 599  ASN A OD1 1 
ATOM   1175 N  ND2 . ASN A 1 227 ? 28.083 -63.634 -8.560  1.00 29.19  ? 599  ASN A ND2 1 
ATOM   1176 N  N   . TRP A 1 228 ? 31.670 -66.859 -6.484  1.00 31.74  ? 600  TRP A N   1 
ATOM   1177 C  CA  . TRP A 1 228 ? 32.477 -68.069 -6.305  1.00 33.46  ? 600  TRP A CA  1 
ATOM   1178 C  C   . TRP A 1 228 ? 31.689 -69.338 -6.608  1.00 34.10  ? 600  TRP A C   1 
ATOM   1179 O  O   . TRP A 1 228 ? 30.591 -69.519 -6.119  1.00 33.59  ? 600  TRP A O   1 
ATOM   1180 C  CB  . TRP A 1 228 ? 33.010 -68.133 -4.878  1.00 33.24  ? 600  TRP A CB  1 
ATOM   1181 C  CG  . TRP A 1 228 ? 34.072 -69.164 -4.649  1.00 35.02  ? 600  TRP A CG  1 
ATOM   1182 C  CD1 . TRP A 1 228 ? 35.402 -69.050 -4.960  1.00 36.13  ? 600  TRP A CD1 1 
ATOM   1183 C  CD2 . TRP A 1 228 ? 33.923 -70.440 -4.004  1.00 36.10  ? 600  TRP A CD2 1 
ATOM   1184 N  NE1 . TRP A 1 228 ? 36.077 -70.167 -4.566  1.00 36.56  ? 600  TRP A NE1 1 
ATOM   1185 C  CE2 . TRP A 1 228 ? 35.204 -71.040 -3.973  1.00 37.18  ? 600  TRP A CE2 1 
ATOM   1186 C  CE3 . TRP A 1 228 ? 32.837 -71.133 -3.444  1.00 36.14  ? 600  TRP A CE3 1 
ATOM   1187 C  CZ2 . TRP A 1 228 ? 35.428 -72.309 -3.421  1.00 37.43  ? 600  TRP A CZ2 1 
ATOM   1188 C  CZ3 . TRP A 1 228 ? 33.069 -72.395 -2.884  1.00 36.45  ? 600  TRP A CZ3 1 
ATOM   1189 C  CH2 . TRP A 1 228 ? 34.353 -72.964 -2.881  1.00 37.13  ? 600  TRP A CH2 1 
ATOM   1190 N  N   . VAL A 1 229 ? 32.273 -70.218 -7.405  1.00 36.19  ? 601  VAL A N   1 
ATOM   1191 C  CA  . VAL A 1 229 ? 31.625 -71.445 -7.823  1.00 37.09  ? 601  VAL A CA  1 
ATOM   1192 C  C   . VAL A 1 229 ? 32.169 -72.582 -6.963  1.00 38.92  ? 601  VAL A C   1 
ATOM   1193 O  O   . VAL A 1 229 ? 33.362 -72.768 -6.888  1.00 39.75  ? 601  VAL A O   1 
ATOM   1194 C  CB  . VAL A 1 229 ? 31.907 -71.699 -9.313  1.00 38.33  ? 601  VAL A CB  1 
ATOM   1195 C  CG1 . VAL A 1 229 ? 31.337 -73.047 -9.766  1.00 39.41  ? 601  VAL A CG1 1 
ATOM   1196 C  CG2 . VAL A 1 229 ? 31.341 -70.563 -10.144 1.00 36.36  ? 601  VAL A CG2 1 
ATOM   1197 N  N   . ASN A 1 230 ? 31.288 -73.325 -6.301  1.00 39.81  ? 602  ASN A N   1 
ATOM   1198 C  CA  . ASN A 1 230 ? 31.710 -74.436 -5.453  1.00 42.85  ? 602  ASN A CA  1 
ATOM   1199 C  C   . ASN A 1 230 ? 32.013 -75.676 -6.303  1.00 45.98  ? 602  ASN A C   1 
ATOM   1200 O  O   . ASN A 1 230 ? 31.203 -76.602 -6.406  1.00 46.51  ? 602  ASN A O   1 
ATOM   1201 C  CB  . ASN A 1 230 ? 30.651 -74.718 -4.391  1.00 42.14  ? 602  ASN A CB  1 
ATOM   1202 C  CG  . ASN A 1 230 ? 31.016 -75.875 -3.494  1.00 45.43  ? 602  ASN A CG  1 
ATOM   1203 O  OD1 . ASN A 1 230 ? 32.175 -76.049 -3.117  1.00 46.68  ? 602  ASN A OD1 1 
ATOM   1204 N  ND2 . ASN A 1 230 ? 30.018 -76.692 -3.153  1.00 47.77  ? 602  ASN A ND2 1 
ATOM   1205 N  N   . GLY A 1 231 ? 33.194 -75.664 -6.914  1.00 48.55  ? 603  GLY A N   1 
ATOM   1206 C  CA  . GLY A 1 231 ? 33.553 -76.609 -7.964  1.00 52.73  ? 603  GLY A CA  1 
ATOM   1207 C  C   . GLY A 1 231 ? 33.760 -78.034 -7.493  1.00 56.16  ? 603  GLY A C   1 
ATOM   1208 O  O   . GLY A 1 231 ? 33.950 -78.297 -6.303  1.00 56.56  ? 603  GLY A O   1 
ATOM   1209 N  N   . GLY A 1 232 ? 33.713 -78.959 -8.442  1.00 59.35  ? 604  GLY A N   1 
ATOM   1210 C  CA  . GLY A 1 232 ? 33.840 -80.389 -8.146  1.00 63.19  ? 604  GLY A CA  1 
ATOM   1211 C  C   . GLY A 1 232 ? 32.624 -80.901 -7.388  1.00 62.56  ? 604  GLY A C   1 
ATOM   1212 O  O   . GLY A 1 232 ? 32.271 -82.084 -7.504  1.00 64.66  ? 604  GLY A O   1 
ATOM   1213 N  N   . GLN A 1 233 ? 32.000 -80.010 -6.609  1.00 59.83  ? 605  GLN A N   1 
ATOM   1214 C  CA  . GLN A 1 233 ? 30.772 -80.324 -5.871  1.00 59.16  ? 605  GLN A CA  1 
ATOM   1215 C  C   . GLN A 1 233 ? 29.495 -80.099 -6.703  1.00 57.01  ? 605  GLN A C   1 
ATOM   1216 O  O   . GLN A 1 233 ? 29.247 -80.863 -7.635  1.00 58.54  ? 605  GLN A O   1 
ATOM   1217 C  CB  . GLN A 1 233 ? 30.731 -79.585 -4.531  1.00 57.77  ? 605  GLN A CB  1 
ATOM   1218 C  CG  . GLN A 1 233 ? 31.478 -80.306 -3.418  1.00 61.96  ? 605  GLN A CG  1 
ATOM   1219 C  CD  . GLN A 1 233 ? 30.996 -79.883 -2.030  1.00 64.72  ? 605  GLN A CD  1 
ATOM   1220 O  OE1 . GLN A 1 233 ? 29.809 -80.018 -1.695  1.00 63.90  ? 605  GLN A OE1 1 
ATOM   1221 N  NE2 . GLN A 1 233 ? 31.923 -79.369 -1.213  1.00 66.07  ? 605  GLN A NE2 1 
ATOM   1222 N  N   . ASP A 1 234 ? 28.700 -79.070 -6.374  1.00 53.61  ? 606  ASP A N   1 
ATOM   1223 C  CA  . ASP A 1 234 ? 27.425 -78.787 -7.058  1.00 51.31  ? 606  ASP A CA  1 
ATOM   1224 C  C   . ASP A 1 234 ? 27.482 -77.552 -7.961  1.00 48.57  ? 606  ASP A C   1 
ATOM   1225 O  O   . ASP A 1 234 ? 26.490 -77.192 -8.593  1.00 47.14  ? 606  ASP A O   1 
ATOM   1226 C  CB  . ASP A 1 234 ? 26.300 -78.616 -6.025  1.00 50.73  ? 606  ASP A CB  1 
ATOM   1227 C  CG  . ASP A 1 234 ? 26.688 -77.673 -4.867  1.00 52.30  ? 606  ASP A CG  1 
ATOM   1228 O  OD1 . ASP A 1 234 ? 27.828 -77.155 -4.839  1.00 54.73  ? 606  ASP A OD1 1 
ATOM   1229 O  OD2 . ASP A 1 234 ? 25.844 -77.438 -3.971  1.00 54.89  ? 606  ASP A OD2 1 
ATOM   1230 N  N   . ASN A 1 235 ? 28.650 -76.910 -8.002  1.00 47.59  ? 607  ASN A N   1 
ATOM   1231 C  CA  . ASN A 1 235 ? 28.863 -75.615 -8.670  1.00 44.97  ? 607  ASN A CA  1 
ATOM   1232 C  C   . ASN A 1 235 ? 27.987 -74.478 -8.158  1.00 41.66  ? 607  ASN A C   1 
ATOM   1233 O  O   . ASN A 1 235 ? 27.721 -73.521 -8.884  1.00 40.64  ? 607  ASN A O   1 
ATOM   1234 C  CB  . ASN A 1 235 ? 28.770 -75.735 -10.199 1.00 45.71  ? 607  ASN A CB  1 
ATOM   1235 C  CG  . ASN A 1 235 ? 30.085 -76.184 -10.837 1.00 49.01  ? 607  ASN A CG  1 
ATOM   1236 O  OD1 . ASN A 1 235 ? 31.078 -76.439 -10.146 1.00 49.32  ? 607  ASN A OD1 1 
ATOM   1237 N  ND2 . ASN A 1 235 ? 30.095 -76.275 -12.163 1.00 49.93  ? 607  ASN A ND2 1 
ATOM   1238 N  N   . ALA A 1 236 ? 27.546 -74.586 -6.906  1.00 39.87  ? 608  ALA A N   1 
ATOM   1239 C  CA  . ALA A 1 236 ? 26.689 -73.565 -6.306  1.00 36.91  ? 608  ALA A CA  1 
ATOM   1240 C  C   . ALA A 1 236 ? 27.501 -72.309 -5.918  1.00 35.74  ? 608  ALA A C   1 
ATOM   1241 O  O   . ALA A 1 236 ? 28.736 -72.355 -5.765  1.00 36.09  ? 608  ALA A O   1 
ATOM   1242 C  CB  . ALA A 1 236 ? 25.923 -74.135 -5.099  1.00 36.46  ? 608  ALA A CB  1 
ATOM   1243 N  N   . THR A 1 237 ? 26.786 -71.198 -5.764  1.00 33.11  ? 609  THR A N   1 
ATOM   1244 C  CA  . THR A 1 237 ? 27.377 -69.901 -5.479  1.00 31.38  ? 609  THR A CA  1 
ATOM   1245 C  C   . THR A 1 237 ? 26.951 -69.466 -4.083  1.00 30.20  ? 609  THR A C   1 
ATOM   1246 O  O   . THR A 1 237 ? 26.073 -70.095 -3.496  1.00 30.66  ? 609  THR A O   1 
ATOM   1247 C  CB  . THR A 1 237 ? 26.874 -68.874 -6.477  1.00 30.62  ? 609  THR A CB  1 
ATOM   1248 O  OG1 . THR A 1 237 ? 25.435 -68.804 -6.399  1.00 29.98  ? 609  THR A OG1 1 
ATOM   1249 C  CG2 . THR A 1 237 ? 27.297 -69.268 -7.881  1.00 31.38  ? 609  THR A CG2 1 
ATOM   1250 N  N   . PRO A 1 238 ? 27.578 -68.409 -3.536  1.00 28.90  ? 610  PRO A N   1 
ATOM   1251 C  CA  . PRO A 1 238 ? 27.108 -67.868 -2.247  1.00 27.60  ? 610  PRO A CA  1 
ATOM   1252 C  C   . PRO A 1 238 ? 25.629 -67.412 -2.270  1.00 25.91  ? 610  PRO A C   1 
ATOM   1253 O  O   . PRO A 1 238 ? 24.889 -67.640 -1.321  1.00 25.07  ? 610  PRO A O   1 
ATOM   1254 C  CB  . PRO A 1 238 ? 28.063 -66.690 -1.983  1.00 27.54  ? 610  PRO A CB  1 
ATOM   1255 C  CG  . PRO A 1 238 ? 29.337 -67.069 -2.729  1.00 28.46  ? 610  PRO A CG  1 
ATOM   1256 C  CD  . PRO A 1 238 ? 28.875 -67.835 -3.957  1.00 28.99  ? 610  PRO A CD  1 
ATOM   1257 N  N   . LEU A 1 239 ? 25.209 -66.789 -3.356  1.00 25.42  ? 611  LEU A N   1 
ATOM   1258 C  CA  . LEU A 1 239 ? 23.806 -66.394 -3.531  1.00 25.43  ? 611  LEU A CA  1 
ATOM   1259 C  C   . LEU A 1 239 ? 22.849 -67.600 -3.432  1.00 26.02  ? 611  LEU A C   1 
ATOM   1260 O  O   . LEU A 1 239 ? 21.795 -67.531 -2.764  1.00 25.80  ? 611  LEU A O   1 
ATOM   1261 C  CB  . LEU A 1 239 ? 23.612 -65.642 -4.862  1.00 24.71  ? 611  LEU A CB  1 
ATOM   1262 C  CG  . LEU A 1 239 ? 22.273 -64.910 -4.985  1.00 26.11  ? 611  LEU A CG  1 
ATOM   1263 C  CD1 . LEU A 1 239 ? 21.947 -64.095 -3.717  1.00 24.40  ? 611  LEU A CD1 1 
ATOM   1264 C  CD2 . LEU A 1 239 ? 22.258 -64.018 -6.188  1.00 23.31  ? 611  LEU A CD2 1 
ATOM   1265 N  N   . ILE A 1 240 ? 23.228 -68.704 -4.088  1.00 26.26  ? 612  ILE A N   1 
ATOM   1266 C  CA  . ILE A 1 240 ? 22.447 -69.937 -4.019  1.00 26.08  ? 612  ILE A CA  1 
ATOM   1267 C  C   . ILE A 1 240 ? 22.437 -70.474 -2.583  1.00 26.86  ? 612  ILE A C   1 
ATOM   1268 O  O   . ILE A 1 240 ? 21.400 -70.949 -2.095  1.00 27.71  ? 612  ILE A O   1 
ATOM   1269 C  CB  . ILE A 1 240 ? 22.938 -70.977 -5.051  1.00 26.30  ? 612  ILE A CB  1 
ATOM   1270 C  CG1 . ILE A 1 240 ? 22.451 -70.565 -6.432  1.00 25.45  ? 612  ILE A CG1 1 
ATOM   1271 C  CG2 . ILE A 1 240 ? 22.475 -72.409 -4.706  1.00 26.15  ? 612  ILE A CG2 1 
ATOM   1272 C  CD1 . ILE A 1 240 ? 23.043 -71.394 -7.586  1.00 25.60  ? 612  ILE A CD1 1 
ATOM   1273 N  N   . GLN A 1 241 ? 23.562 -70.364 -1.893  1.00 26.95  ? 613  GLN A N   1 
ATOM   1274 C  CA  . GLN A 1 241 ? 23.609 -70.742 -0.480  1.00 28.75  ? 613  GLN A CA  1 
ATOM   1275 C  C   . GLN A 1 241 ? 22.723 -69.870 0.406   1.00 28.27  ? 613  GLN A C   1 
ATOM   1276 O  O   . GLN A 1 241 ? 22.116 -70.355 1.367   1.00 29.24  ? 613  GLN A O   1 
ATOM   1277 C  CB  . GLN A 1 241 ? 25.036 -70.656 0.046   1.00 29.86  ? 613  GLN A CB  1 
ATOM   1278 C  CG  . GLN A 1 241 ? 25.904 -71.789 -0.403  1.00 33.97  ? 613  GLN A CG  1 
ATOM   1279 C  CD  . GLN A 1 241 ? 25.593 -73.056 0.344   1.00 38.18  ? 613  GLN A CD  1 
ATOM   1280 O  OE1 . GLN A 1 241 ? 25.813 -73.147 1.551   1.00 41.15  ? 613  GLN A OE1 1 
ATOM   1281 N  NE2 . GLN A 1 241 ? 25.071 -74.044 -0.367  1.00 39.06  ? 613  GLN A NE2 1 
ATOM   1282 N  N   . ALA A 1 242 ? 22.692 -68.572 0.119   1.00 27.42  ? 614  ALA A N   1 
ATOM   1283 C  CA  . ALA A 1 242 ? 21.900 -67.658 0.922   1.00 28.10  ? 614  ALA A CA  1 
ATOM   1284 C  C   . ALA A 1 242 ? 20.416 -67.941 0.644   1.00 28.53  ? 614  ALA A C   1 
ATOM   1285 O  O   . ALA A 1 242 ? 19.568 -67.811 1.523   1.00 29.07  ? 614  ALA A O   1 
ATOM   1286 C  CB  . ALA A 1 242 ? 22.262 -66.228 0.600   1.00 27.15  ? 614  ALA A CB  1 
ATOM   1287 N  N   . THR A 1 243 ? 20.129 -68.346 -0.589  1.00 28.45  ? 615  THR A N   1 
ATOM   1288 C  CA  . THR A 1 243 ? 18.786 -68.740 -0.974  1.00 28.95  ? 615  THR A CA  1 
ATOM   1289 C  C   . THR A 1 243 ? 18.344 -70.000 -0.243  1.00 30.87  ? 615  THR A C   1 
ATOM   1290 O  O   . THR A 1 243 ? 17.235 -70.032 0.298   1.00 31.81  ? 615  THR A O   1 
ATOM   1291 C  CB  . THR A 1 243 ? 18.672 -68.919 -2.483  1.00 28.16  ? 615  THR A CB  1 
ATOM   1292 O  OG1 . THR A 1 243 ? 19.096 -67.703 -3.112  1.00 26.31  ? 615  THR A OG1 1 
ATOM   1293 C  CG2 . THR A 1 243 ? 17.234 -69.223 -2.893  1.00 27.01  ? 615  THR A CG2 1 
ATOM   1294 N  N   . ALA A 1 244 ? 19.214 -71.011 -0.191  1.00 31.65  ? 616  ALA A N   1 
ATOM   1295 C  CA  . ALA A 1 244 ? 18.904 -72.241 0.548   1.00 33.04  ? 616  ALA A CA  1 
ATOM   1296 C  C   . ALA A 1 244 ? 18.727 -71.944 2.041   1.00 33.99  ? 616  ALA A C   1 
ATOM   1297 O  O   . ALA A 1 244 ? 17.999 -72.637 2.736   1.00 35.59  ? 616  ALA A O   1 
ATOM   1298 C  CB  . ALA A 1 244 ? 19.983 -73.302 0.322   1.00 33.40  ? 616  ALA A CB  1 
ATOM   1299 N  N   . ALA A 1 245 ? 19.378 -70.889 2.521   1.00 33.93  ? 617  ALA A N   1 
ATOM   1300 C  CA  . ALA A 1 245 ? 19.269 -70.478 3.931   1.00 34.57  ? 617  ALA A CA  1 
ATOM   1301 C  C   . ALA A 1 245 ? 18.022 -69.630 4.212   1.00 34.77  ? 617  ALA A C   1 
ATOM   1302 O  O   . ALA A 1 245 ? 17.749 -69.291 5.362   1.00 35.64  ? 617  ALA A O   1 
ATOM   1303 C  CB  . ALA A 1 245 ? 20.515 -69.715 4.350   1.00 34.10  ? 617  ALA A CB  1 
ATOM   1304 N  N   . ASN A 1 246 ? 17.269 -69.285 3.166   1.00 33.98  ? 618  ASN A N   1 
ATOM   1305 C  CA  . ASN A 1 246 ? 16.136 -68.355 3.308   1.00 34.55  ? 618  ASN A CA  1 
ATOM   1306 C  C   . ASN A 1 246 ? 16.541 -67.019 3.949   1.00 34.40  ? 618  ASN A C   1 
ATOM   1307 O  O   . ASN A 1 246 ? 15.821 -66.484 4.784   1.00 34.96  ? 618  ASN A O   1 
ATOM   1308 C  CB  . ASN A 1 246 ? 14.961 -68.976 4.096   1.00 35.71  ? 618  ASN A CB  1 
ATOM   1309 C  CG  . ASN A 1 246 ? 13.642 -68.234 3.853   1.00 36.59  ? 618  ASN A CG  1 
ATOM   1310 O  OD1 . ASN A 1 246 ? 13.496 -67.514 2.856   1.00 38.25  ? 618  ASN A OD1 1 
ATOM   1311 N  ND2 . ASN A 1 246 ? 12.683 -68.410 4.748   1.00 37.09  ? 618  ASN A ND2 1 
ATOM   1312 N  N   . SER A 1 247 ? 17.694 -66.492 3.547   1.00 33.62  ? 619  SER A N   1 
ATOM   1313 C  CA  . SER A 1 247 ? 18.222 -65.286 4.160   1.00 34.16  ? 619  SER A CA  1 
ATOM   1314 C  C   . SER A 1 247 ? 18.135 -64.095 3.221   1.00 33.03  ? 619  SER A C   1 
ATOM   1315 O  O   . SER A 1 247 ? 18.983 -63.891 2.353   1.00 32.65  ? 619  SER A O   1 
ATOM   1316 C  CB  . SER A 1 247 ? 19.666 -65.492 4.629   1.00 34.46  ? 619  SER A CB  1 
ATOM   1317 O  OG  . SER A 1 247 ? 20.054 -64.451 5.522   1.00 35.92  ? 619  SER A OG  1 
ATOM   1318 N  N   . LEU A 1 248 ? 17.084 -63.320 3.407   1.00 33.97  ? 620  LEU A N   1 
ATOM   1319 C  CA  . LEU A 1 248 ? 16.914 -62.031 2.769   1.00 34.34  ? 620  LEU A CA  1 
ATOM   1320 C  C   . LEU A 1 248 ? 18.160 -61.143 2.930   1.00 33.26  ? 620  LEU A C   1 
ATOM   1321 O  O   . LEU A 1 248 ? 18.631 -60.577 1.962   1.00 32.49  ? 620  LEU A O   1 
ATOM   1322 C  CB  . LEU A 1 248 ? 15.686 -61.344 3.366   1.00 36.36  ? 620  LEU A CB  1 
ATOM   1323 C  CG  . LEU A 1 248 ? 15.015 -60.209 2.596   1.00 38.98  ? 620  LEU A CG  1 
ATOM   1324 C  CD1 . LEU A 1 248 ? 14.888 -60.526 1.104   1.00 39.08  ? 620  LEU A CD1 1 
ATOM   1325 C  CD2 . LEU A 1 248 ? 13.636 -59.918 3.229   1.00 42.90  ? 620  LEU A CD2 1 
ATOM   1326 N  N   . LEU A 1 249 ? 18.690 -61.058 4.149   1.00 33.63  ? 621  LEU A N   1 
ATOM   1327 C  CA  . LEU A 1 249 ? 19.841 -60.206 4.466   1.00 33.27  ? 621  LEU A CA  1 
ATOM   1328 C  C   . LEU A 1 249 ? 21.110 -60.593 3.687   1.00 31.31  ? 621  LEU A C   1 
ATOM   1329 O  O   . LEU A 1 249 ? 21.753 -59.737 3.049   1.00 30.43  ? 621  LEU A O   1 
ATOM   1330 C  CB  . LEU A 1 249 ? 20.109 -60.217 5.974   1.00 34.34  ? 621  LEU A CB  1 
ATOM   1331 C  CG  . LEU A 1 249 ? 19.421 -59.177 6.857   1.00 37.91  ? 621  LEU A CG  1 
ATOM   1332 C  CD1 . LEU A 1 249 ? 18.000 -58.839 6.398   1.00 39.16  ? 621  LEU A CD1 1 
ATOM   1333 C  CD2 . LEU A 1 249 ? 19.436 -59.626 8.337   1.00 40.34  ? 621  LEU A CD2 1 
ATOM   1334 N  N   . ALA A 1 250 ? 21.451 -61.879 3.723   1.00 30.31  ? 622  ALA A N   1 
ATOM   1335 C  CA  . ALA A 1 250 ? 22.621 -62.368 3.014   1.00 29.13  ? 622  ALA A CA  1 
ATOM   1336 C  C   . ALA A 1 250 ? 22.440 -62.235 1.521   1.00 28.32  ? 622  ALA A C   1 
ATOM   1337 O  O   . ALA A 1 250 ? 23.390 -61.873 0.823   1.00 28.45  ? 622  ALA A O   1 
ATOM   1338 C  CB  . ALA A 1 250 ? 22.944 -63.812 3.404   1.00 29.73  ? 622  ALA A CB  1 
ATOM   1339 N  N   . CYS A 1 251 ? 21.239 -62.503 1.015   1.00 27.93  ? 623  CYS A N   1 
ATOM   1340 C  CA  . CYS A 1 251 ? 20.991 -62.281 -0.408  1.00 28.67  ? 623  CYS A CA  1 
ATOM   1341 C  C   . CYS A 1 251 ? 21.214 -60.824 -0.787  1.00 28.62  ? 623  CYS A C   1 
ATOM   1342 O  O   . CYS A 1 251 ? 21.908 -60.547 -1.760  1.00 28.36  ? 623  CYS A O   1 
ATOM   1343 C  CB  . CYS A 1 251 ? 19.584 -62.709 -0.821  1.00 28.94  ? 623  CYS A CB  1 
ATOM   1344 S  SG  . CYS A 1 251 ? 19.440 -64.461 -0.945  1.00 32.48  ? 623  CYS A SG  1 
ATOM   1345 N  N   . GLU A 1 252 ? 20.605 -59.917 -0.018  1.00 28.82  ? 624  GLU A N   1 
ATOM   1346 C  CA  . GLU A 1 252 ? 20.718 -58.474 -0.228  1.00 29.95  ? 624  GLU A CA  1 
ATOM   1347 C  C   . GLU A 1 252 ? 22.177 -58.029 -0.194  1.00 28.77  ? 624  GLU A C   1 
ATOM   1348 O  O   . GLU A 1 252 ? 22.641 -57.334 -1.097  1.00 28.93  ? 624  GLU A O   1 
ATOM   1349 C  CB  . GLU A 1 252 ? 19.913 -57.724 0.850   1.00 31.64  ? 624  GLU A CB  1 
ATOM   1350 C  CG  . GLU A 1 252 ? 19.954 -56.188 0.763   1.00 36.17  ? 624  GLU A CG  1 
ATOM   1351 C  CD  . GLU A 1 252 ? 19.342 -55.611 -0.533  1.00 40.81  ? 624  GLU A CD  1 
ATOM   1352 O  OE1 . GLU A 1 252 ? 18.669 -56.346 -1.290  1.00 42.61  ? 624  GLU A OE1 1 
ATOM   1353 O  OE2 . GLU A 1 252 ? 19.545 -54.405 -0.796  1.00 43.50  ? 624  GLU A OE2 1 
ATOM   1354 N  N   . PHE A 1 253 ? 22.893 -58.466 0.834   1.00 27.79  ? 625  PHE A N   1 
ATOM   1355 C  CA  . PHE A 1 253 ? 24.329 -58.200 0.959   1.00 27.43  ? 625  PHE A CA  1 
ATOM   1356 C  C   . PHE A 1 253 ? 25.135 -58.613 -0.266  1.00 26.06  ? 625  PHE A C   1 
ATOM   1357 O  O   . PHE A 1 253 ? 25.893 -57.800 -0.803  1.00 26.46  ? 625  PHE A O   1 
ATOM   1358 C  CB  . PHE A 1 253 ? 24.904 -58.865 2.221   1.00 27.73  ? 625  PHE A CB  1 
ATOM   1359 C  CG  . PHE A 1 253 ? 26.279 -58.380 2.582   1.00 28.53  ? 625  PHE A CG  1 
ATOM   1360 C  CD1 . PHE A 1 253 ? 26.560 -57.015 2.622   1.00 27.71  ? 625  PHE A CD1 1 
ATOM   1361 C  CD2 . PHE A 1 253 ? 27.287 -59.279 2.894   1.00 28.23  ? 625  PHE A CD2 1 
ATOM   1362 C  CE1 . PHE A 1 253 ? 27.823 -56.546 2.949   1.00 28.54  ? 625  PHE A CE1 1 
ATOM   1363 C  CE2 . PHE A 1 253 ? 28.557 -58.821 3.230   1.00 31.93  ? 625  PHE A CE2 1 
ATOM   1364 C  CZ  . PHE A 1 253 ? 28.828 -57.445 3.257   1.00 29.54  ? 625  PHE A CZ  1 
ATOM   1365 N  N   . LEU A 1 254 ? 24.938 -59.850 -0.735  1.00 25.11  ? 626  LEU A N   1 
ATOM   1366 C  CA  . LEU A 1 254 ? 25.633 -60.338 -1.937  1.00 23.83  ? 626  LEU A CA  1 
ATOM   1367 C  C   . LEU A 1 254 ? 25.282 -59.547 -3.171  1.00 24.52  ? 626  LEU A C   1 
ATOM   1368 O  O   . LEU A 1 254 ? 26.150 -59.248 -4.006  1.00 24.93  ? 626  LEU A O   1 
ATOM   1369 C  CB  . LEU A 1 254 ? 25.365 -61.826 -2.170  1.00 23.22  ? 626  LEU A CB  1 
ATOM   1370 C  CG  . LEU A 1 254 ? 25.935 -62.755 -1.083  1.00 22.32  ? 626  LEU A CG  1 
ATOM   1371 C  CD1 . LEU A 1 254 ? 25.228 -64.159 -1.035  1.00 17.65  ? 626  LEU A CD1 1 
ATOM   1372 C  CD2 . LEU A 1 254 ? 27.470 -62.874 -1.193  1.00 21.84  ? 626  LEU A CD2 1 
ATOM   1373 N  N   . LEU A 1 255 ? 24.011 -59.185 -3.299  1.00 24.86  ? 627  LEU A N   1 
ATOM   1374 C  CA  . LEU A 1 255 ? 23.574 -58.419 -4.479  1.00 25.62  ? 627  LEU A CA  1 
ATOM   1375 C  C   . LEU A 1 255 ? 24.138 -56.999 -4.503  1.00 26.46  ? 627  LEU A C   1 
ATOM   1376 O  O   . LEU A 1 255 ? 24.524 -56.496 -5.563  1.00 27.16  ? 627  LEU A O   1 
ATOM   1377 C  CB  . LEU A 1 255 ? 22.048 -58.398 -4.580  1.00 25.70  ? 627  LEU A CB  1 
ATOM   1378 C  CG  . LEU A 1 255 ? 21.443 -59.725 -5.032  1.00 25.98  ? 627  LEU A CG  1 
ATOM   1379 C  CD1 . LEU A 1 255 ? 20.008 -59.820 -4.558  1.00 27.70  ? 627  LEU A CD1 1 
ATOM   1380 C  CD2 . LEU A 1 255 ? 21.550 -59.884 -6.562  1.00 26.24  ? 627  LEU A CD2 1 
ATOM   1381 N  N   . GLN A 1 256 ? 24.194 -56.362 -3.337  1.00 26.55  ? 628  GLN A N   1 
ATOM   1382 C  CA  . GLN A 1 256 ? 24.794 -55.038 -3.215  1.00 27.54  ? 628  GLN A CA  1 
ATOM   1383 C  C   . GLN A 1 256 ? 26.275 -55.111 -3.600  1.00 27.95  ? 628  GLN A C   1 
ATOM   1384 O  O   . GLN A 1 256 ? 26.859 -54.138 -4.085  1.00 29.21  ? 628  GLN A O   1 
ATOM   1385 C  CB  . GLN A 1 256 ? 24.651 -54.496 -1.777  1.00 27.54  ? 628  GLN A CB  1 
ATOM   1386 C  CG  . GLN A 1 256 ? 23.239 -54.110 -1.367  1.00 27.98  ? 628  GLN A CG  1 
ATOM   1387 C  CD  . GLN A 1 256 ? 22.626 -53.037 -2.272  1.00 31.54  ? 628  GLN A CD  1 
ATOM   1388 O  OE1 . GLN A 1 256 ? 23.326 -52.307 -2.963  1.00 33.39  ? 628  GLN A OE1 1 
ATOM   1389 N  NE2 . GLN A 1 256 ? 21.309 -52.951 -2.270  1.00 33.21  ? 628  GLN A NE2 1 
ATOM   1390 N  N   . ASN A 1 257 ? 26.875 -56.274 -3.381  1.00 27.45  ? 629  ASN A N   1 
ATOM   1391 C  CA  . ASN A 1 257 ? 28.301 -56.463 -3.655  1.00 27.42  ? 629  ASN A CA  1 
ATOM   1392 C  C   . ASN A 1 257 ? 28.574 -57.169 -4.984  1.00 27.61  ? 629  ASN A C   1 
ATOM   1393 O  O   . ASN A 1 257 ? 29.648 -57.748 -5.176  1.00 28.81  ? 629  ASN A O   1 
ATOM   1394 C  CB  . ASN A 1 257 ? 28.961 -57.168 -2.470  1.00 26.20  ? 629  ASN A CB  1 
ATOM   1395 C  CG  . ASN A 1 257 ? 29.218 -56.219 -1.299  1.00 26.74  ? 629  ASN A CG  1 
ATOM   1396 O  OD1 . ASN A 1 257 ? 30.200 -55.482 -1.309  1.00 27.93  ? 629  ASN A OD1 1 
ATOM   1397 N  ND2 . ASN A 1 257 ? 28.347 -56.235 -0.290  1.00 21.38  ? 629  ASN A ND2 1 
ATOM   1398 N  N   . GLY A 1 258 ? 27.607 -57.137 -5.900  1.00 27.59  ? 630  GLY A N   1 
ATOM   1399 C  CA  . GLY A 1 258 ? 27.868 -57.509 -7.303  1.00 27.79  ? 630  GLY A CA  1 
ATOM   1400 C  C   . GLY A 1 258 ? 27.526 -58.927 -7.760  1.00 28.13  ? 630  GLY A C   1 
ATOM   1401 O  O   . GLY A 1 258 ? 27.811 -59.304 -8.905  1.00 28.50  ? 630  GLY A O   1 
ATOM   1402 N  N   . ALA A 1 259 ? 26.901 -59.712 -6.882  1.00 27.60  ? 631  ALA A N   1 
ATOM   1403 C  CA  . ALA A 1 259 ? 26.454 -61.055 -7.236  1.00 27.35  ? 631  ALA A CA  1 
ATOM   1404 C  C   . ALA A 1 259 ? 25.555 -61.036 -8.453  1.00 27.92  ? 631  ALA A C   1 
ATOM   1405 O  O   . ALA A 1 259 ? 24.679 -60.183 -8.579  1.00 27.69  ? 631  ALA A O   1 
ATOM   1406 C  CB  . ALA A 1 259 ? 25.748 -61.735 -6.057  1.00 26.50  ? 631  ALA A CB  1 
ATOM   1407 N  N   . ASN A 1 260 ? 25.815 -61.972 -9.362  1.00 28.94  ? 632  ASN A N   1 
ATOM   1408 C  CA  . ASN A 1 260 ? 25.048 -62.134 -10.581 1.00 30.29  ? 632  ASN A CA  1 
ATOM   1409 C  C   . ASN A 1 260 ? 23.799 -62.935 -10.217 1.00 29.76  ? 632  ASN A C   1 
ATOM   1410 O  O   . ASN A 1 260 ? 23.871 -64.112 -9.879  1.00 30.15  ? 632  ASN A O   1 
ATOM   1411 C  CB  . ASN A 1 260 ? 25.899 -62.857 -11.630 1.00 30.81  ? 632  ASN A CB  1 
ATOM   1412 C  CG  . ASN A 1 260 ? 25.163 -63.120 -12.934 1.00 33.23  ? 632  ASN A CG  1 
ATOM   1413 O  OD1 . ASN A 1 260 ? 23.958 -62.879 -13.070 1.00 35.60  ? 632  ASN A OD1 1 
ATOM   1414 N  ND2 . ASN A 1 260 ? 25.894 -63.635 -13.908 1.00 34.51  ? 632  ASN A ND2 1 
ATOM   1415 N  N   . VAL A 1 261 ? 22.658 -62.268 -10.289 1.00 29.98  ? 633  VAL A N   1 
ATOM   1416 C  CA  . VAL A 1 261 ? 21.378 -62.820 -9.890  1.00 29.47  ? 633  VAL A CA  1 
ATOM   1417 C  C   . VAL A 1 261 ? 20.955 -63.990 -10.783 1.00 30.20  ? 633  VAL A C   1 
ATOM   1418 O  O   . VAL A 1 261 ? 20.048 -64.754 -10.438 1.00 30.31  ? 633  VAL A O   1 
ATOM   1419 C  CB  . VAL A 1 261 ? 20.300 -61.701 -9.877  1.00 29.69  ? 633  VAL A CB  1 
ATOM   1420 C  CG1 . VAL A 1 261 ? 19.958 -61.224 -11.299 1.00 30.34  ? 633  VAL A CG1 1 
ATOM   1421 C  CG2 . VAL A 1 261 ? 19.071 -62.147 -9.114  1.00 29.48  ? 633  VAL A CG2 1 
ATOM   1422 N  N   . ASN A 1 262 ? 21.636 -64.134 -11.912 1.00 31.42  ? 634  ASN A N   1 
ATOM   1423 C  CA  . ASN A 1 262 ? 21.320 -65.154 -12.894 1.00 32.71  ? 634  ASN A CA  1 
ATOM   1424 C  C   . ASN A 1 262 ? 22.277 -66.346 -12.918 1.00 33.76  ? 634  ASN A C   1 
ATOM   1425 O  O   . ASN A 1 262 ? 22.019 -67.310 -13.635 1.00 35.64  ? 634  ASN A O   1 
ATOM   1426 C  CB  . ASN A 1 262 ? 21.275 -64.540 -14.290 1.00 33.43  ? 634  ASN A CB  1 
ATOM   1427 C  CG  . ASN A 1 262 ? 20.008 -63.760 -14.538 1.00 33.29  ? 634  ASN A CG  1 
ATOM   1428 O  OD1 . ASN A 1 262 ? 20.041 -62.666 -15.094 1.00 34.68  ? 634  ASN A OD1 1 
ATOM   1429 N  ND2 . ASN A 1 262 ? 18.881 -64.322 -14.146 1.00 32.00  ? 634  ASN A ND2 1 
ATOM   1430 N  N   . GLN A 1 263 ? 23.384 -66.287 -12.175 1.00 33.06  ? 635  GLN A N   1 
ATOM   1431 C  CA  . GLN A 1 263 ? 24.371 -67.356 -12.272 1.00 33.51  ? 635  GLN A CA  1 
ATOM   1432 C  C   . GLN A 1 263 ? 23.829 -68.675 -11.703 1.00 32.88  ? 635  GLN A C   1 
ATOM   1433 O  O   . GLN A 1 263 ? 23.473 -68.766 -10.514 1.00 31.47  ? 635  GLN A O   1 
ATOM   1434 C  CB  . GLN A 1 263 ? 25.691 -66.968 -11.622 1.00 33.25  ? 635  GLN A CB  1 
ATOM   1435 C  CG  . GLN A 1 263 ? 26.819 -67.947 -11.908 1.00 36.90  ? 635  GLN A CG  1 
ATOM   1436 C  CD  . GLN A 1 263 ? 28.109 -67.560 -11.179 1.00 39.73  ? 635  GLN A CD  1 
ATOM   1437 O  OE1 . GLN A 1 263 ? 28.444 -66.386 -11.074 1.00 40.28  ? 635  GLN A OE1 1 
ATOM   1438 N  NE2 . GLN A 1 263 ? 28.829 -68.548 -10.683 1.00 40.65  ? 635  GLN A NE2 1 
ATOM   1439 N  N   . ALA A 1 264 ? 23.794 -69.679 -12.576 1.00 33.08  ? 636  ALA A N   1 
ATOM   1440 C  CA  . ALA A 1 264 ? 23.233 -70.993 -12.282 1.00 33.45  ? 636  ALA A CA  1 
ATOM   1441 C  C   . ALA A 1 264 ? 24.256 -71.989 -11.724 1.00 33.89  ? 636  ALA A C   1 
ATOM   1442 O  O   . ALA A 1 264 ? 25.469 -71.847 -11.942 1.00 34.51  ? 636  ALA A O   1 
ATOM   1443 C  CB  . ALA A 1 264 ? 22.567 -71.581 -13.555 1.00 34.10  ? 636  ALA A CB  1 
ATOM   1444 N  N   . ASP A 1 265 ? 23.751 -72.998 -11.014 1.00 33.40  ? 637  ASP A N   1 
ATOM   1445 C  CA  . ASP A 1 265 ? 24.573 -74.125 -10.601 1.00 34.95  ? 637  ASP A CA  1 
ATOM   1446 C  C   . ASP A 1 265 ? 24.765 -75.102 -11.784 1.00 36.66  ? 637  ASP A C   1 
ATOM   1447 O  O   . ASP A 1 265 ? 24.398 -74.793 -12.917 1.00 37.30  ? 637  ASP A O   1 
ATOM   1448 C  CB  . ASP A 1 265 ? 23.978 -74.816 -9.365  1.00 34.21  ? 637  ASP A CB  1 
ATOM   1449 C  CG  . ASP A 1 265 ? 22.638 -75.495 -9.642  1.00 35.89  ? 637  ASP A CG  1 
ATOM   1450 O  OD1 . ASP A 1 265 ? 22.345 -75.884 -10.804 1.00 35.12  ? 637  ASP A OD1 1 
ATOM   1451 O  OD2 . ASP A 1 265 ? 21.877 -75.660 -8.666  1.00 36.65  ? 637  ASP A OD2 1 
ATOM   1452 N  N   . SER A 1 266 ? 25.337 -76.271 -11.511 1.00 38.05  ? 638  SER A N   1 
ATOM   1453 C  CA  . SER A 1 266 ? 25.575 -77.319 -12.523 1.00 40.34  ? 638  SER A CA  1 
ATOM   1454 C  C   . SER A 1 266 ? 24.339 -77.879 -13.230 1.00 40.61  ? 638  SER A C   1 
ATOM   1455 O  O   . SER A 1 266 ? 24.434 -78.417 -14.350 1.00 42.54  ? 638  SER A O   1 
ATOM   1456 C  CB  . SER A 1 266 ? 26.290 -78.478 -11.861 1.00 41.59  ? 638  SER A CB  1 
ATOM   1457 O  OG  . SER A 1 266 ? 27.640 -78.154 -11.703 1.00 44.02  ? 638  SER A OG  1 
ATOM   1458 N  N   . ALA A 1 267 ? 23.195 -77.794 -12.561 1.00 38.75  ? 639  ALA A N   1 
ATOM   1459 C  CA  . ALA A 1 267 ? 21.938 -78.295 -13.105 1.00 38.39  ? 639  ALA A CA  1 
ATOM   1460 C  C   . ALA A 1 267 ? 21.120 -77.170 -13.755 1.00 36.90  ? 639  ALA A C   1 
ATOM   1461 O  O   . ALA A 1 267 ? 19.915 -77.307 -13.946 1.00 36.82  ? 639  ALA A O   1 
ATOM   1462 C  CB  . ALA A 1 267 ? 21.133 -78.985 -11.995 1.00 37.58  ? 639  ALA A CB  1 
ATOM   1463 N  N   . GLY A 1 268 ? 21.777 -76.058 -14.089 1.00 36.41  ? 640  GLY A N   1 
ATOM   1464 C  CA  . GLY A 1 268 ? 21.115 -74.916 -14.734 1.00 35.08  ? 640  GLY A CA  1 
ATOM   1465 C  C   . GLY A 1 268 ? 20.149 -74.157 -13.830 1.00 33.59  ? 640  GLY A C   1 
ATOM   1466 O  O   . GLY A 1 268 ? 19.332 -73.383 -14.326 1.00 33.09  ? 640  GLY A O   1 
ATOM   1467 N  N   . ARG A 1 269 ? 20.234 -74.371 -12.513 1.00 32.33  ? 641  ARG A N   1 
ATOM   1468 C  CA  . ARG A 1 269 ? 19.293 -73.763 -11.585 1.00 31.24  ? 641  ARG A CA  1 
ATOM   1469 C  C   . ARG A 1 269 ? 19.906 -72.509 -10.992 1.00 30.75  ? 641  ARG A C   1 
ATOM   1470 O  O   . ARG A 1 269 ? 20.877 -72.574 -10.215 1.00 30.66  ? 641  ARG A O   1 
ATOM   1471 C  CB  . ARG A 1 269 ? 18.883 -74.741 -10.472 1.00 31.63  ? 641  ARG A CB  1 
ATOM   1472 C  CG  . ARG A 1 269 ? 18.326 -76.097 -10.985 1.00 32.61  ? 641  ARG A CG  1 
ATOM   1473 C  CD  . ARG A 1 269 ? 18.134 -77.107 -9.862  1.00 31.69  ? 641  ARG A CD  1 
ATOM   1474 N  NE  . ARG A 1 269 ? 19.382 -77.351 -9.144  1.00 34.16  ? 641  ARG A NE  1 
ATOM   1475 C  CZ  . ARG A 1 269 ? 19.544 -78.283 -8.213  1.00 34.86  ? 641  ARG A CZ  1 
ATOM   1476 N  NH1 . ARG A 1 269 ? 18.531 -79.071 -7.887  1.00 34.96  ? 641  ARG A NH1 1 
ATOM   1477 N  NH2 . ARG A 1 269 ? 20.717 -78.429 -7.611  1.00 34.24  ? 641  ARG A NH2 1 
ATOM   1478 N  N   . GLY A 1 270 ? 19.347 -71.366 -11.388 1.00 30.43  ? 642  GLY A N   1 
ATOM   1479 C  CA  . GLY A 1 270 ? 19.765 -70.074 -10.870 1.00 29.79  ? 642  GLY A CA  1 
ATOM   1480 C  C   . GLY A 1 270 ? 19.069 -69.772 -9.563  1.00 29.24  ? 642  GLY A C   1 
ATOM   1481 O  O   . GLY A 1 270 ? 18.269 -70.573 -9.085  1.00 29.42  ? 642  GLY A O   1 
ATOM   1482 N  N   . PRO A 1 271 ? 19.378 -68.612 -8.957  1.00 29.01  ? 643  PRO A N   1 
ATOM   1483 C  CA  . PRO A 1 271 ? 18.780 -68.260 -7.643  1.00 27.85  ? 643  PRO A CA  1 
ATOM   1484 C  C   . PRO A 1 271 ? 17.245 -68.230 -7.645  1.00 27.63  ? 643  PRO A C   1 
ATOM   1485 O  O   . PRO A 1 271 ? 16.606 -68.586 -6.642  1.00 27.78  ? 643  PRO A O   1 
ATOM   1486 C  CB  . PRO A 1 271 ? 19.372 -66.874 -7.340  1.00 27.09  ? 643  PRO A CB  1 
ATOM   1487 C  CG  . PRO A 1 271 ? 20.724 -66.907 -8.043  1.00 28.42  ? 643  PRO A CG  1 
ATOM   1488 C  CD  . PRO A 1 271 ? 20.528 -67.751 -9.305  1.00 28.56  ? 643  PRO A CD  1 
ATOM   1489 N  N   . LEU A 1 272 ? 16.667 -67.795 -8.751  1.00 27.99  ? 644  LEU A N   1 
ATOM   1490 C  CA  . LEU A 1 272 ? 15.218 -67.794 -8.910  1.00 28.40  ? 644  LEU A CA  1 
ATOM   1491 C  C   . LEU A 1 272 ? 14.680 -69.234 -8.922  1.00 28.96  ? 644  LEU A C   1 
ATOM   1492 O  O   . LEU A 1 272 ? 13.732 -69.549 -8.193  1.00 29.41  ? 644  LEU A O   1 
ATOM   1493 C  CB  . LEU A 1 272 ? 14.827 -67.029 -10.171 1.00 28.79  ? 644  LEU A CB  1 
ATOM   1494 C  CG  . LEU A 1 272 ? 13.348 -66.788 -10.452 1.00 29.95  ? 644  LEU A CG  1 
ATOM   1495 C  CD1 . LEU A 1 272 ? 12.627 -66.158 -9.265  1.00 26.48  ? 644  LEU A CD1 1 
ATOM   1496 C  CD2 . LEU A 1 272 ? 13.173 -65.963 -11.731 1.00 27.61  ? 644  LEU A CD2 1 
ATOM   1497 N  N   . HIS A 1 273 ? 15.314 -70.121 -9.686  1.00 28.94  ? 645  HIS A N   1 
ATOM   1498 C  CA  . HIS A 1 273 ? 14.948 -71.539 -9.611  1.00 29.72  ? 645  HIS A CA  1 
ATOM   1499 C  C   . HIS A 1 273 ? 14.974 -72.047 -8.169  1.00 29.69  ? 645  HIS A C   1 
ATOM   1500 O  O   . HIS A 1 273 ? 14.050 -72.742 -7.743  1.00 29.69  ? 645  HIS A O   1 
ATOM   1501 C  CB  . HIS A 1 273 ? 15.847 -72.424 -10.479 1.00 30.08  ? 645  HIS A CB  1 
ATOM   1502 C  CG  . HIS A 1 273 ? 15.641 -72.252 -11.948 1.00 31.41  ? 645  HIS A CG  1 
ATOM   1503 N  ND1 . HIS A 1 273 ? 16.450 -71.444 -12.718 1.00 34.27  ? 645  HIS A ND1 1 
ATOM   1504 C  CD2 . HIS A 1 273 ? 14.736 -72.794 -12.795 1.00 32.94  ? 645  HIS A CD2 1 
ATOM   1505 C  CE1 . HIS A 1 273 ? 16.047 -71.492 -13.978 1.00 35.76  ? 645  HIS A CE1 1 
ATOM   1506 N  NE2 . HIS A 1 273 ? 15.011 -72.307 -14.052 1.00 35.61  ? 645  HIS A NE2 1 
ATOM   1507 N  N   . HIS A 1 274 ? 16.020 -71.706 -7.413  1.00 29.26  ? 646  HIS A N   1 
ATOM   1508 C  CA  . HIS A 1 274 ? 16.100 -72.216 -6.038  1.00 29.90  ? 646  HIS A CA  1 
ATOM   1509 C  C   . HIS A 1 274 ? 15.042 -71.619 -5.132  1.00 29.83  ? 646  HIS A C   1 
ATOM   1510 O  O   . HIS A 1 274 ? 14.462 -72.327 -4.324  1.00 30.89  ? 646  HIS A O   1 
ATOM   1511 C  CB  . HIS A 1 274 ? 17.503 -72.067 -5.432  1.00 29.71  ? 646  HIS A CB  1 
ATOM   1512 C  CG  . HIS A 1 274 ? 18.524 -72.957 -6.065  1.00 30.97  ? 646  HIS A CG  1 
ATOM   1513 N  ND1 . HIS A 1 274 ? 18.731 -74.258 -5.660  1.00 33.37  ? 646  HIS A ND1 1 
ATOM   1514 C  CD2 . HIS A 1 274 ? 19.390 -72.736 -7.084  1.00 31.60  ? 646  HIS A CD2 1 
ATOM   1515 C  CE1 . HIS A 1 274 ? 19.694 -74.795 -6.390  1.00 34.35  ? 646  HIS A CE1 1 
ATOM   1516 N  NE2 . HIS A 1 274 ? 20.111 -73.892 -7.261  1.00 32.28  ? 646  HIS A NE2 1 
ATOM   1517 N  N   . ALA A 1 275 ? 14.777 -70.322 -5.274  1.00 29.73  ? 647  ALA A N   1 
ATOM   1518 C  CA  . ALA A 1 275 ? 13.755 -69.670 -4.444  1.00 30.42  ? 647  ALA A CA  1 
ATOM   1519 C  C   . ALA A 1 275 ? 12.402 -70.351 -4.653  1.00 31.08  ? 647  ALA A C   1 
ATOM   1520 O  O   . ALA A 1 275 ? 11.651 -70.587 -3.704  1.00 31.80  ? 647  ALA A O   1 
ATOM   1521 C  CB  . ALA A 1 275 ? 13.659 -68.158 -4.757  1.00 29.59  ? 647  ALA A CB  1 
ATOM   1522 N  N   . THR A 1 276 ? 12.108 -70.664 -5.909  1.00 31.61  ? 648  THR A N   1 
ATOM   1523 C  CA  . THR A 1 276 ? 10.822 -71.255 -6.270  1.00 32.86  ? 648  THR A CA  1 
ATOM   1524 C  C   . THR A 1 276 ? 10.762 -72.748 -5.904  1.00 33.29  ? 648  THR A C   1 
ATOM   1525 O  O   . THR A 1 276 ? 9.749  -73.176 -5.367  1.00 34.77  ? 648  THR A O   1 
ATOM   1526 C  CB  . THR A 1 276 ? 10.384 -70.885 -7.717  1.00 32.86  ? 648  THR A CB  1 
ATOM   1527 O  OG1 . THR A 1 276 ? 9.277  -71.700 -8.143  1.00 36.19  ? 648  THR A OG1 1 
ATOM   1528 C  CG2 . THR A 1 276 ? 11.470 -71.076 -8.656  1.00 34.59  ? 648  THR A CG2 1 
ATOM   1529 N  N   . ILE A 1 277 ? 11.847 -73.517 -6.091  1.00 32.39  ? 649  ILE A N   1 
ATOM   1530 C  CA  . ILE A 1 277 ? 11.904 -74.881 -5.537  1.00 32.73  ? 649  ILE A CA  1 
ATOM   1531 C  C   . ILE A 1 277 ? 11.564 -74.873 -4.049  1.00 33.26  ? 649  ILE A C   1 
ATOM   1532 O  O   . ILE A 1 277 ? 10.796 -75.692 -3.591  1.00 34.44  ? 649  ILE A O   1 
ATOM   1533 C  CB  . ILE A 1 277 ? 13.302 -75.571 -5.709  1.00 33.08  ? 649  ILE A CB  1 
ATOM   1534 C  CG1 . ILE A 1 277 ? 13.501 -76.073 -7.134  1.00 32.31  ? 649  ILE A CG1 1 
ATOM   1535 C  CG2 . ILE A 1 277 ? 13.470 -76.761 -4.727  1.00 33.60  ? 649  ILE A CG2 1 
ATOM   1536 C  CD1 . ILE A 1 277 ? 14.943 -76.053 -7.560  1.00 31.18  ? 649  ILE A CD1 1 
ATOM   1537 N  N   . LEU A 1 278 ? 12.132 -73.937 -3.295  1.00 32.89  ? 650  LEU A N   1 
ATOM   1538 C  CA  . LEU A 1 278 ? 12.004 -73.988 -1.843  1.00 33.64  ? 650  LEU A CA  1 
ATOM   1539 C  C   . LEU A 1 278 ? 10.772 -73.250 -1.305  1.00 34.60  ? 650  LEU A C   1 
ATOM   1540 O  O   . LEU A 1 278 ? 10.512 -73.289 -0.108  1.00 35.87  ? 650  LEU A O   1 
ATOM   1541 C  CB  . LEU A 1 278 ? 13.288 -73.497 -1.172  1.00 32.55  ? 650  LEU A CB  1 
ATOM   1542 C  CG  . LEU A 1 278 ? 14.558 -74.339 -1.366  1.00 32.77  ? 650  LEU A CG  1 
ATOM   1543 C  CD1 . LEU A 1 278 ? 15.794 -73.553 -0.967  1.00 31.47  ? 650  LEU A CD1 1 
ATOM   1544 C  CD2 . LEU A 1 278 ? 14.490 -75.638 -0.588  1.00 33.52  ? 650  LEU A CD2 1 
ATOM   1545 N  N   . GLY A 1 279 ? 10.020 -72.594 -2.193  1.00 34.80  ? 651  GLY A N   1 
ATOM   1546 C  CA  . GLY A 1 279 ? 8.809  -71.859 -1.814  1.00 35.88  ? 651  GLY A CA  1 
ATOM   1547 C  C   . GLY A 1 279 ? 9.112  -70.581 -1.052  1.00 36.52  ? 651  GLY A C   1 
ATOM   1548 O  O   . GLY A 1 279 ? 8.363  -70.196 -0.162  1.00 38.34  ? 651  GLY A O   1 
ATOM   1549 N  N   . HIS A 1 280 ? 10.226 -69.932 -1.384  1.00 35.26  ? 652  HIS A N   1 
ATOM   1550 C  CA  . HIS A 1 280 ? 10.631 -68.700 -0.712  1.00 35.01  ? 652  HIS A CA  1 
ATOM   1551 C  C   . HIS A 1 280 ? 10.178 -67.502 -1.523  1.00 34.70  ? 652  HIS A C   1 
ATOM   1552 O  O   . HIS A 1 280 ? 10.935 -66.973 -2.343  1.00 34.28  ? 652  HIS A O   1 
ATOM   1553 C  CB  . HIS A 1 280 ? 12.143 -68.663 -0.470  1.00 33.69  ? 652  HIS A CB  1 
ATOM   1554 C  CG  . HIS A 1 280 ? 12.620 -69.685 0.512   1.00 34.53  ? 652  HIS A CG  1 
ATOM   1555 N  ND1 . HIS A 1 280 ? 13.855 -70.298 0.412   1.00 34.26  ? 652  HIS A ND1 1 
ATOM   1556 C  CD2 . HIS A 1 280 ? 12.029 -70.205 1.615   1.00 35.74  ? 652  HIS A CD2 1 
ATOM   1557 C  CE1 . HIS A 1 280 ? 14.004 -71.143 1.419   1.00 35.36  ? 652  HIS A CE1 1 
ATOM   1558 N  NE2 . HIS A 1 280 ? 12.904 -71.118 2.153   1.00 36.59  ? 652  HIS A NE2 1 
ATOM   1559 N  N   . THR A 1 281 ? 8.935  -67.092 -1.267  1.00 35.62  ? 653  THR A N   1 
ATOM   1560 C  CA  . THR A 1 281 ? 8.239  -66.049 -2.012  1.00 35.83  ? 653  THR A CA  1 
ATOM   1561 C  C   . THR A 1 281 ? 8.952  -64.698 -1.954  1.00 35.36  ? 653  THR A C   1 
ATOM   1562 O  O   . THR A 1 281 ? 9.166  -64.073 -2.996  1.00 34.42  ? 653  THR A O   1 
ATOM   1563 C  CB  . THR A 1 281 ? 6.762  -65.937 -1.524  1.00 37.88  ? 653  THR A CB  1 
ATOM   1564 O  OG1 . THR A 1 281 ? 6.092  -67.172 -1.795  1.00 38.38  ? 653  THR A OG1 1 
ATOM   1565 C  CG2 . THR A 1 281 ? 6.031  -64.831 -2.242  1.00 38.43  ? 653  THR A CG2 1 
ATOM   1566 N  N   . GLY A 1 282 ? 9.316  -64.266 -0.744  1.00 35.98  ? 654  GLY A N   1 
ATOM   1567 C  CA  . GLY A 1 282 ? 10.139 -63.056 -0.539  1.00 36.14  ? 654  GLY A CA  1 
ATOM   1568 C  C   . GLY A 1 282 ? 11.427 -63.005 -1.364  1.00 34.96  ? 654  GLY A C   1 
ATOM   1569 O  O   . GLY A 1 282 ? 11.706 -61.994 -2.022  1.00 34.43  ? 654  GLY A O   1 
ATOM   1570 N  N   . LEU A 1 283 ? 12.209 -64.093 -1.342  1.00 34.24  ? 655  LEU A N   1 
ATOM   1571 C  CA  . LEU A 1 283 ? 13.450 -64.156 -2.134  1.00 33.22  ? 655  LEU A CA  1 
ATOM   1572 C  C   . LEU A 1 283 ? 13.164 -64.135 -3.629  1.00 33.44  ? 655  LEU A C   1 
ATOM   1573 O  O   . LEU A 1 283 ? 13.880 -63.492 -4.387  1.00 33.15  ? 655  LEU A O   1 
ATOM   1574 C  CB  . LEU A 1 283 ? 14.285 -65.386 -1.778  1.00 32.34  ? 655  LEU A CB  1 
ATOM   1575 C  CG  . LEU A 1 283 ? 14.860 -65.518 -0.367  1.00 32.97  ? 655  LEU A CG  1 
ATOM   1576 C  CD1 . LEU A 1 283 ? 15.942 -66.577 -0.350  1.00 31.90  ? 655  LEU A CD1 1 
ATOM   1577 C  CD2 . LEU A 1 283 ? 15.426 -64.193 0.147   1.00 33.21  ? 655  LEU A CD2 1 
ATOM   1578 N  N   . ALA A 1 284 ? 12.116 -64.842 -4.050  1.00 34.19  ? 656  ALA A N   1 
ATOM   1579 C  CA  . ALA A 1 284 ? 11.725 -64.837 -5.450  1.00 34.87  ? 656  ALA A CA  1 
ATOM   1580 C  C   . ALA A 1 284 ? 11.473 -63.409 -5.887  1.00 35.97  ? 656  ALA A C   1 
ATOM   1581 O  O   . ALA A 1 284 ? 11.940 -62.974 -6.948  1.00 36.05  ? 656  ALA A O   1 
ATOM   1582 C  CB  . ALA A 1 284 ? 10.465 -65.692 -5.666  1.00 35.72  ? 656  ALA A CB  1 
ATOM   1583 N  N   . CYS A 1 285 ? 10.743 -62.680 -5.050  1.00 37.25  ? 657  CYS A N   1 
ATOM   1584 C  CA  . CYS A 1 285 ? 10.346 -61.306 -5.357  1.00 39.48  ? 657  CYS A CA  1 
ATOM   1585 C  C   . CYS A 1 285 ? 11.573 -60.390 -5.388  1.00 37.94  ? 657  CYS A C   1 
ATOM   1586 O  O   . CYS A 1 285 ? 11.702 -59.551 -6.287  1.00 38.42  ? 657  CYS A O   1 
ATOM   1587 C  CB  . CYS A 1 285 ? 9.262  -60.821 -4.379  1.00 40.75  ? 657  CYS A CB  1 
ATOM   1588 S  SG  . CYS A 1 285 ? 8.796  -59.082 -4.581  1.00 52.10  ? 657  CYS A SG  1 
ATOM   1589 N  N   . LEU A 1 286 ? 12.489 -60.592 -4.440  1.00 36.12  ? 658  LEU A N   1 
ATOM   1590 C  CA  . LEU A 1 286 ? 13.770 -59.918 -4.461  1.00 35.17  ? 658  LEU A CA  1 
ATOM   1591 C  C   . LEU A 1 286 ? 14.500 -60.133 -5.793  1.00 34.62  ? 658  LEU A C   1 
ATOM   1592 O  O   . LEU A 1 286 ? 14.920 -59.162 -6.415  1.00 35.21  ? 658  LEU A O   1 
ATOM   1593 C  CB  . LEU A 1 286 ? 14.645 -60.353 -3.289  1.00 34.21  ? 658  LEU A CB  1 
ATOM   1594 C  CG  . LEU A 1 286 ? 16.090 -59.835 -3.252  1.00 34.77  ? 658  LEU A CG  1 
ATOM   1595 C  CD1 . LEU A 1 286 ? 16.145 -58.307 -3.056  1.00 35.83  ? 658  LEU A CD1 1 
ATOM   1596 C  CD2 . LEU A 1 286 ? 16.863 -60.546 -2.138  1.00 34.31  ? 658  LEU A CD2 1 
ATOM   1597 N  N   . PHE A 1 287 ? 14.621 -61.382 -6.250  1.00 33.47  ? 659  PHE A N   1 
ATOM   1598 C  CA  . PHE A 1 287 ? 15.394 -61.643 -7.463  1.00 33.15  ? 659  PHE A CA  1 
ATOM   1599 C  C   . PHE A 1 287 ? 14.739 -61.044 -8.707  1.00 34.56  ? 659  PHE A C   1 
ATOM   1600 O  O   . PHE A 1 287 ? 15.426 -60.572 -9.610  1.00 35.01  ? 659  PHE A O   1 
ATOM   1601 C  CB  . PHE A 1 287 ? 15.699 -63.141 -7.652  1.00 32.20  ? 659  PHE A CB  1 
ATOM   1602 C  CG  . PHE A 1 287 ? 16.413 -63.773 -6.483  1.00 29.90  ? 659  PHE A CG  1 
ATOM   1603 C  CD1 . PHE A 1 287 ? 17.361 -63.056 -5.750  1.00 30.17  ? 659  PHE A CD1 1 
ATOM   1604 C  CD2 . PHE A 1 287 ? 16.154 -65.086 -6.128  1.00 28.09  ? 659  PHE A CD2 1 
ATOM   1605 C  CE1 . PHE A 1 287 ? 18.019 -63.633 -4.648  1.00 28.97  ? 659  PHE A CE1 1 
ATOM   1606 C  CE2 . PHE A 1 287 ? 16.812 -65.683 -5.031  1.00 29.13  ? 659  PHE A CE2 1 
ATOM   1607 C  CZ  . PHE A 1 287 ? 17.757 -64.950 -4.300  1.00 28.44  ? 659  PHE A CZ  1 
ATOM   1608 N  N   . LEU A 1 288 ? 13.412 -61.051 -8.746  1.00 36.13  ? 660  LEU A N   1 
ATOM   1609 C  CA  . LEU A 1 288 ? 12.685 -60.465 -9.872  1.00 38.09  ? 660  LEU A CA  1 
ATOM   1610 C  C   . LEU A 1 288 ? 12.906 -58.956 -9.937  1.00 39.61  ? 660  LEU A C   1 
ATOM   1611 O  O   . LEU A 1 288 ? 13.129 -58.393 -11.010 1.00 40.82  ? 660  LEU A O   1 
ATOM   1612 C  CB  . LEU A 1 288 ? 11.192 -60.824 -9.810  1.00 38.70  ? 660  LEU A CB  1 
ATOM   1613 C  CG  . LEU A 1 288 ? 10.918 -62.300 -10.147 1.00 39.26  ? 660  LEU A CG  1 
ATOM   1614 C  CD1 . LEU A 1 288 ? 9.583  -62.783 -9.545  1.00 39.59  ? 660  LEU A CD1 1 
ATOM   1615 C  CD2 . LEU A 1 288 ? 10.977 -62.574 -11.684 1.00 38.73  ? 660  LEU A CD2 1 
ATOM   1616 N  N   . LYS A 1 289 ? 12.874 -58.310 -8.778  1.00 40.41  ? 661  LYS A N   1 
ATOM   1617 C  CA  . LYS A 1 289 ? 13.152 -56.887 -8.693  1.00 42.00  ? 661  LYS A CA  1 
ATOM   1618 C  C   . LYS A 1 289 ? 14.565 -56.540 -9.182  1.00 41.74  ? 661  LYS A C   1 
ATOM   1619 O  O   . LYS A 1 289 ? 14.794 -55.429 -9.655  1.00 42.75  ? 661  LYS A O   1 
ATOM   1620 C  CB  . LYS A 1 289 ? 12.945 -56.398 -7.263  1.00 42.32  ? 661  LYS A CB  1 
ATOM   1621 C  CG  . LYS A 1 289 ? 11.490 -56.349 -6.848  1.00 45.18  ? 661  LYS A CG  1 
ATOM   1622 C  CD  . LYS A 1 289 ? 11.346 -56.256 -5.336  1.00 47.78  ? 661  LYS A CD  1 
ATOM   1623 C  CE  . LYS A 1 289 ? 11.413 -54.808 -4.862  1.00 51.22  ? 661  LYS A CE  1 
ATOM   1624 N  NZ  . LYS A 1 289 ? 11.219 -54.695 -3.390  1.00 52.36  ? 661  LYS A NZ  1 
ATOM   1625 N  N   . ARG A 1 290 ? 15.500 -57.484 -9.079  1.00 40.12  ? 662  ARG A N   1 
ATOM   1626 C  CA  . ARG A 1 290 ? 16.886 -57.230 -9.479  1.00 40.06  ? 662  ARG A CA  1 
ATOM   1627 C  C   . ARG A 1 290 ? 17.272 -57.842 -10.814 1.00 39.91  ? 662  ARG A C   1 
ATOM   1628 O  O   . ARG A 1 290 ? 18.444 -58.109 -11.063 1.00 39.65  ? 662  ARG A O   1 
ATOM   1629 C  CB  . ARG A 1 290 ? 17.847 -57.717 -8.396  1.00 39.16  ? 662  ARG A CB  1 
ATOM   1630 C  CG  . ARG A 1 290 ? 17.618 -57.079 -7.046  1.00 41.48  ? 662  ARG A CG  1 
ATOM   1631 C  CD  . ARG A 1 290 ? 18.485 -55.859 -6.833  1.00 47.29  ? 662  ARG A CD  1 
ATOM   1632 N  NE  . ARG A 1 290 ? 18.822 -55.776 -5.414  1.00 50.67  ? 662  ARG A NE  1 
ATOM   1633 C  CZ  . ARG A 1 290 ? 19.948 -55.274 -4.912  1.00 52.66  ? 662  ARG A CZ  1 
ATOM   1634 N  NH1 . ARG A 1 290 ? 20.116 -55.296 -3.590  1.00 53.24  ? 662  ARG A NH1 1 
ATOM   1635 N  NH2 . ARG A 1 290 ? 20.900 -54.763 -5.706  1.00 52.32  ? 662  ARG A NH2 1 
ATOM   1636 N  N   . GLY A 1 291 ? 16.285 -58.087 -11.667 1.00 40.70  ? 663  GLY A N   1 
ATOM   1637 C  CA  . GLY A 1 291 ? 16.544 -58.537 -13.030 1.00 40.60  ? 663  GLY A CA  1 
ATOM   1638 C  C   . GLY A 1 291 ? 16.830 -60.014 -13.255 1.00 39.08  ? 663  GLY A C   1 
ATOM   1639 O  O   . GLY A 1 291 ? 17.522 -60.369 -14.206 1.00 39.52  ? 663  GLY A O   1 
ATOM   1640 N  N   . ALA A 1 292 ? 16.300 -60.886 -12.409 1.00 37.46  ? 664  ALA A N   1 
ATOM   1641 C  CA  . ALA A 1 292 ? 16.391 -62.320 -12.698 1.00 36.98  ? 664  ALA A CA  1 
ATOM   1642 C  C   . ALA A 1 292 ? 15.704 -62.656 -14.022 1.00 38.06  ? 664  ALA A C   1 
ATOM   1643 O  O   . ALA A 1 292 ? 14.625 -62.137 -14.317 1.00 38.57  ? 664  ALA A O   1 
ATOM   1644 C  CB  . ALA A 1 292 ? 15.788 -63.132 -11.576 1.00 35.80  ? 664  ALA A CB  1 
ATOM   1645 N  N   . ASP A 1 293 ? 16.333 -63.514 -14.820 1.00 39.00  ? 665  ASP A N   1 
ATOM   1646 C  CA  . ASP A 1 293 ? 15.755 -63.964 -16.094 1.00 41.03  ? 665  ASP A CA  1 
ATOM   1647 C  C   . ASP A 1 293 ? 14.568 -64.893 -15.843 1.00 41.11  ? 665  ASP A C   1 
ATOM   1648 O  O   . ASP A 1 293 ? 14.721 -65.999 -15.341 1.00 40.66  ? 665  ASP A O   1 
ATOM   1649 C  CB  . ASP A 1 293 ? 16.804 -64.675 -16.939 1.00 42.06  ? 665  ASP A CB  1 
ATOM   1650 C  CG  . ASP A 1 293 ? 16.293 -65.068 -18.325 1.00 45.90  ? 665  ASP A CG  1 
ATOM   1651 O  OD1 . ASP A 1 293 ? 15.100 -64.852 -18.660 1.00 47.75  ? 665  ASP A OD1 1 
ATOM   1652 O  OD2 . ASP A 1 293 ? 17.113 -65.604 -19.104 1.00 51.11  ? 665  ASP A OD2 1 
ATOM   1653 N  N   . LEU A 1 294 ? 13.382 -64.409 -16.178 1.00 42.32  ? 666  LEU A N   1 
ATOM   1654 C  CA  . LEU A 1 294 ? 12.148 -65.157 -16.053 1.00 42.48  ? 666  LEU A CA  1 
ATOM   1655 C  C   . LEU A 1 294 ? 12.144 -66.446 -16.871 1.00 42.50  ? 666  LEU A C   1 
ATOM   1656 O  O   . LEU A 1 294 ? 11.621 -67.464 -16.423 1.00 42.02  ? 666  LEU A O   1 
ATOM   1657 C  CB  . LEU A 1 294 ? 10.995 -64.289 -16.548 1.00 44.72  ? 666  LEU A CB  1 
ATOM   1658 C  CG  . LEU A 1 294 ? 10.119 -63.601 -15.523 1.00 46.02  ? 666  LEU A CG  1 
ATOM   1659 C  CD1 . LEU A 1 294 ? 9.370  -62.499 -16.233 1.00 48.88  ? 666  LEU A CD1 1 
ATOM   1660 C  CD2 . LEU A 1 294 ? 9.167  -64.647 -14.941 1.00 47.45  ? 666  LEU A CD2 1 
ATOM   1661 N  N   . GLY A 1 295 ? 12.702 -66.385 -18.080 1.00 43.05  ? 667  GLY A N   1 
ATOM   1662 C  CA  . GLY A 1 295 ? 12.611 -67.494 -19.022 1.00 42.98  ? 667  GLY A CA  1 
ATOM   1663 C  C   . GLY A 1 295 ? 13.711 -68.538 -18.970 1.00 42.05  ? 667  GLY A C   1 
ATOM   1664 O  O   . GLY A 1 295 ? 13.745 -69.442 -19.804 1.00 43.56  ? 667  GLY A O   1 
ATOM   1665 N  N   . ALA A 1 296 ? 14.613 -68.443 -18.000 1.00 39.92  ? 668  ALA A N   1 
ATOM   1666 C  CA  . ALA A 1 296 ? 15.761 -69.338 -18.000 1.00 39.06  ? 668  ALA A CA  1 
ATOM   1667 C  C   . ALA A 1 296 ? 15.318 -70.769 -17.667 1.00 38.20  ? 668  ALA A C   1 
ATOM   1668 O  O   . ALA A 1 296 ? 14.550 -71.003 -16.729 1.00 36.85  ? 668  ALA A O   1 
ATOM   1669 C  CB  . ALA A 1 296 ? 16.854 -68.851 -17.052 1.00 37.45  ? 668  ALA A CB  1 
ATOM   1670 N  N   . ARG A 1 297 ? 15.797 -71.708 -18.467 1.00 38.70  ? 669  ARG A N   1 
ATOM   1671 C  CA  . ARG A 1 297 ? 15.425 -73.109 -18.343 1.00 39.02  ? 669  ARG A CA  1 
ATOM   1672 C  C   . ARG A 1 297 ? 16.587 -73.921 -17.753 1.00 38.13  ? 669  ARG A C   1 
ATOM   1673 O  O   . ARG A 1 297 ? 17.732 -73.793 -18.213 1.00 38.42  ? 669  ARG A O   1 
ATOM   1674 C  CB  . ARG A 1 297 ? 14.973 -73.650 -19.711 1.00 41.51  ? 669  ARG A CB  1 
ATOM   1675 C  CG  . ARG A 1 297 ? 13.648 -73.025 -20.230 1.00 43.57  ? 669  ARG A CG  1 
ATOM   1676 C  CD  . ARG A 1 297 ? 12.895 -73.995 -21.132 1.00 50.62  ? 669  ARG A CD  1 
ATOM   1677 N  NE  . ARG A 1 297 ? 11.580 -73.504 -21.581 1.00 54.72  ? 669  ARG A NE  1 
ATOM   1678 C  CZ  . ARG A 1 297 ? 10.428 -73.632 -20.908 1.00 54.84  ? 669  ARG A CZ  1 
ATOM   1679 N  NH1 . ARG A 1 297 ? 10.386 -74.219 -19.715 1.00 52.93  ? 669  ARG A NH1 1 
ATOM   1680 N  NH2 . ARG A 1 297 ? 9.302  -73.156 -21.431 1.00 56.38  ? 669  ARG A NH2 1 
ATOM   1681 N  N   . ASP A 1 298 ? 16.298 -74.729 -16.726 1.00 36.30  ? 670  ASP A N   1 
ATOM   1682 C  CA  . ASP A 1 298 ? 17.326 -75.574 -16.100 1.00 36.08  ? 670  ASP A CA  1 
ATOM   1683 C  C   . ASP A 1 298 ? 17.643 -76.839 -16.923 1.00 37.60  ? 670  ASP A C   1 
ATOM   1684 O  O   . ASP A 1 298 ? 17.186 -76.972 -18.070 1.00 38.66  ? 670  ASP A O   1 
ATOM   1685 C  CB  . ASP A 1 298 ? 16.983 -75.902 -14.638 1.00 34.53  ? 670  ASP A CB  1 
ATOM   1686 C  CG  . ASP A 1 298 ? 15.754 -76.792 -14.491 1.00 36.11  ? 670  ASP A CG  1 
ATOM   1687 O  OD1 . ASP A 1 298 ? 15.267 -77.390 -15.482 1.00 38.37  ? 670  ASP A OD1 1 
ATOM   1688 O  OD2 . ASP A 1 298 ? 15.264 -76.896 -13.352 1.00 35.86  ? 670  ASP A OD2 1 
ATOM   1689 N  N   . SER A 1 299 ? 18.420 -77.764 -16.356 1.00 37.89  ? 671  SER A N   1 
ATOM   1690 C  CA  . SER A 1 299 ? 18.808 -78.968 -17.104 1.00 40.25  ? 671  SER A CA  1 
ATOM   1691 C  C   . SER A 1 299 ? 17.622 -79.917 -17.330 1.00 40.91  ? 671  SER A C   1 
ATOM   1692 O  O   . SER A 1 299 ? 17.718 -80.869 -18.107 1.00 42.92  ? 671  SER A O   1 
ATOM   1693 C  CB  . SER A 1 299 ? 19.966 -79.695 -16.418 1.00 41.20  ? 671  SER A CB  1 
ATOM   1694 O  OG  . SER A 1 299 ? 19.598 -80.128 -15.129 1.00 40.54  ? 671  SER A OG  1 
ATOM   1695 N  N   . GLU A 1 300 ? 16.505 -79.653 -16.653 1.00 39.00  ? 672  GLU A N   1 
ATOM   1696 C  CA  . GLU A 1 300 ? 15.304 -80.461 -16.825 1.00 39.57  ? 672  GLU A CA  1 
ATOM   1697 C  C   . GLU A 1 300 ? 14.295 -79.749 -17.727 1.00 39.51  ? 672  GLU A C   1 
ATOM   1698 O  O   . GLU A 1 300 ? 13.155 -80.173 -17.851 1.00 39.46  ? 672  GLU A O   1 
ATOM   1699 C  CB  . GLU A 1 300 ? 14.698 -80.811 -15.466 1.00 38.01  ? 672  GLU A CB  1 
ATOM   1700 C  CG  . GLU A 1 300 ? 15.574 -81.742 -14.661 1.00 39.33  ? 672  GLU A CG  1 
ATOM   1701 C  CD  . GLU A 1 300 ? 15.140 -81.926 -13.211 1.00 39.34  ? 672  GLU A CD  1 
ATOM   1702 O  OE1 . GLU A 1 300 ? 13.932 -81.801 -12.893 1.00 40.41  ? 672  GLU A OE1 1 
ATOM   1703 O  OE2 . GLU A 1 300 ? 16.019 -82.225 -12.380 1.00 39.39  ? 672  GLU A OE2 1 
ATOM   1704 N  N   . GLY A 1 301 ? 14.727 -78.652 -18.344 1.00 39.68  ? 673  GLY A N   1 
ATOM   1705 C  CA  . GLY A 1 301 ? 13.856 -77.862 -19.212 1.00 40.16  ? 673  GLY A CA  1 
ATOM   1706 C  C   . GLY A 1 301 ? 12.820 -77.016 -18.481 1.00 38.83  ? 673  GLY A C   1 
ATOM   1707 O  O   . GLY A 1 301 ? 11.881 -76.533 -19.092 1.00 40.04  ? 673  GLY A O   1 
ATOM   1708 N  N   . ARG A 1 302 ? 12.988 -76.824 -17.179 1.00 37.28  ? 674  ARG A N   1 
ATOM   1709 C  CA  . ARG A 1 302 ? 12.019 -76.080 -16.383 1.00 35.59  ? 674  ARG A CA  1 
ATOM   1710 C  C   . ARG A 1 302 ? 12.437 -74.620 -16.222 1.00 34.54  ? 674  ARG A C   1 
ATOM   1711 O  O   . ARG A 1 302 ? 13.587 -74.333 -15.875 1.00 32.96  ? 674  ARG A O   1 
ATOM   1712 C  CB  . ARG A 1 302 ? 11.879 -76.689 -14.993 1.00 34.72  ? 674  ARG A CB  1 
ATOM   1713 C  CG  . ARG A 1 302 ? 11.609 -78.178 -14.961 1.00 36.20  ? 674  ARG A CG  1 
ATOM   1714 C  CD  . ARG A 1 302 ? 11.659 -78.673 -13.528 1.00 35.81  ? 674  ARG A CD  1 
ATOM   1715 N  NE  . ARG A 1 302 ? 12.964 -78.405 -12.922 1.00 35.51  ? 674  ARG A NE  1 
ATOM   1716 C  CZ  . ARG A 1 302 ? 13.328 -78.788 -11.699 1.00 34.81  ? 674  ARG A CZ  1 
ATOM   1717 N  NH1 . ARG A 1 302 ? 12.485 -79.470 -10.929 1.00 35.25  ? 674  ARG A NH1 1 
ATOM   1718 N  NH2 . ARG A 1 302 ? 14.547 -78.507 -11.255 1.00 32.83  ? 674  ARG A NH2 1 
ATOM   1719 N  N   . ASP A 1 303 ? 11.498 -73.709 -16.479 1.00 34.37  ? 675  ASP A N   1 
ATOM   1720 C  CA  . ASP A 1 303 ? 11.670 -72.325 -16.087 1.00 34.34  ? 675  ASP A CA  1 
ATOM   1721 C  C   . ASP A 1 303 ? 11.047 -72.128 -14.703 1.00 32.89  ? 675  ASP A C   1 
ATOM   1722 O  O   . ASP A 1 303 ? 10.441 -73.051 -14.154 1.00 33.30  ? 675  ASP A O   1 
ATOM   1723 C  CB  . ASP A 1 303 ? 11.096 -71.373 -17.133 1.00 35.42  ? 675  ASP A CB  1 
ATOM   1724 C  CG  . ASP A 1 303 ? 9.617  -71.560 -17.341 1.00 39.04  ? 675  ASP A CG  1 
ATOM   1725 O  OD1 . ASP A 1 303 ? 8.966  -72.279 -16.533 1.00 39.92  ? 675  ASP A OD1 1 
ATOM   1726 O  OD2 . ASP A 1 303 ? 9.108  -70.981 -18.332 1.00 42.88  ? 675  ASP A OD2 1 
ATOM   1727 N  N   . PRO A 1 304 ? 11.208 -70.941 -14.109 1.00 32.25  ? 676  PRO A N   1 
ATOM   1728 C  CA  . PRO A 1 304 ? 10.659 -70.896 -12.739 1.00 30.71  ? 676  PRO A CA  1 
ATOM   1729 C  C   . PRO A 1 304 ? 9.132  -71.081 -12.631 1.00 30.76  ? 676  PRO A C   1 
ATOM   1730 O  O   . PRO A 1 304 ? 8.658  -71.656 -11.646 1.00 29.82  ? 676  PRO A O   1 
ATOM   1731 C  CB  . PRO A 1 304 ? 11.135 -69.538 -12.216 1.00 29.56  ? 676  PRO A CB  1 
ATOM   1732 C  CG  . PRO A 1 304 ? 12.439 -69.342 -12.906 1.00 30.97  ? 676  PRO A CG  1 
ATOM   1733 C  CD  . PRO A 1 304 ? 12.190 -69.860 -14.339 1.00 31.77  ? 676  PRO A CD  1 
ATOM   1734 N  N   . LEU A 1 305 ? 8.384  -70.642 -13.641 1.00 31.57  ? 677  LEU A N   1 
ATOM   1735 C  CA  . LEU A 1 305 ? 6.923  -70.846 -13.666 1.00 32.45  ? 677  LEU A CA  1 
ATOM   1736 C  C   . LEU A 1 305 ? 6.523  -72.328 -13.611 1.00 32.92  ? 677  LEU A C   1 
ATOM   1737 O  O   . LEU A 1 305 ? 5.587  -72.700 -12.889 1.00 33.60  ? 677  LEU A O   1 
ATOM   1738 C  CB  . LEU A 1 305 ? 6.289  -70.161 -14.888 1.00 33.20  ? 677  LEU A CB  1 
ATOM   1739 C  CG  . LEU A 1 305 ? 4.756  -70.216 -15.023 1.00 34.43  ? 677  LEU A CG  1 
ATOM   1740 C  CD1 . LEU A 1 305 ? 4.036  -69.530 -13.838 1.00 32.84  ? 677  LEU A CD1 1 
ATOM   1741 C  CD2 . LEU A 1 305 ? 4.321  -69.605 -16.341 1.00 33.83  ? 677  LEU A CD2 1 
ATOM   1742 N  N   . THR A 1 306 ? 7.234  -73.174 -14.357 1.00 33.48  ? 678  THR A N   1 
ATOM   1743 C  CA  . THR A 1 306 ? 6.973  -74.628 -14.333 1.00 34.41  ? 678  THR A CA  1 
ATOM   1744 C  C   . THR A 1 306 ? 7.176  -75.225 -12.940 1.00 33.98  ? 678  THR A C   1 
ATOM   1745 O  O   . THR A 1 306 ? 6.380  -76.021 -12.479 1.00 35.35  ? 678  THR A O   1 
ATOM   1746 C  CB  . THR A 1 306 ? 7.866  -75.374 -15.332 1.00 35.16  ? 678  THR A CB  1 
ATOM   1747 O  OG1 . THR A 1 306 ? 7.808  -74.718 -16.600 1.00 36.54  ? 678  THR A OG1 1 
ATOM   1748 C  CG2 . THR A 1 306 ? 7.418  -76.817 -15.484 1.00 35.02  ? 678  THR A CG2 1 
ATOM   1749 N  N   . ILE A 1 307 ? 8.239  -74.818 -12.263 1.00 33.58  ? 679  ILE A N   1 
ATOM   1750 C  CA  . ILE A 1 307 ? 8.490  -75.278 -10.901 1.00 33.02  ? 679  ILE A CA  1 
ATOM   1751 C  C   . ILE A 1 307 ? 7.394  -74.768 -9.969  1.00 32.97  ? 679  ILE A C   1 
ATOM   1752 O  O   . ILE A 1 307 ? 6.948  -75.477 -9.058  1.00 33.70  ? 679  ILE A O   1 
ATOM   1753 C  CB  . ILE A 1 307 ? 9.903  -74.840 -10.434 1.00 32.06  ? 679  ILE A CB  1 
ATOM   1754 C  CG1 . ILE A 1 307 ? 10.953 -75.458 -11.362 1.00 32.23  ? 679  ILE A CG1 1 
ATOM   1755 C  CG2 . ILE A 1 307 ? 10.154 -75.202 -8.964  1.00 31.94  ? 679  ILE A CG2 1 
ATOM   1756 C  CD1 . ILE A 1 307 ? 12.342 -74.863 -11.262 1.00 30.73  ? 679  ILE A CD1 1 
ATOM   1757 N  N   . ALA A 1 308 ? 6.956  -73.537 -10.195 1.00 32.47  ? 680  ALA A N   1 
ATOM   1758 C  CA  . ALA A 1 308 ? 5.910  -72.962 -9.362  1.00 33.08  ? 680  ALA A CA  1 
ATOM   1759 C  C   . ALA A 1 308 ? 4.606  -73.762 -9.507  1.00 34.17  ? 680  ALA A C   1 
ATOM   1760 O  O   . ALA A 1 308 ? 3.950  -74.063 -8.522  1.00 34.26  ? 680  ALA A O   1 
ATOM   1761 C  CB  . ALA A 1 308 ? 5.702  -71.499 -9.720  1.00 32.44  ? 680  ALA A CB  1 
ATOM   1762 N  N   . MET A 1 309 ? 4.249  -74.106 -10.740 1.00 35.59  ? 681  MET A N   1 
ATOM   1763 C  CA  . MET A 1 309 ? 3.048  -74.905 -10.995 1.00 38.13  ? 681  MET A CA  1 
ATOM   1764 C  C   . MET A 1 309 ? 3.187  -76.294 -10.375 1.00 38.68  ? 681  MET A C   1 
ATOM   1765 O  O   . MET A 1 309 ? 2.292  -76.759 -9.672  1.00 39.39  ? 681  MET A O   1 
ATOM   1766 C  CB  . MET A 1 309 ? 2.768  -75.016 -12.495 1.00 38.56  ? 681  MET A CB  1 
ATOM   1767 C  CG  . MET A 1 309 ? 1.947  -73.861 -13.051 1.00 42.94  ? 681  MET A CG  1 
ATOM   1768 S  SD  . MET A 1 309 ? 0.195  -73.952 -12.563 1.00 50.93  ? 681  MET A SD  1 
ATOM   1769 C  CE  . MET A 1 309 ? -0.116 -72.236 -12.279 1.00 50.33  ? 681  MET A CE  1 
ATOM   1770 N  N   . GLU A 1 310 ? 4.327  -76.936 -10.626 1.00 38.22  ? 682  GLU A N   1 
ATOM   1771 C  CA  . GLU A 1 310 ? 4.564  -78.297 -10.160 1.00 38.79  ? 682  GLU A CA  1 
ATOM   1772 C  C   . GLU A 1 310 ? 4.634  -78.415 -8.646  1.00 38.28  ? 682  GLU A C   1 
ATOM   1773 O  O   . GLU A 1 310 ? 4.313  -79.469 -8.094  1.00 39.27  ? 682  GLU A O   1 
ATOM   1774 C  CB  . GLU A 1 310 ? 5.818  -78.878 -10.818 1.00 38.84  ? 682  GLU A CB  1 
ATOM   1775 C  CG  . GLU A 1 310 ? 5.588  -79.267 -12.291 1.00 41.47  ? 682  GLU A CG  1 
ATOM   1776 C  CD  . GLU A 1 310 ? 6.875  -79.626 -13.034 1.00 44.15  ? 682  GLU A CD  1 
ATOM   1777 O  OE1 . GLU A 1 310 ? 7.975  -79.569 -12.431 1.00 44.70  ? 682  GLU A OE1 1 
ATOM   1778 O  OE2 . GLU A 1 310 ? 6.783  -79.941 -14.237 1.00 46.68  ? 682  GLU A OE2 1 
ATOM   1779 N  N   . THR A 1 311 ? 5.035  -77.343 -7.973  1.00 36.72  ? 683  THR A N   1 
ATOM   1780 C  CA  . THR A 1 311 ? 5.027  -77.338 -6.510  1.00 37.43  ? 683  THR A CA  1 
ATOM   1781 C  C   . THR A 1 311 ? 3.693  -76.843 -5.932  1.00 38.25  ? 683  THR A C   1 
ATOM   1782 O  O   . THR A 1 311 ? 3.535  -76.754 -4.709  1.00 38.88  ? 683  THR A O   1 
ATOM   1783 C  CB  . THR A 1 311 ? 6.192  -76.524 -5.901  1.00 36.48  ? 683  THR A CB  1 
ATOM   1784 O  OG1 . THR A 1 311 ? 6.043  -75.142 -6.238  1.00 36.79  ? 683  THR A OG1 1 
ATOM   1785 C  CG2 . THR A 1 311 ? 7.548  -77.036 -6.398  1.00 35.61  ? 683  THR A CG2 1 
ATOM   1786 N  N   . ALA A 1 312 ? 2.735  -76.547 -6.814  1.00 38.43  ? 684  ALA A N   1 
ATOM   1787 C  CA  . ALA A 1 312 ? 1.422  -76.010 -6.420  1.00 39.63  ? 684  ALA A CA  1 
ATOM   1788 C  C   . ALA A 1 312 ? 1.534  -74.730 -5.559  1.00 39.02  ? 684  ALA A C   1 
ATOM   1789 O  O   . ALA A 1 312 ? 0.901  -74.610 -4.506  1.00 39.80  ? 684  ALA A O   1 
ATOM   1790 C  CB  . ALA A 1 312 ? 0.562  -77.101 -5.715  1.00 40.90  ? 684  ALA A CB  1 
ATOM   1791 N  N   . ASN A 1 313 ? 2.344  -73.781 -6.029  1.00 37.63  ? 685  ASN A N   1 
ATOM   1792 C  CA  . ASN A 1 313 ? 2.592  -72.535 -5.296  1.00 37.32  ? 685  ASN A CA  1 
ATOM   1793 C  C   . ASN A 1 313 ? 1.928  -71.338 -5.977  1.00 37.21  ? 685  ASN A C   1 
ATOM   1794 O  O   . ASN A 1 313 ? 2.537  -70.688 -6.822  1.00 36.97  ? 685  ASN A O   1 
ATOM   1795 C  CB  . ASN A 1 313 ? 4.103  -72.308 -5.134  1.00 35.50  ? 685  ASN A CB  1 
ATOM   1796 C  CG  . ASN A 1 313 ? 4.440  -71.205 -4.134  1.00 36.60  ? 685  ASN A CG  1 
ATOM   1797 O  OD1 . ASN A 1 313 ? 3.681  -70.255 -3.941  1.00 37.71  ? 685  ASN A OD1 1 
ATOM   1798 N  ND2 . ASN A 1 313 ? 5.611  -71.313 -3.517  1.00 36.28  ? 685  ASN A ND2 1 
ATOM   1799 N  N   . ALA A 1 314 ? 0.680  -71.064 -5.603  1.00 38.42  ? 686  ALA A N   1 
ATOM   1800 C  CA  . ALA A 1 314 ? -0.126 -69.997 -6.212  1.00 38.97  ? 686  ALA A CA  1 
ATOM   1801 C  C   . ALA A 1 314 ? 0.521  -68.607 -6.133  1.00 38.45  ? 686  ALA A C   1 
ATOM   1802 O  O   . ALA A 1 314 ? 0.435  -67.843 -7.085  1.00 38.32  ? 686  ALA A O   1 
ATOM   1803 C  CB  . ALA A 1 314 ? -1.514 -69.965 -5.596  1.00 40.91  ? 686  ALA A CB  1 
ATOM   1804 N  N   . ASP A 1 315 ? 1.166  -68.286 -5.007  1.00 37.92  ? 687  ASP A N   1 
ATOM   1805 C  CA  . ASP A 1 315 ? 1.831  -66.993 -4.858  1.00 37.60  ? 687  ASP A CA  1 
ATOM   1806 C  C   . ASP A 1 315 ? 2.961  -66.783 -5.866  1.00 35.62  ? 687  ASP A C   1 
ATOM   1807 O  O   . ASP A 1 315 ? 3.007  -65.747 -6.531  1.00 35.21  ? 687  ASP A O   1 
ATOM   1808 C  CB  . ASP A 1 315 ? 2.330  -66.791 -3.433  1.00 38.23  ? 687  ASP A CB  1 
ATOM   1809 C  CG  . ASP A 1 315 ? 1.192  -66.656 -2.433  1.00 43.12  ? 687  ASP A CG  1 
ATOM   1810 O  OD1 . ASP A 1 315 ? 0.015  -66.533 -2.846  1.00 46.11  ? 687  ASP A OD1 1 
ATOM   1811 O  OD2 . ASP A 1 315 ? 1.468  -66.672 -1.216  1.00 47.50  ? 687  ASP A OD2 1 
ATOM   1812 N  N   . ILE A 1 316 ? 3.841  -67.774 -6.012  1.00 33.79  ? 688  ILE A N   1 
ATOM   1813 C  CA  . ILE A 1 316 ? 4.975  -67.626 -6.922  1.00 31.84  ? 688  ILE A CA  1 
ATOM   1814 C  C   . ILE A 1 316 ? 4.534  -67.677 -8.388  1.00 31.94  ? 688  ILE A C   1 
ATOM   1815 O  O   . ILE A 1 316 ? 5.018  -66.899 -9.206  1.00 32.11  ? 688  ILE A O   1 
ATOM   1816 C  CB  . ILE A 1 316 ? 6.155  -68.564 -6.572  1.00 30.74  ? 688  ILE A CB  1 
ATOM   1817 C  CG1 . ILE A 1 316 ? 6.603  -68.285 -5.128  1.00 30.55  ? 688  ILE A CG1 1 
ATOM   1818 C  CG2 . ILE A 1 316 ? 7.322  -68.371 -7.548  1.00 28.77  ? 688  ILE A CG2 1 
ATOM   1819 C  CD1 . ILE A 1 316 ? 7.835  -69.049 -4.693  1.00 31.64  ? 688  ILE A CD1 1 
ATOM   1820 N  N   . VAL A 1 317 ? 3.583  -68.548 -8.715  1.00 32.24  ? 689  VAL A N   1 
ATOM   1821 C  CA  . VAL A 1 317 ? 2.965  -68.496 -10.046 1.00 32.62  ? 689  VAL A CA  1 
ATOM   1822 C  C   . VAL A 1 317 ? 2.459  -67.084 -10.345 1.00 33.77  ? 689  VAL A C   1 
ATOM   1823 O  O   . VAL A 1 317 ? 2.745  -66.535 -11.397 1.00 33.50  ? 689  VAL A O   1 
ATOM   1824 C  CB  . VAL A 1 317 ? 1.810  -69.512 -10.205 1.00 33.97  ? 689  VAL A CB  1 
ATOM   1825 C  CG1 . VAL A 1 317 ? 0.958  -69.197 -11.448 1.00 32.99  ? 689  VAL A CG1 1 
ATOM   1826 C  CG2 . VAL A 1 317 ? 2.368  -70.927 -10.253 1.00 32.53  ? 689  VAL A CG2 1 
ATOM   1827 N  N   . THR A 1 318 ? 1.725  -66.506 -9.398  1.00 35.50  ? 690  THR A N   1 
ATOM   1828 C  CA  . THR A 1 318 ? 1.204  -65.141 -9.537  1.00 37.74  ? 690  THR A CA  1 
ATOM   1829 C  C   . THR A 1 318 ? 2.314  -64.112 -9.785  1.00 37.22  ? 690  THR A C   1 
ATOM   1830 O  O   . THR A 1 318 ? 2.238  -63.345 -10.745 1.00 37.72  ? 690  THR A O   1 
ATOM   1831 C  CB  . THR A 1 318 ? 0.329  -64.755 -8.331  1.00 39.09  ? 690  THR A CB  1 
ATOM   1832 O  OG1 . THR A 1 318 ? -0.804 -65.625 -8.298  1.00 40.42  ? 690  THR A OG1 1 
ATOM   1833 C  CG2 . THR A 1 318 ? -0.170 -63.308 -8.441  1.00 41.46  ? 690  THR A CG2 1 
ATOM   1834 N  N   . LEU A 1 319 ? 3.343  -64.130 -8.938  1.00 36.22  ? 691  LEU A N   1 
ATOM   1835 C  CA  . LEU A 1 319 ? 4.517  -63.279 -9.108  1.00 36.36  ? 691  LEU A CA  1 
ATOM   1836 C  C   . LEU A 1 319 ? 5.095  -63.361 -10.512 1.00 36.21  ? 691  LEU A C   1 
ATOM   1837 O  O   . LEU A 1 319 ? 5.291  -62.331 -11.188 1.00 37.07  ? 691  LEU A O   1 
ATOM   1838 C  CB  . LEU A 1 319 ? 5.612  -63.706 -8.146  1.00 35.00  ? 691  LEU A CB  1 
ATOM   1839 C  CG  . LEU A 1 319 ? 5.708  -63.196 -6.722  1.00 37.45  ? 691  LEU A CG  1 
ATOM   1840 C  CD1 . LEU A 1 319 ? 7.069  -63.680 -6.209  1.00 38.09  ? 691  LEU A CD1 1 
ATOM   1841 C  CD2 . LEU A 1 319 ? 5.614  -61.634 -6.663  1.00 40.00  ? 691  LEU A CD2 1 
ATOM   1842 N  N   . LEU A 1 320 ? 5.359  -64.593 -10.946 1.00 35.06  ? 692  LEU A N   1 
ATOM   1843 C  CA  . LEU A 1 320 ? 6.080  -64.842 -12.184 1.00 35.14  ? 692  LEU A CA  1 
ATOM   1844 C  C   . LEU A 1 320 ? 5.270  -64.428 -13.379 1.00 37.17  ? 692  LEU A C   1 
ATOM   1845 O  O   . LEU A 1 320 ? 5.786  -63.875 -14.339 1.00 37.72  ? 692  LEU A O   1 
ATOM   1846 C  CB  . LEU A 1 320 ? 6.456  -66.329 -12.289 1.00 33.90  ? 692  LEU A CB  1 
ATOM   1847 C  CG  . LEU A 1 320 ? 7.498  -66.764 -11.268 1.00 31.88  ? 692  LEU A CG  1 
ATOM   1848 C  CD1 . LEU A 1 320 ? 7.653  -68.288 -11.286 1.00 31.11  ? 692  LEU A CD1 1 
ATOM   1849 C  CD2 . LEU A 1 320 ? 8.825  -66.065 -11.519 1.00 28.19  ? 692  LEU A CD2 1 
ATOM   1850 N  N   . ARG A 1 321 ? 3.980  -64.699 -13.296 1.00 39.03  ? 693  ARG A N   1 
ATOM   1851 C  CA  . ARG A 1 321 ? 3.052  -64.329 -14.335 1.00 42.06  ? 693  ARG A CA  1 
ATOM   1852 C  C   . ARG A 1 321 ? 2.940  -62.802 -14.406 1.00 43.66  ? 693  ARG A C   1 
ATOM   1853 O  O   . ARG A 1 321 ? 2.928  -62.232 -15.498 1.00 44.81  ? 693  ARG A O   1 
ATOM   1854 C  CB  . ARG A 1 321 ? 1.706  -64.991 -14.054 1.00 43.12  ? 693  ARG A CB  1 
ATOM   1855 C  CG  . ARG A 1 321 ? 0.836  -65.206 -15.265 1.00 48.08  ? 693  ARG A CG  1 
ATOM   1856 C  CD  . ARG A 1 321 ? 1.234  -66.431 -16.079 1.00 50.11  ? 693  ARG A CD  1 
ATOM   1857 N  NE  . ARG A 1 321 ? 2.194  -66.114 -17.130 1.00 53.11  ? 693  ARG A NE  1 
ATOM   1858 C  CZ  . ARG A 1 321 ? 1.882  -65.626 -18.331 1.00 56.90  ? 693  ARG A CZ  1 
ATOM   1859 N  NH1 . ARG A 1 321 ? 0.619  -65.373 -18.666 1.00 58.24  ? 693  ARG A NH1 1 
ATOM   1860 N  NH2 . ARG A 1 321 ? 2.854  -65.384 -19.205 1.00 59.16  ? 693  ARG A NH2 1 
ATOM   1861 N  N   . LEU A 1 322 ? 2.887  -62.148 -13.244 1.00 43.76  ? 694  LEU A N   1 
ATOM   1862 C  CA  . LEU A 1 322 ? 2.870  -60.688 -13.185 1.00 46.16  ? 694  LEU A CA  1 
ATOM   1863 C  C   . LEU A 1 322 ? 4.167  -60.069 -13.726 1.00 46.30  ? 694  LEU A C   1 
ATOM   1864 O  O   . LEU A 1 322 ? 4.119  -59.080 -14.459 1.00 47.71  ? 694  LEU A O   1 
ATOM   1865 C  CB  . LEU A 1 322 ? 2.600  -60.188 -11.756 1.00 46.32  ? 694  LEU A CB  1 
ATOM   1866 C  CG  . LEU A 1 322 ? 1.149  -60.143 -11.264 1.00 47.89  ? 694  LEU A CG  1 
ATOM   1867 C  CD1 . LEU A 1 322 ? 1.066  -59.566 -9.858  1.00 48.01  ? 694  LEU A CD1 1 
ATOM   1868 C  CD2 . LEU A 1 322 ? 0.256  -59.357 -12.216 1.00 50.43  ? 694  LEU A CD2 1 
ATOM   1869 N  N   . ALA A 1 323 ? 5.307  -60.668 -13.370 1.00 44.84  ? 695  ALA A N   1 
ATOM   1870 C  CA  . ALA A 1 323 ? 6.620  -60.236 -13.853 1.00 44.90  ? 695  ALA A CA  1 
ATOM   1871 C  C   . ALA A 1 323 ? 6.734  -60.316 -15.375 1.00 47.22  ? 695  ALA A C   1 
ATOM   1872 O  O   . ALA A 1 323 ? 7.417  -59.500 -15.995 1.00 48.02  ? 695  ALA A O   1 
ATOM   1873 C  CB  . ALA A 1 323 ? 7.704  -61.050 -13.203 1.00 42.20  ? 695  ALA A CB  1 
ATOM   1874 N  N   . LYS A 1 324 ? 6.066  -61.298 -15.972 1.00 48.67  ? 696  LYS A N   1 
ATOM   1875 C  CA  . LYS A 1 324 ? 6.051  -61.435 -17.420 1.00 51.65  ? 696  LYS A CA  1 
ATOM   1876 C  C   . LYS A 1 324 ? 5.274  -60.293 -18.079 1.00 55.21  ? 696  LYS A C   1 
ATOM   1877 O  O   . LYS A 1 324 ? 5.602  -59.873 -19.183 1.00 57.01  ? 696  LYS A O   1 
ATOM   1878 C  CB  . LYS A 1 324 ? 5.454  -62.784 -17.827 1.00 51.48  ? 696  LYS A CB  1 
ATOM   1879 C  CG  . LYS A 1 324 ? 5.600  -63.127 -19.309 1.00 54.49  ? 696  LYS A CG  1 
ATOM   1880 C  CD  . LYS A 1 324 ? 7.043  -63.504 -19.639 1.00 56.70  ? 696  LYS A CD  1 
ATOM   1881 C  CE  . LYS A 1 324 ? 7.205  -63.856 -21.109 1.00 60.42  ? 696  LYS A CE  1 
ATOM   1882 N  NZ  . LYS A 1 324 ? 8.631  -63.689 -21.517 1.00 61.59  ? 696  LYS A NZ  1 
ATOM   1883 N  N   . MET A 1 325 ? 4.230  -59.817 -17.403 1.00 57.02  ? 697  MET A N   1 
ATOM   1884 C  CA  . MET A 1 325 ? 3.457  -58.663 -17.854 1.00 60.11  ? 697  MET A CA  1 
ATOM   1885 C  C   . MET A 1 325 ? 4.252  -57.401 -17.552 1.00 60.69  ? 697  MET A C   1 
ATOM   1886 O  O   . MET A 1 325 ? 4.565  -56.634 -18.453 1.00 62.73  ? 697  MET A O   1 
ATOM   1887 C  CB  . MET A 1 325 ? 2.105  -58.622 -17.131 1.00 61.31  ? 697  MET A CB  1 
ATOM   1888 C  CG  . MET A 1 325 ? 1.275  -57.361 -17.382 1.00 65.43  ? 697  MET A CG  1 
ATOM   1889 S  SD  . MET A 1 325 ? -0.159 -57.184 -16.279 1.00 67.23  ? 697  MET A SD  1 
ATOM   1890 C  CE  . MET A 1 325 ? -0.958 -55.736 -17.000 1.00 73.26  ? 697  MET A CE  1 
ATOM   1891 N  N   . VAL B 1 32  ? 41.006 -41.424 -11.933 1.00 64.09  ? 404  VAL B N   1 
ATOM   1892 C  CA  . VAL B 1 32  ? 40.334 -40.694 -10.816 1.00 62.71  ? 404  VAL B CA  1 
ATOM   1893 C  C   . VAL B 1 32  ? 38.957 -40.187 -11.241 1.00 59.04  ? 404  VAL B C   1 
ATOM   1894 O  O   . VAL B 1 32  ? 38.839 -39.404 -12.204 1.00 58.82  ? 404  VAL B O   1 
ATOM   1895 C  CB  . VAL B 1 32  ? 41.215 -39.518 -10.235 1.00 64.49  ? 404  VAL B CB  1 
ATOM   1896 C  CG1 . VAL B 1 32  ? 41.620 -38.492 -11.326 1.00 64.19  ? 404  VAL B CG1 1 
ATOM   1897 C  CG2 . VAL B 1 32  ? 40.505 -38.833 -9.051  1.00 64.02  ? 404  VAL B CG2 1 
ATOM   1898 N  N   . GLY B 1 33  ? 37.926 -40.654 -10.527 1.00 56.26  ? 405  GLY B N   1 
ATOM   1899 C  CA  . GLY B 1 33  ? 36.569 -40.152 -10.682 1.00 51.07  ? 405  GLY B CA  1 
ATOM   1900 C  C   . GLY B 1 33  ? 36.371 -38.882 -9.868  1.00 49.02  ? 405  GLY B C   1 
ATOM   1901 O  O   . GLY B 1 33  ? 35.428 -38.770 -9.078  1.00 47.96  ? 405  GLY B O   1 
ATOM   1902 N  N   . HIS B 1 34  ? 37.265 -37.916 -10.055 1.00 48.18  ? 406  HIS B N   1 
ATOM   1903 C  CA  . HIS B 1 34  ? 37.139 -36.637 -9.371  1.00 46.81  ? 406  HIS B CA  1 
ATOM   1904 C  C   . HIS B 1 34  ? 35.902 -35.858 -9.825  1.00 42.26  ? 406  HIS B C   1 
ATOM   1905 O  O   . HIS B 1 34  ? 35.234 -35.236 -9.013  1.00 41.43  ? 406  HIS B O   1 
ATOM   1906 C  CB  . HIS B 1 34  ? 38.392 -35.793 -9.541  1.00 49.48  ? 406  HIS B CB  1 
ATOM   1907 C  CG  . HIS B 1 34  ? 38.501 -34.686 -8.538  1.00 55.50  ? 406  HIS B CG  1 
ATOM   1908 N  ND1 . HIS B 1 34  ? 38.671 -33.362 -8.898  1.00 59.92  ? 406  HIS B ND1 1 
ATOM   1909 C  CD2 . HIS B 1 34  ? 38.435 -34.702 -7.182  1.00 60.26  ? 406  HIS B CD2 1 
ATOM   1910 C  CE1 . HIS B 1 34  ? 38.728 -32.614 -7.808  1.00 62.45  ? 406  HIS B CE1 1 
ATOM   1911 N  NE2 . HIS B 1 34  ? 38.583 -33.402 -6.753  1.00 63.66  ? 406  HIS B NE2 1 
ATOM   1912 N  N   . VAL B 1 35  ? 35.583 -35.929 -11.114 1.00 38.27  ? 407  VAL B N   1 
ATOM   1913 C  CA  . VAL B 1 35  ? 34.504 -35.138 -11.671 1.00 34.46  ? 407  VAL B CA  1 
ATOM   1914 C  C   . VAL B 1 35  ? 33.143 -35.493 -11.060 1.00 31.81  ? 407  VAL B C   1 
ATOM   1915 O  O   . VAL B 1 35  ? 32.413 -34.604 -10.629 1.00 30.52  ? 407  VAL B O   1 
ATOM   1916 C  CB  . VAL B 1 35  ? 34.466 -35.252 -13.217 1.00 34.20  ? 407  VAL B CB  1 
ATOM   1917 C  CG1 . VAL B 1 35  ? 33.160 -34.673 -13.781 1.00 30.65  ? 407  VAL B CG1 1 
ATOM   1918 C  CG2 . VAL B 1 35  ? 35.690 -34.559 -13.813 1.00 34.78  ? 407  VAL B CG2 1 
ATOM   1919 N  N   . VAL B 1 36  ? 32.819 -36.784 -11.036 1.00 30.22  ? 408  VAL B N   1 
ATOM   1920 C  CA  . VAL B 1 36  ? 31.578 -37.277 -10.449 1.00 28.35  ? 408  VAL B CA  1 
ATOM   1921 C  C   . VAL B 1 36  ? 31.514 -36.956 -8.946  1.00 29.04  ? 408  VAL B C   1 
ATOM   1922 O  O   . VAL B 1 36  ? 30.487 -36.462 -8.469  1.00 27.54  ? 408  VAL B O   1 
ATOM   1923 C  CB  . VAL B 1 36  ? 31.332 -38.798 -10.763 1.00 28.95  ? 408  VAL B CB  1 
ATOM   1924 C  CG1 . VAL B 1 36  ? 32.330 -39.705 -10.053 1.00 30.09  ? 408  VAL B CG1 1 
ATOM   1925 C  CG2 . VAL B 1 36  ? 29.890 -39.212 -10.430 1.00 27.48  ? 408  VAL B CG2 1 
ATOM   1926 N  N   . ALA B 1 37  ? 32.606 -37.181 -8.217  1.00 30.21  ? 409  ALA B N   1 
ATOM   1927 C  CA  . ALA B 1 37  ? 32.628 -36.824 -6.805  1.00 32.02  ? 409  ALA B CA  1 
ATOM   1928 C  C   . ALA B 1 37  ? 32.312 -35.343 -6.646  1.00 32.12  ? 409  ALA B C   1 
ATOM   1929 O  O   . ALA B 1 37  ? 31.395 -34.975 -5.913  1.00 32.20  ? 409  ALA B O   1 
ATOM   1930 C  CB  . ALA B 1 37  ? 33.962 -37.165 -6.168  1.00 34.39  ? 409  ALA B CB  1 
ATOM   1931 N  N   . GLN B 1 38  ? 33.026 -34.500 -7.386  1.00 32.41  ? 410  GLN B N   1 
ATOM   1932 C  CA  . GLN B 1 38  ? 32.854 -33.062 -7.257  1.00 33.38  ? 410  GLN B CA  1 
ATOM   1933 C  C   . GLN B 1 38  ? 31.450 -32.595 -7.664  1.00 31.17  ? 410  GLN B C   1 
ATOM   1934 O  O   . GLN B 1 38  ? 30.806 -31.868 -6.916  1.00 31.56  ? 410  GLN B O   1 
ATOM   1935 C  CB  . GLN B 1 38  ? 33.925 -32.331 -8.046  1.00 34.27  ? 410  GLN B CB  1 
ATOM   1936 C  CG  . GLN B 1 38  ? 33.981 -30.852 -7.746  1.00 39.43  ? 410  GLN B CG  1 
ATOM   1937 C  CD  . GLN B 1 38  ? 35.279 -30.181 -8.224  1.00 45.42  ? 410  GLN B CD  1 
ATOM   1938 O  OE1 . GLN B 1 38  ? 36.235 -30.842 -8.676  1.00 45.53  ? 410  GLN B OE1 1 
ATOM   1939 N  NE2 . GLN B 1 38  ? 35.313 -28.853 -8.112  1.00 47.93  ? 410  GLN B NE2 1 
ATOM   1940 N  N   . VAL B 1 39  ? 30.975 -33.030 -8.830  1.00 29.31  ? 411  VAL B N   1 
ATOM   1941 C  CA  . VAL B 1 39  ? 29.668 -32.615 -9.332  1.00 27.95  ? 411  VAL B CA  1 
ATOM   1942 C  C   . VAL B 1 39  ? 28.522 -33.202 -8.497  1.00 28.57  ? 411  VAL B C   1 
ATOM   1943 O  O   . VAL B 1 39  ? 27.566 -32.494 -8.180  1.00 28.68  ? 411  VAL B O   1 
ATOM   1944 C  CB  . VAL B 1 39  ? 29.490 -32.928 -10.864 1.00 27.04  ? 411  VAL B CB  1 
ATOM   1945 C  CG1 . VAL B 1 39  ? 28.038 -32.670 -11.335 1.00 22.89  ? 411  VAL B CG1 1 
ATOM   1946 C  CG2 . VAL B 1 39  ? 30.490 -32.094 -11.694 1.00 25.61  ? 411  VAL B CG2 1 
ATOM   1947 N  N   . GLN B 1 40  ? 28.628 -34.472 -8.105  1.00 29.14  ? 412  GLN B N   1 
ATOM   1948 C  CA  . GLN B 1 40  ? 27.580 -35.085 -7.281  1.00 29.35  ? 412  GLN B CA  1 
ATOM   1949 C  C   . GLN B 1 40  ? 27.493 -34.520 -5.867  1.00 31.35  ? 412  GLN B C   1 
ATOM   1950 O  O   . GLN B 1 40  ? 26.451 -34.652 -5.211  1.00 31.41  ? 412  GLN B O   1 
ATOM   1951 C  CB  . GLN B 1 40  ? 27.772 -36.586 -7.169  1.00 29.69  ? 412  GLN B CB  1 
ATOM   1952 C  CG  . GLN B 1 40  ? 27.175 -37.406 -8.288  1.00 28.40  ? 412  GLN B CG  1 
ATOM   1953 C  CD  . GLN B 1 40  ? 27.356 -38.902 -8.055  1.00 29.48  ? 412  GLN B CD  1 
ATOM   1954 O  OE1 . GLN B 1 40  ? 26.916 -39.713 -8.865  1.00 27.98  ? 412  GLN B OE1 1 
ATOM   1955 N  NE2 . GLN B 1 40  ? 27.974 -39.271 -6.918  1.00 28.90  ? 412  GLN B NE2 1 
ATOM   1956 N  N   . SER B 1 41  ? 28.568 -33.926 -5.364  1.00 33.12  ? 413  SER B N   1 
ATOM   1957 C  CA  . SER B 1 41  ? 28.484 -33.384 -4.010  1.00 35.53  ? 413  SER B CA  1 
ATOM   1958 C  C   . SER B 1 41  ? 28.071 -31.918 -3.919  1.00 36.38  ? 413  SER B C   1 
ATOM   1959 O  O   . SER B 1 41  ? 28.012 -31.348 -2.840  1.00 38.56  ? 413  SER B O   1 
ATOM   1960 C  CB  . SER B 1 41  ? 29.687 -33.747 -3.138  1.00 37.88  ? 413  SER B CB  1 
ATOM   1961 O  OG  . SER B 1 41  ? 30.897 -33.704 -3.829  1.00 39.43  ? 413  SER B OG  1 
ATOM   1962 N  N   . VAL B 1 42  ? 27.738 -31.321 -5.058  1.00 35.85  ? 414  VAL B N   1 
ATOM   1963 C  CA  . VAL B 1 42  ? 26.998 -30.063 -5.084  1.00 36.78  ? 414  VAL B CA  1 
ATOM   1964 C  C   . VAL B 1 42  ? 25.604 -30.249 -4.447  1.00 37.10  ? 414  VAL B C   1 
ATOM   1965 O  O   . VAL B 1 42  ? 24.952 -31.287 -4.634  1.00 35.34  ? 414  VAL B O   1 
ATOM   1966 C  CB  . VAL B 1 42  ? 26.823 -29.561 -6.535  1.00 35.45  ? 414  VAL B CB  1 
ATOM   1967 C  CG1 . VAL B 1 42  ? 25.897 -28.356 -6.599  1.00 35.84  ? 414  VAL B CG1 1 
ATOM   1968 C  CG2 . VAL B 1 42  ? 28.166 -29.235 -7.152  1.00 36.19  ? 414  VAL B CG2 1 
ATOM   1969 N  N   . ASP B 1 43  ? 25.171 -29.225 -3.707  1.00 39.32  ? 415  ASP B N   1 
ATOM   1970 C  CA  . ASP B 1 43  ? 23.855 -29.151 -3.053  1.00 39.80  ? 415  ASP B CA  1 
ATOM   1971 C  C   . ASP B 1 43  ? 22.723 -29.720 -3.902  1.00 36.90  ? 415  ASP B C   1 
ATOM   1972 O  O   . ASP B 1 43  ? 22.378 -29.184 -4.983  1.00 35.55  ? 415  ASP B O   1 
ATOM   1973 C  CB  . ASP B 1 43  ? 23.556 -27.699 -2.637  1.00 42.56  ? 415  ASP B CB  1 
ATOM   1974 C  CG  . ASP B 1 43  ? 22.256 -27.561 -1.833  1.00 46.65  ? 415  ASP B CG  1 
ATOM   1975 O  OD1 . ASP B 1 43  ? 21.873 -28.527 -1.123  1.00 51.07  ? 415  ASP B OD1 1 
ATOM   1976 O  OD2 . ASP B 1 43  ? 21.623 -26.477 -1.907  1.00 49.86  ? 415  ASP B OD2 1 
ATOM   1977 N  N   . GLY B 1 44  ? 22.180 -30.841 -3.421  1.00 35.76  ? 416  GLY B N   1 
ATOM   1978 C  CA  . GLY B 1 44  ? 21.108 -31.552 -4.123  1.00 32.81  ? 416  GLY B CA  1 
ATOM   1979 C  C   . GLY B 1 44  ? 21.488 -32.378 -5.348  1.00 30.52  ? 416  GLY B C   1 
ATOM   1980 O  O   . GLY B 1 44  ? 20.604 -32.927 -6.018  1.00 29.76  ? 416  GLY B O   1 
ATOM   1981 N  N   . ASN B 1 45  ? 22.780 -32.497 -5.658  1.00 29.55  ? 417  ASN B N   1 
ATOM   1982 C  CA  . ASN B 1 45  ? 23.173 -33.198 -6.896  1.00 27.80  ? 417  ASN B CA  1 
ATOM   1983 C  C   . ASN B 1 45  ? 23.256 -34.721 -6.799  1.00 27.52  ? 417  ASN B C   1 
ATOM   1984 O  O   . ASN B 1 45  ? 23.371 -35.395 -7.819  1.00 26.79  ? 417  ASN B O   1 
ATOM   1985 C  CB  . ASN B 1 45  ? 24.463 -32.618 -7.481  1.00 27.88  ? 417  ASN B CB  1 
ATOM   1986 C  CG  . ASN B 1 45  ? 24.206 -31.437 -8.384  1.00 25.85  ? 417  ASN B CG  1 
ATOM   1987 O  OD1 . ASN B 1 45  ? 23.114 -30.873 -8.373  1.00 25.86  ? 417  ASN B OD1 1 
ATOM   1988 N  ND2 . ASN B 1 45  ? 25.199 -31.068 -9.194  1.00 22.91  ? 417  ASN B ND2 1 
ATOM   1989 N  N   . ALA B 1 46  ? 23.166 -35.255 -5.580  1.00 28.03  ? 418  ALA B N   1 
ATOM   1990 C  CA  . ALA B 1 46  ? 23.226 -36.703 -5.368  1.00 28.34  ? 418  ALA B CA  1 
ATOM   1991 C  C   . ALA B 1 46  ? 21.860 -37.379 -5.545  1.00 28.02  ? 418  ALA B C   1 
ATOM   1992 O  O   . ALA B 1 46  ? 21.697 -38.569 -5.245  1.00 28.36  ? 418  ALA B O   1 
ATOM   1993 C  CB  . ALA B 1 46  ? 23.827 -37.019 -3.996  1.00 30.13  ? 418  ALA B CB  1 
ATOM   1994 N  N   . GLN B 1 47  ? 20.890 -36.605 -6.038  1.00 26.93  ? 419  GLN B N   1 
ATOM   1995 C  CA  . GLN B 1 47  ? 19.568 -37.105 -6.401  1.00 27.23  ? 419  GLN B CA  1 
ATOM   1996 C  C   . GLN B 1 47  ? 19.264 -36.584 -7.785  1.00 25.76  ? 419  GLN B C   1 
ATOM   1997 O  O   . GLN B 1 47  ? 19.425 -35.388 -8.046  1.00 24.93  ? 419  GLN B O   1 
ATOM   1998 C  CB  . GLN B 1 47  ? 18.486 -36.608 -5.431  1.00 27.60  ? 419  GLN B CB  1 
ATOM   1999 C  CG  . GLN B 1 47  ? 18.428 -37.357 -4.101  1.00 31.90  ? 419  GLN B CG  1 
ATOM   2000 C  CD  . GLN B 1 47  ? 19.477 -36.888 -3.105  1.00 33.50  ? 419  GLN B CD  1 
ATOM   2001 O  OE1 . GLN B 1 47  ? 19.780 -35.691 -3.014  1.00 34.23  ? 419  GLN B OE1 1 
ATOM   2002 N  NE2 . GLN B 1 47  ? 20.055 -37.834 -2.364  1.00 35.28  ? 419  GLN B NE2 1 
ATOM   2003 N  N   . CYS B 1 48  ? 18.837 -37.467 -8.681  1.00 25.84  ? 420  CYS B N   1 
ATOM   2004 C  CA  . CYS B 1 48  ? 18.434 -37.028 -10.025 1.00 25.01  ? 420  CYS B CA  1 
ATOM   2005 C  C   . CYS B 1 48  ? 17.526 -35.791 -9.937  1.00 25.43  ? 420  CYS B C   1 
ATOM   2006 O  O   . CYS B 1 48  ? 16.615 -35.737 -9.106  1.00 27.00  ? 420  CYS B O   1 
ATOM   2007 C  CB  . CYS B 1 48  ? 17.701 -38.146 -10.752 1.00 24.59  ? 420  CYS B CB  1 
ATOM   2008 S  SG  . CYS B 1 48  ? 17.030 -37.620 -12.360 1.00 23.59  ? 420  CYS B SG  1 
ATOM   2009 N  N   . CYS B 1 49  ? 17.781 -34.812 -10.793 1.00 25.45  ? 421  CYS B N   1 
ATOM   2010 C  CA  . CYS B 1 49  ? 17.011 -33.560 -10.866 1.00 25.75  ? 421  CYS B CA  1 
ATOM   2011 C  C   . CYS B 1 49  ? 15.525 -33.782 -11.148 1.00 26.24  ? 421  CYS B C   1 
ATOM   2012 O  O   . CYS B 1 49  ? 14.676 -33.111 -10.568 1.00 26.78  ? 421  CYS B O   1 
ATOM   2013 C  CB  . CYS B 1 49  ? 17.602 -32.655 -11.946 1.00 24.97  ? 421  CYS B CB  1 
ATOM   2014 S  SG  . CYS B 1 49  ? 16.990 -30.948 -11.996 1.00 29.18  ? 421  CYS B SG  1 
ATOM   2015 N  N   . ASP B 1 50  ? 15.224 -34.720 -12.039 1.00 26.45  ? 422  ASP B N   1 
ATOM   2016 C  CA  . ASP B 1 50  ? 13.856 -34.936 -12.525 1.00 27.22  ? 422  ASP B CA  1 
ATOM   2017 C  C   . ASP B 1 50  ? 13.029 -35.998 -11.780 1.00 28.10  ? 422  ASP B C   1 
ATOM   2018 O  O   . ASP B 1 50  ? 11.801 -35.897 -11.762 1.00 29.24  ? 422  ASP B O   1 
ATOM   2019 C  CB  . ASP B 1 50  ? 13.886 -35.225 -14.020 1.00 27.87  ? 422  ASP B CB  1 
ATOM   2020 C  CG  . ASP B 1 50  ? 14.506 -34.087 -14.816 1.00 28.51  ? 422  ASP B CG  1 
ATOM   2021 O  OD1 . ASP B 1 50  ? 14.524 -32.939 -14.333 1.00 27.83  ? 422  ASP B OD1 1 
ATOM   2022 O  OD2 . ASP B 1 50  ? 14.993 -34.337 -15.933 1.00 31.55  ? 422  ASP B OD2 1 
ATOM   2023 N  N   . CYS B 1 51  ? 13.685 -36.989 -11.148 1.00 27.22  ? 423  CYS B N   1 
ATOM   2024 C  CA  . CYS B 1 51  ? 12.968 -38.088 -10.469 1.00 27.45  ? 423  CYS B CA  1 
ATOM   2025 C  C   . CYS B 1 51  ? 13.540 -38.491 -9.103  1.00 27.46  ? 423  CYS B C   1 
ATOM   2026 O  O   . CYS B 1 51  ? 12.997 -39.365 -8.448  1.00 28.37  ? 423  CYS B O   1 
ATOM   2027 C  CB  . CYS B 1 51  ? 12.905 -39.325 -11.350 1.00 27.23  ? 423  CYS B CB  1 
ATOM   2028 S  SG  . CYS B 1 51  ? 14.429 -40.343 -11.260 1.00 28.22  ? 423  CYS B SG  1 
ATOM   2029 N  N   . ARG B 1 52  ? 14.641 -37.862 -8.694  1.00 27.03  ? 424  ARG B N   1 
ATOM   2030 C  CA  . ARG B 1 52  ? 15.281 -38.114 -7.388  1.00 27.42  ? 424  ARG B CA  1 
ATOM   2031 C  C   . ARG B 1 52  ? 16.007 -39.450 -7.265  1.00 27.41  ? 424  ARG B C   1 
ATOM   2032 O  O   . ARG B 1 52  ? 16.418 -39.815 -6.171  1.00 28.38  ? 424  ARG B O   1 
ATOM   2033 C  CB  . ARG B 1 52  ? 14.305 -37.913 -6.206  1.00 28.72  ? 424  ARG B CB  1 
ATOM   2034 C  CG  . ARG B 1 52  ? 13.778 -36.470 -6.098  1.00 29.84  ? 424  ARG B CG  1 
ATOM   2035 C  CD  . ARG B 1 52  ? 13.033 -36.180 -4.784  1.00 33.57  ? 424  ARG B CD  1 
ATOM   2036 N  NE  . ARG B 1 52  ? 13.883 -36.429 -3.618  1.00 39.06  ? 424  ARG B NE  1 
ATOM   2037 C  CZ  . ARG B 1 52  ? 14.788 -35.575 -3.117  1.00 39.31  ? 424  ARG B CZ  1 
ATOM   2038 N  NH1 . ARG B 1 52  ? 14.991 -34.380 -3.659  1.00 38.16  ? 424  ARG B NH1 1 
ATOM   2039 N  NH2 . ARG B 1 52  ? 15.497 -35.918 -2.056  1.00 41.03  ? 424  ARG B NH2 1 
ATOM   2040 N  N   . GLU B 1 53  ? 16.169 -40.171 -8.368  1.00 26.53  ? 425  GLU B N   1 
ATOM   2041 C  CA  . GLU B 1 53  ? 17.039 -41.347 -8.365  1.00 28.20  ? 425  GLU B CA  1 
ATOM   2042 C  C   . GLU B 1 53  ? 18.417 -41.013 -7.752  1.00 27.29  ? 425  GLU B C   1 
ATOM   2043 O  O   . GLU B 1 53  ? 19.078 -40.072 -8.188  1.00 27.05  ? 425  GLU B O   1 
ATOM   2044 C  CB  . GLU B 1 53  ? 17.216 -41.906 -9.778  1.00 28.09  ? 425  GLU B CB  1 
ATOM   2045 C  CG  . GLU B 1 53  ? 18.072 -43.181 -9.867  1.00 30.56  ? 425  GLU B CG  1 
ATOM   2046 C  CD  . GLU B 1 53  ? 17.305 -44.446 -9.512  1.00 36.33  ? 425  GLU B CD  1 
ATOM   2047 O  OE1 . GLU B 1 53  ? 16.213 -44.686 -10.085 1.00 37.46  ? 425  GLU B OE1 1 
ATOM   2048 O  OE2 . GLU B 1 53  ? 17.816 -45.222 -8.676  1.00 39.50  ? 425  GLU B OE2 1 
ATOM   2049 N  N   . PRO B 1 54  ? 18.836 -41.777 -6.742  1.00 27.73  ? 426  PRO B N   1 
ATOM   2050 C  CA  . PRO B 1 54  ? 20.069 -41.520 -6.010  1.00 28.23  ? 426  PRO B CA  1 
ATOM   2051 C  C   . PRO B 1 54  ? 21.306 -41.654 -6.875  1.00 27.39  ? 426  PRO B C   1 
ATOM   2052 O  O   . PRO B 1 54  ? 21.329 -42.480 -7.778  1.00 27.24  ? 426  PRO B O   1 
ATOM   2053 C  CB  . PRO B 1 54  ? 20.097 -42.642 -4.943  1.00 30.12  ? 426  PRO B CB  1 
ATOM   2054 C  CG  . PRO B 1 54  ? 18.723 -43.145 -4.873  1.00 30.55  ? 426  PRO B CG  1 
ATOM   2055 C  CD  . PRO B 1 54  ? 18.131 -42.965 -6.226  1.00 29.63  ? 426  PRO B CD  1 
ATOM   2056 N  N   . ALA B 1 55  ? 22.333 -40.860 -6.564  1.00 27.32  ? 427  ALA B N   1 
ATOM   2057 C  CA  . ALA B 1 55  ? 23.645 -40.931 -7.240  1.00 26.85  ? 427  ALA B CA  1 
ATOM   2058 C  C   . ALA B 1 55  ? 23.558 -40.923 -8.788  1.00 25.04  ? 427  ALA B C   1 
ATOM   2059 O  O   . ALA B 1 55  ? 24.039 -41.820 -9.437  1.00 25.52  ? 427  ALA B O   1 
ATOM   2060 C  CB  . ALA B 1 55  ? 24.461 -42.154 -6.719  1.00 28.33  ? 427  ALA B CB  1 
ATOM   2061 N  N   . PRO B 1 56  ? 22.926 -39.898 -9.373  1.00 24.49  ? 428  PRO B N   1 
ATOM   2062 C  CA  . PRO B 1 56  ? 22.871 -39.771 -10.850 1.00 23.99  ? 428  PRO B CA  1 
ATOM   2063 C  C   . PRO B 1 56  ? 24.276 -39.592 -11.440 1.00 25.10  ? 428  PRO B C   1 
ATOM   2064 O  O   . PRO B 1 56  ? 25.102 -38.864 -10.873 1.00 24.25  ? 428  PRO B O   1 
ATOM   2065 C  CB  . PRO B 1 56  ? 22.065 -38.491 -11.052 1.00 22.25  ? 428  PRO B CB  1 
ATOM   2066 C  CG  . PRO B 1 56  ? 22.314 -37.696 -9.781  1.00 22.55  ? 428  PRO B CG  1 
ATOM   2067 C  CD  . PRO B 1 56  ? 22.302 -38.743 -8.704  1.00 23.47  ? 428  PRO B CD  1 
ATOM   2068 N  N   . GLU B 1 57  ? 24.535 -40.248 -12.574 1.00 26.77  ? 429  GLU B N   1 
ATOM   2069 C  CA  . GLU B 1 57  ? 25.875 -40.268 -13.185 1.00 28.37  ? 429  GLU B CA  1 
ATOM   2070 C  C   . GLU B 1 57  ? 25.943 -39.474 -14.477 1.00 27.93  ? 429  GLU B C   1 
ATOM   2071 O  O   . GLU B 1 57  ? 26.965 -39.478 -15.177 1.00 29.48  ? 429  GLU B O   1 
ATOM   2072 C  CB  . GLU B 1 57  ? 26.263 -41.701 -13.502 1.00 29.56  ? 429  GLU B CB  1 
ATOM   2073 C  CG  . GLU B 1 57  ? 26.544 -42.526 -12.301 1.00 35.19  ? 429  GLU B CG  1 
ATOM   2074 C  CD  . GLU B 1 57  ? 26.861 -43.962 -12.674 1.00 41.85  ? 429  GLU B CD  1 
ATOM   2075 O  OE1 . GLU B 1 57  ? 25.942 -44.670 -13.161 1.00 46.08  ? 429  GLU B OE1 1 
ATOM   2076 O  OE2 . GLU B 1 57  ? 28.024 -44.376 -12.479 1.00 44.42  ? 429  GLU B OE2 1 
ATOM   2077 N  N   . TRP B 1 58  ? 24.842 -38.829 -14.817 1.00 26.78  ? 430  TRP B N   1 
ATOM   2078 C  CA  . TRP B 1 58  ? 24.741 -38.127 -16.085 1.00 25.74  ? 430  TRP B CA  1 
ATOM   2079 C  C   . TRP B 1 58  ? 24.435 -36.685 -15.756 1.00 25.06  ? 430  TRP B C   1 
ATOM   2080 O  O   . TRP B 1 58  ? 24.197 -36.354 -14.608 1.00 23.05  ? 430  TRP B O   1 
ATOM   2081 C  CB  . TRP B 1 58  ? 23.655 -38.759 -16.964 1.00 26.10  ? 430  TRP B CB  1 
ATOM   2082 C  CG  . TRP B 1 58  ? 24.035 -40.114 -17.414 1.00 26.73  ? 430  TRP B CG  1 
ATOM   2083 C  CD1 . TRP B 1 58  ? 23.853 -41.300 -16.737 1.00 26.14  ? 430  TRP B CD1 1 
ATOM   2084 C  CD2 . TRP B 1 58  ? 24.730 -40.439 -18.626 1.00 26.65  ? 430  TRP B CD2 1 
ATOM   2085 N  NE1 . TRP B 1 58  ? 24.386 -42.350 -17.480 1.00 27.99  ? 430  TRP B NE1 1 
ATOM   2086 C  CE2 . TRP B 1 58  ? 24.942 -41.845 -18.628 1.00 28.46  ? 430  TRP B CE2 1 
ATOM   2087 C  CE3 . TRP B 1 58  ? 25.191 -39.682 -19.708 1.00 28.81  ? 430  TRP B CE3 1 
ATOM   2088 C  CZ2 . TRP B 1 58  ? 25.595 -42.508 -19.684 1.00 32.17  ? 430  TRP B CZ2 1 
ATOM   2089 C  CZ3 . TRP B 1 58  ? 25.838 -40.347 -20.785 1.00 31.32  ? 430  TRP B CZ3 1 
ATOM   2090 C  CH2 . TRP B 1 58  ? 26.031 -41.746 -20.756 1.00 32.48  ? 430  TRP B CH2 1 
ATOM   2091 N  N   . ALA B 1 59  ? 24.465 -35.822 -16.764 1.00 26.20  ? 431  ALA B N   1 
ATOM   2092 C  CA  . ALA B 1 59  ? 24.307 -34.404 -16.526 1.00 26.20  ? 431  ALA B CA  1 
ATOM   2093 C  C   . ALA B 1 59  ? 23.764 -33.726 -17.748 1.00 27.14  ? 431  ALA B C   1 
ATOM   2094 O  O   . ALA B 1 59  ? 23.937 -34.216 -18.871 1.00 28.29  ? 431  ALA B O   1 
ATOM   2095 C  CB  . ALA B 1 59  ? 25.651 -33.792 -16.148 1.00 26.85  ? 431  ALA B CB  1 
ATOM   2096 N  N   . SER B 1 60  ? 23.101 -32.597 -17.536 1.00 26.89  ? 432  SER B N   1 
ATOM   2097 C  CA  . SER B 1 60  ? 22.798 -31.691 -18.634 1.00 28.30  ? 432  SER B CA  1 
ATOM   2098 C  C   . SER B 1 60  ? 23.661 -30.454 -18.456 1.00 28.40  ? 432  SER B C   1 
ATOM   2099 O  O   . SER B 1 60  ? 23.584 -29.793 -17.425 1.00 28.41  ? 432  SER B O   1 
ATOM   2100 C  CB  . SER B 1 60  ? 21.321 -31.304 -18.645 1.00 28.58  ? 432  SER B CB  1 
ATOM   2101 O  OG  . SER B 1 60  ? 21.084 -30.271 -19.597 1.00 31.99  ? 432  SER B OG  1 
ATOM   2102 N  N   . ILE B 1 61  ? 24.478 -30.136 -19.455 1.00 29.25  ? 433  ILE B N   1 
ATOM   2103 C  CA  . ILE B 1 61  ? 25.485 -29.077 -19.280 1.00 29.85  ? 433  ILE B CA  1 
ATOM   2104 C  C   . ILE B 1 61  ? 25.007 -27.661 -19.582 1.00 31.23  ? 433  ILE B C   1 
ATOM   2105 O  O   . ILE B 1 61  ? 25.651 -26.701 -19.166 1.00 32.64  ? 433  ILE B O   1 
ATOM   2106 C  CB  . ILE B 1 61  ? 26.849 -29.382 -19.970 1.00 30.03  ? 433  ILE B CB  1 
ATOM   2107 C  CG1 . ILE B 1 61  ? 26.699 -29.519 -21.490 1.00 31.46  ? 433  ILE B CG1 1 
ATOM   2108 C  CG2 . ILE B 1 61  ? 27.466 -30.624 -19.333 1.00 29.97  ? 433  ILE B CG2 1 
ATOM   2109 C  CD1 . ILE B 1 61  ? 28.047 -29.585 -22.268 1.00 30.52  ? 433  ILE B CD1 1 
ATOM   2110 N  N   . ASN B 1 62  ? 23.895 -27.518 -20.291 1.00 31.32  ? 434  ASN B N   1 
ATOM   2111 C  CA  . ASN B 1 62  ? 23.343 -26.189 -20.491 1.00 33.03  ? 434  ASN B CA  1 
ATOM   2112 C  C   . ASN B 1 62  ? 22.382 -25.812 -19.366 1.00 32.00  ? 434  ASN B C   1 
ATOM   2113 O  O   . ASN B 1 62  ? 22.191 -24.626 -19.084 1.00 33.25  ? 434  ASN B O   1 
ATOM   2114 C  CB  . ASN B 1 62  ? 22.677 -26.061 -21.858 1.00 34.73  ? 434  ASN B CB  1 
ATOM   2115 C  CG  . ASN B 1 62  ? 21.573 -27.068 -22.050 1.00 34.96  ? 434  ASN B CG  1 
ATOM   2116 O  OD1 . ASN B 1 62  ? 21.699 -28.233 -21.647 1.00 34.45  ? 434  ASN B OD1 1 
ATOM   2117 N  ND2 . ASN B 1 62  ? 20.475 -26.631 -22.660 1.00 35.97  ? 434  ASN B ND2 1 
ATOM   2118 N  N   . LEU B 1 63  ? 21.805 -26.824 -18.712 1.00 30.11  ? 435  LEU B N   1 
ATOM   2119 C  CA  . LEU B 1 63  ? 20.921 -26.612 -17.572 1.00 28.75  ? 435  LEU B CA  1 
ATOM   2120 C  C   . LEU B 1 63  ? 21.665 -26.612 -16.243 1.00 27.72  ? 435  LEU B C   1 
ATOM   2121 O  O   . LEU B 1 63  ? 21.225 -25.996 -15.288 1.00 27.64  ? 435  LEU B O   1 
ATOM   2122 C  CB  . LEU B 1 63  ? 19.834 -27.675 -17.539 1.00 28.01  ? 435  LEU B CB  1 
ATOM   2123 C  CG  . LEU B 1 63  ? 18.877 -27.705 -18.733 1.00 29.79  ? 435  LEU B CG  1 
ATOM   2124 C  CD1 . LEU B 1 63  ? 18.087 -29.015 -18.694 1.00 25.67  ? 435  LEU B CD1 1 
ATOM   2125 C  CD2 . LEU B 1 63  ? 17.947 -26.444 -18.792 1.00 29.25  ? 435  LEU B CD2 1 
ATOM   2126 N  N   . GLY B 1 64  ? 22.784 -27.320 -16.183 1.00 27.23  ? 436  GLY B N   1 
ATOM   2127 C  CA  . GLY B 1 64  ? 23.596 -27.379 -14.971 1.00 26.12  ? 436  GLY B CA  1 
ATOM   2128 C  C   . GLY B 1 64  ? 23.062 -28.314 -13.918 1.00 25.08  ? 436  GLY B C   1 
ATOM   2129 O  O   . GLY B 1 64  ? 23.122 -28.000 -12.733 1.00 24.98  ? 436  GLY B O   1 
ATOM   2130 N  N   . VAL B 1 65  ? 22.571 -29.481 -14.348 1.00 24.42  ? 437  VAL B N   1 
ATOM   2131 C  CA  . VAL B 1 65  ? 21.886 -30.423 -13.449 1.00 23.43  ? 437  VAL B CA  1 
ATOM   2132 C  C   . VAL B 1 65  ? 22.433 -31.843 -13.590 1.00 23.20  ? 437  VAL B C   1 
ATOM   2133 O  O   . VAL B 1 65  ? 22.997 -32.181 -14.631 1.00 23.20  ? 437  VAL B O   1 
ATOM   2134 C  CB  . VAL B 1 65  ? 20.337 -30.470 -13.725 1.00 22.82  ? 437  VAL B CB  1 
ATOM   2135 C  CG1 . VAL B 1 65  ? 19.740 -29.124 -13.628 1.00 21.82  ? 437  VAL B CG1 1 
ATOM   2136 C  CG2 . VAL B 1 65  ? 20.044 -31.055 -15.114 1.00 23.74  ? 437  VAL B CG2 1 
ATOM   2137 N  N   . THR B 1 66  ? 22.239 -32.674 -12.559 1.00 23.33  ? 438  THR B N   1 
ATOM   2138 C  CA  . THR B 1 66  ? 22.543 -34.107 -12.668 1.00 23.46  ? 438  THR B CA  1 
ATOM   2139 C  C   . THR B 1 66  ? 21.289 -34.948 -12.893 1.00 23.80  ? 438  THR B C   1 
ATOM   2140 O  O   . THR B 1 66  ? 20.203 -34.652 -12.365 1.00 23.52  ? 438  THR B O   1 
ATOM   2141 C  CB  . THR B 1 66  ? 23.345 -34.629 -11.473 1.00 23.91  ? 438  THR B CB  1 
ATOM   2142 O  OG1 . THR B 1 66  ? 22.637 -34.342 -10.253 1.00 24.50  ? 438  THR B OG1 1 
ATOM   2143 C  CG2 . THR B 1 66  ? 24.726 -33.966 -11.432 1.00 23.48  ? 438  THR B CG2 1 
ATOM   2144 N  N   . LEU B 1 67  ? 21.458 -35.994 -13.698 1.00 24.33  ? 439  LEU B N   1 
ATOM   2145 C  CA  . LEU B 1 67  ? 20.369 -36.849 -14.171 1.00 24.34  ? 439  LEU B CA  1 
ATOM   2146 C  C   . LEU B 1 67  ? 20.706 -38.335 -14.050 1.00 25.22  ? 439  LEU B C   1 
ATOM   2147 O  O   . LEU B 1 67  ? 21.865 -38.739 -14.218 1.00 24.53  ? 439  LEU B O   1 
ATOM   2148 C  CB  . LEU B 1 67  ? 20.076 -36.543 -15.644 1.00 24.82  ? 439  LEU B CB  1 
ATOM   2149 C  CG  . LEU B 1 67  ? 19.632 -35.127 -16.011 1.00 25.68  ? 439  LEU B CG  1 
ATOM   2150 C  CD1 . LEU B 1 67  ? 19.748 -34.914 -17.524 1.00 22.83  ? 439  LEU B CD1 1 
ATOM   2151 C  CD2 . LEU B 1 67  ? 18.210 -34.842 -15.468 1.00 22.04  ? 439  LEU B CD2 1 
ATOM   2152 N  N   . CYS B 1 68  ? 19.687 -39.148 -13.788 1.00 25.86  ? 440  CYS B N   1 
ATOM   2153 C  CA  . CYS B 1 68  ? 19.869 -40.589 -13.757 1.00 28.44  ? 440  CYS B CA  1 
ATOM   2154 C  C   . CYS B 1 68  ? 19.919 -41.106 -15.198 1.00 29.73  ? 440  CYS B C   1 
ATOM   2155 O  O   . CYS B 1 68  ? 19.749 -40.328 -16.147 1.00 30.30  ? 440  CYS B O   1 
ATOM   2156 C  CB  . CYS B 1 68  ? 18.776 -41.275 -12.916 1.00 28.41  ? 440  CYS B CB  1 
ATOM   2157 S  SG  . CYS B 1 68  ? 17.137 -41.272 -13.693 1.00 30.68  ? 440  CYS B SG  1 
ATOM   2158 N  N   . ILE B 1 69  ? 20.188 -42.397 -15.370 1.00 31.79  ? 441  ILE B N   1 
ATOM   2159 C  CA  . ILE B 1 69  ? 20.305 -42.983 -16.711 1.00 34.02  ? 441  ILE B CA  1 
ATOM   2160 C  C   . ILE B 1 69  ? 19.000 -42.817 -17.477 1.00 34.81  ? 441  ILE B C   1 
ATOM   2161 O  O   . ILE B 1 69  ? 19.000 -42.432 -18.646 1.00 35.70  ? 441  ILE B O   1 
ATOM   2162 C  CB  . ILE B 1 69  ? 20.654 -44.501 -16.665 1.00 36.44  ? 441  ILE B CB  1 
ATOM   2163 C  CG1 . ILE B 1 69  ? 21.665 -44.790 -15.549 1.00 37.99  ? 441  ILE B CG1 1 
ATOM   2164 C  CG2 . ILE B 1 69  ? 21.172 -45.006 -18.040 1.00 37.65  ? 441  ILE B CG2 1 
ATOM   2165 C  CD1 . ILE B 1 69  ? 21.778 -46.310 -15.156 1.00 43.27  ? 441  ILE B CD1 1 
ATOM   2166 N  N   . GLN B 1 70  ? 17.888 -43.109 -16.807 1.00 35.05  ? 442  GLN B N   1 
ATOM   2167 C  CA  . GLN B 1 70  ? 16.568 -43.064 -17.433 1.00 35.85  ? 442  GLN B CA  1 
ATOM   2168 C  C   . GLN B 1 70  ? 16.236 -41.645 -17.877 1.00 34.24  ? 442  GLN B C   1 
ATOM   2169 O  O   . GLN B 1 70  ? 15.858 -41.400 -19.023 1.00 35.38  ? 442  GLN B O   1 
ATOM   2170 C  CB  . GLN B 1 70  ? 15.524 -43.570 -16.443 1.00 36.60  ? 442  GLN B CB  1 
ATOM   2171 C  CG  . GLN B 1 70  ? 14.145 -43.758 -17.020 1.00 39.71  ? 442  GLN B CG  1 
ATOM   2172 C  CD  . GLN B 1 70  ? 13.362 -44.789 -16.244 1.00 43.01  ? 442  GLN B CD  1 
ATOM   2173 O  OE1 . GLN B 1 70  ? 13.338 -44.765 -15.011 1.00 43.72  ? 442  GLN B OE1 1 
ATOM   2174 N  NE2 . GLN B 1 70  ? 12.725 -45.709 -16.958 1.00 44.71  ? 442  GLN B NE2 1 
ATOM   2175 N  N   . CYS B 1 71  ? 16.417 -40.705 -16.967 1.00 32.25  ? 443  CYS B N   1 
ATOM   2176 C  CA  . CYS B 1 71  ? 16.056 -39.331 -17.235 1.00 31.30  ? 443  CYS B CA  1 
ATOM   2177 C  C   . CYS B 1 71  ? 16.974 -38.708 -18.269 1.00 31.06  ? 443  CYS B C   1 
ATOM   2178 O  O   . CYS B 1 71  ? 16.500 -37.962 -19.111 1.00 31.84  ? 443  CYS B O   1 
ATOM   2179 C  CB  . CYS B 1 71  ? 15.971 -38.516 -15.939 1.00 29.72  ? 443  CYS B CB  1 
ATOM   2180 S  SG  . CYS B 1 71  ? 14.516 -38.964 -14.908 1.00 28.97  ? 443  CYS B SG  1 
ATOM   2181 N  N   . SER B 1 72  ? 18.269 -39.043 -18.229 1.00 30.61  ? 444  SER B N   1 
ATOM   2182 C  CA  . SER B 1 72  ? 19.222 -38.502 -19.195 1.00 30.82  ? 444  SER B CA  1 
ATOM   2183 C  C   . SER B 1 72  ? 18.863 -39.011 -20.585 1.00 32.55  ? 444  SER B C   1 
ATOM   2184 O  O   . SER B 1 72  ? 18.934 -38.261 -21.569 1.00 33.40  ? 444  SER B O   1 
ATOM   2185 C  CB  . SER B 1 72  ? 20.676 -38.847 -18.824 1.00 30.08  ? 444  SER B CB  1 
ATOM   2186 O  OG  . SER B 1 72  ? 21.000 -40.201 -19.136 1.00 32.62  ? 444  SER B OG  1 
ATOM   2187 N  N   . GLY B 1 73  ? 18.457 -40.277 -20.653 1.00 33.49  ? 445  GLY B N   1 
ATOM   2188 C  CA  . GLY B 1 73  ? 17.910 -40.861 -21.887 1.00 36.19  ? 445  GLY B CA  1 
ATOM   2189 C  C   . GLY B 1 73  ? 16.767 -40.051 -22.485 1.00 37.32  ? 445  GLY B C   1 
ATOM   2190 O  O   . GLY B 1 73  ? 16.735 -39.852 -23.701 1.00 39.70  ? 445  GLY B O   1 
ATOM   2191 N  N   . ILE B 1 74  ? 15.838 -39.586 -21.634 1.00 35.92  ? 446  ILE B N   1 
ATOM   2192 C  CA  . ILE B 1 74  ? 14.695 -38.764 -22.053 1.00 36.46  ? 446  ILE B CA  1 
ATOM   2193 C  C   . ILE B 1 74  ? 15.139 -37.378 -22.539 1.00 36.11  ? 446  ILE B C   1 
ATOM   2194 O  O   . ILE B 1 74  ? 14.680 -36.909 -23.579 1.00 37.18  ? 446  ILE B O   1 
ATOM   2195 C  CB  . ILE B 1 74  ? 13.599 -38.681 -20.933 1.00 36.26  ? 446  ILE B CB  1 
ATOM   2196 C  CG1 . ILE B 1 74  ? 12.949 -40.054 -20.716 1.00 37.03  ? 446  ILE B CG1 1 
ATOM   2197 C  CG2 . ILE B 1 74  ? 12.507 -37.643 -21.245 1.00 35.72  ? 446  ILE B CG2 1 
ATOM   2198 C  CD1 . ILE B 1 74  ? 12.440 -40.276 -19.277 1.00 34.17  ? 446  ILE B CD1 1 
ATOM   2199 N  N   . HIS B 1 75  ? 16.038 -36.735 -21.792 1.00 34.73  ? 447  HIS B N   1 
ATOM   2200 C  CA  . HIS B 1 75  ? 16.694 -35.501 -22.255 1.00 35.04  ? 447  HIS B CA  1 
ATOM   2201 C  C   . HIS B 1 75  ? 17.313 -35.630 -23.665 1.00 37.50  ? 447  HIS B C   1 
ATOM   2202 O  O   . HIS B 1 75  ? 17.329 -34.657 -24.418 1.00 38.40  ? 447  HIS B O   1 
ATOM   2203 C  CB  . HIS B 1 75  ? 17.765 -35.046 -21.281 1.00 32.91  ? 447  HIS B CB  1 
ATOM   2204 C  CG  . HIS B 1 75  ? 17.248 -34.259 -20.117 1.00 31.50  ? 447  HIS B CG  1 
ATOM   2205 N  ND1 . HIS B 1 75  ? 16.422 -34.799 -19.152 1.00 32.09  ? 447  HIS B ND1 1 
ATOM   2206 C  CD2 . HIS B 1 75  ? 17.492 -32.987 -19.726 1.00 31.06  ? 447  HIS B CD2 1 
ATOM   2207 C  CE1 . HIS B 1 75  ? 16.158 -33.884 -18.234 1.00 28.97  ? 447  HIS B CE1 1 
ATOM   2208 N  NE2 . HIS B 1 75  ? 16.798 -32.776 -18.557 1.00 29.38  ? 447  HIS B NE2 1 
ATOM   2209 N  N   . ARG B 1 76  ? 17.791 -36.822 -24.025 1.00 38.86  ? 448  ARG B N   1 
ATOM   2210 C  CA  . ARG B 1 76  ? 18.371 -37.057 -25.360 1.00 42.33  ? 448  ARG B CA  1 
ATOM   2211 C  C   . ARG B 1 76  ? 17.339 -37.000 -26.476 1.00 45.18  ? 448  ARG B C   1 
ATOM   2212 O  O   . ARG B 1 76  ? 17.690 -36.843 -27.631 1.00 46.94  ? 448  ARG B O   1 
ATOM   2213 C  CB  . ARG B 1 76  ? 19.037 -38.431 -25.446 1.00 42.89  ? 448  ARG B CB  1 
ATOM   2214 C  CG  . ARG B 1 76  ? 20.239 -38.602 -24.589 1.00 42.45  ? 448  ARG B CG  1 
ATOM   2215 C  CD  . ARG B 1 76  ? 20.855 -39.985 -24.783 1.00 44.69  ? 448  ARG B CD  1 
ATOM   2216 N  NE  . ARG B 1 76  ? 22.258 -39.932 -24.408 1.00 44.28  ? 448  ARG B NE  1 
ATOM   2217 C  CZ  . ARG B 1 76  ? 22.725 -40.340 -23.241 1.00 44.73  ? 448  ARG B CZ  1 
ATOM   2218 N  NH1 . ARG B 1 76  ? 21.905 -40.859 -22.334 1.00 47.98  ? 448  ARG B NH1 1 
ATOM   2219 N  NH2 . ARG B 1 76  ? 24.012 -40.241 -22.981 1.00 44.37  ? 448  ARG B NH2 1 
ATOM   2220 N  N   . SER B 1 77  ? 16.073 -37.189 -26.117 1.00 46.46  ? 449  SER B N   1 
ATOM   2221 C  CA  . SER B 1 77  ? 14.963 -37.145 -27.072 1.00 50.20  ? 449  SER B CA  1 
ATOM   2222 C  C   . SER B 1 77  ? 14.450 -35.730 -27.328 1.00 50.73  ? 449  SER B C   1 
ATOM   2223 O  O   . SER B 1 77  ? 13.883 -35.454 -28.375 1.00 53.60  ? 449  SER B O   1 
ATOM   2224 C  CB  . SER B 1 77  ? 13.818 -38.034 -26.598 1.00 50.58  ? 449  SER B CB  1 
ATOM   2225 O  OG  . SER B 1 77  ? 14.098 -39.383 -26.923 1.00 53.10  ? 449  SER B OG  1 
ATOM   2226 N  N   . LEU B 1 78  ? 14.677 -34.848 -26.366 1.00 49.09  ? 450  LEU B N   1 
ATOM   2227 C  CA  . LEU B 1 78  ? 14.251 -33.456 -26.453 1.00 50.20  ? 450  LEU B CA  1 
ATOM   2228 C  C   . LEU B 1 78  ? 14.959 -32.694 -27.574 1.00 52.76  ? 450  LEU B C   1 
ATOM   2229 O  O   . LEU B 1 78  ? 14.349 -31.868 -28.259 1.00 54.71  ? 450  LEU B O   1 
ATOM   2230 C  CB  . LEU B 1 78  ? 14.491 -32.755 -25.110 1.00 47.02  ? 450  LEU B CB  1 
ATOM   2231 C  CG  . LEU B 1 78  ? 13.744 -33.298 -23.883 1.00 45.29  ? 450  LEU B CG  1 
ATOM   2232 C  CD1 . LEU B 1 78  ? 14.024 -32.445 -22.641 1.00 40.89  ? 450  LEU B CD1 1 
ATOM   2233 C  CD2 . LEU B 1 78  ? 12.236 -33.411 -24.152 1.00 45.72  ? 450  LEU B CD2 1 
ATOM   2234 N  N   . GLY B 1 79  ? 16.246 -32.986 -27.753 1.00 53.02  ? 451  GLY B N   1 
ATOM   2235 C  CA  . GLY B 1 79  ? 17.076 -32.252 -28.703 1.00 55.59  ? 451  GLY B CA  1 
ATOM   2236 C  C   . GLY B 1 79  ? 17.996 -31.307 -27.951 1.00 53.99  ? 451  GLY B C   1 
ATOM   2237 O  O   . GLY B 1 79  ? 17.737 -30.963 -26.790 1.00 51.60  ? 451  GLY B O   1 
ATOM   2238 N  N   . VAL B 1 80  ? 19.070 -30.890 -28.624 1.00 55.53  ? 452  VAL B N   1 
ATOM   2239 C  CA  . VAL B 1 80  ? 20.135 -30.081 -28.016 1.00 54.10  ? 452  VAL B CA  1 
ATOM   2240 C  C   . VAL B 1 80  ? 19.735 -28.634 -27.705 1.00 54.58  ? 452  VAL B C   1 
ATOM   2241 O  O   . VAL B 1 80  ? 20.418 -27.957 -26.922 1.00 53.38  ? 452  VAL B O   1 
ATOM   2242 C  CB  . VAL B 1 80  ? 21.419 -30.096 -28.871 1.00 55.96  ? 452  VAL B CB  1 
ATOM   2243 C  CG1 . VAL B 1 80  ? 22.133 -31.435 -28.711 1.00 54.62  ? 452  VAL B CG1 1 
ATOM   2244 C  CG2 . VAL B 1 80  ? 21.097 -29.805 -30.349 1.00 59.09  ? 452  VAL B CG2 1 
ATOM   2245 N  N   . HIS B 1 81  ? 18.637 -28.166 -28.305 1.00 56.18  ? 453  HIS B N   1 
ATOM   2246 C  CA  . HIS B 1 81  ? 18.094 -26.853 -27.964 1.00 56.45  ? 453  HIS B CA  1 
ATOM   2247 C  C   . HIS B 1 81  ? 17.573 -26.864 -26.538 1.00 52.82  ? 453  HIS B C   1 
ATOM   2248 O  O   . HIS B 1 81  ? 17.554 -25.820 -25.879 1.00 52.52  ? 453  HIS B O   1 
ATOM   2249 C  CB  . HIS B 1 81  ? 16.975 -26.408 -28.916 1.00 60.16  ? 453  HIS B CB  1 
ATOM   2250 C  CG  . HIS B 1 81  ? 16.516 -24.997 -28.679 1.00 63.74  ? 453  HIS B CG  1 
ATOM   2251 N  ND1 . HIS B 1 81  ? 15.917 -24.595 -27.500 1.00 64.14  ? 453  HIS B ND1 1 
ATOM   2252 C  CD2 . HIS B 1 81  ? 16.575 -23.893 -29.465 1.00 69.01  ? 453  HIS B CD2 1 
ATOM   2253 C  CE1 . HIS B 1 81  ? 15.627 -23.306 -27.572 1.00 67.58  ? 453  HIS B CE1 1 
ATOM   2254 N  NE2 . HIS B 1 81  ? 16.014 -22.857 -28.756 1.00 70.04  ? 453  HIS B NE2 1 
ATOM   2255 N  N   . PHE B 1 82  ? 17.153 -28.038 -26.066 1.00 49.67  ? 454  PHE B N   1 
ATOM   2256 C  CA  . PHE B 1 82  ? 16.647 -28.147 -24.708 1.00 46.27  ? 454  PHE B CA  1 
ATOM   2257 C  C   . PHE B 1 82  ? 17.683 -28.682 -23.747 1.00 43.08  ? 454  PHE B C   1 
ATOM   2258 O  O   . PHE B 1 82  ? 17.819 -28.157 -22.647 1.00 42.11  ? 454  PHE B O   1 
ATOM   2259 C  CB  . PHE B 1 82  ? 15.340 -28.951 -24.643 1.00 46.04  ? 454  PHE B CB  1 
ATOM   2260 C  CG  . PHE B 1 82  ? 14.185 -28.265 -25.314 1.00 47.82  ? 454  PHE B CG  1 
ATOM   2261 C  CD1 . PHE B 1 82  ? 13.491 -27.244 -24.661 1.00 46.61  ? 454  PHE B CD1 1 
ATOM   2262 C  CD2 . PHE B 1 82  ? 13.810 -28.611 -26.618 1.00 50.41  ? 454  PHE B CD2 1 
ATOM   2263 C  CE1 . PHE B 1 82  ? 12.430 -26.585 -25.280 1.00 48.48  ? 454  PHE B CE1 1 
ATOM   2264 C  CE2 . PHE B 1 82  ? 12.738 -27.958 -27.257 1.00 52.61  ? 454  PHE B CE2 1 
ATOM   2265 C  CZ  . PHE B 1 82  ? 12.047 -26.944 -26.583 1.00 51.63  ? 454  PHE B CZ  1 
ATOM   2266 N  N   . SER B 1 83  ? 18.421 -29.716 -24.145 1.00 41.90  ? 455  SER B N   1 
ATOM   2267 C  CA  . SER B 1 83  ? 19.335 -30.356 -23.199 1.00 38.77  ? 455  SER B CA  1 
ATOM   2268 C  C   . SER B 1 83  ? 20.546 -30.987 -23.858 1.00 38.45  ? 455  SER B C   1 
ATOM   2269 O  O   . SER B 1 83  ? 20.429 -31.655 -24.882 1.00 40.22  ? 455  SER B O   1 
ATOM   2270 C  CB  . SER B 1 83  ? 18.585 -31.381 -22.328 1.00 37.37  ? 455  SER B CB  1 
ATOM   2271 O  OG  . SER B 1 83  ? 19.349 -31.753 -21.193 1.00 35.78  ? 455  SER B OG  1 
ATOM   2272 N  N   . LYS B 1 84  ? 21.709 -30.749 -23.257 1.00 36.46  ? 456  LYS B N   1 
ATOM   2273 C  CA  . LYS B 1 84  ? 22.983 -31.269 -23.741 1.00 36.04  ? 456  LYS B CA  1 
ATOM   2274 C  C   . LYS B 1 84  ? 23.490 -32.263 -22.712 1.00 33.20  ? 456  LYS B C   1 
ATOM   2275 O  O   . LYS B 1 84  ? 24.012 -31.884 -21.671 1.00 32.58  ? 456  LYS B O   1 
ATOM   2276 C  CB  . LYS B 1 84  ? 24.006 -30.139 -23.910 1.00 37.22  ? 456  LYS B CB  1 
ATOM   2277 C  CG  . LYS B 1 84  ? 23.805 -29.248 -25.107 1.00 39.66  ? 456  LYS B CG  1 
ATOM   2278 C  CD  . LYS B 1 84  ? 24.910 -28.195 -25.158 1.00 42.24  ? 456  LYS B CD  1 
ATOM   2279 C  CE  . LYS B 1 84  ? 24.920 -27.416 -26.481 1.00 47.81  ? 456  LYS B CE  1 
ATOM   2280 N  NZ  . LYS B 1 84  ? 23.720 -26.557 -26.627 1.00 49.41  ? 456  LYS B NZ  1 
ATOM   2281 N  N   . VAL B 1 85  ? 23.327 -33.539 -23.002 1.00 32.04  ? 457  VAL B N   1 
ATOM   2282 C  CA  . VAL B 1 85  ? 23.573 -34.583 -22.030 1.00 29.15  ? 457  VAL B CA  1 
ATOM   2283 C  C   . VAL B 1 85  ? 25.030 -35.064 -22.075 1.00 28.86  ? 457  VAL B C   1 
ATOM   2284 O  O   . VAL B 1 85  ? 25.570 -35.321 -23.147 1.00 29.52  ? 457  VAL B O   1 
ATOM   2285 C  CB  . VAL B 1 85  ? 22.607 -35.768 -22.268 1.00 29.73  ? 457  VAL B CB  1 
ATOM   2286 C  CG1 . VAL B 1 85  ? 22.807 -36.867 -21.225 1.00 27.76  ? 457  VAL B CG1 1 
ATOM   2287 C  CG2 . VAL B 1 85  ? 21.154 -35.273 -22.270 1.00 28.94  ? 457  VAL B CG2 1 
ATOM   2288 N  N   . ARG B 1 86  ? 25.644 -35.179 -20.899 1.00 26.91  ? 458  ARG B N   1 
ATOM   2289 C  CA  . ARG B 1 86  ? 27.003 -35.689 -20.762 1.00 27.72  ? 458  ARG B CA  1 
ATOM   2290 C  C   . ARG B 1 86  ? 27.111 -36.654 -19.590 1.00 26.76  ? 458  ARG B C   1 
ATOM   2291 O  O   . ARG B 1 86  ? 26.355 -36.547 -18.600 1.00 26.15  ? 458  ARG B O   1 
ATOM   2292 C  CB  . ARG B 1 86  ? 27.994 -34.532 -20.555 1.00 27.81  ? 458  ARG B CB  1 
ATOM   2293 C  CG  . ARG B 1 86  ? 27.976 -33.451 -21.658 1.00 30.54  ? 458  ARG B CG  1 
ATOM   2294 C  CD  . ARG B 1 86  ? 28.516 -33.970 -22.971 1.00 32.26  ? 458  ARG B CD  1 
ATOM   2295 N  NE  . ARG B 1 86  ? 28.585 -32.954 -24.024 1.00 33.45  ? 458  ARG B NE  1 
ATOM   2296 C  CZ  . ARG B 1 86  ? 27.617 -32.716 -24.913 1.00 35.54  ? 458  ARG B CZ  1 
ATOM   2297 N  NH1 . ARG B 1 86  ? 26.479 -33.398 -24.877 1.00 35.66  ? 458  ARG B NH1 1 
ATOM   2298 N  NH2 . ARG B 1 86  ? 27.777 -31.784 -25.843 1.00 36.35  ? 458  ARG B NH2 1 
ATOM   2299 N  N   . SER B 1 87  ? 28.068 -37.570 -19.682 1.00 27.14  ? 459  SER B N   1 
ATOM   2300 C  CA  . SER B 1 87  ? 28.342 -38.507 -18.595 1.00 26.91  ? 459  SER B CA  1 
ATOM   2301 C  C   . SER B 1 87  ? 29.373 -37.919 -17.643 1.00 26.42  ? 459  SER B C   1 
ATOM   2302 O  O   . SER B 1 87  ? 30.396 -37.437 -18.082 1.00 26.02  ? 459  SER B O   1 
ATOM   2303 C  CB  . SER B 1 87  ? 28.854 -39.845 -19.163 1.00 28.71  ? 459  SER B CB  1 
ATOM   2304 O  OG  . SER B 1 87  ? 29.463 -40.646 -18.156 1.00 29.74  ? 459  SER B OG  1 
ATOM   2305 N  N   . LEU B 1 88  ? 29.101 -37.983 -16.337 1.00 26.53  ? 460  LEU B N   1 
ATOM   2306 C  CA  . LEU B 1 88  ? 30.062 -37.565 -15.317 1.00 27.58  ? 460  LEU B CA  1 
ATOM   2307 C  C   . LEU B 1 88  ? 31.249 -38.525 -15.210 1.00 29.69  ? 460  LEU B C   1 
ATOM   2308 O  O   . LEU B 1 88  ? 32.279 -38.164 -14.656 1.00 30.78  ? 460  LEU B O   1 
ATOM   2309 C  CB  . LEU B 1 88  ? 29.398 -37.449 -13.937 1.00 26.89  ? 460  LEU B CB  1 
ATOM   2310 C  CG  . LEU B 1 88  ? 28.257 -36.434 -13.785 1.00 25.48  ? 460  LEU B CG  1 
ATOM   2311 C  CD1 . LEU B 1 88  ? 27.534 -36.607 -12.468 1.00 24.80  ? 460  LEU B CD1 1 
ATOM   2312 C  CD2 . LEU B 1 88  ? 28.806 -35.025 -13.900 1.00 25.17  ? 460  LEU B CD2 1 
ATOM   2313 N  N   . THR B 1 89  ? 31.102 -39.749 -15.713 1.00 30.80  ? 461  THR B N   1 
ATOM   2314 C  CA  . THR B 1 89  ? 32.152 -40.741 -15.521 1.00 33.15  ? 461  THR B CA  1 
ATOM   2315 C  C   . THR B 1 89  ? 32.865 -41.111 -16.812 1.00 34.66  ? 461  THR B C   1 
ATOM   2316 O  O   . THR B 1 89  ? 34.034 -41.476 -16.768 1.00 36.30  ? 461  THR B O   1 
ATOM   2317 C  CB  . THR B 1 89  ? 31.604 -42.028 -14.899 1.00 33.93  ? 461  THR B CB  1 
ATOM   2318 O  OG1 . THR B 1 89  ? 30.574 -42.537 -15.748 1.00 33.91  ? 461  THR B OG1 1 
ATOM   2319 C  CG2 . THR B 1 89  ? 31.013 -41.755 -13.496 1.00 33.57  ? 461  THR B CG2 1 
ATOM   2320 N  N   . LEU B 1 90  ? 32.161 -41.021 -17.948 1.00 34.32  ? 462  LEU B N   1 
ATOM   2321 C  CA  . LEU B 1 90  ? 32.695 -41.468 -19.234 1.00 36.34  ? 462  LEU B CA  1 
ATOM   2322 C  C   . LEU B 1 90  ? 33.129 -40.348 -20.202 1.00 36.90  ? 462  LEU B C   1 
ATOM   2323 O  O   . LEU B 1 90  ? 33.857 -40.616 -21.143 1.00 38.30  ? 462  LEU B O   1 
ATOM   2324 C  CB  . LEU B 1 90  ? 31.698 -42.395 -19.939 1.00 37.03  ? 462  LEU B CB  1 
ATOM   2325 C  CG  . LEU B 1 90  ? 31.309 -43.708 -19.245 1.00 38.09  ? 462  LEU B CG  1 
ATOM   2326 C  CD1 . LEU B 1 90  ? 30.044 -44.263 -19.907 1.00 38.35  ? 462  LEU B CD1 1 
ATOM   2327 C  CD2 . LEU B 1 90  ? 32.440 -44.731 -19.262 1.00 37.01  ? 462  LEU B CD2 1 
ATOM   2328 N  N   . ASP B 1 91  ? 32.680 -39.113 -19.978 1.00 35.47  ? 463  ASP B N   1 
ATOM   2329 C  CA  . ASP B 1 91  ? 33.090 -37.984 -20.818 1.00 36.38  ? 463  ASP B CA  1 
ATOM   2330 C  C   . ASP B 1 91  ? 34.209 -37.188 -20.158 1.00 36.88  ? 463  ASP B C   1 
ATOM   2331 O  O   . ASP B 1 91  ? 34.367 -37.218 -18.936 1.00 36.00  ? 463  ASP B O   1 
ATOM   2332 C  CB  . ASP B 1 91  ? 31.898 -37.053 -21.125 1.00 35.23  ? 463  ASP B CB  1 
ATOM   2333 C  CG  . ASP B 1 91  ? 30.831 -37.716 -21.999 1.00 35.77  ? 463  ASP B CG  1 
ATOM   2334 O  OD1 . ASP B 1 91  ? 31.195 -38.430 -22.959 1.00 35.95  ? 463  ASP B OD1 1 
ATOM   2335 O  OD2 . ASP B 1 91  ? 29.621 -37.526 -21.722 1.00 35.39  ? 463  ASP B OD2 1 
ATOM   2336 N  N   . SER B 1 92  ? 34.995 -36.497 -20.977 1.00 38.62  ? 464  SER B N   1 
ATOM   2337 C  CA  . SER B 1 92  ? 35.963 -35.512 -20.493 1.00 39.91  ? 464  SER B CA  1 
ATOM   2338 C  C   . SER B 1 92  ? 35.289 -34.197 -20.131 1.00 38.50  ? 464  SER B C   1 
ATOM   2339 O  O   . SER B 1 92  ? 34.340 -33.769 -20.787 1.00 37.59  ? 464  SER B O   1 
ATOM   2340 C  CB  . SER B 1 92  ? 37.013 -35.235 -21.552 1.00 42.07  ? 464  SER B CB  1 
ATOM   2341 O  OG  . SER B 1 92  ? 37.779 -36.396 -21.763 1.00 46.26  ? 464  SER B OG  1 
ATOM   2342 N  N   . TRP B 1 93  ? 35.802 -33.566 -19.083 1.00 38.72  ? 465  TRP B N   1 
ATOM   2343 C  CA  . TRP B 1 93  ? 35.297 -32.289 -18.612 1.00 38.49  ? 465  TRP B CA  1 
ATOM   2344 C  C   . TRP B 1 93  ? 36.439 -31.296 -18.462 1.00 40.81  ? 465  TRP B C   1 
ATOM   2345 O  O   . TRP B 1 93  ? 37.366 -31.515 -17.665 1.00 41.41  ? 465  TRP B O   1 
ATOM   2346 C  CB  . TRP B 1 93  ? 34.602 -32.464 -17.260 1.00 36.38  ? 465  TRP B CB  1 
ATOM   2347 C  CG  . TRP B 1 93  ? 33.386 -33.310 -17.325 1.00 34.67  ? 465  TRP B CG  1 
ATOM   2348 C  CD1 . TRP B 1 93  ? 33.333 -34.662 -17.538 1.00 33.03  ? 465  TRP B CD1 1 
ATOM   2349 C  CD2 . TRP B 1 93  ? 32.031 -32.872 -17.195 1.00 32.37  ? 465  TRP B CD2 1 
ATOM   2350 N  NE1 . TRP B 1 93  ? 32.036 -35.081 -17.544 1.00 31.71  ? 465  TRP B NE1 1 
ATOM   2351 C  CE2 . TRP B 1 93  ? 31.214 -34.006 -17.335 1.00 30.94  ? 465  TRP B CE2 1 
ATOM   2352 C  CE3 . TRP B 1 93  ? 31.426 -31.628 -16.972 1.00 31.90  ? 465  TRP B CE3 1 
ATOM   2353 C  CZ2 . TRP B 1 93  ? 29.826 -33.937 -17.257 1.00 29.23  ? 465  TRP B CZ2 1 
ATOM   2354 C  CZ3 . TRP B 1 93  ? 30.053 -31.566 -16.889 1.00 28.53  ? 465  TRP B CZ3 1 
ATOM   2355 C  CH2 . TRP B 1 93  ? 29.269 -32.713 -17.027 1.00 27.31  ? 465  TRP B CH2 1 
ATOM   2356 N  N   . GLU B 1 94  ? 36.361 -30.205 -19.220 1.00 42.13  ? 466  GLU B N   1 
ATOM   2357 C  CA  . GLU B 1 94  ? 37.206 -29.027 -18.974 1.00 44.94  ? 466  GLU B CA  1 
ATOM   2358 C  C   . GLU B 1 94  ? 36.891 -28.486 -17.571 1.00 43.50  ? 466  GLU B C   1 
ATOM   2359 O  O   . GLU B 1 94  ? 35.728 -28.443 -17.182 1.00 41.93  ? 466  GLU B O   1 
ATOM   2360 C  CB  . GLU B 1 94  ? 36.953 -27.946 -20.044 1.00 46.75  ? 466  GLU B CB  1 
ATOM   2361 C  CG  . GLU B 1 94  ? 37.139 -28.412 -21.504 1.00 50.18  ? 466  GLU B CG  1 
ATOM   2362 C  CD  . GLU B 1 94  ? 38.413 -27.885 -22.172 1.00 59.56  ? 466  GLU B CD  1 
ATOM   2363 O  OE1 . GLU B 1 94  ? 39.232 -27.210 -21.503 1.00 63.50  ? 466  GLU B OE1 1 
ATOM   2364 O  OE2 . GLU B 1 94  ? 38.595 -28.132 -23.393 1.00 62.99  ? 466  GLU B OE2 1 
ATOM   2365 N  N   . PRO B 1 95  ? 37.924 -28.100 -16.799 1.00 45.18  ? 467  PRO B N   1 
ATOM   2366 C  CA  . PRO B 1 95  ? 37.795 -27.546 -15.432 1.00 44.77  ? 467  PRO B CA  1 
ATOM   2367 C  C   . PRO B 1 95  ? 36.725 -26.459 -15.271 1.00 44.37  ? 467  PRO B C   1 
ATOM   2368 O  O   . PRO B 1 95  ? 35.961 -26.483 -14.301 1.00 43.27  ? 467  PRO B O   1 
ATOM   2369 C  CB  . PRO B 1 95  ? 39.187 -26.955 -15.147 1.00 47.65  ? 467  PRO B CB  1 
ATOM   2370 C  CG  . PRO B 1 95  ? 40.028 -27.223 -16.386 1.00 49.33  ? 467  PRO B CG  1 
ATOM   2371 C  CD  . PRO B 1 95  ? 39.340 -28.284 -17.175 1.00 47.52  ? 467  PRO B CD  1 
ATOM   2372 N  N   . GLU B 1 96  ? 36.654 -25.525 -16.215 1.00 45.33  ? 468  GLU B N   1 
ATOM   2373 C  CA  . GLU B 1 96  ? 35.656 -24.467 -16.150 1.00 45.17  ? 468  GLU B CA  1 
ATOM   2374 C  C   . GLU B 1 96  ? 34.220 -25.010 -16.181 1.00 41.97  ? 468  GLU B C   1 
ATOM   2375 O  O   . GLU B 1 96  ? 33.303 -24.427 -15.601 1.00 41.03  ? 468  GLU B O   1 
ATOM   2376 C  CB  . GLU B 1 96  ? 35.893 -23.417 -17.254 1.00 47.99  ? 468  GLU B CB  1 
ATOM   2377 C  CG  . GLU B 1 96  ? 35.519 -23.839 -18.680 1.00 49.83  ? 468  GLU B CG  1 
ATOM   2378 C  CD  . GLU B 1 96  ? 36.717 -24.213 -19.569 1.00 55.58  ? 468  GLU B CD  1 
ATOM   2379 O  OE1 . GLU B 1 96  ? 37.839 -24.452 -19.045 1.00 57.28  ? 468  GLU B OE1 1 
ATOM   2380 O  OE2 . GLU B 1 96  ? 36.519 -24.270 -20.810 1.00 56.75  ? 468  GLU B OE2 1 
ATOM   2381 N  N   . LEU B 1 97  ? 34.021 -26.146 -16.838 1.00 40.16  ? 469  LEU B N   1 
ATOM   2382 C  CA  . LEU B 1 97  ? 32.684 -26.697 -16.944 1.00 37.65  ? 469  LEU B CA  1 
ATOM   2383 C  C   . LEU B 1 97  ? 32.310 -27.410 -15.644 1.00 35.89  ? 469  LEU B C   1 
ATOM   2384 O  O   . LEU B 1 97  ? 31.153 -27.403 -15.236 1.00 34.33  ? 469  LEU B O   1 
ATOM   2385 C  CB  . LEU B 1 97  ? 32.578 -27.619 -18.167 1.00 37.12  ? 469  LEU B CB  1 
ATOM   2386 C  CG  . LEU B 1 97  ? 31.208 -28.183 -18.532 1.00 35.98  ? 469  LEU B CG  1 
ATOM   2387 C  CD1 . LEU B 1 97  ? 30.150 -27.098 -18.588 1.00 35.79  ? 469  LEU B CD1 1 
ATOM   2388 C  CD2 . LEU B 1 97  ? 31.272 -28.963 -19.855 1.00 36.06  ? 469  LEU B CD2 1 
ATOM   2389 N  N   . VAL B 1 98  ? 33.295 -28.018 -14.992 1.00 36.33  ? 470  VAL B N   1 
ATOM   2390 C  CA  . VAL B 1 98  ? 33.060 -28.618 -13.689 1.00 35.42  ? 470  VAL B CA  1 
ATOM   2391 C  C   . VAL B 1 98  ? 32.714 -27.479 -12.731 1.00 36.33  ? 470  VAL B C   1 
ATOM   2392 O  O   . VAL B 1 98  ? 31.724 -27.573 -11.987 1.00 34.94  ? 470  VAL B O   1 
ATOM   2393 C  CB  . VAL B 1 98  ? 34.292 -29.424 -13.171 1.00 36.53  ? 470  VAL B CB  1 
ATOM   2394 C  CG1 . VAL B 1 98  ? 34.081 -29.867 -11.711 1.00 36.11  ? 470  VAL B CG1 1 
ATOM   2395 C  CG2 . VAL B 1 98  ? 34.559 -30.615 -14.054 1.00 34.75  ? 470  VAL B CG2 1 
ATOM   2396 N  N   . LYS B 1 99  ? 33.504 -26.400 -12.784 1.00 38.06  ? 471  LYS B N   1 
ATOM   2397 C  CA  . LYS B 1 99  ? 33.225 -25.218 -11.966 1.00 39.85  ? 471  LYS B CA  1 
ATOM   2398 C  C   . LYS B 1 99  ? 31.849 -24.619 -12.271 1.00 38.44  ? 471  LYS B C   1 
ATOM   2399 O  O   . LYS B 1 99  ? 31.161 -24.163 -11.366 1.00 38.26  ? 471  LYS B O   1 
ATOM   2400 C  CB  . LYS B 1 99  ? 34.337 -24.158 -12.081 1.00 43.24  ? 471  LYS B CB  1 
ATOM   2401 C  CG  . LYS B 1 99  ? 35.715 -24.638 -11.577 1.00 46.52  ? 471  LYS B CG  1 
ATOM   2402 C  CD  . LYS B 1 99  ? 36.750 -23.507 -11.498 1.00 53.80  ? 471  LYS B CD  1 
ATOM   2403 C  CE  . LYS B 1 99  ? 36.841 -22.865 -10.091 1.00 57.90  ? 471  LYS B CE  1 
ATOM   2404 N  NZ  . LYS B 1 99  ? 35.517 -22.411 -9.529  1.00 57.22  ? 471  LYS B NZ  1 
ATOM   2405 N  N   . LEU B 1 100 ? 31.433 -24.629 -13.534 1.00 37.66  ? 472  LEU B N   1 
ATOM   2406 C  CA  . LEU B 1 100 ? 30.092 -24.127 -13.869 1.00 36.75  ? 472  LEU B CA  1 
ATOM   2407 C  C   . LEU B 1 100 ? 28.988 -24.943 -13.194 1.00 34.86  ? 472  LEU B C   1 
ATOM   2408 O  O   . LEU B 1 100 ? 28.026 -24.376 -12.649 1.00 34.55  ? 472  LEU B O   1 
ATOM   2409 C  CB  . LEU B 1 100 ? 29.884 -24.065 -15.392 1.00 36.95  ? 472  LEU B CB  1 
ATOM   2410 C  CG  . LEU B 1 100 ? 28.470 -23.782 -15.938 1.00 36.95  ? 472  LEU B CG  1 
ATOM   2411 C  CD1 . LEU B 1 100 ? 27.948 -22.436 -15.469 1.00 39.76  ? 472  LEU B CD1 1 
ATOM   2412 C  CD2 . LEU B 1 100 ? 28.412 -23.871 -17.457 1.00 37.36  ? 472  LEU B CD2 1 
ATOM   2413 N  N   . MET B 1 101 ? 29.128 -26.274 -13.231 1.00 33.25  ? 473  MET B N   1 
ATOM   2414 C  CA  . MET B 1 101 ? 28.176 -27.173 -12.583 1.00 31.72  ? 473  MET B CA  1 
ATOM   2415 C  C   . MET B 1 101 ? 28.087 -26.887 -11.079 1.00 32.61  ? 473  MET B C   1 
ATOM   2416 O  O   . MET B 1 101 ? 27.008 -26.984 -10.475 1.00 32.20  ? 473  MET B O   1 
ATOM   2417 C  CB  . MET B 1 101 ? 28.558 -28.636 -12.835 1.00 30.71  ? 473  MET B CB  1 
ATOM   2418 C  CG  . MET B 1 101 ? 28.512 -29.065 -14.306 1.00 31.44  ? 473  MET B CG  1 
ATOM   2419 S  SD  . MET B 1 101 ? 26.842 -29.358 -14.943 1.00 33.24  ? 473  MET B SD  1 
ATOM   2420 C  CE  . MET B 1 101 ? 26.754 -27.955 -16.050 1.00 36.23  ? 473  MET B CE  1 
ATOM   2421 N  N   . CYS B 1 102 ? 29.211 -26.512 -10.482 1.00 34.10  ? 474  CYS B N   1 
ATOM   2422 C  CA  . CYS B 1 102 ? 29.249 -26.240 -9.056  1.00 36.11  ? 474  CYS B CA  1 
ATOM   2423 C  C   . CYS B 1 102 ? 28.552 -24.942 -8.681  1.00 37.78  ? 474  CYS B C   1 
ATOM   2424 O  O   . CYS B 1 102 ? 28.118 -24.777 -7.538  1.00 39.10  ? 474  CYS B O   1 
ATOM   2425 C  CB  . CYS B 1 102 ? 30.685 -26.297 -8.543  1.00 37.64  ? 474  CYS B CB  1 
ATOM   2426 S  SG  . CYS B 1 102 ? 31.342 -27.988 -8.720  1.00 39.78  ? 474  CYS B SG  1 
ATOM   2427 N  N   . GLU B 1 103 ? 28.421 -24.023 -9.635  1.00 38.41  ? 475  GLU B N   1 
ATOM   2428 C  CA  . GLU B 1 103 ? 27.680 -22.783 -9.380  1.00 39.87  ? 475  GLU B CA  1 
ATOM   2429 C  C   . GLU B 1 103 ? 26.183 -22.910 -9.618  1.00 37.64  ? 475  GLU B C   1 
ATOM   2430 O  O   . GLU B 1 103 ? 25.419 -22.015 -9.264  1.00 38.79  ? 475  GLU B O   1 
ATOM   2431 C  CB  . GLU B 1 103 ? 28.239 -21.631 -10.212 1.00 41.90  ? 475  GLU B CB  1 
ATOM   2432 C  CG  . GLU B 1 103 ? 29.620 -21.163 -9.758  1.00 47.94  ? 475  GLU B CG  1 
ATOM   2433 C  CD  . GLU B 1 103 ? 29.674 -20.790 -8.284  1.00 53.49  ? 475  GLU B CD  1 
ATOM   2434 O  OE1 . GLU B 1 103 ? 28.775 -20.053 -7.813  1.00 55.51  ? 475  GLU B OE1 1 
ATOM   2435 O  OE2 . GLU B 1 103 ? 30.623 -21.241 -7.597  1.00 56.80  ? 475  GLU B OE2 1 
ATOM   2436 N  N   . LEU B 1 104 ? 25.766 -24.009 -10.241 1.00 34.84  ? 476  LEU B N   1 
ATOM   2437 C  CA  . LEU B 1 104 ? 24.355 -24.242 -10.501 1.00 32.63  ? 476  LEU B CA  1 
ATOM   2438 C  C   . LEU B 1 104 ? 23.834 -25.393 -9.634  1.00 31.00  ? 476  LEU B C   1 
ATOM   2439 O  O   . LEU B 1 104 ? 23.848 -25.285 -8.402  1.00 31.29  ? 476  LEU B O   1 
ATOM   2440 C  CB  . LEU B 1 104 ? 24.121 -24.478 -11.994 1.00 31.94  ? 476  LEU B CB  1 
ATOM   2441 C  CG  . LEU B 1 104 ? 23.665 -23.315 -12.887 1.00 34.17  ? 476  LEU B CG  1 
ATOM   2442 C  CD1 . LEU B 1 104 ? 23.542 -21.948 -12.179 1.00 35.20  ? 476  LEU B CD1 1 
ATOM   2443 C  CD2 . LEU B 1 104 ? 24.584 -23.208 -14.070 1.00 33.93  ? 476  LEU B CD2 1 
ATOM   2444 N  N   . GLY B 1 105 ? 23.370 -26.474 -10.264 1.00 28.73  ? 477  GLY B N   1 
ATOM   2445 C  CA  . GLY B 1 105 ? 22.925 -27.656 -9.535  1.00 27.47  ? 477  GLY B CA  1 
ATOM   2446 C  C   . GLY B 1 105 ? 21.423 -27.790 -9.357  1.00 27.18  ? 477  GLY B C   1 
ATOM   2447 O  O   . GLY B 1 105 ? 20.648 -26.865 -9.653  1.00 28.13  ? 477  GLY B O   1 
ATOM   2448 N  N   . ASN B 1 106 ? 21.021 -28.942 -8.826  1.00 25.87  ? 478  ASN B N   1 
ATOM   2449 C  CA  . ASN B 1 106 ? 19.634 -29.373 -8.838  1.00 24.83  ? 478  ASN B CA  1 
ATOM   2450 C  C   . ASN B 1 106 ? 18.741 -28.493 -7.971  1.00 25.77  ? 478  ASN B C   1 
ATOM   2451 O  O   . ASN B 1 106 ? 17.650 -28.103 -8.402  1.00 25.64  ? 478  ASN B O   1 
ATOM   2452 C  CB  . ASN B 1 106 ? 19.534 -30.842 -8.422  1.00 24.63  ? 478  ASN B CB  1 
ATOM   2453 C  CG  . ASN B 1 106 ? 20.112 -31.801 -9.465  1.00 24.40  ? 478  ASN B CG  1 
ATOM   2454 O  OD1 . ASN B 1 106 ? 20.190 -33.011 -9.223  1.00 25.60  ? 478  ASN B OD1 1 
ATOM   2455 N  ND2 . ASN B 1 106 ? 20.465 -31.283 -10.643 1.00 22.43  ? 478  ASN B ND2 1 
ATOM   2456 N  N   . VAL B 1 107 ? 19.209 -28.162 -6.769  1.00 26.25  ? 479  VAL B N   1 
ATOM   2457 C  CA  . VAL B 1 107 ? 18.450 -27.288 -5.885  1.00 27.90  ? 479  VAL B CA  1 
ATOM   2458 C  C   . VAL B 1 107 ? 18.177 -25.925 -6.548  1.00 29.05  ? 479  VAL B C   1 
ATOM   2459 O  O   . VAL B 1 107 ? 17.038 -25.462 -6.549  1.00 30.08  ? 479  VAL B O   1 
ATOM   2460 C  CB  . VAL B 1 107 ? 19.140 -27.111 -4.499  1.00 29.77  ? 479  VAL B CB  1 
ATOM   2461 C  CG1 . VAL B 1 107 ? 18.466 -25.969 -3.671  1.00 30.57  ? 479  VAL B CG1 1 
ATOM   2462 C  CG2 . VAL B 1 107 ? 19.116 -28.413 -3.752  1.00 26.80  ? 479  VAL B CG2 1 
ATOM   2463 N  N   A ILE B 1 108 ? 19.225 -25.302 -7.094  0.50 29.33  ? 480  ILE B N   1 
ATOM   2464 N  N   B ILE B 1 108 ? 19.209 -25.306 -7.117  0.50 29.26  ? 480  ILE B N   1 
ATOM   2465 C  CA  A ILE B 1 108 ? 19.108 -24.014 -7.782  0.50 30.31  ? 480  ILE B CA  1 
ATOM   2466 C  CA  B ILE B 1 108 ? 19.058 -24.004 -7.763  0.50 30.25  ? 480  ILE B CA  1 
ATOM   2467 C  C   A ILE B 1 108 ? 18.173 -24.097 -8.999  0.50 29.74  ? 480  ILE B C   1 
ATOM   2468 C  C   B ILE B 1 108 ? 18.208 -24.050 -9.044  0.50 29.73  ? 480  ILE B C   1 
ATOM   2469 O  O   A ILE B 1 108 ? 17.236 -23.308 -9.112  0.50 30.69  ? 480  ILE B O   1 
ATOM   2470 O  O   B ILE B 1 108 ? 17.358 -23.185 -9.248  0.50 30.73  ? 480  ILE B O   1 
ATOM   2471 C  CB  A ILE B 1 108 ? 20.486 -23.469 -8.240  0.50 31.05  ? 480  ILE B CB  1 
ATOM   2472 C  CB  B ILE B 1 108 ? 20.418 -23.347 -8.039  0.50 31.22  ? 480  ILE B CB  1 
ATOM   2473 C  CG1 A ILE B 1 108 ? 21.354 -23.063 -7.039  0.50 32.88  ? 480  ILE B CG1 1 
ATOM   2474 C  CG1 B ILE B 1 108 ? 20.945 -22.688 -6.761  0.50 33.21  ? 480  ILE B CG1 1 
ATOM   2475 C  CG2 A ILE B 1 108 ? 20.312 -22.302 -9.211  0.50 31.29  ? 480  ILE B CG2 1 
ATOM   2476 C  CG2 B ILE B 1 108 ? 20.307 -22.325 -9.169  0.50 31.19  ? 480  ILE B CG2 1 
ATOM   2477 C  CD1 A ILE B 1 108 ? 20.762 -21.981 -6.165  0.50 34.72  ? 480  ILE B CD1 1 
ATOM   2478 C  CD1 B ILE B 1 108 ? 22.426 -22.425 -6.782  0.50 33.53  ? 480  ILE B CD1 1 
ATOM   2479 N  N   . ILE B 1 109 ? 18.422 -25.058 -9.891  1.00 28.31  ? 481  ILE B N   1 
ATOM   2480 C  CA  . ILE B 1 109 ? 17.619 -25.202 -11.124 1.00 28.35  ? 481  ILE B CA  1 
ATOM   2481 C  C   . ILE B 1 109 ? 16.153 -25.613 -10.869 1.00 29.09  ? 481  ILE B C   1 
ATOM   2482 O  O   . ILE B 1 109 ? 15.245 -25.165 -11.574 1.00 31.09  ? 481  ILE B O   1 
ATOM   2483 C  CB  . ILE B 1 109 ? 18.322 -26.102 -12.185 1.00 27.28  ? 481  ILE B CB  1 
ATOM   2484 C  CG1 . ILE B 1 109 ? 19.685 -25.519 -12.591 1.00 26.47  ? 481  ILE B CG1 1 
ATOM   2485 C  CG2 . ILE B 1 109 ? 17.463 -26.320 -13.426 1.00 27.11  ? 481  ILE B CG2 1 
ATOM   2486 C  CD1 . ILE B 1 109 ? 19.678 -24.034 -13.020 1.00 27.49  ? 481  ILE B CD1 1 
ATOM   2487 N  N   . ASN B 1 110 ? 15.921 -26.437 -9.854  1.00 28.90  ? 482  ASN B N   1 
ATOM   2488 C  CA  . ASN B 1 110 ? 14.555 -26.782 -9.448  1.00 29.33  ? 482  ASN B CA  1 
ATOM   2489 C  C   . ASN B 1 110 ? 13.773 -25.622 -8.800  1.00 31.12  ? 482  ASN B C   1 
ATOM   2490 O  O   . ASN B 1 110 ? 12.555 -25.545 -8.960  1.00 31.34  ? 482  ASN B O   1 
ATOM   2491 C  CB  . ASN B 1 110 ? 14.518 -28.075 -8.613  1.00 28.54  ? 482  ASN B CB  1 
ATOM   2492 C  CG  . ASN B 1 110 ? 14.610 -29.331 -9.491  1.00 28.04  ? 482  ASN B CG  1 
ATOM   2493 O  OD1 . ASN B 1 110 ? 14.284 -29.278 -10.681 1.00 29.36  ? 482  ASN B OD1 1 
ATOM   2494 N  ND2 . ASN B 1 110 ? 15.036 -30.459 -8.916  1.00 25.98  ? 482  ASN B ND2 1 
ATOM   2495 N  N   . GLN B 1 111 ? 14.470 -24.710 -8.112  1.00 32.28  ? 483  GLN B N   1 
ATOM   2496 C  CA  . GLN B 1 111 ? 13.850 -23.470 -7.617  1.00 35.07  ? 483  GLN B CA  1 
ATOM   2497 C  C   . GLN B 1 111 ? 13.250 -22.618 -8.749  1.00 35.86  ? 483  GLN B C   1 
ATOM   2498 O  O   . GLN B 1 111 ? 12.365 -21.809 -8.510  1.00 37.86  ? 483  GLN B O   1 
ATOM   2499 C  CB  . GLN B 1 111 ? 14.855 -22.638 -6.827  1.00 36.51  ? 483  GLN B CB  1 
ATOM   2500 C  CG  . GLN B 1 111 ? 14.969 -23.065 -5.360  1.00 40.18  ? 483  GLN B CG  1 
ATOM   2501 C  CD  . GLN B 1 111 ? 16.179 -22.476 -4.628  1.00 44.52  ? 483  GLN B CD  1 
ATOM   2502 O  OE1 . GLN B 1 111 ? 16.432 -22.817 -3.475  1.00 47.33  ? 483  GLN B OE1 1 
ATOM   2503 N  NE2 . GLN B 1 111 ? 16.926 -21.598 -5.292  1.00 46.92  ? 483  GLN B NE2 1 
ATOM   2504 N  N   . ILE B 1 112 ? 13.752 -22.821 -9.970  1.00 34.61  ? 484  ILE B N   1 
ATOM   2505 C  CA  . ILE B 1 112 ? 13.282 -22.156 -11.178 1.00 34.53  ? 484  ILE B CA  1 
ATOM   2506 C  C   . ILE B 1 112 ? 12.308 -23.054 -11.943 1.00 33.69  ? 484  ILE B C   1 
ATOM   2507 O  O   . ILE B 1 112 ? 11.173 -22.669 -12.195 1.00 35.11  ? 484  ILE B O   1 
ATOM   2508 C  CB  . ILE B 1 112 ? 14.472 -21.831 -12.114 1.00 34.39  ? 484  ILE B CB  1 
ATOM   2509 C  CG1 . ILE B 1 112 ? 15.506 -20.965 -11.388 1.00 35.89  ? 484  ILE B CG1 1 
ATOM   2510 C  CG2 . ILE B 1 112 ? 14.010 -21.175 -13.406 1.00 33.49  ? 484  ILE B CG2 1 
ATOM   2511 C  CD1 . ILE B 1 112 ? 16.853 -20.885 -12.120 1.00 35.57  ? 484  ILE B CD1 1 
ATOM   2512 N  N   . TYR B 1 113 ? 12.738 -24.258 -12.300 1.00 31.46  ? 485  TYR B N   1 
ATOM   2513 C  CA  . TYR B 1 113 ? 11.922 -25.095 -13.170 1.00 31.25  ? 485  TYR B CA  1 
ATOM   2514 C  C   . TYR B 1 113 ? 10.770 -25.822 -12.487 1.00 31.32  ? 485  TYR B C   1 
ATOM   2515 O  O   . TYR B 1 113 ? 9.839  -26.291 -13.157 1.00 31.38  ? 485  TYR B O   1 
ATOM   2516 C  CB  . TYR B 1 113 ? 12.783 -26.059 -13.970 1.00 29.95  ? 485  TYR B CB  1 
ATOM   2517 C  CG  . TYR B 1 113 ? 13.461 -25.395 -15.147 1.00 30.77  ? 485  TYR B CG  1 
ATOM   2518 C  CD1 . TYR B 1 113 ? 12.847 -25.364 -16.398 1.00 34.08  ? 485  TYR B CD1 1 
ATOM   2519 C  CD2 . TYR B 1 113 ? 14.708 -24.797 -15.009 1.00 31.08  ? 485  TYR B CD2 1 
ATOM   2520 C  CE1 . TYR B 1 113 ? 13.463 -24.757 -17.499 1.00 36.16  ? 485  TYR B CE1 1 
ATOM   2521 C  CE2 . TYR B 1 113 ? 15.337 -24.177 -16.098 1.00 34.37  ? 485  TYR B CE2 1 
ATOM   2522 C  CZ  . TYR B 1 113 ? 14.712 -24.169 -17.336 1.00 36.60  ? 485  TYR B CZ  1 
ATOM   2523 O  OH  . TYR B 1 113 ? 15.329 -23.561 -18.408 1.00 41.45  ? 485  TYR B OH  1 
ATOM   2524 N  N   . GLU B 1 114 ? 10.833 -25.913 -11.165 1.00 31.16  ? 486  GLU B N   1 
ATOM   2525 C  CA  . GLU B 1 114 ? 9.792  -26.566 -10.400 1.00 32.35  ? 486  GLU B CA  1 
ATOM   2526 C  C   . GLU B 1 114 ? 9.236  -25.606 -9.363  1.00 33.76  ? 486  GLU B C   1 
ATOM   2527 O  O   . GLU B 1 114 ? 8.737  -26.030 -8.330  1.00 34.47  ? 486  GLU B O   1 
ATOM   2528 C  CB  . GLU B 1 114 ? 10.323 -27.860 -9.752  1.00 30.77  ? 486  GLU B CB  1 
ATOM   2529 C  CG  . GLU B 1 114 ? 10.508 -28.985 -10.759 1.00 32.37  ? 486  GLU B CG  1 
ATOM   2530 C  CD  . GLU B 1 114 ? 11.061 -30.286 -10.147 1.00 34.59  ? 486  GLU B CD  1 
ATOM   2531 O  OE1 . GLU B 1 114 ? 11.366 -30.302 -8.930  1.00 37.17  ? 486  GLU B OE1 1 
ATOM   2532 O  OE2 . GLU B 1 114 ? 11.191 -31.293 -10.887 1.00 32.73  ? 486  GLU B OE2 1 
ATOM   2533 N  N   . ALA B 1 115 ? 9.308  -24.307 -9.659  1.00 34.90  ? 487  ALA B N   1 
ATOM   2534 C  CA  . ALA B 1 115 ? 8.963  -23.263 -8.689  1.00 36.21  ? 487  ALA B CA  1 
ATOM   2535 C  C   . ALA B 1 115 ? 7.528  -23.356 -8.197  1.00 37.71  ? 487  ALA B C   1 
ATOM   2536 O  O   . ALA B 1 115 ? 7.248  -23.125 -7.015  1.00 38.53  ? 487  ALA B O   1 
ATOM   2537 C  CB  . ALA B 1 115 ? 9.225  -21.880 -9.282  1.00 37.35  ? 487  ALA B CB  1 
ATOM   2538 N  N   . ARG B 1 116 ? 6.624  -23.674 -9.114  1.00 38.03  ? 488  ARG B N   1 
ATOM   2539 C  CA  . ARG B 1 116 ? 5.192  -23.636 -8.825  1.00 40.69  ? 488  ARG B CA  1 
ATOM   2540 C  C   . ARG B 1 116 ? 4.585  -25.026 -8.678  1.00 40.38  ? 488  ARG B C   1 
ATOM   2541 O  O   . ARG B 1 116 ? 3.381  -25.176 -8.797  1.00 42.14  ? 488  ARG B O   1 
ATOM   2542 C  CB  . ARG B 1 116 ? 4.441  -22.851 -9.910  1.00 42.35  ? 488  ARG B CB  1 
ATOM   2543 C  CG  . ARG B 1 116 ? 4.825  -21.375 -9.994  1.00 43.87  ? 488  ARG B CG  1 
ATOM   2544 C  CD  . ARG B 1 116 ? 3.748  -20.559 -10.686 1.00 47.61  ? 488  ARG B CD  1 
ATOM   2545 N  NE  . ARG B 1 116 ? 2.493  -20.539 -9.919  1.00 50.47  ? 488  ARG B NE  1 
ATOM   2546 C  CZ  . ARG B 1 116 ? 1.335  -21.031 -10.354 1.00 51.55  ? 488  ARG B CZ  1 
ATOM   2547 N  NH1 . ARG B 1 116 ? 1.246  -21.586 -11.561 1.00 49.92  ? 488  ARG B NH1 1 
ATOM   2548 N  NH2 . ARG B 1 116 ? 0.259  -20.962 -9.581  1.00 53.40  ? 488  ARG B NH2 1 
ATOM   2549 N  N   . VAL B 1 117 ? 5.422  -26.033 -8.429  1.00 38.70  ? 489  VAL B N   1 
ATOM   2550 C  CA  . VAL B 1 117 ? 4.957  -27.408 -8.262  1.00 38.41  ? 489  VAL B CA  1 
ATOM   2551 C  C   . VAL B 1 117 ? 4.022  -27.516 -7.051  1.00 40.84  ? 489  VAL B C   1 
ATOM   2552 O  O   . VAL B 1 117 ? 2.905  -28.050 -7.155  1.00 42.20  ? 489  VAL B O   1 
ATOM   2553 C  CB  . VAL B 1 117 ? 6.143  -28.404 -8.164  1.00 35.81  ? 489  VAL B CB  1 
ATOM   2554 C  CG1 . VAL B 1 117 ? 5.703  -29.761 -7.621  1.00 35.63  ? 489  VAL B CG1 1 
ATOM   2555 C  CG2 . VAL B 1 117 ? 6.758  -28.591 -9.520  1.00 33.86  ? 489  VAL B CG2 1 
ATOM   2556 N  N   . GLU B 1 118 ? 4.475  -26.986 -5.919  1.00 41.45  ? 490  GLU B N   1 
ATOM   2557 C  CA  . GLU B 1 118 ? 3.707  -27.057 -4.692  1.00 44.07  ? 490  GLU B CA  1 
ATOM   2558 C  C   . GLU B 1 118 ? 2.381  -26.313 -4.830  1.00 45.93  ? 490  GLU B C   1 
ATOM   2559 O  O   . GLU B 1 118 ? 1.323  -26.867 -4.517  1.00 47.61  ? 490  GLU B O   1 
ATOM   2560 C  CB  . GLU B 1 118 ? 4.528  -26.536 -3.512  1.00 44.89  ? 490  GLU B CB  1 
ATOM   2561 C  CG  . GLU B 1 118 ? 3.832  -26.704 -2.168  1.00 50.39  ? 490  GLU B CG  1 
ATOM   2562 C  CD  . GLU B 1 118 ? 4.791  -27.062 -1.039  1.00 54.68  ? 490  GLU B CD  1 
ATOM   2563 O  OE1 . GLU B 1 118 ? 5.976  -27.385 -1.332  1.00 54.15  ? 490  GLU B OE1 1 
ATOM   2564 O  OE2 . GLU B 1 118 ? 4.348  -27.029 0.138   1.00 58.18  ? 490  GLU B OE2 1 
ATOM   2565 N  N   . ALA B 1 119 ? 2.439  -25.081 -5.338  1.00 46.06  ? 491  ALA B N   1 
ATOM   2566 C  CA  . ALA B 1 119 ? 1.236  -24.256 -5.543  1.00 48.18  ? 491  ALA B CA  1 
ATOM   2567 C  C   . ALA B 1 119 ? 0.269  -24.876 -6.542  1.00 48.41  ? 491  ALA B C   1 
ATOM   2568 O  O   . ALA B 1 119 ? -0.941 -24.704 -6.413  1.00 50.73  ? 491  ALA B O   1 
ATOM   2569 C  CB  . ALA B 1 119 ? 1.604  -22.821 -5.976  1.00 48.38  ? 491  ALA B CB  1 
ATOM   2570 N  N   . MET B 1 120 ? 0.798  -25.571 -7.548  1.00 46.21  ? 492  MET B N   1 
ATOM   2571 C  CA  . MET B 1 120 ? -0.043 -26.281 -8.509  1.00 47.17  ? 492  MET B CA  1 
ATOM   2572 C  C   . MET B 1 120 ? -0.561 -27.637 -7.988  1.00 47.58  ? 492  MET B C   1 
ATOM   2573 O  O   . MET B 1 120 ? -1.429 -28.248 -8.619  1.00 48.12  ? 492  MET B O   1 
ATOM   2574 C  CB  . MET B 1 120 ? 0.681  -26.450 -9.850  1.00 45.59  ? 492  MET B CB  1 
ATOM   2575 C  CG  . MET B 1 120 ? 0.780  -25.163 -10.655 1.00 47.75  ? 492  MET B CG  1 
ATOM   2576 S  SD  . MET B 1 120 ? 1.735  -25.308 -12.177 1.00 49.46  ? 492  MET B SD  1 
ATOM   2577 C  CE  . MET B 1 120 ? 0.599  -26.244 -13.201 1.00 48.22  ? 492  MET B CE  1 
ATOM   2578 N  N   . ALA B 1 121 ? -0.031 -28.094 -6.843  1.00 47.15  ? 493  ALA B N   1 
ATOM   2579 C  CA  . ALA B 1 121 ? -0.413 -29.384 -6.214  1.00 47.98  ? 493  ALA B CA  1 
ATOM   2580 C  C   . ALA B 1 121 ? -0.259 -30.602 -7.148  1.00 47.11  ? 493  ALA B C   1 
ATOM   2581 O  O   . ALA B 1 121 ? -1.056 -31.542 -7.137  1.00 48.90  ? 493  ALA B O   1 
ATOM   2582 C  CB  . ALA B 1 121 ? -1.831 -29.313 -5.610  1.00 50.57  ? 493  ALA B CB  1 
ATOM   2583 N  N   . VAL B 1 122 ? 0.795  -30.575 -7.945  1.00 45.34  ? 494  VAL B N   1 
ATOM   2584 C  CA  . VAL B 1 122 ? 1.041  -31.607 -8.934  1.00 44.83  ? 494  VAL B CA  1 
ATOM   2585 C  C   . VAL B 1 122 ? 2.134  -32.550 -8.389  1.00 43.23  ? 494  VAL B C   1 
ATOM   2586 O  O   . VAL B 1 122 ? 2.968  -32.130 -7.571  1.00 41.98  ? 494  VAL B O   1 
ATOM   2587 C  CB  . VAL B 1 122 ? 1.371  -30.943 -10.305 1.00 44.10  ? 494  VAL B CB  1 
ATOM   2588 C  CG1 . VAL B 1 122 ? 2.787  -30.361 -10.323 1.00 41.38  ? 494  VAL B CG1 1 
ATOM   2589 C  CG2 . VAL B 1 122 ? 1.138  -31.906 -11.453 1.00 45.81  ? 494  VAL B CG2 1 
ATOM   2590 N  N   . LYS B 1 123 ? 2.115  -33.820 -8.802  1.00 43.57  ? 495  LYS B N   1 
ATOM   2591 C  CA  . LYS B 1 123 ? 3.000  -34.833 -8.184  1.00 42.86  ? 495  LYS B CA  1 
ATOM   2592 C  C   . LYS B 1 123 ? 4.253  -35.131 -9.009  1.00 40.16  ? 495  LYS B C   1 
ATOM   2593 O  O   . LYS B 1 123 ? 4.162  -35.629 -10.128 1.00 40.60  ? 495  LYS B O   1 
ATOM   2594 C  CB  . LYS B 1 123 ? 2.231  -36.131 -7.862  1.00 44.88  ? 495  LYS B CB  1 
ATOM   2595 C  CG  . LYS B 1 123 ? 3.086  -37.235 -7.201  1.00 45.87  ? 495  LYS B CG  1 
ATOM   2596 C  CD  . LYS B 1 123 ? 2.269  -38.516 -6.892  1.00 51.31  ? 495  LYS B CD  1 
ATOM   2597 C  CE  . LYS B 1 123 ? 1.584  -38.442 -5.514  1.00 55.05  ? 495  LYS B CE  1 
ATOM   2598 N  NZ  . LYS B 1 123 ? 0.363  -39.321 -5.381  1.00 59.66  ? 495  LYS B NZ  1 
ATOM   2599 N  N   . LYS B 1 124 ? 5.417  -34.825 -8.441  1.00 38.10  ? 496  LYS B N   1 
ATOM   2600 C  CA  . LYS B 1 124 ? 6.706  -35.089 -9.087  1.00 35.26  ? 496  LYS B CA  1 
ATOM   2601 C  C   . LYS B 1 124 ? 6.967  -36.601 -9.123  1.00 35.23  ? 496  LYS B C   1 
ATOM   2602 O  O   . LYS B 1 124 ? 6.709  -37.286 -8.142  1.00 36.62  ? 496  LYS B O   1 
ATOM   2603 C  CB  . LYS B 1 124 ? 7.833  -34.366 -8.341  1.00 33.69  ? 496  LYS B CB  1 
ATOM   2604 C  CG  . LYS B 1 124 ? 9.197  -34.428 -9.038  1.00 31.71  ? 496  LYS B CG  1 
ATOM   2605 C  CD  . LYS B 1 124 ? 10.309 -33.820 -8.170  1.00 29.57  ? 496  LYS B CD  1 
ATOM   2606 C  CE  . LYS B 1 124 ? 11.663 -33.941 -8.885  1.00 27.92  ? 496  LYS B CE  1 
ATOM   2607 N  NZ  . LYS B 1 124 ? 12.484 -32.736 -8.705  1.00 25.50  ? 496  LYS B NZ  1 
ATOM   2608 N  N   . PRO B 1 125 ? 7.459  -37.131 -10.260 1.00 34.00  ? 497  PRO B N   1 
ATOM   2609 C  CA  . PRO B 1 125 ? 7.731  -38.577 -10.282 1.00 34.33  ? 497  PRO B CA  1 
ATOM   2610 C  C   . PRO B 1 125 ? 8.834  -38.963 -9.302  1.00 33.31  ? 497  PRO B C   1 
ATOM   2611 O  O   . PRO B 1 125 ? 9.747  -38.171 -9.055  1.00 31.97  ? 497  PRO B O   1 
ATOM   2612 C  CB  . PRO B 1 125 ? 8.186  -38.847 -11.726 1.00 33.90  ? 497  PRO B CB  1 
ATOM   2613 C  CG  . PRO B 1 125 ? 8.471  -37.515 -12.329 1.00 32.67  ? 497  PRO B CG  1 
ATOM   2614 C  CD  . PRO B 1 125 ? 7.737  -36.475 -11.551 1.00 32.72  ? 497  PRO B CD  1 
ATOM   2615 N  N   . GLY B 1 126 ? 8.710  -40.152 -8.722  1.00 34.15  ? 498  GLY B N   1 
ATOM   2616 C  CA  . GLY B 1 126 ? 9.758  -40.743 -7.894  1.00 33.09  ? 498  GLY B CA  1 
ATOM   2617 C  C   . GLY B 1 126 ? 10.638 -41.655 -8.734  1.00 32.42  ? 498  GLY B C   1 
ATOM   2618 O  O   . GLY B 1 126 ? 10.395 -41.830 -9.936  1.00 31.90  ? 498  GLY B O   1 
ATOM   2619 N  N   . PRO B 1 127 ? 11.681 -42.231 -8.118  1.00 32.54  ? 499  PRO B N   1 
ATOM   2620 C  CA  . PRO B 1 127 ? 12.652 -43.042 -8.863  1.00 32.49  ? 499  PRO B CA  1 
ATOM   2621 C  C   . PRO B 1 127 ? 12.012 -44.233 -9.556  1.00 34.76  ? 499  PRO B C   1 
ATOM   2622 O  O   . PRO B 1 127 ? 12.467 -44.619 -10.623 1.00 34.33  ? 499  PRO B O   1 
ATOM   2623 C  CB  . PRO B 1 127 ? 13.618 -43.507 -7.772  1.00 32.82  ? 499  PRO B CB  1 
ATOM   2624 C  CG  . PRO B 1 127 ? 13.565 -42.366 -6.766  1.00 32.29  ? 499  PRO B CG  1 
ATOM   2625 C  CD  . PRO B 1 127 ? 12.100 -42.028 -6.719  1.00 32.91  ? 499  PRO B CD  1 
ATOM   2626 N  N   . SER B 1 128 ? 10.944 -44.771 -8.963  1.00 37.18  ? 500  SER B N   1 
ATOM   2627 C  CA  . SER B 1 128 ? 10.264 -45.962 -9.471  1.00 40.76  ? 500  SER B CA  1 
ATOM   2628 C  C   . SER B 1 128 ? 9.163  -45.740 -10.495 1.00 41.51  ? 500  SER B C   1 
ATOM   2629 O  O   . SER B 1 128 ? 8.521  -46.704 -10.905 1.00 43.35  ? 500  SER B O   1 
ATOM   2630 C  CB  . SER B 1 128 ? 9.644  -46.750 -8.319  1.00 42.97  ? 500  SER B CB  1 
ATOM   2631 O  OG  . SER B 1 128 ? 10.652 -47.484 -7.681  1.00 45.95  ? 500  SER B OG  1 
ATOM   2632 N  N   . CYS B 1 129 ? 8.907  -44.498 -10.887 1.00 40.21  ? 501  CYS B N   1 
ATOM   2633 C  CA  . CYS B 1 129 ? 7.838  -44.252 -11.856 1.00 42.13  ? 501  CYS B CA  1 
ATOM   2634 C  C   . CYS B 1 129 ? 8.243  -44.736 -13.248 1.00 42.27  ? 501  CYS B C   1 
ATOM   2635 O  O   . CYS B 1 129 ? 9.426  -44.901 -13.530 1.00 41.12  ? 501  CYS B O   1 
ATOM   2636 C  CB  . CYS B 1 129 ? 7.414  -42.787 -11.844 1.00 40.79  ? 501  CYS B CB  1 
ATOM   2637 S  SG  . CYS B 1 129 ? 6.736  -42.294 -10.214 1.00 45.30  ? 501  CYS B SG  1 
ATOM   2638 N  N   . SER B 1 130 ? 7.257  -44.999 -14.095 1.00 44.71  ? 502  SER B N   1 
ATOM   2639 C  CA  . SER B 1 130 ? 7.504  -45.491 -15.449 1.00 45.99  ? 502  SER B CA  1 
ATOM   2640 C  C   . SER B 1 130 ? 8.189  -44.424 -16.292 1.00 44.07  ? 502  SER B C   1 
ATOM   2641 O  O   . SER B 1 130 ? 8.118  -43.229 -15.987 1.00 41.58  ? 502  SER B O   1 
ATOM   2642 C  CB  . SER B 1 130 ? 6.185  -45.899 -16.107 1.00 49.03  ? 502  SER B CB  1 
ATOM   2643 O  OG  . SER B 1 130 ? 5.336  -44.769 -16.227 1.00 49.10  ? 502  SER B OG  1 
ATOM   2644 N  N   . ARG B 1 131 ? 8.844  -44.870 -17.361 1.00 45.60  ? 503  ARG B N   1 
ATOM   2645 C  CA  . ARG B 1 131 ? 9.475  -43.981 -18.335 1.00 45.18  ? 503  ARG B CA  1 
ATOM   2646 C  C   . ARG B 1 131 ? 8.498  -42.926 -18.851 1.00 45.01  ? 503  ARG B C   1 
ATOM   2647 O  O   . ARG B 1 131 ? 8.842  -41.754 -18.919 1.00 43.04  ? 503  ARG B O   1 
ATOM   2648 C  CB  . ARG B 1 131 ? 10.023 -44.783 -19.519 1.00 47.57  ? 503  ARG B CB  1 
ATOM   2649 C  CG  . ARG B 1 131 ? 11.127 -44.065 -20.292 1.00 49.31  ? 503  ARG B CG  1 
ATOM   2650 C  CD  . ARG B 1 131 ? 11.259 -44.582 -21.739 1.00 56.83  ? 503  ARG B CD  1 
ATOM   2651 N  NE  . ARG B 1 131 ? 12.427 -43.986 -22.408 1.00 59.36  ? 503  ARG B NE  1 
ATOM   2652 C  CZ  . ARG B 1 131 ? 12.392 -42.902 -23.190 1.00 60.38  ? 503  ARG B CZ  1 
ATOM   2653 N  NH1 . ARG B 1 131 ? 11.234 -42.278 -23.427 1.00 61.50  ? 503  ARG B NH1 1 
ATOM   2654 N  NH2 . ARG B 1 131 ? 13.518 -42.443 -23.743 1.00 58.37  ? 503  ARG B NH2 1 
ATOM   2655 N  N   . GLN B 1 132 ? 7.281  -43.336 -19.201 1.00 47.66  ? 504  GLN B N   1 
ATOM   2656 C  CA  . GLN B 1 132 ? 6.319  -42.382 -19.759 1.00 48.68  ? 504  GLN B CA  1 
ATOM   2657 C  C   . GLN B 1 132 ? 5.871  -41.302 -18.753 1.00 46.43  ? 504  GLN B C   1 
ATOM   2658 O  O   . GLN B 1 132 ? 5.612  -40.170 -19.144 1.00 45.86  ? 504  GLN B O   1 
ATOM   2659 C  CB  . GLN B 1 132 ? 5.141  -43.081 -20.471 1.00 52.69  ? 504  GLN B CB  1 
ATOM   2660 C  CG  . GLN B 1 132 ? 3.990  -43.542 -19.588 1.00 56.10  ? 504  GLN B CG  1 
ATOM   2661 C  CD  . GLN B 1 132 ? 2.842  -44.140 -20.392 1.00 63.99  ? 504  GLN B CD  1 
ATOM   2662 O  OE1 . GLN B 1 132 ? 3.053  -44.942 -21.316 1.00 67.64  ? 504  GLN B OE1 1 
ATOM   2663 N  NE2 . GLN B 1 132 ? 1.614  -43.760 -20.038 1.00 66.18  ? 504  GLN B NE2 1 
ATOM   2664 N  N   . GLU B 1 133 ? 5.817  -41.643 -17.468 1.00 45.29  ? 505  GLU B N   1 
ATOM   2665 C  CA  . GLU B 1 133 ? 5.499  -40.653 -16.437 1.00 43.85  ? 505  GLU B CA  1 
ATOM   2666 C  C   . GLU B 1 133 ? 6.642  -39.634 -16.225 1.00 39.82  ? 505  GLU B C   1 
ATOM   2667 O  O   . GLU B 1 133 ? 6.401  -38.429 -16.125 1.00 38.82  ? 505  GLU B O   1 
ATOM   2668 C  CB  . GLU B 1 133 ? 5.085  -41.332 -15.121 1.00 44.75  ? 505  GLU B CB  1 
ATOM   2669 C  CG  . GLU B 1 133 ? 4.748  -40.339 -14.016 1.00 46.17  ? 505  GLU B CG  1 
ATOM   2670 C  CD  . GLU B 1 133 ? 4.207  -40.987 -12.750 1.00 51.75  ? 505  GLU B CD  1 
ATOM   2671 O  OE1 . GLU B 1 133 ? 3.594  -42.082 -12.835 1.00 56.62  ? 505  GLU B OE1 1 
ATOM   2672 O  OE2 . GLU B 1 133 ? 4.378  -40.378 -11.666 1.00 51.63  ? 505  GLU B OE2 1 
ATOM   2673 N  N   . LYS B 1 134 ? 7.878  -40.127 -16.174 1.00 37.91  ? 506  LYS B N   1 
ATOM   2674 C  CA  . LYS B 1 134 ? 9.076  -39.273 -16.173 1.00 34.52  ? 506  LYS B CA  1 
ATOM   2675 C  C   . LYS B 1 134 ? 9.147  -38.425 -17.456 1.00 34.84  ? 506  LYS B C   1 
ATOM   2676 O  O   . LYS B 1 134 ? 9.513  -37.243 -17.424 1.00 33.41  ? 506  LYS B O   1 
ATOM   2677 C  CB  . LYS B 1 134 ? 10.347 -40.127 -16.016 1.00 33.11  ? 506  LYS B CB  1 
ATOM   2678 C  CG  . LYS B 1 134 ? 10.397 -40.924 -14.701 1.00 33.41  ? 506  LYS B CG  1 
ATOM   2679 C  CD  . LYS B 1 134 ? 11.762 -41.549 -14.423 1.00 29.89  ? 506  LYS B CD  1 
ATOM   2680 C  CE  . LYS B 1 134 ? 11.723 -42.339 -13.129 1.00 31.00  ? 506  LYS B CE  1 
ATOM   2681 N  NZ  . LYS B 1 134 ? 13.026 -43.012 -12.823 1.00 30.42  ? 506  LYS B NZ  1 
ATOM   2682 N  N   . GLU B 1 135 ? 8.774  -39.043 -18.574 1.00 36.25  ? 507  GLU B N   1 
ATOM   2683 C  CA  . GLU B 1 135 ? 8.767  -38.386 -19.873 1.00 37.70  ? 507  GLU B CA  1 
ATOM   2684 C  C   . GLU B 1 135 ? 7.787  -37.212 -19.889 1.00 37.68  ? 507  GLU B C   1 
ATOM   2685 O  O   . GLU B 1 135 ? 8.156  -36.100 -20.282 1.00 37.05  ? 507  GLU B O   1 
ATOM   2686 C  CB  . GLU B 1 135 ? 8.416  -39.404 -20.951 1.00 40.22  ? 507  GLU B CB  1 
ATOM   2687 C  CG  . GLU B 1 135 ? 8.854  -39.055 -22.334 1.00 45.13  ? 507  GLU B CG  1 
ATOM   2688 C  CD  . GLU B 1 135 ? 8.227  -39.993 -23.357 1.00 53.83  ? 507  GLU B CD  1 
ATOM   2689 O  OE1 . GLU B 1 135 ? 8.420  -41.233 -23.240 1.00 56.07  ? 507  GLU B OE1 1 
ATOM   2690 O  OE2 . GLU B 1 135 ? 7.521  -39.493 -24.264 1.00 58.03  ? 507  GLU B OE2 1 
ATOM   2691 N  N   . ALA B 1 136 ? 6.550  -37.461 -19.446 1.00 38.07  ? 508  ALA B N   1 
ATOM   2692 C  CA  . ALA B 1 136 ? 5.537  -36.411 -19.331 1.00 38.19  ? 508  ALA B CA  1 
ATOM   2693 C  C   . ALA B 1 136 ? 5.992  -35.290 -18.381 1.00 35.61  ? 508  ALA B C   1 
ATOM   2694 O  O   . ALA B 1 136 ? 5.797  -34.116 -18.677 1.00 35.98  ? 508  ALA B O   1 
ATOM   2695 C  CB  . ALA B 1 136 ? 4.177  -37.000 -18.891 1.00 39.55  ? 508  ALA B CB  1 
ATOM   2696 N  N   . TRP B 1 137 ? 6.618  -35.647 -17.261 1.00 33.34  ? 509  TRP B N   1 
ATOM   2697 C  CA  . TRP B 1 137 ? 7.120  -34.635 -16.331 1.00 32.12  ? 509  TRP B CA  1 
ATOM   2698 C  C   . TRP B 1 137 ? 8.210  -33.764 -16.949 1.00 31.80  ? 509  TRP B C   1 
ATOM   2699 O  O   . TRP B 1 137 ? 8.166  -32.526 -16.855 1.00 31.56  ? 509  TRP B O   1 
ATOM   2700 C  CB  . TRP B 1 137 ? 7.656  -35.278 -15.060 1.00 30.47  ? 509  TRP B CB  1 
ATOM   2701 C  CG  . TRP B 1 137 ? 8.090  -34.285 -14.045 1.00 28.33  ? 509  TRP B CG  1 
ATOM   2702 C  CD1 . TRP B 1 137 ? 9.373  -33.869 -13.791 1.00 26.56  ? 509  TRP B CD1 1 
ATOM   2703 C  CD2 . TRP B 1 137 ? 7.247  -33.563 -13.139 1.00 27.23  ? 509  TRP B CD2 1 
ATOM   2704 N  NE1 . TRP B 1 137 ? 9.378  -32.940 -12.779 1.00 24.88  ? 509  TRP B NE1 1 
ATOM   2705 C  CE2 . TRP B 1 137 ? 8.090  -32.730 -12.359 1.00 26.08  ? 509  TRP B CE2 1 
ATOM   2706 C  CE3 . TRP B 1 137 ? 5.867  -33.550 -12.899 1.00 27.83  ? 509  TRP B CE3 1 
ATOM   2707 C  CZ2 . TRP B 1 137 ? 7.593  -31.890 -11.350 1.00 24.54  ? 509  TRP B CZ2 1 
ATOM   2708 C  CZ3 . TRP B 1 137 ? 5.371  -32.707 -11.904 1.00 28.03  ? 509  TRP B CZ3 1 
ATOM   2709 C  CH2 . TRP B 1 137 ? 6.235  -31.888 -11.145 1.00 26.24  ? 509  TRP B CH2 1 
ATOM   2710 N  N   . ILE B 1 138 ? 9.188  -34.425 -17.569 1.00 31.90  ? 510  ILE B N   1 
ATOM   2711 C  CA  . ILE B 1 138 ? 10.320 -33.747 -18.203 1.00 31.75  ? 510  ILE B CA  1 
ATOM   2712 C  C   . ILE B 1 138 ? 9.828  -32.810 -19.314 1.00 33.49  ? 510  ILE B C   1 
ATOM   2713 O  O   . ILE B 1 138 ? 10.232 -31.651 -19.368 1.00 33.59  ? 510  ILE B O   1 
ATOM   2714 C  CB  . ILE B 1 138 ? 11.413 -34.771 -18.668 1.00 30.98  ? 510  ILE B CB  1 
ATOM   2715 C  CG1 . ILE B 1 138 ? 12.032 -35.435 -17.428 1.00 29.25  ? 510  ILE B CG1 1 
ATOM   2716 C  CG2 . ILE B 1 138 ? 12.490 -34.103 -19.547 1.00 30.76  ? 510  ILE B CG2 1 
ATOM   2717 C  CD1 . ILE B 1 138 ? 12.872 -36.648 -17.686 1.00 27.01  ? 510  ILE B CD1 1 
ATOM   2718 N  N   . HIS B 1 139 ? 8.920  -33.295 -20.157 1.00 36.24  ? 511  HIS B N   1 
ATOM   2719 C  CA  . HIS B 1 139 ? 8.315  -32.454 -21.201 1.00 38.63  ? 511  HIS B CA  1 
ATOM   2720 C  C   . HIS B 1 139 ? 7.583  -31.244 -20.597 1.00 38.82  ? 511  HIS B C   1 
ATOM   2721 O  O   . HIS B 1 139 ? 7.768  -30.120 -21.059 1.00 39.97  ? 511  HIS B O   1 
ATOM   2722 C  CB  . HIS B 1 139 ? 7.388  -33.256 -22.111 1.00 41.25  ? 511  HIS B CB  1 
ATOM   2723 C  CG  . HIS B 1 139 ? 6.939  -32.503 -23.326 1.00 46.29  ? 511  HIS B CG  1 
ATOM   2724 N  ND1 . HIS B 1 139 ? 5.812  -31.703 -23.337 1.00 50.07  ? 511  HIS B ND1 1 
ATOM   2725 C  CD2 . HIS B 1 139 ? 7.464  -32.426 -24.574 1.00 48.77  ? 511  HIS B CD2 1 
ATOM   2726 C  CE1 . HIS B 1 139 ? 5.660  -31.171 -24.538 1.00 52.40  ? 511  HIS B CE1 1 
ATOM   2727 N  NE2 . HIS B 1 139 ? 6.651  -31.591 -25.306 1.00 52.56  ? 511  HIS B NE2 1 
ATOM   2728 N  N   . ALA B 1 140 ? 6.788  -31.466 -19.550 1.00 38.12  ? 512  ALA B N   1 
ATOM   2729 C  CA  . ALA B 1 140 ? 6.108  -30.363 -18.879 1.00 38.16  ? 512  ALA B CA  1 
ATOM   2730 C  C   . ALA B 1 140 ? 7.113  -29.340 -18.356 1.00 36.16  ? 512  ALA B C   1 
ATOM   2731 O  O   . ALA B 1 140 ? 6.949  -28.130 -18.550 1.00 36.69  ? 512  ALA B O   1 
ATOM   2732 C  CB  . ALA B 1 140 ? 5.213  -30.879 -17.740 1.00 38.28  ? 512  ALA B CB  1 
ATOM   2733 N  N   . LYS B 1 141 ? 8.157  -29.854 -17.712 1.00 33.77  ? 513  LYS B N   1 
ATOM   2734 C  CA  . LYS B 1 141 ? 9.148  -29.055 -17.006 1.00 32.30  ? 513  LYS B CA  1 
ATOM   2735 C  C   . LYS B 1 141 ? 10.001 -28.156 -17.922 1.00 33.16  ? 513  LYS B C   1 
ATOM   2736 O  O   . LYS B 1 141 ? 10.113 -26.948 -17.682 1.00 33.43  ? 513  LYS B O   1 
ATOM   2737 C  CB  . LYS B 1 141 ? 10.052 -29.996 -16.219 1.00 30.54  ? 513  LYS B CB  1 
ATOM   2738 C  CG  . LYS B 1 141 ? 10.872 -29.358 -15.123 1.00 29.40  ? 513  LYS B CG  1 
ATOM   2739 C  CD  . LYS B 1 141 ? 11.593 -30.449 -14.350 1.00 27.30  ? 513  LYS B CD  1 
ATOM   2740 C  CE  . LYS B 1 141 ? 12.784 -29.895 -13.604 1.00 26.53  ? 513  LYS B CE  1 
ATOM   2741 N  NZ  . LYS B 1 141 ? 13.323 -30.944 -12.652 1.00 26.45  ? 513  LYS B NZ  1 
ATOM   2742 N  N   . TYR B 1 142 ? 10.598 -28.739 -18.962 1.00 33.00  ? 514  TYR B N   1 
ATOM   2743 C  CA  . TYR B 1 142 ? 11.576 -27.997 -19.749 1.00 34.20  ? 514  TYR B CA  1 
ATOM   2744 C  C   . TYR B 1 142 ? 11.045 -27.462 -21.073 1.00 36.86  ? 514  TYR B C   1 
ATOM   2745 O  O   . TYR B 1 142 ? 11.531 -26.446 -21.537 1.00 38.39  ? 514  TYR B O   1 
ATOM   2746 C  CB  . TYR B 1 142 ? 12.856 -28.817 -20.002 1.00 32.60  ? 514  TYR B CB  1 
ATOM   2747 C  CG  . TYR B 1 142 ? 13.546 -29.308 -18.759 1.00 29.55  ? 514  TYR B CG  1 
ATOM   2748 C  CD1 . TYR B 1 142 ? 13.460 -30.652 -18.381 1.00 28.49  ? 514  TYR B CD1 1 
ATOM   2749 C  CD2 . TYR B 1 142 ? 14.284 -28.447 -17.962 1.00 28.81  ? 514  TYR B CD2 1 
ATOM   2750 C  CE1 . TYR B 1 142 ? 14.082 -31.121 -17.232 1.00 24.67  ? 514  TYR B CE1 1 
ATOM   2751 C  CE2 . TYR B 1 142 ? 14.931 -28.910 -16.795 1.00 26.71  ? 514  TYR B CE2 1 
ATOM   2752 C  CZ  . TYR B 1 142 ? 14.824 -30.252 -16.453 1.00 25.59  ? 514  TYR B CZ  1 
ATOM   2753 O  OH  . TYR B 1 142 ? 15.423 -30.734 -15.318 1.00 24.34  ? 514  TYR B OH  1 
ATOM   2754 N  N   . VAL B 1 143 ? 10.079 -28.154 -21.681 1.00 38.29  ? 515  VAL B N   1 
ATOM   2755 C  CA  . VAL B 1 143 ? 9.558  -27.749 -22.977 1.00 41.40  ? 515  VAL B CA  1 
ATOM   2756 C  C   . VAL B 1 143 ? 8.349  -26.833 -22.812 1.00 43.76  ? 515  VAL B C   1 
ATOM   2757 O  O   . VAL B 1 143 ? 8.361  -25.724 -23.307 1.00 45.53  ? 515  VAL B O   1 
ATOM   2758 C  CB  . VAL B 1 143 ? 9.236  -28.953 -23.905 1.00 42.65  ? 515  VAL B CB  1 
ATOM   2759 C  CG1 . VAL B 1 143 ? 8.744  -28.465 -25.268 1.00 44.57  ? 515  VAL B CG1 1 
ATOM   2760 C  CG2 . VAL B 1 143 ? 10.459 -29.837 -24.076 1.00 40.12  ? 515  VAL B CG2 1 
ATOM   2761 N  N   . GLU B 1 144 ? 7.317  -27.292 -22.109 1.00 44.53  ? 516  GLU B N   1 
ATOM   2762 C  CA  . GLU B 1 144 ? 6.135  -26.455 -21.841 1.00 47.08  ? 516  GLU B CA  1 
ATOM   2763 C  C   . GLU B 1 144 ? 6.431  -25.377 -20.817 1.00 45.50  ? 516  GLU B C   1 
ATOM   2764 O  O   . GLU B 1 144 ? 5.775  -24.340 -20.813 1.00 47.23  ? 516  GLU B O   1 
ATOM   2765 C  CB  . GLU B 1 144 ? 4.969  -27.283 -21.320 1.00 47.94  ? 516  GLU B CB  1 
ATOM   2766 C  CG  . GLU B 1 144 ? 4.496  -28.383 -22.241 1.00 53.13  ? 516  GLU B CG  1 
ATOM   2767 C  CD  . GLU B 1 144 ? 3.560  -29.357 -21.524 1.00 57.49  ? 516  GLU B CD  1 
ATOM   2768 O  OE1 . GLU B 1 144 ? 3.920  -30.564 -21.435 1.00 56.86  ? 516  GLU B OE1 1 
ATOM   2769 O  OE2 . GLU B 1 144 ? 2.487  -28.904 -21.038 1.00 59.02  ? 516  GLU B OE2 1 
ATOM   2770 N  N   . LYS B 1 145 ? 7.411  -25.640 -19.950 1.00 42.19  ? 517  LYS B N   1 
ATOM   2771 C  CA  . LYS B 1 145 ? 7.797  -24.730 -18.867 1.00 41.42  ? 517  LYS B CA  1 
ATOM   2772 C  C   . LYS B 1 145 ? 6.605  -24.464 -17.961 1.00 41.76  ? 517  LYS B C   1 
ATOM   2773 O  O   . LYS B 1 145 ? 6.352  -23.342 -17.519 1.00 42.70  ? 517  LYS B O   1 
ATOM   2774 C  CB  . LYS B 1 145 ? 8.420  -23.444 -19.423 1.00 43.08  ? 517  LYS B CB  1 
ATOM   2775 C  CG  . LYS B 1 145 ? 9.713  -23.701 -20.224 1.00 43.76  ? 517  LYS B CG  1 
ATOM   2776 C  CD  . LYS B 1 145 ? 10.359 -22.381 -20.617 1.00 48.45  ? 517  LYS B CD  1 
ATOM   2777 C  CE  . LYS B 1 145 ? 11.398 -22.535 -21.714 1.00 49.09  ? 517  LYS B CE  1 
ATOM   2778 N  NZ  . LYS B 1 145 ? 12.498 -23.340 -21.198 1.00 45.65  ? 517  LYS B NZ  1 
ATOM   2779 N  N   . LYS B 1 146 ? 5.906  -25.556 -17.667 1.00 41.28  ? 518  LYS B N   1 
ATOM   2780 C  CA  . LYS B 1 146 ? 4.595  -25.560 -17.022 1.00 42.02  ? 518  LYS B CA  1 
ATOM   2781 C  C   . LYS B 1 146 ? 4.641  -25.082 -15.567 1.00 40.72  ? 518  LYS B C   1 
ATOM   2782 O  O   . LYS B 1 146 ? 3.629  -24.635 -15.046 1.00 42.28  ? 518  LYS B O   1 
ATOM   2783 C  CB  . LYS B 1 146 ? 3.994  -26.974 -17.145 1.00 41.83  ? 518  LYS B CB  1 
ATOM   2784 C  CG  . LYS B 1 146 ? 2.660  -27.230 -16.447 1.00 44.05  ? 518  LYS B CG  1 
ATOM   2785 C  CD  . LYS B 1 146 ? 2.060  -28.585 -16.869 1.00 45.80  ? 518  LYS B CD  1 
ATOM   2786 C  CE  . LYS B 1 146 ? 0.711  -28.840 -16.204 1.00 49.30  ? 518  LYS B CE  1 
ATOM   2787 N  NZ  . LYS B 1 146 ? -0.188 -29.747 -16.988 1.00 51.28  ? 518  LYS B NZ  1 
ATOM   2788 N  N   . PHE B 1 147 ? 5.806  -25.152 -14.919 1.00 37.94  ? 519  PHE B N   1 
ATOM   2789 C  CA  . PHE B 1 147 ? 5.889  -24.815 -13.494 1.00 37.64  ? 519  PHE B CA  1 
ATOM   2790 C  C   . PHE B 1 147 ? 6.662  -23.551 -13.175 1.00 38.22  ? 519  PHE B C   1 
ATOM   2791 O  O   . PHE B 1 147 ? 6.923  -23.252 -12.005 1.00 38.31  ? 519  PHE B O   1 
ATOM   2792 C  CB  . PHE B 1 147 ? 6.447  -25.999 -12.688 1.00 35.59  ? 519  PHE B CB  1 
ATOM   2793 C  CG  . PHE B 1 147 ? 5.913  -27.328 -13.130 1.00 35.56  ? 519  PHE B CG  1 
ATOM   2794 C  CD1 . PHE B 1 147 ? 6.782  -28.320 -13.589 1.00 33.90  ? 519  PHE B CD1 1 
ATOM   2795 C  CD2 . PHE B 1 147 ? 4.540  -27.588 -13.110 1.00 36.05  ? 519  PHE B CD2 1 
ATOM   2796 C  CE1 . PHE B 1 147 ? 6.295  -29.555 -14.013 1.00 35.19  ? 519  PHE B CE1 1 
ATOM   2797 C  CE2 . PHE B 1 147 ? 4.044  -28.828 -13.530 1.00 37.62  ? 519  PHE B CE2 1 
ATOM   2798 C  CZ  . PHE B 1 147 ? 4.913  -29.812 -13.978 1.00 35.06  ? 519  PHE B CZ  1 
ATOM   2799 N  N   . LEU B 1 148 ? 7.034  -22.806 -14.208 1.00 39.16  ? 520  LEU B N   1 
ATOM   2800 C  CA  . LEU B 1 148 ? 7.745  -21.548 -14.014 1.00 40.49  ? 520  LEU B CA  1 
ATOM   2801 C  C   . LEU B 1 148 ? 6.882  -20.505 -13.295 1.00 42.92  ? 520  LEU B C   1 
ATOM   2802 O  O   . LEU B 1 148 ? 5.670  -20.500 -13.454 1.00 44.50  ? 520  LEU B O   1 
ATOM   2803 C  CB  . LEU B 1 148 ? 8.208  -21.004 -15.365 1.00 40.95  ? 520  LEU B CB  1 
ATOM   2804 C  CG  . LEU B 1 148 ? 9.669  -21.152 -15.802 1.00 39.99  ? 520  LEU B CG  1 
ATOM   2805 C  CD1 . LEU B 1 148 ? 10.273 -22.536 -15.593 1.00 34.06  ? 520  LEU B CD1 1 
ATOM   2806 C  CD2 . LEU B 1 148 ? 9.814  -20.673 -17.252 1.00 41.36  ? 520  LEU B CD2 1 
ATOM   2807 N  N   . THR B 1 149 ? 7.508  -19.634 -12.503 1.00 43.84  ? 521  THR B N   1 
ATOM   2808 C  CA  . THR B 1 149 ? 6.856  -18.394 -12.054 1.00 47.06  ? 521  THR B CA  1 
ATOM   2809 C  C   . THR B 1 149 ? 6.575  -17.528 -13.293 1.00 49.58  ? 521  THR B C   1 
ATOM   2810 O  O   . THR B 1 149 ? 7.202  -17.715 -14.336 1.00 49.00  ? 521  THR B O   1 
ATOM   2811 C  CB  . THR B 1 149 ? 7.748  -17.578 -11.083 1.00 47.63  ? 521  THR B CB  1 
ATOM   2812 O  OG1 . THR B 1 149 ? 8.963  -17.207 -11.750 1.00 47.33  ? 521  THR B OG1 1 
ATOM   2813 C  CG2 . THR B 1 149 ? 8.082  -18.376 -9.821  1.00 44.90  ? 521  THR B CG2 1 
ATOM   2814 N  N   . LYS B 1 150 ? 5.635  -16.601 -13.195 1.00 52.80  ? 522  LYS B N   1 
ATOM   2815 C  CA  . LYS B 1 150 ? 5.352  -15.696 -14.314 1.00 56.38  ? 522  LYS B CA  1 
ATOM   2816 C  C   . LYS B 1 150 ? 6.585  -14.842 -14.690 1.00 57.39  ? 522  LYS B C   1 
ATOM   2817 O  O   . LYS B 1 150 ? 6.876  -14.633 -15.876 1.00 58.38  ? 522  LYS B O   1 
ATOM   2818 C  CB  . LYS B 1 150 ? 4.136  -14.809 -13.988 1.00 59.68  ? 522  LYS B CB  1 
ATOM   2819 C  CG  . LYS B 1 150 ? 3.568  -14.017 -15.171 1.00 63.23  ? 522  LYS B CG  1 
ATOM   2820 C  CD  . LYS B 1 150 ? 2.514  -12.988 -14.712 1.00 66.96  ? 522  LYS B CD  1 
ATOM   2821 C  CE  . LYS B 1 150 ? 2.390  -11.844 -15.715 1.00 70.86  ? 522  LYS B CE  1 
ATOM   2822 N  NZ  . LYS B 1 150 ? 1.202  -10.981 -15.466 1.00 74.51  ? 522  LYS B NZ  1 
ATOM   2823 N  N   . LEU B 1 151 ? 7.303  -14.370 -13.667 1.00 57.61  ? 523  LEU B N   1 
ATOM   2824 C  CA  . LEU B 1 151 ? 8.449  -13.470 -13.818 1.00 58.83  ? 523  LEU B CA  1 
ATOM   2825 C  C   . LEU B 1 151 ? 9.704  -14.094 -13.190 1.00 56.31  ? 523  LEU B C   1 
ATOM   2826 O  O   . LEU B 1 151 ? 9.596  -14.826 -12.202 1.00 54.44  ? 523  LEU B O   1 
ATOM   2827 C  CB  . LEU B 1 151 ? 8.133  -12.134 -13.145 1.00 62.45  ? 523  LEU B CB  1 
ATOM   2828 C  CG  . LEU B 1 151 ? 7.418  -10.994 -13.899 1.00 67.02  ? 523  LEU B CG  1 
ATOM   2829 C  CD1 . LEU B 1 151 ? 6.349  -11.449 -14.894 1.00 66.88  ? 523  LEU B CD1 1 
ATOM   2830 C  CD2 . LEU B 1 151 ? 6.823  -9.996  -12.900 1.00 69.31  ? 523  LEU B CD2 1 
ATOM   2831 N  N   . PRO B 1 152 ? 10.900 -13.825 -13.767 1.00 56.22  ? 524  PRO B N   1 
ATOM   2832 C  CA  . PRO B 1 152 ? 12.147 -14.423 -13.236 1.00 53.73  ? 524  PRO B CA  1 
ATOM   2833 C  C   . PRO B 1 152 ? 12.629 -13.836 -11.907 1.00 54.59  ? 524  PRO B C   1 
ATOM   2834 O  O   . PRO B 1 152 ? 12.543 -12.624 -11.703 1.00 57.89  ? 524  PRO B O   1 
ATOM   2835 C  CB  . PRO B 1 152 ? 13.171 -14.155 -14.347 1.00 54.13  ? 524  PRO B CB  1 
ATOM   2836 C  CG  . PRO B 1 152 ? 12.600 -13.015 -15.138 1.00 57.82  ? 524  PRO B CG  1 
ATOM   2837 C  CD  . PRO B 1 152 ? 11.113 -13.155 -15.063 1.00 58.11  ? 524  PRO B CD  1 
ATOM   2838 N  N   . LEU B 1 197 ? 10.250 -8.774  -15.441 1.00 60.94  ? 569  LEU B N   1 
ATOM   2839 C  CA  . LEU B 1 197 ? 9.479  -8.132  -16.514 1.00 62.37  ? 569  LEU B CA  1 
ATOM   2840 C  C   . LEU B 1 197 ? 10.223 -8.083  -17.861 1.00 60.27  ? 569  LEU B C   1 
ATOM   2841 O  O   . LEU B 1 197 ? 9.590  -8.129  -18.922 1.00 60.61  ? 569  LEU B O   1 
ATOM   2842 C  CB  . LEU B 1 197 ? 9.017  -6.723  -16.105 1.00 65.79  ? 569  LEU B CB  1 
ATOM   2843 C  CG  . LEU B 1 197 ? 7.747  -6.563  -15.251 1.00 69.97  ? 569  LEU B CG  1 
ATOM   2844 C  CD1 . LEU B 1 197 ? 7.702  -5.211  -14.523 1.00 73.09  ? 569  LEU B CD1 1 
ATOM   2845 C  CD2 . LEU B 1 197 ? 6.462  -6.775  -16.069 1.00 72.39  ? 569  LEU B CD2 1 
ATOM   2846 N  N   . HIS B 1 198 ? 11.552 -7.984  -17.818 1.00 57.90  ? 570  HIS B N   1 
ATOM   2847 C  CA  . HIS B 1 198 ? 12.362 -8.003  -19.041 1.00 55.93  ? 570  HIS B CA  1 
ATOM   2848 C  C   . HIS B 1 198 ? 13.485 -9.050  -18.978 1.00 52.49  ? 570  HIS B C   1 
ATOM   2849 O  O   . HIS B 1 198 ? 14.573 -8.765  -18.469 1.00 51.44  ? 570  HIS B O   1 
ATOM   2850 C  CB  . HIS B 1 198 ? 12.896 -6.602  -19.368 1.00 57.17  ? 570  HIS B CB  1 
ATOM   2851 C  CG  . HIS B 1 198 ? 11.822 -5.636  -19.765 1.00 61.08  ? 570  HIS B CG  1 
ATOM   2852 N  ND1 . HIS B 1 198 ? 11.349 -5.539  -21.056 1.00 62.15  ? 570  HIS B ND1 1 
ATOM   2853 C  CD2 . HIS B 1 198 ? 11.102 -4.752  -19.032 1.00 64.85  ? 570  HIS B CD2 1 
ATOM   2854 C  CE1 . HIS B 1 198 ? 10.395 -4.626  -21.106 1.00 65.93  ? 570  HIS B CE1 1 
ATOM   2855 N  NE2 . HIS B 1 198 ? 10.224 -4.134  -19.890 1.00 67.68  ? 570  HIS B NE2 1 
ATOM   2856 N  N   . PRO B 1 199 ? 13.212 -10.276 -19.488 1.00 50.68  ? 571  PRO B N   1 
ATOM   2857 C  CA  . PRO B 1 199 ? 14.154 -11.406 -19.371 1.00 47.67  ? 571  PRO B CA  1 
ATOM   2858 C  C   . PRO B 1 199 ? 15.510 -11.152 -20.037 1.00 45.21  ? 571  PRO B C   1 
ATOM   2859 O  O   . PRO B 1 199 ? 16.545 -11.386 -19.418 1.00 43.87  ? 571  PRO B O   1 
ATOM   2860 C  CB  . PRO B 1 199 ? 13.403 -12.564 -20.052 1.00 47.23  ? 571  PRO B CB  1 
ATOM   2861 C  CG  . PRO B 1 199 ? 11.959 -12.183 -19.957 1.00 49.59  ? 571  PRO B CG  1 
ATOM   2862 C  CD  . PRO B 1 199 ? 11.947 -10.694 -20.128 1.00 51.48  ? 571  PRO B CD  1 
ATOM   2863 N  N   . GLY B 1 200 ? 15.500 -10.678 -21.280 1.00 44.76  ? 572  GLY B N   1 
ATOM   2864 C  CA  . GLY B 1 200 ? 16.730 -10.348 -21.996 1.00 43.01  ? 572  GLY B CA  1 
ATOM   2865 C  C   . GLY B 1 200 ? 17.592 -9.358  -21.224 1.00 42.90  ? 572  GLY B C   1 
ATOM   2866 O  O   . GLY B 1 200 ? 18.791 -9.592  -21.018 1.00 41.92  ? 572  GLY B O   1 
ATOM   2867 N  N   . ALA B 1 201 ? 16.981 -8.262  -20.779 1.00 43.81  ? 573  ALA B N   1 
ATOM   2868 C  CA  . ALA B 1 201 ? 17.686 -7.247  -19.998 1.00 43.70  ? 573  ALA B CA  1 
ATOM   2869 C  C   . ALA B 1 201 ? 18.216 -7.803  -18.670 1.00 42.44  ? 573  ALA B C   1 
ATOM   2870 O  O   . ALA B 1 201 ? 19.322 -7.452  -18.240 1.00 41.95  ? 573  ALA B O   1 
ATOM   2871 C  CB  . ALA B 1 201 ? 16.787 -6.019  -19.761 1.00 46.32  ? 573  ALA B CB  1 
ATOM   2872 N  N   . LEU B 1 202 ? 17.430 -8.664  -18.027 1.00 41.84  ? 574  LEU B N   1 
ATOM   2873 C  CA  . LEU B 1 202 ? 17.859 -9.309  -16.790 1.00 40.70  ? 574  LEU B CA  1 
ATOM   2874 C  C   . LEU B 1 202 ? 19.094 -10.187 -17.042 1.00 38.42  ? 574  LEU B C   1 
ATOM   2875 O  O   . LEU B 1 202 ? 20.074 -10.093 -16.314 1.00 37.84  ? 574  LEU B O   1 
ATOM   2876 C  CB  . LEU B 1 202 ? 16.721 -10.113 -16.162 1.00 41.29  ? 574  LEU B CB  1 
ATOM   2877 C  CG  . LEU B 1 202 ? 16.983 -10.701 -14.765 1.00 40.82  ? 574  LEU B CG  1 
ATOM   2878 C  CD1 . LEU B 1 202 ? 17.281 -9.627  -13.735 1.00 41.64  ? 574  LEU B CD1 1 
ATOM   2879 C  CD2 . LEU B 1 202 ? 15.806 -11.543 -14.312 1.00 40.85  ? 574  LEU B CD2 1 
ATOM   2880 N  N   . LEU B 1 203 ? 19.056 -11.002 -18.095 1.00 37.01  ? 575  LEU B N   1 
ATOM   2881 C  CA  . LEU B 1 203 ? 20.202 -11.813 -18.476 1.00 35.12  ? 575  LEU B CA  1 
ATOM   2882 C  C   . LEU B 1 203 ? 21.457 -10.939 -18.604 1.00 35.18  ? 575  LEU B C   1 
ATOM   2883 O  O   . LEU B 1 203 ? 22.459 -11.179 -17.914 1.00 33.81  ? 575  LEU B O   1 
ATOM   2884 C  CB  . LEU B 1 203 ? 19.919 -12.552 -19.785 1.00 34.37  ? 575  LEU B CB  1 
ATOM   2885 C  CG  . LEU B 1 203 ? 21.005 -13.500 -20.319 1.00 33.64  ? 575  LEU B CG  1 
ATOM   2886 C  CD1 . LEU B 1 203 ? 21.394 -14.583 -19.313 1.00 31.89  ? 575  LEU B CD1 1 
ATOM   2887 C  CD2 . LEU B 1 203 ? 20.588 -14.114 -21.642 1.00 34.68  ? 575  LEU B CD2 1 
ATOM   2888 N  N   . PHE B 1 204 ? 21.374 -9.913  -19.462 1.00 36.04  ? 576  PHE B N   1 
ATOM   2889 C  CA  . PHE B 1 204 ? 22.459 -8.942  -19.671 1.00 36.20  ? 576  PHE B CA  1 
ATOM   2890 C  C   . PHE B 1 204 ? 23.007 -8.424  -18.342 1.00 37.39  ? 576  PHE B C   1 
ATOM   2891 O  O   . PHE B 1 204 ? 24.204 -8.480  -18.104 1.00 36.76  ? 576  PHE B O   1 
ATOM   2892 C  CB  . PHE B 1 204 ? 21.971 -7.794  -20.563 1.00 37.20  ? 576  PHE B CB  1 
ATOM   2893 C  CG  . PHE B 1 204 ? 23.019 -6.731  -20.857 1.00 36.65  ? 576  PHE B CG  1 
ATOM   2894 C  CD1 . PHE B 1 204 ? 23.206 -5.647  -19.991 1.00 37.26  ? 576  PHE B CD1 1 
ATOM   2895 C  CD2 . PHE B 1 204 ? 23.775 -6.791  -22.015 1.00 34.38  ? 576  PHE B CD2 1 
ATOM   2896 C  CE1 . PHE B 1 204 ? 24.160 -4.654  -20.268 1.00 37.89  ? 576  PHE B CE1 1 
ATOM   2897 C  CE2 . PHE B 1 204 ? 24.735 -5.809  -22.300 1.00 36.01  ? 576  PHE B CE2 1 
ATOM   2898 C  CZ  . PHE B 1 204 ? 24.925 -4.740  -21.421 1.00 36.56  ? 576  PHE B CZ  1 
ATOM   2899 N  N   . ARG B 1 205 ? 22.127 -7.944  -17.472 1.00 39.85  ? 577  ARG B N   1 
ATOM   2900 C  CA  . ARG B 1 205 ? 22.526 -7.453  -16.156 1.00 42.33  ? 577  ARG B CA  1 
ATOM   2901 C  C   . ARG B 1 205 ? 23.270 -8.526  -15.344 1.00 41.39  ? 577  ARG B C   1 
ATOM   2902 O  O   . ARG B 1 205 ? 24.320 -8.252  -14.769 1.00 41.67  ? 577  ARG B O   1 
ATOM   2903 C  CB  . ARG B 1 205 ? 21.297 -6.966  -15.384 1.00 44.81  ? 577  ARG B CB  1 
ATOM   2904 C  CG  . ARG B 1 205 ? 21.559 -5.841  -14.377 1.00 50.37  ? 577  ARG B CG  1 
ATOM   2905 C  CD  . ARG B 1 205 ? 20.258 -5.438  -13.654 1.00 58.16  ? 577  ARG B CD  1 
ATOM   2906 N  NE  . ARG B 1 205 ? 19.148 -5.234  -14.598 1.00 61.48  ? 577  ARG B NE  1 
ATOM   2907 C  CZ  . ARG B 1 205 ? 17.866 -5.514  -14.351 1.00 65.13  ? 577  ARG B CZ  1 
ATOM   2908 N  NH1 . ARG B 1 205 ? 17.485 -6.015  -13.171 1.00 66.97  ? 577  ARG B NH1 1 
ATOM   2909 N  NH2 . ARG B 1 205 ? 16.952 -5.293  -15.292 1.00 66.29  ? 577  ARG B NH2 1 
ATOM   2910 N  N   . ALA B 1 206 ? 22.727 -9.744  -15.330 1.00 40.79  ? 578  ALA B N   1 
ATOM   2911 C  CA  . ALA B 1 206 ? 23.222 -10.833 -14.488 1.00 40.28  ? 578  ALA B CA  1 
ATOM   2912 C  C   . ALA B 1 206 ? 24.568 -11.362 -14.954 1.00 38.96  ? 578  ALA B C   1 
ATOM   2913 O  O   . ALA B 1 206 ? 25.313 -11.948 -14.168 1.00 38.39  ? 578  ALA B O   1 
ATOM   2914 C  CB  . ALA B 1 206 ? 22.192 -11.963 -14.422 1.00 40.01  ? 578  ALA B CB  1 
ATOM   2915 N  N   . SER B 1 207 ? 24.870 -11.145 -16.234 1.00 38.41  ? 579  SER B N   1 
ATOM   2916 C  CA  . SER B 1 207 ? 26.125 -11.573 -16.843 1.00 37.98  ? 579  SER B CA  1 
ATOM   2917 C  C   . SER B 1 207 ? 27.305 -10.648 -16.513 1.00 39.43  ? 579  SER B C   1 
ATOM   2918 O  O   . SER B 1 207 ? 28.469 -11.033 -16.682 1.00 38.41  ? 579  SER B O   1 
ATOM   2919 C  CB  . SER B 1 207 ? 25.972 -11.618 -18.358 1.00 37.04  ? 579  SER B CB  1 
ATOM   2920 O  OG  . SER B 1 207 ? 24.861 -12.400 -18.735 1.00 37.49  ? 579  SER B OG  1 
ATOM   2921 N  N   . GLY B 1 208 ? 27.004 -9.426  -16.065 1.00 41.35  ? 580  GLY B N   1 
ATOM   2922 C  CA  . GLY B 1 208 ? 28.034 -8.419  -15.802 1.00 42.71  ? 580  GLY B CA  1 
ATOM   2923 C  C   . GLY B 1 208 ? 28.597 -8.614  -14.414 1.00 44.53  ? 580  GLY B C   1 
ATOM   2924 O  O   . GLY B 1 208 ? 28.095 -9.449  -13.662 1.00 44.81  ? 580  GLY B O   1 
ATOM   2925 N  N   . HIS B 1 209 ? 29.642 -7.857  -14.081 1.00 45.73  ? 581  HIS B N   1 
ATOM   2926 C  CA  . HIS B 1 209 ? 30.322 -7.984  -12.784 1.00 47.89  ? 581  HIS B CA  1 
ATOM   2927 C  C   . HIS B 1 209 ? 29.453 -7.509  -11.629 1.00 49.56  ? 581  HIS B C   1 
ATOM   2928 O  O   . HIS B 1 209 ? 28.904 -6.408  -11.695 1.00 50.99  ? 581  HIS B O   1 
ATOM   2929 C  CB  . HIS B 1 209 ? 31.637 -7.190  -12.782 1.00 48.87  ? 581  HIS B CB  1 
ATOM   2930 C  CG  . HIS B 1 209 ? 32.440 -7.361  -11.529 1.00 52.32  ? 581  HIS B CG  1 
ATOM   2931 N  ND1 . HIS B 1 209 ? 33.175 -8.498  -11.264 1.00 53.28  ? 581  HIS B ND1 1 
ATOM   2932 C  CD2 . HIS B 1 209 ? 32.618 -6.542  -10.463 1.00 56.20  ? 581  HIS B CD2 1 
ATOM   2933 C  CE1 . HIS B 1 209 ? 33.777 -8.369  -10.094 1.00 55.47  ? 581  HIS B CE1 1 
ATOM   2934 N  NE2 . HIS B 1 209 ? 33.455 -7.191  -9.588  1.00 57.55  ? 581  HIS B NE2 1 
ATOM   2935 N  N   . PRO B 1 210 ? 29.305 -8.341  -10.575 1.00 50.42  ? 582  PRO B N   1 
ATOM   2936 C  CA  . PRO B 1 210 ? 29.711 -9.760  -10.531 1.00 48.87  ? 582  PRO B CA  1 
ATOM   2937 C  C   . PRO B 1 210 ? 28.575 -10.650 -11.053 1.00 46.82  ? 582  PRO B C   1 
ATOM   2938 O  O   . PRO B 1 210 ? 27.412 -10.389 -10.741 1.00 48.21  ? 582  PRO B O   1 
ATOM   2939 C  CB  . PRO B 1 210 ? 29.970 -10.014 -9.039  1.00 50.88  ? 582  PRO B CB  1 
ATOM   2940 C  CG  . PRO B 1 210 ? 29.144 -8.997  -8.318  1.00 53.27  ? 582  PRO B CG  1 
ATOM   2941 C  CD  . PRO B 1 210 ? 28.795 -7.872  -9.269  1.00 52.64  ? 582  PRO B CD  1 
ATOM   2942 N  N   . PRO B 1 211 ? 28.893 -11.674 -11.865 1.00 44.12  ? 583  PRO B N   1 
ATOM   2943 C  CA  . PRO B 1 211 ? 27.767 -12.381 -12.474 1.00 42.36  ? 583  PRO B CA  1 
ATOM   2944 C  C   . PRO B 1 211 ? 27.046 -13.303 -11.510 1.00 42.36  ? 583  PRO B C   1 
ATOM   2945 O  O   . PRO B 1 211 ? 27.679 -13.969 -10.703 1.00 43.58  ? 583  PRO B O   1 
ATOM   2946 C  CB  . PRO B 1 211 ? 28.409 -13.177 -13.621 1.00 40.38  ? 583  PRO B CB  1 
ATOM   2947 C  CG  . PRO B 1 211 ? 29.822 -12.669 -13.725 1.00 41.11  ? 583  PRO B CG  1 
ATOM   2948 C  CD  . PRO B 1 211 ? 30.187 -12.159 -12.372 1.00 42.80  ? 583  PRO B CD  1 
ATOM   2949 N  N   . SER B 1 212 ? 25.722 -13.311 -11.589 1.00 41.26  ? 584  SER B N   1 
ATOM   2950 C  CA  . SER B 1 212 ? 24.917 -14.269 -10.847 1.00 41.16  ? 584  SER B CA  1 
ATOM   2951 C  C   . SER B 1 212 ? 24.418 -15.345 -11.796 1.00 38.28  ? 584  SER B C   1 
ATOM   2952 O  O   . SER B 1 212 ? 23.499 -15.129 -12.575 1.00 38.12  ? 584  SER B O   1 
ATOM   2953 C  CB  . SER B 1 212 ? 23.754 -13.571 -10.142 1.00 42.81  ? 584  SER B CB  1 
ATOM   2954 O  OG  . SER B 1 212 ? 22.765 -14.512 -9.768  1.00 45.50  ? 584  SER B OG  1 
ATOM   2955 N  N   . LEU B 1 213 ? 25.039 -16.509 -11.747 1.00 36.61  ? 585  LEU B N   1 
ATOM   2956 C  CA  . LEU B 1 213 ? 24.614 -17.610 -12.606 1.00 34.46  ? 585  LEU B CA  1 
ATOM   2957 C  C   . LEU B 1 213 ? 23.182 -18.120 -12.342 1.00 33.75  ? 585  LEU B C   1 
ATOM   2958 O  O   . LEU B 1 213 ? 22.470 -18.469 -13.304 1.00 31.87  ? 585  LEU B O   1 
ATOM   2959 C  CB  . LEU B 1 213 ? 25.635 -18.743 -12.570 1.00 34.92  ? 585  LEU B CB  1 
ATOM   2960 C  CG  . LEU B 1 213 ? 26.876 -18.431 -13.393 1.00 35.62  ? 585  LEU B CG  1 
ATOM   2961 C  CD1 . LEU B 1 213 ? 27.989 -19.306 -12.917 1.00 39.56  ? 585  LEU B CD1 1 
ATOM   2962 C  CD2 . LEU B 1 213 ? 26.581 -18.714 -14.843 1.00 35.23  ? 585  LEU B CD2 1 
ATOM   2963 N  N   . PRO B 1 214 ? 22.750 -18.158 -11.059 1.00 34.08  ? 586  PRO B N   1 
ATOM   2964 C  CA  . PRO B 1 214 ? 21.341 -18.504 -10.813 1.00 34.88  ? 586  PRO B CA  1 
ATOM   2965 C  C   . PRO B 1 214 ? 20.355 -17.528 -11.469 1.00 34.78  ? 586  PRO B C   1 
ATOM   2966 O  O   . PRO B 1 214 ? 19.336 -17.975 -11.995 1.00 34.63  ? 586  PRO B O   1 
ATOM   2967 C  CB  . PRO B 1 214 ? 21.214 -18.480 -9.282  1.00 36.76  ? 586  PRO B CB  1 
ATOM   2968 C  CG  . PRO B 1 214 ? 22.585 -18.761 -8.779  1.00 37.17  ? 586  PRO B CG  1 
ATOM   2969 C  CD  . PRO B 1 214 ? 23.533 -18.132 -9.810  1.00 35.90  ? 586  PRO B CD  1 
ATOM   2970 N  N   . THR B 1 215 ? 20.678 -16.226 -11.481 1.00 35.11  ? 587  THR B N   1 
ATOM   2971 C  CA  . THR B 1 215 ? 19.819 -15.223 -12.146 1.00 34.61  ? 587  THR B CA  1 
ATOM   2972 C  C   . THR B 1 215 ? 19.788 -15.399 -13.662 1.00 32.91  ? 587  THR B C   1 
ATOM   2973 O  O   . THR B 1 215 ? 18.701 -15.347 -14.277 1.00 33.00  ? 587  THR B O   1 
ATOM   2974 C  CB  . THR B 1 215 ? 20.150 -13.760 -11.735 1.00 35.71  ? 587  THR B CB  1 
ATOM   2975 O  OG1 . THR B 1 215 ? 20.173 -13.660 -10.302 1.00 37.19  ? 587  THR B OG1 1 
ATOM   2976 C  CG2 . THR B 1 215 ? 19.084 -12.813 -12.242 1.00 35.28  ? 587  THR B CG2 1 
ATOM   2977 N  N   . MET B 1 216 ? 20.961 -15.635 -14.253 1.00 31.33  ? 588  MET B N   1 
ATOM   2978 C  CA  . MET B 1 216 ? 21.081 -15.945 -15.684 1.00 29.94  ? 588  MET B CA  1 
ATOM   2979 C  C   . MET B 1 216 ? 20.248 -17.153 -16.088 1.00 29.55  ? 588  MET B C   1 
ATOM   2980 O  O   . MET B 1 216 ? 19.589 -17.141 -17.124 1.00 29.78  ? 588  MET B O   1 
ATOM   2981 C  CB  . MET B 1 216 ? 22.549 -16.208 -16.072 1.00 29.22  ? 588  MET B CB  1 
ATOM   2982 C  CG  . MET B 1 216 ? 23.467 -14.981 -16.010 1.00 31.44  ? 588  MET B CG  1 
ATOM   2983 S  SD  . MET B 1 216 ? 25.252 -15.314 -16.145 1.00 31.87  ? 588  MET B SD  1 
ATOM   2984 C  CE  . MET B 1 216 ? 25.351 -15.998 -17.805 1.00 27.52  ? 588  MET B CE  1 
ATOM   2985 N  N   . ALA B 1 217 ? 20.318 -18.215 -15.290 1.00 30.29  ? 589  ALA B N   1 
ATOM   2986 C  CA  . ALA B 1 217 ? 19.536 -19.426 -15.529 1.00 30.73  ? 589  ALA B CA  1 
ATOM   2987 C  C   . ALA B 1 217 ? 18.031 -19.092 -15.499 1.00 31.80  ? 589  ALA B C   1 
ATOM   2988 O  O   . ALA B 1 217 ? 17.262 -19.544 -16.371 1.00 31.23  ? 589  ALA B O   1 
ATOM   2989 C  CB  . ALA B 1 217 ? 19.865 -20.490 -14.477 1.00 30.63  ? 589  ALA B CB  1 
ATOM   2990 N  N   . ASP B 1 218 ? 17.641 -18.289 -14.500 1.00 32.87  ? 590  ASP B N   1 
ATOM   2991 C  CA  . ASP B 1 218 ? 16.253 -17.847 -14.325 1.00 34.50  ? 590  ASP B CA  1 
ATOM   2992 C  C   . ASP B 1 218 ? 15.796 -17.056 -15.550 1.00 34.38  ? 590  ASP B C   1 
ATOM   2993 O  O   . ASP B 1 218 ? 14.733 -17.341 -16.094 1.00 35.11  ? 590  ASP B O   1 
ATOM   2994 C  CB  . ASP B 1 218 ? 16.114 -17.025 -13.040 1.00 36.25  ? 590  ASP B CB  1 
ATOM   2995 C  CG  . ASP B 1 218 ? 14.687 -16.970 -12.511 1.00 39.40  ? 590  ASP B CG  1 
ATOM   2996 O  OD1 . ASP B 1 218 ? 13.763 -17.532 -13.141 1.00 40.70  ? 590  ASP B OD1 1 
ATOM   2997 O  OD2 . ASP B 1 218 ? 14.481 -16.333 -11.450 1.00 42.64  ? 590  ASP B OD2 1 
ATOM   2998 N  N   . ALA B 1 219 ? 16.619 -16.112 -16.018 1.00 33.47  ? 591  ALA B N   1 
ATOM   2999 C  CA  . ALA B 1 219 ? 16.265 -15.302 -17.188 1.00 33.66  ? 591  ALA B CA  1 
ATOM   3000 C  C   . ALA B 1 219 ? 16.102 -16.162 -18.442 1.00 33.31  ? 591  ALA B C   1 
ATOM   3001 O  O   . ALA B 1 219 ? 15.139 -15.990 -19.199 1.00 34.35  ? 591  ALA B O   1 
ATOM   3002 C  CB  . ALA B 1 219 ? 17.311 -14.187 -17.429 1.00 32.84  ? 591  ALA B CB  1 
ATOM   3003 N  N   . LEU B 1 220 ? 17.055 -17.070 -18.671 1.00 32.27  ? 592  LEU B N   1 
ATOM   3004 C  CA  . LEU B 1 220 ? 17.003 -18.008 -19.807 1.00 32.11  ? 592  LEU B CA  1 
ATOM   3005 C  C   . LEU B 1 220 ? 15.747 -18.908 -19.754 1.00 32.74  ? 592  LEU B C   1 
ATOM   3006 O  O   . LEU B 1 220 ? 15.118 -19.148 -20.769 1.00 32.61  ? 592  LEU B O   1 
ATOM   3007 C  CB  . LEU B 1 220 ? 18.289 -18.862 -19.861 1.00 31.09  ? 592  LEU B CB  1 
ATOM   3008 C  CG  . LEU B 1 220 ? 19.546 -18.140 -20.401 1.00 32.05  ? 592  LEU B CG  1 
ATOM   3009 C  CD1 . LEU B 1 220 ? 20.845 -18.714 -19.856 1.00 32.60  ? 592  LEU B CD1 1 
ATOM   3010 C  CD2 . LEU B 1 220 ? 19.560 -18.121 -21.933 1.00 30.97  ? 592  LEU B CD2 1 
ATOM   3011 N  N   . ALA B 1 221 ? 15.388 -19.384 -18.563 1.00 32.93  ? 593  ALA B N   1 
ATOM   3012 C  CA  . ALA B 1 221 ? 14.203 -20.227 -18.403 1.00 34.42  ? 593  ALA B CA  1 
ATOM   3013 C  C   . ALA B 1 221 ? 12.944 -19.450 -18.784 1.00 35.93  ? 593  ALA B C   1 
ATOM   3014 O  O   . ALA B 1 221 ? 12.005 -20.005 -19.356 1.00 36.94  ? 593  ALA B O   1 
ATOM   3015 C  CB  . ALA B 1 221 ? 14.104 -20.739 -16.973 1.00 34.79  ? 593  ALA B CB  1 
ATOM   3016 N  N   . HIS B 1 222 ? 12.948 -18.156 -18.482 1.00 36.26  ? 594  HIS B N   1 
ATOM   3017 C  CA  . HIS B 1 222 ? 11.826 -17.283 -18.813 1.00 37.75  ? 594  HIS B CA  1 
ATOM   3018 C  C   . HIS B 1 222 ? 11.900 -16.691 -20.207 1.00 37.80  ? 594  HIS B C   1 
ATOM   3019 O  O   . HIS B 1 222 ? 11.221 -15.704 -20.490 1.00 39.23  ? 594  HIS B O   1 
ATOM   3020 C  CB  . HIS B 1 222 ? 11.705 -16.187 -17.775 1.00 38.26  ? 594  HIS B CB  1 
ATOM   3021 C  CG  . HIS B 1 222 ? 11.277 -16.701 -16.447 1.00 38.46  ? 594  HIS B CG  1 
ATOM   3022 N  ND1 . HIS B 1 222 ? 9.951  -16.770 -16.071 1.00 41.00  ? 594  HIS B ND1 1 
ATOM   3023 C  CD2 . HIS B 1 222 ? 11.988 -17.237 -15.428 1.00 36.35  ? 594  HIS B CD2 1 
ATOM   3024 C  CE1 . HIS B 1 222 ? 9.868  -17.298 -14.862 1.00 39.72  ? 594  HIS B CE1 1 
ATOM   3025 N  NE2 . HIS B 1 222 ? 11.089 -17.586 -14.449 1.00 38.79  ? 594  HIS B NE2 1 
ATOM   3026 N  N   . GLY B 1 223 ? 12.721 -17.284 -21.073 1.00 36.87  ? 595  GLY B N   1 
ATOM   3027 C  CA  . GLY B 1 223 ? 12.753 -16.895 -22.485 1.00 37.27  ? 595  GLY B CA  1 
ATOM   3028 C  C   . GLY B 1 223 ? 13.644 -15.716 -22.861 1.00 37.07  ? 595  GLY B C   1 
ATOM   3029 O  O   . GLY B 1 223 ? 13.485 -15.148 -23.939 1.00 37.93  ? 595  GLY B O   1 
ATOM   3030 N  N   . ALA B 1 224 ? 14.578 -15.337 -21.991 1.00 36.40  ? 596  ALA B N   1 
ATOM   3031 C  CA  . ALA B 1 224 ? 15.652 -14.406 -22.380 1.00 36.17  ? 596  ALA B CA  1 
ATOM   3032 C  C   . ALA B 1 224 ? 16.356 -14.842 -23.665 1.00 35.83  ? 596  ALA B C   1 
ATOM   3033 O  O   . ALA B 1 224 ? 16.720 -16.008 -23.806 1.00 35.11  ? 596  ALA B O   1 
ATOM   3034 C  CB  . ALA B 1 224 ? 16.667 -14.271 -21.266 1.00 34.65  ? 596  ALA B CB  1 
ATOM   3035 N  N   . ASP B 1 225 ? 16.524 -13.912 -24.607 1.00 37.32  ? 597  ASP B N   1 
ATOM   3036 C  CA  . ASP B 1 225 ? 17.338 -14.159 -25.805 1.00 37.42  ? 597  ASP B CA  1 
ATOM   3037 C  C   . ASP B 1 225 ? 18.799 -14.175 -25.394 1.00 35.95  ? 597  ASP B C   1 
ATOM   3038 O  O   . ASP B 1 225 ? 19.293 -13.219 -24.772 1.00 35.79  ? 597  ASP B O   1 
ATOM   3039 C  CB  . ASP B 1 225 ? 17.107 -13.074 -26.853 1.00 39.34  ? 597  ASP B CB  1 
ATOM   3040 C  CG  . ASP B 1 225 ? 17.930 -13.289 -28.120 1.00 40.99  ? 597  ASP B CG  1 
ATOM   3041 O  OD1 . ASP B 1 225 ? 18.710 -14.271 -28.195 1.00 40.87  ? 597  ASP B OD1 1 
ATOM   3042 O  OD2 . ASP B 1 225 ? 17.794 -12.462 -29.050 1.00 43.79  ? 597  ASP B OD2 1 
ATOM   3043 N  N   . VAL B 1 226 ? 19.490 -15.270 -25.713 1.00 34.77  ? 598  VAL B N   1 
ATOM   3044 C  CA  . VAL B 1 226 ? 20.876 -15.450 -25.240 1.00 32.94  ? 598  VAL B CA  1 
ATOM   3045 C  C   . VAL B 1 226 ? 21.848 -14.452 -25.922 1.00 32.59  ? 598  VAL B C   1 
ATOM   3046 O  O   . VAL B 1 226 ? 22.948 -14.189 -25.426 1.00 31.35  ? 598  VAL B O   1 
ATOM   3047 C  CB  . VAL B 1 226 ? 21.333 -16.938 -25.328 1.00 31.84  ? 598  VAL B CB  1 
ATOM   3048 C  CG1 . VAL B 1 226 ? 21.497 -17.392 -26.784 1.00 30.99  ? 598  VAL B CG1 1 
ATOM   3049 C  CG2 . VAL B 1 226 ? 22.602 -17.168 -24.520 1.00 30.68  ? 598  VAL B CG2 1 
ATOM   3050 N  N   . ASN B 1 227 ? 21.382 -13.886 -27.032 1.00 33.66  ? 599  ASN B N   1 
ATOM   3051 C  CA  . ASN B 1 227 ? 22.088 -12.886 -27.832 1.00 34.05  ? 599  ASN B CA  1 
ATOM   3052 C  C   . ASN B 1 227 ? 21.396 -11.523 -27.805 1.00 35.85  ? 599  ASN B C   1 
ATOM   3053 O  O   . ASN B 1 227 ? 21.412 -10.787 -28.804 1.00 37.35  ? 599  ASN B O   1 
ATOM   3054 C  CB  . ASN B 1 227 ? 22.155 -13.368 -29.279 1.00 34.16  ? 599  ASN B CB  1 
ATOM   3055 C  CG  . ASN B 1 227 ? 22.952 -14.628 -29.418 1.00 33.29  ? 599  ASN B CG  1 
ATOM   3056 O  OD1 . ASN B 1 227 ? 22.554 -15.562 -30.108 1.00 32.94  ? 599  ASN B OD1 1 
ATOM   3057 N  ND2 . ASN B 1 227 ? 24.077 -14.680 -28.720 1.00 31.81  ? 599  ASN B ND2 1 
ATOM   3058 N  N   . TRP B 1 228 ? 20.766 -11.215 -26.673 1.00 36.48  ? 600  TRP B N   1 
ATOM   3059 C  CA  . TRP B 1 228 ? 20.021 -9.982  -26.471 1.00 38.50  ? 600  TRP B CA  1 
ATOM   3060 C  C   . TRP B 1 228 ? 20.936 -8.805  -26.761 1.00 39.33  ? 600  TRP B C   1 
ATOM   3061 O  O   . TRP B 1 228 ? 22.101 -8.807  -26.370 1.00 38.11  ? 600  TRP B O   1 
ATOM   3062 C  CB  . TRP B 1 228 ? 19.535 -9.911  -25.031 1.00 38.42  ? 600  TRP B CB  1 
ATOM   3063 C  CG  . TRP B 1 228 ? 18.570 -8.792  -24.743 1.00 40.93  ? 600  TRP B CG  1 
ATOM   3064 C  CD1 . TRP B 1 228 ? 17.235 -8.758  -25.050 1.00 42.65  ? 600  TRP B CD1 1 
ATOM   3065 C  CD2 . TRP B 1 228 ? 18.852 -7.567  -24.052 1.00 41.17  ? 600  TRP B CD2 1 
ATOM   3066 N  NE1 . TRP B 1 228 ? 16.672 -7.586  -24.599 1.00 43.56  ? 600  TRP B NE1 1 
ATOM   3067 C  CE2 . TRP B 1 228 ? 17.640 -6.836  -23.985 1.00 43.52  ? 600  TRP B CE2 1 
ATOM   3068 C  CE3 . TRP B 1 228 ? 20.011 -7.012  -23.490 1.00 39.52  ? 600  TRP B CE3 1 
ATOM   3069 C  CZ2 . TRP B 1 228 ? 17.556 -5.578  -23.377 1.00 43.33  ? 600  TRP B CZ2 1 
ATOM   3070 C  CZ3 . TRP B 1 228 ? 19.929 -5.774  -22.883 1.00 40.25  ? 600  TRP B CZ3 1 
ATOM   3071 C  CH2 . TRP B 1 228 ? 18.711 -5.062  -22.838 1.00 43.09  ? 600  TRP B CH2 1 
ATOM   3072 N  N   . VAL B 1 229 ? 20.410 -7.814  -27.468 1.00 41.59  ? 601  VAL B N   1 
ATOM   3073 C  CA  . VAL B 1 229 ? 21.199 -6.678  -27.894 1.00 42.69  ? 601  VAL B CA  1 
ATOM   3074 C  C   . VAL B 1 229 ? 20.789 -5.477  -27.050 1.00 45.09  ? 601  VAL B C   1 
ATOM   3075 O  O   . VAL B 1 229 ? 19.612 -5.106  -27.017 1.00 46.55  ? 601  VAL B O   1 
ATOM   3076 C  CB  . VAL B 1 229 ? 20.984 -6.416  -29.399 1.00 44.03  ? 601  VAL B CB  1 
ATOM   3077 C  CG1 . VAL B 1 229 ? 21.476 -5.046  -29.788 1.00 45.57  ? 601  VAL B CG1 1 
ATOM   3078 C  CG2 . VAL B 1 229 ? 21.665 -7.494  -30.233 1.00 41.92  ? 601  VAL B CG2 1 
ATOM   3079 N  N   . ASN B 1 230 ? 21.742 -4.887  -26.332 1.00 45.67  ? 602  ASN B N   1 
ATOM   3080 C  CA  . ASN B 1 230 ? 21.419 -3.693  -25.565 1.00 48.63  ? 602  ASN B CA  1 
ATOM   3081 C  C   . ASN B 1 230 ? 21.294 -2.507  -26.531 1.00 51.46  ? 602  ASN B C   1 
ATOM   3082 O  O   . ASN B 1 230 ? 22.218 -1.709  -26.692 1.00 51.29  ? 602  ASN B O   1 
ATOM   3083 C  CB  . ASN B 1 230 ? 22.444 -3.443  -24.458 1.00 47.88  ? 602  ASN B CB  1 
ATOM   3084 C  CG  . ASN B 1 230 ? 21.912 -2.532  -23.365 1.00 50.23  ? 602  ASN B CG  1 
ATOM   3085 O  OD1 . ASN B 1 230 ? 20.889 -1.874  -23.524 1.00 53.08  ? 602  ASN B OD1 1 
ATOM   3086 N  ND2 . ASN B 1 230 ? 22.608 -2.494  -22.245 1.00 51.38  ? 602  ASN B ND2 1 
ATOM   3087 N  N   . GLY B 1 231 ? 20.133 -2.434  -27.180 1.00 54.15  ? 603  GLY B N   1 
ATOM   3088 C  CA  . GLY B 1 231 ? 19.880 -1.505  -28.275 1.00 57.76  ? 603  GLY B CA  1 
ATOM   3089 C  C   . GLY B 1 231 ? 19.741 -0.077  -27.807 1.00 61.15  ? 603  GLY B C   1 
ATOM   3090 O  O   . GLY B 1 231 ? 19.590 0.185   -26.610 1.00 61.84  ? 603  GLY B O   1 
ATOM   3091 N  N   . GLY B 1 232 ? 19.791 0.853   -28.756 1.00 64.10  ? 604  GLY B N   1 
ATOM   3092 C  CA  . GLY B 1 232 ? 19.848 2.292   -28.443 1.00 67.14  ? 604  GLY B CA  1 
ATOM   3093 C  C   . GLY B 1 232 ? 21.172 2.626   -27.760 1.00 65.87  ? 604  GLY B C   1 
ATOM   3094 O  O   . GLY B 1 232 ? 21.724 3.719   -27.954 1.00 67.75  ? 604  GLY B O   1 
ATOM   3095 N  N   . GLN B 1 233 ? 21.664 1.663   -26.974 1.00 62.78  ? 605  GLN B N   1 
ATOM   3096 C  CA  . GLN B 1 233 ? 22.916 1.752   -26.216 1.00 61.21  ? 605  GLN B CA  1 
ATOM   3097 C  C   . GLN B 1 233 ? 24.155 1.485   -27.083 1.00 58.94  ? 605  GLN B C   1 
ATOM   3098 O  O   . GLN B 1 233 ? 24.386 2.204   -28.061 1.00 60.17  ? 605  GLN B O   1 
ATOM   3099 C  CB  . GLN B 1 233 ? 22.874 0.779   -25.032 1.00 59.55  ? 605  GLN B CB  1 
ATOM   3100 C  CG  . GLN B 1 233 ? 21.936 1.209   -23.927 1.00 62.63  ? 605  GLN B CG  1 
ATOM   3101 C  CD  . GLN B 1 233 ? 22.540 2.307   -23.088 1.00 66.04  ? 605  GLN B CD  1 
ATOM   3102 O  OE1 . GLN B 1 233 ? 23.765 2.402   -22.969 1.00 64.56  ? 605  GLN B OE1 1 
ATOM   3103 N  NE2 . GLN B 1 233 ? 21.686 3.154   -22.505 1.00 69.35  ? 605  GLN B NE2 1 
ATOM   3104 N  N   . ASP B 1 234 ? 24.940 0.460   -26.721 1.00 55.36  ? 606  ASP B N   1 
ATOM   3105 C  CA  . ASP B 1 234 ? 26.171 0.108   -27.448 1.00 52.86  ? 606  ASP B CA  1 
ATOM   3106 C  C   . ASP B 1 234 ? 26.044 -1.198  -28.243 1.00 49.90  ? 606  ASP B C   1 
ATOM   3107 O  O   . ASP B 1 234 ? 27.004 -1.652  -28.863 1.00 48.35  ? 606  ASP B O   1 
ATOM   3108 C  CB  . ASP B 1 234 ? 27.364 0.039   -26.485 1.00 52.07  ? 606  ASP B CB  1 
ATOM   3109 C  CG  . ASP B 1 234 ? 27.210 -1.056  -25.402 1.00 52.83  ? 606  ASP B CG  1 
ATOM   3110 O  OD1 . ASP B 1 234 ? 26.078 -1.541  -25.146 1.00 52.69  ? 606  ASP B OD1 1 
ATOM   3111 O  OD2 . ASP B 1 234 ? 28.248 -1.424  -24.792 1.00 53.97  ? 606  ASP B OD2 1 
ATOM   3112 N  N   . ASN B 1 235 ? 24.845 -1.776  -28.221 1.00 48.56  ? 607  ASN B N   1 
ATOM   3113 C  CA  . ASN B 1 235 ? 24.561 -3.088  -28.800 1.00 45.87  ? 607  ASN B CA  1 
ATOM   3114 C  C   . ASN B 1 235 ? 25.367 -4.231  -28.199 1.00 42.60  ? 607  ASN B C   1 
ATOM   3115 O  O   . ASN B 1 235 ? 25.599 -5.247  -28.858 1.00 41.87  ? 607  ASN B O   1 
ATOM   3116 C  CB  . ASN B 1 235 ? 24.680 -3.062  -30.324 1.00 46.63  ? 607  ASN B CB  1 
ATOM   3117 C  CG  . ASN B 1 235 ? 23.536 -2.307  -30.987 1.00 49.06  ? 607  ASN B CG  1 
ATOM   3118 O  OD1 . ASN B 1 235 ? 23.578 -2.044  -32.175 1.00 51.77  ? 607  ASN B OD1 1 
ATOM   3119 N  ND2 . ASN B 1 235 ? 22.516 -1.960  -30.218 1.00 49.04  ? 607  ASN B ND2 1 
ATOM   3120 N  N   . ALA B 1 236 ? 25.775 -4.073  -26.945 1.00 40.42  ? 608  ALA B N   1 
ATOM   3121 C  CA  . ALA B 1 236 ? 26.486 -5.134  -26.249 1.00 37.89  ? 608  ALA B CA  1 
ATOM   3122 C  C   . ALA B 1 236 ? 25.540 -6.286  -25.941 1.00 37.08  ? 608  ALA B C   1 
ATOM   3123 O  O   . ALA B 1 236 ? 24.318 -6.108  -25.859 1.00 38.37  ? 608  ALA B O   1 
ATOM   3124 C  CB  . ALA B 1 236 ? 27.098 -4.627  -24.979 1.00 37.90  ? 608  ALA B CB  1 
ATOM   3125 N  N   . THR B 1 237 ? 26.127 -7.466  -25.778 1.00 34.62  ? 609  THR B N   1 
ATOM   3126 C  CA  . THR B 1 237 ? 25.392 -8.688  -25.526 1.00 33.08  ? 609  THR B CA  1 
ATOM   3127 C  C   . THR B 1 237 ? 25.730 -9.195  -24.137 1.00 31.92  ? 609  THR B C   1 
ATOM   3128 O  O   . THR B 1 237 ? 26.673 -8.693  -23.514 1.00 30.95  ? 609  THR B O   1 
ATOM   3129 C  CB  . THR B 1 237 ? 25.819 -9.752  -26.491 1.00 32.25  ? 609  THR B CB  1 
ATOM   3130 O  OG1 . THR B 1 237 ? 27.233 -9.960  -26.340 1.00 32.11  ? 609  THR B OG1 1 
ATOM   3131 C  CG2 . THR B 1 237 ? 25.479 -9.340  -27.921 1.00 32.45  ? 609  THR B CG2 1 
ATOM   3132 N  N   . PRO B 1 238 ? 24.961 -10.190 -23.645 1.00 31.15  ? 610  PRO B N   1 
ATOM   3133 C  CA  . PRO B 1 238 ? 25.323 -10.843 -22.383 1.00 30.27  ? 610  PRO B CA  1 
ATOM   3134 C  C   . PRO B 1 238 ? 26.771 -11.364 -22.403 1.00 28.84  ? 610  PRO B C   1 
ATOM   3135 O  O   . PRO B 1 238 ? 27.493 -11.204 -21.418 1.00 27.81  ? 610  PRO B O   1 
ATOM   3136 C  CB  . PRO B 1 238 ? 24.316 -12.009 -22.284 1.00 29.80  ? 610  PRO B CB  1 
ATOM   3137 C  CG  . PRO B 1 238 ? 23.107 -11.493 -23.007 1.00 31.16  ? 610  PRO B CG  1 
ATOM   3138 C  CD  . PRO B 1 238 ? 23.677 -10.700 -24.180 1.00 31.66  ? 610  PRO B CD  1 
ATOM   3139 N  N   . LEU B 1 239 ? 27.181 -11.949 -23.526 1.00 27.91  ? 611  LEU B N   1 
ATOM   3140 C  CA  . LEU B 1 239 ? 28.515 -12.531 -23.652 1.00 27.89  ? 611  LEU B CA  1 
ATOM   3141 C  C   . LEU B 1 239 ? 29.615 -11.470 -23.631 1.00 28.16  ? 611  LEU B C   1 
ATOM   3142 O  O   . LEU B 1 239 ? 30.649 -11.642 -22.962 1.00 28.68  ? 611  LEU B O   1 
ATOM   3143 C  CB  . LEU B 1 239 ? 28.607 -13.401 -24.914 1.00 27.83  ? 611  LEU B CB  1 
ATOM   3144 C  CG  . LEU B 1 239 ? 29.877 -14.193 -25.218 1.00 27.53  ? 611  LEU B CG  1 
ATOM   3145 C  CD1 . LEU B 1 239 ? 30.246 -15.126 -24.045 1.00 30.12  ? 611  LEU B CD1 1 
ATOM   3146 C  CD2 . LEU B 1 239 ? 29.611 -14.987 -26.449 1.00 29.03  ? 611  LEU B CD2 1 
ATOM   3147 N  N   . ILE B 1 240 ? 29.396 -10.371 -24.340 1.00 28.97  ? 612  ILE B N   1 
ATOM   3148 C  CA  . ILE B 1 240 ? 30.299 -9.232  -24.229 1.00 30.03  ? 612  ILE B CA  1 
ATOM   3149 C  C   . ILE B 1 240 ? 30.338 -8.726  -22.791 1.00 30.70  ? 612  ILE B C   1 
ATOM   3150 O  O   . ILE B 1 240 ? 31.381 -8.374  -22.272 1.00 31.13  ? 612  ILE B O   1 
ATOM   3151 C  CB  . ILE B 1 240 ? 29.944 -8.107  -25.216 1.00 31.23  ? 612  ILE B CB  1 
ATOM   3152 C  CG1 . ILE B 1 240 ? 30.474 -8.467  -26.605 1.00 30.61  ? 612  ILE B CG1 1 
ATOM   3153 C  CG2 . ILE B 1 240 ? 30.552 -6.744  -24.766 1.00 31.23  ? 612  ILE B CG2 1 
ATOM   3154 C  CD1 . ILE B 1 240 ? 29.758 -7.728  -27.742 1.00 33.37  ? 612  ILE B CD1 1 
ATOM   3155 N  N   . GLN B 1 241 ? 29.191 -8.749  -22.143 1.00 31.74  ? 613  GLN B N   1 
ATOM   3156 C  CA  . GLN B 1 241 ? 29.072 -8.326  -20.776 1.00 33.46  ? 613  GLN B CA  1 
ATOM   3157 C  C   . GLN B 1 241 ? 29.875 -9.241  -19.822 1.00 33.25  ? 613  GLN B C   1 
ATOM   3158 O  O   . GLN B 1 241 ? 30.503 -8.753  -18.883 1.00 34.31  ? 613  GLN B O   1 
ATOM   3159 C  CB  . GLN B 1 241 ? 27.578 -8.269  -20.432 1.00 34.74  ? 613  GLN B CB  1 
ATOM   3160 C  CG  . GLN B 1 241 ? 27.238 -7.671  -19.099 1.00 39.07  ? 613  GLN B CG  1 
ATOM   3161 C  CD  . GLN B 1 241 ? 27.220 -6.151  -19.076 1.00 43.18  ? 613  GLN B CD  1 
ATOM   3162 O  OE1 . GLN B 1 241 ? 27.687 -5.477  -20.003 1.00 43.31  ? 613  GLN B OE1 1 
ATOM   3163 N  NE2 . GLN B 1 241 ? 26.683 -5.603  -17.990 1.00 45.09  ? 613  GLN B NE2 1 
ATOM   3164 N  N   . ALA B 1 242 ? 29.879 -10.551 -20.084 1.00 32.31  ? 614  ALA B N   1 
ATOM   3165 C  CA  . ALA B 1 242 ? 30.588 -11.527 -19.229 1.00 32.14  ? 614  ALA B CA  1 
ATOM   3166 C  C   . ALA B 1 242 ? 32.106 -11.475 -19.460 1.00 31.76  ? 614  ALA B C   1 
ATOM   3167 O  O   . ALA B 1 242 ? 32.901 -11.731 -18.543 1.00 32.61  ? 614  ALA B O   1 
ATOM   3168 C  CB  . ALA B 1 242 ? 30.051 -12.949 -19.467 1.00 30.85  ? 614  ALA B CB  1 
ATOM   3169 N  N   . THR B 1 243 ? 32.482 -11.156 -20.693 1.00 30.65  ? 615  THR B N   1 
ATOM   3170 C  CA  . THR B 1 243 ? 33.863 -10.854 -21.048 1.00 30.70  ? 615  THR B CA  1 
ATOM   3171 C  C   . THR B 1 243 ? 34.394 -9.638  -20.291 1.00 32.37  ? 615  THR B C   1 
ATOM   3172 O  O   . THR B 1 243 ? 35.476 -9.707  -19.700 1.00 33.44  ? 615  THR B O   1 
ATOM   3173 C  CB  . THR B 1 243 ? 33.999 -10.615 -22.552 1.00 29.59  ? 615  THR B CB  1 
ATOM   3174 O  OG1 . THR B 1 243 ? 33.418 -11.724 -23.229 1.00 28.43  ? 615  THR B OG1 1 
ATOM   3175 C  CG2 . THR B 1 243 ? 35.466 -10.473 -22.973 1.00 28.52  ? 615  THR B CG2 1 
ATOM   3176 N  N   . ALA B 1 244 ? 33.647 -8.537  -20.309 1.00 33.15  ? 616  ALA B N   1 
ATOM   3177 C  CA  . ALA B 1 244 ? 34.045 -7.330  -19.573 1.00 34.76  ? 616  ALA B CA  1 
ATOM   3178 C  C   . ALA B 1 244 ? 34.260 -7.692  -18.125 1.00 35.89  ? 616  ALA B C   1 
ATOM   3179 O  O   . ALA B 1 244 ? 35.175 -7.170  -17.485 1.00 37.56  ? 616  ALA B O   1 
ATOM   3180 C  CB  . ALA B 1 244 ? 32.989 -6.226  -19.697 1.00 35.19  ? 616  ALA B CB  1 
ATOM   3181 N  N   . ALA B 1 245 ? 33.419 -8.614  -17.636 1.00 35.79  ? 617  ALA B N   1 
ATOM   3182 C  CA  . ALA B 1 245 ? 33.456 -9.122  -16.270 1.00 36.49  ? 617  ALA B CA  1 
ATOM   3183 C  C   . ALA B 1 245 ? 34.593 -10.106 -16.010 1.00 36.58  ? 617  ALA B C   1 
ATOM   3184 O  O   . ALA B 1 245 ? 34.814 -10.495 -14.864 1.00 37.50  ? 617  ALA B O   1 
ATOM   3185 C  CB  . ALA B 1 245 ? 32.119 -9.791  -15.926 1.00 36.52  ? 617  ALA B CB  1 
ATOM   3186 N  N   . ASN B 1 246 ? 35.295 -10.538 -17.060 1.00 35.64  ? 618  ASN B N   1 
ATOM   3187 C  CA  . ASN B 1 246 ? 36.362 -11.523 -16.887 1.00 36.25  ? 618  ASN B CA  1 
ATOM   3188 C  C   . ASN B 1 246 ? 35.817 -12.789 -16.183 1.00 36.70  ? 618  ASN B C   1 
ATOM   3189 O  O   . ASN B 1 246 ? 36.414 -13.299 -15.236 1.00 37.52  ? 618  ASN B O   1 
ATOM   3190 C  CB  . ASN B 1 246 ? 37.510 -10.920 -16.056 1.00 37.21  ? 618  ASN B CB  1 
ATOM   3191 C  CG  . ASN B 1 246 ? 38.807 -11.709 -16.180 1.00 38.29  ? 618  ASN B CG  1 
ATOM   3192 O  OD1 . ASN B 1 246 ? 39.003 -12.489 -17.122 1.00 38.67  ? 618  ASN B OD1 1 
ATOM   3193 N  ND2 . ASN B 1 246 ? 39.706 -11.492 -15.240 1.00 38.24  ? 618  ASN B ND2 1 
ATOM   3194 N  N   . SER B 1 247 ? 34.665 -13.269 -16.634 1.00 35.63  ? 619  SER B N   1 
ATOM   3195 C  CA  . SER B 1 247 ? 34.032 -14.408 -15.988 1.00 35.52  ? 619  SER B CA  1 
ATOM   3196 C  C   . SER B 1 247 ? 33.938 -15.563 -16.956 1.00 34.38  ? 619  SER B C   1 
ATOM   3197 O  O   . SER B 1 247 ? 33.069 -15.608 -17.856 1.00 33.38  ? 619  SER B O   1 
ATOM   3198 C  CB  . SER B 1 247 ? 32.654 -14.064 -15.423 1.00 35.52  ? 619  SER B CB  1 
ATOM   3199 O  OG  . SER B 1 247 ? 31.950 -15.253 -15.087 1.00 35.87  ? 619  SER B OG  1 
ATOM   3200 N  N   . LEU B 1 248 ? 34.850 -16.495 -16.748 1.00 34.53  ? 620  LEU B N   1 
ATOM   3201 C  CA  . LEU B 1 248 ? 34.926 -17.708 -17.529 1.00 35.01  ? 620  LEU B CA  1 
ATOM   3202 C  C   . LEU B 1 248 ? 33.652 -18.547 -17.338 1.00 33.98  ? 620  LEU B C   1 
ATOM   3203 O  O   . LEU B 1 248 ? 33.182 -19.176 -18.278 1.00 32.38  ? 620  LEU B O   1 
ATOM   3204 C  CB  . LEU B 1 248 ? 36.175 -18.493 -17.123 1.00 36.62  ? 620  LEU B CB  1 
ATOM   3205 C  CG  . LEU B 1 248 ? 37.143 -19.022 -18.179 1.00 38.91  ? 620  LEU B CG  1 
ATOM   3206 C  CD1 . LEU B 1 248 ? 38.234 -19.853 -17.497 1.00 42.95  ? 620  LEU B CD1 1 
ATOM   3207 C  CD2 . LEU B 1 248 ? 36.438 -19.876 -19.202 1.00 41.53  ? 620  LEU B CD2 1 
ATOM   3208 N  N   . LEU B 1 249 ? 33.094 -18.513 -16.128 1.00 34.48  ? 621  LEU B N   1 
ATOM   3209 C  CA  . LEU B 1 249 ? 31.874 -19.254 -15.809 1.00 34.99  ? 621  LEU B CA  1 
ATOM   3210 C  C   . LEU B 1 249 ? 30.655 -18.752 -16.567 1.00 33.31  ? 621  LEU B C   1 
ATOM   3211 O  O   . LEU B 1 249 ? 29.917 -19.549 -17.157 1.00 32.35  ? 621  LEU B O   1 
ATOM   3212 C  CB  . LEU B 1 249 ? 31.614 -19.276 -14.296 1.00 37.12  ? 621  LEU B CB  1 
ATOM   3213 C  CG  . LEU B 1 249 ? 32.390 -20.358 -13.528 1.00 40.61  ? 621  LEU B CG  1 
ATOM   3214 C  CD1 . LEU B 1 249 ? 33.891 -20.348 -13.856 1.00 43.28  ? 621  LEU B CD1 1 
ATOM   3215 C  CD2 . LEU B 1 249 ? 32.194 -20.218 -12.025 1.00 44.09  ? 621  LEU B CD2 1 
ATOM   3216 N  N   . ALA B 1 250 ? 30.467 -17.435 -16.567 1.00 32.93  ? 622  ALA B N   1 
ATOM   3217 C  CA  . ALA B 1 250 ? 29.345 -16.802 -17.261 1.00 32.12  ? 622  ALA B CA  1 
ATOM   3218 C  C   . ALA B 1 250 ? 29.452 -16.955 -18.767 1.00 31.44  ? 622  ALA B C   1 
ATOM   3219 O  O   . ALA B 1 250 ? 28.468 -17.301 -19.433 1.00 31.70  ? 622  ALA B O   1 
ATOM   3220 C  CB  . ALA B 1 250 ? 29.231 -15.335 -16.873 1.00 32.28  ? 622  ALA B CB  1 
ATOM   3221 N  N   . CYS B 1 251 ? 30.642 -16.716 -19.308 1.00 31.18  ? 623  CYS B N   1 
ATOM   3222 C  CA  . CYS B 1 251 ? 30.878 -16.958 -20.723 1.00 31.08  ? 623  CYS B CA  1 
ATOM   3223 C  C   . CYS B 1 251 ? 30.592 -18.408 -21.064 1.00 31.22  ? 623  CYS B C   1 
ATOM   3224 O  O   . CYS B 1 251 ? 29.955 -18.685 -22.072 1.00 30.87  ? 623  CYS B O   1 
ATOM   3225 C  CB  . CYS B 1 251 ? 32.316 -16.616 -21.138 1.00 30.73  ? 623  CYS B CB  1 
ATOM   3226 S  SG  . CYS B 1 251 ? 32.736 -14.847 -21.058 1.00 35.06  ? 623  CYS B SG  1 
ATOM   3227 N  N   . GLU B 1 252 ? 31.073 -19.337 -20.235 1.00 32.02  ? 624  GLU B N   1 
ATOM   3228 C  CA  . GLU B 1 252 ? 30.883 -20.758 -20.521 1.00 32.66  ? 624  GLU B CA  1 
ATOM   3229 C  C   . GLU B 1 252 ? 29.390 -21.099 -20.498 1.00 31.62  ? 624  GLU B C   1 
ATOM   3230 O  O   . GLU B 1 252 ? 28.895 -21.774 -21.394 1.00 30.83  ? 624  GLU B O   1 
ATOM   3231 C  CB  . GLU B 1 252 ? 31.668 -21.621 -19.527 1.00 34.81  ? 624  GLU B CB  1 
ATOM   3232 C  CG  . GLU B 1 252 ? 31.581 -23.138 -19.739 1.00 38.79  ? 624  GLU B CG  1 
ATOM   3233 C  CD  . GLU B 1 252 ? 32.039 -23.595 -21.138 1.00 42.76  ? 624  GLU B CD  1 
ATOM   3234 O  OE1 . GLU B 1 252 ? 32.412 -22.757 -21.987 1.00 45.36  ? 624  GLU B OE1 1 
ATOM   3235 O  OE2 . GLU B 1 252 ? 32.007 -24.811 -21.393 1.00 44.91  ? 624  GLU B OE2 1 
ATOM   3236 N  N   . PHE B 1 253 ? 28.681 -20.596 -19.484 1.00 30.97  ? 625  PHE B N   1 
ATOM   3237 C  CA  . PHE B 1 253 ? 27.235 -20.803 -19.356 1.00 30.79  ? 625  PHE B CA  1 
ATOM   3238 C  C   . PHE B 1 253 ? 26.422 -20.300 -20.551 1.00 29.89  ? 625  PHE B C   1 
ATOM   3239 O  O   . PHE B 1 253 ? 25.579 -21.021 -21.060 1.00 30.51  ? 625  PHE B O   1 
ATOM   3240 C  CB  . PHE B 1 253 ? 26.718 -20.198 -18.054 1.00 31.46  ? 625  PHE B CB  1 
ATOM   3241 C  CG  . PHE B 1 253 ? 25.278 -20.539 -17.748 1.00 33.38  ? 625  PHE B CG  1 
ATOM   3242 C  CD1 . PHE B 1 253 ? 24.860 -21.860 -17.629 1.00 33.19  ? 625  PHE B CD1 1 
ATOM   3243 C  CD2 . PHE B 1 253 ? 24.340 -19.530 -17.575 1.00 34.49  ? 625  PHE B CD2 1 
ATOM   3244 C  CE1 . PHE B 1 253 ? 23.524 -22.165 -17.348 1.00 35.86  ? 625  PHE B CE1 1 
ATOM   3245 C  CE2 . PHE B 1 253 ? 23.006 -19.833 -17.287 1.00 36.34  ? 625  PHE B CE2 1 
ATOM   3246 C  CZ  . PHE B 1 253 ? 22.602 -21.152 -17.169 1.00 36.27  ? 625  PHE B CZ  1 
ATOM   3247 N  N   . LEU B 1 254 ? 26.713 -19.088 -21.020 1.00 29.26  ? 626  LEU B N   1 
ATOM   3248 C  CA  . LEU B 1 254 ? 26.068 -18.504 -22.203 1.00 28.34  ? 626  LEU B CA  1 
ATOM   3249 C  C   . LEU B 1 254 ? 26.377 -19.249 -23.489 1.00 28.67  ? 626  LEU B C   1 
ATOM   3250 O  O   . LEU B 1 254 ? 25.511 -19.378 -24.374 1.00 28.86  ? 626  LEU B O   1 
ATOM   3251 C  CB  . LEU B 1 254 ? 26.522 -17.058 -22.359 1.00 28.27  ? 626  LEU B CB  1 
ATOM   3252 C  CG  . LEU B 1 254 ? 26.052 -16.091 -21.276 1.00 28.42  ? 626  LEU B CG  1 
ATOM   3253 C  CD1 . LEU B 1 254 ? 26.868 -14.784 -21.319 1.00 26.95  ? 626  LEU B CD1 1 
ATOM   3254 C  CD2 . LEU B 1 254 ? 24.538 -15.853 -21.416 1.00 26.91  ? 626  LEU B CD2 1 
ATOM   3255 N  N   . LEU B 1 255 ? 27.618 -19.722 -23.600 1.00 28.09  ? 627  LEU B N   1 
ATOM   3256 C  CA  . LEU B 1 255 ? 28.036 -20.528 -24.743 1.00 28.54  ? 627  LEU B CA  1 
ATOM   3257 C  C   . LEU B 1 255 ? 27.316 -21.880 -24.793 1.00 29.52  ? 627  LEU B C   1 
ATOM   3258 O  O   . LEU B 1 255 ? 26.881 -22.308 -25.875 1.00 29.62  ? 627  LEU B O   1 
ATOM   3259 C  CB  . LEU B 1 255 ? 29.570 -20.691 -24.769 1.00 28.30  ? 627  LEU B CB  1 
ATOM   3260 C  CG  . LEU B 1 255 ? 30.317 -19.415 -25.216 1.00 27.82  ? 627  LEU B CG  1 
ATOM   3261 C  CD1 . LEU B 1 255 ? 31.810 -19.539 -24.996 1.00 26.53  ? 627  LEU B CD1 1 
ATOM   3262 C  CD2 . LEU B 1 255 ? 30.003 -19.037 -26.688 1.00 28.51  ? 627  LEU B CD2 1 
ATOM   3263 N  N   . GLN B 1 256 ? 27.180 -22.539 -23.635 1.00 29.23  ? 628  GLN B N   1 
ATOM   3264 C  CA  . GLN B 1 256 ? 26.434 -23.799 -23.557 1.00 30.96  ? 628  GLN B CA  1 
ATOM   3265 C  C   . GLN B 1 256 ? 24.977 -23.599 -23.926 1.00 31.31  ? 628  GLN B C   1 
ATOM   3266 O  O   . GLN B 1 256 ? 24.340 -24.510 -24.447 1.00 32.79  ? 628  GLN B O   1 
ATOM   3267 C  CB  . GLN B 1 256 ? 26.511 -24.442 -22.164 1.00 31.91  ? 628  GLN B CB  1 
ATOM   3268 C  CG  . GLN B 1 256 ? 27.860 -25.001 -21.788 1.00 33.44  ? 628  GLN B CG  1 
ATOM   3269 C  CD  . GLN B 1 256 ? 28.352 -26.041 -22.769 1.00 36.49  ? 628  GLN B CD  1 
ATOM   3270 O  OE1 . GLN B 1 256 ? 27.565 -26.697 -23.460 1.00 38.58  ? 628  GLN B OE1 1 
ATOM   3271 N  NE2 . GLN B 1 256 ? 29.667 -26.203 -22.836 1.00 37.76  ? 628  GLN B NE2 1 
ATOM   3272 N  N   . ASN B 1 257 ? 24.466 -22.401 -23.671 1.00 30.78  ? 629  ASN B N   1 
ATOM   3273 C  CA  . ASN B 1 257 ? 23.090 -22.051 -24.003 1.00 31.63  ? 629  ASN B CA  1 
ATOM   3274 C  C   . ASN B 1 257 ? 22.895 -21.306 -25.332 1.00 32.29  ? 629  ASN B C   1 
ATOM   3275 O  O   . ASN B 1 257 ? 21.881 -20.636 -25.539 1.00 32.90  ? 629  ASN B O   1 
ATOM   3276 C  CB  . ASN B 1 257 ? 22.485 -21.267 -22.837 1.00 31.18  ? 629  ASN B CB  1 
ATOM   3277 C  CG  . ASN B 1 257 ? 22.086 -22.174 -21.697 1.00 31.31  ? 629  ASN B CG  1 
ATOM   3278 O  OD1 . ASN B 1 257 ? 21.121 -22.921 -21.827 1.00 33.18  ? 629  ASN B OD1 1 
ATOM   3279 N  ND2 . ASN B 1 257 ? 22.843 -22.155 -20.594 1.00 29.49  ? 629  ASN B ND2 1 
ATOM   3280 N  N   . GLY B 1 258 ? 23.873 -21.398 -26.223 1.00 31.97  ? 630  GLY B N   1 
ATOM   3281 C  CA  . GLY B 1 258 ? 23.652 -20.959 -27.597 1.00 32.37  ? 630  GLY B CA  1 
ATOM   3282 C  C   . GLY B 1 258 ? 24.107 -19.563 -27.983 1.00 31.70  ? 630  GLY B C   1 
ATOM   3283 O  O   . GLY B 1 258 ? 23.798 -19.118 -29.080 1.00 32.35  ? 630  GLY B O   1 
ATOM   3284 N  N   . ALA B 1 259 ? 24.827 -18.864 -27.104 1.00 30.48  ? 631  ALA B N   1 
ATOM   3285 C  CA  . ALA B 1 259 ? 25.375 -17.554 -27.463 1.00 30.12  ? 631  ALA B CA  1 
ATOM   3286 C  C   . ALA B 1 259 ? 26.242 -17.645 -28.723 1.00 30.52  ? 631  ALA B C   1 
ATOM   3287 O  O   . ALA B 1 259 ? 27.066 -18.558 -28.884 1.00 31.02  ? 631  ALA B O   1 
ATOM   3288 C  CB  . ALA B 1 259 ? 26.150 -16.927 -26.316 1.00 28.55  ? 631  ALA B CB  1 
ATOM   3289 N  N   . ASN B 1 260 ? 25.995 -16.725 -29.639 1.00 30.65  ? 632  ASN B N   1 
ATOM   3290 C  CA  . ASN B 1 260 ? 26.763 -16.624 -30.850 1.00 31.69  ? 632  ASN B CA  1 
ATOM   3291 C  C   . ASN B 1 260 ? 28.114 -16.001 -30.496 1.00 30.90  ? 632  ASN B C   1 
ATOM   3292 O  O   . ASN B 1 260 ? 28.173 -14.854 -30.076 1.00 30.53  ? 632  ASN B O   1 
ATOM   3293 C  CB  . ASN B 1 260 ? 26.008 -15.762 -31.861 1.00 32.44  ? 632  ASN B CB  1 
ATOM   3294 C  CG  . ASN B 1 260 ? 26.791 -15.528 -33.125 1.00 33.70  ? 632  ASN B CG  1 
ATOM   3295 O  OD1 . ASN B 1 260 ? 28.019 -15.675 -33.165 1.00 34.25  ? 632  ASN B OD1 1 
ATOM   3296 N  ND2 . ASN B 1 260 ? 26.084 -15.174 -34.181 1.00 35.76  ? 632  ASN B ND2 1 
ATOM   3297 N  N   . VAL B 1 261 ? 29.189 -16.765 -30.669 1.00 31.43  ? 633  VAL B N   1 
ATOM   3298 C  CA  . VAL B 1 261 ? 30.523 -16.324 -30.251 1.00 31.35  ? 633  VAL B CA  1 
ATOM   3299 C  C   . VAL B 1 261 ? 31.062 -15.147 -31.097 1.00 31.91  ? 633  VAL B C   1 
ATOM   3300 O  O   . VAL B 1 261 ? 31.958 -14.431 -30.662 1.00 31.30  ? 633  VAL B O   1 
ATOM   3301 C  CB  . VAL B 1 261 ? 31.539 -17.506 -30.227 1.00 31.49  ? 633  VAL B CB  1 
ATOM   3302 C  CG1 . VAL B 1 261 ? 31.876 -17.976 -31.626 1.00 31.50  ? 633  VAL B CG1 1 
ATOM   3303 C  CG2 . VAL B 1 261 ? 32.806 -17.127 -29.436 1.00 30.01  ? 633  VAL B CG2 1 
ATOM   3304 N  N   . ASN B 1 262 ? 30.498 -14.958 -32.283 1.00 33.43  ? 634  ASN B N   1 
ATOM   3305 C  CA  . ASN B 1 262 ? 30.939 -13.901 -33.200 1.00 35.21  ? 634  ASN B CA  1 
ATOM   3306 C  C   . ASN B 1 262 ? 30.065 -12.632 -33.254 1.00 36.22  ? 634  ASN B C   1 
ATOM   3307 O  O   . ASN B 1 262 ? 30.334 -11.739 -34.063 1.00 37.94  ? 634  ASN B O   1 
ATOM   3308 C  CB  . ASN B 1 262 ? 31.096 -14.465 -34.616 1.00 36.10  ? 634  ASN B CB  1 
ATOM   3309 C  CG  . ASN B 1 262 ? 32.227 -15.465 -34.714 1.00 37.29  ? 634  ASN B CG  1 
ATOM   3310 O  OD1 . ASN B 1 262 ? 32.071 -16.549 -35.276 1.00 39.45  ? 634  ASN B OD1 1 
ATOM   3311 N  ND2 . ASN B 1 262 ? 33.371 -15.114 -34.154 1.00 35.00  ? 634  ASN B ND2 1 
ATOM   3312 N  N   . GLN B 1 263 ? 29.027 -12.543 -32.418 1.00 35.73  ? 635  GLN B N   1 
ATOM   3313 C  CA  . GLN B 1 263 ? 28.141 -11.372 -32.458 1.00 36.46  ? 635  GLN B CA  1 
ATOM   3314 C  C   . GLN B 1 263 ? 28.830 -10.137 -31.873 1.00 35.33  ? 635  GLN B C   1 
ATOM   3315 O  O   . GLN B 1 263 ? 29.263 -10.145 -30.719 1.00 34.05  ? 635  GLN B O   1 
ATOM   3316 C  CB  . GLN B 1 263 ? 26.808 -11.641 -31.754 1.00 36.25  ? 635  GLN B CB  1 
ATOM   3317 C  CG  . GLN B 1 263 ? 25.741 -10.589 -32.045 1.00 40.15  ? 635  GLN B CG  1 
ATOM   3318 C  CD  . GLN B 1 263 ? 24.405 -10.915 -31.384 1.00 43.60  ? 635  GLN B CD  1 
ATOM   3319 O  OE1 . GLN B 1 263 ? 23.945 -12.054 -31.431 1.00 45.49  ? 635  GLN B OE1 1 
ATOM   3320 N  NE2 . GLN B 1 263 ? 23.784 -9.919  -30.768 1.00 42.95  ? 635  GLN B NE2 1 
ATOM   3321 N  N   . ALA B 1 264 ? 28.905 -9.081  -32.681 1.00 35.91  ? 636  ALA B N   1 
ATOM   3322 C  CA  . ALA B 1 264 ? 29.650 -7.866  -32.329 1.00 35.49  ? 636  ALA B CA  1 
ATOM   3323 C  C   . ALA B 1 264 ? 28.747 -6.760  -31.771 1.00 35.88  ? 636  ALA B C   1 
ATOM   3324 O  O   . ALA B 1 264 ? 27.549 -6.740  -32.030 1.00 36.63  ? 636  ALA B O   1 
ATOM   3325 C  CB  . ALA B 1 264 ? 30.413 -7.358  -33.560 1.00 35.72  ? 636  ALA B CB  1 
ATOM   3326 N  N   . ASP B 1 265 ? 29.334 -5.837  -31.015 1.00 35.65  ? 637  ASP B N   1 
ATOM   3327 C  CA  . ASP B 1 265 ? 28.627 -4.628  -30.592 1.00 36.60  ? 637  ASP B CA  1 
ATOM   3328 C  C   . ASP B 1 265 ? 28.568 -3.637  -31.759 1.00 38.60  ? 637  ASP B C   1 
ATOM   3329 O  O   . ASP B 1 265 ? 28.903 -3.998  -32.896 1.00 39.14  ? 637  ASP B O   1 
ATOM   3330 C  CB  . ASP B 1 265 ? 29.299 -4.012  -29.358 1.00 36.19  ? 637  ASP B CB  1 
ATOM   3331 C  CG  . ASP B 1 265 ? 30.763 -3.571  -29.607 1.00 36.52  ? 637  ASP B CG  1 
ATOM   3332 O  OD1 . ASP B 1 265 ? 31.171 -3.296  -30.761 1.00 35.36  ? 637  ASP B OD1 1 
ATOM   3333 O  OD2 . ASP B 1 265 ? 31.512 -3.483  -28.609 1.00 36.23  ? 637  ASP B OD2 1 
ATOM   3334 N  N   . SER B 1 266 ? 28.166 -2.397  -31.472 1.00 39.68  ? 638  SER B N   1 
ATOM   3335 C  CA  . SER B 1 266 ? 28.034 -1.331  -32.469 1.00 41.74  ? 638  SER B CA  1 
ATOM   3336 C  C   . SER B 1 266 ? 29.318 -0.971  -33.199 1.00 41.93  ? 638  SER B C   1 
ATOM   3337 O  O   . SER B 1 266 ? 29.276 -0.517  -34.358 1.00 43.86  ? 638  SER B O   1 
ATOM   3338 C  CB  . SER B 1 266 ? 27.530 -0.061  -31.801 1.00 43.30  ? 638  SER B CB  1 
ATOM   3339 O  OG  . SER B 1 266 ? 26.144 -0.132  -31.611 1.00 45.20  ? 638  SER B OG  1 
ATOM   3340 N  N   . ALA B 1 267 ? 30.446 -1.123  -32.513 1.00 39.79  ? 639  ALA B N   1 
ATOM   3341 C  CA  . ALA B 1 267 ? 31.734 -0.780  -33.080 1.00 39.83  ? 639  ALA B CA  1 
ATOM   3342 C  C   . ALA B 1 267 ? 32.374 -1.969  -33.839 1.00 39.09  ? 639  ALA B C   1 
ATOM   3343 O  O   . ALA B 1 267 ? 33.548 -1.920  -34.232 1.00 39.05  ? 639  ALA B O   1 
ATOM   3344 C  CB  . ALA B 1 267 ? 32.645 -0.254  -31.975 1.00 38.83  ? 639  ALA B CB  1 
ATOM   3345 N  N   . GLY B 1 268 ? 31.601 -3.042  -34.032 1.00 38.56  ? 640  GLY B N   1 
ATOM   3346 C  CA  . GLY B 1 268 ? 32.092 -4.249  -34.712 1.00 37.56  ? 640  GLY B CA  1 
ATOM   3347 C  C   . GLY B 1 268 ? 33.024 -5.111  -33.870 1.00 35.84  ? 640  GLY B C   1 
ATOM   3348 O  O   . GLY B 1 268 ? 33.745 -5.957  -34.403 1.00 35.92  ? 640  GLY B O   1 
ATOM   3349 N  N   . ARG B 1 269 ? 32.997 -4.908  -32.556 1.00 34.86  ? 641  ARG B N   1 
ATOM   3350 C  CA  . ARG B 1 269 ? 33.835 -5.643  -31.627 1.00 33.61  ? 641  ARG B CA  1 
ATOM   3351 C  C   . ARG B 1 269 ? 33.082 -6.827  -31.018 1.00 33.43  ? 641  ARG B C   1 
ATOM   3352 O  O   . ARG B 1 269 ? 32.191 -6.641  -30.171 1.00 33.88  ? 641  ARG B O   1 
ATOM   3353 C  CB  . ARG B 1 269 ? 34.302 -4.719  -30.491 1.00 33.33  ? 641  ARG B CB  1 
ATOM   3354 C  CG  . ARG B 1 269 ? 35.200 -3.542  -30.922 1.00 33.77  ? 641  ARG B CG  1 
ATOM   3355 C  CD  . ARG B 1 269 ? 35.446 -2.568  -29.777 1.00 31.79  ? 641  ARG B CD  1 
ATOM   3356 N  NE  . ARG B 1 269 ? 34.195 -2.124  -29.170 1.00 34.28  ? 641  ARG B NE  1 
ATOM   3357 C  CZ  . ARG B 1 269 ? 34.093 -1.235  -28.182 1.00 34.42  ? 641  ARG B CZ  1 
ATOM   3358 N  NH1 . ARG B 1 269 ? 35.182 -0.667  -27.653 1.00 32.40  ? 641  ARG B NH1 1 
ATOM   3359 N  NH2 . ARG B 1 269 ? 32.892 -0.924  -27.715 1.00 32.52  ? 641  ARG B NH2 1 
ATOM   3360 N  N   . GLY B 1 270 ? 33.448 -8.038  -31.436 1.00 33.03  ? 642  GLY B N   1 
ATOM   3361 C  CA  . GLY B 1 270 ? 32.917 -9.251  -30.848 1.00 31.88  ? 642  GLY B CA  1 
ATOM   3362 C  C   . GLY B 1 270 ? 33.645 -9.620  -29.570 1.00 31.42  ? 642  GLY B C   1 
ATOM   3363 O  O   . GLY B 1 270 ? 34.578 -8.917  -29.142 1.00 31.99  ? 642  GLY B O   1 
ATOM   3364 N  N   . PRO B 1 271 ? 33.225 -10.729 -28.938 1.00 30.35  ? 643  PRO B N   1 
ATOM   3365 C  CA  . PRO B 1 271 ? 33.825 -11.233 -27.690 1.00 28.74  ? 643  PRO B CA  1 
ATOM   3366 C  C   . PRO B 1 271 ? 35.355 -11.447 -27.779 1.00 28.31  ? 643  PRO B C   1 
ATOM   3367 O  O   . PRO B 1 271 ? 36.080 -11.139 -26.837 1.00 27.81  ? 643  PRO B O   1 
ATOM   3368 C  CB  . PRO B 1 271 ? 33.095 -12.561 -27.478 1.00 28.52  ? 643  PRO B CB  1 
ATOM   3369 C  CG  . PRO B 1 271 ? 31.716 -12.323 -28.117 1.00 29.32  ? 643  PRO B CG  1 
ATOM   3370 C  CD  . PRO B 1 271 ? 32.053 -11.527 -29.359 1.00 30.54  ? 643  PRO B CD  1 
ATOM   3371 N  N   . LEU B 1 272 ? 35.840 -11.976 -28.892 1.00 28.20  ? 644  LEU B N   1 
ATOM   3372 C  CA  . LEU B 1 272 ? 37.282 -12.078 -29.081 1.00 28.60  ? 644  LEU B CA  1 
ATOM   3373 C  C   . LEU B 1 272 ? 37.995 -10.691 -29.083 1.00 28.57  ? 644  LEU B C   1 
ATOM   3374 O  O   . LEU B 1 272 ? 38.980 -10.497 -28.347 1.00 28.08  ? 644  LEU B O   1 
ATOM   3375 C  CB  . LEU B 1 272 ? 37.622 -12.889 -30.336 1.00 28.79  ? 644  LEU B CB  1 
ATOM   3376 C  CG  . LEU B 1 272 ? 39.113 -13.156 -30.524 1.00 29.43  ? 644  LEU B CG  1 
ATOM   3377 C  CD1 . LEU B 1 272 ? 39.747 -13.828 -29.299 1.00 27.38  ? 644  LEU B CD1 1 
ATOM   3378 C  CD2 . LEU B 1 272 ? 39.371 -13.949 -31.798 1.00 29.37  ? 644  LEU B CD2 1 
ATOM   3379 N  N   . HIS B 1 273 ? 37.492 -9.729  -29.866 1.00 28.68  ? 645  HIS B N   1 
ATOM   3380 C  CA  . HIS B 1 273 ? 38.036 -8.356  -29.781 1.00 28.97  ? 645  HIS B CA  1 
ATOM   3381 C  C   . HIS B 1 273 ? 38.054 -7.868  -28.332 1.00 28.56  ? 645  HIS B C   1 
ATOM   3382 O  O   . HIS B 1 273 ? 39.078 -7.398  -27.867 1.00 29.74  ? 645  HIS B O   1 
ATOM   3383 C  CB  . HIS B 1 273 ? 37.284 -7.329  -30.651 1.00 29.32  ? 645  HIS B CB  1 
ATOM   3384 C  CG  . HIS B 1 273 ? 37.391 -7.564  -32.121 1.00 28.79  ? 645  HIS B CG  1 
ATOM   3385 N  ND1 . HIS B 1 273 ? 36.433 -8.249  -32.833 1.00 30.76  ? 645  HIS B ND1 1 
ATOM   3386 C  CD2 . HIS B 1 273 ? 38.307 -7.155  -33.027 1.00 30.38  ? 645  HIS B CD2 1 
ATOM   3387 C  CE1 . HIS B 1 273 ? 36.766 -8.279  -34.111 1.00 30.90  ? 645  HIS B CE1 1 
ATOM   3388 N  NE2 . HIS B 1 273 ? 37.898 -7.616  -34.256 1.00 33.36  ? 645  HIS B NE2 1 
ATOM   3389 N  N   . HIS B 1 274 ? 36.935 -7.983  -27.621 1.00 27.82  ? 646  HIS B N   1 
ATOM   3390 C  CA  . HIS B 1 274 ? 36.881 -7.522  -26.232 1.00 28.24  ? 646  HIS B CA  1 
ATOM   3391 C  C   . HIS B 1 274 ? 37.841 -8.263  -25.302 1.00 28.29  ? 646  HIS B C   1 
ATOM   3392 O  O   . HIS B 1 274 ? 38.427 -7.645  -24.415 1.00 29.02  ? 646  HIS B O   1 
ATOM   3393 C  CB  . HIS B 1 274 ? 35.453 -7.619  -25.652 1.00 28.22  ? 646  HIS B CB  1 
ATOM   3394 C  CG  . HIS B 1 274 ? 34.510 -6.598  -26.201 1.00 28.26  ? 646  HIS B CG  1 
ATOM   3395 N  ND1 . HIS B 1 274 ? 34.311 -5.369  -25.606 1.00 28.66  ? 646  HIS B ND1 1 
ATOM   3396 C  CD2 . HIS B 1 274 ? 33.710 -6.624  -27.292 1.00 28.21  ? 646  HIS B CD2 1 
ATOM   3397 C  CE1 . HIS B 1 274 ? 33.424 -4.685  -26.308 1.00 30.00  ? 646  HIS B CE1 1 
ATOM   3398 N  NE2 . HIS B 1 274 ? 33.046 -5.422  -27.337 1.00 29.33  ? 646  HIS B NE2 1 
ATOM   3399 N  N   . ALA B 1 275 ? 37.970 -9.583  -25.459 1.00 27.80  ? 647  ALA B N   1 
ATOM   3400 C  CA  . ALA B 1 275 ? 38.881 -10.329 -24.575 1.00 28.88  ? 647  ALA B CA  1 
ATOM   3401 C  C   . ALA B 1 275 ? 40.341 -9.854  -24.784 1.00 29.56  ? 647  ALA B C   1 
ATOM   3402 O  O   . ALA B 1 275 ? 41.101 -9.664  -23.819 1.00 30.44  ? 647  ALA B O   1 
ATOM   3403 C  CB  . ALA B 1 275 ? 38.746 -11.860 -24.768 1.00 27.68  ? 647  ALA B CB  1 
ATOM   3404 N  N   . THR B 1 276 ? 40.698 -9.648  -26.048 1.00 29.55  ? 648  THR B N   1 
ATOM   3405 C  CA  . THR B 1 276 ? 41.993 -9.101  -26.413 1.00 30.29  ? 648  THR B CA  1 
ATOM   3406 C  C   . THR B 1 276 ? 42.219 -7.683  -25.881 1.00 30.81  ? 648  THR B C   1 
ATOM   3407 O  O   . THR B 1 276 ? 43.246 -7.435  -25.268 1.00 31.40  ? 648  THR B O   1 
ATOM   3408 C  CB  . THR B 1 276 ? 42.207 -9.169  -27.926 1.00 30.80  ? 648  THR B CB  1 
ATOM   3409 O  OG1 . THR B 1 276 ? 41.937 -10.508 -28.373 1.00 31.47  ? 648  THR B OG1 1 
ATOM   3410 C  CG2 . THR B 1 276 ? 43.643 -8.822  -28.268 1.00 30.52  ? 648  THR B CG2 1 
ATOM   3411 N  N   . ILE B 1 277 ? 41.257 -6.774  -26.068 1.00 30.61  ? 649  ILE B N   1 
ATOM   3412 C  CA  . ILE B 1 277 ? 41.365 -5.411  -25.521 1.00 31.14  ? 649  ILE B CA  1 
ATOM   3413 C  C   . ILE B 1 277 ? 41.639 -5.417  -24.010 1.00 32.04  ? 649  ILE B C   1 
ATOM   3414 O  O   . ILE B 1 277 ? 42.420 -4.612  -23.491 1.00 32.63  ? 649  ILE B O   1 
ATOM   3415 C  CB  . ILE B 1 277 ? 40.078 -4.559  -25.806 1.00 31.80  ? 649  ILE B CB  1 
ATOM   3416 C  CG1 . ILE B 1 277 ? 39.972 -4.195  -27.292 1.00 30.98  ? 649  ILE B CG1 1 
ATOM   3417 C  CG2 . ILE B 1 277 ? 40.044 -3.283  -24.940 1.00 31.02  ? 649  ILE B CG2 1 
ATOM   3418 C  CD1 . ILE B 1 277 ? 38.541 -3.853  -27.730 1.00 32.41  ? 649  ILE B CD1 1 
ATOM   3419 N  N   . LEU B 1 278 ? 40.991 -6.332  -23.303 1.00 31.47  ? 650  LEU B N   1 
ATOM   3420 C  CA  . LEU B 1 278 ? 41.094 -6.344  -21.857 1.00 32.22  ? 650  LEU B CA  1 
ATOM   3421 C  C   . LEU B 1 278 ? 42.254 -7.215  -21.397 1.00 32.48  ? 650  LEU B C   1 
ATOM   3422 O  O   . LEU B 1 278 ? 42.530 -7.297  -20.205 1.00 33.31  ? 650  LEU B O   1 
ATOM   3423 C  CB  . LEU B 1 278 ? 39.753 -6.790  -21.244 1.00 31.52  ? 650  LEU B CB  1 
ATOM   3424 C  CG  . LEU B 1 278 ? 38.607 -5.797  -21.501 1.00 33.07  ? 650  LEU B CG  1 
ATOM   3425 C  CD1 . LEU B 1 278 ? 37.233 -6.397  -21.202 1.00 31.89  ? 650  LEU B CD1 1 
ATOM   3426 C  CD2 . LEU B 1 278 ? 38.825 -4.471  -20.727 1.00 31.24  ? 650  LEU B CD2 1 
ATOM   3427 N  N   . GLY B 1 279 ? 42.923 -7.866  -22.348 1.00 32.15  ? 651  GLY B N   1 
ATOM   3428 C  CA  . GLY B 1 279 ? 44.018 -8.780  -22.028 1.00 33.39  ? 651  GLY B CA  1 
ATOM   3429 C  C   . GLY B 1 279 ? 43.612 -10.019 -21.238 1.00 34.07  ? 651  GLY B C   1 
ATOM   3430 O  O   . GLY B 1 279 ? 44.385 -10.519 -20.423 1.00 35.07  ? 651  GLY B O   1 
ATOM   3431 N  N   . HIS B 1 280 ? 42.395 -10.516 -21.477 1.00 33.46  ? 652  HIS B N   1 
ATOM   3432 C  CA  . HIS B 1 280 ? 41.914 -11.735 -20.826 1.00 33.42  ? 652  HIS B CA  1 
ATOM   3433 C  C   . HIS B 1 280 ? 42.264 -13.005 -21.655 1.00 33.00  ? 652  HIS B C   1 
ATOM   3434 O  O   . HIS B 1 280 ? 41.477 -13.467 -22.481 1.00 32.50  ? 652  HIS B O   1 
ATOM   3435 C  CB  . HIS B 1 280 ? 40.408 -11.619 -20.558 1.00 32.80  ? 652  HIS B CB  1 
ATOM   3436 C  CG  . HIS B 1 280 ? 40.039 -10.537 -19.581 1.00 34.37  ? 652  HIS B CG  1 
ATOM   3437 N  ND1 . HIS B 1 280 ? 38.834 -9.864  -19.633 1.00 34.33  ? 652  HIS B ND1 1 
ATOM   3438 C  CD2 . HIS B 1 280 ? 40.712 -10.015 -18.526 1.00 35.93  ? 652  HIS B CD2 1 
ATOM   3439 C  CE1 . HIS B 1 280 ? 38.781 -8.980  -18.651 1.00 34.71  ? 652  HIS B CE1 1 
ATOM   3440 N  NE2 . HIS B 1 280 ? 39.909 -9.047  -17.968 1.00 35.02  ? 652  HIS B NE2 1 
ATOM   3441 N  N   . THR B 1 281 ? 43.449 -13.558 -21.412 1.00 33.63  ? 653  THR B N   1 
ATOM   3442 C  CA  . THR B 1 281 ? 44.006 -14.675 -22.195 1.00 33.81  ? 653  THR B CA  1 
ATOM   3443 C  C   . THR B 1 281 ? 43.123 -15.942 -22.194 1.00 33.46  ? 653  THR B C   1 
ATOM   3444 O  O   . THR B 1 281 ? 42.811 -16.481 -23.258 1.00 33.22  ? 653  THR B O   1 
ATOM   3445 C  CB  . THR B 1 281 ? 45.466 -14.973 -21.756 1.00 34.94  ? 653  THR B CB  1 
ATOM   3446 O  OG1 . THR B 1 281 ? 46.235 -13.773 -21.869 1.00 36.02  ? 653  THR B OG1 1 
ATOM   3447 C  CG2 . THR B 1 281 ? 46.118 -16.056 -22.612 1.00 35.30  ? 653  THR B CG2 1 
ATOM   3448 N  N   . GLY B 1 282 ? 42.717 -16.390 -21.010 1.00 33.77  ? 654  GLY B N   1 
ATOM   3449 C  CA  . GLY B 1 282 ? 41.785 -17.512 -20.868 1.00 34.01  ? 654  GLY B CA  1 
ATOM   3450 C  C   . GLY B 1 282 ? 40.481 -17.363 -21.631 1.00 33.02  ? 654  GLY B C   1 
ATOM   3451 O  O   . GLY B 1 282 ? 40.035 -18.313 -22.286 1.00 33.12  ? 654  GLY B O   1 
ATOM   3452 N  N   . LEU B 1 283 ? 39.864 -16.177 -21.567 1.00 32.30  ? 655  LEU B N   1 
ATOM   3453 C  CA  . LEU B 1 283 ? 38.650 -15.925 -22.350 1.00 31.43  ? 655  LEU B CA  1 
ATOM   3454 C  C   . LEU B 1 283 ? 38.932 -15.973 -23.851 1.00 31.33  ? 655  LEU B C   1 
ATOM   3455 O  O   . LEU B 1 283 ? 38.160 -16.557 -24.602 1.00 31.31  ? 655  LEU B O   1 
ATOM   3456 C  CB  . LEU B 1 283 ? 37.979 -14.610 -21.949 1.00 30.92  ? 655  LEU B CB  1 
ATOM   3457 C  CG  . LEU B 1 283 ? 37.310 -14.598 -20.557 1.00 32.43  ? 655  LEU B CG  1 
ATOM   3458 C  CD1 . LEU B 1 283 ? 36.619 -13.286 -20.287 1.00 30.18  ? 655  LEU B CD1 1 
ATOM   3459 C  CD2 . LEU B 1 283 ? 36.303 -15.734 -20.437 1.00 34.19  ? 655  LEU B CD2 1 
ATOM   3460 N  N   . ALA B 1 284 ? 40.045 -15.384 -24.288 1.00 31.77  ? 656  ALA B N   1 
ATOM   3461 C  CA  . ALA B 1 284 ? 40.430 -15.462 -25.704 1.00 32.26  ? 656  ALA B CA  1 
ATOM   3462 C  C   . ALA B 1 284 ? 40.569 -16.911 -26.167 1.00 33.06  ? 656  ALA B C   1 
ATOM   3463 O  O   . ALA B 1 284 ? 40.153 -17.253 -27.275 1.00 33.22  ? 656  ALA B O   1 
ATOM   3464 C  CB  . ALA B 1 284 ? 41.717 -14.682 -25.968 1.00 32.72  ? 656  ALA B CB  1 
ATOM   3465 N  N   A CYS B 1 285 ? 41.161 -17.755 -25.317 0.50 34.47  ? 657  CYS B N   1 
ATOM   3466 N  N   B CYS B 1 285 ? 41.131 -17.747 -25.297 0.50 34.04  ? 657  CYS B N   1 
ATOM   3467 C  CA  A CYS B 1 285 ? 41.290 -19.196 -25.590 0.50 36.09  ? 657  CYS B CA  1 
ATOM   3468 C  CA  B CYS B 1 285 ? 41.325 -19.173 -25.563 0.50 35.24  ? 657  CYS B CA  1 
ATOM   3469 C  C   A CYS B 1 285 ? 39.923 -19.825 -25.761 0.50 35.47  ? 657  CYS B C   1 
ATOM   3470 C  C   B CYS B 1 285 ? 39.991 -19.918 -25.687 0.50 35.15  ? 657  CYS B C   1 
ATOM   3471 O  O   A CYS B 1 285 ? 39.626 -20.417 -26.802 0.50 36.01  ? 657  CYS B O   1 
ATOM   3472 O  O   B CYS B 1 285 ? 39.786 -20.679 -26.634 0.50 35.98  ? 657  CYS B O   1 
ATOM   3473 C  CB  A CYS B 1 285 ? 42.014 -19.918 -24.456 0.50 37.21  ? 657  CYS B CB  1 
ATOM   3474 C  CB  B CYS B 1 285 ? 42.189 -19.793 -24.466 0.50 36.23  ? 657  CYS B CB  1 
ATOM   3475 S  SG  A CYS B 1 285 ? 43.762 -19.629 -24.391 0.50 40.12  ? 657  CYS B SG  1 
ATOM   3476 S  SG  B CYS B 1 285 ? 42.643 -21.489 -24.765 0.50 36.40  ? 657  CYS B SG  1 
ATOM   3477 N  N   . LEU B 1 286 ? 39.096 -19.683 -24.729 1.00 34.78  ? 658  LEU B N   1 
ATOM   3478 C  CA  . LEU B 1 286 ? 37.729 -20.193 -24.762 1.00 34.63  ? 658  LEU B CA  1 
ATOM   3479 C  C   . LEU B 1 286 ? 37.055 -19.846 -26.084 1.00 34.28  ? 658  LEU B C   1 
ATOM   3480 O  O   . LEU B 1 286 ? 36.570 -20.728 -26.796 1.00 35.33  ? 658  LEU B O   1 
ATOM   3481 C  CB  . LEU B 1 286 ? 36.936 -19.607 -23.597 1.00 34.11  ? 658  LEU B CB  1 
ATOM   3482 C  CG  . LEU B 1 286 ? 35.528 -20.156 -23.325 1.00 35.03  ? 658  LEU B CG  1 
ATOM   3483 C  CD1 . LEU B 1 286 ? 35.563 -21.618 -22.904 1.00 32.75  ? 658  LEU B CD1 1 
ATOM   3484 C  CD2 . LEU B 1 286 ? 34.888 -19.312 -22.239 1.00 35.25  ? 658  LEU B CD2 1 
ATOM   3485 N  N   . PHE B 1 287 ? 37.069 -18.564 -26.436 1.00 33.26  ? 659  PHE B N   1 
ATOM   3486 C  CA  . PHE B 1 287 ? 36.425 -18.118 -27.665 1.00 32.97  ? 659  PHE B CA  1 
ATOM   3487 C  C   . PHE B 1 287 ? 37.019 -18.772 -28.917 1.00 34.46  ? 659  PHE B C   1 
ATOM   3488 O  O   . PHE B 1 287 ? 36.273 -19.201 -29.801 1.00 34.92  ? 659  PHE B O   1 
ATOM   3489 C  CB  . PHE B 1 287 ? 36.385 -16.579 -27.745 1.00 31.83  ? 659  PHE B CB  1 
ATOM   3490 C  CG  . PHE B 1 287 ? 35.657 -15.937 -26.592 1.00 30.85  ? 659  PHE B CG  1 
ATOM   3491 C  CD1 . PHE B 1 287 ? 34.648 -16.634 -25.902 1.00 28.98  ? 659  PHE B CD1 1 
ATOM   3492 C  CD2 . PHE B 1 287 ? 35.958 -14.635 -26.198 1.00 29.92  ? 659  PHE B CD2 1 
ATOM   3493 C  CE1 . PHE B 1 287 ? 33.973 -16.043 -24.821 1.00 28.90  ? 659  PHE B CE1 1 
ATOM   3494 C  CE2 . PHE B 1 287 ? 35.281 -14.023 -25.125 1.00 29.25  ? 659  PHE B CE2 1 
ATOM   3495 C  CZ  . PHE B 1 287 ? 34.284 -14.732 -24.430 1.00 27.58  ? 659  PHE B CZ  1 
ATOM   3496 N  N   . LEU B 1 288 ? 38.345 -18.880 -28.985 1.00 35.56  ? 660  LEU B N   1 
ATOM   3497 C  CA  . LEU B 1 288 ? 38.972 -19.565 -30.128 1.00 37.88  ? 660  LEU B CA  1 
ATOM   3498 C  C   . LEU B 1 288 ? 38.525 -21.014 -30.252 1.00 39.59  ? 660  LEU B C   1 
ATOM   3499 O  O   . LEU B 1 288 ? 38.145 -21.448 -31.341 1.00 41.09  ? 660  LEU B O   1 
ATOM   3500 C  CB  . LEU B 1 288 ? 40.504 -19.445 -30.108 1.00 38.34  ? 660  LEU B CB  1 
ATOM   3501 C  CG  . LEU B 1 288 ? 41.029 -18.035 -30.434 1.00 37.70  ? 660  LEU B CG  1 
ATOM   3502 C  CD1 . LEU B 1 288 ? 42.513 -17.930 -30.126 1.00 39.66  ? 660  LEU B CD1 1 
ATOM   3503 C  CD2 . LEU B 1 288 ? 40.720 -17.594 -31.888 1.00 37.36  ? 660  LEU B CD2 1 
ATOM   3504 N  N   . LYS B 1 289 ? 38.544 -21.739 -29.134 1.00 40.60  ? 661  LYS B N   1 
ATOM   3505 C  CA  . LYS B 1 289 ? 38.072 -23.132 -29.061 1.00 43.11  ? 661  LYS B CA  1 
ATOM   3506 C  C   . LYS B 1 289 ? 36.612 -23.298 -29.513 1.00 42.72  ? 661  LYS B C   1 
ATOM   3507 O  O   . LYS B 1 289 ? 36.239 -24.361 -29.993 1.00 44.48  ? 661  LYS B O   1 
ATOM   3508 C  CB  . LYS B 1 289 ? 38.229 -23.684 -27.630 1.00 43.43  ? 661  LYS B CB  1 
ATOM   3509 C  CG  . LYS B 1 289 ? 39.672 -24.062 -27.251 1.00 47.96  ? 661  LYS B CG  1 
ATOM   3510 C  CD  . LYS B 1 289 ? 39.960 -23.966 -25.726 1.00 51.25  ? 661  LYS B CD  1 
ATOM   3511 C  CE  . LYS B 1 289 ? 39.156 -24.969 -24.896 1.00 53.54  ? 661  LYS B CE  1 
ATOM   3512 N  NZ  . LYS B 1 289 ? 38.900 -24.449 -23.516 1.00 54.51  ? 661  LYS B NZ  1 
ATOM   3513 N  N   . ARG B 1 290 ? 35.807 -22.248 -29.364 1.00 40.99  ? 662  ARG B N   1 
ATOM   3514 C  CA  . ARG B 1 290 ? 34.397 -22.283 -29.739 1.00 41.32  ? 662  ARG B CA  1 
ATOM   3515 C  C   . ARG B 1 290 ? 34.109 -21.681 -31.091 1.00 41.27  ? 662  ARG B C   1 
ATOM   3516 O  O   . ARG B 1 290 ? 32.975 -21.313 -31.344 1.00 41.44  ? 662  ARG B O   1 
ATOM   3517 C  CB  . ARG B 1 290 ? 33.523 -21.533 -28.723 1.00 40.08  ? 662  ARG B CB  1 
ATOM   3518 C  CG  . ARG B 1 290 ? 33.546 -22.069 -27.326 1.00 42.65  ? 662  ARG B CG  1 
ATOM   3519 C  CD  . ARG B 1 290 ? 32.826 -23.383 -27.229 1.00 48.13  ? 662  ARG B CD  1 
ATOM   3520 N  NE  . ARG B 1 290 ? 33.361 -24.147 -26.108 1.00 53.61  ? 662  ARG B NE  1 
ATOM   3521 C  CZ  . ARG B 1 290 ? 32.793 -24.225 -24.906 1.00 54.89  ? 662  ARG B CZ  1 
ATOM   3522 N  NH1 . ARG B 1 290 ? 33.372 -24.942 -23.949 1.00 56.29  ? 662  ARG B NH1 1 
ATOM   3523 N  NH2 . ARG B 1 290 ? 31.651 -23.597 -24.657 1.00 54.31  ? 662  ARG B NH2 1 
ATOM   3524 N  N   . GLY B 1 291 ? 35.115 -21.542 -31.949 1.00 42.05  ? 663  GLY B N   1 
ATOM   3525 C  CA  . GLY B 1 291 ? 34.880 -21.098 -33.323 1.00 41.78  ? 663  GLY B CA  1 
ATOM   3526 C  C   . GLY B 1 291 ? 34.845 -19.596 -33.593 1.00 40.46  ? 663  GLY B C   1 
ATOM   3527 O  O   . GLY B 1 291 ? 34.379 -19.175 -34.662 1.00 41.02  ? 663  GLY B O   1 
ATOM   3528 N  N   . ALA B 1 292 ? 35.336 -18.783 -32.654 1.00 38.15  ? 664  ALA B N   1 
ATOM   3529 C  CA  . ALA B 1 292 ? 35.447 -17.341 -32.895 1.00 37.13  ? 664  ALA B CA  1 
ATOM   3530 C  C   . ALA B 1 292 ? 36.257 -17.055 -34.166 1.00 38.27  ? 664  ALA B C   1 
ATOM   3531 O  O   . ALA B 1 292 ? 37.268 -17.716 -34.423 1.00 38.33  ? 664  ALA B O   1 
ATOM   3532 C  CB  . ALA B 1 292 ? 36.046 -16.631 -31.709 1.00 35.53  ? 664  ALA B CB  1 
ATOM   3533 N  N   . ASP B 1 293 ? 35.780 -16.099 -34.963 1.00 38.52  ? 665  ASP B N   1 
ATOM   3534 C  CA  . ASP B 1 293 ? 36.419 -15.733 -36.212 1.00 40.72  ? 665  ASP B CA  1 
ATOM   3535 C  C   . ASP B 1 293 ? 37.665 -14.902 -35.929 1.00 40.59  ? 665  ASP B C   1 
ATOM   3536 O  O   . ASP B 1 293 ? 37.608 -13.834 -35.303 1.00 39.32  ? 665  ASP B O   1 
ATOM   3537 C  CB  . ASP B 1 293 ? 35.459 -14.986 -37.146 1.00 41.74  ? 665  ASP B CB  1 
ATOM   3538 C  CG  . ASP B 1 293 ? 36.094 -14.643 -38.497 1.00 46.32  ? 665  ASP B CG  1 
ATOM   3539 O  OD1 . ASP B 1 293 ? 37.279 -14.983 -38.740 1.00 49.75  ? 665  ASP B OD1 1 
ATOM   3540 O  OD2 . ASP B 1 293 ? 35.404 -14.033 -39.341 1.00 50.80  ? 665  ASP B OD2 1 
ATOM   3541 N  N   . LEU B 1 294 ? 38.787 -15.424 -36.410 1.00 42.04  ? 666  LEU B N   1 
ATOM   3542 C  CA  . LEU B 1 294 ? 40.101 -14.857 -36.189 1.00 42.68  ? 666  LEU B CA  1 
ATOM   3543 C  C   . LEU B 1 294 ? 40.320 -13.587 -36.987 1.00 43.03  ? 666  LEU B C   1 
ATOM   3544 O  O   . LEU B 1 294 ? 40.991 -12.676 -36.518 1.00 42.65  ? 666  LEU B O   1 
ATOM   3545 C  CB  . LEU B 1 294 ? 41.151 -15.863 -36.639 1.00 44.62  ? 666  LEU B CB  1 
ATOM   3546 C  CG  . LEU B 1 294 ? 41.733 -16.791 -35.607 1.00 45.22  ? 666  LEU B CG  1 
ATOM   3547 C  CD1 . LEU B 1 294 ? 42.300 -17.981 -36.339 1.00 49.01  ? 666  LEU B CD1 1 
ATOM   3548 C  CD2 . LEU B 1 294 ? 42.816 -16.032 -34.883 1.00 47.06  ? 666  LEU B CD2 1 
ATOM   3549 N  N   . GLY B 1 295 ? 39.781 -13.556 -38.201 1.00 44.05  ? 667  GLY B N   1 
ATOM   3550 C  CA  . GLY B 1 295 ? 39.963 -12.424 -39.093 1.00 44.81  ? 667  GLY B CA  1 
ATOM   3551 C  C   . GLY B 1 295 ? 38.819 -11.426 -39.129 1.00 44.12  ? 667  GLY B C   1 
ATOM   3552 O  O   . GLY B 1 295 ? 38.688 -10.688 -40.102 1.00 46.08  ? 667  GLY B O   1 
ATOM   3553 N  N   . ALA B 1 296 ? 37.989 -11.396 -38.085 1.00 41.71  ? 668  ALA B N   1 
ATOM   3554 C  CA  . ALA B 1 296 ? 36.905 -10.416 -38.005 1.00 40.58  ? 668  ALA B CA  1 
ATOM   3555 C  C   . ALA B 1 296 ? 37.486 -9.022  -37.706 1.00 39.79  ? 668  ALA B C   1 
ATOM   3556 O  O   . ALA B 1 296 ? 38.191 -8.830  -36.697 1.00 38.55  ? 668  ALA B O   1 
ATOM   3557 C  CB  . ALA B 1 296 ? 35.856 -10.834 -36.956 1.00 38.39  ? 668  ALA B CB  1 
ATOM   3558 N  N   . ARG B 1 297 ? 37.221 -8.074  -38.605 1.00 40.30  ? 669  ARG B N   1 
ATOM   3559 C  CA  . ARG B 1 297 ? 37.664 -6.685  -38.439 1.00 40.00  ? 669  ARG B CA  1 
ATOM   3560 C  C   . ARG B 1 297 ? 36.558 -5.815  -37.828 1.00 38.56  ? 669  ARG B C   1 
ATOM   3561 O  O   . ARG B 1 297 ? 35.395 -5.881  -38.260 1.00 38.79  ? 669  ARG B O   1 
ATOM   3562 C  CB  . ARG B 1 297 ? 38.171 -6.094  -39.774 1.00 42.94  ? 669  ARG B CB  1 
ATOM   3563 C  CG  . ARG B 1 297 ? 39.368 -6.861  -40.384 1.00 45.68  ? 669  ARG B CG  1 
ATOM   3564 C  CD  . ARG B 1 297 ? 40.328 -5.969  -41.157 1.00 51.67  ? 669  ARG B CD  1 
ATOM   3565 N  NE  . ARG B 1 297 ? 41.577 -6.665  -41.509 1.00 55.27  ? 669  ARG B NE  1 
ATOM   3566 C  CZ  . ARG B 1 297 ? 42.714 -6.642  -40.800 1.00 54.57  ? 669  ARG B CZ  1 
ATOM   3567 N  NH1 . ARG B 1 297 ? 42.811 -5.953  -39.666 1.00 53.64  ? 669  ARG B NH1 1 
ATOM   3568 N  NH2 . ARG B 1 297 ? 43.775 -7.318  -41.233 1.00 55.52  ? 669  ARG B NH2 1 
ATOM   3569 N  N   . ASP B 1 298 ? 36.924 -5.029  -36.813 1.00 36.20  ? 670  ASP B N   1 
ATOM   3570 C  CA  . ASP B 1 298 ? 36.011 -4.075  -36.184 1.00 35.72  ? 670  ASP B CA  1 
ATOM   3571 C  C   . ASP B 1 298 ? 35.898 -2.770  -36.999 1.00 37.27  ? 670  ASP B C   1 
ATOM   3572 O  O   . ASP B 1 298 ? 36.457 -2.680  -38.100 1.00 38.15  ? 670  ASP B O   1 
ATOM   3573 C  CB  . ASP B 1 298 ? 36.418 -3.793  -34.730 1.00 34.09  ? 670  ASP B CB  1 
ATOM   3574 C  CG  . ASP B 1 298 ? 37.718 -2.995  -34.606 1.00 34.99  ? 670  ASP B CG  1 
ATOM   3575 O  OD1 . ASP B 1 298 ? 38.234 -2.460  -35.605 1.00 36.41  ? 670  ASP B OD1 1 
ATOM   3576 O  OD2 . ASP B 1 298 ? 38.244 -2.907  -33.477 1.00 36.51  ? 670  ASP B OD2 1 
ATOM   3577 N  N   . SER B 1 299 ? 35.201 -1.771  -36.443 1.00 37.35  ? 671  SER B N   1 
ATOM   3578 C  CA  . SER B 1 299 ? 34.926 -0.495  -37.139 1.00 39.83  ? 671  SER B CA  1 
ATOM   3579 C  C   . SER B 1 299 ? 36.192 0.319   -37.349 1.00 40.50  ? 671  SER B C   1 
ATOM   3580 O  O   . SER B 1 299 ? 36.240 1.173   -38.224 1.00 42.81  ? 671  SER B O   1 
ATOM   3581 C  CB  . SER B 1 299 ? 33.851 0.351   -36.414 1.00 40.25  ? 671  SER B CB  1 
ATOM   3582 O  OG  . SER B 1 299 ? 34.324 0.875   -35.177 1.00 39.07  ? 671  SER B OG  1 
ATOM   3583 N  N   . GLU B 1 300 ? 37.222 0.029   -36.557 1.00 38.95  ? 672  GLU B N   1 
ATOM   3584 C  CA  . GLU B 1 300 ? 38.516 0.673   -36.722 1.00 39.42  ? 672  GLU B CA  1 
ATOM   3585 C  C   . GLU B 1 300 ? 39.411 -0.103  -37.688 1.00 39.74  ? 672  GLU B C   1 
ATOM   3586 O  O   . GLU B 1 300 ? 40.528 0.294   -37.954 1.00 39.73  ? 672  GLU B O   1 
ATOM   3587 C  CB  . GLU B 1 300 ? 39.165 0.880   -35.353 1.00 37.93  ? 672  GLU B CB  1 
ATOM   3588 C  CG  . GLU B 1 300 ? 38.301 1.791   -34.462 1.00 38.57  ? 672  GLU B CG  1 
ATOM   3589 C  CD  . GLU B 1 300 ? 38.856 2.040   -33.075 1.00 39.61  ? 672  GLU B CD  1 
ATOM   3590 O  OE1 . GLU B 1 300 ? 40.083 1.937   -32.850 1.00 41.26  ? 672  GLU B OE1 1 
ATOM   3591 O  OE2 . GLU B 1 300 ? 38.048 2.350   -32.183 1.00 41.98  ? 672  GLU B OE2 1 
ATOM   3592 N  N   . GLY B 1 301 ? 38.898 -1.210  -38.223 1.00 40.06  ? 673  GLY B N   1 
ATOM   3593 C  CA  . GLY B 1 301 ? 39.656 -2.052  -39.152 1.00 40.77  ? 673  GLY B CA  1 
ATOM   3594 C  C   . GLY B 1 301 ? 40.585 -3.059  -38.480 1.00 39.49  ? 673  GLY B C   1 
ATOM   3595 O  O   . GLY B 1 301 ? 41.432 -3.651  -39.145 1.00 40.75  ? 673  GLY B O   1 
ATOM   3596 N  N   . ARG B 1 302 ? 40.430 -3.252  -37.172 1.00 37.55  ? 674  ARG B N   1 
ATOM   3597 C  CA  . ARG B 1 302 ? 41.312 -4.117  -36.384 1.00 35.95  ? 674  ARG B CA  1 
ATOM   3598 C  C   . ARG B 1 302 ? 40.748 -5.528  -36.218 1.00 35.14  ? 674  ARG B C   1 
ATOM   3599 O  O   . ARG B 1 302 ? 39.583 -5.711  -35.809 1.00 33.98  ? 674  ARG B O   1 
ATOM   3600 C  CB  . ARG B 1 302 ? 41.544 -3.534  -34.977 1.00 35.01  ? 674  ARG B CB  1 
ATOM   3601 C  CG  . ARG B 1 302 ? 41.928 -2.056  -34.918 1.00 34.76  ? 674  ARG B CG  1 
ATOM   3602 C  CD  . ARG B 1 302 ? 41.888 -1.517  -33.489 1.00 33.79  ? 674  ARG B CD  1 
ATOM   3603 N  NE  . ARG B 1 302 ? 40.576 -1.703  -32.859 1.00 33.85  ? 674  ARG B NE  1 
ATOM   3604 C  CZ  . ARG B 1 302 ? 40.294 -1.401  -31.593 1.00 33.65  ? 674  ARG B CZ  1 
ATOM   3605 N  NH1 . ARG B 1 302 ? 41.241 -0.909  -30.806 1.00 32.68  ? 674  ARG B NH1 1 
ATOM   3606 N  NH2 . ARG B 1 302 ? 39.062 -1.603  -31.105 1.00 32.65  ? 674  ARG B NH2 1 
ATOM   3607 N  N   . ASP B 1 303 ? 41.573 -6.521  -36.541 1.00 35.15  ? 675  ASP B N   1 
ATOM   3608 C  CA  . ASP B 1 303 ? 41.297 -7.887  -36.140 1.00 34.83  ? 675  ASP B CA  1 
ATOM   3609 C  C   . ASP B 1 303 ? 41.908 -8.123  -34.758 1.00 33.17  ? 675  ASP B C   1 
ATOM   3610 O  O   . ASP B 1 303 ? 42.641 -7.267  -34.242 1.00 33.94  ? 675  ASP B O   1 
ATOM   3611 C  CB  . ASP B 1 303 ? 41.786 -8.896  -37.185 1.00 36.59  ? 675  ASP B CB  1 
ATOM   3612 C  CG  . ASP B 1 303 ? 43.300 -8.879  -37.385 1.00 40.56  ? 675  ASP B CG  1 
ATOM   3613 O  OD1 . ASP B 1 303 ? 44.033 -8.052  -36.773 1.00 43.20  ? 675  ASP B OD1 1 
ATOM   3614 O  OD2 . ASP B 1 303 ? 43.759 -9.716  -38.192 1.00 45.49  ? 675  ASP B OD2 1 
ATOM   3615 N  N   . PRO B 1 304 ? 41.577 -9.252  -34.118 1.00 31.66  ? 676  PRO B N   1 
ATOM   3616 C  CA  . PRO B 1 304 ? 42.182 -9.481  -32.798 1.00 30.11  ? 676  PRO B CA  1 
ATOM   3617 C  C   . PRO B 1 304 ? 43.727 -9.481  -32.786 1.00 30.70  ? 676  PRO B C   1 
ATOM   3618 O  O   . PRO B 1 304 ? 44.335 -9.045  -31.807 1.00 30.56  ? 676  PRO B O   1 
ATOM   3619 C  CB  . PRO B 1 304 ? 41.594 -10.836 -32.392 1.00 29.42  ? 676  PRO B CB  1 
ATOM   3620 C  CG  . PRO B 1 304 ? 40.226 -10.817 -33.055 1.00 29.75  ? 676  PRO B CG  1 
ATOM   3621 C  CD  . PRO B 1 304 ? 40.534 -10.250 -34.422 1.00 30.69  ? 676  PRO B CD  1 
ATOM   3622 N  N   . LEU B 1 305 ? 44.362 -9.933  -33.862 1.00 32.01  ? 677  LEU B N   1 
ATOM   3623 C  CA  . LEU B 1 305 ? 45.812 -9.919  -33.908 1.00 33.01  ? 677  LEU B CA  1 
ATOM   3624 C  C   . LEU B 1 305 ? 46.356 -8.488  -33.749 1.00 33.95  ? 677  LEU B C   1 
ATOM   3625 O  O   . LEU B 1 305 ? 47.240 -8.240  -32.920 1.00 33.94  ? 677  LEU B O   1 
ATOM   3626 C  CB  . LEU B 1 305 ? 46.328 -10.573 -35.191 1.00 34.25  ? 677  LEU B CB  1 
ATOM   3627 C  CG  . LEU B 1 305 ? 47.851 -10.720 -35.299 1.00 34.82  ? 677  LEU B CG  1 
ATOM   3628 C  CD1 . LEU B 1 305 ? 48.426 -11.396 -34.054 1.00 32.48  ? 677  LEU B CD1 1 
ATOM   3629 C  CD2 . LEU B 1 305 ? 48.245 -11.461 -36.570 1.00 34.29  ? 677  LEU B CD2 1 
ATOM   3630 N  N   . THR B 1 306 ? 45.806 -7.562  -34.535 1.00 34.80  ? 678  THR B N   1 
ATOM   3631 C  CA  . THR B 1 306 ? 46.172 -6.158  -34.476 1.00 35.96  ? 678  THR B CA  1 
ATOM   3632 C  C   . THR B 1 306 ? 46.088 -5.606  -33.051 1.00 34.91  ? 678  THR B C   1 
ATOM   3633 O  O   . THR B 1 306 ? 47.023 -4.951  -32.578 1.00 35.50  ? 678  THR B O   1 
ATOM   3634 C  CB  . THR B 1 306 ? 45.299 -5.319  -35.427 1.00 36.93  ? 678  THR B CB  1 
ATOM   3635 O  OG1 . THR B 1 306 ? 45.581 -5.700  -36.780 1.00 40.01  ? 678  THR B OG1 1 
ATOM   3636 C  CG2 . THR B 1 306 ? 45.597 -3.835  -35.267 1.00 37.51  ? 678  THR B CG2 1 
ATOM   3637 N  N   . ILE B 1 307 ? 44.984 -5.899  -32.367 1.00 33.36  ? 679  ILE B N   1 
ATOM   3638 C  CA  . ILE B 1 307 ? 44.795 -5.427  -31.002 1.00 32.57  ? 679  ILE B CA  1 
ATOM   3639 C  C   . ILE B 1 307 ? 45.822 -6.015  -30.036 1.00 32.58  ? 679  ILE B C   1 
ATOM   3640 O  O   . ILE B 1 307 ? 46.354 -5.308  -29.184 1.00 33.17  ? 679  ILE B O   1 
ATOM   3641 C  CB  . ILE B 1 307 ? 43.357 -5.733  -30.479 1.00 31.27  ? 679  ILE B CB  1 
ATOM   3642 C  CG1 . ILE B 1 307 ? 42.307 -5.158  -31.450 1.00 32.21  ? 679  ILE B CG1 1 
ATOM   3643 C  CG2 . ILE B 1 307 ? 43.192 -5.166  -29.073 1.00 29.83  ? 679  ILE B CG2 1 
ATOM   3644 C  CD1 . ILE B 1 307 ? 40.840 -5.425  -31.066 1.00 29.67  ? 679  ILE B CD1 1 
ATOM   3645 N  N   . ALA B 1 308 ? 46.070 -7.319  -30.141 1.00 32.76  ? 680  ALA B N   1 
ATOM   3646 C  CA  . ALA B 1 308 ? 47.030 -7.990  -29.249 1.00 33.45  ? 680  ALA B CA  1 
ATOM   3647 C  C   . ALA B 1 308 ? 48.462 -7.409  -29.396 1.00 34.69  ? 680  ALA B C   1 
ATOM   3648 O  O   . ALA B 1 308 ? 49.205 -7.300  -28.409 1.00 34.85  ? 680  ALA B O   1 
ATOM   3649 C  CB  . ALA B 1 308 ? 47.020 -9.504  -29.491 1.00 32.94  ? 680  ALA B CB  1 
ATOM   3650 N  N   . MET B 1 309 ? 48.824 -7.033  -30.617 1.00 35.34  ? 681  MET B N   1 
ATOM   3651 C  CA  . MET B 1 309 ? 50.130 -6.414  -30.868 1.00 38.41  ? 681  MET B CA  1 
ATOM   3652 C  C   . MET B 1 309 ? 50.191 -4.998  -30.314 1.00 38.63  ? 681  MET B C   1 
ATOM   3653 O  O   . MET B 1 309 ? 51.146 -4.630  -29.636 1.00 39.46  ? 681  MET B O   1 
ATOM   3654 C  CB  . MET B 1 309 ? 50.443 -6.376  -32.355 1.00 39.09  ? 681  MET B CB  1 
ATOM   3655 C  CG  . MET B 1 309 ? 51.939 -6.323  -32.638 1.00 45.72  ? 681  MET B CG  1 
ATOM   3656 S  SD  . MET B 1 309 ? 52.784 -7.903  -32.273 1.00 53.46  ? 681  MET B SD  1 
ATOM   3657 C  CE  . MET B 1 309 ? 51.788 -9.007  -33.261 1.00 51.12  ? 681  MET B CE  1 
ATOM   3658 N  N   . GLU B 1 310 ? 49.150 -4.221  -30.591 1.00 38.18  ? 682  GLU B N   1 
ATOM   3659 C  CA  . GLU B 1 310 ? 49.061 -2.848  -30.123 1.00 39.21  ? 682  GLU B CA  1 
ATOM   3660 C  C   . GLU B 1 310 ? 49.038 -2.724  -28.597 1.00 39.05  ? 682  GLU B C   1 
ATOM   3661 O  O   . GLU B 1 310 ? 49.545 -1.745  -28.050 1.00 40.36  ? 682  GLU B O   1 
ATOM   3662 C  CB  . GLU B 1 310 ? 47.857 -2.152  -30.749 1.00 39.09  ? 682  GLU B CB  1 
ATOM   3663 C  CG  . GLU B 1 310 ? 48.059 -1.850  -32.227 1.00 41.34  ? 682  GLU B CG  1 
ATOM   3664 C  CD  . GLU B 1 310 ? 46.777 -1.404  -32.927 1.00 44.15  ? 682  GLU B CD  1 
ATOM   3665 O  OE1 . GLU B 1 310 ? 45.683 -1.520  -32.323 1.00 44.06  ? 682  GLU B OE1 1 
ATOM   3666 O  OE2 . GLU B 1 310 ? 46.870 -0.957  -34.091 1.00 45.16  ? 682  GLU B OE2 1 
ATOM   3667 N  N   . THR B 1 311 ? 48.477 -3.719  -27.916 1.00 37.26  ? 683  THR B N   1 
ATOM   3668 C  CA  . THR B 1 311 ? 48.493 -3.741  -26.457 1.00 37.56  ? 683  THR B CA  1 
ATOM   3669 C  C   . THR B 1 311 ? 49.716 -4.498  -25.915 1.00 37.99  ? 683  THR B C   1 
ATOM   3670 O  O   . THR B 1 311 ? 49.828 -4.750  -24.698 1.00 38.36  ? 683  THR B O   1 
ATOM   3671 C  CB  . THR B 1 311 ? 47.229 -4.418  -25.917 1.00 37.07  ? 683  THR B CB  1 
ATOM   3672 O  OG1 . THR B 1 311 ? 47.107 -5.713  -26.526 1.00 37.64  ? 683  THR B OG1 1 
ATOM   3673 C  CG2 . THR B 1 311 ? 45.965 -3.569  -26.230 1.00 36.03  ? 683  THR B CG2 1 
ATOM   3674 N  N   . ALA B 1 312 ? 50.614 -4.877  -26.824 1.00 37.58  ? 684  ALA B N   1 
ATOM   3675 C  CA  . ALA B 1 312 ? 51.813 -5.648  -26.486 1.00 38.56  ? 684  ALA B CA  1 
ATOM   3676 C  C   . ALA B 1 312 ? 51.520 -6.862  -25.589 1.00 37.85  ? 684  ALA B C   1 
ATOM   3677 O  O   . ALA B 1 312 ? 52.140 -7.043  -24.549 1.00 39.25  ? 684  ALA B O   1 
ATOM   3678 C  CB  . ALA B 1 312 ? 52.908 -4.737  -25.872 1.00 39.31  ? 684  ALA B CB  1 
ATOM   3679 N  N   . ASN B 1 313 ? 50.569 -7.686  -26.002 1.00 36.29  ? 685  ASN B N   1 
ATOM   3680 C  CA  . ASN B 1 313 ? 50.286 -8.930  -25.302 1.00 35.92  ? 685  ASN B CA  1 
ATOM   3681 C  C   . ASN B 1 313 ? 50.882 -10.113 -26.070 1.00 36.49  ? 685  ASN B C   1 
ATOM   3682 O  O   . ASN B 1 313 ? 50.277 -10.599 -27.019 1.00 35.85  ? 685  ASN B O   1 
ATOM   3683 C  CB  . ASN B 1 313 ? 48.774 -9.106  -25.148 1.00 34.42  ? 685  ASN B CB  1 
ATOM   3684 C  CG  . ASN B 1 313 ? 48.410 -10.186 -24.157 1.00 35.54  ? 685  ASN B CG  1 
ATOM   3685 O  OD1 . ASN B 1 313 ? 49.048 -11.243 -24.099 1.00 37.22  ? 685  ASN B OD1 1 
ATOM   3686 N  ND2 . ASN B 1 313 ? 47.376 -9.929  -23.364 1.00 34.77  ? 685  ASN B ND2 1 
ATOM   3687 N  N   . ALA B 1 314 ? 52.066 -10.566 -25.664 1.00 38.05  ? 686  ALA B N   1 
ATOM   3688 C  CA  . ALA B 1 314 ? 52.741 -11.681 -26.341 1.00 39.27  ? 686  ALA B CA  1 
ATOM   3689 C  C   . ALA B 1 314 ? 51.933 -12.998 -26.314 1.00 38.92  ? 686  ALA B C   1 
ATOM   3690 O  O   . ALA B 1 314 ? 51.903 -13.731 -27.309 1.00 39.37  ? 686  ALA B O   1 
ATOM   3691 C  CB  . ALA B 1 314 ? 54.167 -11.882 -25.790 1.00 40.59  ? 686  ALA B CB  1 
ATOM   3692 N  N   . ASP B 1 315 ? 51.276 -13.282 -25.190 1.00 38.24  ? 687  ASP B N   1 
ATOM   3693 C  CA  . ASP B 1 315 ? 50.500 -14.519 -25.042 1.00 38.22  ? 687  ASP B CA  1 
ATOM   3694 C  C   . ASP B 1 315 ? 49.313 -14.603 -25.983 1.00 36.06  ? 687  ASP B C   1 
ATOM   3695 O  O   . ASP B 1 315 ? 49.085 -15.643 -26.590 1.00 36.61  ? 687  ASP B O   1 
ATOM   3696 C  CB  . ASP B 1 315 ? 50.007 -14.703 -23.608 1.00 38.37  ? 687  ASP B CB  1 
ATOM   3697 C  CG  . ASP B 1 315 ? 51.133 -14.918 -22.626 1.00 42.38  ? 687  ASP B CG  1 
ATOM   3698 O  OD1 . ASP B 1 315 ? 52.295 -15.159 -23.055 1.00 46.14  ? 687  ASP B OD1 1 
ATOM   3699 O  OD2 . ASP B 1 315 ? 50.846 -14.853 -21.412 1.00 43.55  ? 687  ASP B OD2 1 
ATOM   3700 N  N   . ILE B 1 316 ? 48.552 -13.518 -26.096 1.00 33.87  ? 688  ILE B N   1 
ATOM   3701 C  CA  . ILE B 1 316 ? 47.396 -13.525 -26.995 1.00 32.15  ? 688  ILE B CA  1 
ATOM   3702 C  C   . ILE B 1 316 ? 47.822 -13.488 -28.472 1.00 32.27  ? 688  ILE B C   1 
ATOM   3703 O  O   . ILE B 1 316 ? 47.195 -14.140 -29.303 1.00 32.12  ? 688  ILE B O   1 
ATOM   3704 C  CB  . ILE B 1 316 ? 46.359 -12.441 -26.637 1.00 30.74  ? 688  ILE B CB  1 
ATOM   3705 C  CG1 . ILE B 1 316 ? 45.826 -12.687 -25.220 1.00 30.90  ? 688  ILE B CG1 1 
ATOM   3706 C  CG2 . ILE B 1 316 ? 45.220 -12.420 -27.654 1.00 29.59  ? 688  ILE B CG2 1 
ATOM   3707 C  CD1 . ILE B 1 316 ? 44.712 -11.725 -24.780 1.00 31.72  ? 688  ILE B CD1 1 
ATOM   3708 N  N   . VAL B 1 317 ? 48.894 -12.757 -28.789 1.00 32.42  ? 689  VAL B N   1 
ATOM   3709 C  CA  . VAL B 1 317 ? 49.491 -12.808 -30.136 1.00 33.25  ? 689  VAL B CA  1 
ATOM   3710 C  C   . VAL B 1 317 ? 49.783 -14.258 -30.545 1.00 34.41  ? 689  VAL B C   1 
ATOM   3711 O  O   . VAL B 1 317 ? 49.346 -14.705 -31.600 1.00 34.54  ? 689  VAL B O   1 
ATOM   3712 C  CB  . VAL B 1 317 ? 50.794 -11.953 -30.238 1.00 34.23  ? 689  VAL B CB  1 
ATOM   3713 C  CG1 . VAL B 1 317 ? 51.548 -12.237 -31.534 1.00 34.68  ? 689  VAL B CG1 1 
ATOM   3714 C  CG2 . VAL B 1 317 ? 50.470 -10.466 -30.159 1.00 34.01  ? 689  VAL B CG2 1 
ATOM   3715 N  N   . THR B 1 318 ? 50.502 -14.979 -29.686 1.00 36.12  ? 690  THR B N   1 
ATOM   3716 C  CA  . THR B 1 318 ? 50.938 -16.367 -29.942 1.00 38.38  ? 690  THR B CA  1 
ATOM   3717 C  C   . THR B 1 318 ? 49.716 -17.271 -30.167 1.00 38.39  ? 690  THR B C   1 
ATOM   3718 O  O   . THR B 1 318 ? 49.606 -17.965 -31.186 1.00 38.87  ? 690  THR B O   1 
ATOM   3719 C  CB  . THR B 1 318 ? 51.790 -16.887 -28.755 1.00 39.47  ? 690  THR B CB  1 
ATOM   3720 O  OG1 . THR B 1 318 ? 52.894 -16.003 -28.544 1.00 39.98  ? 690  THR B OG1 1 
ATOM   3721 C  CG2 . THR B 1 318 ? 52.323 -18.310 -28.999 1.00 42.09  ? 690  THR B CG2 1 
ATOM   3722 N  N   . LEU B 1 319 ? 48.789 -17.209 -29.213 1.00 37.44  ? 691  LEU B N   1 
ATOM   3723 C  CA  . LEU B 1 319 ? 47.504 -17.876 -29.296 1.00 37.57  ? 691  LEU B CA  1 
ATOM   3724 C  C   . LEU B 1 319 ? 46.844 -17.653 -30.654 1.00 37.34  ? 691  LEU B C   1 
ATOM   3725 O  O   . LEU B 1 319 ? 46.506 -18.613 -31.353 1.00 38.38  ? 691  LEU B O   1 
ATOM   3726 C  CB  . LEU B 1 319 ? 46.607 -17.330 -28.195 1.00 36.29  ? 691  LEU B CB  1 
ATOM   3727 C  CG  . LEU B 1 319 ? 45.816 -18.293 -27.329 1.00 37.55  ? 691  LEU B CG  1 
ATOM   3728 C  CD1 . LEU B 1 319 ? 46.612 -19.548 -26.931 1.00 40.08  ? 691  LEU B CD1 1 
ATOM   3729 C  CD2 . LEU B 1 319 ? 45.362 -17.493 -26.112 1.00 38.51  ? 691  LEU B CD2 1 
ATOM   3730 N  N   . LEU B 1 320 ? 46.700 -16.389 -31.039 1.00 36.32  ? 692  LEU B N   1 
ATOM   3731 C  CA  . LEU B 1 320 ? 46.030 -16.038 -32.292 1.00 36.69  ? 692  LEU B CA  1 
ATOM   3732 C  C   . LEU B 1 320 ? 46.743 -16.581 -33.526 1.00 39.00  ? 692  LEU B C   1 
ATOM   3733 O  O   . LEU B 1 320 ? 46.112 -17.042 -34.478 1.00 39.44  ? 692  LEU B O   1 
ATOM   3734 C  CB  . LEU B 1 320 ? 45.867 -14.519 -32.402 1.00 35.47  ? 692  LEU B CB  1 
ATOM   3735 C  CG  . LEU B 1 320 ? 44.868 -13.899 -31.425 1.00 34.26  ? 692  LEU B CG  1 
ATOM   3736 C  CD1 . LEU B 1 320 ? 44.967 -12.378 -31.434 1.00 33.36  ? 692  LEU B CD1 1 
ATOM   3737 C  CD2 . LEU B 1 320 ? 43.440 -14.357 -31.725 1.00 34.95  ? 692  LEU B CD2 1 
ATOM   3738 N  N   . ARG B 1 321 ? 48.068 -16.506 -33.503 1.00 41.15  ? 693  ARG B N   1 
ATOM   3739 C  CA  . ARG B 1 321 ? 48.885 -16.982 -34.600 1.00 43.91  ? 693  ARG B CA  1 
ATOM   3740 C  C   . ARG B 1 321 ? 48.832 -18.492 -34.709 1.00 45.92  ? 693  ARG B C   1 
ATOM   3741 O  O   . ARG B 1 321 ? 48.810 -19.032 -35.809 1.00 47.48  ? 693  ARG B O   1 
ATOM   3742 C  CB  . ARG B 1 321 ? 50.324 -16.519 -34.414 1.00 45.23  ? 693  ARG B CB  1 
ATOM   3743 C  CG  . ARG B 1 321 ? 50.622 -15.174 -35.030 1.00 46.25  ? 693  ARG B CG  1 
ATOM   3744 C  CD  . ARG B 1 321 ? 51.188 -15.345 -36.437 1.00 52.17  ? 693  ARG B CD  1 
ATOM   3745 N  NE  . ARG B 1 321 ? 50.168 -15.245 -37.477 1.00 55.71  ? 693  ARG B NE  1 
ATOM   3746 C  CZ  . ARG B 1 321 ? 50.340 -15.623 -38.746 1.00 60.16  ? 693  ARG B CZ  1 
ATOM   3747 N  NH1 . ARG B 1 321 ? 51.493 -16.148 -39.154 1.00 61.50  ? 693  ARG B NH1 1 
ATOM   3748 N  NH2 . ARG B 1 321 ? 49.344 -15.485 -39.619 1.00 62.09  ? 693  ARG B NH2 1 
ATOM   3749 N  N   . LEU B 1 322 ? 48.815 -19.173 -33.567 1.00 46.52  ? 694  LEU B N   1 
ATOM   3750 C  CA  . LEU B 1 322 ? 48.721 -20.633 -33.560 1.00 49.21  ? 694  LEU B CA  1 
ATOM   3751 C  C   . LEU B 1 322 ? 47.346 -21.106 -34.025 1.00 49.30  ? 694  LEU B C   1 
ATOM   3752 O  O   . LEU B 1 322 ? 47.231 -22.157 -34.663 1.00 51.48  ? 694  LEU B O   1 
ATOM   3753 C  CB  . LEU B 1 322 ? 49.042 -21.213 -32.176 1.00 49.14  ? 694  LEU B CB  1 
ATOM   3754 C  CG  . LEU B 1 322 ? 50.502 -21.236 -31.712 1.00 50.89  ? 694  LEU B CG  1 
ATOM   3755 C  CD1 . LEU B 1 322 ? 50.575 -21.863 -30.317 1.00 50.70  ? 694  LEU B CD1 1 
ATOM   3756 C  CD2 . LEU B 1 322 ? 51.406 -21.984 -32.703 1.00 53.55  ? 694  LEU B CD2 1 
ATOM   3757 N  N   . ALA B 1 323 ? 46.309 -20.334 -33.702 1.00 47.62  ? 695  ALA B N   1 
ATOM   3758 C  CA  . ALA B 1 323 ? 44.968 -20.645 -34.179 1.00 48.14  ? 695  ALA B CA  1 
ATOM   3759 C  C   . ALA B 1 323 ? 44.891 -20.460 -35.693 1.00 50.55  ? 695  ALA B C   1 
ATOM   3760 O  O   . ALA B 1 323 ? 44.285 -21.274 -36.384 1.00 51.98  ? 695  ALA B O   1 
ATOM   3761 C  CB  . ALA B 1 323 ? 43.931 -19.805 -33.473 1.00 44.89  ? 695  ALA B CB  1 
ATOM   3762 N  N   . LYS B 1 324 ? 45.519 -19.408 -36.208 1.00 52.05  ? 696  LYS B N   1 
ATOM   3763 C  CA  . LYS B 1 324 ? 45.531 -19.158 -37.645 1.00 55.75  ? 696  LYS B CA  1 
ATOM   3764 C  C   . LYS B 1 324 ? 46.217 -20.309 -38.386 1.00 60.11  ? 696  LYS B C   1 
ATOM   3765 O  O   . LYS B 1 324 ? 45.758 -20.729 -39.457 1.00 61.92  ? 696  LYS B O   1 
ATOM   3766 C  CB  . LYS B 1 324 ? 46.205 -17.816 -37.936 1.00 55.35  ? 696  LYS B CB  1 
ATOM   3767 C  CG  . LYS B 1 324 ? 46.403 -17.482 -39.409 1.00 58.95  ? 696  LYS B CG  1 
ATOM   3768 C  CD  . LYS B 1 324 ? 45.379 -16.482 -39.959 1.00 60.37  ? 696  LYS B CD  1 
ATOM   3769 C  CE  . LYS B 1 324 ? 45.916 -15.873 -41.269 1.00 63.45  ? 696  LYS B CE  1 
ATOM   3770 N  NZ  . LYS B 1 324 ? 44.977 -14.958 -41.976 1.00 63.51  ? 696  LYS B NZ  1 
ATOM   3771 N  N   . MET B 1 325 ? 47.295 -20.833 -37.801 1.00 62.68  ? 697  MET B N   1 
ATOM   3772 C  CA  . MET B 1 325 ? 48.041 -21.930 -38.410 1.00 67.64  ? 697  MET B CA  1 
ATOM   3773 C  C   . MET B 1 325 ? 47.215 -23.210 -38.412 1.00 69.30  ? 697  MET B C   1 
ATOM   3774 O  O   . MET B 1 325 ? 47.150 -23.901 -39.427 1.00 71.67  ? 697  MET B O   1 
ATOM   3775 C  CB  . MET B 1 325 ? 49.381 -22.164 -37.698 1.00 68.99  ? 697  MET B CB  1 
ATOM   3776 C  CG  . MET B 1 325 ? 50.378 -21.003 -37.752 1.00 70.64  ? 697  MET B CG  1 
ATOM   3777 S  SD  . MET B 1 325 ? 50.932 -20.544 -39.412 1.00 78.90  ? 697  MET B SD  1 
ATOM   3778 C  CE  . MET B 1 325 ? 49.785 -19.213 -39.790 1.00 74.45  ? 697  MET B CE  1 
ATOM   3779 N  N   . ARG B 1 326 ? 46.580 -23.507 -37.278 1.00 68.52  ? 698  ARG B N   1 
ATOM   3780 C  CA  . ARG B 1 326 ? 45.748 -24.703 -37.130 1.00 70.61  ? 698  ARG B CA  1 
ATOM   3781 C  C   . ARG B 1 326 ? 44.566 -24.691 -38.104 1.00 71.29  ? 698  ARG B C   1 
ATOM   3782 O  O   . ARG B 1 326 ? 44.222 -25.720 -38.691 1.00 73.88  ? 698  ARG B O   1 
ATOM   3783 C  CB  . ARG B 1 326 ? 45.262 -24.853 -35.683 1.00 68.69  ? 698  ARG B CB  1 
ATOM   3784 C  CG  . ARG B 1 326 ? 44.462 -26.127 -35.412 1.00 71.10  ? 698  ARG B CG  1 
ATOM   3785 C  CD  . ARG B 1 326 ? 44.438 -26.512 -33.924 1.00 72.14  ? 698  ARG B CD  1 
ATOM   3786 N  NE  . ARG B 1 326 ? 45.760 -26.906 -33.409 1.00 74.71  ? 698  ARG B NE  1 
ATOM   3787 C  CZ  . ARG B 1 326 ? 46.151 -28.155 -33.152 1.00 76.47  ? 698  ARG B CZ  1 
ATOM   3788 N  NH1 . ARG B 1 326 ? 45.333 -29.185 -33.355 1.00 78.16  ? 698  ARG B NH1 1 
ATOM   3789 N  NH2 . ARG B 1 326 ? 47.370 -28.371 -32.679 1.00 77.24  ? 698  ARG B NH2 1 
ATOM   3790 N  N   . GLU B 1 327 ? 43.968 -23.517 -38.276 1.00 69.83  ? 699  GLU B N   1 
ATOM   3791 C  CA  . GLU B 1 327 ? 42.867 -23.306 -39.216 1.00 70.65  ? 699  GLU B CA  1 
ATOM   3792 C  C   . GLU B 1 327 ? 43.304 -23.537 -40.673 1.00 73.94  ? 699  GLU B C   1 
ATOM   3793 O  O   . GLU B 1 327 ? 42.551 -24.107 -41.471 1.00 75.49  ? 699  GLU B O   1 
ATOM   3794 C  CB  . GLU B 1 327 ? 42.278 -21.913 -38.978 1.00 68.10  ? 699  GLU B CB  1 
ATOM   3795 C  CG  . GLU B 1 327 ? 41.567 -21.222 -40.133 1.00 69.96  ? 699  GLU B CG  1 
ATOM   3796 C  CD  . GLU B 1 327 ? 41.135 -19.805 -39.743 1.00 69.69  ? 699  GLU B CD  1 
ATOM   3797 O  OE1 . GLU B 1 327 ? 40.546 -19.645 -38.642 1.00 67.51  ? 699  GLU B OE1 1 
ATOM   3798 O  OE2 . GLU B 1 327 ? 41.396 -18.853 -40.522 1.00 69.73  ? 699  GLU B OE2 1 
ATOM   3799 N  N   . ALA B 1 328 ? 44.532 -23.123 -40.994 1.00 75.19  ? 700  ALA B N   1 
ATOM   3800 C  CA  . ALA B 1 328 ? 45.125 -23.343 -42.316 1.00 78.62  ? 700  ALA B CA  1 
ATOM   3801 C  C   . ALA B 1 328 ? 45.446 -24.817 -42.553 1.00 82.02  ? 700  ALA B C   1 
ATOM   3802 O  O   . ALA B 1 328 ? 45.798 -25.210 -43.674 1.00 85.21  ? 700  ALA B O   1 
ATOM   3803 C  CB  . ALA B 1 328 ? 46.379 -22.493 -42.484 1.00 78.78  ? 700  ALA B CB  1 
ATOM   3804 N  N   . GLU B 1 329 ? 45.323 -25.613 -41.484 1.00 81.58  ? 701  GLU B N   1 
ATOM   3805 C  CA  . GLU B 1 329 ? 45.560 -27.062 -41.528 1.00 84.96  ? 701  GLU B CA  1 
ATOM   3806 C  C   . GLU B 1 329 ? 47.052 -27.383 -41.419 1.00 87.38  ? 701  GLU B C   1 
ATOM   3807 O  O   . GLU B 1 329 ? 47.598 -27.401 -40.312 1.00 86.33  ? 701  GLU B O   1 
ATOM   3808 C  CB  . GLU B 1 329 ? 44.960 -27.708 -42.788 1.00 88.11  ? 701  GLU B CB  1 
ATOM   3809 C  CG  . GLU B 1 329 ? 43.660 -28.452 -42.532 1.00 87.49  ? 701  GLU B CG  1 
ATOM   3810 C  CD  . GLU B 1 329 ? 42.473 -27.529 -42.342 1.00 84.04  ? 701  GLU B CD  1 
ATOM   3811 O  OE1 . GLU B 1 329 ? 42.046 -27.330 -41.179 1.00 80.80  ? 701  GLU B OE1 1 
ATOM   3812 O  OE2 . GLU B 1 329 ? 41.972 -26.998 -43.355 1.00 84.47  ? 701  GLU B OE2 1 
HETATM 3813 ZN ZN  . ZN  C 2 .   ? 34.308 -38.700 7.664   1.00 38.50  ? 999  ZN  A ZN  1 
HETATM 3814 S  S   . SO4 D 3 .   ? 39.191 -69.473 -2.776  1.00 117.60 ? 1133 SO4 A S   1 
HETATM 3815 O  O1  . SO4 D 3 .   ? 40.500 -69.988 -2.387  1.00 121.67 ? 1133 SO4 A O1  1 
HETATM 3816 O  O2  . SO4 D 3 .   ? 38.997 -69.548 -4.217  1.00 113.66 ? 1133 SO4 A O2  1 
HETATM 3817 O  O3  . SO4 D 3 .   ? 38.193 -70.270 -2.074  1.00 120.81 ? 1133 SO4 A O3  1 
HETATM 3818 O  O4  . SO4 D 3 .   ? 39.077 -68.068 -2.404  1.00 114.60 ? 1133 SO4 A O4  1 
HETATM 3819 S  S   . SO4 E 3 .   ? 28.052 -35.954 -0.567  1.00 101.14 ? 1135 SO4 A S   1 
HETATM 3820 O  O1  . SO4 E 3 .   ? 29.486 -35.740 -0.726  1.00 101.18 ? 1135 SO4 A O1  1 
HETATM 3821 O  O2  . SO4 E 3 .   ? 27.363 -35.703 -1.826  1.00 99.28  ? 1135 SO4 A O2  1 
HETATM 3822 O  O3  . SO4 E 3 .   ? 27.808 -37.332 -0.150  1.00 102.33 ? 1135 SO4 A O3  1 
HETATM 3823 O  O4  . SO4 E 3 .   ? 27.541 -35.006 0.416   1.00 102.56 ? 1135 SO4 A O4  1 
HETATM 3824 ZN ZN  . ZN  F 2 .   ? 15.736 -39.464 -13.014 1.00 37.55  ? 999  ZN  B ZN  1 
HETATM 3825 S  S   . SO4 G 3 .   ? 13.396 -8.191  -22.984 1.00 11.80  ? 1134 SO4 B S   1 
HETATM 3826 O  O1  . SO4 G 3 .   ? 13.849 -8.063  -24.361 1.00 12.07  ? 1134 SO4 B O1  1 
HETATM 3827 O  O2  . SO4 G 3 .   ? 12.008 -7.778  -22.860 1.00 11.14  ? 1134 SO4 B O2  1 
HETATM 3828 O  O3  . SO4 G 3 .   ? 13.523 -9.595  -22.633 1.00 13.56  ? 1134 SO4 B O3  1 
HETATM 3829 O  O4  . SO4 G 3 .   ? 14.232 -7.389  -22.103 1.00 11.71  ? 1134 SO4 B O4  1 
HETATM 3830 O  O   . HOH H 4 .   ? 42.386 -51.915 5.005   1.00 23.25  ? 1000 HOH A O   1 
HETATM 3831 O  O   . HOH H 4 .   ? 26.717 -65.369 -5.668  1.00 31.47  ? 1002 HOH A O   1 
HETATM 3832 O  O   . HOH H 4 .   ? 37.439 -66.082 -4.416  1.00 34.56  ? 1004 HOH A O   1 
HETATM 3833 O  O   . HOH H 4 .   ? 36.797 -65.291 9.927   1.00 51.28  ? 1005 HOH A O   1 
HETATM 3834 O  O   . HOH H 4 .   ? 28.461 -44.378 17.620  1.00 35.14  ? 1007 HOH A O   1 
HETATM 3835 O  O   . HOH H 4 .   ? 26.998 -36.198 7.573   1.00 32.64  ? 1008 HOH A O   1 
HETATM 3836 O  O   . HOH H 4 .   ? 24.147 -67.554 -7.984  1.00 26.76  ? 1009 HOH A O   1 
HETATM 3837 O  O   . HOH H 4 .   ? 7.212  -73.407 -4.422  1.00 41.31  ? 1010 HOH A O   1 
HETATM 3838 O  O   . HOH H 4 .   ? 32.496 -45.768 14.885  1.00 32.81  ? 1013 HOH A O   1 
HETATM 3839 O  O   . HOH H 4 .   ? 11.465 -65.861 1.272   1.00 40.56  ? 1014 HOH A O   1 
HETATM 3840 O  O   . HOH H 4 .   ? 22.073 -40.066 -3.084  1.00 24.61  ? 1015 HOH A O   1 
HETATM 3841 O  O   . HOH H 4 .   ? 41.098 -57.623 8.358   1.00 28.62  ? 1017 HOH A O   1 
HETATM 3842 O  O   . HOH H 4 .   ? 28.887 -52.454 13.806  1.00 30.81  ? 1019 HOH A O   1 
HETATM 3843 O  O   . HOH H 4 .   ? 26.085 -45.628 -6.239  1.00 35.41  ? 1022 HOH A O   1 
HETATM 3844 O  O   . HOH H 4 .   ? 16.411 -40.287 -3.536  1.00 36.28  ? 1024 HOH A O   1 
HETATM 3845 O  O   . HOH H 4 .   ? 22.055 -37.024 3.776   1.00 35.03  ? 1028 HOH A O   1 
HETATM 3846 O  O   . HOH H 4 .   ? 28.144 -38.669 17.847  1.00 30.54  ? 1029 HOH A O   1 
HETATM 3847 O  O   . HOH H 4 .   ? 25.298 -49.793 9.099   1.00 35.23  ? 1030 HOH A O   1 
HETATM 3848 O  O   . HOH H 4 .   ? 17.799 -66.244 -10.803 1.00 31.86  ? 1032 HOH A O   1 
HETATM 3849 O  O   . HOH H 4 .   ? 36.934 -55.188 -2.752  1.00 54.35  ? 1034 HOH A O   1 
HETATM 3850 O  O   . HOH H 4 .   ? 22.154 -36.257 11.767  1.00 40.32  ? 1037 HOH A O   1 
HETATM 3851 O  O   . HOH H 4 .   ? 32.296 -67.441 -11.271 1.00 53.69  ? 1039 HOH A O   1 
HETATM 3852 O  O   . HOH H 4 .   ? 45.599 -56.468 2.239   1.00 46.81  ? 1041 HOH A O   1 
HETATM 3853 O  O   . HOH H 4 .   ? 34.738 -34.653 -0.012  1.00 35.45  ? 1043 HOH A O   1 
HETATM 3854 O  O   . HOH H 4 .   ? 22.934 -59.407 -11.484 1.00 30.40  ? 1044 HOH A O   1 
HETATM 3855 O  O   . HOH H 4 .   ? 36.006 -59.400 -2.850  1.00 34.47  ? 1045 HOH A O   1 
HETATM 3856 O  O   . HOH H 4 .   ? 35.682 -51.709 15.357  1.00 46.59  ? 1046 HOH A O   1 
HETATM 3857 O  O   . HOH H 4 .   ? 39.573 -40.511 14.316  1.00 40.39  ? 1048 HOH A O   1 
HETATM 3858 O  O   . HOH H 4 .   ? 15.855 -40.537 7.848   1.00 52.06  ? 1050 HOH A O   1 
HETATM 3859 O  O   . HOH H 4 .   ? 45.882 -40.447 5.997   1.00 36.47  ? 1053 HOH A O   1 
HETATM 3860 O  O   . HOH H 4 .   ? 24.815 -62.060 10.621  1.00 43.33  ? 1054 HOH A O   1 
HETATM 3861 O  O   . HOH H 4 .   ? 25.501 -59.476 12.123  1.00 41.51  ? 1056 HOH A O   1 
HETATM 3862 O  O   . HOH H 4 .   ? 22.247 -72.541 2.943   1.00 45.92  ? 1057 HOH A O   1 
HETATM 3863 O  O   . HOH H 4 .   ? 28.458 -64.945 -13.036 1.00 42.69  ? 1058 HOH A O   1 
HETATM 3864 O  O   . HOH H 4 .   ? 24.315 -57.542 -7.781  1.00 26.82  ? 1059 HOH A O   1 
HETATM 3865 O  O   . HOH H 4 .   ? 33.740 -60.393 -5.905  1.00 36.43  ? 1060 HOH A O   1 
HETATM 3866 O  O   . HOH H 4 .   ? 31.504 -44.775 -5.458  1.00 28.53  ? 1061 HOH A O   1 
HETATM 3867 O  O   . HOH H 4 .   ? 18.790 -46.117 -0.121  1.00 43.48  ? 1063 HOH A O   1 
HETATM 3868 O  O   . HOH H 4 .   ? 34.215 -34.305 8.091   1.00 36.69  ? 1065 HOH A O   1 
HETATM 3869 O  O   . HOH H 4 .   ? 28.043 -63.555 13.004  1.00 48.83  ? 1066 HOH A O   1 
HETATM 3870 O  O   . HOH H 4 .   ? 50.584 -57.337 13.088  1.00 61.25  ? 1070 HOH A O   1 
HETATM 3871 O  O   . HOH H 4 .   ? 7.449  -68.292 1.801   1.00 53.47  ? 1072 HOH A O   1 
HETATM 3872 O  O   . HOH H 4 .   ? 53.534 -48.026 4.266   1.00 54.73  ? 1073 HOH A O   1 
HETATM 3873 O  O   . HOH H 4 .   ? 25.714 -65.223 -8.116  1.00 27.30  ? 1074 HOH A O   1 
HETATM 3874 O  O   . HOH H 4 .   ? 39.021 -63.964 10.758  1.00 48.06  ? 1075 HOH A O   1 
HETATM 3875 O  O   . HOH H 4 .   ? 24.482 -40.607 -3.616  1.00 23.24  ? 1077 HOH A O   1 
HETATM 3876 O  O   . HOH H 4 .   ? 34.119 -44.835 13.206  1.00 28.50  ? 1078 HOH A O   1 
HETATM 3877 O  O   . HOH H 4 .   ? 16.982 -66.702 -13.781 1.00 44.16  ? 1080 HOH A O   1 
HETATM 3878 O  O   . HOH H 4 .   ? 23.135 -51.369 -5.670  1.00 38.42  ? 1083 HOH A O   1 
HETATM 3879 O  O   . HOH H 4 .   ? 31.172 -54.504 -3.512  1.00 38.05  ? 1085 HOH A O   1 
HETATM 3880 O  O   . HOH H 4 .   ? 35.198 -70.327 -8.237  1.00 49.82  ? 1086 HOH A O   1 
HETATM 3881 O  O   . HOH H 4 .   ? 33.417 -48.946 -10.158 1.00 53.81  ? 1092 HOH A O   1 
HETATM 3882 O  O   . HOH H 4 .   ? 15.074 -42.579 -3.288  1.00 35.74  ? 1094 HOH A O   1 
HETATM 3883 O  O   . HOH H 4 .   ? 32.187 -58.190 -5.161  1.00 44.42  ? 1097 HOH A O   1 
HETATM 3884 O  O   . HOH H 4 .   ? 25.398 -54.412 13.587  1.00 36.08  ? 1099 HOH A O   1 
HETATM 3885 O  O   . HOH H 4 .   ? -0.263 -72.414 -3.280  1.00 47.98  ? 1100 HOH A O   1 
HETATM 3886 O  O   . HOH H 4 .   ? 38.871 -51.610 14.720  1.00 38.57  ? 1102 HOH A O   1 
HETATM 3887 O  O   . HOH H 4 .   ? 24.857 -69.573 -15.039 1.00 51.62  ? 1103 HOH A O   1 
HETATM 3888 O  O   . HOH H 4 .   ? 40.455 -29.798 3.263   1.00 51.38  ? 1105 HOH A O   1 
HETATM 3889 O  O   . HOH H 4 .   ? 8.840  -66.153 1.643   1.00 55.30  ? 1107 HOH A O   1 
HETATM 3890 O  O   . HOH H 4 .   ? 34.288 -47.998 14.374  1.00 38.75  ? 1112 HOH A O   1 
HETATM 3891 O  O   . HOH H 4 .   ? 33.534 -56.151 2.891   1.00 36.84  ? 1113 HOH A O   1 
HETATM 3892 O  O   . HOH H 4 .   ? 23.633 -44.441 18.721  1.00 53.65  ? 1117 HOH A O   1 
HETATM 3893 O  O   . HOH H 4 .   ? 12.830 -44.556 3.474   1.00 42.79  ? 1118 HOH A O   1 
HETATM 3894 O  O   . HOH H 4 .   ? 25.942 -45.534 18.711  1.00 52.68  ? 1119 HOH A O   1 
HETATM 3895 O  O   . HOH H 4 .   ? 40.003 -56.492 14.404  1.00 47.09  ? 1120 HOH A O   1 
HETATM 3896 O  O   . HOH H 4 .   ? 39.755 -59.685 9.608   1.00 37.07  ? 1121 HOH A O   1 
HETATM 3897 O  O   . HOH H 4 .   ? 17.559 -62.705 6.654   1.00 55.48  ? 1123 HOH A O   1 
HETATM 3898 O  O   . HOH H 4 .   ? 41.480 -68.356 6.414   1.00 53.17  ? 1124 HOH A O   1 
HETATM 3899 O  O   . HOH H 4 .   ? 38.121 -32.953 15.667  1.00 55.07  ? 1125 HOH A O   1 
HETATM 3900 O  O   . HOH H 4 .   ? 19.769 -68.510 -14.308 1.00 37.49  ? 1126 HOH A O   1 
HETATM 3901 O  O   . HOH H 4 .   ? 10.992 -40.388 12.896  1.00 52.18  ? 1128 HOH A O   1 
HETATM 3902 O  O   . HOH H 4 .   ? 16.999 -83.715 -18.473 1.00 41.66  ? 1130 HOH A O   1 
HETATM 3903 O  O   . HOH H 4 .   ? 19.171 -47.344 -2.989  1.00 45.08  ? 1131 HOH A O   1 
HETATM 3904 O  O   . HOH I 4 .   ? 22.727 -42.707 -13.071 1.00 31.20  ? 1001 HOH B O   1 
HETATM 3905 O  O   . HOH I 4 .   ? 25.401 -29.086 -11.263 1.00 36.14  ? 1003 HOH B O   1 
HETATM 3906 O  O   . HOH I 4 .   ? 22.142 -34.155 -2.728  1.00 28.20  ? 1006 HOH B O   1 
HETATM 3907 O  O   . HOH I 4 .   ? 25.537 -13.372 -25.916 1.00 35.31  ? 1011 HOH B O   1 
HETATM 3908 O  O   . HOH I 4 .   ? 27.013 -21.244 -28.407 1.00 29.01  ? 1012 HOH B O   1 
HETATM 3909 O  O   . HOH I 4 .   ? 27.793 -41.994 -16.612 1.00 34.89  ? 1016 HOH B O   1 
HETATM 3910 O  O   . HOH I 4 .   ? 21.948 -26.179 -6.731  1.00 33.77  ? 1018 HOH B O   1 
HETATM 3911 O  O   . HOH I 4 .   ? 28.816 -19.343 -31.401 1.00 38.16  ? 1020 HOH B O   1 
HETATM 3912 O  O   . HOH I 4 .   ? 34.574 -13.265 -31.120 1.00 29.44  ? 1021 HOH B O   1 
HETATM 3913 O  O   . HOH I 4 .   ? 28.302 -11.210 -28.291 1.00 28.48  ? 1023 HOH B O   1 
HETATM 3914 O  O   . HOH I 4 .   ? 24.542 -32.979 -26.751 1.00 42.32  ? 1025 HOH B O   1 
HETATM 3915 O  O   . HOH I 4 .   ? 29.630 -24.419 -26.429 1.00 52.50  ? 1026 HOH B O   1 
HETATM 3916 O  O   . HOH I 4 .   ? 40.028 -21.694 -21.699 1.00 43.19  ? 1027 HOH B O   1 
HETATM 3917 O  O   . HOH I 4 .   ? 40.571 -14.577 -19.041 1.00 39.04  ? 1031 HOH B O   1 
HETATM 3918 O  O   . HOH I 4 .   ? 8.706  -25.704 -15.573 1.00 36.31  ? 1033 HOH B O   1 
HETATM 3919 O  O   . HOH I 4 .   ? 34.126 -30.005 -21.219 1.00 43.72  ? 1035 HOH B O   1 
HETATM 3920 O  O   . HOH I 4 .   ? 25.085 -7.051  -31.038 1.00 37.12  ? 1036 HOH B O   1 
HETATM 3921 O  O   . HOH I 4 .   ? 15.703 -18.374 -23.259 1.00 36.12  ? 1038 HOH B O   1 
HETATM 3922 O  O   . HOH I 4 .   ? 26.496 -13.429 -28.456 1.00 27.94  ? 1040 HOH B O   1 
HETATM 3923 O  O   . HOH I 4 .   ? 14.737 -11.339 -24.857 1.00 43.09  ? 1042 HOH B O   1 
HETATM 3924 O  O   . HOH I 4 .   ? 22.071 -42.806 -21.031 1.00 52.48  ? 1047 HOH B O   1 
HETATM 3925 O  O   . HOH I 4 .   ? 27.613 -9.270  -35.384 1.00 46.24  ? 1049 HOH B O   1 
HETATM 3926 O  O   . HOH I 4 .   ? 11.618 -47.188 -13.622 1.00 39.92  ? 1051 HOH B O   1 
HETATM 3927 O  O   . HOH I 4 .   ? 33.196 -10.652 -12.668 1.00 46.89  ? 1052 HOH B O   1 
HETATM 3928 O  O   . HOH I 4 .   ? 25.441 -24.285 -6.399  1.00 42.57  ? 1055 HOH B O   1 
HETATM 3929 O  O   . HOH I 4 .   ? 33.765 -37.807 -23.962 1.00 30.33  ? 1062 HOH B O   1 
HETATM 3930 O  O   . HOH I 4 .   ? 22.343 -34.097 -25.497 1.00 34.80  ? 1064 HOH B O   1 
HETATM 3931 O  O   . HOH I 4 .   ? 30.329 -2.996  -26.338 1.00 51.97  ? 1067 HOH B O   1 
HETATM 3932 O  O   . HOH I 4 .   ? 30.117 -0.302  -27.435 1.00 56.92  ? 1068 HOH B O   1 
HETATM 3933 O  O   . HOH I 4 .   ? 15.677 -43.819 -12.564 1.00 33.72  ? 1069 HOH B O   1 
HETATM 3934 O  O   . HOH I 4 .   ? 6.350  -46.518 -19.633 1.00 40.50  ? 1071 HOH B O   1 
HETATM 3935 O  O   . HOH I 4 .   ? 21.471 -24.498 -26.968 1.00 59.72  ? 1076 HOH B O   1 
HETATM 3936 O  O   . HOH I 4 .   ? 22.860 -32.588 -0.720  1.00 38.45  ? 1079 HOH B O   1 
HETATM 3937 O  O   . HOH I 4 .   ? 18.009 -32.961 -5.428  1.00 33.63  ? 1081 HOH B O   1 
HETATM 3938 O  O   . HOH I 4 .   ? 14.873 -26.498 -5.221  1.00 39.55  ? 1082 HOH B O   1 
HETATM 3939 O  O   . HOH I 4 .   ? 31.744 -32.803 -20.745 1.00 45.17  ? 1084 HOH B O   1 
HETATM 3940 O  O   . HOH I 4 .   ? 20.157 -24.234 -24.259 1.00 43.16  ? 1087 HOH B O   1 
HETATM 3941 O  O   . HOH I 4 .   ? 43.682 -14.839 -18.641 1.00 56.02  ? 1088 HOH B O   1 
HETATM 3942 O  O   . HOH I 4 .   ? 25.640 -38.018 -23.933 1.00 37.79  ? 1089 HOH B O   1 
HETATM 3943 O  O   . HOH I 4 .   ? 11.519 -29.412 -6.654  1.00 47.30  ? 1090 HOH B O   1 
HETATM 3944 O  O   . HOH I 4 .   ? 12.781 -30.458 -4.677  1.00 32.19  ? 1091 HOH B O   1 
HETATM 3945 O  O   . HOH I 4 .   ? 20.440 -44.649 -12.591 1.00 47.45  ? 1093 HOH B O   1 
HETATM 3946 O  O   . HOH I 4 .   ? 17.697 -21.981 -17.475 1.00 37.72  ? 1095 HOH B O   1 
HETATM 3947 O  O   . HOH I 4 .   ? 30.873 -6.771  -17.072 1.00 48.28  ? 1096 HOH B O   1 
HETATM 3948 O  O   . HOH I 4 .   ? 14.759 -46.869 -10.118 1.00 53.39  ? 1098 HOH B O   1 
HETATM 3949 O  O   . HOH I 4 .   ? 19.649 -31.060 -0.917  1.00 51.48  ? 1101 HOH B O   1 
HETATM 3950 O  O   . HOH I 4 .   ? 17.873 -33.638 -3.019  1.00 34.33  ? 1104 HOH B O   1 
HETATM 3951 O  O   . HOH I 4 .   ? 34.304 -38.744 -12.512 1.00 37.24  ? 1106 HOH B O   1 
HETATM 3952 O  O   . HOH I 4 .   ? 30.892 -31.635 -23.064 1.00 34.41  ? 1108 HOH B O   1 
HETATM 3953 O  O   . HOH I 4 .   ? 10.495 -37.252 -6.659  1.00 49.86  ? 1109 HOH B O   1 
HETATM 3954 O  O   . HOH I 4 .   ? 38.177 -19.999 -33.995 1.00 42.84  ? 1110 HOH B O   1 
HETATM 3955 O  O   . HOH I 4 .   ? 19.077 -15.718 -30.383 1.00 47.17  ? 1111 HOH B O   1 
HETATM 3956 O  O   . HOH I 4 .   ? 25.817 -19.853 -7.617  1.00 40.85  ? 1114 HOH B O   1 
HETATM 3957 O  O   . HOH I 4 .   ? 43.233 -11.267 -17.570 1.00 61.05  ? 1115 HOH B O   1 
HETATM 3958 O  O   . HOH I 4 .   ? 17.988 -17.678 -26.633 1.00 48.08  ? 1116 HOH B O   1 
HETATM 3959 O  O   . HOH I 4 .   ? 15.179 -12.521 -10.188 1.00 57.74  ? 1122 HOH B O   1 
HETATM 3960 O  O   . HOH I 4 .   ? 8.669  -13.822 -17.767 1.00 55.05  ? 1127 HOH B O   1 
HETATM 3961 O  O   . HOH I 4 .   ? 4.297  -37.026 -14.835 1.00 42.27  ? 1129 HOH B O   1 
HETATM 3962 O  O   . HOH I 4 .   ? 19.547 -11.344 -31.337 1.00 48.01  ? 1132 HOH B O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N  N   . VAL A 32  ? 0.6388 1.0900 1.0514 0.0840  0.0871  0.1420  404  VAL A N   
2    C  CA  . VAL A 32  ? 0.6523 1.1275 1.0719 0.1219  0.1028  0.1387  404  VAL A CA  
3    C  C   . VAL A 32  ? 0.6713 1.1540 1.0639 0.1423  0.1445  0.1405  404  VAL A C   
4    O  O   . VAL A 32  ? 0.6972 1.1501 1.0461 0.1730  0.1542  0.1251  404  VAL A O   
5    C  CB  . VAL A 32  ? 0.6491 1.1955 1.1545 0.1279  0.0916  0.1505  404  VAL A CB  
6    C  CG1 . VAL A 32  ? 0.6334 1.1648 1.1503 0.1139  0.0462  0.1439  404  VAL A CG1 
7    C  CG2 . VAL A 32  ? 0.6448 1.2630 1.2230 0.1088  0.1112  0.1747  404  VAL A CG2 
8    N  N   . GLY A 33  ? 0.6636 1.1833 1.0794 0.1253  0.1677  0.1593  405  GLY A N   
9    C  CA  . GLY A 33  ? 0.6746 1.2019 1.0547 0.1421  0.2080  0.1625  405  GLY A CA  
10   C  C   . GLY A 33  ? 0.6740 1.1216 0.9635 0.1494  0.2034  0.1403  405  GLY A C   
11   O  O   . GLY A 33  ? 0.6635 1.0653 0.9258 0.1240  0.1814  0.1370  405  GLY A O   
12   N  N   . HIS A 34  ? 0.6850 1.1153 0.9306 0.1843  0.2221  0.1238  406  HIS A N   
13   C  CA  . HIS A 34  ? 0.6742 1.0270 0.8511 0.1933  0.2051  0.0989  406  HIS A CA  
14   C  C   . HIS A 34  ? 0.6345 0.9377 0.7734 0.1616  0.1858  0.0975  406  HIS A C   
15   O  O   . HIS A 34  ? 0.6418 0.9319 0.7439 0.1521  0.1980  0.1009  406  HIS A O   
16   C  CB  . HIS A 34  ? 0.7255 1.0536 0.8496 0.2291  0.2261  0.0794  406  HIS A CB  
17   C  CG  . HIS A 34  ? 0.7672 1.0527 0.8773 0.2533  0.2083  0.0594  406  HIS A CG  
18   N  ND1 . HIS A 34  ? 0.8001 1.1177 0.9638 0.2718  0.2015  0.0630  406  HIS A ND1 
19   C  CD2 . HIS A 34  ? 0.8154 1.0280 0.8673 0.2607  0.1940  0.0382  406  HIS A CD2 
20   C  CE1 . HIS A 34  ? 0.8259 1.0887 0.9611 0.2907  0.1844  0.0462  406  HIS A CE1 
21   N  NE2 . HIS A 34  ? 0.8518 1.0501 0.9206 0.2829  0.1802  0.0312  406  HIS A NE2 
22   N  N   . VAL A 35  ? 0.5793 0.8585 0.7292 0.1475  0.1552  0.0932  407  VAL A N   
23   C  CA  . VAL A 35  ? 0.5316 0.7720 0.6593 0.1192  0.1345  0.0912  407  VAL A CA  
24   C  C   . VAL A 35  ? 0.5417 0.7275 0.6014 0.1238  0.1380  0.0762  407  VAL A C   
25   O  O   . VAL A 35  ? 0.5368 0.7101 0.5760 0.1065  0.1392  0.0808  407  VAL A O   
26   C  CB  . VAL A 35  ? 0.5094 0.7359 0.6535 0.1112  0.1043  0.0859  407  VAL A CB  
27   C  CG1 . VAL A 35  ? 0.4836 0.6655 0.5961 0.0887  0.0859  0.0786  407  VAL A CG1 
28   C  CG2 . VAL A 35  ? 0.4734 0.7550 0.6864 0.1014  0.0953  0.1003  407  VAL A CG2 
29   N  N   . VAL A 36  ? 0.5494 0.7030 0.5772 0.1475  0.1380  0.0593  408  VAL A N   
30   C  CA  . VAL A 36  ? 0.5601 0.6583 0.5270 0.1509  0.1358  0.0425  408  VAL A CA  
31   C  C   . VAL A 36  ? 0.5895 0.6932 0.5225 0.1571  0.1574  0.0423  408  VAL A C   
32   O  O   . VAL A 36  ? 0.6014 0.6699 0.4922 0.1468  0.1508  0.0353  408  VAL A O   
33   C  CB  . VAL A 36  ? 0.5860 0.6437 0.5300 0.1743  0.1291  0.0250  408  VAL A CB  
34   C  CG1 . VAL A 36  ? 0.6262 0.7027 0.5712 0.2095  0.1507  0.0184  408  VAL A CG1 
35   C  CG2 . VAL A 36  ? 0.5904 0.5883 0.4824 0.1676  0.1180  0.0091  408  VAL A CG2 
36   N  N   . ALA A 37  ? 0.5921 0.7433 0.5443 0.1742  0.1831  0.0510  409  ALA A N   
37   C  CA  . ALA A 37  ? 0.6268 0.7920 0.5449 0.1809  0.2076  0.0550  409  ALA A CA  
38   C  C   . ALA A 37  ? 0.6009 0.7799 0.5273 0.1493  0.2054  0.0773  409  ALA A C   
39   O  O   . ALA A 37  ? 0.6293 0.7833 0.5069 0.1437  0.2057  0.0760  409  ALA A O   
40   C  CB  . ALA A 37  ? 0.6475 0.8701 0.5901 0.2083  0.2403  0.0614  409  ALA A CB  
41   N  N   . GLN A 38  ? 0.5564 0.7724 0.5452 0.1293  0.2001  0.0973  410  GLN A N   
42   C  CA  . GLN A 38  ? 0.5398 0.7672 0.5469 0.0989  0.1960  0.1201  410  GLN A CA  
43   C  C   . GLN A 38  ? 0.5166 0.6896 0.4943 0.0800  0.1682  0.1107  410  GLN A C   
44   O  O   . GLN A 38  ? 0.5246 0.6829 0.4735 0.0690  0.1685  0.1196  410  GLN A O   
45   C  CB  . GLN A 38  ? 0.5142 0.7898 0.5995 0.0824  0.1923  0.1394  410  GLN A CB  
46   C  CG  . GLN A 38  ? 0.5229 0.8011 0.6358 0.0482  0.1809  0.1612  410  GLN A CG  
47   C  CD  . GLN A 38  ? 0.5533 0.8917 0.7436 0.0330  0.1878  0.1865  410  GLN A CD  
48   O  OE1 . GLN A 38  ? 0.5473 0.9270 0.7796 0.0463  0.1940  0.1852  410  GLN A OE1 
49   N  NE2 . GLN A 38  ? 0.5576 0.9009 0.7711 0.0046  0.1850  0.2109  410  GLN A NE2 
50   N  N   . VAL A 39  ? 0.4831 0.6289 0.4676 0.0781  0.1453  0.0940  411  VAL A N   
51   C  CA  . VAL A 39  ? 0.4627 0.5645 0.4266 0.0623  0.1213  0.0841  411  VAL A CA  
52   C  C   . VAL A 39  ? 0.4998 0.5612 0.4030 0.0708  0.1203  0.0696  411  VAL A C   
53   O  O   . VAL A 39  ? 0.4960 0.5354 0.3818 0.0570  0.1083  0.0709  411  VAL A O   
54   C  CB  . VAL A 39  ? 0.4308 0.5190 0.4144 0.0591  0.1009  0.0720  411  VAL A CB  
55   C  CG1 . VAL A 39  ? 0.4106 0.4596 0.3726 0.0459  0.0817  0.0615  411  VAL A CG1 
56   C  CG2 . VAL A 39  ? 0.3956 0.5192 0.4357 0.0469  0.0941  0.0842  411  VAL A CG2 
57   N  N   . GLN A 40  ? 0.5373 0.5883 0.4103 0.0943  0.1306  0.0549  412  GLN A N   
58   C  CA  . GLN A 40  ? 0.5783 0.5910 0.3923 0.1034  0.1279  0.0387  412  GLN A CA  
59   C  C   . GLN A 40  ? 0.6174 0.6419 0.3975 0.1051  0.1423  0.0499  412  GLN A C   
60   O  O   . GLN A 40  ? 0.6530 0.6462 0.3857 0.1053  0.1326  0.0401  412  GLN A O   
61   C  CB  . GLN A 40  ? 0.6074 0.5980 0.3971 0.1290  0.1320  0.0169  412  GLN A CB  
62   C  CG  . GLN A 40  ? 0.5916 0.5470 0.3907 0.1248  0.1111  0.0037  412  GLN A CG  
63   C  CD  . GLN A 40  ? 0.6302 0.5577 0.4089 0.1504  0.1134  -0.0154 412  GLN A CD  
64   O  OE1 . GLN A 40  ? 0.6974 0.6359 0.4582 0.1751  0.1320  -0.0218 412  GLN A OE1 
65   N  NE2 . GLN A 40  ? 0.6117 0.5024 0.3929 0.1455  0.0953  -0.0239 412  GLN A NE2 
66   N  N   . SER A 41  ? 0.6236 0.6943 0.4282 0.1051  0.1643  0.0723  413  SER A N   
67   C  CA  . SER A 41  ? 0.6723 0.7572 0.4411 0.1065  0.1814  0.0886  413  SER A CA  
68   C  C   . SER A 41  ? 0.6654 0.7404 0.4382 0.0800  0.1657  0.1086  413  SER A C   
69   O  O   . SER A 41  ? 0.7026 0.7810 0.4400 0.0787  0.1743  0.1248  413  SER A O   
70   C  CB  . SER A 41  ? 0.6822 0.8250 0.4774 0.1165  0.2151  0.1086  413  SER A CB  
71   O  OG  . SER A 41  ? 0.6659 0.8409 0.5231 0.0910  0.2141  0.1372  413  SER A OG  
72   N  N   . VAL A 42  ? 0.6287 0.6903 0.4420 0.0610  0.1425  0.1072  414  VAL A N   
73   C  CA  . VAL A 42  ? 0.6286 0.6739 0.4503 0.0393  0.1234  0.1206  414  VAL A CA  
74   C  C   . VAL A 42  ? 0.6590 0.6630 0.4300 0.0421  0.1041  0.1051  414  VAL A C   
75   O  O   . VAL A 42  ? 0.6680 0.6495 0.4133 0.0541  0.0973  0.0794  414  VAL A O   
76   C  CB  . VAL A 42  ? 0.5785 0.6222 0.4571 0.0229  0.1049  0.1176  414  VAL A CB  
77   C  CG1 . VAL A 42  ? 0.5698 0.5889 0.4553 0.0055  0.0822  0.1237  414  VAL A CG1 
78   C  CG2 . VAL A 42  ? 0.5520 0.6371 0.4846 0.0162  0.1178  0.1349  414  VAL A CG2 
79   N  N   . ASP A 43  ? 0.6821 0.6759 0.4443 0.0300  0.0927  0.1221  415  ASP A N   
80   C  CA  . ASP A 43  ? 0.7046 0.6648 0.4262 0.0307  0.0703  0.1124  415  ASP A CA  
81   C  C   . ASP A 43  ? 0.6654 0.6002 0.3933 0.0311  0.0491  0.0831  415  ASP A C   
82   O  O   . ASP A 43  ? 0.6312 0.5634 0.4035 0.0196  0.0363  0.0795  415  ASP A O   
83   C  CB  . ASP A 43  ? 0.7213 0.6749 0.4569 0.0152  0.0560  0.1369  415  ASP A CB  
84   C  CG  . ASP A 43  ? 0.7981 0.7274 0.4813 0.0199  0.0381  0.1374  415  ASP A CG  
85   O  OD1 . ASP A 43  ? 0.8723 0.7885 0.5097 0.0332  0.0343  0.1150  415  ASP A OD1 
86   O  OD2 . ASP A 43  ? 0.8141 0.7348 0.5025 0.0106  0.0249  0.1595  415  ASP A OD2 
87   N  N   . GLY A 44  ? 0.6796 0.5961 0.3625 0.0444  0.0464  0.0620  416  GLY A N   
88   C  CA  . GLY A 44  ? 0.6391 0.5306 0.3265 0.0426  0.0265  0.0366  416  GLY A CA  
89   C  C   . GLY A 44  ? 0.5847 0.4798 0.3083 0.0426  0.0328  0.0255  416  GLY A C   
90   O  O   . GLY A 44  ? 0.5635 0.4419 0.3002 0.0369  0.0183  0.0109  416  GLY A O   
91   N  N   . ASN A 45  ? 0.5659 0.4851 0.3071 0.0487  0.0541  0.0344  417  ASN A N   
92   C  CA  . ASN A 45  ? 0.5299 0.4540 0.3042 0.0502  0.0579  0.0267  417  ASN A CA  
93   C  C   . ASN A 45  ? 0.5533 0.4579 0.3024 0.0672  0.0621  0.0074  417  ASN A C   
94   O  O   . ASN A 45  ? 0.5349 0.4358 0.3063 0.0688  0.0612  0.0016  417  ASN A O   
95   C  CB  . ASN A 45  ? 0.5053 0.4656 0.3194 0.0480  0.0729  0.0443  417  ASN A CB  
96   C  CG  . ASN A 45  ? 0.4841 0.4517 0.3402 0.0290  0.0600  0.0536  417  ASN A CG  
97   O  OD1 . ASN A 45  ? 0.4783 0.4281 0.3327 0.0196  0.0435  0.0497  417  ASN A OD1 
98   N  ND2 . ASN A 45  ? 0.4262 0.4203 0.3216 0.0247  0.0662  0.0640  417  ASN A ND2 
99   N  N   . ALA A 46  ? 0.5943 0.4825 0.2939 0.0805  0.0646  -0.0030 418  ALA A N   
100  C  CA  . ALA A 46  ? 0.6324 0.4922 0.3025 0.0986  0.0651  -0.0256 418  ALA A CA  
101  C  C   . ALA A 46  ? 0.6465 0.4630 0.3030 0.0894  0.0388  -0.0447 418  ALA A C   
102  O  O   . ALA A 46  ? 0.6918 0.4752 0.3231 0.1016  0.0338  -0.0650 418  ALA A O   
103  C  CB  . ALA A 46  ? 0.6833 0.5472 0.3032 0.1213  0.0824  -0.0311 418  ALA A CB  
104  N  N   . GLN A 47  ? 0.6183 0.4356 0.2939 0.0686  0.0216  -0.0383 419  GLN A N   
105  C  CA  . GLN A 47  ? 0.6239 0.4132 0.3092 0.0545  -0.0015 -0.0506 419  GLN A CA  
106  C  C   . GLN A 47  ? 0.5634 0.3709 0.3013 0.0389  -0.0012 -0.0385 419  GLN A C   
107  O  O   . GLN A 47  ? 0.5377 0.3740 0.2990 0.0330  0.0045  -0.0235 419  GLN A O   
108  C  CB  . GLN A 47  ? 0.6381 0.4194 0.3054 0.0450  -0.0229 -0.0541 419  GLN A CB  
109  C  CG  . GLN A 47  ? 0.7223 0.4769 0.3291 0.0584  -0.0320 -0.0717 419  GLN A CG  
110  C  CD  . GLN A 47  ? 0.7508 0.5245 0.3194 0.0763  -0.0107 -0.0625 419  GLN A CD  
111  O  OE1 . GLN A 47  ? 0.7439 0.5468 0.3254 0.0707  -0.0029 -0.0401 419  GLN A OE1 
112  N  NE2 . GLN A 47  ? 0.7702 0.5273 0.2933 0.0984  -0.0001 -0.0792 419  GLN A NE2 
113  N  N   . CYS A 48  ? 0.5563 0.3453 0.3105 0.0319  -0.0081 -0.0447 420  CYS A N   
114  C  CA  . CYS A 48  ? 0.5112 0.3178 0.3069 0.0180  -0.0072 -0.0341 420  CYS A CA  
115  C  C   . CYS A 48  ? 0.4881 0.3148 0.3038 0.0048  -0.0164 -0.0290 420  CYS A C   
116  O  O   . CYS A 48  ? 0.4999 0.3165 0.3050 -0.0001 -0.0319 -0.0357 420  CYS A O   
117  C  CB  . CYS A 48  ? 0.5158 0.2977 0.3219 0.0089  -0.0149 -0.0387 420  CYS A CB  
118  S  SG  . CYS A 48  ? 0.4930 0.3013 0.3422 -0.0082 -0.0118 -0.0254 420  CYS A SG  
119  N  N   . CYS A 49  ? 0.4521 0.3053 0.2966 0.0006  -0.0094 -0.0186 421  CYS A N   
120  C  CA  . CYS A 49  ? 0.4350 0.3062 0.3014 -0.0075 -0.0173 -0.0146 421  CYS A CA  
121  C  C   . CYS A 49  ? 0.4340 0.3033 0.3195 -0.0194 -0.0304 -0.0208 421  CYS A C   
122  O  O   . CYS A 49  ? 0.4444 0.3196 0.3386 -0.0231 -0.0440 -0.0220 421  CYS A O   
123  C  CB  . CYS A 49  ? 0.3991 0.2932 0.2919 -0.0082 -0.0087 -0.0072 421  CYS A CB  
124  S  SG  . CYS A 49  ? 0.4059 0.3157 0.3241 -0.0123 -0.0183 -0.0036 421  CYS A SG  
125  N  N   . ASP A 50  ? 0.4251 0.2877 0.3200 -0.0257 -0.0270 -0.0227 422  ASP A N   
126  C  CA  . ASP A 50  ? 0.4180 0.2882 0.3414 -0.0397 -0.0351 -0.0244 422  ASP A CA  
127  C  C   . ASP A 50  ? 0.4485 0.2934 0.3646 -0.0484 -0.0520 -0.0327 422  ASP A C   
128  O  O   . ASP A 50  ? 0.4424 0.2991 0.3868 -0.0606 -0.0644 -0.0344 422  ASP A O   
129  C  CB  . ASP A 50  ? 0.4002 0.2848 0.3440 -0.0449 -0.0210 -0.0173 422  ASP A CB  
130  C  CG  . ASP A 50  ? 0.3859 0.2948 0.3370 -0.0367 -0.0099 -0.0138 422  ASP A CG  
131  O  OD1 . ASP A 50  ? 0.3460 0.2659 0.3036 -0.0319 -0.0151 -0.0159 422  ASP A OD1 
132  O  OD2 . ASP A 50  ? 0.4085 0.3227 0.3580 -0.0353 0.0017  -0.0087 422  ASP A OD2 
133  N  N   . CYS A 51  ? 0.4711 0.2825 0.3518 -0.0412 -0.0538 -0.0394 423  CYS A N   
134  C  CA  . CYS A 51  ? 0.5162 0.2944 0.3862 -0.0490 -0.0727 -0.0514 423  CYS A CA  
135  C  C   . CYS A 51  ? 0.5608 0.3078 0.3798 -0.0339 -0.0810 -0.0659 423  CYS A C   
136  O  O   . CYS A 51  ? 0.6138 0.3272 0.4175 -0.0381 -0.0993 -0.0802 423  CYS A O   
137  C  CB  . CYS A 51  ? 0.5289 0.2855 0.4112 -0.0587 -0.0687 -0.0475 423  CYS A CB  
138  S  SG  . CYS A 51  ? 0.5377 0.2581 0.3812 -0.0386 -0.0568 -0.0505 423  CYS A SG  
139  N  N   . ARG A 52  ? 0.5512 0.3099 0.3448 -0.0166 -0.0673 -0.0623 424  ARG A N   
140  C  CA  . ARG A 52  ? 0.5971 0.3363 0.3386 0.0010  -0.0687 -0.0734 424  ARG A CA  
141  C  C   . ARG A 52  ? 0.6356 0.3379 0.3486 0.0140  -0.0646 -0.0870 424  ARG A C   
142  O  O   . ARG A 52  ? 0.6841 0.3644 0.3503 0.0293  -0.0686 -0.1023 424  ARG A O   
143  C  CB  . ARG A 52  ? 0.6218 0.3533 0.3416 -0.0027 -0.0936 -0.0832 424  ARG A CB  
144  C  CG  . ARG A 52  ? 0.6015 0.3680 0.3485 -0.0104 -0.0984 -0.0688 424  ARG A CG  
145  C  CD  . ARG A 52  ? 0.6589 0.4196 0.3843 -0.0121 -0.1257 -0.0757 424  ARG A CD  
146  N  NE  . ARG A 52  ? 0.7385 0.4841 0.3993 0.0060  -0.1233 -0.0806 424  ARG A NE  
147  C  CZ  . ARG A 52  ? 0.7357 0.4998 0.3771 0.0171  -0.1060 -0.0642 424  ARG A CZ  
148  N  NH1 . ARG A 52  ? 0.6863 0.4795 0.3693 0.0118  -0.0934 -0.0445 424  ARG A NH1 
149  N  NH2 . ARG A 52  ? 0.7843 0.5374 0.3640 0.0336  -0.1010 -0.0678 424  ARG A NH2 
150  N  N   . GLU A 53  ? 0.6174 0.3112 0.3559 0.0096  -0.0573 -0.0816 425  GLU A N   
151  C  CA  . GLU A 53  ? 0.6546 0.3141 0.3723 0.0256  -0.0515 -0.0911 425  GLU A CA  
152  C  C   . GLU A 53  ? 0.6511 0.3283 0.3409 0.0515  -0.0307 -0.0910 425  GLU A C   
153  O  O   . GLU A 53  ? 0.6079 0.3260 0.3160 0.0522  -0.0151 -0.0741 425  GLU A O   
154  C  CB  . GLU A 53  ? 0.6358 0.2930 0.3876 0.0178  -0.0441 -0.0767 425  GLU A CB  
155  C  CG  . GLU A 53  ? 0.6868 0.3112 0.4227 0.0383  -0.0371 -0.0819 425  GLU A CG  
156  C  CD  . GLU A 53  ? 0.8047 0.3690 0.5272 0.0352  -0.0571 -0.0987 425  GLU A CD  
157  O  OE1 . GLU A 53  ? 0.8243 0.3762 0.5703 0.0088  -0.0734 -0.0951 425  GLU A OE1 
158  O  OE2 . GLU A 53  ? 0.8705 0.3999 0.5618 0.0593  -0.0569 -0.1160 425  GLU A OE2 
159  N  N   . PRO A 54  ? 0.7080 0.3554 0.3548 0.0728  -0.0308 -0.1105 426  PRO A N   
160  C  CA  . PRO A 54  ? 0.7134 0.3838 0.3349 0.0986  -0.0076 -0.1098 426  PRO A CA  
161  C  C   . PRO A 54  ? 0.6825 0.3716 0.3318 0.1116  0.0129  -0.0977 426  PRO A C   
162  O  O   . PRO A 54  ? 0.6814 0.3464 0.3500 0.1096  0.0071  -0.0975 426  PRO A O   
163  C  CB  . PRO A 54  ? 0.7933 0.4218 0.3589 0.1201  -0.0144 -0.1388 426  PRO A CB  
164  C  CG  . PRO A 54  ? 0.8223 0.4020 0.3856 0.1032  -0.0455 -0.1554 426  PRO A CG  
165  C  CD  . PRO A 54  ? 0.7708 0.3638 0.3891 0.0727  -0.0543 -0.1357 426  PRO A CD  
166  N  N   . ALA A 55  ? 0.6633 0.3957 0.3152 0.1244  0.0353  -0.0859 427  ALA A N   
167  C  CA  . ALA A 55  ? 0.6364 0.3959 0.3165 0.1395  0.0543  -0.0747 427  ALA A CA  
168  C  C   . ALA A 55  ? 0.5885 0.3582 0.3146 0.1230  0.0487  -0.0580 427  ALA A C   
169  O  O   . ALA A 55  ? 0.6006 0.3589 0.3408 0.1338  0.0495  -0.0569 427  ALA A O   
170  C  CB  . ALA A 55  ? 0.6846 0.4169 0.3421 0.1707  0.0612  -0.0934 427  ALA A CB  
171  N  N   . PRO A 56  ? 0.5470 0.3384 0.2943 0.0990  0.0430  -0.0449 428  PRO A N   
172  C  CA  . PRO A 56  ? 0.5126 0.3154 0.2961 0.0855  0.0389  -0.0312 428  PRO A CA  
173  C  C   . PRO A 56  ? 0.5014 0.3392 0.3099 0.0985  0.0522  -0.0193 428  PRO A C   
174  O  O   . PRO A 56  ? 0.4854 0.3582 0.3007 0.1043  0.0649  -0.0133 428  PRO A O   
175  C  CB  . PRO A 56  ? 0.4735 0.2968 0.2707 0.0633  0.0329  -0.0237 428  PRO A CB  
176  C  CG  . PRO A 56  ? 0.4694 0.3094 0.2493 0.0688  0.0402  -0.0236 428  PRO A CG  
177  C  CD  . PRO A 56  ? 0.5291 0.3414 0.2691 0.0876  0.0426  -0.0399 428  PRO A CD  
178  N  N   . GLU A 57  ? 0.5053 0.3347 0.3287 0.1024  0.0482  -0.0141 429  GLU A N   
179  C  CA  . GLU A 57  ? 0.5026 0.3653 0.3523 0.1158  0.0558  -0.0036 429  GLU A CA  
180  C  C   . GLU A 57  ? 0.4589 0.3440 0.3340 0.0997  0.0480  0.0098  429  GLU A C   
181  O  O   . GLU A 57  ? 0.4494 0.3594 0.3471 0.1083  0.0480  0.0185  429  GLU A O   
182  C  CB  . GLU A 57  ? 0.5496 0.3875 0.3948 0.1401  0.0557  -0.0079 429  GLU A CB  
183  C  CG  . GLU A 57  ? 0.6329 0.4587 0.4549 0.1640  0.0671  -0.0241 429  GLU A CG  
184  C  CD  . GLU A 57  ? 0.7289 0.5333 0.5522 0.1938  0.0679  -0.0298 429  GLU A CD  
185  O  OE1 . GLU A 57  ? 0.7476 0.5135 0.5708 0.1916  0.0532  -0.0264 429  GLU A OE1 
186  O  OE2 . GLU A 57  ? 0.7771 0.6040 0.6022 0.2203  0.0842  -0.0365 429  GLU A OE2 
187  N  N   . TRP A 58  ? 0.4376 0.3153 0.3089 0.0782  0.0406  0.0098  430  TRP A N   
188  C  CA  . TRP A 58  ? 0.4131 0.3102 0.3013 0.0648  0.0341  0.0183  430  TRP A CA  
189  C  C   . TRP A 58  ? 0.3875 0.3087 0.2878 0.0508  0.0341  0.0176  430  TRP A C   
190  O  O   . TRP A 58  ? 0.3873 0.3079 0.2809 0.0492  0.0384  0.0138  430  TRP A O   
191  C  CB  . TRP A 58  ? 0.4201 0.2905 0.2965 0.0543  0.0272  0.0207  430  TRP A CB  
192  C  CG  . TRP A 58  ? 0.4514 0.2949 0.3188 0.0675  0.0248  0.0258  430  TRP A CG  
193  C  CD1 . TRP A 58  ? 0.5024 0.3066 0.3544 0.0759  0.0239  0.0193  430  TRP A CD1 
194  C  CD2 . TRP A 58  ? 0.4488 0.2998 0.3215 0.0765  0.0201  0.0379  430  TRP A CD2 
195  N  NE1 . TRP A 58  ? 0.5316 0.3155 0.3816 0.0897  0.0198  0.0278  430  TRP A NE1 
196  C  CE2 . TRP A 58  ? 0.4963 0.3099 0.3584 0.0906  0.0173  0.0408  430  TRP A CE2 
197  C  CE3 . TRP A 58  ? 0.4228 0.3055 0.3063 0.0747  0.0152  0.0457  430  TRP A CE3 
198  C  CZ2 . TRP A 58  ? 0.5430 0.3512 0.4061 0.1035  0.0102  0.0546  430  TRP A CZ2 
199  C  CZ3 . TRP A 58  ? 0.4608 0.3407 0.3420 0.0868  0.0072  0.0580  430  TRP A CZ3 
200  C  CH2 . TRP A 58  ? 0.5056 0.3493 0.3774 0.1013  0.0050  0.0641  430  TRP A CH2 
201  N  N   . ALA A 59  ? 0.3667 0.3073 0.2827 0.0424  0.0281  0.0213  431  ALA A N   
202  C  CA  . ALA A 59  ? 0.3502 0.3079 0.2806 0.0307  0.0256  0.0198  431  ALA A CA  
203  C  C   . ALA A 59  ? 0.3474 0.3102 0.2822 0.0213  0.0173  0.0164  431  ALA A C   
204  O  O   . ALA A 59  ? 0.3563 0.3203 0.2854 0.0245  0.0136  0.0184  431  ALA A O   
205  C  CB  . ALA A 59  ? 0.3400 0.3261 0.2946 0.0339  0.0285  0.0264  431  ALA A CB  
206  N  N   . SER A 60  ? 0.3433 0.3087 0.2861 0.0117  0.0141  0.0113  432  SER A N   
207  C  CA  . SER A 60  ? 0.3386 0.3121 0.2882 0.0063  0.0066  0.0044  432  SER A CA  
208  C  C   . SER A 60  ? 0.3324 0.3189 0.3060 0.0025  -0.0007 0.0047  432  SER A C   
209  O  O   . SER A 60  ? 0.3357 0.3196 0.3188 -0.0019 0.0005  0.0085  432  SER A O   
210  C  CB  . SER A 60  ? 0.3416 0.3074 0.2881 0.0005  0.0075  -0.0029 432  SER A CB  
211  O  OG  . SER A 60  ? 0.3841 0.3589 0.3347 -0.0003 0.0025  -0.0125 432  SER A OG  
212  N  N   . ILE A 61  ? 0.3284 0.3278 0.3118 0.0031  -0.0103 0.0022  433  ILE A N   
213  C  CA  . ILE A 61  ? 0.3212 0.3338 0.3350 -0.0032 -0.0199 0.0046  433  ILE A CA  
214  C  C   . ILE A 61  ? 0.3382 0.3422 0.3637 -0.0110 -0.0327 -0.0074 433  ILE A C   
215  O  O   . ILE A 61  ? 0.3352 0.3423 0.3893 -0.0199 -0.0414 -0.0033 433  ILE A O   
216  C  CB  . ILE A 61  ? 0.3242 0.3577 0.3523 0.0004  -0.0284 0.0086  433  ILE A CB  
217  C  CG1 . ILE A 61  ? 0.3026 0.3347 0.3110 0.0045  -0.0409 -0.0031 433  ILE A CG1 
218  C  CG2 . ILE A 61  ? 0.3125 0.3552 0.3392 0.0108  -0.0155 0.0213  433  ILE A CG2 
219  C  CD1 . ILE A 61  ? 0.2948 0.3483 0.3201 0.0069  -0.0570 -0.0009 433  ILE A CD1 
220  N  N   . ASN A 62  ? 0.3449 0.3387 0.3511 -0.0073 -0.0336 -0.0215 434  ASN A N   
221  C  CA  . ASN A 62  ? 0.3558 0.3380 0.3719 -0.0099 -0.0435 -0.0356 434  ASN A CA  
222  C  C   . ASN A 62  ? 0.3474 0.3181 0.3685 -0.0115 -0.0370 -0.0308 434  ASN A C   
223  O  O   . ASN A 62  ? 0.3583 0.3169 0.3980 -0.0150 -0.0466 -0.0335 434  ASN A O   
224  C  CB  . ASN A 62  ? 0.3821 0.3640 0.3764 -0.0017 -0.0462 -0.0551 434  ASN A CB  
225  C  CG  . ASN A 62  ? 0.3891 0.3759 0.3581 0.0039  -0.0288 -0.0522 434  ASN A CG  
226  O  OD1 . ASN A 62  ? 0.4276 0.4173 0.3869 0.0034  -0.0194 -0.0377 434  ASN A OD1 
227  N  ND2 . ASN A 62  ? 0.4058 0.3934 0.3675 0.0095  -0.0243 -0.0658 434  ASN A ND2 
228  N  N   . LEU A 63  ? 0.3349 0.3066 0.3400 -0.0090 -0.0236 -0.0233 435  LEU A N   
229  C  CA  . LEU A 63  ? 0.3286 0.2911 0.3364 -0.0105 -0.0211 -0.0184 435  LEU A CA  
230  C  C   . LEU A 63  ? 0.3268 0.2868 0.3400 -0.0154 -0.0198 -0.0014 435  LEU A C   
231  O  O   . LEU A 63  ? 0.3452 0.2954 0.3649 -0.0180 -0.0243 0.0044  435  LEU A O   
232  C  CB  . LEU A 63  ? 0.3322 0.2954 0.3224 -0.0079 -0.0110 -0.0189 435  LEU A CB  
233  C  CG  . LEU A 63  ? 0.3409 0.3115 0.3302 -0.0042 -0.0086 -0.0322 435  LEU A CG  
234  C  CD1 . LEU A 63  ? 0.3357 0.3094 0.3116 -0.0058 0.0024  -0.0278 435  LEU A CD1 
235  C  CD2 . LEU A 63  ? 0.3720 0.3403 0.3815 -0.0015 -0.0160 -0.0414 435  LEU A CD2 
236  N  N   . GLY A 64  ? 0.3210 0.2917 0.3313 -0.0151 -0.0129 0.0079  436  GLY A N   
237  C  CA  . GLY A 64  ? 0.3154 0.2912 0.3298 -0.0178 -0.0064 0.0251  436  GLY A CA  
238  C  C   . GLY A 64  ? 0.3162 0.2856 0.3024 -0.0116 0.0046  0.0294  436  GLY A C   
239  O  O   . GLY A 64  ? 0.3261 0.2934 0.3051 -0.0127 0.0085  0.0411  436  GLY A O   
240  N  N   . VAL A 65  ? 0.3139 0.2780 0.2820 -0.0054 0.0083  0.0202  437  VAL A N   
241  C  CA  . VAL A 65  ? 0.3242 0.2751 0.2652 -0.0002 0.0139  0.0189  437  VAL A CA  
242  C  C   . VAL A 65  ? 0.3391 0.2872 0.2658 0.0091  0.0222  0.0168  437  VAL A C   
243  O  O   . VAL A 65  ? 0.3325 0.2869 0.2674 0.0110  0.0217  0.0154  437  VAL A O   
244  C  CB  . VAL A 65  ? 0.3251 0.2626 0.2608 -0.0042 0.0060  0.0094  437  VAL A CB  
245  C  CG1 . VAL A 65  ? 0.2966 0.2336 0.2459 -0.0091 -0.0038 0.0111  437  VAL A CG1 
246  C  CG2 . VAL A 65  ? 0.2997 0.2402 0.2416 -0.0054 0.0063  0.0016  437  VAL A CG2 
247  N  N   . THR A 66  ? 0.3564 0.2913 0.2584 0.0161  0.0274  0.0155  438  THR A N   
248  C  CA  . THR A 66  ? 0.3789 0.3004 0.2639 0.0273  0.0329  0.0106  438  THR A CA  
249  C  C   . THR A 66  ? 0.3953 0.2889 0.2658 0.0227  0.0249  0.0011  438  THR A C   
250  O  O   . THR A 66  ? 0.4072 0.2924 0.2731 0.0143  0.0167  -0.0033 438  THR A O   
251  C  CB  . THR A 66  ? 0.3965 0.3174 0.2608 0.0410  0.0437  0.0111  438  THR A CB  
252  O  OG1 . THR A 66  ? 0.4211 0.3283 0.2613 0.0378  0.0391  0.0075  438  THR A OG1 
253  C  CG2 . THR A 66  ? 0.3704 0.3254 0.2562 0.0444  0.0549  0.0243  438  THR A CG2 
254  N  N   . LEU A 67  ? 0.4063 0.2866 0.2735 0.0275  0.0260  -0.0001 439  LEU A N   
255  C  CA  . LEU A 67  ? 0.4112 0.2672 0.2736 0.0192  0.0191  -0.0039 439  LEU A CA  
256  C  C   . LEU A 67  ? 0.4466 0.2733 0.2927 0.0308  0.0201  -0.0065 439  LEU A C   
257  O  O   . LEU A 67  ? 0.4449 0.2785 0.2911 0.0464  0.0270  -0.0031 439  LEU A O   
258  C  CB  . LEU A 67  ? 0.3848 0.2554 0.2650 0.0095  0.0190  0.0028  439  LEU A CB  
259  C  CG  . LEU A 67  ? 0.3547 0.2522 0.2527 0.0023  0.0177  0.0024  439  LEU A CG  
260  C  CD1 . LEU A 67  ? 0.3528 0.2664 0.2597 0.0001  0.0197  0.0063  439  LEU A CD1 
261  C  CD2 . LEU A 67  ? 0.3465 0.2417 0.2508 -0.0080 0.0110  -0.0032 439  LEU A CD2 
262  N  N   . CYS A 68  ? 0.4678 0.2619 0.3042 0.0234  0.0114  -0.0129 440  CYS A N   
263  C  CA  . CYS A 68  ? 0.5096 0.2651 0.3321 0.0322  0.0082  -0.0164 440  CYS A CA  
264  C  C   . CYS A 68  ? 0.5162 0.2678 0.3516 0.0265  0.0090  -0.0013 440  CYS A C   
265  O  O   . CYS A 68  ? 0.4883 0.2695 0.3390 0.0164  0.0129  0.0091  440  CYS A O   
266  C  CB  . CYS A 68  ? 0.5430 0.2615 0.3521 0.0232  -0.0056 -0.0298 440  CYS A CB  
267  S  SG  . CYS A 68  ? 0.5368 0.2550 0.3725 -0.0079 -0.0163 -0.0228 440  CYS A SG  
268  N  N   . ILE A 69  ? 0.5612 0.2736 0.3871 0.0345  0.0047  -0.0002 441  ILE A N   
269  C  CA  . ILE A 69  ? 0.5730 0.2741 0.4050 0.0309  0.0042  0.0181  441  ILE A CA  
270  C  C   . ILE A 69  ? 0.5679 0.2778 0.4135 0.0040  0.0036  0.0291  441  ILE A C   
271  O  O   . ILE A 69  ? 0.5452 0.2835 0.3971 -0.0014 0.0106  0.0436  441  ILE A O   
272  C  CB  . ILE A 69  ? 0.6319 0.2765 0.4521 0.0418  -0.0043 0.0171  441  ILE A CB  
273  C  CG1 . ILE A 69  ? 0.6590 0.2987 0.4677 0.0733  -0.0010 0.0040  441  ILE A CG1 
274  C  CG2 . ILE A 69  ? 0.6448 0.2744 0.4692 0.0363  -0.0060 0.0418  441  ILE A CG2 
275  C  CD1 . ILE A 69  ? 0.6725 0.2551 0.4711 0.0914  -0.0096 0.0016  441  ILE A CD1 
276  N  N   . GLN A 70  ? 0.5834 0.2717 0.4337 -0.0117 -0.0049 0.0212  442  GLN A N   
277  C  CA  . GLN A 70  ? 0.5806 0.2804 0.4524 -0.0382 -0.0050 0.0315  442  GLN A CA  
278  C  C   . GLN A 70  ? 0.5329 0.2879 0.4190 -0.0433 0.0052  0.0329  442  GLN A C   
279  O  O   . GLN A 70  ? 0.5271 0.3052 0.4224 -0.0522 0.0149  0.0481  442  GLN A O   
280  C  CB  . GLN A 70  ? 0.6052 0.2764 0.4848 -0.0531 -0.0204 0.0187  442  GLN A CB  
281  C  CG  . GLN A 70  ? 0.6208 0.2973 0.5310 -0.0822 -0.0218 0.0335  442  GLN A CG  
282  C  CD  . GLN A 70  ? 0.6613 0.2963 0.5818 -0.0986 -0.0425 0.0236  442  GLN A CD  
283  O  OE1 . GLN A 70  ? 0.6661 0.2874 0.5744 -0.0923 -0.0570 0.0001  442  GLN A OE1 
284  N  NE2 . GLN A 70  ? 0.6932 0.3082 0.6359 -0.1212 -0.0450 0.0424  442  GLN A NE2 
285  N  N   . CYS A 71  ? 0.5029 0.2769 0.3884 -0.0366 0.0030  0.0174  443  CYS A N   
286  C  CA  . CYS A 71  ? 0.4626 0.2812 0.3635 -0.0398 0.0096  0.0169  443  CYS A CA  
287  C  C   . CYS A 71  ? 0.4362 0.2797 0.3314 -0.0289 0.0197  0.0238  443  CYS A C   
288  O  O   . CYS A 71  ? 0.4201 0.2940 0.3265 -0.0338 0.0263  0.0263  443  CYS A O   
289  C  CB  . CYS A 71  ? 0.4483 0.2758 0.3499 -0.0363 0.0023  0.0023  443  CYS A CB  
290  S  SG  . CYS A 71  ? 0.4987 0.3072 0.4106 -0.0520 -0.0148 -0.0071 443  CYS A SG  
291  N  N   . SER A 72  ? 0.4304 0.2629 0.3099 -0.0130 0.0198  0.0250  444  SER A N   
292  C  CA  . SER A 72  ? 0.4155 0.2715 0.2920 -0.0040 0.0243  0.0311  444  SER A CA  
293  C  C   . SER A 72  ? 0.4267 0.2835 0.2967 -0.0102 0.0289  0.0466  444  SER A C   
294  O  O   . SER A 72  ? 0.4201 0.3038 0.2873 -0.0093 0.0329  0.0487  444  SER A O   
295  C  CB  . SER A 72  ? 0.4182 0.2683 0.2874 0.0145  0.0223  0.0308  444  SER A CB  
296  O  OG  . SER A 72  ? 0.4826 0.2966 0.3406 0.0211  0.0196  0.0358  444  SER A OG  
297  N  N   . GLY A 73  ? 0.4525 0.2775 0.3175 -0.0164 0.0277  0.0576  445  GLY A N   
298  C  CA  . GLY A 73  ? 0.4819 0.3041 0.3397 -0.0257 0.0337  0.0782  445  GLY A CA  
299  C  C   . GLY A 73  ? 0.4739 0.3302 0.3445 -0.0405 0.0446  0.0792  445  GLY A C   
300  O  O   . GLY A 73  ? 0.4846 0.3632 0.3429 -0.0403 0.0539  0.0896  445  GLY A O   
301  N  N   . ILE A 74  ? 0.4567 0.3195 0.3509 -0.0511 0.0430  0.0674  446  ILE A N   
302  C  CA  . ILE A 74  ? 0.4439 0.3450 0.3587 -0.0615 0.0531  0.0651  446  ILE A CA  
303  C  C   . ILE A 74  ? 0.4165 0.3506 0.3254 -0.0479 0.0569  0.0522  446  ILE A C   
304  O  O   . ILE A 74  ? 0.4209 0.3839 0.3273 -0.0482 0.0692  0.0553  446  ILE A O   
305  C  CB  . ILE A 74  ? 0.4338 0.3352 0.3800 -0.0745 0.0456  0.0550  446  ILE A CB  
306  C  CG1 . ILE A 74  ? 0.4618 0.3296 0.4177 -0.0920 0.0395  0.0671  446  ILE A CG1 
307  C  CG2 . ILE A 74  ? 0.4064 0.3533 0.3806 -0.0808 0.0558  0.0518  446  ILE A CG2 
308  C  CD1 . ILE A 74  ? 0.4571 0.3091 0.4328 -0.1011 0.0224  0.0528  446  ILE A CD1 
309  N  N   . HIS A 75  ? 0.3927 0.3220 0.2989 -0.0362 0.0466  0.0379  447  HIS A N   
310  C  CA  . HIS A 75  ? 0.3792 0.3318 0.2814 -0.0251 0.0462  0.0265  447  HIS A CA  
311  C  C   . HIS A 75  ? 0.3935 0.3557 0.2701 -0.0183 0.0511  0.0343  447  HIS A C   
312  O  O   . HIS A 75  ? 0.3922 0.3771 0.2638 -0.0125 0.0534  0.0243  447  HIS A O   
313  C  CB  . HIS A 75  ? 0.3619 0.3058 0.2654 -0.0159 0.0351  0.0172  447  HIS A CB  
314  C  CG  . HIS A 75  ? 0.3591 0.3051 0.2819 -0.0187 0.0298  0.0064  447  HIS A CG  
315  N  ND1 . HIS A 75  ? 0.3796 0.3126 0.3110 -0.0269 0.0268  0.0065  447  HIS A ND1 
316  C  CD2 . HIS A 75  ? 0.3213 0.2775 0.2548 -0.0143 0.0240  -0.0034 447  HIS A CD2 
317  C  CE1 . HIS A 75  ? 0.3393 0.2773 0.2827 -0.0260 0.0197  -0.0021 447  HIS A CE1 
318  N  NE2 . HIS A 75  ? 0.3413 0.2921 0.2869 -0.0186 0.0188  -0.0068 447  HIS A NE2 
319  N  N   . ARG A 76  ? 0.4165 0.3589 0.2744 -0.0176 0.0506  0.0511  448  ARG A N   
320  C  CA  . ARG A 76  ? 0.4468 0.3967 0.2750 -0.0097 0.0516  0.0607  448  ARG A CA  
321  C  C   . ARG A 76  ? 0.4756 0.4486 0.2923 -0.0160 0.0681  0.0675  448  ARG A C   
322  O  O   . ARG A 76  ? 0.4937 0.4827 0.2817 -0.0077 0.0703  0.0678  448  ARG A O   
323  C  CB  . ARG A 76  ? 0.4722 0.3926 0.2841 -0.0063 0.0462  0.0810  448  ARG A CB  
324  C  CG  . ARG A 76  ? 0.4439 0.3474 0.2639 0.0055  0.0327  0.0752  448  ARG A CG  
325  C  CD  . ARG A 76  ? 0.4602 0.3317 0.2667 0.0116  0.0276  0.0950  448  ARG A CD  
326  N  NE  . ARG A 76  ? 0.4438 0.3003 0.2635 0.0247  0.0187  0.0873  448  ARG A NE  
327  C  CZ  . ARG A 76  ? 0.4357 0.3102 0.2614 0.0394  0.0102  0.0809  448  ARG A CZ  
328  N  NH1 . ARG A 76  ? 0.4408 0.3436 0.2590 0.0421  0.0047  0.0793  448  ARG A NH1 
329  N  NH2 . ARG A 76  ? 0.4582 0.3243 0.2989 0.0516  0.0070  0.0750  448  ARG A NH2 
330  N  N   . SER A 77  ? 0.4839 0.4605 0.3239 -0.0304 0.0792  0.0729  449  SER A N   
331  C  CA  . SER A 77  ? 0.5172 0.5241 0.3586 -0.0381 0.0994  0.0806  449  SER A CA  
332  C  C   . SER A 77  ? 0.4996 0.5420 0.3447 -0.0276 0.1054  0.0572  449  SER A C   
333  O  O   . SER A 77  ? 0.5197 0.5911 0.3500 -0.0250 0.1231  0.0602  449  SER A O   
334  C  CB  . SER A 77  ? 0.5030 0.5085 0.3824 -0.0578 0.1058  0.0900  449  SER A CB  
335  O  OG  . SER A 77  ? 0.5878 0.5756 0.4566 -0.0703 0.1125  0.1191  449  SER A OG  
336  N  N   . LEU A 78  ? 0.4693 0.5078 0.3338 -0.0210 0.0914  0.0347  450  LEU A N   
337  C  CA  . LEU A 78  ? 0.4693 0.5337 0.3460 -0.0113 0.0939  0.0113  450  LEU A CA  
338  C  C   . LEU A 78  ? 0.4938 0.5658 0.3350 0.0047  0.0906  -0.0026 450  LEU A C   
339  O  O   . LEU A 78  ? 0.5023 0.5978 0.3411 0.0148  0.0989  -0.0199 450  LEU A O   
340  C  CB  . LEU A 78  ? 0.4329 0.4854 0.3410 -0.0108 0.0780  -0.0039 450  LEU A CB  
341  C  CG  . LEU A 78  ? 0.4201 0.4600 0.3569 -0.0248 0.0747  0.0056  450  LEU A CG  
342  C  CD1 . LEU A 78  ? 0.3573 0.3841 0.3123 -0.0218 0.0582  -0.0074 450  LEU A CD1 
343  C  CD2 . LEU A 78  ? 0.4111 0.4790 0.3761 -0.0349 0.0901  0.0119  450  LEU A CD2 
344  N  N   . GLY A 79  ? 0.5130 0.5651 0.3275 0.0083  0.0767  0.0031  451  GLY A N   
345  C  CA  . GLY A 79  ? 0.5433 0.5995 0.3260 0.0222  0.0659  -0.0120 451  GLY A CA  
346  C  C   . GLY A 79  ? 0.5269 0.5715 0.3317 0.0262  0.0442  -0.0326 451  GLY A C   
347  O  O   . GLY A 79  ? 0.4958 0.5343 0.3372 0.0207  0.0418  -0.0371 451  GLY A O   
348  N  N   . VAL A 80  ? 0.5570 0.5991 0.3395 0.0348  0.0271  -0.0438 452  VAL A N   
349  C  CA  . VAL A 80  ? 0.5474 0.5778 0.3534 0.0347  0.0039  -0.0565 452  VAL A CA  
350  C  C   . VAL A 80  ? 0.5453 0.5742 0.3780 0.0364  -0.0005 -0.0797 452  VAL A C   
351  O  O   . VAL A 80  ? 0.5278 0.5450 0.3922 0.0309  -0.0137 -0.0820 452  VAL A O   
352  C  CB  . VAL A 80  ? 0.5789 0.6089 0.3601 0.0411  -0.0178 -0.0616 452  VAL A CB  
353  C  CG1 . VAL A 80  ? 0.5859 0.6128 0.3539 0.0402  -0.0189 -0.0350 452  VAL A CG1 
354  C  CG2 . VAL A 80  ? 0.6062 0.6460 0.3436 0.0530  -0.0183 -0.0805 452  VAL A CG2 
355  N  N   . HIS A 81  ? 0.5738 0.6150 0.3948 0.0450  0.0120  -0.0948 453  HIS A N   
356  C  CA  . HIS A 81  ? 0.5748 0.6131 0.4236 0.0501  0.0090  -0.1165 453  HIS A CA  
357  C  C   . HIS A 81  ? 0.5230 0.5555 0.4144 0.0402  0.0123  -0.1047 453  HIS A C   
358  O  O   . HIS A 81  ? 0.5185 0.5379 0.4379 0.0408  -0.0002 -0.1154 453  HIS A O   
359  C  CB  . HIS A 81  ? 0.6177 0.6764 0.4492 0.0647  0.0266  -0.1340 453  HIS A CB  
360  C  CG  . HIS A 81  ? 0.6741 0.7275 0.5366 0.0742  0.0215  -0.1578 453  HIS A CG  
361  N  ND1 . HIS A 81  ? 0.7017 0.7678 0.6006 0.0738  0.0349  -0.1532 453  HIS A ND1 
362  C  CD2 . HIS A 81  ? 0.7291 0.7622 0.5955 0.0840  0.0007  -0.1857 453  HIS A CD2 
363  C  CE1 . HIS A 81  ? 0.7212 0.7759 0.6434 0.0855  0.0238  -0.1763 453  HIS A CE1 
364  N  NE2 . HIS A 81  ? 0.7466 0.7784 0.6493 0.0914  0.0033  -0.1965 453  HIS A NE2 
365  N  N   . PHE A 82  ? 0.4918 0.5309 0.3862 0.0311  0.0267  -0.0823 454  PHE A N   
366  C  CA  . PHE A 82  ? 0.4420 0.4745 0.3699 0.0221  0.0269  -0.0725 454  PHE A CA  
367  C  C   . PHE A 82  ? 0.4216 0.4355 0.3534 0.0133  0.0166  -0.0575 454  PHE A C   
368  O  O   . PHE A 82  ? 0.4056 0.4087 0.3598 0.0091  0.0090  -0.0555 454  PHE A O   
369  C  CB  . PHE A 82  ? 0.4346 0.4844 0.3704 0.0167  0.0459  -0.0609 454  PHE A CB  
370  C  CG  . PHE A 82  ? 0.4307 0.5071 0.3755 0.0267  0.0590  -0.0752 454  PHE A CG  
371  C  CD1 . PHE A 82  ? 0.4030 0.4834 0.3828 0.0327  0.0538  -0.0884 454  PHE A CD1 
372  C  CD2 . PHE A 82  ? 0.4367 0.5355 0.3538 0.0324  0.0771  -0.0750 454  PHE A CD2 
373  C  CE1 . PHE A 82  ? 0.4038 0.5123 0.3967 0.0462  0.0669  -0.1036 454  PHE A CE1 
374  C  CE2 . PHE A 82  ? 0.4650 0.5943 0.3901 0.0450  0.0933  -0.0896 454  PHE A CE2 
375  C  CZ  . PHE A 82  ? 0.4437 0.5789 0.4095 0.0529  0.0885  -0.1054 454  PHE A CZ  
376  N  N   . SER A 83  ? 0.4207 0.4321 0.3298 0.0122  0.0169  -0.0463 455  SER A N   
377  C  CA  . SER A 83  ? 0.3985 0.3967 0.3127 0.0072  0.0120  -0.0318 455  SER A CA  
378  C  C   . SER A 83  ? 0.4088 0.4065 0.3036 0.0111  0.0061  -0.0240 455  SER A C   
379  O  O   . SER A 83  ? 0.4204 0.4228 0.2889 0.0144  0.0114  -0.0188 455  SER A O   
380  C  CB  . SER A 83  ? 0.3941 0.3852 0.3119 0.0003  0.0225  -0.0191 455  SER A CB  
381  O  OG  . SER A 83  ? 0.3796 0.3563 0.3041 -0.0016 0.0177  -0.0117 455  SER A OG  
382  N  N   . LYS A 84  ? 0.3948 0.3898 0.3047 0.0111  -0.0047 -0.0212 456  LYS A N   
383  C  CA  . LYS A 84  ? 0.4021 0.4013 0.3045 0.0162  -0.0132 -0.0134 456  LYS A CA  
384  C  C   . LYS A 84  ? 0.3796 0.3714 0.2922 0.0173  -0.0078 0.0009  456  LYS A C   
385  O  O   . LYS A 84  ? 0.3649 0.3587 0.3005 0.0149  -0.0086 0.0015  456  LYS A O   
386  C  CB  . LYS A 84  ? 0.4077 0.4168 0.3277 0.0158  -0.0314 -0.0234 456  LYS A CB  
387  C  CG  . LYS A 84  ? 0.4516 0.4626 0.3596 0.0174  -0.0407 -0.0432 456  LYS A CG  
388  C  CD  . LYS A 84  ? 0.5009 0.5158 0.4336 0.0136  -0.0633 -0.0532 456  LYS A CD  
389  C  CE  . LYS A 84  ? 0.5579 0.5710 0.4690 0.0187  -0.0785 -0.0768 456  LYS A CE  
390  N  NZ  . LYS A 84  ? 0.5821 0.5861 0.4838 0.0224  -0.0678 -0.0926 456  LYS A NZ  
391  N  N   . VAL A 85  ? 0.3822 0.3638 0.2755 0.0217  -0.0019 0.0127  457  VAL A N   
392  C  CA  . VAL A 85  ? 0.3702 0.3371 0.2671 0.0257  0.0040  0.0227  457  VAL A CA  
393  C  C   . VAL A 85  ? 0.3670 0.3430 0.2736 0.0374  -0.0036 0.0297  457  VAL A C   
394  O  O   . VAL A 85  ? 0.3753 0.3589 0.2729 0.0432  -0.0132 0.0342  457  VAL A O   
395  C  CB  . VAL A 85  ? 0.3964 0.3407 0.2721 0.0236  0.0122  0.0322  457  VAL A CB  
396  C  CG1 . VAL A 85  ? 0.3774 0.2983 0.2544 0.0295  0.0151  0.0379  457  VAL A CG1 
397  C  CG2 . VAL A 85  ? 0.3964 0.3407 0.2725 0.0113  0.0202  0.0262  457  VAL A CG2 
398  N  N   . ARG A 86  ? 0.3592 0.3374 0.2842 0.0422  0.0009  0.0309  458  ARG A N   
399  C  CA  . ARG A 86  ? 0.3647 0.3595 0.3085 0.0552  -0.0031 0.0375  458  ARG A CA  
400  C  C   . ARG A 86  ? 0.3758 0.3558 0.3182 0.0660  0.0090  0.0396  458  ARG A C   
401  O  O   . ARG A 86  ? 0.3845 0.3480 0.3166 0.0601  0.0176  0.0341  458  ARG A O   
402  C  CB  . ARG A 86  ? 0.3395 0.3664 0.3174 0.0496  -0.0089 0.0348  458  ARG A CB  
403  C  CG  . ARG A 86  ? 0.3350 0.3728 0.3145 0.0402  -0.0254 0.0276  458  ARG A CG  
404  C  CD  . ARG A 86  ? 0.3356 0.3797 0.3040 0.0500  -0.0395 0.0323  458  ARG A CD  
405  N  NE  . ARG A 86  ? 0.3448 0.3990 0.3083 0.0439  -0.0581 0.0224  458  ARG A NE  
406  C  CZ  . ARG A 86  ? 0.3801 0.4206 0.3079 0.0407  -0.0591 0.0141  458  ARG A CZ  
407  N  NH1 . ARG A 86  ? 0.3965 0.4163 0.2977 0.0401  -0.0422 0.0175  458  ARG A NH1 
408  N  NH2 . ARG A 86  ? 0.3919 0.4412 0.3117 0.0384  -0.0773 0.0015  458  ARG A NH2 
409  N  N   . SER A 87  ? 0.3928 0.3785 0.3449 0.0838  0.0080  0.0461  459  SER A N   
410  C  CA  . SER A 87  ? 0.4117 0.3845 0.3623 0.0999  0.0198  0.0445  459  SER A CA  
411  C  C   . SER A 87  ? 0.3946 0.4044 0.3748 0.1046  0.0298  0.0442  459  SER A C   
412  O  O   . SER A 87  ? 0.3774 0.4252 0.3912 0.1058  0.0241  0.0505  459  SER A O   
413  C  CB  . SER A 87  ? 0.4452 0.4046 0.3938 0.1209  0.0139  0.0517  459  SER A CB  
414  O  OG  . SER A 87  ? 0.4899 0.4425 0.4426 0.1421  0.0252  0.0469  459  SER A OG  
415  N  N   . LEU A 88  ? 0.4017 0.4018 0.3696 0.1067  0.0442  0.0380  460  LEU A N   
416  C  CA  . LEU A 88  ? 0.4052 0.4404 0.3950 0.1140  0.0592  0.0409  460  LEU A CA  
417  C  C   . LEU A 88  ? 0.4252 0.4824 0.4368 0.1409  0.0666  0.0440  460  LEU A C   
418  O  O   . LEU A 88  ? 0.4214 0.5254 0.4685 0.1460  0.0776  0.0516  460  LEU A O   
419  C  CB  . LEU A 88  ? 0.4201 0.4358 0.3794 0.1128  0.0723  0.0333  460  LEU A CB  
420  C  CG  . LEU A 88  ? 0.4134 0.4197 0.3618 0.0885  0.0668  0.0327  460  LEU A CG  
421  C  CD1 . LEU A 88  ? 0.4216 0.4068 0.3349 0.0910  0.0761  0.0253  460  LEU A CD1 
422  C  CD2 . LEU A 88  ? 0.3688 0.4139 0.3539 0.0739  0.0655  0.0445  460  LEU A CD2 
423  N  N   . THR A 89  ? 0.4543 0.4790 0.4488 0.1584  0.0609  0.0396  461  THR A N   
424  C  CA  . THR A 89  ? 0.4894 0.5286 0.5030 0.1895  0.0677  0.0400  461  THR A CA  
425  C  C   . THR A 89  ? 0.4923 0.5447 0.5325 0.1984  0.0496  0.0505  461  THR A C   
426  O  O   . THR A 89  ? 0.4983 0.5870 0.5752 0.2205  0.0530  0.0551  461  THR A O   
427  C  CB  . THR A 89  ? 0.5362 0.5239 0.5120 0.2103  0.0738  0.0256  461  THR A CB  
428  O  OG1 . THR A 89  ? 0.5571 0.4907 0.5031 0.1981  0.0568  0.0248  461  THR A OG1 
429  C  CG2 . THR A 89  ? 0.5430 0.5253 0.4914 0.2084  0.0918  0.0136  461  THR A CG2 
430  N  N   . LEU A 90  ? 0.4873 0.5138 0.5091 0.1825  0.0306  0.0551  462  LEU A N   
431  C  CA  . LEU A 90  ? 0.5013 0.5307 0.5343 0.1926  0.0107  0.0661  462  LEU A CA  
432  C  C   . LEU A 90  ? 0.4767 0.5472 0.5348 0.1763  -0.0062 0.0738  462  LEU A C   
433  O  O   . LEU A 90  ? 0.4970 0.5819 0.5703 0.1873  -0.0244 0.0830  462  LEU A O   
434  C  CB  . LEU A 90  ? 0.5285 0.4980 0.5183 0.1907  0.0005  0.0693  462  LEU A CB  
435  C  CG  . LEU A 90  ? 0.5672 0.4828 0.5293 0.2028  0.0101  0.0602  462  LEU A CG  
436  C  CD1 . LEU A 90  ? 0.6008 0.4625 0.5261 0.1877  0.0001  0.0667  462  LEU A CD1 
437  C  CD2 . LEU A 90  ? 0.5883 0.5005 0.5679 0.2395  0.0120  0.0586  462  LEU A CD2 
438  N  N   . ASP A 91  ? 0.4433 0.5287 0.5040 0.1512  -0.0033 0.0693  463  ASP A N   
439  C  CA  . ASP A 91  ? 0.4250 0.5422 0.5073 0.1346  -0.0218 0.0719  463  ASP A CA  
440  C  C   . ASP A 91  ? 0.4064 0.5766 0.5430 0.1291  -0.0160 0.0743  463  ASP A C   
441  O  O   . ASP A 91  ? 0.3950 0.5723 0.5391 0.1308  0.0066  0.0734  463  ASP A O   
442  C  CB  . ASP A 91  ? 0.4102 0.5024 0.4587 0.1101  -0.0255 0.0643  463  ASP A CB  
443  C  CG  . ASP A 91  ? 0.4243 0.4732 0.4242 0.1111  -0.0305 0.0658  463  ASP A CG  
444  O  OD1 . ASP A 91  ? 0.4284 0.4707 0.4203 0.1257  -0.0424 0.0753  463  ASP A OD1 
445  O  OD2 . ASP A 91  ? 0.3938 0.4172 0.3659 0.0966  -0.0227 0.0596  463  ASP A OD2 
446  N  N   . SER A 92  ? 0.4056 0.6127 0.5790 0.1213  -0.0371 0.0781  464  SER A N   
447  C  CA  . SER A 92  ? 0.3926 0.6496 0.6237 0.1079  -0.0348 0.0828  464  SER A CA  
448  C  C   . SER A 92  ? 0.3760 0.6198 0.5984 0.0797  -0.0323 0.0772  464  SER A C   
449  O  O   . SER A 92  ? 0.3788 0.5860 0.5602 0.0692  -0.0429 0.0671  464  SER A O   
450  C  CB  . SER A 92  ? 0.3958 0.6949 0.6740 0.1067  -0.0633 0.0876  464  SER A CB  
451  O  OG  . SER A 92  ? 0.4339 0.7687 0.7506 0.1322  -0.0586 0.0973  464  SER A OG  
452  N  N   . TRP A 93  ? 0.3596 0.6348 0.6221 0.0689  -0.0176 0.0854  465  TRP A N   
453  C  CA  . TRP A 93  ? 0.3493 0.6114 0.6092 0.0435  -0.0151 0.0842  465  TRP A CA  
454  C  C   . TRP A 93  ? 0.3455 0.6512 0.6715 0.0229  -0.0241 0.0953  465  TRP A C   
455  O  O   . TRP A 93  ? 0.3443 0.6971 0.7183 0.0261  -0.0082 0.1110  465  TRP A O   
456  C  CB  . TRP A 93  ? 0.3432 0.5863 0.5730 0.0472  0.0148  0.0868  465  TRP A CB  
457  C  CG  . TRP A 93  ? 0.3475 0.5404 0.5148 0.0584  0.0191  0.0743  465  TRP A CG  
458  C  CD1 . TRP A 93  ? 0.3667 0.5441 0.5096 0.0813  0.0227  0.0703  465  TRP A CD1 
459  C  CD2 . TRP A 93  ? 0.3343 0.4860 0.4611 0.0464  0.0187  0.0654  465  TRP A CD2 
460  N  NE1 . TRP A 93  ? 0.3754 0.5042 0.4665 0.0808  0.0245  0.0606  465  TRP A NE1 
461  C  CE2 . TRP A 93  ? 0.3436 0.4600 0.4258 0.0601  0.0227  0.0572  465  TRP A CE2 
462  C  CE3 . TRP A 93  ? 0.3139 0.4549 0.4418 0.0257  0.0143  0.0644  465  TRP A CE3 
463  C  CZ2 . TRP A 93  ? 0.3527 0.4309 0.3964 0.0524  0.0230  0.0484  465  TRP A CZ2 
464  C  CZ3 . TRP A 93  ? 0.3094 0.4120 0.3971 0.0219  0.0148  0.0547  465  TRP A CZ3 
465  C  CH2 . TRP A 93  ? 0.3342 0.4091 0.3822 0.0344  0.0194  0.0468  465  TRP A CH2 
466  N  N   . GLU A 94  ? 0.3530 0.6427 0.6826 0.0016  -0.0495 0.0866  466  GLU A N   
467  C  CA  . GLU A 94  ? 0.3559 0.6723 0.7454 -0.0242 -0.0624 0.0954  466  GLU A CA  
468  C  C   . GLU A 94  ? 0.3403 0.6570 0.7377 -0.0363 -0.0348 0.1119  466  GLU A C   
469  O  O   . GLU A 94  ? 0.3315 0.6078 0.6774 -0.0334 -0.0217 0.1065  466  GLU A O   
470  C  CB  . GLU A 94  ? 0.3741 0.6557 0.7480 -0.0402 -0.0957 0.0759  466  GLU A CB  
471  C  CG  . GLU A 94  ? 0.4281 0.7364 0.8647 -0.0618 -0.1269 0.0766  466  GLU A CG  
472  C  CD  . GLU A 94  ? 0.4769 0.8144 0.9302 -0.0506 -0.1525 0.0708  466  GLU A CD  
473  O  OE1 . GLU A 94  ? 0.5194 0.8378 0.9187 -0.0285 -0.1537 0.0603  466  GLU A OE1 
474  O  OE2 . GLU A 94  ? 0.4848 0.8646 1.0067 -0.0645 -0.1726 0.0785  466  GLU A OE2 
475  N  N   . PRO A 95  ? 0.3369 0.7019 0.7995 -0.0499 -0.0259 0.1342  467  PRO A N   
476  C  CA  . PRO A 95  ? 0.3360 0.7050 0.8020 -0.0605 0.0029  0.1552  467  PRO A CA  
477  C  C   . PRO A 95  ? 0.3385 0.6541 0.7748 -0.0796 -0.0062 0.1513  467  PRO A C   
478  O  O   . PRO A 95  ? 0.3419 0.6358 0.7373 -0.0747 0.0159  0.1575  467  PRO A O   
479  C  CB  . PRO A 95  ? 0.3404 0.7737 0.8921 -0.0777 0.0072  0.1811  467  PRO A CB  
480  C  CG  . PRO A 95  ? 0.3427 0.7991 0.9393 -0.0808 -0.0275 0.1701  467  PRO A CG  
481  C  CD  . PRO A 95  ? 0.3351 0.7586 0.8716 -0.0546 -0.0397 0.1439  467  PRO A CD  
482  N  N   . GLU A 96  ? 0.3403 0.6332 0.7947 -0.0985 -0.0403 0.1392  468  GLU A N   
483  C  CA  . GLU A 96  ? 0.3541 0.5908 0.7774 -0.1104 -0.0521 0.1296  468  GLU A CA  
484  C  C   . GLU A 96  ? 0.3358 0.5322 0.6836 -0.0891 -0.0405 0.1127  468  GLU A C   
485  O  O   . GLU A 96  ? 0.3423 0.5063 0.6630 -0.0926 -0.0335 0.1156  468  GLU A O   
486  C  CB  . GLU A 96  ? 0.3706 0.5831 0.8103 -0.1242 -0.0927 0.1078  468  GLU A CB  
487  C  CG  . GLU A 96  ? 0.4316 0.6837 0.9454 -0.1434 -0.1147 0.1160  468  GLU A CG  
488  C  CD  . GLU A 96  ? 0.4615 0.7395 0.9764 -0.1281 -0.1321 0.0994  468  GLU A CD  
489  O  OE1 . GLU A 96  ? 0.4865 0.7306 0.9489 -0.1144 -0.1488 0.0717  468  GLU A OE1 
490  O  OE2 . GLU A 96  ? 0.4604 0.7948 1.0295 -0.1291 -0.1286 0.1158  468  GLU A OE2 
491  N  N   . LEU A 97  ? 0.3153 0.5135 0.6327 -0.0682 -0.0409 0.0964  469  LEU A N   
492  C  CA  . LEU A 97  ? 0.3054 0.4666 0.5588 -0.0517 -0.0334 0.0805  469  LEU A CA  
493  C  C   . LEU A 97  ? 0.3011 0.4632 0.5274 -0.0403 -0.0028 0.0928  469  LEU A C   
494  O  O   . LEU A 97  ? 0.3036 0.4327 0.4906 -0.0379 0.0023  0.0872  469  LEU A O   
495  C  CB  . LEU A 97  ? 0.2990 0.4596 0.5289 -0.0352 -0.0437 0.0637  469  LEU A CB  
496  C  CG  . LEU A 97  ? 0.3010 0.4244 0.4719 -0.0227 -0.0403 0.0475  469  LEU A CG  
497  C  CD1 . LEU A 97  ? 0.3046 0.3953 0.4621 -0.0335 -0.0508 0.0352  469  LEU A CD1 
498  C  CD2 . LEU A 97  ? 0.3139 0.4392 0.4663 -0.0101 -0.0528 0.0365  469  LEU A CD2 
499  N  N   . VAL A 98  ? 0.3050 0.5066 0.5530 -0.0321 0.0164  0.1084  470  VAL A N   
500  C  CA  . VAL A 98  ? 0.3151 0.5201 0.5360 -0.0204 0.0461  0.1192  470  VAL A CA  
501  C  C   . VAL A 98  ? 0.3296 0.5207 0.5475 -0.0376 0.0514  0.1346  470  VAL A C   
502  O  O   . VAL A 98  ? 0.3325 0.4958 0.5035 -0.0313 0.0607  0.1323  470  VAL A O   
503  C  CB  . VAL A 98  ? 0.3195 0.5775 0.5722 -0.0073 0.0682  0.1339  470  VAL A CB  
504  C  CG1 . VAL A 98  ? 0.3309 0.5914 0.5487 0.0059  0.0996  0.1429  470  VAL A CG1 
505  C  CG2 . VAL A 98  ? 0.3084 0.5754 0.5614 0.0138  0.0616  0.1201  470  VAL A CG2 
506  N  N   . LYS A 99  ? 0.3413 0.5496 0.6105 -0.0603 0.0423  0.1509  471  LYS A N   
507  C  CA  . LYS A 99  ? 0.3725 0.5667 0.6443 -0.0782 0.0460  0.1712  471  LYS A CA  
508  C  C   . LYS A 99  ? 0.3734 0.5121 0.6080 -0.0801 0.0272  0.1544  471  LYS A C   
509  O  O   . LYS A 99  ? 0.3835 0.4997 0.5870 -0.0804 0.0346  0.1637  471  LYS A O   
510  C  CB  . LYS A 99  ? 0.3853 0.6043 0.7269 -0.1053 0.0359  0.1927  471  LYS A CB  
511  C  CG  . LYS A 99  ? 0.4256 0.7104 0.8170 -0.1059 0.0571  0.2148  471  LYS A CG  
512  C  CD  . LYS A 99  ? 0.5078 0.8184 0.8813 -0.1001 0.0958  0.2429  471  LYS A CD  
513  C  CE  . LYS A 99  ? 0.5304 0.9146 0.9526 -0.0934 0.1220  0.2607  471  LYS A CE  
514  N  NZ  . LYS A 99  ? 0.5220 0.9199 0.9250 -0.0612 0.1269  0.2351  471  LYS A NZ  
515  N  N   . LEU A 100 ? 0.3632 0.4827 0.5997 -0.0794 0.0031  0.1293  472  LEU A N   
516  C  CA  . LEU A 100 ? 0.3683 0.4422 0.5732 -0.0775 -0.0123 0.1103  472  LEU A CA  
517  C  C   . LEU A 100 ? 0.3630 0.4220 0.5134 -0.0598 0.0030  0.1036  472  LEU A C   
518  O  O   . LEU A 100 ? 0.3684 0.4003 0.4979 -0.0610 0.0004  0.1052  472  LEU A O   
519  C  CB  . LEU A 100 ? 0.3656 0.4275 0.5752 -0.0761 -0.0364 0.0831  472  LEU A CB  
520  C  CG  . LEU A 100 ? 0.3797 0.4013 0.5589 -0.0705 -0.0489 0.0611  472  LEU A CG  
521  C  CD1 . LEU A 100 ? 0.3849 0.3772 0.5797 -0.0832 -0.0604 0.0688  472  LEU A CD1 
522  C  CD2 . LEU A 100 ? 0.3783 0.3946 0.5525 -0.0653 -0.0672 0.0343  472  LEU A CD2 
523  N  N   A MET A 101 ? 0.3515 0.4262 0.4822 -0.0436 0.0159  0.0965  473  MET A N   
524  N  N   B MET A 101 ? 0.3487 0.4231 0.4791 -0.0436 0.0158  0.0963  473  MET A N   
525  C  CA  A MET A 101 ? 0.3579 0.4164 0.4397 -0.0283 0.0282  0.0892  473  MET A CA  
526  C  CA  B MET A 101 ? 0.3526 0.4103 0.4338 -0.0284 0.0280  0.0891  473  MET A CA  
527  C  C   A MET A 101 ? 0.3774 0.4345 0.4400 -0.0290 0.0429  0.1074  473  MET A C   
528  C  C   B MET A 101 ? 0.3744 0.4315 0.4368 -0.0290 0.0430  0.1074  473  MET A C   
529  O  O   A MET A 101 ? 0.3874 0.4194 0.4131 -0.0239 0.0416  0.1015  473  MET A O   
530  O  O   B MET A 101 ? 0.3848 0.4170 0.4100 -0.0237 0.0419  0.1016  473  MET A O   
531  C  CB  A MET A 101 ? 0.3571 0.4302 0.4258 -0.0109 0.0397  0.0819  473  MET A CB  
532  C  CB  B MET A 101 ? 0.3488 0.4196 0.4157 -0.0109 0.0389  0.0808  473  MET A CB  
533  C  CG  A MET A 101 ? 0.3432 0.4176 0.4221 -0.0077 0.0256  0.0674  473  MET A CG  
534  C  CG  B MET A 101 ? 0.3194 0.3856 0.3895 -0.0072 0.0245  0.0641  473  MET A CG  
535  S  SD  A MET A 101 ? 0.3711 0.4092 0.4192 -0.0076 0.0114  0.0464  473  MET A SD  
536  S  SD  B MET A 101 ? 0.3288 0.3575 0.3601 -0.0039 0.0158  0.0444  473  MET A SD  
537  C  CE  A MET A 101 ? 0.3710 0.4055 0.4498 -0.0238 -0.0096 0.0419  473  MET A CE  
538  C  CE  B MET A 101 ? 0.2734 0.2873 0.2652 0.0094  0.0319  0.0437  473  MET A CE  
539  N  N   . CYS A 102 ? 0.3829 0.4700 0.4714 -0.0357 0.0562  0.1306  474  CYS A N   
540  C  CA  . CYS A 102 ? 0.4154 0.5065 0.4828 -0.0367 0.0732  0.1531  474  CYS A CA  
541  C  C   . CYS A 102 ? 0.4353 0.4991 0.5022 -0.0522 0.0597  0.1670  474  CYS A C   
542  O  O   . CYS A 102 ? 0.4608 0.5189 0.4955 -0.0505 0.0697  0.1836  474  CYS A O   
543  C  CB  . CYS A 102 ? 0.4249 0.5640 0.5225 -0.0387 0.0965  0.1770  474  CYS A CB  
544  S  SG  . CYS A 102 ? 0.4353 0.6058 0.5258 -0.0124 0.1163  0.1625  474  CYS A SG  
545  N  N   . GLU A 103 ? 0.4229 0.4676 0.5220 -0.0654 0.0359  0.1600  475  GLU A N   
546  C  CA  . GLU A 103 ? 0.4417 0.4535 0.5420 -0.0764 0.0196  0.1699  475  GLU A CA  
547  C  C   . GLU A 103 ? 0.4289 0.4080 0.4982 -0.0648 0.0047  0.1451  475  GLU A C   
548  O  O   . GLU A 103 ? 0.4486 0.4001 0.5128 -0.0676 -0.0091 0.1501  475  GLU A O   
549  C  CB  . GLU A 103 ? 0.4459 0.4499 0.6006 -0.0960 0.0002  0.1748  475  GLU A CB  
550  C  CG  . GLU A 103 ? 0.4822 0.5213 0.6826 -0.1130 0.0110  0.2017  475  GLU A CG  
551  C  CD  . GLU A 103 ? 0.5582 0.6076 0.7524 -0.1221 0.0299  0.2417  475  GLU A CD  
552  O  OE1 . GLU A 103 ? 0.5813 0.5971 0.7515 -0.1241 0.0224  0.2541  475  GLU A OE1 
553  O  OE2 . GLU A 103 ? 0.5934 0.6881 0.8082 -0.1264 0.0530  0.2623  475  GLU A OE2 
554  N  N   . LEU A 104 ? 0.3966 0.3800 0.4495 -0.0521 0.0068  0.1200  476  LEU A N   
555  C  CA  . LEU A 104 ? 0.3897 0.3496 0.4182 -0.0429 -0.0041 0.0998  476  LEU A CA  
556  C  C   . LEU A 104 ? 0.3944 0.3555 0.3780 -0.0306 0.0083  0.0972  476  LEU A C   
557  O  O   . LEU A 104 ? 0.4189 0.3791 0.3784 -0.0295 0.0152  0.1142  476  LEU A O   
558  C  CB  . LEU A 104 ? 0.3660 0.3239 0.4088 -0.0402 -0.0139 0.0745  476  LEU A CB  
559  C  CG  . LEU A 104 ? 0.3804 0.3269 0.4597 -0.0500 -0.0319 0.0709  476  LEU A CG  
560  C  CD1 . LEU A 104 ? 0.3403 0.2908 0.4258 -0.0454 -0.0389 0.0458  476  LEU A CD1 
561  C  CD2 . LEU A 104 ? 0.3741 0.2920 0.4551 -0.0501 -0.0465 0.0720  476  LEU A CD2 
562  N  N   . GLY A 105 ? 0.3772 0.3381 0.3474 -0.0216 0.0100  0.0767  477  GLY A N   
563  C  CA  . GLY A 105 ? 0.3923 0.3487 0.3219 -0.0106 0.0186  0.0712  477  GLY A CA  
564  C  C   . GLY A 105 ? 0.3913 0.3268 0.3038 -0.0087 0.0044  0.0580  477  GLY A C   
565  O  O   . GLY A 105 ? 0.3894 0.3164 0.3189 -0.0138 -0.0099 0.0575  477  GLY A O   
566  N  N   . ASN A 106 ? 0.4014 0.3290 0.2837 -0.0009 0.0075  0.0467  478  ASN A N   
567  C  CA  . ASN A 106 ? 0.4053 0.3167 0.2766 -0.0010 -0.0065 0.0330  478  ASN A CA  
568  C  C   . ASN A 106 ? 0.4231 0.3256 0.2870 -0.0033 -0.0222 0.0396  478  ASN A C   
569  O  O   . ASN A 106 ? 0.4236 0.3229 0.3067 -0.0066 -0.0371 0.0319  478  ASN A O   
570  C  CB  . ASN A 106 ? 0.4299 0.3291 0.2671 0.0069  -0.0021 0.0214  478  ASN A CB  
571  C  CG  . ASN A 106 ? 0.4214 0.3238 0.2675 0.0109  0.0090  0.0143  478  ASN A CG  
572  O  OD1 . ASN A 106 ? 0.5050 0.3950 0.3262 0.0199  0.0143  0.0060  478  ASN A OD1 
573  N  ND2 . ASN A 106 ? 0.3434 0.2593 0.2221 0.0057  0.0105  0.0163  478  ASN A ND2 
574  N  N   . VAL A 107 ? 0.4337 0.3347 0.2707 -0.0005 -0.0186 0.0553  479  VAL A N   
575  C  CA  . VAL A 107 ? 0.4556 0.3462 0.2809 -0.0014 -0.0358 0.0650  479  VAL A CA  
576  C  C   . VAL A 107 ? 0.4453 0.3358 0.3144 -0.0079 -0.0473 0.0725  479  VAL A C   
577  O  O   . VAL A 107 ? 0.4397 0.3233 0.3219 -0.0071 -0.0666 0.0671  479  VAL A O   
578  C  CB  . VAL A 107 ? 0.5006 0.3899 0.2805 0.0035  -0.0278 0.0843  479  VAL A CB  
579  C  CG1 . VAL A 107 ? 0.5093 0.3880 0.2837 0.0009  -0.0460 0.1042  479  VAL A CG1 
580  C  CG2 . VAL A 107 ? 0.5026 0.3834 0.2316 0.0140  -0.0257 0.0687  479  VAL A CG2 
581  N  N   A ILE A 108 ? 0.4355 0.3336 0.3300 -0.0134 -0.0369 0.0832  480  ILE A N   
582  N  N   B ILE A 108 ? 0.4322 0.3302 0.3270 -0.0134 -0.0371 0.0830  480  ILE A N   
583  C  CA  A ILE A 108 ? 0.4283 0.3201 0.3637 -0.0187 -0.0488 0.0871  480  ILE A CA  
584  C  CA  B ILE A 108 ? 0.4231 0.3144 0.3580 -0.0186 -0.0494 0.0872  480  ILE A CA  
585  C  C   A ILE A 108 ? 0.4008 0.2943 0.3629 -0.0157 -0.0572 0.0624  480  ILE A C   
586  C  C   B ILE A 108 ? 0.3970 0.2906 0.3607 -0.0159 -0.0572 0.0626  480  ILE A C   
587  O  O   A ILE A 108 ? 0.4069 0.2926 0.3877 -0.0124 -0.0734 0.0584  480  ILE A O   
588  O  O   B ILE A 108 ? 0.4033 0.2887 0.3878 -0.0129 -0.0731 0.0586  480  ILE A O   
589  C  CB  A ILE A 108 ? 0.4224 0.3217 0.3827 -0.0275 -0.0384 0.0996  480  ILE A CB  
590  C  CB  B ILE A 108 ? 0.4194 0.3162 0.3775 -0.0278 -0.0400 0.1033  480  ILE A CB  
591  C  CG1 A ILE A 108 ? 0.4622 0.3605 0.4082 -0.0334 -0.0321 0.1314  480  ILE A CG1 
592  C  CG1 B ILE A 108 ? 0.4466 0.3390 0.3870 -0.0327 -0.0367 0.1353  480  ILE A CG1 
593  C  CG2 A ILE A 108 ? 0.4136 0.3024 0.4166 -0.0314 -0.0527 0.0912  480  ILE A CG2 
594  C  CG2 B ILE A 108 ? 0.4107 0.2971 0.4124 -0.0318 -0.0540 0.0951  480  ILE A CG2 
595  C  CD1 A ILE A 108 ? 0.4958 0.3715 0.4335 -0.0329 -0.0505 0.1471  480  ILE A CD1 
596  C  CD1 B ILE A 108 ? 0.4061 0.3139 0.3676 -0.0440 -0.0212 0.1555  480  ILE A CD1 
597  N  N   . ILE A 109 ? 0.3769 0.2826 0.3404 -0.0153 -0.0453 0.0475  481  ILE A N   
598  C  CA  . ILE A 109 ? 0.3650 0.2771 0.3506 -0.0130 -0.0481 0.0272  481  ILE A CA  
599  C  C   . ILE A 109 ? 0.3707 0.2840 0.3556 -0.0097 -0.0579 0.0179  481  ILE A C   
600  O  O   . ILE A 109 ? 0.3763 0.2956 0.3890 -0.0063 -0.0653 0.0077  481  ILE A O   
601  C  CB  . ILE A 109 ? 0.3392 0.2628 0.3225 -0.0139 -0.0336 0.0184  481  ILE A CB  
602  C  CG1 . ILE A 109 ? 0.3407 0.2682 0.3384 -0.0177 -0.0299 0.0250  481  ILE A CG1 
603  C  CG2 . ILE A 109 ? 0.3437 0.2760 0.3392 -0.0116 -0.0328 0.0011  481  ILE A CG2 
604  C  CD1 . ILE A 109 ? 0.3354 0.2549 0.3631 -0.0196 -0.0428 0.0213  481  ILE A CD1 
605  N  N   . ASN A 110 ? 0.3843 0.2933 0.3399 -0.0101 -0.0587 0.0201  482  ASN A N   
606  C  CA  . ASN A 110 ? 0.4024 0.3118 0.3593 -0.0095 -0.0736 0.0134  482  ASN A CA  
607  C  C   . ASN A 110 ? 0.4245 0.3296 0.3944 -0.0053 -0.0940 0.0212  482  ASN A C   
608  O  O   . ASN A 110 ? 0.4258 0.3406 0.4194 -0.0035 -0.1077 0.0132  482  ASN A O   
609  C  CB  . ASN A 110 ? 0.4250 0.3244 0.3430 -0.0106 -0.0741 0.0112  482  ASN A CB  
610  C  CG  . ASN A 110 ? 0.4275 0.3286 0.3441 -0.0140 -0.0611 0.0000  482  ASN A CG  
611  O  OD1 . ASN A 110 ? 0.4000 0.3140 0.3460 -0.0170 -0.0549 -0.0060 482  ASN A OD1 
612  N  ND2 . ASN A 110 ? 0.4252 0.3119 0.3053 -0.0118 -0.0565 -0.0025 482  ASN A ND2 
613  N  N   . GLN A 111 ? 0.4371 0.3295 0.3958 -0.0039 -0.0965 0.0388  483  GLN A N   
614  C  CA  . GLN A 111 ? 0.4687 0.3521 0.4424 0.0013  -0.1171 0.0491  483  GLN A CA  
615  C  C   . GLN A 111 ? 0.4404 0.3317 0.4644 0.0069  -0.1221 0.0360  483  GLN A C   
616  O  O   . GLN A 111 ? 0.4448 0.3369 0.4926 0.0149  -0.1407 0.0352  483  GLN A O   
617  C  CB  . GLN A 111 ? 0.4944 0.3602 0.4499 -0.0007 -0.1167 0.0746  483  GLN A CB  
618  C  CG  . GLN A 111 ? 0.5866 0.4454 0.4902 -0.0004 -0.1194 0.0901  483  GLN A CG  
619  C  CD  . GLN A 111 ? 0.6825 0.5292 0.5659 -0.0042 -0.1132 0.1207  483  GLN A CD  
620  O  OE1 . GLN A 111 ? 0.7248 0.5682 0.5593 -0.0026 -0.1108 0.1358  483  GLN A OE1 
621  N  NE2 . GLN A 111 ? 0.6834 0.5236 0.6034 -0.0097 -0.1105 0.1298  483  GLN A NE2 
622  N  N   . ILE A 112 ? 0.4119 0.3101 0.4500 0.0047  -0.1057 0.0248  484  ILE A N   
623  C  CA  . ILE A 112 ? 0.3878 0.2949 0.4645 0.0121  -0.1058 0.0079  484  ILE A CA  
624  C  C   . ILE A 112 ? 0.3655 0.3003 0.4561 0.0133  -0.0989 -0.0090 484  ILE A C   
625  O  O   . ILE A 112 ? 0.3687 0.3176 0.4894 0.0214  -0.1092 -0.0158 484  ILE A O   
626  C  CB  . ILE A 112 ? 0.3830 0.2837 0.4630 0.0091  -0.0943 0.0031  484  ILE A CB  
627  C  CG1 . ILE A 112 ? 0.4012 0.2757 0.4802 0.0048  -0.1033 0.0221  484  ILE A CG1 
628  C  CG2 . ILE A 112 ? 0.3598 0.2701 0.4693 0.0193  -0.0926 -0.0198 484  ILE A CG2 
629  C  CD1 . ILE A 112 ? 0.3940 0.2656 0.4715 -0.0043 -0.0929 0.0233  484  ILE A CD1 
630  N  N   . TYR A 113 ? 0.3459 0.2896 0.4180 0.0053  -0.0821 -0.0132 485  TYR A N   
631  C  CA  . TYR A 113 ? 0.3318 0.3008 0.4199 0.0037  -0.0717 -0.0259 485  TYR A CA  
632  C  C   . TYR A 113 ? 0.3346 0.3154 0.4309 -0.0014 -0.0817 -0.0252 485  TYR A C   
633  O  O   . TYR A 113 ? 0.3197 0.3255 0.4409 -0.0044 -0.0747 -0.0326 485  TYR A O   
634  C  CB  . TYR A 113 ? 0.3275 0.2979 0.3941 -0.0029 -0.0526 -0.0280 485  TYR A CB  
635  C  CG  . TYR A 113 ? 0.3312 0.3039 0.4022 0.0026  -0.0432 -0.0362 485  TYR A CG  
636  C  CD1 . TYR A 113 ? 0.3506 0.3457 0.4386 0.0083  -0.0327 -0.0496 485  TYR A CD1 
637  C  CD2 . TYR A 113 ? 0.3546 0.3092 0.4125 0.0020  -0.0452 -0.0309 485  TYR A CD2 
638  C  CE1 . TYR A 113 ? 0.3609 0.3556 0.4449 0.0152  -0.0267 -0.0606 485  TYR A CE1 
639  C  CE2 . TYR A 113 ? 0.3536 0.3081 0.4157 0.0059  -0.0419 -0.0407 485  TYR A CE2 
640  C  CZ  . TYR A 113 ? 0.3682 0.3405 0.4394 0.0134  -0.0338 -0.0572 485  TYR A CZ  
641  O  OH  . TYR A 113 ? 0.4018 0.3712 0.4693 0.0187  -0.0333 -0.0700 485  TYR A OH  
642  N  N   . GLU A 114 ? 0.3492 0.3131 0.4241 -0.0033 -0.0982 -0.0156 486  GLU A N   
643  C  CA  . GLU A 114 ? 0.3586 0.3293 0.4373 -0.0090 -0.1139 -0.0168 486  GLU A CA  
644  C  C   . GLU A 114 ? 0.3799 0.3457 0.4652 -0.0009 -0.1396 -0.0095 486  GLU A C   
645  O  O   . GLU A 114 ? 0.3961 0.3587 0.4697 -0.0043 -0.1593 -0.0077 486  GLU A O   
646  C  CB  . GLU A 114 ? 0.3771 0.3280 0.4113 -0.0183 -0.1116 -0.0156 486  GLU A CB  
647  C  CG  . GLU A 114 ? 0.3762 0.3317 0.4107 -0.0265 -0.0908 -0.0217 486  GLU A CG  
648  C  CD  . GLU A 114 ? 0.4469 0.3782 0.4411 -0.0328 -0.0901 -0.0231 486  GLU A CD  
649  O  OE1 . GLU A 114 ? 0.5035 0.4152 0.4622 -0.0292 -0.1023 -0.0211 486  GLU A OE1 
650  O  OE2 . GLU A 114 ? 0.4436 0.3735 0.4389 -0.0395 -0.0771 -0.0260 486  GLU A OE2 
651  N  N   . ALA A 115 ? 0.3772 0.3397 0.4808 0.0104  -0.1418 -0.0057 487  ALA A N   
652  C  CA  . ALA A 115 ? 0.4052 0.3575 0.5151 0.0202  -0.1669 0.0051  487  ALA A CA  
653  C  C   . ALA A 115 ? 0.4159 0.3906 0.5574 0.0232  -0.1906 0.0013  487  ALA A C   
654  O  O   . ALA A 115 ? 0.4411 0.4031 0.5645 0.0263  -0.2155 0.0126  487  ALA A O   
655  C  CB  . ALA A 115 ? 0.4038 0.3481 0.5406 0.0326  -0.1662 0.0057  487  ALA A CB  
656  N  N   . ARG A 116 ? 0.3948 0.4054 0.5842 0.0224  -0.1831 -0.0129 488  ARG A N   
657  C  CA  . ARG A 116 ? 0.4083 0.4500 0.6450 0.0259  -0.2057 -0.0163 488  ARG A CA  
658  C  C   . ARG A 116 ? 0.4147 0.4719 0.6529 0.0080  -0.2124 -0.0210 488  ARG A C   
659  O  O   . ARG A 116 ? 0.4356 0.5225 0.7182 0.0072  -0.2333 -0.0236 488  ARG A O   
660  C  CB  . ARG A 116 ? 0.3879 0.4668 0.6905 0.0402  -0.1961 -0.0272 488  ARG A CB  
661  C  CG  . ARG A 116 ? 0.3875 0.4469 0.6984 0.0615  -0.2008 -0.0254 488  ARG A CG  
662  C  CD  . ARG A 116 ? 0.3551 0.4528 0.7316 0.0806  -0.1938 -0.0403 488  ARG A CD  
663  N  NE  . ARG A 116 ? 0.3716 0.5013 0.7980 0.0886  -0.2199 -0.0382 488  ARG A NE  
664  C  CZ  . ARG A 116 ? 0.3620 0.5445 0.8372 0.0819  -0.2164 -0.0447 488  ARG A CZ  
665  N  NH1 . ARG A 116 ? 0.3141 0.5214 0.7922 0.0672  -0.1855 -0.0521 488  ARG A NH1 
666  N  NH2 . ARG A 116 ? 0.3784 0.5905 0.9029 0.0895  -0.2453 -0.0416 488  ARG A NH2 
667  N  N   . VAL A 117 ? 0.4137 0.4494 0.6062 -0.0061 -0.1975 -0.0221 489  VAL A N   
668  C  CA  . VAL A 117 ? 0.4266 0.4637 0.6126 -0.0242 -0.2048 -0.0276 489  VAL A CA  
669  C  C   . VAL A 117 ? 0.4725 0.5065 0.6544 -0.0264 -0.2441 -0.0273 489  VAL A C   
670  O  O   . VAL A 117 ? 0.4730 0.5317 0.6955 -0.0384 -0.2597 -0.0336 489  VAL A O   
671  C  CB  . VAL A 117 ? 0.4275 0.4288 0.5523 -0.0321 -0.1876 -0.0281 489  VAL A CB  
672  C  CG1 . VAL A 117 ? 0.4453 0.4336 0.5534 -0.0482 -0.2030 -0.0357 489  VAL A CG1 
673  C  CG2 . VAL A 117 ? 0.3857 0.3959 0.5211 -0.0335 -0.1534 -0.0296 489  VAL A CG2 
674  N  N   . GLU A 118 ? 0.5176 0.5224 0.6506 -0.0157 -0.2607 -0.0185 490  GLU A N   
675  C  CA  . GLU A 118 ? 0.5814 0.5786 0.6956 -0.0155 -0.2999 -0.0175 490  GLU A CA  
676  C  C   . GLU A 118 ? 0.5853 0.6226 0.7722 -0.0090 -0.3249 -0.0167 490  GLU A C   
677  O  O   . GLU A 118 ? 0.6058 0.6605 0.8174 -0.0180 -0.3546 -0.0234 490  GLU A O   
678  C  CB  . GLU A 118 ? 0.6212 0.5812 0.6642 -0.0036 -0.3072 -0.0034 490  GLU A CB  
679  C  CG  . GLU A 118 ? 0.7272 0.6701 0.7226 -0.0032 -0.3453 -0.0033 490  GLU A CG  
680  C  CD  . GLU A 118 ? 0.8084 0.7139 0.7181 0.0061  -0.3412 0.0113  490  GLU A CD  
681  O  OE1 . GLU A 118 ? 0.8152 0.7054 0.6945 0.0050  -0.3068 0.0138  490  GLU A OE1 
682  O  OE2 . GLU A 118 ? 0.8567 0.7513 0.7306 0.0145  -0.3719 0.0217  490  GLU A OE2 
683  N  N   . ALA A 119 ? 0.5719 0.6248 0.7973 0.0070  -0.3134 -0.0104 491  ALA A N   
684  C  CA  . ALA A 119 ? 0.5769 0.6694 0.8751 0.0193  -0.3347 -0.0100 491  ALA A CA  
685  C  C   . ALA A 119 ? 0.5505 0.6966 0.9250 0.0079  -0.3241 -0.0222 491  ALA A C   
686  O  O   . ALA A 119 ? 0.5580 0.7435 0.9931 0.0096  -0.3494 -0.0239 491  ALA A O   
687  C  CB  . ALA A 119 ? 0.5672 0.6544 0.8824 0.0422  -0.3248 -0.0026 491  ALA A CB  
688  N  N   . MET A 120 ? 0.5238 0.6735 0.8967 -0.0039 -0.2866 -0.0285 492  MET A N   
689  C  CA  . MET A 120 ? 0.5052 0.7044 0.9439 -0.0182 -0.2715 -0.0353 492  MET A CA  
690  C  C   . MET A 120 ? 0.5298 0.7286 0.9691 -0.0448 -0.2922 -0.0385 492  MET A C   
691  O  O   . MET A 120 ? 0.5211 0.7613 1.0207 -0.0615 -0.2842 -0.0404 492  MET A O   
692  C  CB  . MET A 120 ? 0.4718 0.6721 0.9020 -0.0211 -0.2256 -0.0379 492  MET A CB  
693  C  CG  . MET A 120 ? 0.4555 0.6776 0.9161 0.0025  -0.2039 -0.0410 492  MET A CG  
694  S  SD  . MET A 120 ? 0.4465 0.6421 0.8571 0.0031  -0.1610 -0.0440 492  MET A SD  
695  C  CE  . MET A 120 ? 0.4403 0.6878 0.8971 -0.0131 -0.1289 -0.0461 492  MET A CE  
696  N  N   . ALA A 121 ? 0.5664 0.7177 0.9380 -0.0487 -0.3182 -0.0391 493  ALA A N   
697  C  CA  . ALA A 121 ? 0.5976 0.7343 0.9555 -0.0720 -0.3426 -0.0468 493  ALA A CA  
698  C  C   . ALA A 121 ? 0.5817 0.7126 0.9424 -0.0945 -0.3141 -0.0507 493  ALA A C   
699  O  O   . ALA A 121 ? 0.6050 0.7352 0.9839 -0.1175 -0.3324 -0.0568 493  ALA A O   
700  C  CB  . ALA A 121 ? 0.6125 0.7921 1.0403 -0.0789 -0.3836 -0.0491 493  ALA A CB  
701  N  N   . VAL A 122 ? 0.5481 0.6719 0.8905 -0.0883 -0.2725 -0.0465 494  VAL A N   
702  C  CA  . VAL A 122 ? 0.5387 0.6561 0.8811 -0.1069 -0.2445 -0.0463 494  VAL A CA  
703  C  C   . VAL A 122 ? 0.5650 0.6188 0.8225 -0.1090 -0.2431 -0.0515 494  VAL A C   
704  O  O   . VAL A 122 ? 0.5796 0.6025 0.7781 -0.0925 -0.2500 -0.0526 494  VAL A O   
705  C  CB  . VAL A 122 ? 0.4969 0.6482 0.8704 -0.0991 -0.2014 -0.0394 494  VAL A CB  
706  C  CG1 . VAL A 122 ? 0.4765 0.5940 0.7880 -0.0807 -0.1788 -0.0385 494  VAL A CG1 
707  C  CG2 . VAL A 122 ? 0.4943 0.6626 0.8995 -0.1223 -0.1789 -0.0339 494  VAL A CG2 
708  N  N   . LYS A 123 ? 0.5766 0.6118 0.8303 -0.1285 -0.2344 -0.0534 495  LYS A N   
709  C  CA  . LYS A 123 ? 0.6062 0.5813 0.7862 -0.1290 -0.2376 -0.0618 495  LYS A CA  
710  C  C   . LYS A 123 ? 0.5766 0.5322 0.7263 -0.1250 -0.2000 -0.0560 495  LYS A C   
711  O  O   . LYS A 123 ? 0.5645 0.5329 0.7470 -0.1388 -0.1804 -0.0484 495  LYS A O   
712  C  CB  . LYS A 123 ? 0.6565 0.6080 0.8437 -0.1518 -0.2681 -0.0729 495  LYS A CB  
713  C  CG  . LYS A 123 ? 0.7223 0.6116 0.8262 -0.1439 -0.2868 -0.0893 495  LYS A CG  
714  C  CD  . LYS A 123 ? 0.8116 0.6794 0.9218 -0.1623 -0.3312 -0.1059 495  LYS A CD  
715  C  CE  . LYS A 123 ? 0.8287 0.7216 0.9515 -0.1574 -0.3695 -0.1099 495  LYS A CE  
716  N  NZ  . LYS A 123 ? 0.8798 0.7622 1.0278 -0.1802 -0.4159 -0.1255 495  LYS A NZ  
717  N  N   . LYS A 124 ? 0.5714 0.4985 0.6591 -0.1060 -0.1910 -0.0577 496  LYS A N   
718  C  CA  . LYS A 124 ? 0.5462 0.4530 0.5997 -0.0990 -0.1606 -0.0535 496  LYS A CA  
719  C  C   . LYS A 124 ? 0.5744 0.4419 0.6081 -0.1110 -0.1626 -0.0598 496  LYS A C   
720  O  O   . LYS A 124 ? 0.6220 0.4618 0.6399 -0.1180 -0.1901 -0.0726 496  LYS A O   
721  C  CB  . LYS A 124 ? 0.5488 0.4366 0.5456 -0.0779 -0.1568 -0.0540 496  LYS A CB  
722  C  CG  . LYS A 124 ? 0.5409 0.4110 0.5035 -0.0685 -0.1292 -0.0502 496  LYS A CG  
723  C  CD  . LYS A 124 ? 0.5266 0.3908 0.4492 -0.0508 -0.1236 -0.0461 496  LYS A CD  
724  C  CE  . LYS A 124 ? 0.5023 0.3611 0.4078 -0.0428 -0.0961 -0.0406 496  LYS A CE  
725  N  NZ  . LYS A 124 ? 0.4648 0.3340 0.3586 -0.0307 -0.0869 -0.0308 496  LYS A NZ  
726  N  N   . PRO A 125 ? 0.5570 0.4184 0.5901 -0.1128 -0.1363 -0.0515 497  PRO A N   
727  C  CA  . PRO A 125 ? 0.5940 0.4103 0.6061 -0.1213 -0.1402 -0.0566 497  PRO A CA  
728  C  C   . PRO A 125 ? 0.6233 0.3953 0.5678 -0.1022 -0.1455 -0.0708 497  PRO A C   
729  O  O   . PRO A 125 ? 0.6094 0.3901 0.5238 -0.0829 -0.1332 -0.0690 497  PRO A O   
730  C  CB  . PRO A 125 ? 0.5699 0.3940 0.5937 -0.1232 -0.1098 -0.0405 497  PRO A CB  
731  C  CG  . PRO A 125 ? 0.5163 0.3919 0.5682 -0.1172 -0.0911 -0.0302 497  PRO A CG  
732  C  CD  . PRO A 125 ? 0.5184 0.4056 0.5603 -0.1042 -0.1052 -0.0389 497  PRO A CD  
733  N  N   . GLY A 126 ? 0.6674 0.3929 0.5905 -0.1078 -0.1633 -0.0847 498  GLY A N   
734  C  CA  . GLY A 126 ? 0.7012 0.3823 0.5603 -0.0873 -0.1632 -0.0999 498  GLY A CA  
735  C  C   . GLY A 126 ? 0.7040 0.3567 0.5570 -0.0835 -0.1446 -0.0948 498  GLY A C   
736  O  O   . GLY A 126 ? 0.6795 0.3430 0.5737 -0.0996 -0.1346 -0.0783 498  GLY A O   
737  N  N   . PRO A 127 ? 0.7363 0.3532 0.5373 -0.0609 -0.1399 -0.1081 499  PRO A N   
738  C  CA  . PRO A 127 ? 0.7421 0.3337 0.5362 -0.0511 -0.1224 -0.1027 499  PRO A CA  
739  C  C   . PRO A 127 ? 0.7738 0.3305 0.5976 -0.0724 -0.1336 -0.0981 499  PRO A C   
740  O  O   . PRO A 127 ? 0.7598 0.3158 0.5995 -0.0734 -0.1166 -0.0800 499  PRO A O   
741  C  CB  . PRO A 127 ? 0.7904 0.3460 0.5251 -0.0229 -0.1236 -0.1252 499  PRO A CB  
742  C  CG  . PRO A 127 ? 0.7852 0.3654 0.4922 -0.0150 -0.1291 -0.1330 499  PRO A CG  
743  C  CD  . PRO A 127 ? 0.7722 0.3722 0.5168 -0.0413 -0.1506 -0.1287 499  PRO A CD  
744  N  N   . SER A 128 ? 0.8236 0.3516 0.6550 -0.0901 -0.1636 -0.1128 500  SER A N   
745  C  CA  . SER A 128 ? 0.8734 0.3575 0.7326 -0.1131 -0.1798 -0.1104 500  SER A CA  
746  C  C   . SER A 128 ? 0.8420 0.3639 0.7676 -0.1459 -0.1751 -0.0830 500  SER A C   
747  O  O   . SER A 128 ? 0.8785 0.3698 0.8337 -0.1688 -0.1848 -0.0737 500  SER A O   
748  C  CB  . SER A 128 ? 0.9427 0.3777 0.7843 -0.1204 -0.2184 -0.1402 500  SER A CB  
749  O  OG  . SER A 128 ? 1.0043 0.3909 0.7818 -0.0896 -0.2222 -0.1673 500  SER A OG  
750  N  N   . CYS A 129 ? 0.7833 0.3709 0.7331 -0.1478 -0.1600 -0.0700 501  CYS A N   
751  C  CA  . CYS A 129 ? 0.7614 0.3943 0.7746 -0.1754 -0.1528 -0.0466 501  CYS A CA  
752  C  C   . CYS A 129 ? 0.7534 0.3877 0.7837 -0.1831 -0.1273 -0.0185 501  CYS A C   
753  O  O   . CYS A 129 ? 0.7462 0.3603 0.7409 -0.1628 -0.1113 -0.0144 501  CYS A O   
754  C  CB  . CYS A 129 ? 0.7021 0.4017 0.7343 -0.1701 -0.1434 -0.0434 501  CYS A CB  
755  S  SG  . CYS A 129 ? 0.7697 0.4777 0.8105 -0.1761 -0.1810 -0.0656 501  CYS A SG  
756  N  N   . SER A 130 ? 0.7589 0.4186 0.8455 -0.2132 -0.1252 0.0019  502  SER A N   
757  C  CA  . SER A 130 ? 0.7590 0.4342 0.8672 -0.2252 -0.0991 0.0343  502  SER A CA  
758  C  C   . SER A 130 ? 0.7096 0.4270 0.7951 -0.2018 -0.0670 0.0446  502  SER A C   
759  O  O   . SER A 130 ? 0.6617 0.4192 0.7426 -0.1865 -0.0623 0.0325  502  SER A O   
760  C  CB  . SER A 130 ? 0.7526 0.4728 0.9307 -0.2592 -0.0988 0.0521  502  SER A CB  
761  O  OG  . SER A 130 ? 0.7667 0.5162 0.9640 -0.2697 -0.0682 0.0855  502  SER A OG  
762  N  N   . ARG A 131 ? 0.7278 0.4330 0.7988 -0.1994 -0.0481 0.0670  503  ARG A N   
763  C  CA  . ARG A 131 ? 0.6963 0.4428 0.7490 -0.1813 -0.0204 0.0782  503  ARG A CA  
764  C  C   . ARG A 131 ? 0.6599 0.4771 0.7521 -0.1912 -0.0045 0.0850  503  ARG A C   
765  O  O   . ARG A 131 ? 0.6207 0.4757 0.7023 -0.1725 0.0068  0.0759  503  ARG A O   
766  C  CB  . ARG A 131 ? 0.7233 0.4486 0.7566 -0.1806 -0.0053 0.1053  503  ARG A CB  
767  C  CG  . ARG A 131 ? 0.7126 0.4802 0.7217 -0.1604 0.0184  0.1121  503  ARG A CG  
768  C  CD  . ARG A 131 ? 0.7839 0.5380 0.7659 -0.1553 0.0322  0.1393  503  ARG A CD  
769  N  NE  . ARG A 131 ? 0.8040 0.5867 0.7543 -0.1288 0.0428  0.1316  503  ARG A NE  
770  C  CZ  . ARG A 131 ? 0.8280 0.6193 0.7505 -0.1190 0.0555  0.1499  503  ARG A CZ  
771  N  NH1 . ARG A 131 ? 0.7680 0.5845 0.6669 -0.0966 0.0593  0.1376  503  ARG A NH1 
772  N  NH2 . ARG A 131 ? 0.8647 0.6385 0.7822 -0.1322 0.0623  0.1815  503  ARG A NH2 
773  N  N   . GLN A 132 ? 0.6813 0.5156 0.8230 -0.2205 -0.0046 0.1005  504  GLN A N   
774  C  CA  . GLN A 132 ? 0.6538 0.5601 0.8413 -0.2295 0.0125  0.1081  504  GLN A CA  
775  C  C   . GLN A 132 ? 0.6014 0.5381 0.8019 -0.2163 -0.0001 0.0815  504  GLN A C   
776  O  O   . GLN A 132 ? 0.5656 0.5541 0.7756 -0.2033 0.0171  0.0789  504  GLN A O   
777  C  CB  . GLN A 132 ? 0.6832 0.6040 0.9305 -0.2661 0.0127  0.1309  504  GLN A CB  
778  C  CG  . GLN A 132 ? 0.7593 0.6892 1.0054 -0.2786 0.0416  0.1678  504  GLN A CG  
779  C  CD  . GLN A 132 ? 0.8740 0.7274 1.0855 -0.2845 0.0314  0.1826  504  GLN A CD  
780  O  OE1 . GLN A 132 ? 0.9099 0.7013 1.1079 -0.2835 0.0014  0.1641  504  GLN A OE1 
781  N  NE2 . GLN A 132 ? 0.9088 0.7654 1.1034 -0.2885 0.0562  0.2159  504  GLN A NE2 
782  N  N   . GLU A 133 ? 0.6060 0.5066 0.8034 -0.2185 -0.0314 0.0616  505  GLU A N   
783  C  CA  . GLU A 133 ? 0.5743 0.4966 0.7803 -0.2073 -0.0484 0.0392  505  GLU A CA  
784  C  C   . GLU A 133 ? 0.5322 0.4546 0.6899 -0.1755 -0.0398 0.0265  505  GLU A C   
785  O  O   . GLU A 133 ? 0.4940 0.4557 0.6648 -0.1633 -0.0369 0.0190  505  GLU A O   
786  C  CB  . GLU A 133 ? 0.6095 0.4885 0.8142 -0.2176 -0.0858 0.0216  505  GLU A CB  
787  C  CG  . GLU A 133 ? 0.6134 0.5092 0.8169 -0.2047 -0.1069 0.0004  505  GLU A CG  
788  C  CD  . GLU A 133 ? 0.6832 0.5510 0.8985 -0.2204 -0.1462 -0.0150 505  GLU A CD  
789  O  OE1 . GLU A 133 ? 0.7431 0.5777 0.9748 -0.2441 -0.1586 -0.0108 505  GLU A OE1 
790  O  OE2 . GLU A 133 ? 0.6804 0.5573 0.8877 -0.2094 -0.1671 -0.0312 505  GLU A OE2 
791  N  N   . LYS A 134 ? 0.5368 0.4152 0.6435 -0.1623 -0.0367 0.0251  506  LYS A N   
792  C  CA  . LYS A 134 ? 0.4978 0.3796 0.5653 -0.1355 -0.0260 0.0178  506  LYS A CA  
793  C  C   . LYS A 134 ? 0.4674 0.3952 0.5447 -0.1289 0.0003  0.0287  506  LYS A C   
794  O  O   . LYS A 134 ? 0.4373 0.3886 0.5101 -0.1128 0.0036  0.0190  506  LYS A O   
795  C  CB  . LYS A 134 ? 0.5155 0.3467 0.5347 -0.1225 -0.0279 0.0149  506  LYS A CB  
796  C  CG  . LYS A 134 ? 0.5318 0.3183 0.5306 -0.1210 -0.0524 -0.0027 506  LYS A CG  
797  C  CD  . LYS A 134 ? 0.5428 0.2837 0.4969 -0.1036 -0.0517 -0.0078 506  LYS A CD  
798  C  CE  . LYS A 134 ? 0.6016 0.2974 0.5328 -0.1011 -0.0759 -0.0289 506  LYS A CE  
799  N  NZ  . LYS A 134 ? 0.6062 0.2620 0.4924 -0.0777 -0.0738 -0.0388 506  LYS A NZ  
800  N  N   . GLU A 135 ? 0.4750 0.4134 0.5640 -0.1414 0.0176  0.0487  507  GLU A N   
801  C  CA  . GLU A 135 ? 0.4591 0.4427 0.5527 -0.1354 0.0436  0.0585  507  GLU A CA  
802  C  C   . GLU A 135 ? 0.4279 0.4642 0.5612 -0.1322 0.0473  0.0486  507  GLU A C   
803  O  O   . GLU A 135 ? 0.4043 0.4638 0.5268 -0.1131 0.0567  0.0387  507  GLU A O   
804  C  CB  . GLU A 135 ? 0.4929 0.4833 0.5966 -0.1536 0.0614  0.0854  507  GLU A CB  
805  C  CG  . GLU A 135 ? 0.5561 0.5136 0.6133 -0.1467 0.0693  0.1001  507  GLU A CG  
806  C  CD  . GLU A 135 ? 0.6590 0.6091 0.7260 -0.1693 0.0812  0.1319  507  GLU A CD  
807  O  OE1 . GLU A 135 ? 0.6784 0.6591 0.7920 -0.1916 0.0889  0.1443  507  GLU A OE1 
808  O  OE2 . GLU A 135 ? 0.7085 0.6222 0.7392 -0.1651 0.0822  0.1468  507  GLU A OE2 
809  N  N   . ALA A 136 ? 0.4184 0.4717 0.6002 -0.1504 0.0374  0.0502  508  ALA A N   
810  C  CA  . ALA A 136 ? 0.3884 0.4940 0.6172 -0.1469 0.0383  0.0419  508  ALA A CA  
811  C  C   . ALA A 136 ? 0.3590 0.4565 0.5724 -0.1252 0.0210  0.0203  508  ALA A C   
812  O  O   . ALA A 136 ? 0.3458 0.4779 0.5743 -0.1092 0.0286  0.0117  508  ALA A O   
813  C  CB  . ALA A 136 ? 0.4016 0.5261 0.6907 -0.1728 0.0255  0.0489  508  ALA A CB  
814  N  N   . TRP A 137 ? 0.3588 0.4089 0.5403 -0.1238 -0.0015 0.0121  509  TRP A N   
815  C  CA  . TRP A 137 ? 0.3331 0.3723 0.4956 -0.1058 -0.0170 -0.0029 509  TRP A CA  
816  C  C   . TRP A 137 ? 0.3205 0.3591 0.4508 -0.0857 -0.0017 -0.0061 509  TRP A C   
817  O  O   . TRP A 137 ? 0.2988 0.3551 0.4383 -0.0713 -0.0035 -0.0147 509  TRP A O   
818  C  CB  . TRP A 137 ? 0.3500 0.3402 0.4780 -0.1080 -0.0398 -0.0094 509  TRP A CB  
819  C  CG  . TRP A 137 ? 0.3222 0.3047 0.4313 -0.0920 -0.0558 -0.0203 509  TRP A CG  
820  C  CD1 . TRP A 137 ? 0.2823 0.2437 0.3493 -0.0761 -0.0523 -0.0231 509  TRP A CD1 
821  C  CD2 . TRP A 137 ? 0.3160 0.3143 0.4508 -0.0916 -0.0779 -0.0264 509  TRP A CD2 
822  N  NE1 . TRP A 137 ? 0.3084 0.2694 0.3706 -0.0669 -0.0691 -0.0283 509  TRP A NE1 
823  C  CE2 . TRP A 137 ? 0.3260 0.3074 0.4266 -0.0750 -0.0864 -0.0308 509  TRP A CE2 
824  C  CE3 . TRP A 137 ? 0.3102 0.3370 0.4966 -0.1044 -0.0928 -0.0268 509  TRP A CE3 
825  C  CZ2 . TRP A 137 ? 0.3285 0.3162 0.4383 -0.0694 -0.1098 -0.0343 509  TRP A CZ2 
826  C  CZ3 . TRP A 137 ? 0.3197 0.3561 0.5195 -0.0977 -0.1177 -0.0328 509  TRP A CZ3 
827  C  CH2 . TRP A 137 ? 0.3259 0.3403 0.4840 -0.0797 -0.1266 -0.0360 509  TRP A CH2 
828  N  N   . ILE A 138 ? 0.3402 0.3557 0.4349 -0.0848 0.0099  0.0006  510  ILE A N   
829  C  CA  . ILE A 138 ? 0.3322 0.3457 0.3968 -0.0681 0.0207  -0.0024 510  ILE A CA  
830  C  C   . ILE A 138 ? 0.3329 0.3870 0.4159 -0.0597 0.0371  -0.0057 510  ILE A C   
831  O  O   . ILE A 138 ? 0.3339 0.3927 0.4121 -0.0447 0.0351  -0.0169 510  ILE A O   
832  C  CB  . ILE A 138 ? 0.3432 0.3264 0.3703 -0.0683 0.0267  0.0066  510  ILE A CB  
833  C  CG1 . ILE A 138 ? 0.3498 0.2933 0.3550 -0.0674 0.0106  0.0027  510  ILE A CG1 
834  C  CG2 . ILE A 138 ? 0.3332 0.3212 0.3357 -0.0531 0.0358  0.0042  510  ILE A CG2 
835  C  CD1 . ILE A 138 ? 0.3598 0.2712 0.3372 -0.0670 0.0136  0.0108  510  ILE A CD1 
836  N  N   . HIS A 139 ? 0.3520 0.4354 0.4579 -0.0695 0.0531  0.0037  511  HIS A N   
837  C  CA  . HIS A 139 ? 0.3581 0.4853 0.4808 -0.0595 0.0721  -0.0009 511  HIS A CA  
838  C  C   . HIS A 139 ? 0.3422 0.4958 0.5048 -0.0487 0.0638  -0.0159 511  HIS A C   
839  O  O   . HIS A 139 ? 0.3490 0.5202 0.5116 -0.0301 0.0712  -0.0293 511  HIS A O   
840  C  CB  . HIS A 139 ? 0.3805 0.5381 0.5221 -0.0745 0.0940  0.0170  511  HIS A CB  
841  C  CG  . HIS A 139 ? 0.4226 0.6246 0.5655 -0.0614 0.1200  0.0137  511  HIS A CG  
842  N  ND1 . HIS A 139 ? 0.4521 0.7036 0.6421 -0.0544 0.1297  0.0053  511  HIS A ND1 
843  C  CD2 . HIS A 139 ? 0.4644 0.6699 0.5649 -0.0516 0.1379  0.0160  511  HIS A CD2 
844  C  CE1 . HIS A 139 ? 0.4757 0.7591 0.6503 -0.0397 0.1552  0.0012  511  HIS A CE1 
845  N  NE2 . HIS A 139 ? 0.5026 0.7578 0.6199 -0.0385 0.1596  0.0075  511  HIS A NE2 
846  N  N   . ALA A 140 ? 0.3265 0.4811 0.5226 -0.0590 0.0462  -0.0145 512  ALA A N   
847  C  CA  . ALA A 140 ? 0.3152 0.4914 0.5496 -0.0477 0.0332  -0.0263 512  ALA A CA  
848  C  C   . ALA A 140 ? 0.3038 0.4475 0.5101 -0.0311 0.0170  -0.0377 512  ALA A C   
849  O  O   . ALA A 140 ? 0.3089 0.4655 0.5316 -0.0132 0.0149  -0.0495 512  ALA A O   
850  C  CB  . ALA A 140 ? 0.3131 0.4956 0.5863 -0.0642 0.0128  -0.0210 512  ALA A CB  
851  N  N   . LYS A 141 ? 0.3049 0.4060 0.4706 -0.0369 0.0065  -0.0332 513  LYS A N   
852  C  CA  . LYS A 141 ? 0.2964 0.3669 0.4363 -0.0262 -0.0079 -0.0381 513  LYS A CA  
853  C  C   . LYS A 141 ? 0.2972 0.3666 0.4215 -0.0117 0.0026  -0.0464 513  LYS A C   
854  O  O   . LYS A 141 ? 0.2965 0.3648 0.4330 0.0014  -0.0060 -0.0553 513  LYS A O   
855  C  CB  . LYS A 141 ? 0.3020 0.3357 0.4041 -0.0354 -0.0154 -0.0306 513  LYS A CB  
856  C  CG  . LYS A 141 ? 0.3067 0.3128 0.3820 -0.0272 -0.0271 -0.0308 513  LYS A CG  
857  C  CD  . LYS A 141 ? 0.3046 0.2818 0.3466 -0.0340 -0.0328 -0.0253 513  LYS A CD  
858  C  CE  . LYS A 141 ? 0.3113 0.2680 0.3255 -0.0262 -0.0373 -0.0219 513  LYS A CE  
859  N  NZ  . LYS A 141 ? 0.3238 0.2562 0.3042 -0.0291 -0.0409 -0.0193 513  LYS A NZ  
860  N  N   . TYR A 142 ? 0.2954 0.3631 0.3938 -0.0141 0.0185  -0.0437 514  TYR A N   
861  C  CA  . TYR A 142 ? 0.3055 0.3661 0.3813 -0.0025 0.0230  -0.0524 514  TYR A CA  
862  C  C   . TYR A 142 ? 0.3158 0.4058 0.3973 0.0091  0.0394  -0.0642 514  TYR A C   
863  O  O   . TYR A 142 ? 0.3304 0.4144 0.4031 0.0226  0.0361  -0.0790 514  TYR A O   
864  C  CB  . TYR A 142 ? 0.2978 0.3369 0.3365 -0.0085 0.0258  -0.0434 514  TYR A CB  
865  C  CG  . TYR A 142 ? 0.3168 0.3277 0.3432 -0.0148 0.0133  -0.0347 514  TYR A CG  
866  C  CD1 . TYR A 142 ? 0.3197 0.3184 0.3345 -0.0253 0.0149  -0.0241 514  TYR A CD1 
867  C  CD2 . TYR A 142 ? 0.2795 0.2747 0.3044 -0.0099 0.0007  -0.0367 514  TYR A CD2 
868  C  CE1 . TYR A 142 ? 0.3178 0.2914 0.3160 -0.0269 0.0054  -0.0198 514  TYR A CE1 
869  C  CE2 . TYR A 142 ? 0.2975 0.2722 0.3070 -0.0139 -0.0064 -0.0278 514  TYR A CE2 
870  C  CZ  . TYR A 142 ? 0.3176 0.2826 0.3117 -0.0205 -0.0033 -0.0213 514  TYR A CZ  
871  O  OH  . TYR A 142 ? 0.3125 0.2580 0.2867 -0.0204 -0.0084 -0.0159 514  TYR A OH  
872  N  N   . VAL A 143 ? 0.3222 0.4434 0.4169 0.0037  0.0572  -0.0580 515  VAL A N   
873  C  CA  . VAL A 143 ? 0.3397 0.4940 0.4339 0.0163  0.0778  -0.0681 515  VAL A CA  
874  C  C   . VAL A 143 ? 0.3480 0.5342 0.4893 0.0289  0.0795  -0.0807 515  VAL A C   
875  O  O   . VAL A 143 ? 0.3677 0.5607 0.5105 0.0499  0.0811  -0.1015 515  VAL A O   
876  C  CB  . VAL A 143 ? 0.3533 0.5299 0.4354 0.0041  0.1013  -0.0503 515  VAL A CB  
877  C  CG1 . VAL A 143 ? 0.3691 0.5858 0.4452 0.0192  0.1266  -0.0600 515  VAL A CG1 
878  C  CG2 . VAL A 143 ? 0.3336 0.4766 0.3709 -0.0052 0.0974  -0.0371 515  VAL A CG2 
879  N  N   . GLU A 144 ? 0.3393 0.5437 0.5209 0.0167  0.0765  -0.0694 516  GLU A N   
880  C  CA  . GLU A 144 ? 0.3400 0.5810 0.5763 0.0272  0.0759  -0.0776 516  GLU A CA  
881  C  C   . GLU A 144 ? 0.3319 0.5454 0.5801 0.0404  0.0482  -0.0894 516  GLU A C   
882  O  O   . GLU A 144 ? 0.3296 0.5647 0.6148 0.0594  0.0457  -0.1028 516  GLU A O   
883  C  CB  . GLU A 144 ? 0.3314 0.5977 0.6076 0.0056  0.0760  -0.0595 516  GLU A CB  
884  C  CG  . GLU A 144 ? 0.3670 0.6920 0.7075 0.0129  0.0858  -0.0629 516  GLU A CG  
885  C  CD  . GLU A 144 ? 0.4017 0.7496 0.7884 -0.0128 0.0791  -0.0445 516  GLU A CD  
886  O  OE1 . GLU A 144 ? 0.4158 0.7422 0.7798 -0.0372 0.0802  -0.0277 516  GLU A OE1 
887  O  OE2 . GLU A 144 ? 0.3980 0.7844 0.8461 -0.0079 0.0708  -0.0478 516  GLU A OE2 
888  N  N   . LYS A 145 ? 0.3241 0.4906 0.5412 0.0314  0.0285  -0.0827 517  LYS A N   
889  C  CA  . LYS A 145 ? 0.3259 0.4612 0.5476 0.0398  0.0022  -0.0866 517  LYS A CA  
890  C  C   . LYS A 145 ? 0.3153 0.4699 0.5840 0.0409  -0.0135 -0.0828 517  LYS A C   
891  O  O   . LYS A 145 ? 0.3174 0.4666 0.6091 0.0570  -0.0297 -0.0898 517  LYS A O   
892  C  CB  . LYS A 145 ? 0.3459 0.4684 0.5636 0.0616  0.0002  -0.1058 517  LYS A CB  
893  C  CG  . LYS A 145 ? 0.3770 0.4861 0.5520 0.0629  0.0127  -0.1139 517  LYS A CG  
894  C  CD  . LYS A 145 ? 0.4073 0.4725 0.5502 0.0531  -0.0027 -0.1061 517  LYS A CD  
895  C  CE  . LYS A 145 ? 0.4621 0.5141 0.5756 0.0604  0.0007  -0.1208 517  LYS A CE  
896  N  NZ  . LYS A 145 ? 0.4795 0.5472 0.5607 0.0532  0.0197  -0.1163 517  LYS A NZ  
897  N  N   . LYS A 146 ? 0.3038 0.4783 0.5871 0.0229  -0.0115 -0.0709 518  LYS A N   
898  C  CA  . LYS A 146 ? 0.2964 0.5024 0.6326 0.0212  -0.0247 -0.0679 518  LYS A CA  
899  C  C   . LYS A 146 ? 0.2941 0.4705 0.6276 0.0221  -0.0584 -0.0630 518  LYS A C   
900  O  O   . LYS A 146 ? 0.2983 0.4980 0.6767 0.0290  -0.0753 -0.0637 518  LYS A O   
901  C  CB  . LYS A 146 ? 0.2911 0.5215 0.6428 -0.0030 -0.0154 -0.0558 518  LYS A CB  
902  C  CG  . LYS A 146 ? 0.2961 0.5749 0.7156 -0.0068 -0.0235 -0.0535 518  LYS A CG  
903  C  CD  . LYS A 146 ? 0.2913 0.5871 0.7278 -0.0355 -0.0177 -0.0398 518  LYS A CD  
904  C  CE  . LYS A 146 ? 0.2897 0.6497 0.8073 -0.0385 -0.0182 -0.0375 518  LYS A CE  
905  N  NZ  . LYS A 146 ? 0.3147 0.6838 0.8571 -0.0710 -0.0247 -0.0233 518  LYS A NZ  
906  N  N   . PHE A 147 ? 0.2933 0.4222 0.5750 0.0163  -0.0678 -0.0568 519  PHE A N   
907  C  CA  . PHE A 147 ? 0.3039 0.4054 0.5727 0.0151  -0.0973 -0.0485 519  PHE A CA  
908  C  C   . PHE A 147 ? 0.3202 0.3907 0.5741 0.0308  -0.1090 -0.0475 519  PHE A C   
909  O  O   . PHE A 147 ? 0.3401 0.3841 0.5737 0.0304  -0.1310 -0.0365 519  PHE A O   
910  C  CB  . PHE A 147 ? 0.3002 0.3740 0.5235 -0.0035 -0.1013 -0.0398 519  PHE A CB  
911  C  CG  . PHE A 147 ? 0.2932 0.3870 0.5294 -0.0212 -0.0910 -0.0396 519  PHE A CG  
912  C  CD1 . PHE A 147 ? 0.2688 0.3461 0.4709 -0.0317 -0.0723 -0.0371 519  PHE A CD1 
913  C  CD2 . PHE A 147 ? 0.2862 0.4158 0.5739 -0.0281 -0.1016 -0.0401 519  PHE A CD2 
914  C  CE1 . PHE A 147 ? 0.2651 0.3548 0.4800 -0.0491 -0.0642 -0.0337 519  PHE A CE1 
915  C  CE2 . PHE A 147 ? 0.2675 0.4138 0.5727 -0.0481 -0.0927 -0.0369 519  PHE A CE2 
916  C  CZ  . PHE A 147 ? 0.2701 0.3934 0.5371 -0.0589 -0.0739 -0.0330 519  PHE A CZ  
917  N  N   . LEU A 148 ? 0.3208 0.3931 0.5832 0.0443  -0.0951 -0.0586 520  LEU A N   
918  C  CA  . LEU A 148 ? 0.3487 0.3880 0.6038 0.0579  -0.1063 -0.0592 520  LEU A CA  
919  C  C   . LEU A 148 ? 0.3691 0.4104 0.6620 0.0744  -0.1307 -0.0577 520  LEU A C   
920  O  O   . LEU A 148 ? 0.3678 0.4481 0.7058 0.0826  -0.1321 -0.0647 520  LEU A O   
921  C  CB  . LEU A 148 ? 0.3438 0.3855 0.6015 0.0694  -0.0880 -0.0772 520  LEU A CB  
922  C  CG  . LEU A 148 ? 0.3550 0.3699 0.5714 0.0613  -0.0773 -0.0778 520  LEU A CG  
923  C  CD1 . LEU A 148 ? 0.3406 0.3552 0.5218 0.0410  -0.0661 -0.0659 520  LEU A CD1 
924  C  CD2 . LEU A 148 ? 0.3676 0.3949 0.5899 0.0751  -0.0615 -0.1005 520  LEU A CD2 
925  N  N   . THR A 149 ? 0.3954 0.3964 0.6734 0.0793  -0.1500 -0.0464 521  THR A N   
926  C  CA  . THR A 149 ? 0.4190 0.4141 0.7341 0.0999  -0.1734 -0.0458 521  THR A CA  
927  C  C   . THR A 149 ? 0.4294 0.4348 0.7787 0.1213  -0.1614 -0.0705 521  THR A C   
928  O  O   . THR A 149 ? 0.4189 0.4261 0.7511 0.1179  -0.1386 -0.0845 521  THR A O   
929  C  CB  . THR A 149 ? 0.4532 0.3970 0.7425 0.0993  -0.1963 -0.0239 521  THR A CB  
930  O  OG1 . THR A 149 ? 0.4381 0.3487 0.7029 0.0934  -0.1852 -0.0245 521  THR A OG1 
931  C  CG2 . THR A 149 ? 0.4504 0.3868 0.7001 0.0829  -0.2080 -0.0009 521  THR A CG2 
932  N  N   . LYS A 150 ? 0.4556 0.4682 0.8510 0.1454  -0.1775 -0.0773 522  LYS A N   
933  C  CA  . LYS A 150 ? 0.4776 0.4987 0.9050 0.1713  -0.1670 -0.1046 522  LYS A CA  
934  C  C   . LYS A 150 ? 0.5025 0.4676 0.9003 0.1726  -0.1692 -0.1109 522  LYS A C   
935  O  O   . LYS A 150 ? 0.5018 0.4704 0.8909 0.1785  -0.1499 -0.1342 522  LYS A O   
936  C  CB  . LYS A 150 ? 0.4984 0.5342 0.9844 0.2002  -0.1877 -0.1094 522  LYS A CB  
937  C  CG  . LYS A 150 ? 0.5293 0.5849 1.0542 0.2327  -0.1737 -0.1421 522  LYS A CG  
938  C  CD  . LYS A 150 ? 0.5842 0.6577 1.1732 0.2640  -0.1957 -0.1453 522  LYS A CD  
939  C  CE  . LYS A 150 ? 0.6050 0.7124 1.2367 0.2996  -0.1759 -0.1806 522  LYS A CE  
940  N  NZ  . LYS A 150 ? 0.6475 0.7606 1.3423 0.3358  -0.2006 -0.1857 522  LYS A NZ  
941  N  N   . LEU A 151 ? 0.5310 0.4458 0.9132 0.1659  -0.1939 -0.0885 523  LEU A N   
942  C  CA  . LEU A 151 ? 0.5621 0.4201 0.9265 0.1638  -0.2023 -0.0890 523  LEU A CA  
943  C  C   . LEU A 151 ? 0.5498 0.3858 0.8664 0.1321  -0.1985 -0.0635 523  LEU A C   
944  O  O   . LEU A 151 ? 0.5378 0.3815 0.8358 0.1182  -0.2030 -0.0382 523  LEU A O   
945  C  CB  . LEU A 151 ? 0.6075 0.4230 1.0003 0.1824  -0.2339 -0.0801 523  LEU A CB  
946  C  CG  . LEU A 151 ? 0.6574 0.4667 1.0962 0.2187  -0.2419 -0.1104 523  LEU A CG  
947  C  CD1 . LEU A 151 ? 0.6356 0.5054 1.0958 0.2370  -0.2144 -0.1449 523  LEU A CD1 
948  C  CD2 . LEU A 151 ? 0.6912 0.4856 1.1661 0.2383  -0.2731 -0.0936 523  LEU A CD2 
949  N  N   . PRO A 152 ? 0.5503 0.3617 0.8476 0.1221  -0.1907 -0.0718 524  PRO A N   
950  C  CA  . PRO A 152 ? 0.5371 0.3332 0.7975 0.0941  -0.1848 -0.0497 524  PRO A CA  
951  C  C   . PRO A 152 ? 0.5653 0.3187 0.8207 0.0835  -0.2054 -0.0160 524  PRO A C   
952  O  O   . PRO A 152 ? 0.6054 0.3302 0.8857 0.0980  -0.2277 -0.0110 524  PRO A O   
953  C  CB  . PRO A 152 ? 0.5416 0.3251 0.7973 0.0922  -0.1770 -0.0731 524  PRO A CB  
954  C  CG  . PRO A 152 ? 0.5750 0.3393 0.8630 0.1190  -0.1901 -0.1008 524  PRO A CG  
955  C  CD  . PRO A 152 ? 0.5693 0.3696 0.8810 0.1392  -0.1877 -0.1060 524  PRO A CD  
956  N  N   . LEU A 197 ? 0.5339 0.5677 0.8574 0.0131  -0.1906 -0.0546 569  LEU A N   
957  C  CA  . LEU A 197 ? 0.5211 0.5872 0.9032 0.0273  -0.1810 -0.0883 569  LEU A CA  
958  C  C   . LEU A 197 ? 0.5029 0.5773 0.8739 0.0308  -0.1521 -0.1067 569  LEU A C   
959  O  O   . LEU A 197 ? 0.4923 0.6003 0.8912 0.0353  -0.1335 -0.1360 569  LEU A O   
960  C  CB  . LEU A 197 ? 0.5382 0.6031 0.9949 0.0425  -0.2135 -0.0952 569  LEU A CB  
961  C  CG  . LEU A 197 ? 0.5601 0.6334 1.0560 0.0436  -0.2422 -0.0899 569  LEU A CG  
962  C  CD1 . LEU A 197 ? 0.5713 0.6384 1.1471 0.0608  -0.2774 -0.0967 569  LEU A CD1 
963  C  CD2 . LEU A 197 ? 0.5401 0.6564 1.0512 0.0419  -0.2222 -0.1140 569  LEU A CD2 
964  N  N   . HIS A 198 ? 0.4990 0.5459 0.8291 0.0268  -0.1485 -0.0902 570  HIS A N   
965  C  CA  . HIS A 198 ? 0.4828 0.5359 0.7998 0.0289  -0.1237 -0.1048 570  HIS A CA  
966  C  C   . HIS A 198 ? 0.4719 0.5085 0.7196 0.0164  -0.1058 -0.0866 570  HIS A C   
967  O  O   . HIS A 198 ? 0.4818 0.4915 0.7039 0.0133  -0.1132 -0.0675 570  HIS A O   
968  C  CB  . HIS A 198 ? 0.4914 0.5322 0.8470 0.0409  -0.1372 -0.1120 570  HIS A CB  
969  C  CG  . HIS A 198 ? 0.5129 0.5734 0.9453 0.0555  -0.1523 -0.1372 570  HIS A CG  
970  N  ND1 . HIS A 198 ? 0.5038 0.6009 0.9735 0.0626  -0.1331 -0.1747 570  HIS A ND1 
971  C  CD2 . HIS A 198 ? 0.5423 0.5935 1.0239 0.0635  -0.1855 -0.1318 570  HIS A CD2 
972  C  CE1 . HIS A 198 ? 0.5244 0.6355 1.0672 0.0762  -0.1521 -0.1949 570  HIS A CE1 
973  N  NE2 . HIS A 198 ? 0.5515 0.6333 1.1046 0.0780  -0.1856 -0.1682 570  HIS A NE2 
974  N  N   . PRO A 199 ? 0.4524 0.5059 0.6727 0.0084  -0.0835 -0.0928 571  PRO A N   
975  C  CA  . PRO A 199 ? 0.4399 0.4784 0.6023 -0.0021 -0.0689 -0.0777 571  PRO A CA  
976  C  C   . PRO A 199 ? 0.4260 0.4544 0.5708 -0.0002 -0.0577 -0.0776 571  PRO A C   
977  O  O   . PRO A 199 ? 0.4235 0.4311 0.5327 -0.0052 -0.0568 -0.0610 571  PRO A O   
978  C  CB  . PRO A 199 ? 0.4306 0.4912 0.5822 -0.0098 -0.0510 -0.0882 571  PRO A CB  
979  C  CG  . PRO A 199 ? 0.4377 0.5207 0.6332 -0.0066 -0.0620 -0.1002 571  PRO A CG  
980  C  CD  . PRO A 199 ? 0.4421 0.5287 0.6869 0.0071  -0.0749 -0.1122 571  PRO A CD  
981  N  N   . GLY A 200 ? 0.4078 0.4540 0.5788 0.0061  -0.0489 -0.0978 572  GLY A N   
982  C  CA  . GLY A 200 ? 0.3997 0.4391 0.5573 0.0075  -0.0393 -0.0994 572  GLY A CA  
983  C  C   . GLY A 200 ? 0.4128 0.4254 0.5733 0.0119  -0.0560 -0.0854 572  GLY A C   
984  O  O   . GLY A 200 ? 0.4151 0.4107 0.5417 0.0073  -0.0518 -0.0710 572  GLY A O   
985  N  N   . ALA A 201 ? 0.4159 0.4253 0.6195 0.0200  -0.0764 -0.0893 573  ALA A N   
986  C  CA  . ALA A 201 ? 0.4271 0.4087 0.6364 0.0215  -0.0974 -0.0728 573  ALA A CA  
987  C  C   . ALA A 201 ? 0.4373 0.3980 0.6031 0.0092  -0.1049 -0.0440 573  ALA A C   
988  O  O   . ALA A 201 ? 0.4500 0.3915 0.5947 0.0035  -0.1095 -0.0284 573  ALA A O   
989  C  CB  . ALA A 201 ? 0.4367 0.4167 0.7053 0.0321  -0.1225 -0.0809 573  ALA A CB  
990  N  N   . LEU A 202 ? 0.4327 0.3998 0.5844 0.0034  -0.1048 -0.0387 574  LEU A N   
991  C  CA  . LEU A 202 ? 0.4434 0.3958 0.5515 -0.0104 -0.1088 -0.0161 574  LEU A CA  
992  C  C   . LEU A 202 ? 0.4304 0.3804 0.4957 -0.0163 -0.0865 -0.0141 574  LEU A C   
993  O  O   . LEU A 202 ? 0.4513 0.3878 0.4885 -0.0258 -0.0891 0.0011  574  LEU A O   
994  C  CB  . LEU A 202 ? 0.4468 0.4085 0.5491 -0.0159 -0.1119 -0.0144 574  LEU A CB  
995  C  CG  . LEU A 202 ? 0.4522 0.4022 0.5092 -0.0322 -0.1155 0.0052  574  LEU A CG  
996  C  CD1 . LEU A 202 ? 0.4645 0.3953 0.5163 -0.0410 -0.1392 0.0269  574  LEU A CD1 
997  C  CD2 . LEU A 202 ? 0.4409 0.4008 0.4944 -0.0377 -0.1190 0.0046  574  LEU A CD2 
998  N  N   . LEU A 203 ? 0.4013 0.3660 0.4638 -0.0120 -0.0658 -0.0295 575  LEU A N   
999  C  CA  . LEU A 203 ? 0.3852 0.3476 0.4153 -0.0155 -0.0475 -0.0285 575  LEU A CA  
1000 C  C   . LEU A 203 ? 0.3977 0.3503 0.4276 -0.0139 -0.0487 -0.0244 575  LEU A C   
1001 O  O   . LEU A 203 ? 0.3991 0.3436 0.4019 -0.0206 -0.0439 -0.0149 575  LEU A O   
1002 C  CB  . LEU A 203 ? 0.3608 0.3394 0.3919 -0.0127 -0.0301 -0.0432 575  LEU A CB  
1003 C  CG  . LEU A 203 ? 0.3255 0.3009 0.3305 -0.0149 -0.0149 -0.0421 575  LEU A CG  
1004 C  CD1 . LEU A 203 ? 0.3018 0.2666 0.2776 -0.0218 -0.0120 -0.0326 575  LEU A CD1 
1005 C  CD2 . LEU A 203 ? 0.2869 0.2777 0.2938 -0.0153 -0.0025 -0.0533 575  LEU A CD2 
1006 N  N   . PHE A 204 ? 0.4054 0.3612 0.4684 -0.0054 -0.0547 -0.0343 576  PHE A N   
1007 C  CA  . PHE A 204 ? 0.4189 0.3649 0.4881 -0.0036 -0.0582 -0.0322 576  PHE A CA  
1008 C  C   . PHE A 204 ? 0.4454 0.3718 0.5004 -0.0131 -0.0739 -0.0107 576  PHE A C   
1009 O  O   . PHE A 204 ? 0.4491 0.3701 0.4805 -0.0198 -0.0675 -0.0027 576  PHE A O   
1010 C  CB  . PHE A 204 ? 0.4220 0.3740 0.5364 0.0071  -0.0659 -0.0492 576  PHE A CB  
1011 C  CG  . PHE A 204 ? 0.4361 0.3787 0.5595 0.0091  -0.0686 -0.0508 576  PHE A CG  
1012 C  CD1 . PHE A 204 ? 0.4622 0.3832 0.6002 0.0074  -0.0904 -0.0377 576  PHE A CD1 
1013 C  CD2 . PHE A 204 ? 0.4364 0.3911 0.5538 0.0110  -0.0514 -0.0642 576  PHE A CD2 
1014 C  CE1 . PHE A 204 ? 0.4839 0.3949 0.6310 0.0080  -0.0938 -0.0389 576  PHE A CE1 
1015 C  CE2 . PHE A 204 ? 0.4496 0.3965 0.5755 0.0120  -0.0541 -0.0666 576  PHE A CE2 
1016 C  CZ  . PHE A 204 ? 0.4672 0.3918 0.6088 0.0109  -0.0749 -0.0546 576  PHE A CZ  
1017 N  N   . ARG A 205 ? 0.4682 0.3863 0.5372 -0.0157 -0.0950 -0.0008 577  ARG A N   
1018 C  CA  . ARG A 205 ? 0.5009 0.4014 0.5521 -0.0299 -0.1130 0.0230  577  ARG A CA  
1019 C  C   . ARG A 205 ? 0.5038 0.4078 0.5065 -0.0446 -0.0992 0.0325  577  ARG A C   
1020 O  O   . ARG A 205 ? 0.5180 0.4155 0.4986 -0.0571 -0.1002 0.0451  577  ARG A O   
1021 C  CB  . ARG A 205 ? 0.5196 0.4115 0.5940 -0.0314 -0.1408 0.0334  577  ARG A CB  
1022 C  CG  . ARG A 205 ? 0.5635 0.4441 0.6909 -0.0199 -0.1632 0.0290  577  ARG A CG  
1023 C  CD  . ARG A 205 ? 0.6227 0.4942 0.7815 -0.0196 -0.1951 0.0395  577  ARG A CD  
1024 N  NE  . ARG A 205 ? 0.6353 0.5278 0.8207 -0.0078 -0.1898 0.0202  577  ARG A NE  
1025 C  CZ  . ARG A 205 ? 0.6704 0.5681 0.8467 -0.0144 -0.1983 0.0289  577  ARG A CZ  
1026 N  NH1 . ARG A 205 ? 0.7044 0.5880 0.8437 -0.0335 -0.2129 0.0563  577  ARG A NH1 
1027 N  NH2 . ARG A 205 ? 0.6428 0.5622 0.8460 -0.0041 -0.1921 0.0097  577  ARG A NH2 
1028 N  N   . ALA A 206 ? 0.4910 0.4070 0.4793 -0.0441 -0.0861 0.0246  578  ALA A N   
1029 C  CA  . ALA A 206 ? 0.4907 0.4110 0.4384 -0.0576 -0.0741 0.0294  578  ALA A CA  
1030 C  C   . ALA A 206 ? 0.4785 0.4046 0.4106 -0.0563 -0.0527 0.0214  578  ALA A C   
1031 O  O   . ALA A 206 ? 0.4788 0.4094 0.3830 -0.0681 -0.0438 0.0237  578  ALA A O   
1032 C  CB  . ALA A 206 ? 0.4768 0.4054 0.4180 -0.0572 -0.0688 0.0223  578  ALA A CB  
1033 N  N   . SER A 207 ? 0.4590 0.3875 0.4110 -0.0430 -0.0450 0.0106  579  SER A N   
1034 C  CA  . SER A 207 ? 0.4612 0.3950 0.4044 -0.0404 -0.0283 0.0040  579  SER A CA  
1035 C  C   . SER A 207 ? 0.4880 0.4171 0.4278 -0.0475 -0.0323 0.0127  579  SER A C   
1036 O  O   . SER A 207 ? 0.4835 0.4190 0.4151 -0.0481 -0.0197 0.0087  579  SER A O   
1037 C  CB  . SER A 207 ? 0.4375 0.3771 0.4000 -0.0271 -0.0206 -0.0092 579  SER A CB  
1038 O  OG  . SER A 207 ? 0.4278 0.3737 0.3936 -0.0230 -0.0165 -0.0168 579  SER A OG  
1039 N  N   . GLY A 208 ? 0.5214 0.4389 0.4706 -0.0533 -0.0516 0.0251  580  GLY A N   
1040 C  CA  . GLY A 208 ? 0.5581 0.4682 0.5062 -0.0621 -0.0588 0.0358  580  GLY A CA  
1041 C  C   . GLY A 208 ? 0.5992 0.5110 0.5153 -0.0844 -0.0613 0.0509  580  GLY A C   
1042 O  O   . GLY A 208 ? 0.6111 0.5279 0.5087 -0.0922 -0.0607 0.0531  580  GLY A O   
1043 N  N   . HIS A 209 ? 0.6241 0.5341 0.5324 -0.0968 -0.0636 0.0605  581  HIS A N   
1044 C  CA  . HIS A 209 ? 0.6669 0.5843 0.5416 -0.1229 -0.0637 0.0739  581  HIS A CA  
1045 C  C   . HIS A 209 ? 0.6960 0.6014 0.5594 -0.1387 -0.0873 0.0940  581  HIS A C   
1046 O  O   . HIS A 209 ? 0.7114 0.5958 0.5983 -0.1347 -0.1118 0.1059  581  HIS A O   
1047 C  CB  . HIS A 209 ? 0.6853 0.6032 0.5565 -0.1357 -0.0643 0.0823  581  HIS A CB  
1048 C  CG  . HIS A 209 ? 0.7562 0.6868 0.5912 -0.1667 -0.0628 0.0952  581  HIS A CG  
1049 N  ND1 . HIS A 209 ? 0.7873 0.7463 0.6002 -0.1752 -0.0384 0.0810  581  HIS A ND1 
1050 C  CD2 . HIS A 209 ? 0.8255 0.7464 0.6429 -0.1934 -0.0833 0.1205  581  HIS A CD2 
1051 C  CE1 . HIS A 209 ? 0.8300 0.8003 0.6113 -0.2068 -0.0409 0.0944  581  HIS A CE1 
1052 N  NE2 . HIS A 209 ? 0.8610 0.8077 0.6415 -0.2198 -0.0688 0.1208  581  HIS A NE2 
1053 N  N   . PRO A 210 ? 0.7092 0.6283 0.5398 -0.1560 -0.0813 0.0961  582  PRO A N   
1054 C  CA  . PRO A 210 ? 0.6904 0.6334 0.5034 -0.1550 -0.0534 0.0754  582  PRO A CA  
1055 C  C   . PRO A 210 ? 0.6545 0.5962 0.4809 -0.1349 -0.0484 0.0608  582  PRO A C   
1056 O  O   . PRO A 210 ? 0.6686 0.6001 0.4981 -0.1356 -0.0655 0.0699  582  PRO A O   
1057 C  CB  . PRO A 210 ? 0.7239 0.6811 0.4963 -0.1872 -0.0541 0.0854  582  PRO A CB  
1058 C  CG  . PRO A 210 ? 0.7583 0.6948 0.5278 -0.1992 -0.0862 0.1117  582  PRO A CG  
1059 C  CD  . PRO A 210 ? 0.7462 0.6577 0.5546 -0.1809 -0.1046 0.1200  582  PRO A CD  
1060 N  N   . PRO A 211 ? 0.6146 0.5663 0.4503 -0.1183 -0.0272 0.0398  583  PRO A N   
1061 C  CA  . PRO A 211 ? 0.5882 0.5358 0.4383 -0.1009 -0.0253 0.0292  583  PRO A CA  
1062 C  C   . PRO A 211 ? 0.5902 0.5438 0.4196 -0.1112 -0.0242 0.0264  583  PRO A C   
1063 O  O   . PRO A 211 ? 0.6124 0.5798 0.4163 -0.1277 -0.0144 0.0222  583  PRO A O   
1064 C  CB  . PRO A 211 ? 0.5621 0.5166 0.4253 -0.0844 -0.0062 0.0113  583  PRO A CB  
1065 C  CG  . PRO A 211 ? 0.5742 0.5349 0.4368 -0.0895 -0.0007 0.0130  583  PRO A CG  
1066 C  CD  . PRO A 211 ? 0.5971 0.5629 0.4342 -0.1146 -0.0071 0.0260  583  PRO A CD  
1067 N  N   . SER A 212 ? 0.5685 0.5144 0.4095 -0.1030 -0.0342 0.0273  584  SER A N   
1068 C  CA  . SER A 212 ? 0.5630 0.5143 0.3871 -0.1109 -0.0326 0.0224  584  SER A CA  
1069 C  C   . SER A 212 ? 0.5317 0.4832 0.3715 -0.0933 -0.0206 0.0057  584  SER A C   
1070 O  O   . SER A 212 ? 0.5208 0.4665 0.3816 -0.0820 -0.0287 0.0067  584  SER A O   
1071 C  CB  . SER A 212 ? 0.5775 0.5213 0.4005 -0.1202 -0.0567 0.0392  584  SER A CB  
1072 O  OG  . SER A 212 ? 0.5801 0.5297 0.3890 -0.1265 -0.0552 0.0330  584  SER A OG  
1073 N  N   . LEU A 213 ? 0.5139 0.4729 0.3454 -0.0924 -0.0024 -0.0100 585  LEU A N   
1074 C  CA  . LEU A 213 ? 0.4870 0.4430 0.3318 -0.0784 0.0069  -0.0235 585  LEU A CA  
1075 C  C   . LEU A 213 ? 0.4730 0.4258 0.3164 -0.0804 0.0000  -0.0241 585  LEU A C   
1076 O  O   . LEU A 213 ? 0.4533 0.4017 0.3133 -0.0695 0.0003  -0.0273 585  LEU A O   
1077 C  CB  . LEU A 213 ? 0.4931 0.4555 0.3350 -0.0770 0.0240  -0.0405 585  LEU A CB  
1078 C  CG  . LEU A 213 ? 0.5229 0.4908 0.3730 -0.0723 0.0316  -0.0422 585  LEU A CG  
1079 C  CD1 . LEU A 213 ? 0.5721 0.5534 0.4179 -0.0771 0.0466  -0.0602 585  LEU A CD1 
1080 C  CD2 . LEU A 213 ? 0.5311 0.4907 0.4040 -0.0550 0.0316  -0.0416 585  LEU A CD2 
1081 N  N   . PRO A 214 ? 0.4855 0.4427 0.3080 -0.0967 -0.0065 -0.0207 586  PRO A N   
1082 C  CA  . PRO A 214 ? 0.4832 0.4381 0.3069 -0.0991 -0.0161 -0.0192 586  PRO A CA  
1083 C  C   . PRO A 214 ? 0.4655 0.4164 0.3138 -0.0903 -0.0317 -0.0077 586  PRO A C   
1084 O  O   . PRO A 214 ? 0.4530 0.4042 0.3159 -0.0839 -0.0334 -0.0121 586  PRO A O   
1085 C  CB  . PRO A 214 ? 0.5102 0.4722 0.3044 -0.1211 -0.0227 -0.0146 586  PRO A CB  
1086 C  CG  . PRO A 214 ? 0.5232 0.4946 0.2998 -0.1291 -0.0066 -0.0253 586  PRO A CG  
1087 C  CD  . PRO A 214 ? 0.5084 0.4761 0.3031 -0.1160 -0.0029 -0.0212 586  PRO A CD  
1088 N  N   . THR A 215 ? 0.4615 0.4096 0.3172 -0.0903 -0.0430 0.0050  587  THR A N   
1089 C  CA  . THR A 215 ? 0.4385 0.3839 0.3253 -0.0800 -0.0579 0.0112  587  THR A CA  
1090 C  C   . THR A 215 ? 0.4110 0.3586 0.3218 -0.0629 -0.0459 -0.0006 587  THR A C   
1091 O  O   . THR A 215 ? 0.3991 0.3523 0.3331 -0.0555 -0.0497 -0.0057 587  THR A O   
1092 C  CB  . THR A 215 ? 0.4575 0.3958 0.3494 -0.0852 -0.0762 0.0278  587  THR A CB  
1093 O  OG1 . THR A 215 ? 0.4757 0.4134 0.3390 -0.1061 -0.0882 0.0414  587  THR A OG1 
1094 C  CG2 . THR A 215 ? 0.4421 0.3778 0.3742 -0.0733 -0.0942 0.0305  587  THR A CG2 
1095 N  N   . MET A 216 ? 0.3899 0.3363 0.2950 -0.0584 -0.0318 -0.0056 588  MET A N   
1096 C  CA  . MET A 216 ? 0.3756 0.3250 0.2973 -0.0460 -0.0212 -0.0154 588  MET A CA  
1097 C  C   . MET A 216 ? 0.3705 0.3234 0.2917 -0.0456 -0.0145 -0.0235 588  MET A C   
1098 O  O   . MET A 216 ? 0.3559 0.3159 0.2949 -0.0401 -0.0130 -0.0288 588  MET A O   
1099 C  CB  . MET A 216 ? 0.3678 0.3151 0.2820 -0.0428 -0.0089 -0.0183 588  MET A CB  
1100 C  CG  . MET A 216 ? 0.3816 0.3262 0.2951 -0.0453 -0.0142 -0.0101 588  MET A CG  
1101 S  SD  . MET A 216 ? 0.3702 0.3167 0.2743 -0.0441 0.0006  -0.0147 588  MET A SD  
1102 C  CE  . MET A 216 ? 0.3188 0.2669 0.2403 -0.0306 0.0081  -0.0232 588  MET A CE  
1103 N  N   . ALA A 217 ? 0.3782 0.3275 0.2792 -0.0535 -0.0105 -0.0257 589  ALA A N   
1104 C  CA  . ALA A 217 ? 0.3859 0.3347 0.2852 -0.0553 -0.0058 -0.0326 589  ALA A CA  
1105 C  C   . ALA A 217 ? 0.3857 0.3426 0.2985 -0.0575 -0.0158 -0.0312 589  ALA A C   
1106 O  O   . ALA A 217 ? 0.3764 0.3386 0.2997 -0.0564 -0.0124 -0.0359 589  ALA A O   
1107 C  CB  . ALA A 217 ? 0.3897 0.3329 0.2677 -0.0636 -0.0008 -0.0382 589  ALA A CB  
1108 N  N   . ASP A 218 ? 0.4009 0.3598 0.3139 -0.0623 -0.0292 -0.0239 590  ASP A N   
1109 C  CA  . ASP A 218 ? 0.4138 0.3816 0.3451 -0.0638 -0.0425 -0.0221 590  ASP A CA  
1110 C  C   . ASP A 218 ? 0.4010 0.3801 0.3668 -0.0527 -0.0437 -0.0272 590  ASP A C   
1111 O  O   . ASP A 218 ? 0.3887 0.3811 0.3720 -0.0520 -0.0424 -0.0348 590  ASP A O   
1112 C  CB  . ASP A 218 ? 0.4355 0.4003 0.3599 -0.0722 -0.0605 -0.0099 590  ASP A CB  
1113 C  CG  . ASP A 218 ? 0.4794 0.4523 0.4175 -0.0768 -0.0759 -0.0076 590  ASP A CG  
1114 O  OD1 . ASP A 218 ? 0.5114 0.4950 0.4681 -0.0728 -0.0716 -0.0171 590  ASP A OD1 
1115 O  OD2 . ASP A 218 ? 0.5062 0.4762 0.4362 -0.0865 -0.0937 0.0047  590  ASP A OD2 
1116 N  N   . ALA A 219 ? 0.3971 0.3731 0.3723 -0.0453 -0.0446 -0.0253 591  ALA A N   
1117 C  CA  . ALA A 219 ? 0.3828 0.3713 0.3910 -0.0353 -0.0438 -0.0347 591  ALA A CA  
1118 C  C   . ALA A 219 ? 0.3705 0.3702 0.3773 -0.0353 -0.0267 -0.0457 591  ALA A C   
1119 O  O   . ALA A 219 ? 0.3698 0.3889 0.4008 -0.0340 -0.0250 -0.0566 591  ALA A O   
1120 C  CB  . ALA A 219 ? 0.3693 0.3500 0.3850 -0.0288 -0.0472 -0.0315 591  ALA A CB  
1121 N  N   . LEU A 220 ? 0.3742 0.3633 0.3544 -0.0383 -0.0151 -0.0431 592  LEU A N   
1122 C  CA  . LEU A 220 ? 0.3635 0.3589 0.3386 -0.0413 -0.0026 -0.0487 592  LEU A CA  
1123 C  C   . LEU A 220 ? 0.3622 0.3658 0.3372 -0.0501 -0.0017 -0.0516 592  LEU A C   
1124 O  O   . LEU A 220 ? 0.3437 0.3650 0.3290 -0.0544 0.0042  -0.0586 592  LEU A O   
1125 C  CB  . LEU A 220 ? 0.3670 0.3458 0.3186 -0.0419 0.0048  -0.0436 592  LEU A CB  
1126 C  CG  . LEU A 220 ? 0.3710 0.3487 0.3254 -0.0351 0.0079  -0.0433 592  LEU A CG  
1127 C  CD1 . LEU A 220 ? 0.4271 0.3889 0.3635 -0.0344 0.0115  -0.0385 592  LEU A CD1 
1128 C  CD2 . LEU A 220 ? 0.3628 0.3547 0.3249 -0.0364 0.0145  -0.0491 592  LEU A CD2 
1129 N  N   . ALA A 221 ? 0.3712 0.3642 0.3334 -0.0549 -0.0071 -0.0471 593  ALA A N   
1130 C  CA  . ALA A 221 ? 0.3838 0.3843 0.3475 -0.0641 -0.0085 -0.0496 593  ALA A CA  
1131 C  C   . ALA A 221 ? 0.3840 0.4104 0.3790 -0.0633 -0.0133 -0.0573 593  ALA A C   
1132 O  O   . ALA A 221 ? 0.3926 0.4346 0.3945 -0.0716 -0.0093 -0.0629 593  ALA A O   
1133 C  CB  . ALA A 221 ? 0.3937 0.3808 0.3406 -0.0694 -0.0153 -0.0455 593  ALA A CB  
1134 N  N   . HIS A 222 ? 0.3770 0.4090 0.3941 -0.0540 -0.0226 -0.0585 594  HIS A N   
1135 C  CA  . HIS A 222 ? 0.3738 0.4318 0.4309 -0.0502 -0.0286 -0.0697 594  HIS A CA  
1136 C  C   . HIS A 222 ? 0.3702 0.4491 0.4485 -0.0460 -0.0177 -0.0841 594  HIS A C   
1137 O  O   . HIS A 222 ? 0.3758 0.4762 0.4938 -0.0393 -0.0227 -0.0975 594  HIS A O   
1138 C  CB  . HIS A 222 ? 0.3713 0.4237 0.4486 -0.0428 -0.0488 -0.0641 594  HIS A CB  
1139 C  CG  . HIS A 222 ? 0.3739 0.4151 0.4337 -0.0510 -0.0609 -0.0525 594  HIS A CG  
1140 N  ND1 . HIS A 222 ? 0.3844 0.4410 0.4659 -0.0546 -0.0721 -0.0554 594  HIS A ND1 
1141 C  CD2 . HIS A 222 ? 0.3716 0.3910 0.3937 -0.0580 -0.0623 -0.0402 594  HIS A CD2 
1142 C  CE1 . HIS A 222 ? 0.4010 0.4436 0.4563 -0.0639 -0.0814 -0.0436 594  HIS A CE1 
1143 N  NE2 . HIS A 222 ? 0.4013 0.4223 0.4202 -0.0666 -0.0747 -0.0355 594  HIS A NE2 
1144 N  N   . GLY A 223 ? 0.3735 0.4474 0.4277 -0.0504 -0.0039 -0.0827 595  GLY A N   
1145 C  CA  . GLY A 223 ? 0.3611 0.4586 0.4276 -0.0522 0.0081  -0.0966 595  GLY A CA  
1146 C  C   . GLY A 223 ? 0.3664 0.4596 0.4421 -0.0412 0.0080  -0.1005 595  GLY A C   
1147 O  O   . GLY A 223 ? 0.3549 0.4705 0.4436 -0.0427 0.0175  -0.1153 595  GLY A O   
1148 N  N   . ALA A 224 ? 0.3689 0.4357 0.4371 -0.0325 -0.0022 -0.0883 596  ALA A N   
1149 C  CA  . ALA A 224 ? 0.3683 0.4279 0.4426 -0.0238 -0.0030 -0.0899 596  ALA A CA  
1150 C  C   . ALA A 224 ? 0.3714 0.4359 0.4258 -0.0294 0.0117  -0.0925 596  ALA A C   
1151 O  O   . ALA A 224 ? 0.3819 0.4350 0.4056 -0.0372 0.0172  -0.0815 596  ALA A O   
1152 C  CB  . ALA A 224 ? 0.3606 0.3914 0.4191 -0.0195 -0.0137 -0.0731 596  ALA A CB  
1153 N  N   . ASP A 225 ? 0.3697 0.4515 0.4438 -0.0263 0.0164  -0.1077 597  ASP A N   
1154 C  CA  . ASP A 225 ? 0.3724 0.4596 0.4278 -0.0325 0.0277  -0.1097 597  ASP A CA  
1155 C  C   . ASP A 225 ? 0.3663 0.4242 0.4014 -0.0267 0.0232  -0.0937 597  ASP A C   
1156 O  O   . ASP A 225 ? 0.3659 0.4117 0.4148 -0.0169 0.0144  -0.0923 597  ASP A O   
1157 C  CB  . ASP A 225 ? 0.3731 0.4885 0.4583 -0.0306 0.0333  -0.1340 597  ASP A CB  
1158 C  CG  . ASP A 225 ? 0.4065 0.5329 0.4708 -0.0407 0.0448  -0.1377 597  ASP A CG  
1159 O  OD1 . ASP A 225 ? 0.4366 0.5435 0.4677 -0.0453 0.0450  -0.1193 597  ASP A OD1 
1160 O  OD2 . ASP A 225 ? 0.4489 0.6059 0.5328 -0.0444 0.0530  -0.1612 597  ASP A OD2 
1161 N  N   . VAL A 226 ? 0.3693 0.4161 0.3738 -0.0337 0.0280  -0.0813 598  VAL A N   
1162 C  CA  . VAL A 226 ? 0.3677 0.3911 0.3558 -0.0288 0.0251  -0.0684 598  VAL A CA  
1163 C  C   . VAL A 226 ? 0.3631 0.3913 0.3594 -0.0247 0.0264  -0.0748 598  VAL A C   
1164 O  O   . VAL A 226 ? 0.3540 0.3668 0.3476 -0.0187 0.0223  -0.0678 598  VAL A O   
1165 C  CB  . VAL A 226 ? 0.3725 0.3833 0.3341 -0.0360 0.0276  -0.0559 598  VAL A CB  
1166 C  CG1 . VAL A 226 ? 0.3611 0.3853 0.3127 -0.0470 0.0329  -0.0569 598  VAL A CG1 
1167 C  CG2 . VAL A 226 ? 0.3656 0.3556 0.3176 -0.0294 0.0248  -0.0464 598  VAL A CG2 
1168 N  N   . ASN A 227 ? 0.3601 0.4124 0.3670 -0.0296 0.0326  -0.0899 599  ASN A N   
1169 C  CA  . ASN A 227 ? 0.3634 0.4248 0.3803 -0.0276 0.0348  -0.1010 599  ASN A CA  
1170 C  C   . ASN A 227 ? 0.3597 0.4338 0.4145 -0.0195 0.0316  -0.1210 599  ASN A C   
1171 O  O   . ASN A 227 ? 0.3533 0.4468 0.4226 -0.0211 0.0369  -0.1399 599  ASN A O   
1172 C  CB  . ASN A 227 ? 0.3641 0.4463 0.3641 -0.0420 0.0442  -0.1061 599  ASN A CB  
1173 C  CG  . ASN A 227 ? 0.3922 0.4581 0.3605 -0.0490 0.0426  -0.0851 599  ASN A CG  
1174 O  OD1 . ASN A 227 ? 0.4467 0.5218 0.3971 -0.0634 0.0456  -0.0803 599  ASN A OD1 
1175 N  ND2 . ASN A 227 ? 0.3676 0.4101 0.3313 -0.0399 0.0366  -0.0728 599  ASN A ND2 
1176 N  N   . TRP A 228 ? 0.3567 0.4199 0.4293 -0.0113 0.0216  -0.1176 600  TRP A N   
1177 C  CA  . TRP A 228 ? 0.3616 0.4322 0.4774 -0.0018 0.0131  -0.1343 600  TRP A CA  
1178 C  C   . TRP A 228 ? 0.3670 0.4294 0.4994 0.0051  0.0079  -0.1411 600  TRP A C   
1179 O  O   . TRP A 228 ? 0.3740 0.4131 0.4892 0.0063  0.0025  -0.1241 600  TRP A O   
1180 C  CB  . TRP A 228 ? 0.3615 0.4142 0.4872 0.0041  -0.0020 -0.1213 600  TRP A CB  
1181 C  CG  . TRP A 228 ? 0.3649 0.4257 0.5401 0.0136  -0.0145 -0.1368 600  TRP A CG  
1182 C  CD1 . TRP A 228 ? 0.3598 0.4480 0.5648 0.0142  -0.0119 -0.1560 600  TRP A CD1 
1183 C  CD2 . TRP A 228 ? 0.3754 0.4163 0.5799 0.0234  -0.0341 -0.1337 600  TRP A CD2 
1184 N  NE1 . TRP A 228 ? 0.3490 0.4360 0.6040 0.0260  -0.0290 -0.1668 600  TRP A NE1 
1185 C  CE2 . TRP A 228 ? 0.3672 0.4230 0.6226 0.0316  -0.0444 -0.1520 600  TRP A CE2 
1186 C  CE3 . TRP A 228 ? 0.3888 0.4012 0.5830 0.0247  -0.0452 -0.1167 600  TRP A CE3 
1187 C  CZ2 . TRP A 228 ? 0.3615 0.4007 0.6599 0.0424  -0.0682 -0.1527 600  TRP A CZ2 
1188 C  CZ3 . TRP A 228 ? 0.3857 0.3816 0.6176 0.0326  -0.0679 -0.1156 600  TRP A CZ3 
1189 C  CH2 . TRP A 228 ? 0.3730 0.3804 0.6572 0.0419  -0.0805 -0.1328 600  TRP A CH2 
1190 N  N   . VAL A 229 ? 0.3742 0.4579 0.5428 0.0088  0.0097  -0.1681 601  VAL A N   
1191 C  CA  . VAL A 229 ? 0.3808 0.4585 0.5698 0.0147  0.0049  -0.1793 601  VAL A CA  
1192 C  C   . VAL A 229 ? 0.3942 0.4556 0.6290 0.0279  -0.0158 -0.1824 601  VAL A C   
1193 O  O   . VAL A 229 ? 0.3874 0.4642 0.6587 0.0334  -0.0200 -0.1986 601  VAL A O   
1194 C  CB  . VAL A 229 ? 0.3804 0.4939 0.5823 0.0090  0.0202  -0.2112 601  VAL A CB  
1195 C  CG1 . VAL A 229 ? 0.3867 0.4950 0.6159 0.0156  0.0147  -0.2279 601  VAL A CG1 
1196 C  CG2 . VAL A 229 ? 0.3671 0.4937 0.5207 -0.0073 0.0362  -0.2025 601  VAL A CG2 
1197 N  N   . ASN A 230 ? 0.4162 0.4466 0.6498 0.0315  -0.0304 -0.1655 602  ASN A N   
1198 C  CA  . ASN A 230 ? 0.4481 0.4573 0.7228 0.0413  -0.0549 -0.1629 602  ASN A CA  
1199 C  C   . ASN A 230 ? 0.4668 0.4857 0.7947 0.0505  -0.0595 -0.1949 602  ASN A C   
1200 O  O   . ASN A 230 ? 0.4769 0.4769 0.8134 0.0522  -0.0682 -0.1939 602  ASN A O   
1201 C  CB  . ASN A 230 ? 0.4594 0.4331 0.7086 0.0369  -0.0691 -0.1305 602  ASN A CB  
1202 C  CG  . ASN A 230 ? 0.4970 0.4449 0.7841 0.0428  -0.0985 -0.1220 602  ASN A CG  
1203 O  OD1 . ASN A 230 ? 0.5001 0.4512 0.8224 0.0498  -0.1118 -0.1280 602  ASN A OD1 
1204 N  ND2 . ASN A 230 ? 0.5370 0.4589 0.8189 0.0390  -0.1107 -0.1067 602  ASN A ND2 
1205 N  N   . GLY A 231 ? 0.4763 0.5267 0.8414 0.0556  -0.0529 -0.2255 603  GLY A N   
1206 C  CA  . GLY A 231 ? 0.5056 0.5779 0.9203 0.0626  -0.0493 -0.2659 603  GLY A CA  
1207 C  C   . GLY A 231 ? 0.5372 0.5842 1.0125 0.0771  -0.0772 -0.2732 603  GLY A C   
1208 O  O   . GLY A 231 ? 0.5489 0.5652 1.0350 0.0819  -0.1024 -0.2475 603  GLY A O   
1209 N  N   . GLY A 232 ? 0.5601 0.6198 1.0750 0.0827  -0.0742 -0.3083 604  GLY A N   
1210 C  CA  . GLY A 232 ? 0.5962 0.6296 1.1750 0.0969  -0.1022 -0.3192 604  GLY A CA  
1211 C  C   . GLY A 232 ? 0.6137 0.5983 1.1652 0.0924  -0.1215 -0.2813 604  GLY A C   
1212 O  O   . GLY A 232 ? 0.6350 0.5974 1.2243 0.0985  -0.1388 -0.2907 604  GLY A O   
1213 N  N   . GLN A 233 ? 0.6052 0.5747 1.0934 0.0807  -0.1184 -0.2405 605  GLN A N   
1214 C  CA  . GLN A 233 ? 0.6212 0.5521 1.0746 0.0720  -0.1316 -0.2041 605  GLN A CA  
1215 C  C   . GLN A 233 ? 0.6057 0.5444 1.0160 0.0619  -0.1100 -0.2056 605  GLN A C   
1216 O  O   . GLN A 233 ? 0.6142 0.5596 1.0506 0.0651  -0.1067 -0.2329 605  GLN A O   
1217 C  CB  . GLN A 233 ? 0.6230 0.5358 1.0361 0.0637  -0.1407 -0.1629 605  GLN A CB  
1218 C  CG  . GLN A 233 ? 0.6722 0.5572 1.1248 0.0691  -0.1759 -0.1471 605  GLN A CG  
1219 C  CD  . GLN A 233 ? 0.7317 0.5916 1.1357 0.0544  -0.1881 -0.1016 605  GLN A CD  
1220 O  OE1 . GLN A 233 ? 0.7401 0.5818 1.1061 0.0418  -0.1881 -0.0790 605  GLN A OE1 
1221 N  NE2 . GLN A 233 ? 0.7477 0.6096 1.1529 0.0545  -0.1981 -0.0897 605  GLN A NE2 
1222 N  N   . ASP A 234 ? 0.5833 0.5219 0.9317 0.0500  -0.0964 -0.1783 606  ASP A N   
1223 C  CA  . ASP A 234 ? 0.5656 0.5103 0.8738 0.0404  -0.0792 -0.1754 606  ASP A CA  
1224 C  C   . ASP A 234 ? 0.5305 0.5101 0.8050 0.0349  -0.0517 -0.1862 606  ASP A C   
1225 O  O   . ASP A 234 ? 0.5207 0.5079 0.7624 0.0266  -0.0386 -0.1834 606  ASP A O   
1226 C  CB  . ASP A 234 ? 0.5804 0.4986 0.8485 0.0303  -0.0864 -0.1370 606  ASP A CB  
1227 C  CG  . ASP A 234 ? 0.6108 0.5243 0.8522 0.0266  -0.0885 -0.1116 606  ASP A CG  
1228 O  OD1 . ASP A 234 ? 0.6326 0.5603 0.8864 0.0324  -0.0860 -0.1210 606  ASP A OD1 
1229 O  OD2 . ASP A 234 ? 0.6599 0.5577 0.8678 0.0166  -0.0919 -0.0835 606  ASP A OD2 
1230 N  N   . ASN A 235 ? 0.5081 0.5083 0.7918 0.0381  -0.0453 -0.1970 607  ASN A N   
1231 C  CA  . ASN A 235 ? 0.4763 0.5064 0.7260 0.0300  -0.0227 -0.2012 607  ASN A CA  
1232 C  C   . ASN A 235 ? 0.4561 0.4754 0.6516 0.0212  -0.0166 -0.1692 607  ASN A C   
1233 O  O   . ASN A 235 ? 0.4474 0.4851 0.6115 0.0127  -0.0006 -0.1695 607  ASN A O   
1234 C  CB  . ASN A 235 ? 0.4744 0.5365 0.7260 0.0241  -0.0054 -0.2319 607  ASN A CB  
1235 C  CG  . ASN A 235 ? 0.4901 0.5828 0.7893 0.0293  -0.0009 -0.2709 607  ASN A CG  
1236 O  OD1 . ASN A 235 ? 0.4830 0.5716 0.8191 0.0397  -0.0126 -0.2750 607  ASN A OD1 
1237 N  ND2 . ASN A 235 ? 0.4904 0.6168 0.7898 0.0210  0.0160  -0.3010 607  ASN A ND2 
1238 N  N   . ALA A 236 ? 0.4461 0.4365 0.6323 0.0222  -0.0304 -0.1424 608  ALA A N   
1239 C  CA  . ALA A 236 ? 0.4266 0.4082 0.5677 0.0147  -0.0247 -0.1162 608  ALA A CA  
1240 C  C   . ALA A 236 ? 0.4142 0.4051 0.5387 0.0130  -0.0180 -0.1102 608  ALA A C   
1241 O  O   . ALA A 236 ? 0.4079 0.4069 0.5563 0.0175  -0.0221 -0.1203 608  ALA A O   
1242 C  CB  . ALA A 236 ? 0.4322 0.3855 0.5675 0.0124  -0.0397 -0.0925 608  ALA A CB  
1243 N  N   . THR A 237 ? 0.3935 0.3835 0.4810 0.0067  -0.0088 -0.0950 609  THR A N   
1244 C  CA  . THR A 237 ? 0.3757 0.3720 0.4445 0.0036  -0.0021 -0.0890 609  THR A CA  
1245 C  C   . THR A 237 ? 0.3735 0.3509 0.4230 0.0015  -0.0079 -0.0676 609  THR A C   
1246 O  O   . THR A 237 ? 0.3852 0.3485 0.4314 0.0002  -0.0144 -0.0572 609  THR A O   
1247 C  CB  . THR A 237 ? 0.3700 0.3795 0.4138 -0.0030 0.0115  -0.0899 609  THR A CB  
1248 O  OG1 . THR A 237 ? 0.3714 0.3701 0.3976 -0.0047 0.0120  -0.0778 609  THR A OG1 
1249 C  CG2 . THR A 237 ? 0.3674 0.4007 0.4242 -0.0058 0.0187  -0.1118 609  THR A CG2 
1250 N  N   . PRO A 238 ? 0.3609 0.3398 0.3974 -0.0009 -0.0052 -0.0622 610  PRO A N   
1251 C  CA  . PRO A 238 ? 0.3563 0.3213 0.3711 -0.0051 -0.0078 -0.0455 610  PRO A CA  
1252 C  C   . PRO A 238 ? 0.3432 0.3046 0.3368 -0.0081 -0.0001 -0.0386 610  PRO A C   
1253 O  O   . PRO A 238 ? 0.3387 0.2914 0.3225 -0.0123 -0.0031 -0.0287 610  PRO A O   
1254 C  CB  . PRO A 238 ? 0.3566 0.3270 0.3629 -0.0072 -0.0040 -0.0461 610  PRO A CB  
1255 C  CG  . PRO A 238 ? 0.3545 0.3399 0.3870 -0.0036 -0.0055 -0.0608 610  PRO A CG  
1256 C  CD  . PRO A 238 ? 0.3538 0.3485 0.3992 -0.0009 -0.0012 -0.0730 610  PRO A CD  
1257 N  N   . LEU A 239 ? 0.3359 0.3060 0.3238 -0.0076 0.0090  -0.0439 611  LEU A N   
1258 C  CA  . LEU A 239 ? 0.3406 0.3092 0.3163 -0.0087 0.0141  -0.0390 611  LEU A CA  
1259 C  C   . LEU A 239 ? 0.3471 0.3121 0.3297 -0.0091 0.0101  -0.0369 611  LEU A C   
1260 O  O   . LEU A 239 ? 0.3480 0.3100 0.3223 -0.0120 0.0116  -0.0300 611  LEU A O   
1261 C  CB  . LEU A 239 ? 0.3301 0.3079 0.3010 -0.0096 0.0197  -0.0430 611  LEU A CB  
1262 C  CG  . LEU A 239 ? 0.3515 0.3269 0.3137 -0.0096 0.0221  -0.0369 611  LEU A CG  
1263 C  CD1 . LEU A 239 ? 0.3345 0.3020 0.2905 -0.0088 0.0237  -0.0322 611  LEU A CD1 
1264 C  CD2 . LEU A 239 ? 0.3163 0.2972 0.2722 -0.0128 0.0228  -0.0362 611  LEU A CD2 
1265 N  N   . ILE A 240 ? 0.3435 0.3105 0.3436 -0.0070 0.0052  -0.0447 612  ILE A N   
1266 C  CA  . ILE A 240 ? 0.3402 0.3008 0.3498 -0.0082 -0.0010 -0.0429 612  ILE A CA  
1267 C  C   . ILE A 240 ? 0.3553 0.3022 0.3630 -0.0130 -0.0106 -0.0300 612  ILE A C   
1268 O  O   . ILE A 240 ? 0.3696 0.3120 0.3713 -0.0193 -0.0124 -0.0216 612  ILE A O   
1269 C  CB  . ILE A 240 ? 0.3337 0.2989 0.3667 -0.0045 -0.0049 -0.0578 612  ILE A CB  
1270 C  CG1 . ILE A 240 ? 0.3201 0.3007 0.3463 -0.0058 0.0046  -0.0671 612  ILE A CG1 
1271 C  CG2 . ILE A 240 ? 0.3308 0.2825 0.3802 -0.0056 -0.0167 -0.0552 612  ILE A CG2 
1272 C  CD1 . ILE A 240 ? 0.3112 0.3039 0.3577 -0.0046 0.0049  -0.0877 612  ILE A CD1 
1273 N  N   . GLN A 241 ? 0.3570 0.2991 0.3679 -0.0126 -0.0171 -0.0276 613  GLN A N   
1274 C  CA  . GLN A 241 ? 0.3862 0.3164 0.3896 -0.0209 -0.0279 -0.0126 613  GLN A CA  
1275 C  C   . GLN A 241 ? 0.3881 0.3225 0.3635 -0.0298 -0.0185 -0.0044 613  GLN A C   
1276 O  O   . GLN A 241 ? 0.4056 0.3356 0.3697 -0.0415 -0.0234 0.0072  613  GLN A O   
1277 C  CB  . GLN A 241 ? 0.3985 0.3251 0.4111 -0.0189 -0.0376 -0.0118 613  GLN A CB  
1278 C  CG  . GLN A 241 ? 0.4407 0.3615 0.4884 -0.0117 -0.0520 -0.0190 613  GLN A CG  
1279 C  CD  . GLN A 241 ? 0.4974 0.3990 0.5542 -0.0184 -0.0717 -0.0046 613  GLN A CD  
1280 O  OE1 . GLN A 241 ? 0.5423 0.4336 0.5877 -0.0283 -0.0843 0.0126  613  GLN A OE1 
1281 N  NE2 . GLN A 241 ? 0.5040 0.4002 0.5799 -0.0154 -0.0757 -0.0108 613  GLN A NE2 
1282 N  N   . ALA A 242 ? 0.3775 0.3214 0.3429 -0.0258 -0.0057 -0.0113 614  ALA A N   
1283 C  CA  . ALA A 242 ? 0.3905 0.3403 0.3366 -0.0321 0.0038  -0.0093 614  ALA A CA  
1284 C  C   . ALA A 242 ? 0.3937 0.3503 0.3401 -0.0343 0.0099  -0.0099 614  ALA A C   
1285 O  O   . ALA A 242 ? 0.4020 0.3656 0.3371 -0.0437 0.0150  -0.0075 614  ALA A O   
1286 C  CB  . ALA A 242 ? 0.3785 0.3328 0.3204 -0.0260 0.0126  -0.0171 614  ALA A CB  
1287 N  N   . THR A 243 ? 0.3878 0.3454 0.3478 -0.0271 0.0096  -0.0146 615  THR A N   
1288 C  CA  . THR A 243 ? 0.3907 0.3550 0.3544 -0.0291 0.0131  -0.0151 615  THR A CA  
1289 C  C   . THR A 243 ? 0.4170 0.3761 0.3797 -0.0405 0.0054  -0.0056 615  THR A C   
1290 O  O   . THR A 243 ? 0.4280 0.3966 0.3840 -0.0495 0.0109  -0.0031 615  THR A O   
1291 C  CB  . THR A 243 ? 0.3758 0.3426 0.3517 -0.0212 0.0129  -0.0222 615  THR A CB  
1292 O  OG1 . THR A 243 ? 0.3520 0.3229 0.3250 -0.0148 0.0179  -0.0272 615  THR A OG1 
1293 C  CG2 . THR A 243 ? 0.3569 0.3321 0.3371 -0.0234 0.0157  -0.0225 615  THR A CG2 
1294 N  N   . ALA A 244 ? 0.4287 0.3736 0.4001 -0.0414 -0.0080 -0.0007 616  ALA A N   
1295 C  CA  . ALA A 244 ? 0.4498 0.3844 0.4211 -0.0543 -0.0203 0.0121  616  ALA A CA  
1296 C  C   . ALA A 244 ? 0.4686 0.4067 0.4161 -0.0706 -0.0196 0.0238  616  ALA A C   
1297 O  O   . ALA A 244 ? 0.4919 0.4301 0.4301 -0.0871 -0.0238 0.0350  616  ALA A O   
1298 C  CB  . ALA A 244 ? 0.4536 0.3696 0.4458 -0.0500 -0.0384 0.0141  616  ALA A CB  
1299 N  N   . ALA A 245 ? 0.4699 0.4130 0.4062 -0.0682 -0.0137 0.0204  617  ALA A N   
1300 C  CA  . ALA A 245 ? 0.4838 0.4343 0.3952 -0.0850 -0.0110 0.0275  617  ALA A CA  
1301 C  C   . ALA A 245 ? 0.4822 0.4558 0.3833 -0.0900 0.0084  0.0172  617  ALA A C   
1302 O  O   . ALA A 245 ? 0.4958 0.4820 0.3764 -0.1061 0.0143  0.0184  617  ALA A O   
1303 C  CB  . ALA A 245 ? 0.4812 0.4278 0.3867 -0.0810 -0.0135 0.0261  617  ALA A CB  
1304 N  N   . ASN A 246 ? 0.4643 0.4456 0.3813 -0.0771 0.0177  0.0058  618  ASN A N   
1305 C  CA  . ASN A 246 ? 0.4638 0.4674 0.3814 -0.0772 0.0345  -0.0073 618  ASN A CA  
1306 C  C   . ASN A 246 ? 0.4623 0.4730 0.3718 -0.0751 0.0436  -0.0179 618  ASN A C   
1307 O  O   . ASN A 246 ? 0.4648 0.4955 0.3679 -0.0846 0.0555  -0.0276 618  ASN A O   
1308 C  CB  . ASN A 246 ? 0.4755 0.4968 0.3846 -0.0971 0.0396  -0.0042 618  ASN A CB  
1309 C  CG  . ASN A 246 ? 0.4733 0.5200 0.3970 -0.0926 0.0555  -0.0211 618  ASN A CG  
1310 O  OD1 . ASN A 246 ? 0.4883 0.5337 0.4314 -0.0736 0.0578  -0.0307 618  ASN A OD1 
1311 N  ND2 . ASN A 246 ? 0.4740 0.5451 0.3900 -0.1112 0.0653  -0.0247 618  ASN A ND2 
1312 N  N   . SER A 247 ? 0.4565 0.4528 0.3680 -0.0636 0.0385  -0.0182 619  SER A N   
1313 C  CA  . SER A 247 ? 0.4651 0.4641 0.3688 -0.0626 0.0446  -0.0271 619  SER A CA  
1314 C  C   . SER A 247 ? 0.4456 0.4430 0.3665 -0.0454 0.0497  -0.0388 619  SER A C   
1315 O  O   . SER A 247 ? 0.4433 0.4275 0.3697 -0.0353 0.0433  -0.0356 619  SER A O   
1316 C  CB  . SER A 247 ? 0.4776 0.4625 0.3691 -0.0665 0.0335  -0.0174 619  SER A CB  
1317 O  OG  . SER A 247 ? 0.4986 0.4890 0.3774 -0.0715 0.0397  -0.0256 619  SER A OG  
1318 N  N   . LEU A 248 ? 0.4492 0.4615 0.3801 -0.0435 0.0603  -0.0526 620  LEU A N   
1319 C  CA  . LEU A 248 ? 0.4487 0.4582 0.3978 -0.0292 0.0625  -0.0637 620  LEU A CA  
1320 C  C   . LEU A 248 ? 0.4423 0.4376 0.3839 -0.0263 0.0593  -0.0644 620  LEU A C   
1321 O  O   . LEU A 248 ? 0.4341 0.4164 0.3839 -0.0165 0.0532  -0.0614 620  LEU A O   
1322 C  CB  . LEU A 248 ? 0.4622 0.4927 0.4267 -0.0298 0.0742  -0.0824 620  LEU A CB  
1323 C  CG  . LEU A 248 ? 0.4854 0.5150 0.4808 -0.0137 0.0733  -0.0939 620  LEU A CG  
1324 C  CD1 . LEU A 248 ? 0.4872 0.5050 0.4927 -0.0041 0.0620  -0.0804 620  LEU A CD1 
1325 C  CD2 . LEU A 248 ? 0.5185 0.5758 0.5358 -0.0152 0.0853  -0.1147 620  LEU A CD2 
1326 N  N   . LEU A 249 ? 0.4516 0.4507 0.3754 -0.0377 0.0627  -0.0674 621  LEU A N   
1327 C  CA  . LEU A 249 ? 0.4534 0.4414 0.3694 -0.0372 0.0601  -0.0695 621  LEU A CA  
1328 C  C   . LEU A 249 ? 0.4353 0.4069 0.3476 -0.0331 0.0487  -0.0549 621  LEU A C   
1329 O  O   . LEU A 249 ? 0.4256 0.3865 0.3442 -0.0258 0.0456  -0.0559 621  LEU A O   
1330 C  CB  . LEU A 249 ? 0.4706 0.4692 0.3649 -0.0537 0.0650  -0.0746 621  LEU A CB  
1331 C  CG  . LEU A 249 ? 0.5092 0.5238 0.4075 -0.0576 0.0781  -0.0981 621  LEU A CG  
1332 C  CD1 . LEU A 249 ? 0.5115 0.5389 0.4375 -0.0480 0.0863  -0.1126 621  LEU A CD1 
1333 C  CD2 . LEU A 249 ? 0.5432 0.5763 0.4131 -0.0809 0.0840  -0.1006 621  LEU A CD2 
1334 N  N   . ALA A 250 ? 0.4253 0.3961 0.3302 -0.0386 0.0420  -0.0425 622  ALA A N   
1335 C  CA  . ALA A 250 ? 0.4128 0.3731 0.3209 -0.0344 0.0321  -0.0333 622  ALA A CA  
1336 C  C   . ALA A 250 ? 0.3986 0.3560 0.3216 -0.0234 0.0317  -0.0339 622  ALA A C   
1337 O  O   . ALA A 250 ? 0.4007 0.3533 0.3270 -0.0197 0.0284  -0.0332 622  ALA A O   
1338 C  CB  . ALA A 250 ? 0.4223 0.3809 0.3265 -0.0416 0.0225  -0.0218 622  ALA A CB  
1339 N  N   . CYS A 251 ? 0.3891 0.3518 0.3201 -0.0203 0.0350  -0.0353 623  CYS A N   
1340 C  CA  . CYS A 251 ? 0.3954 0.3566 0.3375 -0.0125 0.0333  -0.0350 623  CYS A CA  
1341 C  C   . CYS A 251 ? 0.3958 0.3508 0.3407 -0.0084 0.0335  -0.0383 623  CYS A C   
1342 O  O   . CYS A 251 ? 0.3939 0.3448 0.3387 -0.0077 0.0294  -0.0346 623  CYS A O   
1343 C  CB  . CYS A 251 ? 0.3932 0.3620 0.3446 -0.0104 0.0354  -0.0360 623  CYS A CB  
1344 S  SG  . CYS A 251 ? 0.4371 0.4083 0.3886 -0.0150 0.0314  -0.0299 623  CYS A SG  
1345 N  N   . GLU A 252 ? 0.3970 0.3524 0.3456 -0.0074 0.0379  -0.0463 624  GLU A N   
1346 C  CA  . GLU A 252 ? 0.4120 0.3578 0.3681 -0.0033 0.0357  -0.0504 624  GLU A CA  
1347 C  C   . GLU A 252 ? 0.4039 0.3405 0.3487 -0.0076 0.0325  -0.0468 624  GLU A C   
1348 O  O   . GLU A 252 ? 0.4081 0.3361 0.3548 -0.0074 0.0266  -0.0415 624  GLU A O   
1349 C  CB  . GLU A 252 ? 0.4287 0.3792 0.3943 -0.0019 0.0424  -0.0654 624  GLU A CB  
1350 C  CG  . GLU A 252 ? 0.4856 0.4231 0.4657 0.0035  0.0383  -0.0727 624  GLU A CG  
1351 C  CD  . GLU A 252 ? 0.5412 0.4689 0.5406 0.0113  0.0274  -0.0658 624  GLU A CD  
1352 O  OE1 . GLU A 252 ? 0.5603 0.4953 0.5634 0.0132  0.0253  -0.0589 624  GLU A OE1 
1353 O  OE2 . GLU A 252 ? 0.5769 0.4883 0.5876 0.0141  0.0190  -0.0662 624  GLU A OE2 
1354 N  N   . PHE A 253 ? 0.3944 0.3345 0.3272 -0.0136 0.0351  -0.0483 625  PHE A N   
1355 C  CA  . PHE A 253 ? 0.3944 0.3294 0.3186 -0.0181 0.0315  -0.0453 625  PHE A CA  
1356 C  C   . PHE A 253 ? 0.3760 0.3122 0.3021 -0.0181 0.0269  -0.0377 625  PHE A C   
1357 O  O   . PHE A 253 ? 0.3829 0.3143 0.3080 -0.0208 0.0243  -0.0359 625  PHE A O   
1358 C  CB  . PHE A 253 ? 0.4004 0.3406 0.3125 -0.0254 0.0317  -0.0454 625  PHE A CB  
1359 C  CG  . PHE A 253 ? 0.4139 0.3503 0.3198 -0.0303 0.0277  -0.0448 625  PHE A CG  
1360 C  CD1 . PHE A 253 ? 0.4062 0.3342 0.3125 -0.0308 0.0286  -0.0506 625  PHE A CD1 
1361 C  CD2 . PHE A 253 ? 0.4097 0.3503 0.3128 -0.0344 0.0213  -0.0386 625  PHE A CD2 
1362 C  CE1 . PHE A 253 ? 0.4194 0.3448 0.3203 -0.0367 0.0248  -0.0502 625  PHE A CE1 
1363 C  CE2 . PHE A 253 ? 0.4577 0.3974 0.3582 -0.0389 0.0169  -0.0387 625  PHE A CE2 
1364 C  CZ  . PHE A 253 ? 0.4306 0.3636 0.3283 -0.0408 0.0196  -0.0445 625  PHE A CZ  
1365 N  N   . LEU A 254 ? 0.3603 0.3042 0.2897 -0.0166 0.0263  -0.0347 626  LEU A N   
1366 C  CA  . LEU A 254 ? 0.3404 0.2908 0.2741 -0.0174 0.0241  -0.0328 626  LEU A CA  
1367 C  C   . LEU A 254 ? 0.3499 0.2988 0.2831 -0.0187 0.0233  -0.0299 626  LEU A C   
1368 O  O   . LEU A 254 ? 0.3543 0.3083 0.2848 -0.0248 0.0224  -0.0286 626  LEU A O   
1369 C  CB  . LEU A 254 ? 0.3279 0.2853 0.2689 -0.0151 0.0229  -0.0333 626  LEU A CB  
1370 C  CG  . LEU A 254 ? 0.3160 0.2728 0.2594 -0.0161 0.0184  -0.0325 626  LEU A CG  
1371 C  CD1 . LEU A 254 ? 0.2542 0.2115 0.2048 -0.0147 0.0149  -0.0304 626  LEU A CD1 
1372 C  CD2 . LEU A 254 ? 0.3054 0.2676 0.2569 -0.0173 0.0143  -0.0356 626  LEU A CD2 
1373 N  N   . LEU A 255 ? 0.3548 0.2986 0.2914 -0.0147 0.0227  -0.0283 627  LEU A N   
1374 C  CA  . LEU A 255 ? 0.3654 0.3055 0.3026 -0.0170 0.0174  -0.0219 627  LEU A CA  
1375 C  C   . LEU A 255 ? 0.3814 0.3087 0.3155 -0.0217 0.0124  -0.0179 627  LEU A C   
1376 O  O   . LEU A 255 ? 0.3925 0.3191 0.3202 -0.0305 0.0069  -0.0097 627  LEU A O   
1377 C  CB  . LEU A 255 ? 0.3636 0.3017 0.3113 -0.0103 0.0152  -0.0215 627  LEU A CB  
1378 C  CG  . LEU A 255 ? 0.3624 0.3128 0.3119 -0.0091 0.0175  -0.0223 627  LEU A CG  
1379 C  CD1 . LEU A 255 ? 0.3795 0.3312 0.3417 -0.0023 0.0184  -0.0254 627  LEU A CD1 
1380 C  CD2 . LEU A 255 ? 0.3654 0.3224 0.3091 -0.0160 0.0128  -0.0165 627  LEU A CD2 
1381 N  N   . GLN A 256 ? 0.3844 0.3024 0.3220 -0.0181 0.0140  -0.0238 628  GLN A N   
1382 C  CA  . GLN A 256 ? 0.4020 0.3056 0.3387 -0.0226 0.0087  -0.0219 628  GLN A CA  
1383 C  C   . GLN A 256 ? 0.4090 0.3195 0.3335 -0.0335 0.0095  -0.0181 628  GLN A C   
1384 O  O   . GLN A 256 ? 0.4292 0.3312 0.3494 -0.0425 0.0036  -0.0114 628  GLN A O   
1385 C  CB  . GLN A 256 ? 0.4026 0.2991 0.3449 -0.0178 0.0125  -0.0338 628  GLN A CB  
1386 C  CG  . GLN A 256 ? 0.4035 0.2958 0.3636 -0.0083 0.0125  -0.0424 628  GLN A CG  
1387 C  CD  . GLN A 256 ? 0.4487 0.3246 0.4250 -0.0056 -0.0003 -0.0358 628  GLN A CD  
1388 O  OE1 . GLN A 256 ? 0.4782 0.3413 0.4492 -0.0133 -0.0097 -0.0248 628  GLN A OE1 
1389 N  NE2 . GLN A 256 ? 0.4624 0.3394 0.4599 0.0040  -0.0023 -0.0417 628  GLN A NE2 
1390 N  N   . ASN A 257 ? 0.3983 0.3248 0.3201 -0.0332 0.0158  -0.0227 629  ASN A N   
1391 C  CA  . ASN A 257 ? 0.3952 0.3337 0.3128 -0.0418 0.0175  -0.0236 629  ASN A CA  
1392 C  C   . ASN A 257 ? 0.3919 0.3487 0.3084 -0.0480 0.0195  -0.0230 629  ASN A C   
1393 O  O   . ASN A 257 ? 0.3999 0.3745 0.3202 -0.0522 0.0233  -0.0296 629  ASN A O   
1394 C  CB  . ASN A 257 ? 0.3768 0.3210 0.2978 -0.0380 0.0200  -0.0306 629  ASN A CB  
1395 C  CG  . ASN A 257 ? 0.3893 0.3207 0.3061 -0.0393 0.0185  -0.0327 629  ASN A CG  
1396 O  OD1 . ASN A 257 ? 0.4056 0.3359 0.3197 -0.0469 0.0167  -0.0320 629  ASN A OD1 
1397 N  ND2 . ASN A 257 ? 0.3239 0.2482 0.2400 -0.0336 0.0200  -0.0367 629  ASN A ND2 
1398 N  N   . GLY A 258 ? 0.3932 0.3484 0.3067 -0.0489 0.0168  -0.0171 630  GLY A N   
1399 C  CA  . GLY A 258 ? 0.3918 0.3654 0.2987 -0.0602 0.0183  -0.0162 630  GLY A CA  
1400 C  C   . GLY A 258 ? 0.3883 0.3787 0.3019 -0.0555 0.0234  -0.0253 630  GLY A C   
1401 O  O   . GLY A 258 ? 0.3881 0.3981 0.2966 -0.0660 0.0265  -0.0291 630  GLY A O   
1402 N  N   . ALA A 259 ? 0.3802 0.3640 0.3044 -0.0419 0.0241  -0.0295 631  ALA A N   
1403 C  CA  . ALA A 259 ? 0.3706 0.3652 0.3034 -0.0371 0.0266  -0.0371 631  ALA A CA  
1404 C  C   . ALA A 259 ? 0.3788 0.3785 0.3038 -0.0429 0.0246  -0.0327 631  ALA A C   
1405 O  O   . ALA A 259 ? 0.3822 0.3690 0.3011 -0.0434 0.0185  -0.0213 631  ALA A O   
1406 C  CB  . ALA A 259 ? 0.3606 0.3440 0.3023 -0.0252 0.0254  -0.0374 631  ALA A CB  
1407 N  N   . ASN A 260 ? 0.3842 0.4037 0.3118 -0.0479 0.0289  -0.0432 632  ASN A N   
1408 C  CA  . ASN A 260 ? 0.4013 0.4301 0.3195 -0.0562 0.0272  -0.0412 632  ASN A CA  
1409 C  C   . ASN A 260 ? 0.3942 0.4142 0.3224 -0.0445 0.0246  -0.0410 632  ASN A C   
1410 O  O   . ASN A 260 ? 0.3931 0.4168 0.3355 -0.0374 0.0276  -0.0521 632  ASN A O   
1411 C  CB  . ASN A 260 ? 0.3982 0.4560 0.3165 -0.0676 0.0350  -0.0578 632  ASN A CB  
1412 C  CG  . ASN A 260 ? 0.4286 0.5002 0.3339 -0.0794 0.0338  -0.0580 632  ASN A CG  
1413 O  OD1 . ASN A 260 ? 0.4650 0.5236 0.3641 -0.0774 0.0256  -0.0447 632  ASN A OD1 
1414 N  ND2 . ASN A 260 ? 0.4357 0.5368 0.3386 -0.0927 0.0422  -0.0751 632  ASN A ND2 
1415 N  N   . VAL A 261 ? 0.4025 0.4106 0.3258 -0.0433 0.0174  -0.0280 633  VAL A N   
1416 C  CA  . VAL A 261 ? 0.3949 0.3965 0.3285 -0.0336 0.0150  -0.0268 633  VAL A CA  
1417 C  C   . VAL A 261 ? 0.3987 0.4147 0.3340 -0.0373 0.0162  -0.0350 633  VAL A C   
1418 O  O   . VAL A 261 ? 0.3977 0.4109 0.3433 -0.0305 0.0155  -0.0367 633  VAL A O   
1419 C  CB  . VAL A 261 ? 0.4016 0.3907 0.3357 -0.0315 0.0060  -0.0134 633  VAL A CB  
1420 C  CG1 . VAL A 261 ? 0.4118 0.4070 0.3338 -0.0442 -0.0033 -0.0036 633  VAL A CG1 
1421 C  CG2 . VAL A 261 ? 0.3952 0.3803 0.3446 -0.0204 0.0061  -0.0150 633  VAL A CG2 
1422 N  N   . ASN A 262 ? 0.4118 0.4451 0.3369 -0.0499 0.0187  -0.0415 634  ASN A N   
1423 C  CA  . ASN A 262 ? 0.4225 0.4726 0.3476 -0.0562 0.0205  -0.0527 634  ASN A CA  
1424 C  C   . ASN A 262 ? 0.4265 0.4900 0.3662 -0.0544 0.0290  -0.0751 634  ASN A C   
1425 O  O   . ASN A 262 ? 0.4443 0.5207 0.3890 -0.0580 0.0308  -0.0886 634  ASN A O   
1426 C  CB  . ASN A 262 ? 0.4342 0.4994 0.3366 -0.0754 0.0170  -0.0470 634  ASN A CB  
1427 C  CG  . ASN A 262 ? 0.4387 0.4919 0.3342 -0.0766 0.0038  -0.0268 634  ASN A CG  
1428 O  OD1 . ASN A 262 ? 0.4624 0.5132 0.3420 -0.0885 -0.0049 -0.0113 634  ASN A OD1 
1429 N  ND2 . ASN A 262 ? 0.4199 0.4660 0.3298 -0.0654 0.0006  -0.0263 634  ASN A ND2 
1430 N  N   . GLN A 263 ? 0.4151 0.4763 0.3646 -0.0491 0.0328  -0.0805 635  GLN A N   
1431 C  CA  . GLN A 263 ? 0.4090 0.4846 0.3794 -0.0468 0.0385  -0.1034 635  GLN A CA  
1432 C  C   . GLN A 263 ? 0.3975 0.4610 0.3907 -0.0347 0.0340  -0.1098 635  GLN A C   
1433 O  O   . GLN A 263 ? 0.3848 0.4269 0.3841 -0.0249 0.0282  -0.0978 635  GLN A O   
1434 C  CB  . GLN A 263 ? 0.4023 0.4796 0.3814 -0.0441 0.0413  -0.1069 635  GLN A CB  
1435 C  CG  . GLN A 263 ? 0.4325 0.5306 0.4390 -0.0426 0.0465  -0.1338 635  GLN A CG  
1436 C  CD  . GLN A 263 ? 0.4635 0.5638 0.4824 -0.0391 0.0473  -0.1363 635  GLN A CD  
1437 O  OE1 . GLN A 263 ? 0.4771 0.5769 0.4765 -0.0465 0.0491  -0.1239 635  GLN A OE1 
1438 N  NE2 . GLN A 263 ? 0.4631 0.5648 0.5168 -0.0282 0.0439  -0.1519 635  GLN A NE2 
1439 N  N   . ALA A 264 ? 0.3912 0.4699 0.3960 -0.0381 0.0364  -0.1294 636  ALA A N   
1440 C  CA  . ALA A 264 ? 0.3922 0.4596 0.4192 -0.0297 0.0306  -0.1367 636  ALA A CA  
1441 C  C   . ALA A 264 ? 0.3869 0.4511 0.4496 -0.0197 0.0272  -0.1535 636  ALA A C   
1442 O  O   . ALA A 264 ? 0.3851 0.4662 0.4599 -0.0203 0.0325  -0.1689 636  ALA A O   
1443 C  CB  . ALA A 264 ? 0.3962 0.4802 0.4192 -0.0390 0.0332  -0.1506 636  ALA A CB  
1444 N  N   . ASP A 265 ? 0.3816 0.4244 0.4631 -0.0115 0.0169  -0.1500 637  ASP A N   
1445 C  CA  . ASP A 265 ? 0.3903 0.4263 0.5115 -0.0022 0.0083  -0.1656 637  ASP A CA  
1446 C  C   . ASP A 265 ? 0.3973 0.4523 0.5433 -0.0038 0.0120  -0.1981 637  ASP A C   
1447 O  O   . ASP A 265 ? 0.4045 0.4817 0.5311 -0.0145 0.0228  -0.2078 637  ASP A O   
1448 C  CB  . ASP A 265 ? 0.3887 0.3926 0.5186 0.0034  -0.0070 -0.1462 637  ASP A CB  
1449 C  CG  . ASP A 265 ? 0.4146 0.4095 0.5396 -0.0007 -0.0103 -0.1420 637  ASP A CG  
1450 O  OD1 . ASP A 265 ? 0.3984 0.4087 0.5271 -0.0047 -0.0047 -0.1609 637  ASP A OD1 
1451 O  OD2 . ASP A 265 ? 0.4339 0.4078 0.5509 -0.0017 -0.0186 -0.1203 637  ASP A OD2 
1452 N  N   . SER A 266 ? 0.4031 0.4493 0.5931 0.0059  0.0015  -0.2151 638  SER A N   
1453 C  CA  . SER A 266 ? 0.4156 0.4783 0.6389 0.0066  0.0037  -0.2514 638  SER A CA  
1454 C  C   . SER A 266 ? 0.4236 0.4840 0.6353 -0.0006 0.0042  -0.2545 638  SER A C   
1455 O  O   . SER A 266 ? 0.4358 0.5195 0.6611 -0.0055 0.0119  -0.2864 638  SER A O   
1456 C  CB  . SER A 266 ? 0.4193 0.4631 0.6977 0.0209  -0.0138 -0.2637 638  SER A CB  
1457 O  OG  . SER A 266 ? 0.4369 0.4973 0.7384 0.0269  -0.0114 -0.2772 638  SER A OG  
1458 N  N   . ALA A 267 ? 0.4161 0.4510 0.6052 -0.0022 -0.0037 -0.2239 639  ALA A N   
1459 C  CA  . ALA A 267 ? 0.4163 0.4477 0.5947 -0.0094 -0.0049 -0.2230 639  ALA A CA  
1460 C  C   . ALA A 267 ? 0.4070 0.4561 0.5391 -0.0215 0.0066  -0.2091 639  ALA A C   
1461 O  O   . ALA A 267 ? 0.4127 0.4564 0.5300 -0.0273 0.0040  -0.1983 639  ALA A O   
1462 C  CB  . ALA A 267 ? 0.4155 0.4111 0.6015 -0.0059 -0.0216 -0.1993 639  ALA A CB  
1463 N  N   . GLY A 268 ? 0.4007 0.4702 0.5123 -0.0259 0.0175  -0.2085 640  GLY A N   
1464 C  CA  . GLY A 268 ? 0.3928 0.4768 0.4634 -0.0382 0.0246  -0.1936 640  GLY A CA  
1465 C  C   . GLY A 268 ? 0.3878 0.4508 0.4378 -0.0354 0.0188  -0.1596 640  GLY A C   
1466 O  O   . GLY A 268 ? 0.3877 0.4578 0.4118 -0.0435 0.0199  -0.1464 640  GLY A O   
1467 N  N   . ARG A 269 ? 0.3755 0.4144 0.4386 -0.0250 0.0116  -0.1463 641  ARG A N   
1468 C  CA  . ARG A 269 ? 0.3722 0.3954 0.4193 -0.0235 0.0080  -0.1193 641  ARG A CA  
1469 C  C   . ARG A 269 ? 0.3711 0.3935 0.4037 -0.0212 0.0119  -0.1068 641  ARG A C   
1470 O  O   . ARG A 269 ? 0.3689 0.3834 0.4128 -0.0154 0.0101  -0.1075 641  ARG A O   
1471 C  CB  . ARG A 269 ? 0.3792 0.3790 0.4435 -0.0190 -0.0021 -0.1109 641  ARG A CB  
1472 C  CG  . ARG A 269 ? 0.3867 0.3826 0.4699 -0.0216 -0.0084 -0.1236 641  ARG A CG  
1473 C  CD  . ARG A 269 ? 0.3776 0.3475 0.4791 -0.0197 -0.0215 -0.1134 641  ARG A CD  
1474 N  NE  . ARG A 269 ? 0.4066 0.3646 0.5269 -0.0125 -0.0284 -0.1155 641  ARG A NE  
1475 C  CZ  . ARG A 269 ? 0.4169 0.3506 0.5571 -0.0115 -0.0440 -0.1072 641  ARG A CZ  
1476 N  NH1 . ARG A 269 ? 0.4226 0.3415 0.5643 -0.0188 -0.0528 -0.0964 641  ARG A NH1 
1477 N  NH2 . ARG A 269 ? 0.4060 0.3301 0.5649 -0.0048 -0.0524 -0.1084 641  ARG A NH2 
1478 N  N   . GLY A 270 ? 0.3722 0.4021 0.3818 -0.0262 0.0153  -0.0953 642  GLY A N   
1479 C  CA  . GLY A 270 ? 0.3698 0.3966 0.3657 -0.0248 0.0177  -0.0827 642  GLY A CA  
1480 C  C   . GLY A 270 ? 0.3684 0.3788 0.3638 -0.0190 0.0148  -0.0666 642  GLY A C   
1481 O  O   . GLY A 270 ? 0.3704 0.3736 0.3740 -0.0180 0.0113  -0.0639 642  GLY A O   
1482 N  N   . PRO A 271 ? 0.3702 0.3761 0.3558 -0.0171 0.0167  -0.0572 643  PRO A N   
1483 C  CA  . PRO A 271 ? 0.3596 0.3542 0.3444 -0.0132 0.0162  -0.0461 643  PRO A CA  
1484 C  C   . PRO A 271 ? 0.3554 0.3527 0.3417 -0.0139 0.0153  -0.0405 643  PRO A C   
1485 O  O   . PRO A 271 ? 0.3572 0.3508 0.3476 -0.0139 0.0157  -0.0364 643  PRO A O   
1486 C  CB  . PRO A 271 ? 0.3540 0.3463 0.3289 -0.0121 0.0187  -0.0412 643  PRO A CB  
1487 C  CG  . PRO A 271 ? 0.3690 0.3680 0.3427 -0.0149 0.0201  -0.0495 643  PRO A CG  
1488 C  CD  . PRO A 271 ? 0.3654 0.3769 0.3429 -0.0195 0.0200  -0.0596 643  PRO A CD  
1489 N  N   . LEU A 272 ? 0.3581 0.3642 0.3413 -0.0162 0.0133  -0.0399 644  LEU A N   
1490 C  CA  . LEU A 272 ? 0.3594 0.3710 0.3488 -0.0165 0.0106  -0.0357 644  LEU A CA  
1491 C  C   . LEU A 272 ? 0.3630 0.3763 0.3608 -0.0197 0.0095  -0.0404 644  LEU A C   
1492 O  O   . LEU A 272 ? 0.3660 0.3803 0.3714 -0.0202 0.0101  -0.0370 644  LEU A O   
1493 C  CB  . LEU A 272 ? 0.3634 0.3828 0.3475 -0.0199 0.0047  -0.0318 644  LEU A CB  
1494 C  CG  . LEU A 272 ? 0.3723 0.3988 0.3670 -0.0192 -0.0014 -0.0265 644  LEU A CG  
1495 C  CD1 . LEU A 272 ? 0.3241 0.3487 0.3333 -0.0114 0.0012  -0.0244 644  LEU A CD1 
1496 C  CD2 . LEU A 272 ? 0.3436 0.3748 0.3305 -0.0248 -0.0117 -0.0189 644  LEU A CD2 
1497 N  N   . HIS A 273 ? 0.3622 0.3768 0.3606 -0.0230 0.0082  -0.0499 645  HIS A N   
1498 C  CA  . HIS A 273 ? 0.3693 0.3805 0.3792 -0.0257 0.0053  -0.0554 645  HIS A CA  
1499 C  C   . HIS A 273 ? 0.3715 0.3695 0.3871 -0.0250 0.0043  -0.0487 645  HIS A C   
1500 O  O   . HIS A 273 ? 0.3701 0.3667 0.3914 -0.0297 0.0019  -0.0444 645  HIS A O   
1501 C  CB  . HIS A 273 ? 0.3713 0.3844 0.3873 -0.0276 0.0042  -0.0713 645  HIS A CB  
1502 C  CG  . HIS A 273 ? 0.3853 0.4152 0.3930 -0.0341 0.0049  -0.0796 645  HIS A CG  
1503 N  ND1 . HIS A 273 ? 0.4222 0.4635 0.4166 -0.0378 0.0086  -0.0835 645  HIS A ND1 
1504 C  CD2 . HIS A 273 ? 0.4014 0.4403 0.4100 -0.0406 0.0016  -0.0841 645  HIS A CD2 
1505 C  CE1 . HIS A 273 ? 0.4388 0.4959 0.4239 -0.0476 0.0073  -0.0893 645  HIS A CE1 
1506 N  NE2 . HIS A 273 ? 0.4345 0.4903 0.4284 -0.0487 0.0030  -0.0903 645  HIS A NE2 
1507 N  N   . HIS A 274 ? 0.3699 0.3596 0.3823 -0.0216 0.0054  -0.0466 646  HIS A N   
1508 C  CA  . HIS A 274 ? 0.3815 0.3592 0.3955 -0.0245 0.0022  -0.0382 646  HIS A CA  
1509 C  C   . HIS A 274 ? 0.3810 0.3651 0.3872 -0.0286 0.0074  -0.0290 646  HIS A C   
1510 O  O   . HIS A 274 ? 0.3951 0.3766 0.4019 -0.0370 0.0050  -0.0224 646  HIS A O   
1511 C  CB  . HIS A 274 ? 0.3823 0.3505 0.3959 -0.0210 -0.0001 -0.0380 646  HIS A CB  
1512 C  CG  . HIS A 274 ? 0.3944 0.3575 0.4249 -0.0175 -0.0065 -0.0497 646  HIS A CG  
1513 N  ND1 . HIS A 274 ? 0.4239 0.3723 0.4717 -0.0193 -0.0183 -0.0493 646  HIS A ND1 
1514 C  CD2 . HIS A 274 ? 0.3974 0.3701 0.4332 -0.0131 -0.0031 -0.0641 646  HIS A CD2 
1515 C  CE1 . HIS A 274 ? 0.4294 0.3783 0.4973 -0.0135 -0.0218 -0.0655 646  HIS A CE1 
1516 N  NE2 . HIS A 274 ? 0.4002 0.3665 0.4599 -0.0105 -0.0111 -0.0758 646  HIS A NE2 
1517 N  N   . ALA A 275 ? 0.3784 0.3720 0.3792 -0.0239 0.0139  -0.0297 647  ALA A N   
1518 C  CA  . ALA A 275 ? 0.3838 0.3878 0.3842 -0.0263 0.0201  -0.0268 647  ALA A CA  
1519 C  C   . ALA A 275 ? 0.3854 0.4003 0.3952 -0.0321 0.0196  -0.0266 647  ALA A C   
1520 O  O   . ALA A 275 ? 0.3916 0.4148 0.4019 -0.0404 0.0237  -0.0242 647  ALA A O   
1521 C  CB  . ALA A 275 ? 0.3710 0.3810 0.3724 -0.0181 0.0237  -0.0298 647  ALA A CB  
1522 N  N   . THR A 276 ? 0.3891 0.4066 0.4054 -0.0299 0.0150  -0.0299 648  THR A N   
1523 C  CA  . THR A 276 ? 0.3976 0.4266 0.4243 -0.0352 0.0134  -0.0303 648  THR A CA  
1524 C  C   . THR A 276 ? 0.4056 0.4256 0.4335 -0.0455 0.0088  -0.0275 648  THR A C   
1525 O  O   . THR A 276 ? 0.4197 0.4491 0.4522 -0.0547 0.0105  -0.0241 648  THR A O   
1526 C  CB  . THR A 276 ? 0.3931 0.4305 0.4248 -0.0311 0.0087  -0.0337 648  THR A CB  
1527 O  OG1 . THR A 276 ? 0.4288 0.4759 0.4705 -0.0375 0.0053  -0.0347 648  THR A OG1 
1528 C  CG2 . THR A 276 ? 0.4208 0.4495 0.4439 -0.0295 0.0051  -0.0379 648  THR A CG2 
1529 N  N   . ILE A 277 ? 0.4006 0.4030 0.4271 -0.0449 0.0024  -0.0289 649  ILE A N   
1530 C  CA  . ILE A 277 ? 0.4082 0.3961 0.4393 -0.0545 -0.0058 -0.0239 649  ILE A CA  
1531 C  C   . ILE A 277 ? 0.4177 0.4064 0.4395 -0.0657 -0.0035 -0.0117 649  ILE A C   
1532 O  O   . ILE A 277 ? 0.4320 0.4211 0.4553 -0.0792 -0.0069 -0.0048 649  ILE A O   
1533 C  CB  . ILE A 277 ? 0.4173 0.3848 0.4548 -0.0499 -0.0148 -0.0282 649  ILE A CB  
1534 C  CG1 . ILE A 277 ? 0.4031 0.3719 0.4525 -0.0449 -0.0176 -0.0437 649  ILE A CG1 
1535 C  CG2 . ILE A 277 ? 0.4288 0.3761 0.4716 -0.0603 -0.0272 -0.0172 649  ILE A CG2 
1536 C  CD1 . ILE A 277 ? 0.3886 0.3514 0.4446 -0.0362 -0.0192 -0.0552 649  ILE A CD1 
1537 N  N   . LEU A 278 ? 0.4161 0.4067 0.4268 -0.0626 0.0024  -0.0096 650  LEU A N   
1538 C  CA  . LEU A 278 ? 0.4293 0.4216 0.4272 -0.0764 0.0041  0.0008  650  LEU A CA  
1539 C  C   . LEU A 278 ? 0.4331 0.4528 0.4287 -0.0828 0.0178  -0.0026 650  LEU A C   
1540 O  O   . LEU A 278 ? 0.4505 0.4787 0.4336 -0.0981 0.0220  0.0033  650  LEU A O   
1541 C  CB  . LEU A 278 ? 0.4230 0.4038 0.4100 -0.0728 0.0023  0.0039  650  LEU A CB  
1542 C  CG  . LEU A 278 ? 0.4318 0.3876 0.4258 -0.0689 -0.0128 0.0074  650  LEU A CG  
1543 C  CD1 . LEU A 278 ? 0.4193 0.3702 0.4063 -0.0616 -0.0122 0.0066  650  LEU A CD1 
1544 C  CD2 . LEU A 278 ? 0.4468 0.3864 0.4405 -0.0852 -0.0276 0.0224  650  LEU A CD2 
1545 N  N   . GLY A 279 ? 0.4259 0.4613 0.4349 -0.0725 0.0237  -0.0127 651  GLY A N   
1546 C  CA  . GLY A 279 ? 0.4274 0.4913 0.4448 -0.0751 0.0355  -0.0201 651  GLY A CA  
1547 C  C   . GLY A 279 ? 0.4339 0.5067 0.4471 -0.0700 0.0454  -0.0272 651  GLY A C   
1548 O  O   . GLY A 279 ? 0.4484 0.5447 0.4638 -0.0786 0.0564  -0.0340 651  GLY A O   
1549 N  N   . HIS A 280 ? 0.4253 0.4813 0.4331 -0.0574 0.0420  -0.0275 652  HIS A N   
1550 C  CA  . HIS A 280 ? 0.4220 0.4822 0.4261 -0.0521 0.0497  -0.0346 652  HIS A CA  
1551 C  C   . HIS A 280 ? 0.4088 0.4765 0.4332 -0.0362 0.0509  -0.0445 652  HIS A C   
1552 O  O   . HIS A 280 ? 0.4088 0.4612 0.4324 -0.0252 0.0443  -0.0424 652  HIS A O   
1553 C  CB  . HIS A 280 ? 0.4184 0.4563 0.4053 -0.0501 0.0442  -0.0281 652  HIS A CB  
1554 C  CG  . HIS A 280 ? 0.4377 0.4672 0.4071 -0.0662 0.0396  -0.0169 652  HIS A CG  
1555 N  ND1 . HIS A 280 ? 0.4443 0.4508 0.4068 -0.0650 0.0280  -0.0080 652  HIS A ND1 
1556 C  CD2 . HIS A 280 ? 0.4526 0.4943 0.4111 -0.0856 0.0434  -0.0124 652  HIS A CD2 
1557 C  CE1 . HIS A 280 ? 0.4643 0.4655 0.4136 -0.0818 0.0220  0.0037  652  HIS A CE1 
1558 N  NE2 . HIS A 280 ? 0.4748 0.4971 0.4183 -0.0963 0.0313  0.0025  652  HIS A NE2 
1559 N  N   . THR A 281 ? 0.4055 0.4980 0.4498 -0.0367 0.0582  -0.0551 653  THR A N   
1560 C  CA  . THR A 281 ? 0.3961 0.4973 0.4682 -0.0222 0.0557  -0.0640 653  THR A CA  
1561 C  C   . THR A 281 ? 0.3928 0.4825 0.4681 -0.0102 0.0546  -0.0691 653  THR A C   
1562 O  O   . THR A 281 ? 0.3826 0.4594 0.4658 0.0008  0.0437  -0.0645 653  THR A O   
1563 C  CB  . THR A 281 ? 0.4018 0.5366 0.5009 -0.0258 0.0648  -0.0781 653  THR A CB  
1564 O  OG1 . THR A 281 ? 0.4059 0.5492 0.5032 -0.0372 0.0632  -0.0712 653  THR A OG1 
1565 C  CG2 . THR A 281 ? 0.3940 0.5369 0.5295 -0.0092 0.0586  -0.0875 653  THR A CG2 
1566 N  N   . GLY A 282 ? 0.4018 0.4962 0.4689 -0.0149 0.0649  -0.0777 654  GLY A N   
1567 C  CA  . GLY A 282 ? 0.4085 0.4894 0.4752 -0.0060 0.0642  -0.0828 654  GLY A CA  
1568 C  C   . GLY A 282 ? 0.4093 0.4616 0.4575 -0.0013 0.0531  -0.0681 654  GLY A C   
1569 O  O   . GLY A 282 ? 0.4033 0.4435 0.4614 0.0091  0.0452  -0.0675 654  GLY A O   
1570 N  N   . LEU A 283 ? 0.4116 0.4540 0.4354 -0.0099 0.0513  -0.0566 655  LEU A N   
1571 C  CA  . LEU A 283 ? 0.4103 0.4317 0.4202 -0.0066 0.0427  -0.0466 655  LEU A CA  
1572 C  C   . LEU A 283 ? 0.4113 0.4295 0.4300 -0.0007 0.0333  -0.0414 655  LEU A C   
1573 O  O   . LEU A 283 ? 0.4127 0.4196 0.4272 0.0033  0.0270  -0.0372 655  LEU A O   
1574 C  CB  . LEU A 283 ? 0.4081 0.4215 0.3990 -0.0157 0.0413  -0.0386 655  LEU A CB  
1575 C  CG  . LEU A 283 ? 0.4215 0.4342 0.3969 -0.0250 0.0460  -0.0383 655  LEU A CG  
1576 C  CD1 . LEU A 283 ? 0.4168 0.4150 0.3801 -0.0299 0.0378  -0.0281 655  LEU A CD1 
1577 C  CD2 . LEU A 283 ? 0.4263 0.4363 0.3993 -0.0206 0.0500  -0.0454 655  LEU A CD2 
1578 N  N   . ALA A 284 ? 0.4134 0.4431 0.4424 -0.0028 0.0320  -0.0412 656  ALA A N   
1579 C  CA  . ALA A 284 ? 0.4197 0.4495 0.4558 0.0003  0.0221  -0.0364 656  ALA A CA  
1580 C  C   . ALA A 284 ? 0.4296 0.4566 0.4805 0.0089  0.0150  -0.0364 656  ALA A C   
1581 O  O   . ALA A 284 ? 0.4361 0.4534 0.4803 0.0091  0.0050  -0.0283 656  ALA A O   
1582 C  CB  . ALA A 284 ? 0.4210 0.4664 0.4699 -0.0035 0.0219  -0.0378 656  ALA A CB  
1583 N  N   . CYS A 285 ? 0.4357 0.4719 0.5077 0.0143  0.0196  -0.0463 657  CYS A N   
1584 C  CA  . CYS A 285 ? 0.4572 0.4894 0.5534 0.0243  0.0103  -0.0486 657  CYS A CA  
1585 C  C   . CYS A 285 ? 0.4493 0.4603 0.5317 0.0258  0.0064  -0.0437 657  CYS A C   
1586 O  O   . CYS A 285 ? 0.4580 0.4563 0.5455 0.0285  -0.0082 -0.0345 657  CYS A O   
1587 C  CB  . CYS A 285 ? 0.4560 0.5074 0.5847 0.0304  0.0180  -0.0665 657  CYS A CB  
1588 S  SG  . CYS A 285 ? 0.5886 0.6326 0.7584 0.0456  0.0046  -0.0738 657  CYS A SG  
1589 N  N   . LEU A 286 ? 0.4339 0.4411 0.4972 0.0217  0.0176  -0.0480 658  LEU A N   
1590 C  CA  . LEU A 286 ? 0.4333 0.4224 0.4804 0.0207  0.0150  -0.0431 658  LEU A CA  
1591 C  C   . LEU A 286 ? 0.4356 0.4152 0.4648 0.0153  0.0052  -0.0285 658  LEU A C   
1592 O  O   . LEU A 286 ? 0.4474 0.4143 0.4759 0.0152  -0.0050 -0.0210 658  LEU A O   
1593 C  CB  . LEU A 286 ? 0.4275 0.4167 0.4555 0.0152  0.0270  -0.0483 658  LEU A CB  
1594 C  CG  . LEU A 286 ? 0.4459 0.4192 0.4560 0.0127  0.0252  -0.0436 658  LEU A CG  
1595 C  CD1 . LEU A 286 ? 0.4584 0.4206 0.4825 0.0185  0.0205  -0.0485 658  LEU A CD1 
1596 C  CD2 . LEU A 286 ? 0.4451 0.4210 0.4373 0.0061  0.0343  -0.0465 658  LEU A CD2 
1597 N  N   . PHE A 287 ? 0.4229 0.4098 0.4388 0.0093  0.0079  -0.0255 659  PHE A N   
1598 C  CA  . PHE A 287 ? 0.4258 0.4095 0.4243 0.0021  0.0019  -0.0170 659  PHE A CA  
1599 C  C   . PHE A 287 ? 0.4418 0.4253 0.4459 0.0001  -0.0122 -0.0074 659  PHE A C   
1600 O  O   . PHE A 287 ? 0.4542 0.4324 0.4436 -0.0078 -0.0196 0.0015  659  PHE A O   
1601 C  CB  . PHE A 287 ? 0.4145 0.4062 0.4029 -0.0031 0.0077  -0.0204 659  PHE A CB  
1602 C  CG  . PHE A 287 ? 0.3879 0.3768 0.3713 -0.0028 0.0165  -0.0259 659  PHE A CG  
1603 C  CD1 . PHE A 287 ? 0.3962 0.3768 0.3734 -0.0019 0.0193  -0.0266 659  PHE A CD1 
1604 C  CD2 . PHE A 287 ? 0.3629 0.3564 0.3478 -0.0052 0.0196  -0.0288 659  PHE A CD2 
1605 C  CE1 . PHE A 287 ? 0.3835 0.3618 0.3554 -0.0033 0.0245  -0.0296 659  PHE A CE1 
1606 C  CE2 . PHE A 287 ? 0.3792 0.3680 0.3595 -0.0071 0.0234  -0.0302 659  PHE A CE2 
1607 C  CZ  . PHE A 287 ? 0.3751 0.3570 0.3483 -0.0063 0.0256  -0.0302 659  PHE A CZ  
1608 N  N   . LEU A 288 ? 0.4522 0.4430 0.4774 0.0054  -0.0170 -0.0084 660  LEU A N   
1609 C  CA  . LEU A 288 ? 0.4743 0.4645 0.5086 0.0037  -0.0344 0.0026  660  LEU A CA  
1610 C  C   . LEU A 288 ? 0.4962 0.4691 0.5398 0.0065  -0.0473 0.0105  660  LEU A C   
1611 O  O   . LEU A 288 ? 0.5176 0.4825 0.5508 -0.0025 -0.0630 0.0259  660  LEU A O   
1612 C  CB  . LEU A 288 ? 0.4685 0.4726 0.5295 0.0099  -0.0373 -0.0019 660  LEU A CB  
1613 C  CG  . LEU A 288 ? 0.4744 0.4931 0.5242 0.0031  -0.0304 -0.0052 660  LEU A CG  
1614 C  CD1 . LEU A 288 ? 0.4644 0.4992 0.5408 0.0088  -0.0262 -0.0141 660  LEU A CD1 
1615 C  CD2 . LEU A 288 ? 0.4725 0.4942 0.5049 -0.0088 -0.0426 0.0056  660  LEU A CD2 
1616 N  N   . LYS A 289 ? 0.5022 0.4691 0.5641 0.0170  -0.0413 -0.0001 661  LYS A N   
1617 C  CA  . LYS A 289 ? 0.5246 0.4721 0.5989 0.0206  -0.0532 0.0044  661  LYS A CA  
1618 C  C   . LYS A 289 ? 0.5365 0.4704 0.5790 0.0082  -0.0555 0.0162  661  LYS A C   
1619 O  O   . LYS A 289 ? 0.5542 0.4702 0.5999 0.0046  -0.0720 0.0284  661  LYS A O   
1620 C  CB  . LYS A 289 ? 0.5209 0.4684 0.6186 0.0326  -0.0422 -0.0148 661  LYS A CB  
1621 C  CG  . LYS A 289 ? 0.5387 0.5012 0.6766 0.0443  -0.0427 -0.0284 661  LYS A CG  
1622 C  CD  . LYS A 289 ? 0.5633 0.5370 0.7152 0.0509  -0.0242 -0.0522 661  LYS A CD  
1623 C  CE  . LYS A 289 ? 0.6027 0.5608 0.7828 0.0603  -0.0316 -0.0622 661  LYS A CE  
1624 N  NZ  . LYS A 289 ? 0.6073 0.5812 0.8008 0.0645  -0.0122 -0.0893 661  LYS A NZ  
1625 N  N   . ARG A 290 ? 0.5222 0.4651 0.5371 0.0009  -0.0404 0.0124  662  ARG A N   
1626 C  CA  . ARG A 290 ? 0.5324 0.4690 0.5207 -0.0113 -0.0397 0.0196  662  ARG A CA  
1627 C  C   . ARG A 290 ? 0.5349 0.4830 0.4984 -0.0270 -0.0427 0.0286  662  ARG A C   
1628 O  O   . ARG A 290 ? 0.5368 0.4907 0.4789 -0.0374 -0.0351 0.0273  662  ARG A O   
1629 C  CB  . ARG A 290 ? 0.5230 0.4626 0.5024 -0.0088 -0.0223 0.0069  662  ARG A CB  
1630 C  CG  . ARG A 290 ? 0.5491 0.4804 0.5466 0.0025  -0.0177 -0.0038 662  ARG A CG  
1631 C  CD  . ARG A 290 ? 0.6295 0.5431 0.6243 -0.0004 -0.0230 -0.0003 662  ARG A CD  
1632 N  NE  . ARG A 290 ? 0.6712 0.5843 0.6697 0.0056  -0.0110 -0.0149 662  ARG A NE  
1633 C  CZ  . ARG A 290 ? 0.7028 0.6076 0.6903 0.0012  -0.0082 -0.0163 662  ARG A CZ  
1634 N  NH1 . ARG A 290 ? 0.7086 0.6159 0.6982 0.0052  0.0023  -0.0300 662  ARG A NH1 
1635 N  NH2 . ARG A 290 ? 0.7061 0.6025 0.6793 -0.0094 -0.0156 -0.0043 662  ARG A NH2 
1636 N  N   . GLY A 291 ? 0.5413 0.4959 0.5091 -0.0297 -0.0532 0.0356  663  GLY A N   
1637 C  CA  . GLY A 291 ? 0.5442 0.5116 0.4869 -0.0479 -0.0579 0.0439  663  GLY A CA  
1638 C  C   . GLY A 291 ? 0.5219 0.5104 0.4526 -0.0515 -0.0424 0.0298  663  GLY A C   
1639 O  O   . GLY A 291 ? 0.5307 0.5328 0.4383 -0.0679 -0.0400 0.0296  663  GLY A O   
1640 N  N   . ALA A 292 ? 0.4946 0.4868 0.4418 -0.0380 -0.0323 0.0170  664  ALA A N   
1641 C  CA  . ALA A 292 ? 0.4851 0.4934 0.4263 -0.0412 -0.0222 0.0048  664  ALA A CA  
1642 C  C   . ALA A 292 ? 0.4976 0.5187 0.4299 -0.0531 -0.0315 0.0099  664  ALA A C   
1643 O  O   . ALA A 292 ? 0.5017 0.5194 0.4441 -0.0516 -0.0454 0.0211  664  ALA A O   
1644 C  CB  . ALA A 292 ? 0.4643 0.4717 0.4242 -0.0277 -0.0138 -0.0052 664  ALA A CB  
1645 N  N   . ASP A 293 ? 0.5096 0.5470 0.4253 -0.0652 -0.0247 0.0000  665  ASP A N   
1646 C  CA  . ASP A 293 ? 0.5340 0.5874 0.4376 -0.0794 -0.0317 0.0013  665  ASP A CA  
1647 C  C   . ASP A 293 ? 0.5280 0.5838 0.4503 -0.0700 -0.0321 -0.0046 665  ASP A C   
1648 O  O   . ASP A 293 ? 0.5182 0.5766 0.4499 -0.0635 -0.0209 -0.0201 665  ASP A O   
1649 C  CB  . ASP A 293 ? 0.5467 0.6208 0.4306 -0.0952 -0.0211 -0.0142 665  ASP A CB  
1650 C  CG  . ASP A 293 ? 0.5946 0.6888 0.4605 -0.1143 -0.0276 -0.0146 665  ASP A CG  
1651 O  OD1 . ASP A 293 ? 0.6181 0.7091 0.4870 -0.1151 -0.0422 -0.0010 665  ASP A OD1 
1652 O  OD2 . ASP A 293 ? 0.6586 0.7748 0.5084 -0.1298 -0.0179 -0.0306 665  ASP A OD2 
1653 N  N   . LEU A 294 ? 0.5412 0.5955 0.4713 -0.0699 -0.0471 0.0088  666  LEU A N   
1654 C  CA  . LEU A 294 ? 0.5352 0.5950 0.4838 -0.0635 -0.0495 0.0050  666  LEU A CA  
1655 C  C   . LEU A 294 ? 0.5336 0.6101 0.4710 -0.0748 -0.0445 -0.0085 666  LEU A C   
1656 O  O   . LEU A 294 ? 0.5218 0.6003 0.4743 -0.0682 -0.0386 -0.0190 666  LEU A O   
1657 C  CB  . LEU A 294 ? 0.5603 0.6192 0.5195 -0.0645 -0.0700 0.0225  666  LEU A CB  
1658 C  CG  . LEU A 294 ? 0.5688 0.6177 0.5619 -0.0463 -0.0747 0.0265  666  LEU A CG  
1659 C  CD1 . LEU A 294 ? 0.6030 0.6480 0.6062 -0.0493 -0.0994 0.0454  666  LEU A CD1 
1660 C  CD2 . LEU A 294 ? 0.5765 0.6360 0.5905 -0.0384 -0.0664 0.0144  666  LEU A CD2 
1661 N  N   . GLY A 295 ? 0.5450 0.6346 0.4559 -0.0938 -0.0474 -0.0086 667  GLY A N   
1662 C  CA  . GLY A 295 ? 0.5415 0.6502 0.4413 -0.1072 -0.0441 -0.0236 667  GLY A CA  
1663 C  C   . GLY A 295 ? 0.5276 0.6443 0.4260 -0.1083 -0.0264 -0.0493 667  GLY A C   
1664 O  O   . GLY A 295 ? 0.5432 0.6773 0.4344 -0.1200 -0.0228 -0.0663 667  GLY A O   
1665 N  N   . ALA A 296 ? 0.5013 0.6061 0.4095 -0.0960 -0.0164 -0.0540 668  ALA A N   
1666 C  CA  . ALA A 296 ? 0.4863 0.5994 0.3982 -0.0966 -0.0025 -0.0785 668  ALA A CA  
1667 C  C   . ALA A 296 ? 0.4691 0.5787 0.4036 -0.0884 0.0006  -0.0950 668  ALA A C   
1668 O  O   . ALA A 296 ? 0.4518 0.5450 0.4034 -0.0758 -0.0030 -0.0864 668  ALA A O   
1669 C  CB  . ALA A 296 ? 0.4677 0.5693 0.3858 -0.0864 0.0047  -0.0778 668  ALA A CB  
1670 N  N   . ARG A 297 ? 0.4696 0.5963 0.4045 -0.0975 0.0068  -0.1196 669  ARG A N   
1671 C  CA  . ARG A 297 ? 0.4675 0.5903 0.4248 -0.0924 0.0075  -0.1373 669  ARG A CA  
1672 C  C   . ARG A 297 ? 0.4500 0.5665 0.4321 -0.0820 0.0153  -0.1585 669  ARG A C   
1673 O  O   . ARG A 297 ? 0.4491 0.5821 0.4285 -0.0873 0.0239  -0.1753 669  ARG A O   
1674 C  CB  . ARG A 297 ? 0.4954 0.6415 0.4404 -0.1102 0.0063  -0.1525 669  ARG A CB  
1675 C  CG  . ARG A 297 ? 0.5263 0.6762 0.4530 -0.1195 -0.0062 -0.1298 669  ARG A CG  
1676 C  CD  . ARG A 297 ? 0.6111 0.7751 0.5372 -0.1314 -0.0097 -0.1449 669  ARG A CD  
1677 N  NE  . ARG A 297 ? 0.6656 0.8335 0.5798 -0.1393 -0.0240 -0.1234 669  ARG A NE  
1678 C  CZ  . ARG A 297 ? 0.6657 0.8197 0.5983 -0.1285 -0.0323 -0.1090 669  ARG A CZ  
1679 N  NH1 . ARG A 297 ? 0.6394 0.7736 0.5983 -0.1118 -0.0277 -0.1112 669  ARG A NH1 
1680 N  NH2 . ARG A 297 ? 0.6851 0.8469 0.6103 -0.1363 -0.0464 -0.0919 669  ARG A NH2 
1681 N  N   . ASP A 298 ? 0.4261 0.5198 0.4334 -0.0687 0.0111  -0.1569 670  ASP A N   
1682 C  CA  . ASP A 298 ? 0.4173 0.5004 0.4532 -0.0583 0.0129  -0.1738 670  ASP A CA  
1683 C  C   . ASP A 298 ? 0.4256 0.5198 0.4830 -0.0622 0.0146  -0.2075 670  ASP A C   
1684 O  O   . ASP A 298 ? 0.4367 0.5517 0.4806 -0.0756 0.0172  -0.2196 670  ASP A O   
1685 C  CB  . ASP A 298 ? 0.4024 0.4556 0.4542 -0.0460 0.0051  -0.1559 670  ASP A CB  
1686 C  CG  . ASP A 298 ? 0.4232 0.4650 0.4840 -0.0480 -0.0029 -0.1513 670  ASP A CG  
1687 O  OD1 . ASP A 298 ? 0.4475 0.5011 0.5094 -0.0563 -0.0035 -0.1662 670  ASP A OD1 
1688 O  OD2 . ASP A 298 ? 0.4247 0.4473 0.4905 -0.0433 -0.0085 -0.1329 670  ASP A OD2 
1689 N  N   . SER A 299 ? 0.4220 0.5029 0.5146 -0.0511 0.0118  -0.2235 671  SER A N   
1690 C  CA  . SER A 299 ? 0.4390 0.5297 0.5608 -0.0526 0.0126  -0.2603 671  SER A CA  
1691 C  C   . SER A 299 ? 0.4488 0.5281 0.5775 -0.0568 0.0039  -0.2618 671  SER A C   
1692 O  O   . SER A 299 ? 0.4643 0.5533 0.6133 -0.0607 0.0046  -0.2932 671  SER A O   
1693 C  CB  . SER A 299 ? 0.4409 0.5180 0.6064 -0.0380 0.0079  -0.2769 671  SER A CB  
1694 O  OG  . SER A 299 ? 0.4401 0.4801 0.6202 -0.0279 -0.0071 -0.2528 671  SER A OG  
1695 N  N   . GLU A 300 ? 0.4359 0.4967 0.5493 -0.0568 -0.0036 -0.2300 672  GLU A N   
1696 C  CA  . GLU A 300 ? 0.4445 0.4964 0.5625 -0.0626 -0.0117 -0.2282 672  GLU A CA  
1697 C  C   . GLU A 300 ? 0.4476 0.5220 0.5316 -0.0762 -0.0082 -0.2191 672  GLU A C   
1698 O  O   . GLU A 300 ? 0.4487 0.5193 0.5315 -0.0822 -0.0148 -0.2124 672  GLU A O   
1699 C  CB  . GLU A 300 ? 0.4319 0.4518 0.5606 -0.0563 -0.0232 -0.2017 672  GLU A CB  
1700 C  CG  . GLU A 300 ? 0.4451 0.4393 0.6100 -0.0460 -0.0328 -0.2094 672  GLU A CG  
1701 C  CD  . GLU A 300 ? 0.4542 0.4187 0.6220 -0.0438 -0.0443 -0.1787 672  GLU A CD  
1702 O  OE1 . GLU A 300 ? 0.4740 0.4362 0.6253 -0.0516 -0.0460 -0.1582 672  GLU A OE1 
1703 O  OE2 . GLU A 300 ? 0.4545 0.3998 0.6422 -0.0358 -0.0524 -0.1758 672  GLU A OE2 
1704 N  N   . GLY A 301 ? 0.4510 0.5485 0.5082 -0.0823 0.0003  -0.2173 673  GLY A N   
1705 C  CA  . GLY A 301 ? 0.4613 0.5787 0.4860 -0.0963 -0.0003 -0.2049 673  GLY A CA  
1706 C  C   . GLY A 301 ? 0.4521 0.5575 0.4658 -0.0920 -0.0073 -0.1698 673  GLY A C   
1707 O  O   . GLY A 301 ? 0.4692 0.5868 0.4655 -0.1015 -0.0125 -0.1580 673  GLY A O   
1708 N  N   . ARG A 302 ? 0.4357 0.5195 0.4612 -0.0785 -0.0080 -0.1543 674  ARG A N   
1709 C  CA  . ARG A 302 ? 0.4187 0.4942 0.4392 -0.0740 -0.0125 -0.1266 674  ARG A CA  
1710 C  C   . ARG A 302 ? 0.4100 0.4893 0.4129 -0.0709 -0.0096 -0.1112 674  ARG A C   
1711 O  O   . ARG A 302 ? 0.3917 0.4667 0.3942 -0.0657 -0.0038 -0.1153 674  ARG A O   
1712 C  CB  . ARG A 302 ? 0.4089 0.4611 0.4492 -0.0649 -0.0148 -0.1185 674  ARG A CB  
1713 C  CG  . ARG A 302 ? 0.4243 0.4652 0.4857 -0.0678 -0.0204 -0.1311 674  ARG A CG  
1714 C  CD  . ARG A 302 ? 0.4226 0.4390 0.4990 -0.0622 -0.0247 -0.1188 674  ARG A CD  
1715 N  NE  . ARG A 302 ? 0.4210 0.4273 0.5008 -0.0532 -0.0221 -0.1200 674  ARG A NE  
1716 C  CZ  . ARG A 302 ? 0.4157 0.4006 0.5065 -0.0492 -0.0274 -0.1097 674  ARG A CZ  
1717 N  NH1 . ARG A 302 ? 0.4236 0.3949 0.5208 -0.0552 -0.0349 -0.0966 674  ARG A NH1 
1718 N  NH2 . ARG A 302 ? 0.3914 0.3697 0.4861 -0.0413 -0.0263 -0.1118 674  ARG A NH2 
1719 N  N   . ASP A 303 ? 0.4090 0.4960 0.4008 -0.0741 -0.0153 -0.0939 675  ASP A N   
1720 C  CA  . ASP A 303 ? 0.4127 0.4968 0.3953 -0.0690 -0.0158 -0.0766 675  ASP A CA  
1721 C  C   . ASP A 303 ? 0.3934 0.4641 0.3922 -0.0573 -0.0156 -0.0642 675  ASP A C   
1722 O  O   . ASP A 303 ? 0.3953 0.4612 0.4086 -0.0562 -0.0156 -0.0667 675  ASP A O   
1723 C  CB  . ASP A 303 ? 0.4273 0.5254 0.3932 -0.0790 -0.0252 -0.0649 675  ASP A CB  
1724 C  CG  . ASP A 303 ? 0.4677 0.5720 0.4437 -0.0811 -0.0351 -0.0573 675  ASP A CG  
1725 O  OD1 . ASP A 303 ? 0.4743 0.5724 0.4701 -0.0743 -0.0331 -0.0594 675  ASP A OD1 
1726 O  OD2 . ASP A 303 ? 0.5163 0.6328 0.4801 -0.0914 -0.0463 -0.0483 675  ASP A OD2 
1727 N  N   . PRO A 304 ? 0.3878 0.4534 0.3842 -0.0503 -0.0150 -0.0519 676  PRO A N   
1728 C  CA  . PRO A 304 ? 0.3660 0.4234 0.3776 -0.0416 -0.0120 -0.0456 676  PRO A CA  
1729 C  C   . PRO A 304 ? 0.3583 0.4254 0.3852 -0.0427 -0.0166 -0.0410 676  PRO A C   
1730 O  O   . PRO A 304 ? 0.3433 0.4082 0.3817 -0.0418 -0.0124 -0.0412 676  PRO A O   
1731 C  CB  . PRO A 304 ? 0.3547 0.4065 0.3621 -0.0345 -0.0104 -0.0371 676  PRO A CB  
1732 C  CG  . PRO A 304 ? 0.3787 0.4290 0.3692 -0.0386 -0.0088 -0.0416 676  PRO A CG  
1733 C  CD  . PRO A 304 ? 0.3872 0.4513 0.3687 -0.0504 -0.0139 -0.0476 676  PRO A CD  
1734 N  N   . LEU A 305 ? 0.3644 0.4439 0.3912 -0.0469 -0.0260 -0.0367 677  LEU A N   
1735 C  CA  . LEU A 305 ? 0.3651 0.4575 0.4103 -0.0483 -0.0318 -0.0338 677  LEU A CA  
1736 C  C   . LEU A 305 ? 0.3689 0.4627 0.4191 -0.0557 -0.0294 -0.0424 677  LEU A C   
1737 O  O   . LEU A 305 ? 0.3698 0.4698 0.4370 -0.0561 -0.0275 -0.0412 677  LEU A O   
1738 C  CB  . LEU A 305 ? 0.3711 0.4755 0.4148 -0.0530 -0.0465 -0.0262 677  LEU A CB  
1739 C  CG  . LEU A 305 ? 0.3733 0.4940 0.4408 -0.0536 -0.0556 -0.0227 677  LEU A CG  
1740 C  CD1 . LEU A 305 ? 0.3419 0.4674 0.4383 -0.0415 -0.0518 -0.0210 677  LEU A CD1 
1741 C  CD2 . LEU A 305 ? 0.3643 0.4943 0.4266 -0.0605 -0.0738 -0.0130 677  LEU A CD2 
1742 N  N   . THR A 306 ? 0.3816 0.4710 0.4193 -0.0627 -0.0293 -0.0524 678  THR A N   
1743 C  CA  . THR A 306 ? 0.3921 0.4779 0.4374 -0.0695 -0.0291 -0.0622 678  THR A CA  
1744 C  C   . THR A 306 ? 0.3885 0.4591 0.4434 -0.0664 -0.0231 -0.0602 678  THR A C   
1745 O  O   . THR A 306 ? 0.4020 0.4728 0.4685 -0.0723 -0.0245 -0.0588 678  THR A O   
1746 C  CB  . THR A 306 ? 0.4058 0.4894 0.4406 -0.0758 -0.0292 -0.0784 678  THR A CB  
1747 O  OG1 . THR A 306 ? 0.4232 0.5230 0.4420 -0.0828 -0.0343 -0.0786 678  THR A OG1 
1748 C  CG2 . THR A 306 ? 0.4013 0.4811 0.4483 -0.0833 -0.0323 -0.0897 678  THR A CG2 
1749 N  N   . ILE A 307 ? 0.3896 0.4480 0.4383 -0.0593 -0.0176 -0.0586 679  ILE A N   
1750 C  CA  . ILE A 307 ? 0.3855 0.4297 0.4393 -0.0586 -0.0141 -0.0537 679  ILE A CA  
1751 C  C   . ILE A 307 ? 0.3786 0.4347 0.4393 -0.0599 -0.0103 -0.0437 679  ILE A C   
1752 O  O   . ILE A 307 ? 0.3870 0.4404 0.4531 -0.0678 -0.0093 -0.0393 679  ILE A O   
1753 C  CB  . ILE A 307 ? 0.3806 0.4117 0.4259 -0.0511 -0.0103 -0.0542 679  ILE A CB  
1754 C  CG1 . ILE A 307 ? 0.3848 0.4099 0.4296 -0.0508 -0.0127 -0.0688 679  ILE A CG1 
1755 C  CG2 . ILE A 307 ? 0.3829 0.4003 0.4303 -0.0525 -0.0089 -0.0459 679  ILE A CG2 
1756 C  CD1 . ILE A 307 ? 0.3700 0.3899 0.4078 -0.0438 -0.0086 -0.0722 679  ILE A CD1 
1757 N  N   . ALA A 308 ? 0.3669 0.4373 0.4294 -0.0535 -0.0090 -0.0409 680  ALA A N   
1758 C  CA  . ALA A 308 ? 0.3647 0.4514 0.4407 -0.0530 -0.0043 -0.0371 680  ALA A CA  
1759 C  C   . ALA A 308 ? 0.3685 0.4705 0.4591 -0.0629 -0.0071 -0.0380 680  ALA A C   
1760 O  O   . ALA A 308 ? 0.3639 0.4755 0.4625 -0.0702 -0.0010 -0.0365 680  ALA A O   
1761 C  CB  . ALA A 308 ? 0.3512 0.4477 0.4338 -0.0425 -0.0062 -0.0358 680  ALA A CB  
1762 N  N   . MET A 309 ? 0.3846 0.4909 0.4770 -0.0655 -0.0159 -0.0407 681  MET A N   
1763 C  CA  . MET A 309 ? 0.4073 0.5280 0.5136 -0.0757 -0.0200 -0.0421 681  MET A CA  
1764 C  C   . MET A 309 ? 0.4199 0.5265 0.5231 -0.0878 -0.0186 -0.0420 681  MET A C   
1765 O  O   . MET A 309 ? 0.4217 0.5396 0.5353 -0.0981 -0.0158 -0.0390 681  MET A O   
1766 C  CB  . MET A 309 ? 0.4112 0.5380 0.5160 -0.0779 -0.0311 -0.0454 681  MET A CB  
1767 C  CG  . MET A 309 ? 0.4554 0.6026 0.5734 -0.0719 -0.0383 -0.0412 681  MET A CG  
1768 S  SD  . MET A 309 ? 0.5353 0.7124 0.6873 -0.0761 -0.0387 -0.0414 681  MET A SD  
1769 C  CE  . MET A 309 ? 0.5162 0.7065 0.6897 -0.0600 -0.0404 -0.0387 681  MET A CE  
1770 N  N   . GLU A 310 ? 0.4262 0.5088 0.5173 -0.0872 -0.0215 -0.0455 682  GLU A N   
1771 C  CA  . GLU A 310 ? 0.4393 0.5025 0.5319 -0.0976 -0.0254 -0.0451 682  GLU A CA  
1772 C  C   . GLU A 310 ? 0.4360 0.4928 0.5257 -0.1040 -0.0207 -0.0338 682  GLU A C   
1773 O  O   . GLU A 310 ? 0.4505 0.4980 0.5436 -0.1182 -0.0254 -0.0279 682  GLU A O   
1774 C  CB  . GLU A 310 ? 0.4489 0.4899 0.5369 -0.0930 -0.0306 -0.0553 682  GLU A CB  
1775 C  CG  . GLU A 310 ? 0.4790 0.5274 0.5692 -0.0953 -0.0362 -0.0691 682  GLU A CG  
1776 C  CD  . GLU A 310 ? 0.5183 0.5537 0.6054 -0.0903 -0.0377 -0.0852 682  GLU A CD  
1777 O  OE1 . GLU A 310 ? 0.5308 0.5505 0.6171 -0.0832 -0.0357 -0.0850 682  GLU A OE1 
1778 O  OE2 . GLU A 310 ? 0.5476 0.5920 0.6339 -0.0944 -0.0407 -0.0996 682  GLU A OE2 
1779 N  N   . THR A 311 ? 0.4169 0.4789 0.4992 -0.0959 -0.0123 -0.0304 683  THR A N   
1780 C  CA  . THR A 311 ? 0.4280 0.4900 0.5040 -0.1048 -0.0065 -0.0208 683  THR A CA  
1781 C  C   . THR A 311 ? 0.4245 0.5192 0.5098 -0.1125 0.0031  -0.0206 683  THR A C   
1782 O  O   . THR A 311 ? 0.4317 0.5349 0.5106 -0.1233 0.0108  -0.0153 683  THR A O   
1783 C  CB  . THR A 311 ? 0.4239 0.4752 0.4870 -0.0949 -0.0020 -0.0190 683  THR A CB  
1784 O  OG1 . THR A 311 ? 0.4210 0.4896 0.4871 -0.0814 0.0053  -0.0251 683  THR A OG1 
1785 C  CG2 . THR A 311 ? 0.4237 0.4469 0.4826 -0.0876 -0.0108 -0.0215 683  THR A CG2 
1786 N  N   . ALA A 312 ? 0.4144 0.5299 0.5159 -0.1085 0.0023  -0.0274 684  ALA A N   
1787 C  CA  . ALA A 312 ? 0.4115 0.5629 0.5314 -0.1128 0.0107  -0.0314 684  ALA A CA  
1788 C  C   . ALA A 312 ? 0.3979 0.5645 0.5202 -0.1042 0.0227  -0.0361 684  ALA A C   
1789 O  O   . ALA A 312 ? 0.3981 0.5885 0.5258 -0.1153 0.0340  -0.0390 684  ALA A O   
1790 C  CB  . ALA A 312 ? 0.4231 0.5855 0.5455 -0.1365 0.0126  -0.0263 684  ALA A CB  
1791 N  N   . ASN A 313 ? 0.3857 0.5399 0.5042 -0.0863 0.0204  -0.0383 685  ASN A N   
1792 C  CA  . ASN A 313 ? 0.3778 0.5407 0.4993 -0.0768 0.0298  -0.0439 685  ASN A CA  
1793 C  C   . ASN A 313 ? 0.3615 0.5421 0.5103 -0.0610 0.0267  -0.0521 685  ASN A C   
1794 O  O   . ASN A 313 ? 0.3649 0.5298 0.5102 -0.0481 0.0179  -0.0495 685  ASN A O   
1795 C  CB  . ASN A 313 ? 0.3727 0.5059 0.4701 -0.0700 0.0284  -0.0388 685  ASN A CB  
1796 C  CG  . ASN A 313 ? 0.3848 0.5247 0.4810 -0.0647 0.0388  -0.0443 685  ASN A CG  
1797 O  OD1 . ASN A 313 ? 0.3837 0.5470 0.5022 -0.0581 0.0448  -0.0549 685  ASN A OD1 
1798 N  ND2 . ASN A 313 ? 0.3955 0.5146 0.4685 -0.0668 0.0400  -0.0386 685  ASN A ND2 
1799 N  N   . ALA A 314 ? 0.3559 0.5702 0.5336 -0.0636 0.0328  -0.0618 686  ALA A N   
1800 C  CA  . ALA A 314 ? 0.3446 0.5779 0.5582 -0.0486 0.0264  -0.0701 686  ALA A CA  
1801 C  C   . ALA A 314 ? 0.3398 0.5622 0.5590 -0.0311 0.0250  -0.0739 686  ALA A C   
1802 O  O   . ALA A 314 ? 0.3351 0.5515 0.5695 -0.0182 0.0104  -0.0710 686  ALA A O   
1803 C  CB  . ALA A 314 ? 0.3433 0.6190 0.5921 -0.0547 0.0359  -0.0842 686  ALA A CB  
1804 N  N   . ASP A 315 ? 0.3386 0.5575 0.5445 -0.0328 0.0383  -0.0793 687  ASP A N   
1805 C  CA  . ASP A 315 ? 0.3370 0.5438 0.5476 -0.0177 0.0372  -0.0838 687  ASP A CA  
1806 C  C   . ASP A 315 ? 0.3318 0.5034 0.5183 -0.0103 0.0232  -0.0688 687  ASP A C   
1807 O  O   . ASP A 315 ? 0.3240 0.4880 0.5258 0.0027  0.0113  -0.0673 687  ASP A O   
1808 C  CB  . ASP A 315 ? 0.3481 0.5595 0.5451 -0.0240 0.0545  -0.0929 687  ASP A CB  
1809 C  CG  . ASP A 315 ? 0.3866 0.6400 0.6117 -0.0313 0.0702  -0.1131 687  ASP A CG  
1810 O  OD1 . ASP A 315 ? 0.4032 0.6827 0.6662 -0.0270 0.0671  -0.1222 687  ASP A OD1 
1811 O  OD2 . ASP A 315 ? 0.4439 0.7075 0.6535 -0.0428 0.0859  -0.1211 687  ASP A OD2 
1812 N  N   . ILE A 316 ? 0.3269 0.4784 0.4786 -0.0197 0.0234  -0.0581 688  ILE A N   
1813 C  CA  . ILE A 316 ? 0.3188 0.4429 0.4482 -0.0150 0.0133  -0.0478 688  ILE A CA  
1814 C  C   . ILE A 316 ? 0.3178 0.4423 0.4535 -0.0135 -0.0023 -0.0414 688  ILE A C   
1815 O  O   . ILE A 316 ? 0.3256 0.4380 0.4566 -0.0075 -0.0131 -0.0351 688  ILE A O   
1816 C  CB  . ILE A 316 ? 0.3222 0.4264 0.4194 -0.0234 0.0180  -0.0425 688  ILE A CB  
1817 C  CG1 . ILE A 316 ? 0.3222 0.4265 0.4121 -0.0258 0.0304  -0.0467 688  ILE A CG1 
1818 C  CG2 . ILE A 316 ? 0.3106 0.3933 0.3891 -0.0191 0.0097  -0.0362 688  ILE A CG2 
1819 C  CD1 . ILE A 316 ? 0.3521 0.4354 0.4146 -0.0326 0.0315  -0.0399 688  ILE A CD1 
1820 N  N   . VAL A 317 ? 0.3133 0.4529 0.4588 -0.0211 -0.0045 -0.0422 689  VAL A N   
1821 C  CA  . VAL A 317 ? 0.3132 0.4584 0.4680 -0.0208 -0.0204 -0.0370 689  VAL A CA  
1822 C  C   . VAL A 317 ? 0.3163 0.4677 0.4989 -0.0083 -0.0319 -0.0360 689  VAL A C   
1823 O  O   . VAL A 317 ? 0.3189 0.4595 0.4945 -0.0067 -0.0475 -0.0259 689  VAL A O   
1824 C  CB  . VAL A 317 ? 0.3189 0.4841 0.4876 -0.0304 -0.0211 -0.0400 689  VAL A CB  
1825 C  CG1 . VAL A 317 ? 0.2969 0.4736 0.4829 -0.0289 -0.0393 -0.0353 689  VAL A CG1 
1826 C  CG2 . VAL A 317 ? 0.3138 0.4661 0.4562 -0.0430 -0.0166 -0.0388 689  VAL A CG2 
1827 N  N   . THR A 318 ? 0.3215 0.4908 0.5366 -0.0010 -0.0248 -0.0472 690  THR A N   
1828 C  CA  . THR A 318 ? 0.3358 0.5103 0.5877 0.0133  -0.0367 -0.0499 690  THR A CA  
1829 C  C   . THR A 318 ? 0.3438 0.4902 0.5801 0.0203  -0.0445 -0.0414 690  THR A C   
1830 O  O   . THR A 318 ? 0.3505 0.4872 0.5956 0.0246  -0.0655 -0.0300 690  THR A O   
1831 C  CB  . THR A 318 ? 0.3305 0.5326 0.6223 0.0195  -0.0233 -0.0702 690  THR A CB  
1832 O  OG1 . THR A 318 ? 0.3316 0.5629 0.6413 0.0113  -0.0193 -0.0762 690  THR A OG1 
1833 C  CG2 . THR A 318 ? 0.3437 0.5493 0.6823 0.0370  -0.0372 -0.0767 690  THR A CG2 
1834 N  N   . LEU A 319 ? 0.3435 0.4770 0.5555 0.0191  -0.0292 -0.0452 691  LEU A N   
1835 C  CA  . LEU A 319 ? 0.3604 0.4677 0.5533 0.0230  -0.0343 -0.0375 691  LEU A CA  
1836 C  C   . LEU A 319 ? 0.3727 0.4642 0.5389 0.0159  -0.0502 -0.0198 691  LEU A C   
1837 O  O   . LEU A 319 ? 0.3866 0.4649 0.5569 0.0191  -0.0674 -0.0090 691  LEU A O   
1838 C  CB  . LEU A 319 ? 0.3565 0.4541 0.5194 0.0183  -0.0159 -0.0419 691  LEU A CB  
1839 C  CG  . LEU A 319 ? 0.3820 0.4853 0.5557 0.0230  -0.0009 -0.0566 691  LEU A CG  
1840 C  CD1 . LEU A 319 ? 0.4087 0.4950 0.5434 0.0157  0.0093  -0.0526 691  LEU A CD1 
1841 C  CD2 . LEU A 319 ? 0.4067 0.5033 0.6098 0.0368  -0.0101 -0.0617 691  LEU A CD2 
1842 N  N   . LEU A 320 ? 0.3664 0.4600 0.5059 0.0044  -0.0451 -0.0175 692  LEU A N   
1843 C  CA  . LEU A 320 ? 0.3810 0.4643 0.4897 -0.0058 -0.0545 -0.0062 692  LEU A CA  
1844 C  C   . LEU A 320 ? 0.4011 0.4907 0.5206 -0.0090 -0.0764 0.0050  692  LEU A C   
1845 O  O   . LEU A 320 ? 0.4175 0.4972 0.5186 -0.0160 -0.0902 0.0180  692  LEU A O   
1846 C  CB  . LEU A 320 ? 0.3721 0.4582 0.4578 -0.0161 -0.0435 -0.0119 692  LEU A CB  
1847 C  CG  . LEU A 320 ? 0.3550 0.4303 0.4258 -0.0151 -0.0270 -0.0188 692  LEU A CG  
1848 C  CD1 . LEU A 320 ? 0.3486 0.4253 0.4080 -0.0238 -0.0200 -0.0248 692  LEU A CD1 
1849 C  CD2 . LEU A 320 ? 0.3206 0.3802 0.3704 -0.0151 -0.0277 -0.0143 692  LEU A CD2 
1850 N  N   . ARG A 321 ? 0.4085 0.5164 0.5582 -0.0058 -0.0804 0.0006  693  ARG A N   
1851 C  CA  . ARG A 321 ? 0.4383 0.5546 0.6051 -0.0080 -0.1036 0.0113  693  ARG A CA  
1852 C  C   . ARG A 321 ? 0.4541 0.5589 0.6460 0.0024  -0.1223 0.0207  693  ARG A C   
1853 O  O   . ARG A 321 ? 0.4735 0.5705 0.6586 -0.0046 -0.1460 0.0386  693  ARG A O   
1854 C  CB  . ARG A 321 ? 0.4327 0.5740 0.6316 -0.0059 -0.1015 0.0017  693  ARG A CB  
1855 C  CG  . ARG A 321 ? 0.4893 0.6428 0.6946 -0.0143 -0.1227 0.0117  693  ARG A CG  
1856 C  CD  . ARG A 321 ? 0.5281 0.6827 0.6933 -0.0320 -0.1188 0.0126  693  ARG A CD  
1857 N  NE  . ARG A 321 ? 0.5836 0.7240 0.7104 -0.0436 -0.1290 0.0253  693  ARG A NE  
1858 C  CZ  . ARG A 321 ? 0.6330 0.7756 0.7533 -0.0537 -0.1537 0.0414  693  ARG A CZ  
1859 N  NH1 . ARG A 321 ? 0.6342 0.7907 0.7879 -0.0511 -0.1733 0.0478  693  ARG A NH1 
1860 N  NH2 . ARG A 321 ? 0.6784 0.8111 0.7584 -0.0683 -0.1594 0.0516  693  ARG A NH2 
1861 N  N   . LEU A 322 ? 0.4465 0.5496 0.6665 0.0171  -0.1126 0.0087  694  LEU A N   
1862 C  CA  . LEU A 322 ? 0.4724 0.5609 0.7207 0.0286  -0.1297 0.0140  694  LEU A CA  
1863 C  C   . LEU A 322 ? 0.4960 0.5568 0.7065 0.0204  -0.1374 0.0306  694  LEU A C   
1864 O  O   . LEU A 322 ? 0.5160 0.5618 0.7352 0.0193  -0.1636 0.0479  694  LEU A O   
1865 C  CB  . LEU A 322 ? 0.4596 0.5552 0.7451 0.0448  -0.1139 -0.0082 694  LEU A CB  
1866 C  CG  . LEU A 322 ? 0.4507 0.5753 0.7935 0.0562  -0.1141 -0.0255 694  LEU A CG  
1867 C  CD1 . LEU A 322 ? 0.4389 0.5723 0.8129 0.0691  -0.0960 -0.0506 694  LEU A CD1 
1868 C  CD2 . LEU A 322 ? 0.4696 0.5934 0.8531 0.0628  -0.1476 -0.0135 694  LEU A CD2 
1869 N  N   . ALA A 323 ? 0.4929 0.5476 0.6633 0.0133  -0.1162 0.0259  695  ALA A N   
1870 C  CA  . ALA A 323 ? 0.5130 0.5474 0.6456 0.0031  -0.1192 0.0385  695  ALA A CA  
1871 C  C   . ALA A 323 ? 0.5520 0.5858 0.6563 -0.0155 -0.1385 0.0584  695  ALA A C   
1872 O  O   . ALA A 323 ? 0.5737 0.5917 0.6592 -0.0251 -0.1525 0.0749  695  ALA A O   
1873 C  CB  . ALA A 323 ? 0.4893 0.5233 0.5910 -0.0005 -0.0932 0.0270  695  ALA A CB  
1874 N  N   . LYS A 324 ? 0.5658 0.6181 0.6654 -0.0230 -0.1392 0.0568  696  LYS A N   
1875 C  CA  . LYS A 324 ? 0.6112 0.6680 0.6832 -0.0431 -0.1572 0.0734  696  LYS A CA  
1876 C  C   . LYS A 324 ? 0.6510 0.6997 0.7469 -0.0434 -0.1914 0.0950  696  LYS A C   
1877 O  O   . LYS A 324 ? 0.6852 0.7280 0.7531 -0.0626 -0.2112 0.1159  696  LYS A O   
1878 C  CB  . LYS A 324 ? 0.6041 0.6829 0.6690 -0.0505 -0.1499 0.0637  696  LYS A CB  
1879 C  CG  . LYS A 324 ? 0.6516 0.7393 0.6796 -0.0751 -0.1630 0.0754  696  LYS A CG  
1880 C  CD  . LYS A 324 ? 0.6950 0.7815 0.6779 -0.0899 -0.1467 0.0696  696  LYS A CD  
1881 C  CE  . LYS A 324 ? 0.7500 0.8514 0.6944 -0.1174 -0.1568 0.0768  696  LYS A CE  
1882 N  NZ  . LYS A 324 ? 0.7782 0.8789 0.6831 -0.1337 -0.1468 0.0757  696  LYS A NZ  
1883 N  N   . MET A 325 ? 0.6557 0.7058 0.8049 -0.0235 -0.1992 0.0893  697  MET A N   
1884 C  CA  . MET A 325 ? 0.6861 0.7260 0.8719 -0.0186 -0.2340 0.1071  697  MET A CA  
1885 C  C   . MET A 325 ? 0.7022 0.7131 0.8907 -0.0144 -0.2428 0.1164  697  MET A C   
1886 O  O   . MET A 325 ? 0.7394 0.7328 0.9114 -0.0289 -0.2697 0.1423  697  MET A O   
1887 C  CB  . MET A 325 ? 0.6747 0.7304 0.9245 0.0033  -0.2359 0.0911  697  MET A CB  
1888 C  CG  . MET A 325 ? 0.7126 0.7570 1.0165 0.0147  -0.2723 0.1040  697  MET A CG  
1889 S  SD  . MET A 325 ? 0.6991 0.7670 1.0884 0.0439  -0.2681 0.0752  697  MET A SD  
1890 C  CE  . MET A 325 ? 0.7619 0.8113 1.2104 0.0528  -0.3206 0.0970  697  MET A CE  
1891 N  N   . VAL B 32  ? 0.6087 0.8840 0.9424 0.1258  -0.0521 -0.0049 404  VAL B N   
1892 C  CA  . VAL B 32  ? 0.6042 0.8745 0.9038 0.1109  -0.0706 -0.0010 404  VAL B CA  
1893 C  C   . VAL B 32  ? 0.5873 0.8163 0.8396 0.0954  -0.0580 -0.0052 404  VAL B C   
1894 O  O   . VAL B 32  ? 0.5853 0.8119 0.8376 0.0828  -0.0401 -0.0148 404  VAL B O   
1895 C  CB  . VAL B 32  ? 0.6020 0.9190 0.9296 0.0962  -0.0840 -0.0094 404  VAL B CB  
1896 C  CG1 . VAL B 32  ? 0.5855 0.9149 0.9386 0.0796  -0.0620 -0.0225 404  VAL B CG1 
1897 C  CG2 . VAL B 32  ? 0.6106 0.9217 0.9001 0.0828  -0.1027 -0.0100 404  VAL B CG2 
1898 N  N   . GLY B 33  ? 0.5748 0.7735 0.7892 0.0975  -0.0665 0.0045  405  GLY B N   
1899 C  CA  . GLY B 33  ? 0.5344 0.6993 0.7069 0.0832  -0.0587 0.0018  405  GLY B CA  
1900 C  C   . GLY B 33  ? 0.5093 0.6864 0.6669 0.0658  -0.0685 -0.0031 405  GLY B C   
1901 O  O   . GLY B 33  ? 0.5134 0.6727 0.6362 0.0613  -0.0750 0.0015  405  GLY B O   
1902 N  N   . HIS B 34  ? 0.4787 0.6862 0.6658 0.0556  -0.0680 -0.0138 406  HIS B N   
1903 C  CA  . HIS B 34  ? 0.4604 0.6774 0.6406 0.0374  -0.0756 -0.0238 406  HIS B CA  
1904 C  C   . HIS B 34  ? 0.4246 0.6071 0.5740 0.0241  -0.0607 -0.0271 406  HIS B C   
1905 O  O   . HIS B 34  ? 0.4252 0.5988 0.5503 0.0151  -0.0675 -0.0315 406  HIS B O   
1906 C  CB  . HIS B 34  ? 0.4654 0.7211 0.6937 0.0275  -0.0766 -0.0355 406  HIS B CB  
1907 C  CG  . HIS B 34  ? 0.5357 0.8078 0.7653 0.0109  -0.0915 -0.0497 406  HIS B CG  
1908 N  ND1 . HIS B 34  ? 0.5832 0.8576 0.8357 -0.0097 -0.0809 -0.0633 406  HIS B ND1 
1909 C  CD2 . HIS B 34  ? 0.5980 0.8841 0.8075 0.0120  -0.1155 -0.0537 406  HIS B CD2 
1910 C  CE1 . HIS B 34  ? 0.6115 0.8995 0.8619 -0.0215 -0.0983 -0.0791 406  HIS B CE1 
1911 N  NE2 . HIS B 34  ? 0.6334 0.9310 0.8545 -0.0083 -0.1200 -0.0744 406  HIS B NE2 
1912 N  N   . VAL B 35  ? 0.3797 0.5451 0.5291 0.0249  -0.0406 -0.0250 407  VAL B N   
1913 C  CA  . VAL B 35  ? 0.3483 0.4870 0.4740 0.0143  -0.0269 -0.0259 407  VAL B CA  
1914 C  C   . VAL B 35  ? 0.3377 0.4480 0.4231 0.0160  -0.0322 -0.0213 407  VAL B C   
1915 O  O   . VAL B 35  ? 0.3304 0.4295 0.3998 0.0055  -0.0318 -0.0249 407  VAL B O   
1916 C  CB  . VAL B 35  ? 0.3459 0.4783 0.4753 0.0179  -0.0062 -0.0232 407  VAL B CB  
1917 C  CG1 . VAL B 35  ? 0.3202 0.4252 0.4192 0.0119  0.0044  -0.0202 407  VAL B CG1 
1918 C  CG2 . VAL B 35  ? 0.3306 0.4909 0.5000 0.0123  0.0047  -0.0259 407  VAL B CG2 
1919 N  N   . VAL B 36  ? 0.3252 0.4239 0.3992 0.0289  -0.0353 -0.0135 408  VAL B N   
1920 C  CA  . VAL B 36  ? 0.3202 0.3940 0.3629 0.0305  -0.0384 -0.0068 408  VAL B CA  
1921 C  C   . VAL B 36  ? 0.3312 0.4135 0.3587 0.0275  -0.0527 -0.0051 408  VAL B C   
1922 O  O   . VAL B 36  ? 0.3252 0.3932 0.3280 0.0205  -0.0505 -0.0059 408  VAL B O   
1923 C  CB  . VAL B 36  ? 0.3333 0.3908 0.3759 0.0441  -0.0371 0.0011  408  VAL B CB  
1924 C  CG1 . VAL B 36  ? 0.3370 0.4093 0.3970 0.0577  -0.0491 0.0095  408  VAL B CG1 
1925 C  CG2 . VAL B 36  ? 0.3326 0.3623 0.3492 0.0418  -0.0351 0.0075  408  VAL B CG2 
1926 N  N   . ALA B 37  ? 0.3321 0.4414 0.3743 0.0334  -0.0672 -0.0042 409  ALA B N   
1927 C  CA  . ALA B 37  ? 0.3563 0.4806 0.3798 0.0313  -0.0827 -0.0053 409  ALA B CA  
1928 C  C   . ALA B 37  ? 0.3592 0.4839 0.3774 0.0141  -0.0792 -0.0230 409  ALA B C   
1929 O  O   . ALA B 37  ? 0.3741 0.4872 0.3620 0.0098  -0.0788 -0.0251 409  ALA B O   
1930 C  CB  . ALA B 37  ? 0.3668 0.5282 0.4115 0.0402  -0.1015 -0.0038 409  ALA B CB  
1931 N  N   . GLN B 38  ? 0.3484 0.4841 0.3988 0.0045  -0.0734 -0.0348 410  GLN B N   
1932 C  CA  . GLN B 38  ? 0.3599 0.4934 0.4149 -0.0120 -0.0690 -0.0516 410  GLN B CA  
1933 C  C   . GLN B 38  ? 0.3513 0.4500 0.3830 -0.0164 -0.0527 -0.0491 410  GLN B C   
1934 O  O   . GLN B 38  ? 0.3648 0.4555 0.3789 -0.0231 -0.0533 -0.0590 410  GLN B O   
1935 C  CB  . GLN B 38  ? 0.3504 0.5008 0.4511 -0.0214 -0.0627 -0.0600 410  GLN B CB  
1936 C  CG  . GLN B 38  ? 0.4106 0.5607 0.5269 -0.0396 -0.0602 -0.0789 410  GLN B CG  
1937 C  CD  . GLN B 38  ? 0.4601 0.6352 0.6306 -0.0509 -0.0575 -0.0880 410  GLN B CD  
1938 O  OE1 . GLN B 38  ? 0.4445 0.6440 0.6413 -0.0439 -0.0594 -0.0810 410  GLN B OE1 
1939 N  NE2 . GLN B 38  ? 0.4867 0.6555 0.6791 -0.0686 -0.0515 -0.1040 410  GLN B NE2 
1940 N  N   . VAL B 39  ? 0.3336 0.4147 0.3654 -0.0115 -0.0391 -0.0375 411  VAL B N   
1941 C  CA  . VAL B 39  ? 0.3311 0.3852 0.3455 -0.0141 -0.0256 -0.0339 411  VAL B CA  
1942 C  C   . VAL B 39  ? 0.3544 0.3950 0.3362 -0.0093 -0.0291 -0.0286 411  VAL B C   
1943 O  O   . VAL B 39  ? 0.3647 0.3920 0.3332 -0.0141 -0.0230 -0.0326 411  VAL B O   
1944 C  CB  . VAL B 39  ? 0.3202 0.3657 0.3415 -0.0096 -0.0124 -0.0246 411  VAL B CB  
1945 C  CG1 . VAL B 39  ? 0.2815 0.3045 0.2836 -0.0096 -0.0029 -0.0194 411  VAL B CG1 
1946 C  CG2 . VAL B 39  ? 0.2877 0.3457 0.3397 -0.0157 -0.0031 -0.0270 411  VAL B CG2 
1947 N  N   . GLN B 40  ? 0.3637 0.4077 0.3359 0.0007  -0.0371 -0.0186 412  GLN B N   
1948 C  CA  . GLN B 40  ? 0.3796 0.4115 0.3240 0.0048  -0.0377 -0.0098 412  GLN B CA  
1949 C  C   . GLN B 40  ? 0.4087 0.4511 0.3314 0.0018  -0.0447 -0.0167 412  GLN B C   
1950 O  O   . GLN B 40  ? 0.4209 0.4533 0.3192 0.0027  -0.0396 -0.0115 412  GLN B O   
1951 C  CB  . GLN B 40  ? 0.3847 0.4148 0.3284 0.0165  -0.0428 0.0056  412  GLN B CB  
1952 C  CG  . GLN B 40  ? 0.3718 0.3825 0.3246 0.0196  -0.0335 0.0112  412  GLN B CG  
1953 C  CD  . GLN B 40  ? 0.3865 0.3901 0.3436 0.0308  -0.0373 0.0252  412  GLN B CD  
1954 O  OE1 . GLN B 40  ? 0.3697 0.3566 0.3370 0.0332  -0.0310 0.0266  412  GLN B OE1 
1955 N  NE2 . GLN B 40  ? 0.3772 0.3936 0.3271 0.0382  -0.0481 0.0355  412  GLN B NE2 
1956 N  N   . SER B 41  ? 0.4204 0.4857 0.3522 -0.0018 -0.0563 -0.0295 413  SER B N   
1957 C  CA  . SER B 41  ? 0.4548 0.5333 0.3619 -0.0044 -0.0645 -0.0410 413  SER B CA  
1958 C  C   . SER B 41  ? 0.4672 0.5378 0.3771 -0.0170 -0.0564 -0.0633 413  SER B C   
1959 O  O   . SER B 41  ? 0.4979 0.5792 0.3882 -0.0202 -0.0622 -0.0794 413  SER B O   
1960 C  CB  . SER B 41  ? 0.4736 0.5860 0.3795 0.0011  -0.0859 -0.0429 413  SER B CB  
1961 O  OG  . SER B 41  ? 0.4749 0.6037 0.4196 -0.0006 -0.0925 -0.0472 413  SER B OG  
1962 N  N   . VAL B 42  ? 0.4593 0.5104 0.3922 -0.0229 -0.0422 -0.0640 414  VAL B N   
1963 C  CA  . VAL B 42  ? 0.4759 0.5097 0.4120 -0.0312 -0.0297 -0.0779 414  VAL B CA  
1964 C  C   . VAL B 42  ? 0.4947 0.5159 0.3990 -0.0260 -0.0212 -0.0734 414  VAL B C   
1965 O  O   . VAL B 42  ? 0.4787 0.4941 0.3700 -0.0182 -0.0181 -0.0539 414  VAL B O   
1966 C  CB  . VAL B 42  ? 0.4555 0.4716 0.4199 -0.0342 -0.0155 -0.0705 414  VAL B CB  
1967 C  CG1 . VAL B 42  ? 0.4659 0.4608 0.4352 -0.0389 -0.0012 -0.0789 414  VAL B CG1 
1968 C  CG2 . VAL B 42  ? 0.4491 0.4785 0.4476 -0.0405 -0.0188 -0.0747 414  VAL B CG2 
1969 N  N   . ASP B 43  ? 0.5269 0.5440 0.4232 -0.0310 -0.0160 -0.0932 415  ASP B N   
1970 C  CA  . ASP B 43  ? 0.5447 0.5521 0.4153 -0.0266 -0.0042 -0.0932 415  ASP B CA  
1971 C  C   . ASP B 43  ? 0.5119 0.5030 0.3872 -0.0210 0.0083  -0.0708 415  ASP B C   
1972 O  O   . ASP B 43  ? 0.4913 0.4676 0.3920 -0.0225 0.0170  -0.0673 415  ASP B O   
1973 C  CB  . ASP B 43  ? 0.5804 0.5779 0.4585 -0.0333 0.0048  -0.1205 415  ASP B CB  
1974 C  CG  . ASP B 43  ? 0.6429 0.6348 0.4948 -0.0275 0.0186  -0.1243 415  ASP B CG  
1975 O  OD1 . ASP B 43  ? 0.7057 0.7103 0.5244 -0.0204 0.0173  -0.1114 415  ASP B OD1 
1976 O  OD2 . ASP B 43  ? 0.6841 0.6590 0.5513 -0.0294 0.0327  -0.1391 415  ASP B OD2 
1977 N  N   . GLY B 44  ? 0.5036 0.4996 0.3557 -0.0143 0.0085  -0.0544 416  GLY B N   
1978 C  CA  . GLY B 44  ? 0.4675 0.4521 0.3270 -0.0106 0.0182  -0.0352 416  GLY B CA  
1979 C  C   . GLY B 44  ? 0.4332 0.4138 0.3124 -0.0094 0.0125  -0.0213 416  GLY B C   
1980 O  O   . GLY B 44  ? 0.4231 0.3961 0.3115 -0.0077 0.0185  -0.0100 416  GLY B O   
1981 N  N   . ASN B 45  ? 0.4156 0.4040 0.3033 -0.0102 0.0010  -0.0240 417  ASN B N   
1982 C  CA  . ASN B 45  ? 0.3881 0.3736 0.2944 -0.0080 -0.0018 -0.0145 417  ASN B CA  
1983 C  C   . ASN B 45  ? 0.3863 0.3718 0.2877 -0.0017 -0.0070 0.0002  417  ASN B C   
1984 O  O   . ASN B 45  ? 0.3737 0.3543 0.2898 0.0006  -0.0074 0.0050  417  ASN B O   
1985 C  CB  . ASN B 45  ? 0.3801 0.3738 0.3052 -0.0112 -0.0072 -0.0230 417  ASN B CB  
1986 C  CG  . ASN B 45  ? 0.3517 0.3366 0.2941 -0.0159 0.0028  -0.0279 417  ASN B CG  
1987 O  OD1 . ASN B 45  ? 0.3564 0.3303 0.2959 -0.0162 0.0118  -0.0280 417  ASN B OD1 
1988 N  ND2 . ASN B 45  ? 0.3058 0.2961 0.2686 -0.0185 0.0027  -0.0293 417  ASN B ND2 
1989 N  N   . ALA B 46  ? 0.3980 0.3883 0.2787 0.0018  -0.0097 0.0075  418  ALA B N   
1990 C  CA  . ALA B 46  ? 0.4038 0.3903 0.2827 0.0088  -0.0126 0.0257  418  ALA B CA  
1991 C  C   . ALA B 46  ? 0.4037 0.3745 0.2864 0.0073  -0.0006 0.0368  418  ALA B C   
1992 O  O   . ALA B 46  ? 0.4101 0.3731 0.2943 0.0114  0.0008  0.0534  418  ALA B O   
1993 C  CB  . ALA B 46  ? 0.4296 0.4309 0.2843 0.0151  -0.0212 0.0337  418  ALA B CB  
1994 N  N   . GLN B 47  ? 0.3891 0.3559 0.2782 0.0014  0.0083  0.0282  419  GLN B N   
1995 C  CA  . GLN B 47  ? 0.3916 0.3493 0.2935 -0.0016 0.0181  0.0348  419  GLN B CA  
1996 C  C   . GLN B 47  ? 0.3669 0.3236 0.2882 -0.0044 0.0175  0.0241  419  GLN B C   
1997 O  O   . GLN B 47  ? 0.3553 0.3165 0.2752 -0.0051 0.0180  0.0145  419  GLN B O   
1998 C  CB  . GLN B 47  ? 0.3994 0.3606 0.2885 -0.0035 0.0308  0.0373  419  GLN B CB  
1999 C  CG  . GLN B 47  ? 0.4604 0.4237 0.3279 -0.0001 0.0357  0.0538  419  GLN B CG  
2000 C  CD  . GLN B 47  ? 0.4867 0.4629 0.3232 0.0050  0.0273  0.0497  419  GLN B CD  
2001 O  OE1 . GLN B 47  ? 0.4960 0.4798 0.3250 0.0031  0.0246  0.0305  419  GLN B OE1 
2002 N  NE2 . GLN B 47  ? 0.5133 0.4926 0.3345 0.0116  0.0223  0.0674  419  GLN B NE2 
2003 N  N   . CYS B 48  ? 0.3636 0.3148 0.3034 -0.0055 0.0163  0.0257  420  CYS B N   
2004 C  CA  . CYS B 48  ? 0.3472 0.3028 0.3005 -0.0066 0.0143  0.0164  420  CYS B CA  
2005 C  C   . CYS B 48  ? 0.3501 0.3123 0.3037 -0.0076 0.0211  0.0144  420  CYS B C   
2006 O  O   . CYS B 48  ? 0.3696 0.3327 0.3237 -0.0095 0.0295  0.0189  420  CYS B O   
2007 C  CB  . CYS B 48  ? 0.3363 0.2886 0.3093 -0.0095 0.0124  0.0151  420  CYS B CB  
2008 S  SG  . CYS B 48  ? 0.3152 0.2815 0.2994 -0.0093 0.0071  0.0037  420  CYS B SG  
2009 N  N   . CYS B 49  ? 0.3482 0.3151 0.3035 -0.0052 0.0193  0.0093  421  CYS B N   
2010 C  CA  . CYS B 49  ? 0.3490 0.3195 0.3097 -0.0035 0.0260  0.0089  421  CYS B CA  
2011 C  C   . CYS B 49  ? 0.3467 0.3259 0.3244 -0.0035 0.0284  0.0118  421  CYS B C   
2012 O  O   . CYS B 49  ? 0.3507 0.3322 0.3347 -0.0022 0.0374  0.0131  421  CYS B O   
2013 C  CB  . CYS B 49  ? 0.3378 0.3103 0.3006 0.0002  0.0240  0.0083  421  CYS B CB  
2014 S  SG  . CYS B 49  ? 0.3885 0.3586 0.3615 0.0045  0.0338  0.0108  421  CYS B SG  
2015 N  N   . ASP B 50  ? 0.3438 0.3294 0.3318 -0.0049 0.0203  0.0105  422  ASP B N   
2016 C  CA  . ASP B 50  ? 0.3412 0.3414 0.3515 -0.0059 0.0187  0.0104  422  ASP B CA  
2017 C  C   . ASP B 50  ? 0.3469 0.3466 0.3740 -0.0138 0.0235  0.0122  422  ASP B C   
2018 O  O   . ASP B 50  ? 0.3491 0.3629 0.3992 -0.0154 0.0269  0.0134  422  ASP B O   
2019 C  CB  . ASP B 50  ? 0.3441 0.3572 0.3577 -0.0033 0.0058  0.0043  422  ASP B CB  
2020 C  CG  . ASP B 50  ? 0.3557 0.3723 0.3551 0.0054  0.0046  0.0083  422  ASP B CG  
2021 O  OD1 . ASP B 50  ? 0.3495 0.3603 0.3476 0.0091  0.0133  0.0152  422  ASP B OD1 
2022 O  OD2 . ASP B 50  ? 0.3947 0.4193 0.3850 0.0086  -0.0035 0.0045  422  ASP B OD2 
2023 N  N   . CYS B 51  ? 0.3435 0.3280 0.3628 -0.0180 0.0251  0.0146  423  CYS B N   
2024 C  CA  . CYS B 51  ? 0.3415 0.3219 0.3795 -0.0259 0.0321  0.0207  423  CYS B CA  
2025 C  C   . CYS B 51  ? 0.3529 0.3184 0.3720 -0.0257 0.0420  0.0334  423  CYS B C   
2026 O  O   . CYS B 51  ? 0.3618 0.3222 0.3941 -0.0313 0.0511  0.0438  423  CYS B O   
2027 C  CB  . CYS B 51  ? 0.3325 0.3098 0.3923 -0.0319 0.0227  0.0121  423  CYS B CB  
2028 S  SG  . CYS B 51  ? 0.3582 0.3112 0.4029 -0.0293 0.0185  0.0128  423  CYS B SG  
2029 N  N   . ARG B 52  ? 0.3589 0.3197 0.3485 -0.0194 0.0398  0.0334  424  ARG B N   
2030 C  CA  . ARG B 52  ? 0.3742 0.3277 0.3398 -0.0170 0.0453  0.0444  424  ARG B CA  
2031 C  C   . ARG B 52  ? 0.3781 0.3178 0.3456 -0.0164 0.0409  0.0539  424  ARG B C   
2032 O  O   . ARG B 52  ? 0.3977 0.3336 0.3469 -0.0129 0.0451  0.0680  424  ARG B O   
2033 C  CB  . ARG B 52  ? 0.3904 0.3499 0.3509 -0.0183 0.0620  0.0541  424  ARG B CB  
2034 C  CG  . ARG B 52  ? 0.4023 0.3732 0.3581 -0.0156 0.0681  0.0435  424  ARG B CG  
2035 C  CD  . ARG B 52  ? 0.4514 0.4296 0.3944 -0.0145 0.0866  0.0498  424  ARG B CD  
2036 N  NE  . ARG B 52  ? 0.5342 0.5099 0.4399 -0.0108 0.0878  0.0569  424  ARG B NE  
2037 C  CZ  . ARG B 52  ? 0.5465 0.5246 0.4224 -0.0062 0.0819  0.0452  424  ARG B CZ  
2038 N  NH1 . ARG B 52  ? 0.5302 0.5082 0.4115 -0.0054 0.0773  0.0267  424  ARG B NH1 
2039 N  NH2 . ARG B 52  ? 0.5784 0.5600 0.4206 -0.0023 0.0804  0.0524  424  ARG B NH2 
2040 N  N   . GLU B 53  ? 0.3621 0.2951 0.3509 -0.0183 0.0327  0.0463  425  GLU B N   
2041 C  CA  . GLU B 53  ? 0.3868 0.3042 0.3805 -0.0152 0.0283  0.0522  425  GLU B CA  
2042 C  C   . GLU B 53  ? 0.3836 0.3033 0.3499 -0.0058 0.0223  0.0571  425  GLU B C   
2043 O  O   . GLU B 53  ? 0.3808 0.3110 0.3358 -0.0032 0.0155  0.0451  425  GLU B O   
2044 C  CB  . GLU B 53  ? 0.3796 0.2926 0.3950 -0.0166 0.0193  0.0351  425  GLU B CB  
2045 C  CG  . GLU B 53  ? 0.4133 0.3070 0.4409 -0.0121 0.0166  0.0380  425  GLU B CG  
2046 C  CD  . GLU B 53  ? 0.4830 0.3571 0.5405 -0.0189 0.0252  0.0482  425  GLU B CD  
2047 O  OE1 . GLU B 53  ? 0.4879 0.3638 0.5716 -0.0296 0.0269  0.0372  425  GLU B OE1 
2048 O  OE2 . GLU B 53  ? 0.5283 0.3862 0.5863 -0.0133 0.0299  0.0681  425  GLU B OE2 
2049 N  N   . PRO B 54  ? 0.3945 0.3064 0.3528 -0.0007 0.0247  0.0760  426  PRO B N   
2050 C  CA  . PRO B 54  ? 0.4061 0.3266 0.3397 0.0088  0.0168  0.0820  426  PRO B CA  
2051 C  C   . PRO B 54  ? 0.3919 0.3133 0.3355 0.0146  0.0048  0.0708  426  PRO B C   
2052 O  O   . PRO B 54  ? 0.3861 0.2944 0.3543 0.0146  0.0043  0.0656  426  PRO B O   
2053 C  CB  . PRO B 54  ? 0.4349 0.3450 0.3646 0.0148  0.0222  0.1096  426  PRO B CB  
2054 C  CG  . PRO B 54  ? 0.4382 0.3366 0.3857 0.0057  0.0374  0.1182  426  PRO B CG  
2055 C  CD  . PRO B 54  ? 0.4183 0.3141 0.3936 -0.0035 0.0355  0.0951  426  PRO B CD  
2056 N  N   . ALA B 55  ? 0.3909 0.3293 0.3178 0.0191  -0.0040 0.0656  427  ALA B N   
2057 C  CA  . ALA B 55  ? 0.3787 0.3239 0.3174 0.0254  -0.0139 0.0570  427  ALA B CA  
2058 C  C   . ALA B 55  ? 0.3509 0.2909 0.3097 0.0220  -0.0120 0.0399  427  ALA B C   
2059 O  O   . ALA B 55  ? 0.3536 0.2855 0.3305 0.0275  -0.0133 0.0375  427  ALA B O   
2060 C  CB  . ALA B 55  ? 0.3966 0.3365 0.3433 0.0376  -0.0191 0.0744  427  ALA B CB  
2061 N  N   . PRO B 56  ? 0.3436 0.2892 0.2978 0.0143  -0.0084 0.0283  428  PRO B N   
2062 C  CA  . PRO B 56  ? 0.3330 0.2797 0.2986 0.0129  -0.0076 0.0140  428  PRO B CA  
2063 C  C   . PRO B 56  ? 0.3415 0.2996 0.3126 0.0189  -0.0113 0.0073  428  PRO B C   
2064 O  O   . PRO B 56  ? 0.3281 0.2989 0.2945 0.0195  -0.0146 0.0089  428  PRO B O   
2065 C  CB  . PRO B 56  ? 0.3115 0.2656 0.2682 0.0065  -0.0036 0.0097  428  PRO B CB  
2066 C  CG  . PRO B 56  ? 0.3184 0.2780 0.2603 0.0053  -0.0036 0.0149  428  PRO B CG  
2067 C  CD  . PRO B 56  ? 0.3338 0.2867 0.2711 0.0086  -0.0048 0.0279  428  PRO B CD  
2068 N  N   . GLU B 57  ? 0.3594 0.3152 0.3424 0.0229  -0.0102 -0.0022 429  GLU B N   
2069 C  CA  . GLU B 57  ? 0.3727 0.3406 0.3648 0.0302  -0.0105 -0.0084 429  GLU B CA  
2070 C  C   . GLU B 57  ? 0.3644 0.3450 0.3518 0.0286  -0.0049 -0.0185 429  GLU B C   
2071 O  O   . GLU B 57  ? 0.3774 0.3701 0.3725 0.0343  -0.0013 -0.0241 429  GLU B O   
2072 C  CB  . GLU B 57  ? 0.3857 0.3420 0.3953 0.0390  -0.0106 -0.0124 429  GLU B CB  
2073 C  CG  . GLU B 57  ? 0.4578 0.4035 0.4757 0.0448  -0.0152 0.0029  429  GLU B CG  
2074 C  CD  . GLU B 57  ? 0.5402 0.4686 0.5815 0.0545  -0.0132 -0.0006 429  GLU B CD  
2075 O  OE1 . GLU B 57  ? 0.5977 0.5066 0.6464 0.0502  -0.0094 -0.0090 429  GLU B OE1 
2076 O  OE2 . GLU B 57  ? 0.5655 0.5004 0.6220 0.0665  -0.0157 0.0037  429  GLU B OE2 
2077 N  N   . TRP B 58  ? 0.3541 0.3336 0.3297 0.0223  -0.0031 -0.0190 430  TRP B N   
2078 C  CA  . TRP B 58  ? 0.3395 0.3314 0.3071 0.0229  0.0019  -0.0242 430  TRP B CA  
2079 C  C   . TRP B 58  ? 0.3317 0.3276 0.2930 0.0173  0.0050  -0.0149 430  TRP B C   
2080 O  O   . TRP B 58  ? 0.3083 0.2974 0.2702 0.0127  0.0028  -0.0096 430  TRP B O   
2081 C  CB  . TRP B 58  ? 0.3465 0.3362 0.3090 0.0231  -0.0007 -0.0343 430  TRP B CB  
2082 C  CG  . TRP B 58  ? 0.3533 0.3369 0.3254 0.0284  -0.0020 -0.0484 430  TRP B CG  
2083 C  CD1 . TRP B 58  ? 0.3469 0.3112 0.3352 0.0278  -0.0052 -0.0503 430  TRP B CD1 
2084 C  CD2 . TRP B 58  ? 0.3498 0.3450 0.3179 0.0362  0.0024  -0.0623 430  TRP B CD2 
2085 N  NE1 . TRP B 58  ? 0.3682 0.3285 0.3667 0.0349  -0.0038 -0.0667 430  TRP B NE1 
2086 C  CE2 . TRP B 58  ? 0.3720 0.3526 0.3567 0.0403  0.0009  -0.0760 430  TRP B CE2 
2087 C  CE3 . TRP B 58  ? 0.3753 0.3918 0.3277 0.0408  0.0093  -0.0636 430  TRP B CE3 
2088 C  CZ2 . TRP B 58  ? 0.4166 0.4036 0.4021 0.0493  0.0058  -0.0955 430  TRP B CZ2 
2089 C  CZ3 . TRP B 58  ? 0.4050 0.4315 0.3535 0.0498  0.0149  -0.0807 430  TRP B CZ3 
2090 C  CH2 . TRP B 58  ? 0.4191 0.4310 0.3841 0.0541  0.0128  -0.0986 430  TRP B CH2 
2091 N  N   . ALA B 59  ? 0.3445 0.3511 0.2998 0.0187  0.0113  -0.0125 431  ALA B N   
2092 C  CA  . ALA B 59  ? 0.3444 0.3511 0.3002 0.0143  0.0167  -0.0028 431  ALA B CA  
2093 C  C   . ALA B 59  ? 0.3567 0.3720 0.3026 0.0184  0.0221  0.0039  431  ALA B C   
2094 O  O   . ALA B 59  ? 0.3706 0.3980 0.3064 0.0248  0.0233  0.0002  431  ALA B O   
2095 C  CB  . ALA B 59  ? 0.3462 0.3580 0.3159 0.0113  0.0216  -0.0010 431  ALA B CB  
2096 N  N   . SER B 60  ? 0.3546 0.3647 0.3025 0.0164  0.0257  0.0137  432  SER B N   
2097 C  CA  . SER B 60  ? 0.3718 0.3902 0.3133 0.0221  0.0328  0.0270  432  SER B CA  
2098 C  C   . SER B 60  ? 0.3699 0.3823 0.3268 0.0180  0.0455  0.0375  432  SER B C   
2099 O  O   . SER B 60  ? 0.3700 0.3683 0.3413 0.0112  0.0466  0.0359  432  SER B O   
2100 C  CB  . SER B 60  ? 0.3764 0.3937 0.3156 0.0251  0.0283  0.0328  432  SER B CB  
2101 O  OG  . SER B 60  ? 0.4185 0.4430 0.3538 0.0327  0.0355  0.0508  432  SER B OG  
2102 N  N   . ILE B 61  ? 0.3774 0.4010 0.3330 0.0215  0.0562  0.0471  433  ILE B N   
2103 C  CA  . ILE B 61  ? 0.3789 0.3974 0.3580 0.0148  0.0700  0.0558  433  ILE B CA  
2104 C  C   . ILE B 61  ? 0.3970 0.4040 0.3858 0.0159  0.0817  0.0759  433  ILE B C   
2105 O  O   . ILE B 61  ? 0.4096 0.4050 0.4258 0.0072  0.0923  0.0796  433  ILE B O   
2106 C  CB  . ILE B 61  ? 0.3735 0.4093 0.3580 0.0153  0.0800  0.0567  433  ILE B CB  
2107 C  CG1 . ILE B 61  ? 0.3943 0.4478 0.3532 0.0274  0.0883  0.0696  433  ILE B CG1 
2108 C  CG2 . ILE B 61  ? 0.3699 0.4116 0.3574 0.0136  0.0688  0.0365  433  ILE B CG2 
2109 C  CD1 . ILE B 61  ? 0.3738 0.4464 0.3393 0.0290  0.1048  0.0743  433  ILE B CD1 
2110 N  N   . ASN B 62  ? 0.4028 0.4136 0.3735 0.0267  0.0794  0.0885  434  ASN B N   
2111 C  CA  . ASN B 62  ? 0.4246 0.4223 0.4080 0.0305  0.0899  0.1100  434  ASN B CA  
2112 C  C   . ASN B 62  ? 0.4134 0.3919 0.4104 0.0274  0.0834  0.1007  434  ASN B C   
2113 O  O   . ASN B 62  ? 0.4282 0.3871 0.4482 0.0265  0.0941  0.1106  434  ASN B O   
2114 C  CB  . ASN B 62  ? 0.4483 0.4637 0.4074 0.0465  0.0912  0.1328  434  ASN B CB  
2115 C  CG  . ASN B 62  ? 0.4538 0.4862 0.3885 0.0538  0.0717  0.1206  434  ASN B CG  
2116 O  OD1 . ASN B 62  ? 0.4480 0.4854 0.3753 0.0482  0.0604  0.0968  434  ASN B OD1 
2117 N  ND2 . ASN B 62  ? 0.4662 0.5081 0.3926 0.0664  0.0673  0.1374  434  ASN B ND2 
2118 N  N   . LEU B 63  ? 0.3919 0.3750 0.3772 0.0258  0.0683  0.0815  435  LEU B N   
2119 C  CA  . LEU B 63  ? 0.3760 0.3450 0.3714 0.0228  0.0641  0.0711  435  LEU B CA  
2120 C  C   . LEU B 63  ? 0.3634 0.3197 0.3703 0.0099  0.0640  0.0517  435  LEU B C   
2121 O  O   . LEU B 63  ? 0.3633 0.3048 0.3819 0.0066  0.0667  0.0437  435  LEU B O   
2122 C  CB  . LEU B 63  ? 0.3674 0.3496 0.3472 0.0272  0.0501  0.0635  435  LEU B CB  
2123 C  CG  . LEU B 63  ? 0.3871 0.3881 0.3566 0.0400  0.0450  0.0780  435  LEU B CG  
2124 C  CD1 . LEU B 63  ? 0.3333 0.3498 0.2924 0.0395  0.0296  0.0634  435  LEU B CD1 
2125 C  CD2 . LEU B 63  ? 0.3771 0.3707 0.3638 0.0492  0.0519  0.0956  435  LEU B CD2 
2126 N  N   . GLY B 64  ? 0.3554 0.3205 0.3585 0.0040  0.0603  0.0431  436  GLY B N   
2127 C  CA  . GLY B 64  ? 0.3397 0.3002 0.3524 -0.0068 0.0568  0.0255  436  GLY B CA  
2128 C  C   . GLY B 64  ? 0.3312 0.2930 0.3287 -0.0075 0.0450  0.0122  436  GLY B C   
2129 O  O   . GLY B 64  ? 0.3312 0.2861 0.3319 -0.0135 0.0434  -0.0005 436  GLY B O   
2130 N  N   . VAL B 65  ? 0.3252 0.2962 0.3064 -0.0016 0.0375  0.0145  437  VAL B N   
2131 C  CA  . VAL B 65  ? 0.3167 0.2870 0.2865 -0.0019 0.0293  0.0072  437  VAL B CA  
2132 C  C   . VAL B 65  ? 0.3137 0.2921 0.2757 -0.0005 0.0208  0.0040  437  VAL B C   
2133 O  O   . VAL B 65  ? 0.3109 0.2975 0.2732 0.0030  0.0211  0.0061  437  VAL B O   
2134 C  CB  . VAL B 65  ? 0.3099 0.2800 0.2771 0.0032  0.0297  0.0127  437  VAL B CB  
2135 C  CG1 . VAL B 65  ? 0.2964 0.2579 0.2750 0.0050  0.0389  0.0172  437  VAL B CG1 
2136 C  CG2 . VAL B 65  ? 0.3190 0.3017 0.2812 0.0095  0.0255  0.0189  437  VAL B CG2 
2137 N  N   . THR B 66  ? 0.3185 0.2940 0.2740 -0.0020 0.0149  -0.0002 438  THR B N   
2138 C  CA  . THR B 66  ? 0.3202 0.2981 0.2730 0.0008  0.0082  -0.0010 438  THR B CA  
2139 C  C   . THR B 66  ? 0.3262 0.3004 0.2777 0.0018  0.0067  0.0004  438  THR B C   
2140 O  O   . THR B 66  ? 0.3238 0.2948 0.2749 -0.0004 0.0097  0.0029  438  THR B O   
2141 C  CB  . THR B 66  ? 0.3267 0.3051 0.2767 0.0002  0.0024  -0.0022 438  THR B CB  
2142 O  OG1 . THR B 66  ? 0.3392 0.3129 0.2789 -0.0027 0.0036  -0.0014 438  THR B OG1 
2143 C  CG2 . THR B 66  ? 0.3148 0.3033 0.2739 -0.0016 0.0011  -0.0066 438  THR B CG2 
2144 N  N   . LEU B 67  ? 0.3314 0.3071 0.2859 0.0048  0.0027  -0.0033 439  LEU B N   
2145 C  CA  . LEU B 67  ? 0.3301 0.3045 0.2900 0.0040  -0.0002 -0.0069 439  LEU B CA  
2146 C  C   . LEU B 67  ? 0.3418 0.3067 0.3098 0.0047  -0.0037 -0.0112 439  LEU B C   
2147 O  O   . LEU B 67  ? 0.3329 0.2973 0.3018 0.0095  -0.0047 -0.0140 439  LEU B O   
2148 C  CB  . LEU B 67  ? 0.3327 0.3205 0.2897 0.0076  -0.0019 -0.0120 439  LEU B CB  
2149 C  CG  . LEU B 67  ? 0.3423 0.3387 0.2949 0.0096  0.0021  -0.0038 439  LEU B CG  
2150 C  CD1 . LEU B 67  ? 0.3040 0.3164 0.2471 0.0163  0.0006  -0.0049 439  LEU B CD1 
2151 C  CD2 . LEU B 67  ? 0.2932 0.2896 0.2545 0.0068  0.0022  -0.0001 439  LEU B CD2 
2152 N  N   . CYS B 68  ? 0.3487 0.3059 0.3279 0.0002  -0.0043 -0.0116 440  CYS B N   
2153 C  CA  . CYS B 68  ? 0.3812 0.3245 0.3750 0.0003  -0.0059 -0.0155 440  CYS B CA  
2154 C  C   . CYS B 68  ? 0.3937 0.3426 0.3931 0.0023  -0.0106 -0.0346 440  CYS B C   
2155 O  O   . CYS B 68  ? 0.3991 0.3655 0.3869 0.0041  -0.0129 -0.0410 440  CYS B O   
2156 C  CB  . CYS B 68  ? 0.3795 0.3112 0.3886 -0.0070 -0.0020 -0.0075 440  CYS B CB  
2157 S  SG  . CYS B 68  ? 0.3983 0.3416 0.4258 -0.0159 -0.0044 -0.0186 440  CYS B SG  
2158 N  N   . ILE B 69  ? 0.4193 0.3535 0.4352 0.0033  -0.0114 -0.0437 441  ILE B N   
2159 C  CA  . ILE B 69  ? 0.4445 0.3837 0.4643 0.0059  -0.0154 -0.0675 441  ILE B CA  
2160 C  C   . ILE B 69  ? 0.4487 0.4030 0.4710 -0.0013 -0.0220 -0.0803 441  ILE B C   
2161 O  O   . ILE B 69  ? 0.4582 0.4332 0.4648 0.0027  -0.0269 -0.0939 441  ILE B O   
2162 C  CB  . ILE B 69  ? 0.4748 0.3898 0.5200 0.0073  -0.0139 -0.0779 441  ILE B CB  
2163 C  CG1 . ILE B 69  ? 0.4981 0.3974 0.5477 0.0146  -0.0089 -0.0576 441  ILE B CG1 
2164 C  CG2 . ILE B 69  ? 0.4885 0.4100 0.5321 0.0137  -0.0159 -0.1062 441  ILE B CG2 
2165 C  CD1 . ILE B 69  ? 0.5647 0.4333 0.6462 0.0163  -0.0054 -0.0575 441  ILE B CD1 
2166 N  N   . GLN B 70  ? 0.4472 0.3946 0.4898 -0.0113 -0.0220 -0.0746 442  GLN B N   
2167 C  CA  . GLN B 70  ? 0.4473 0.4125 0.5022 -0.0192 -0.0299 -0.0872 442  GLN B CA  
2168 C  C   . GLN B 70  ? 0.4255 0.4183 0.4571 -0.0142 -0.0334 -0.0796 442  GLN B C   
2169 O  O   . GLN B 70  ? 0.4348 0.4516 0.4579 -0.0115 -0.0430 -0.0934 442  GLN B O   
2170 C  CB  . GLN B 70  ? 0.4504 0.4038 0.5365 -0.0310 -0.0251 -0.0775 442  GLN B CB  
2171 C  CG  . GLN B 70  ? 0.4747 0.4475 0.5865 -0.0413 -0.0337 -0.0928 442  GLN B CG  
2172 C  CD  . GLN B 70  ? 0.5083 0.4627 0.6630 -0.0551 -0.0267 -0.0898 442  GLN B CD  
2173 O  OE1 . GLN B 70  ? 0.5215 0.4602 0.6794 -0.0565 -0.0134 -0.0648 442  GLN B OE1 
2174 N  NE2 . GLN B 70  ? 0.5179 0.4749 0.7060 -0.0657 -0.0349 -0.1156 442  GLN B NE2 
2175 N  N   . CYS B 71  ? 0.4051 0.3943 0.4260 -0.0119 -0.0255 -0.0577 443  CYS B N   
2176 C  CA  . CYS B 71  ? 0.3914 0.4003 0.3976 -0.0070 -0.0260 -0.0478 443  CYS B CA  
2177 C  C   . CYS B 71  ? 0.3931 0.4137 0.3734 0.0029  -0.0274 -0.0498 443  CYS B C   
2178 O  O   . CYS B 71  ? 0.3990 0.4414 0.3694 0.0080  -0.0322 -0.0482 443  CYS B O   
2179 C  CB  . CYS B 71  ? 0.3750 0.3744 0.3798 -0.0079 -0.0159 -0.0285 443  CYS B CB  
2180 S  SG  . CYS B 71  ? 0.3565 0.3538 0.3905 -0.0182 -0.0110 -0.0230 443  CYS B SG  
2181 N  N   . SER B 72  ? 0.3943 0.4030 0.3656 0.0065  -0.0225 -0.0517 444  SER B N   
2182 C  CA  . SER B 72  ? 0.4000 0.4211 0.3498 0.0154  -0.0200 -0.0524 444  SER B CA  
2183 C  C   . SER B 72  ? 0.4185 0.4594 0.3589 0.0192  -0.0285 -0.0716 444  SER B C   
2184 O  O   . SER B 72  ? 0.4293 0.4918 0.3479 0.0270  -0.0289 -0.0678 444  SER B O   
2185 C  CB  . SER B 72  ? 0.3951 0.4033 0.3447 0.0185  -0.0128 -0.0519 444  SER B CB  
2186 O  OG  . SER B 72  ? 0.4268 0.4269 0.3857 0.0196  -0.0152 -0.0701 444  SER B OG  
2187 N  N   . GLY B 73  ? 0.4272 0.4609 0.3844 0.0136  -0.0352 -0.0922 445  GLY B N   
2188 C  CA  . GLY B 73  ? 0.4563 0.5105 0.4084 0.0146  -0.0465 -0.1175 445  GLY B CA  
2189 C  C   . GLY B 73  ? 0.4632 0.5478 0.4070 0.0160  -0.0572 -0.1128 445  GLY B C   
2190 O  O   . GLY B 73  ? 0.4923 0.6047 0.4112 0.0242  -0.0643 -0.1223 445  GLY B O   
2191 N  N   . ILE B 74  ? 0.4396 0.5216 0.4035 0.0098  -0.0579 -0.0973 446  ILE B N   
2192 C  CA  . ILE B 74  ? 0.4366 0.5478 0.4008 0.0128  -0.0675 -0.0892 446  ILE B CA  
2193 C  C   . ILE B 74  ? 0.4378 0.5616 0.3726 0.0264  -0.0618 -0.0659 446  ILE B C   
2194 O  O   . ILE B 74  ? 0.4465 0.6016 0.3645 0.0355  -0.0716 -0.0642 446  ILE B O   
2195 C  CB  . ILE B 74  ? 0.4248 0.5291 0.4239 0.0032  -0.0661 -0.0795 446  ILE B CB  
2196 C  CG1 . ILE B 74  ? 0.4250 0.5236 0.4582 -0.0109 -0.0724 -0.1018 446  ILE B CG1 
2197 C  CG2 . ILE B 74  ? 0.4065 0.5406 0.4101 0.0096  -0.0732 -0.0663 446  ILE B CG2 
2198 C  CD1 . ILE B 74  ? 0.3856 0.4623 0.4502 -0.0215 -0.0610 -0.0887 446  ILE B CD1 
2199 N  N   . HIS B 75  ? 0.4296 0.5302 0.3599 0.0276  -0.0463 -0.0477 447  HIS B N   
2200 C  CA  . HIS B 75  ? 0.4390 0.5453 0.3469 0.0383  -0.0372 -0.0264 447  HIS B CA  
2201 C  C   . HIS B 75  ? 0.4733 0.6018 0.3496 0.0483  -0.0389 -0.0329 447  HIS B C   
2202 O  O   . HIS B 75  ? 0.4855 0.6315 0.3421 0.0592  -0.0360 -0.0140 447  HIS B O   
2203 C  CB  . HIS B 75  ? 0.4198 0.4986 0.3321 0.0350  -0.0217 -0.0146 447  HIS B CB  
2204 C  CG  . HIS B 75  ? 0.4007 0.4646 0.3314 0.0308  -0.0162 -0.0007 447  HIS B CG  
2205 N  ND1 . HIS B 75  ? 0.4042 0.4595 0.3554 0.0225  -0.0194 -0.0069 447  HIS B ND1 
2206 C  CD2 . HIS B 75  ? 0.3975 0.4522 0.3304 0.0335  -0.0055 0.0174  447  HIS B CD2 
2207 C  CE1 . HIS B 75  ? 0.3653 0.4096 0.3260 0.0217  -0.0111 0.0058  447  HIS B CE1 
2208 N  NE2 . HIS B 75  ? 0.3742 0.4165 0.3254 0.0280  -0.0033 0.0189  447  HIS B NE2 
2209 N  N   . ARG B 76  ? 0.4924 0.6201 0.3639 0.0456  -0.0421 -0.0586 448  ARG B N   
2210 C  CA  . ARG B 76  ? 0.5394 0.6904 0.3784 0.0557  -0.0422 -0.0699 448  ARG B CA  
2211 C  C   . ARG B 76  ? 0.5692 0.7584 0.3889 0.0628  -0.0594 -0.0775 448  ARG B C   
2212 O  O   . ARG B 76  ? 0.5947 0.8101 0.3786 0.0745  -0.0590 -0.0788 448  ARG B O   
2213 C  CB  . ARG B 76  ? 0.5490 0.6884 0.3924 0.0519  -0.0416 -0.1008 448  ARG B CB  
2214 C  CG  . ARG B 76  ? 0.5482 0.6587 0.4061 0.0490  -0.0264 -0.0948 448  ARG B CG  
2215 C  CD  . ARG B 76  ? 0.5776 0.6778 0.4428 0.0487  -0.0256 -0.1247 448  ARG B CD  
2216 N  NE  . ARG B 76  ? 0.5751 0.6622 0.4450 0.0526  -0.0097 -0.1161 448  ARG B NE  
2217 C  CZ  . ARG B 76  ? 0.5806 0.6407 0.4782 0.0472  -0.0063 -0.1112 448  ARG B CZ  
2218 N  NH1 . ARG B 76  ? 0.6206 0.6612 0.5413 0.0377  -0.0148 -0.1127 448  ARG B NH1 
2219 N  NH2 . ARG B 76  ? 0.5755 0.6313 0.4790 0.0519  0.0058  -0.1038 448  ARG B NH2 
2220 N  N   . SER B 77  ? 0.5753 0.7707 0.4194 0.0559  -0.0747 -0.0835 449  SER B N   
2221 C  CA  . SER B 77  ? 0.6122 0.8493 0.4458 0.0619  -0.0954 -0.0917 449  SER B CA  
2222 C  C   . SER B 77  ? 0.6157 0.8727 0.4390 0.0749  -0.0957 -0.0557 449  SER B C   
2223 O  O   . SER B 77  ? 0.6463 0.9439 0.4464 0.0868  -0.1102 -0.0536 449  SER B O   
2224 C  CB  . SER B 77  ? 0.6032 0.8420 0.4767 0.0476  -0.1116 -0.1157 449  SER B CB  
2225 O  OG  . SER B 77  ? 0.6358 0.8695 0.5124 0.0396  -0.1171 -0.1543 449  SER B OG  
2226 N  N   . LEU B 78  ? 0.5986 0.8272 0.4395 0.0736  -0.0798 -0.0280 450  LEU B N   
2227 C  CA  . LEU B 78  ? 0.6100 0.8474 0.4499 0.0858  -0.0760 0.0075  450  LEU B CA  
2228 C  C   . LEU B 78  ? 0.6504 0.9051 0.4491 0.1023  -0.0678 0.0300  450  LEU B C   
2229 O  O   . LEU B 78  ? 0.6702 0.9517 0.4567 0.1174  -0.0741 0.0538  450  LEU B O   
2230 C  CB  . LEU B 78  ? 0.5733 0.7711 0.4420 0.0788  -0.0584 0.0253  450  LEU B CB  
2231 C  CG  . LEU B 78  ? 0.5441 0.7252 0.4513 0.0647  -0.0618 0.0115  450  LEU B CG  
2232 C  CD1 . LEU B 78  ? 0.4934 0.6406 0.4198 0.0609  -0.0438 0.0290  450  LEU B CD1 
2233 C  CD2 . LEU B 78  ? 0.5320 0.7458 0.4593 0.0670  -0.0807 0.0067  450  LEU B CD2 
2234 N  N   . GLY B 79  ? 0.6649 0.9056 0.4442 0.1003  -0.0527 0.0244  451  GLY B N   
2235 C  CA  . GLY B 79  ? 0.7050 0.9583 0.4488 0.1142  -0.0383 0.0487  451  GLY B CA  
2236 C  C   . GLY B 79  ? 0.6904 0.9078 0.4531 0.1101  -0.0134 0.0748  451  GLY B C   
2237 O  O   . GLY B 79  ? 0.6578 0.8467 0.4560 0.1007  -0.0106 0.0786  451  GLY B O   
2238 N  N   . VAL B 80  ? 0.7164 0.9377 0.4560 0.1169  0.0053  0.0913  452  VAL B N   
2239 C  CA  . VAL B 80  ? 0.7013 0.8919 0.4623 0.1108  0.0299  0.1116  452  VAL B CA  
2240 C  C   . VAL B 80  ? 0.7056 0.8804 0.4877 0.1151  0.0391  0.1482  452  VAL B C   
2241 O  O   . VAL B 80  ? 0.6909 0.8349 0.5023 0.1059  0.0559  0.1584  452  VAL B O   
2242 C  CB  . VAL B 80  ? 0.7292 0.9319 0.4653 0.1159  0.0498  0.1184  452  VAL B CB  
2243 C  CG1 . VAL B 80  ? 0.7130 0.9149 0.4476 0.1079  0.0475  0.0804  452  VAL B CG1 
2244 C  CG2 . VAL B 80  ? 0.7713 1.0138 0.4601 0.1354  0.0491  0.1375  452  VAL B CG2 
2245 N  N   . HIS B 81  ? 0.7225 0.9191 0.4929 0.1294  0.0274  0.1663  453  HIS B N   
2246 C  CA  . HIS B 81  ? 0.7229 0.9026 0.5194 0.1357  0.0347  0.1993  453  HIS B CA  
2247 C  C   . HIS B 81  ? 0.6729 0.8227 0.5114 0.1222  0.0298  0.1822  453  HIS B C   
2248 O  O   . HIS B 81  ? 0.6684 0.7896 0.5376 0.1209  0.0429  0.2000  453  HIS B O   
2249 C  CB  . HIS B 81  ? 0.7648 0.9789 0.5420 0.1569  0.0208  0.2234  453  HIS B CB  
2250 C  CG  . HIS B 81  ? 0.8070 1.0017 0.6130 0.1669  0.0319  0.2621  453  HIS B CG  
2251 N  ND1 . HIS B 81  ? 0.8068 0.9722 0.6581 0.1595  0.0316  0.2561  453  HIS B ND1 
2252 C  CD2 . HIS B 81  ? 0.8751 1.0739 0.6729 0.1848  0.0455  0.3077  453  HIS B CD2 
2253 C  CE1 . HIS B 81  ? 0.8483 0.9989 0.7204 0.1723  0.0441  0.2933  453  HIS B CE1 
2254 N  NE2 . HIS B 81  ? 0.8833 1.0525 0.7252 0.1878  0.0526  0.3271  453  HIS B NE2 
2255 N  N   . PHE B 82  ? 0.6303 0.7862 0.4707 0.1124  0.0126  0.1475  454  PHE B N   
2256 C  CA  . PHE B 82  ? 0.5838 0.7150 0.4593 0.1002  0.0095  0.1321  454  PHE B CA  
2257 C  C   . PHE B 82  ? 0.5490 0.6530 0.4347 0.0833  0.0182  0.1116  454  PHE B C   
2258 O  O   . PHE B 82  ? 0.5375 0.6136 0.4490 0.0751  0.0272  0.1119  454  PHE B O   
2259 C  CB  . PHE B 82  ? 0.5714 0.7252 0.4527 0.1002  -0.0131 0.1132  454  PHE B CB  
2260 C  CG  . PHE B 82  ? 0.5841 0.7653 0.4673 0.1172  -0.0234 0.1347  454  PHE B CG  
2261 C  CD1 . PHE B 82  ? 0.5630 0.7292 0.4787 0.1224  -0.0169 0.1531  454  PHE B CD1 
2262 C  CD2 . PHE B 82  ? 0.6130 0.8372 0.4652 0.1298  -0.0398 0.1363  454  PHE B CD2 
2263 C  CE1 . PHE B 82  ? 0.5756 0.7686 0.4978 0.1409  -0.0265 0.1758  454  PHE B CE1 
2264 C  CE2 . PHE B 82  ? 0.6298 0.8851 0.4839 0.1480  -0.0521 0.1589  454  PHE B CE2 
2265 C  CZ  . PHE B 82  ? 0.6102 0.8496 0.5018 0.1541  -0.0454 0.1802  454  PHE B CZ  
2266 N  N   . SER B 83  ? 0.5375 0.6511 0.4036 0.0793  0.0154  0.0929  455  SER B N   
2267 C  CA  . SER B 83  ? 0.5010 0.5926 0.3795 0.0653  0.0205  0.0736  455  SER B CA  
2268 C  C   . SER B 83  ? 0.5002 0.6005 0.3604 0.0657  0.0270  0.0650  455  SER B C   
2269 O  O   . SER B 83  ? 0.5230 0.6477 0.3575 0.0731  0.0199  0.0558  455  SER B O   
2270 C  CB  . SER B 83  ? 0.4807 0.5666 0.3725 0.0564  0.0065  0.0500  455  SER B CB  
2271 O  OG  . SER B 83  ? 0.4636 0.5260 0.3699 0.0451  0.0119  0.0391  455  SER B OG  
2272 N  N   . LYS B 84  ? 0.4757 0.5585 0.3512 0.0581  0.0403  0.0662  456  LYS B N   
2273 C  CA  . LYS B 84  ? 0.4703 0.5614 0.3376 0.0583  0.0497  0.0590  456  LYS B CA  
2274 C  C   . LYS B 84  ? 0.4333 0.5101 0.3179 0.0487  0.0439  0.0361  456  LYS B C   
2275 O  O   . LYS B 84  ? 0.4234 0.4831 0.3312 0.0400  0.0480  0.0378  456  LYS B O   
2276 C  CB  . LYS B 84  ? 0.4827 0.5697 0.3616 0.0574  0.0707  0.0818  456  LYS B CB  
2277 C  CG  . LYS B 84  ? 0.5150 0.6177 0.3742 0.0694  0.0816  0.1100  456  LYS B CG  
2278 C  CD  . LYS B 84  ? 0.5433 0.6377 0.4238 0.0652  0.1057  0.1324  456  LYS B CD  
2279 C  CE  . LYS B 84  ? 0.6155 0.7278 0.4734 0.0787  0.1214  0.1655  456  LYS B CE  
2280 N  NZ  . LYS B 84  ? 0.6387 0.7453 0.4935 0.0876  0.1160  0.1885  456  LYS B NZ  
2281 N  N   . VAL B 85  ? 0.4198 0.5040 0.2937 0.0508  0.0338  0.0144  457  VAL B N   
2282 C  CA  . VAL B 85  ? 0.3827 0.4513 0.2737 0.0438  0.0268  -0.0040 457  VAL B CA  
2283 C  C   . VAL B 85  ? 0.3756 0.4465 0.2746 0.0452  0.0363  -0.0110 457  VAL B C   
2284 O  O   . VAL B 85  ? 0.3830 0.4715 0.2672 0.0532  0.0439  -0.0157 457  VAL B O   
2285 C  CB  . VAL B 85  ? 0.3912 0.4622 0.2760 0.0443  0.0121  -0.0246 457  VAL B CB  
2286 C  CG1 . VAL B 85  ? 0.3662 0.4169 0.2717 0.0379  0.0070  -0.0384 457  VAL B CG1 
2287 C  CG2 . VAL B 85  ? 0.3805 0.4561 0.2631 0.0434  0.0024  -0.0175 457  VAL B CG2 
2288 N  N   . ARG B 86  ? 0.3479 0.4044 0.2702 0.0386  0.0356  -0.0117 458  ARG B N   
2289 C  CA  . ARG B 86  ? 0.3514 0.4124 0.2893 0.0405  0.0418  -0.0180 458  ARG B CA  
2290 C  C   . ARG B 86  ? 0.3389 0.3843 0.2937 0.0379  0.0311  -0.0271 458  ARG B C   
2291 O  O   . ARG B 86  ? 0.3351 0.3659 0.2923 0.0314  0.0225  -0.0233 458  ARG B O   
2292 C  CB  . ARG B 86  ? 0.3447 0.4122 0.2997 0.0360  0.0539  -0.0032 458  ARG B CB  
2293 C  CG  . ARG B 86  ? 0.3793 0.4595 0.3216 0.0387  0.0686  0.0134  458  ARG B CG  
2294 C  CD  . ARG B 86  ? 0.3995 0.5015 0.3248 0.0495  0.0795  0.0087  458  ARG B CD  
2295 N  NE  . ARG B 86  ? 0.4146 0.5314 0.3249 0.0537  0.0959  0.0295  458  ARG B NE  
2296 C  CZ  . ARG B 86  ? 0.4494 0.5742 0.3269 0.0613  0.0938  0.0373  458  ARG B CZ  
2297 N  NH1 . ARG B 86  ? 0.4579 0.5786 0.3185 0.0635  0.0752  0.0228  458  ARG B NH1 
2298 N  NH2 . ARG B 86  ? 0.4595 0.5984 0.3232 0.0670  0.1103  0.0612  458  ARG B NH2 
2299 N  N   . SER B 87  ? 0.3381 0.3876 0.3053 0.0442  0.0332  -0.0371 459  SER B N   
2300 C  CA  . SER B 87  ? 0.3336 0.3697 0.3191 0.0448  0.0242  -0.0408 459  SER B CA  
2301 C  C   . SER B 87  ? 0.3181 0.3620 0.3239 0.0416  0.0238  -0.0311 459  SER B C   
2302 O  O   . SER B 87  ? 0.3027 0.3650 0.3209 0.0431  0.0332  -0.0294 459  SER B O   
2303 C  CB  . SER B 87  ? 0.3537 0.3892 0.3479 0.0556  0.0264  -0.0568 459  SER B CB  
2304 O  OG  . SER B 87  ? 0.3621 0.3881 0.3799 0.0596  0.0204  -0.0547 459  SER B OG  
2305 N  N   . LEU B 88  ? 0.3218 0.3545 0.3316 0.0371  0.0130  -0.0255 460  LEU B N   
2306 C  CA  . LEU B 88  ? 0.3256 0.3693 0.3532 0.0346  0.0079  -0.0201 460  LEU B CA  
2307 C  C   . LEU B 88  ? 0.3406 0.3957 0.3918 0.0455  0.0056  -0.0228 460  LEU B C   
2308 O  O   . LEU B 88  ? 0.3411 0.4153 0.4131 0.0449  0.0019  -0.0204 460  LEU B O   
2309 C  CB  . LEU B 88  ? 0.3240 0.3558 0.3420 0.0290  -0.0032 -0.0142 460  LEU B CB  
2310 C  CG  . LEU B 88  ? 0.3155 0.3371 0.3158 0.0193  -0.0009 -0.0119 460  LEU B CG  
2311 C  CD1 . LEU B 88  ? 0.3145 0.3250 0.3029 0.0165  -0.0092 -0.0076 460  LEU B CD1 
2312 C  CD2 . LEU B 88  ? 0.3045 0.3374 0.3145 0.0115  0.0050  -0.0119 460  LEU B CD2 
2313 N  N   . THR B 89  ? 0.3580 0.4022 0.4102 0.0556  0.0073  -0.0292 461  THR B N   
2314 C  CA  . THR B 89  ? 0.3767 0.4277 0.4552 0.0686  0.0052  -0.0305 461  THR B CA  
2315 C  C   . THR B 89  ? 0.3877 0.4511 0.4781 0.0780  0.0193  -0.0431 461  THR B C   
2316 O  O   . THR B 89  ? 0.3930 0.4739 0.5122 0.0880  0.0214  -0.0438 461  THR B O   
2317 C  CB  . THR B 89  ? 0.3948 0.4201 0.4745 0.0756  -0.0025 -0.0271 461  THR B CB  
2318 O  OG1 . THR B 89  ? 0.4060 0.4107 0.4716 0.0737  0.0033  -0.0388 461  THR B OG1 
2319 C  CG2 . THR B 89  ? 0.3972 0.4144 0.4638 0.0687  -0.0145 -0.0119 461  THR B CG2 
2320 N  N   . LEU B 90  ? 0.3927 0.4506 0.4606 0.0760  0.0287  -0.0534 462  LEU B N   
2321 C  CA  . LEU B 90  ? 0.4136 0.4833 0.4840 0.0863  0.0432  -0.0685 462  LEU B CA  
2322 C  C   . LEU B 90  ? 0.4150 0.5111 0.4758 0.0829  0.0587  -0.0658 462  LEU B C   
2323 O  O   . LEU B 90  ? 0.4252 0.5387 0.4914 0.0926  0.0735  -0.0754 462  LEU B O   
2324 C  CB  . LEU B 90  ? 0.4355 0.4843 0.4873 0.0894  0.0428  -0.0863 462  LEU B CB  
2325 C  CG  . LEU B 90  ? 0.4534 0.4726 0.5214 0.0939  0.0331  -0.0909 462  LEU B CG  
2326 C  CD1 . LEU B 90  ? 0.4691 0.4695 0.5184 0.0894  0.0308  -0.1087 462  LEU B CD1 
2327 C  CD2 . LEU B 90  ? 0.4282 0.4481 0.5298 0.1105  0.0387  -0.0982 462  LEU B CD2 
2328 N  N   . ASP B 91  ? 0.4006 0.4986 0.4486 0.0702  0.0573  -0.0521 463  ASP B N   
2329 C  CA  . ASP B 91  ? 0.4066 0.5259 0.4499 0.0665  0.0738  -0.0437 463  ASP B CA  
2330 C  C   . ASP B 91  ? 0.3950 0.5322 0.4742 0.0597  0.0768  -0.0330 463  ASP B C   
2331 O  O   . ASP B 91  ? 0.3794 0.5116 0.4766 0.0550  0.0617  -0.0307 463  ASP B O   
2332 C  CB  . ASP B 91  ? 0.4057 0.5151 0.4176 0.0580  0.0729  -0.0342 463  ASP B CB  
2333 C  CG  . ASP B 91  ? 0.4263 0.5283 0.4043 0.0643  0.0700  -0.0463 463  ASP B CG  
2334 O  OD1 . ASP B 91  ? 0.4274 0.5410 0.3973 0.0750  0.0789  -0.0606 463  ASP B OD1 
2335 O  OD2 . ASP B 91  ? 0.4322 0.5189 0.3935 0.0584  0.0587  -0.0436 463  ASP B OD2 
2336 N  N   . SER B 92  ? 0.4055 0.5663 0.4958 0.0591  0.0965  -0.0267 464  SER B N   
2337 C  CA  . SER B 92  ? 0.4029 0.5821 0.5315 0.0484  0.1016  -0.0167 464  SER B CA  
2338 C  C   . SER B 92  ? 0.3924 0.5573 0.5133 0.0328  0.0996  -0.0041 464  SER B C   
2339 O  O   . SER B 92  ? 0.3961 0.5479 0.4841 0.0327  0.1054  0.0034  464  SER B O   
2340 C  CB  . SER B 92  ? 0.4139 0.6231 0.5615 0.0524  0.1275  -0.0123 464  SER B CB  
2341 O  OG  . SER B 92  ? 0.4563 0.6809 0.6203 0.0674  0.1303  -0.0258 464  SER B OG  
2342 N  N   . TRP B 93  ? 0.3828 0.5521 0.5363 0.0208  0.0909  -0.0034 465  TRP B N   
2343 C  CA  . TRP B 93  ? 0.3842 0.5388 0.5392 0.0055  0.0897  0.0041  465  TRP B CA  
2344 C  C   . TRP B 93  ? 0.3903 0.5653 0.5949 -0.0079 0.1000  0.0074  465  TRP B C   
2345 O  O   . TRP B 93  ? 0.3792 0.5747 0.6196 -0.0113 0.0888  -0.0027 465  TRP B O   
2346 C  CB  . TRP B 93  ? 0.3675 0.5036 0.5113 0.0015  0.0655  -0.0043 465  TRP B CB  
2347 C  CG  . TRP B 93  ? 0.3668 0.4811 0.4693 0.0109  0.0569  -0.0061 465  TRP B CG  
2348 C  CD1 . TRP B 93  ? 0.3500 0.4642 0.4407 0.0241  0.0516  -0.0127 465  TRP B CD1 
2349 C  CD2 . TRP B 93  ? 0.3555 0.4454 0.4290 0.0075  0.0533  -0.0021 465  TRP B CD2 
2350 N  NE1 . TRP B 93  ? 0.3518 0.4433 0.4098 0.0268  0.0448  -0.0138 465  TRP B NE1 
2351 C  CE2 . TRP B 93  ? 0.3499 0.4288 0.3967 0.0172  0.0453  -0.0068 465  TRP B CE2 
2352 C  CE3 . TRP B 93  ? 0.3545 0.4307 0.4269 -0.0026 0.0569  0.0044  465  TRP B CE3 
2353 C  CZ2 . TRP B 93  ? 0.3436 0.4029 0.3640 0.0164  0.0402  -0.0048 465  TRP B CZ2 
2354 C  CZ3 . TRP B 93  ? 0.3278 0.3838 0.3723 -0.0009 0.0522  0.0070  465  TRP B CZ3 
2355 C  CH2 . TRP B 93  ? 0.3227 0.3727 0.3421 0.0081  0.0435  0.0026  465  TRP B CH2 
2356 N  N   . GLU B 94  ? 0.4068 0.5775 0.6163 -0.0153 0.1210  0.0226  466  GLU B N   
2357 C  CA  . GLU B 94  ? 0.4220 0.6026 0.6829 -0.0330 0.1315  0.0264  466  GLU B CA  
2358 C  C   . GLU B 94  ? 0.4050 0.5703 0.6775 -0.0465 0.1098  0.0120  466  GLU B C   
2359 O  O   . GLU B 94  ? 0.4064 0.5442 0.6426 -0.0443 0.0992  0.0106  466  GLU B O   
2360 C  CB  . GLU B 94  ? 0.4490 0.6190 0.7082 -0.0371 0.1595  0.0503  466  GLU B CB  
2361 C  CG  . GLU B 94  ? 0.4946 0.6816 0.7304 -0.0220 0.1826  0.0658  466  GLU B CG  
2362 C  CD  . GLU B 94  ? 0.5882 0.8037 0.8710 -0.0286 0.2112  0.0787  466  GLU B CD  
2363 O  OE1 . GLU B 94  ? 0.6158 0.8399 0.9569 -0.0464 0.2118  0.0740  466  GLU B OE1 
2364 O  OE2 . GLU B 94  ? 0.6333 0.8648 0.8952 -0.0164 0.2342  0.0931  466  GLU B OE2 
2365 N  N   . PRO B 95  ? 0.4022 0.5888 0.7256 -0.0602 0.1027  -0.0008 467  PRO B N   
2366 C  CA  . PRO B 95  ? 0.3952 0.5743 0.7316 -0.0739 0.0814  -0.0197 467  PRO B CA  
2367 C  C   . PRO B 95  ? 0.4081 0.5487 0.7290 -0.0828 0.0867  -0.0169 467  PRO B C   
2368 O  O   . PRO B 95  ? 0.4081 0.5324 0.7035 -0.0829 0.0685  -0.0301 467  PRO B O   
2369 C  CB  . PRO B 95  ? 0.3979 0.6096 0.8032 -0.0905 0.0834  -0.0298 467  PRO B CB  
2370 C  CG  . PRO B 95  ? 0.4031 0.6389 0.8325 -0.0847 0.1086  -0.0129 467  PRO B CG  
2371 C  CD  . PRO B 95  ? 0.4023 0.6281 0.7753 -0.0620 0.1131  -0.0009 467  PRO B CD  
2372 N  N   . GLU B 96  ? 0.4198 0.5464 0.7561 -0.0884 0.1130  0.0018  468  GLU B N   
2373 C  CA  . GLU B 96  ? 0.4334 0.5222 0.7608 -0.0941 0.1204  0.0076  468  GLU B CA  
2374 C  C   . GLU B 96  ? 0.4210 0.4870 0.6868 -0.0779 0.1115  0.0130  468  GLU B C   
2375 O  O   . GLU B 96  ? 0.4217 0.4609 0.6762 -0.0806 0.1066  0.0074  468  GLU B O   
2376 C  CB  . GLU B 96  ? 0.4626 0.5413 0.8195 -0.1003 0.1525  0.0337  468  GLU B CB  
2377 C  CG  . GLU B 96  ? 0.4976 0.5788 0.8170 -0.0823 0.1712  0.0638  468  GLU B CG  
2378 C  CD  . GLU B 96  ? 0.5510 0.6673 0.8936 -0.0806 0.1896  0.0749  468  GLU B CD  
2379 O  OE1 . GLU B 96  ? 0.5490 0.6930 0.9345 -0.0904 0.1834  0.0577  468  GLU B OE1 
2380 O  OE2 . GLU B 96  ? 0.5734 0.6925 0.8902 -0.0683 0.2106  0.1010  468  GLU B OE2 
2381 N  N   . LEU B 97  ? 0.4061 0.4840 0.6359 -0.0613 0.1095  0.0214  469  LEU B N   
2382 C  CA  . LEU B 97  ? 0.3973 0.4573 0.5759 -0.0477 0.1013  0.0255  469  LEU B CA  
2383 C  C   . LEU B 97  ? 0.3814 0.4395 0.5429 -0.0470 0.0761  0.0046  469  LEU B C   
2384 O  O   . LEU B 97  ? 0.3775 0.4155 0.5113 -0.0433 0.0690  0.0030  469  LEU B O   
2385 C  CB  . LEU B 97  ? 0.3964 0.4692 0.5449 -0.0317 0.1088  0.0386  469  LEU B CB  
2386 C  CG  . LEU B 97  ? 0.4025 0.4617 0.5030 -0.0185 0.1017  0.0431  469  LEU B CG  
2387 C  CD1 . LEU B 97  ? 0.4103 0.4450 0.5045 -0.0201 0.1073  0.0556  469  LEU B CD1 
2388 C  CD2 . LEU B 97  ? 0.4064 0.4824 0.4813 -0.0045 0.1107  0.0518  469  LEU B CD2 
2389 N  N   . VAL B 98  ? 0.3731 0.4546 0.5525 -0.0494 0.0635  -0.0093 470  VAL B N   
2390 C  CA  . VAL B 98  ? 0.3663 0.4492 0.5301 -0.0482 0.0403  -0.0255 470  VAL B CA  
2391 C  C   . VAL B 98  ? 0.3798 0.4475 0.5532 -0.0617 0.0365  -0.0388 470  VAL B C   
2392 O  O   . VAL B 98  ? 0.3775 0.4292 0.5209 -0.0587 0.0275  -0.0447 470  VAL B O   
2393 C  CB  . VAL B 98  ? 0.3623 0.4779 0.5477 -0.0463 0.0263  -0.0351 470  VAL B CB  
2394 C  CG1 . VAL B 98  ? 0.3617 0.4807 0.5295 -0.0452 0.0021  -0.0488 470  VAL B CG1 
2395 C  CG2 . VAL B 98  ? 0.3392 0.4658 0.5154 -0.0309 0.0309  -0.0253 470  VAL B CG2 
2396 N  N   . LYS B 99  ? 0.3854 0.4576 0.6031 -0.0766 0.0456  -0.0442 471  LYS B N   
2397 C  CA  . LYS B 99  ? 0.4087 0.4634 0.6422 -0.0907 0.0446  -0.0608 471  LYS B CA  
2398 C  C   . LYS B 99  ? 0.4108 0.4290 0.6207 -0.0858 0.0569  -0.0500 471  LYS B C   
2399 O  O   . LYS B 99  ? 0.4175 0.4194 0.6168 -0.0889 0.0508  -0.0656 471  LYS B O   
2400 C  CB  . LYS B 99  ? 0.4283 0.4918 0.7227 -0.1095 0.0546  -0.0687 471  LYS B CB  
2401 C  CG  . LYS B 99  ? 0.4451 0.5511 0.7715 -0.1159 0.0387  -0.0843 471  LYS B CG  
2402 C  CD  . LYS B 99  ? 0.5112 0.6275 0.9055 -0.1386 0.0461  -0.0981 471  LYS B CD  
2403 C  CE  . LYS B 99  ? 0.5576 0.6768 0.9656 -0.1537 0.0257  -0.1351 471  LYS B CE  
2404 N  NZ  . LYS B 99  ? 0.5750 0.6559 0.9431 -0.1505 0.0254  -0.1434 471  LYS B NZ  
2405 N  N   . LEU B 100 ? 0.4072 0.4156 0.6081 -0.0768 0.0739  -0.0240 472  LEU B N   
2406 C  CA  . LEU B 100 ? 0.4124 0.3917 0.5921 -0.0692 0.0831  -0.0112 472  LEU B CA  
2407 C  C   . LEU B 100 ? 0.4044 0.3794 0.5407 -0.0589 0.0678  -0.0184 472  LEU B C   
2408 O  O   . LEU B 100 ? 0.4098 0.3643 0.5387 -0.0585 0.0686  -0.0242 472  LEU B O   
2409 C  CB  . LEU B 100 ? 0.4179 0.3951 0.5912 -0.0592 0.1012  0.0196  472  LEU B CB  
2410 C  CG  . LEU B 100 ? 0.4334 0.3901 0.5806 -0.0466 0.1072  0.0375  472  LEU B CG  
2411 C  CD1 . LEU B 100 ? 0.4707 0.3973 0.6428 -0.0528 0.1165  0.0354  472  LEU B CD1 
2412 C  CD2 . LEU B 100 ? 0.4400 0.4050 0.5744 -0.0351 0.1214  0.0670  472  LEU B CD2 
2413 N  N   . MET B 101 ? 0.3859 0.3798 0.4977 -0.0504 0.0558  -0.0176 473  MET B N   
2414 C  CA  . MET B 101 ? 0.3794 0.3706 0.4553 -0.0420 0.0428  -0.0222 473  MET B CA  
2415 C  C   . MET B 101 ? 0.3924 0.3813 0.4655 -0.0490 0.0318  -0.0436 473  MET B C   
2416 O  O   . MET B 101 ? 0.3987 0.3763 0.4482 -0.0447 0.0294  -0.0467 473  MET B O   
2417 C  CB  . MET B 101 ? 0.3658 0.3753 0.4258 -0.0333 0.0332  -0.0187 473  MET B CB  
2418 C  CG  . MET B 101 ? 0.3757 0.3893 0.4296 -0.0245 0.0432  -0.0025 473  MET B CG  
2419 S  SD  . MET B 101 ? 0.4136 0.4131 0.4361 -0.0140 0.0447  0.0084  473  MET B SD  
2420 C  CE  . MET B 101 ? 0.4493 0.4415 0.4858 -0.0143 0.0637  0.0263  473  MET B CE  
2421 N  N   . CYS B 102 ? 0.3983 0.4013 0.4961 -0.0598 0.0255  -0.0595 474  CYS B N   
2422 C  CA  . CYS B 102 ? 0.4243 0.4315 0.5162 -0.0663 0.0129  -0.0834 474  CYS B CA  
2423 C  C   . CYS B 102 ? 0.4507 0.4328 0.5518 -0.0733 0.0233  -0.0962 474  CYS B C   
2424 O  O   . CYS B 102 ? 0.4740 0.4547 0.5568 -0.0745 0.0162  -0.1155 474  CYS B O   
2425 C  CB  . CYS B 102 ? 0.4255 0.4620 0.5427 -0.0752 -0.0007 -0.0988 474  CYS B CB  
2426 S  SG  . CYS B 102 ? 0.4480 0.5129 0.5507 -0.0617 -0.0146 -0.0845 474  CYS B SG  
2427 N  N   . GLU B 103 ? 0.4563 0.4184 0.5848 -0.0763 0.0416  -0.0846 475  GLU B N   
2428 C  CA  . GLU B 103 ? 0.4799 0.4128 0.6221 -0.0802 0.0541  -0.0937 475  GLU B CA  
2429 C  C   . GLU B 103 ? 0.4666 0.3819 0.5816 -0.0659 0.0615  -0.0789 475  GLU B C   
2430 O  O   . GLU B 103 ? 0.4861 0.3789 0.6090 -0.0655 0.0711  -0.0874 475  GLU B O   
2431 C  CB  . GLU B 103 ? 0.4948 0.4115 0.6857 -0.0898 0.0720  -0.0857 475  GLU B CB  
2432 C  CG  . GLU B 103 ? 0.5529 0.4840 0.7846 -0.1086 0.0667  -0.1083 475  GLU B CG  
2433 C  CD  . GLU B 103 ? 0.6228 0.5568 0.8528 -0.1181 0.0527  -0.1482 475  GLU B CD  
2434 O  OE1 . GLU B 103 ? 0.6585 0.5658 0.8847 -0.1169 0.0605  -0.1608 475  GLU B OE1 
2435 O  OE2 . GLU B 103 ? 0.6534 0.6192 0.8854 -0.1256 0.0337  -0.1675 475  GLU B OE2 
2436 N  N   . LEU B 104 ? 0.4365 0.3630 0.5244 -0.0543 0.0574  -0.0584 476  LEU B N   
2437 C  CA  . LEU B 104 ? 0.4190 0.3355 0.4855 -0.0418 0.0618  -0.0452 476  LEU B CA  
2438 C  C   . LEU B 104 ? 0.4056 0.3353 0.4371 -0.0368 0.0492  -0.0518 476  LEU B C   
2439 O  O   . LEU B 104 ? 0.4119 0.3437 0.4333 -0.0410 0.0440  -0.0721 476  LEU B O   
2440 C  CB  . LEU B 104 ? 0.4096 0.3278 0.4763 -0.0328 0.0685  -0.0170 476  LEU B CB  
2441 C  CG  . LEU B 104 ? 0.4367 0.3358 0.5259 -0.0284 0.0852  0.0010  476  LEU B CG  
2442 C  CD1 . LEU B 104 ? 0.4485 0.3218 0.5671 -0.0350 0.0960  -0.0131 476  LEU B CD1 
2443 C  CD2 . LEU B 104 ? 0.4268 0.3331 0.5294 -0.0295 0.0928  0.0199  476  LEU B CD2 
2444 N  N   . GLY B 105 ? 0.3799 0.3184 0.3932 -0.0281 0.0452  -0.0352 477  GLY B N   
2445 C  CA  . GLY B 105 ? 0.3697 0.3182 0.3557 -0.0242 0.0355  -0.0370 477  GLY B CA  
2446 C  C   . GLY B 105 ? 0.3719 0.3141 0.3468 -0.0174 0.0410  -0.0318 477  GLY B C   
2447 O  O   . GLY B 105 ? 0.3835 0.3139 0.3716 -0.0144 0.0515  -0.0293 477  GLY B O   
2448 N  N   . ASN B 106 ? 0.3592 0.3098 0.3140 -0.0148 0.0349  -0.0291 478  ASN B N   
2449 C  CA  . ASN B 106 ? 0.3479 0.2978 0.2978 -0.0094 0.0397  -0.0210 478  ASN B CA  
2450 C  C   . ASN B 106 ? 0.3619 0.3051 0.3121 -0.0082 0.0507  -0.0302 478  ASN B C   
2451 O  O   . ASN B 106 ? 0.3569 0.2971 0.3203 -0.0029 0.0588  -0.0240 478  ASN B O   
2452 C  CB  . ASN B 106 ? 0.3479 0.3059 0.2819 -0.0086 0.0328  -0.0148 478  ASN B CB  
2453 C  CG  . ASN B 106 ? 0.3421 0.3042 0.2806 -0.0073 0.0244  -0.0068 478  ASN B CG  
2454 O  OD1 . ASN B 106 ? 0.3589 0.3234 0.2904 -0.0065 0.0191  -0.0020 478  ASN B OD1 
2455 N  ND2 . ASN B 106 ? 0.3132 0.2754 0.2638 -0.0062 0.0251  -0.0046 478  ASN B ND2 
2456 N  N   . VAL B 107 ? 0.3724 0.3161 0.3091 -0.0122 0.0507  -0.0464 479  VAL B N   
2457 C  CA  . VAL B 107 ? 0.3959 0.3336 0.3308 -0.0105 0.0628  -0.0604 479  VAL B CA  
2458 C  C   . VAL B 107 ? 0.4060 0.3266 0.3712 -0.0088 0.0732  -0.0639 479  VAL B C   
2459 O  O   . VAL B 107 ? 0.4170 0.3324 0.3934 -0.0018 0.0851  -0.0620 479  VAL B O   
2460 C  CB  . VAL B 107 ? 0.4252 0.3697 0.3361 -0.0152 0.0588  -0.0820 479  VAL B CB  
2461 C  CG1 . VAL B 107 ? 0.4380 0.3738 0.3496 -0.0136 0.0733  -0.1039 479  VAL B CG1 
2462 C  CG2 . VAL B 107 ? 0.3926 0.3534 0.2723 -0.0129 0.0524  -0.0722 479  VAL B CG2 
2463 N  N   A ILE B 108 ? 0.4066 0.3192 0.3885 -0.0145 0.0698  -0.0672 480  ILE B N   
2464 N  N   B ILE B 108 ? 0.4057 0.3183 0.3879 -0.0143 0.0699  -0.0668 480  ILE B N   
2465 C  CA  A ILE B 108 ? 0.4148 0.3079 0.4290 -0.0129 0.0810  -0.0656 480  ILE B CA  
2466 C  CA  B ILE B 108 ? 0.4142 0.3070 0.4283 -0.0126 0.0814  -0.0657 480  ILE B CA  
2467 C  C   A ILE B 108 ? 0.4034 0.2965 0.4301 -0.0021 0.0851  -0.0396 480  ILE B C   
2468 C  C   B ILE B 108 ? 0.4030 0.2954 0.4310 -0.0022 0.0853  -0.0393 480  ILE B C   
2469 O  O   A ILE B 108 ? 0.4128 0.2953 0.4579 0.0061  0.0966  -0.0364 480  ILE B O   
2470 O  O   B ILE B 108 ? 0.4130 0.2933 0.4614 0.0058  0.0969  -0.0351 480  ILE B O   
2471 C  CB  A ILE B 108 ? 0.4198 0.3067 0.4531 -0.0227 0.0780  -0.0691 480  ILE B CB  
2472 C  CB  B ILE B 108 ? 0.4225 0.3078 0.4559 -0.0230 0.0791  -0.0733 480  ILE B CB  
2473 C  CG1 A ILE B 108 ? 0.4435 0.3314 0.4744 -0.0340 0.0733  -0.1000 480  ILE B CG1 
2474 C  CG1 B ILE B 108 ? 0.4493 0.3301 0.4824 -0.0324 0.0788  -0.1063 480  ILE B CG1 
2475 C  CG2 A ILE B 108 ? 0.4183 0.2839 0.4866 -0.0193 0.0916  -0.0563 480  ILE B CG2 
2476 C  CG2 B ILE B 108 ? 0.4173 0.2833 0.4846 -0.0194 0.0913  -0.0570 480  ILE B CG2 
2477 C  CD1 A ILE B 108 ? 0.4696 0.3402 0.5094 -0.0340 0.0852  -0.1243 480  ILE B CD1 
2478 C  CD1 B ILE B 108 ? 0.4466 0.3316 0.4959 -0.0457 0.0706  -0.1179 480  ILE B CD1 
2479 N  N   . ILE B 109 ? 0.3837 0.2908 0.4010 -0.0011 0.0751  -0.0228 481  ILE B N   
2480 C  CA  . ILE B 109 ? 0.3795 0.2930 0.4048 0.0089  0.0752  -0.0006 481  ILE B CA  
2481 C  C   . ILE B 109 ? 0.3857 0.3093 0.4104 0.0165  0.0766  0.0025  481  ILE B C   
2482 O  O   . ILE B 109 ? 0.4043 0.3309 0.4461 0.0267  0.0801  0.0159  481  ILE B O   
2483 C  CB  . ILE B 109 ? 0.3650 0.2923 0.3793 0.0080  0.0646  0.0115  481  ILE B CB  
2484 C  CG1 . ILE B 109 ? 0.3541 0.2741 0.3777 0.0019  0.0675  0.0122  481  ILE B CG1 
2485 C  CG2 . ILE B 109 ? 0.3579 0.2977 0.3744 0.0186  0.0616  0.0303  481  ILE B CG2 
2486 C  CD1 . ILE B 109 ? 0.3642 0.2653 0.4148 0.0045  0.0815  0.0210  481  ILE B CD1 
2487 N  N   . ASN B 110 ? 0.3864 0.3175 0.3942 0.0121  0.0745  -0.0080 482  ASN B N   
2488 C  CA  . ASN B 110 ? 0.3869 0.3285 0.3991 0.0173  0.0797  -0.0061 482  ASN B CA  
2489 C  C   . ASN B 110 ? 0.4071 0.3391 0.4362 0.0239  0.0956  -0.0146 482  ASN B C   
2490 O  O   . ASN B 110 ? 0.4005 0.3424 0.4478 0.0324  0.1014  -0.0074 482  ASN B O   
2491 C  CB  . ASN B 110 ? 0.3805 0.3326 0.3712 0.0110  0.0757  -0.0095 482  ASN B CB  
2492 C  CG  . ASN B 110 ? 0.3712 0.3346 0.3596 0.0087  0.0627  0.0017  482  ASN B CG  
2493 O  OD1 . ASN B 110 ? 0.3811 0.3514 0.3832 0.0132  0.0572  0.0108  482  ASN B OD1 
2494 N  ND2 . ASN B 110 ? 0.3501 0.3157 0.3213 0.0028  0.0578  0.0009  482  ASN B ND2 
2495 N  N   . GLN B 111 ? 0.4283 0.3423 0.4557 0.0204  0.1025  -0.0316 483  GLN B N   
2496 C  CA  . GLN B 111 ? 0.4616 0.3609 0.5098 0.0274  0.1191  -0.0432 483  GLN B CA  
2497 C  C   . GLN B 111 ? 0.4625 0.3543 0.5458 0.0395  0.1240  -0.0245 483  GLN B C   
2498 O  O   . GLN B 111 ? 0.4823 0.3670 0.5894 0.0500  0.1378  -0.0273 483  GLN B O   
2499 C  CB  . GLN B 111 ? 0.4878 0.3677 0.5317 0.0192  0.1231  -0.0683 483  GLN B CB  
2500 C  CG  . GLN B 111 ? 0.5419 0.4313 0.5533 0.0136  0.1243  -0.0916 483  GLN B CG  
2501 C  CD  . GLN B 111 ? 0.6033 0.4825 0.6056 0.0029  0.1205  -0.1192 483  GLN B CD  
2502 O  OE1 . GLN B 111 ? 0.6456 0.5365 0.6163 -0.0012 0.1179  -0.1381 483  GLN B OE1 
2503 N  NE2 . GLN B 111 ? 0.6308 0.4906 0.6613 -0.0018 0.1201  -0.1209 483  GLN B NE2 
2504 N  N   . ILE B 112 ? 0.4450 0.3400 0.5301 0.0396  0.1133  -0.0047 484  ILE B N   
2505 C  CA  . ILE B 112 ? 0.4359 0.3294 0.5465 0.0525  0.1150  0.0192  484  ILE B CA  
2506 C  C   . ILE B 112 ? 0.4155 0.3399 0.5246 0.0602  0.1035  0.0365  484  ILE B C   
2507 O  O   . ILE B 112 ? 0.4223 0.3564 0.5555 0.0737  0.1074  0.0466  484  ILE B O   
2508 C  CB  . ILE B 112 ? 0.4382 0.3207 0.5479 0.0483  0.1114  0.0318  484  ILE B CB  
2509 C  CG1 . ILE B 112 ? 0.4636 0.3179 0.5822 0.0374  0.1212  0.0124  484  ILE B CG1 
2510 C  CG2 . ILE B 112 ? 0.4196 0.3033 0.5496 0.0636  0.1134  0.0619  484  ILE B CG2 
2511 C  CD1 . ILE B 112 ? 0.4616 0.3105 0.5793 0.0284  0.1179  0.0211  484  ILE B CD1 
2512 N  N   . TYR B 113 ? 0.3897 0.3308 0.4746 0.0519  0.0891  0.0378  485  TYR B N   
2513 C  CA  . TYR B 113 ? 0.3770 0.3472 0.4632 0.0573  0.0762  0.0505  485  TYR B CA  
2514 C  C   . TYR B 113 ? 0.3688 0.3577 0.4637 0.0563  0.0767  0.0431  485  TYR B C   
2515 O  O   . TYR B 113 ? 0.3560 0.3713 0.4649 0.0617  0.0674  0.0519  485  TYR B O   
2516 C  CB  . TYR B 113 ? 0.3655 0.3451 0.4273 0.0502  0.0618  0.0533  485  TYR B CB  
2517 C  CG  . TYR B 113 ? 0.3779 0.3537 0.4374 0.0568  0.0607  0.0702  485  TYR B CG  
2518 C  CD1 . TYR B 113 ? 0.4114 0.4097 0.4737 0.0693  0.0517  0.0888  485  TYR B CD1 
2519 C  CD2 . TYR B 113 ? 0.3910 0.3440 0.4461 0.0506  0.0688  0.0684  485  TYR B CD2 
2520 C  CE1 . TYR B 113 ? 0.4404 0.4375 0.4959 0.0769  0.0529  0.1086  485  TYR B CE1 
2521 C  CE2 . TYR B 113 ? 0.4335 0.3834 0.4890 0.0561  0.0716  0.0875  485  TYR B CE2 
2522 C  CZ  . TYR B 113 ? 0.4555 0.4269 0.5084 0.0699  0.0646  0.1090  485  TYR B CZ  
2523 O  OH  . TYR B 113 ? 0.5187 0.4889 0.5674 0.0768  0.0696  0.1316  485  TYR B OH  
2524 N  N   . GLU B 114 ? 0.3728 0.3509 0.4602 0.0492  0.0876  0.0271  486  GLU B N   
2525 C  CA  . GLU B 114 ? 0.3795 0.3744 0.4751 0.0475  0.0932  0.0221  486  GLU B CA  
2526 C  C   . GLU B 114 ? 0.3962 0.3814 0.5049 0.0541  0.1134  0.0119  486  GLU B C   
2527 O  O   . GLU B 114 ? 0.4044 0.3968 0.5087 0.0506  0.1240  0.0031  486  GLU B O   
2528 C  CB  . GLU B 114 ? 0.3681 0.3643 0.4367 0.0335  0.0887  0.0151  486  GLU B CB  
2529 C  CG  . GLU B 114 ? 0.3851 0.3945 0.4503 0.0283  0.0708  0.0225  486  GLU B CG  
2530 C  CD  . GLU B 114 ? 0.4213 0.4275 0.4655 0.0163  0.0675  0.0180  486  GLU B CD  
2531 O  OE1 . GLU B 114 ? 0.4629 0.4591 0.4901 0.0126  0.0776  0.0119  486  GLU B OE1 
2532 O  OE2 . GLU B 114 ? 0.3950 0.4089 0.4395 0.0115  0.0546  0.0204  486  GLU B OE2 
2533 N  N   . ALA B 115 ? 0.4105 0.3788 0.5366 0.0644  0.1204  0.0135  487  ALA B N   
2534 C  CA  . ALA B 115 ? 0.4280 0.3803 0.5674 0.0711  0.1409  -0.0015 487  ALA B CA  
2535 C  C   . ALA B 115 ? 0.4315 0.4056 0.5956 0.0799  0.1534  -0.0019 487  ALA B C   
2536 O  O   . ALA B 115 ? 0.4449 0.4150 0.6041 0.0801  0.1712  -0.0198 487  ALA B O   
2537 C  CB  . ALA B 115 ? 0.4427 0.3703 0.6062 0.0817  0.1465  0.0041  487  ALA B CB  
2538 N  N   . ARG B 116 ? 0.4176 0.4183 0.6091 0.0877  0.1442  0.0168  488  ARG B N   
2539 C  CA  . ARG B 116 ? 0.4305 0.4572 0.6584 0.0980  0.1555  0.0190  488  ARG B CA  
2540 C  C   . ARG B 116 ? 0.4158 0.4744 0.6439 0.0870  0.1497  0.0218  488  ARG B C   
2541 O  O   . ARG B 116 ? 0.4154 0.5043 0.6816 0.0936  0.1530  0.0282  488  ARG B O   
2542 C  CB  . ARG B 116 ? 0.4331 0.4723 0.7035 0.1173  0.1500  0.0381  488  ARG B CB  
2543 C  CG  . ARG B 116 ? 0.4597 0.4646 0.7427 0.1309  0.1614  0.0386  488  ARG B CG  
2544 C  CD  . ARG B 116 ? 0.4850 0.5053 0.8186 0.1548  0.1634  0.0579  488  ARG B CD  
2545 N  NE  . ARG B 116 ? 0.5020 0.5455 0.8701 0.1635  0.1800  0.0493  488  ARG B NE  
2546 C  CZ  . ARG B 116 ? 0.4891 0.5781 0.8916 0.1709  0.1717  0.0620  488  ARG B CZ  
2547 N  NH1 . ARG B 116 ? 0.4588 0.5755 0.8625 0.1709  0.1448  0.0815  488  ARG B NH1 
2548 N  NH2 . ARG B 116 ? 0.4941 0.6037 0.9311 0.1783  0.1907  0.0533  488  ARG B NH2 
2549 N  N   . VAL B 117 ? 0.4092 0.4610 0.6000 0.0703  0.1415  0.0176  489  VAL B N   
2550 C  CA  . VAL B 117 ? 0.3972 0.4721 0.5900 0.0581  0.1375  0.0211  489  VAL B CA  
2551 C  C   . VAL B 117 ? 0.4191 0.5074 0.6255 0.0584  0.1622  0.0157  489  VAL B C   
2552 O  O   . VAL B 117 ? 0.4136 0.5326 0.6572 0.0576  0.1653  0.0226  489  VAL B O   
2553 C  CB  . VAL B 117 ? 0.3834 0.4427 0.5344 0.0426  0.1261  0.0189  489  VAL B CB  
2554 C  CG1 . VAL B 117 ? 0.3757 0.4497 0.5285 0.0300  0.1298  0.0220  489  VAL B CG1 
2555 C  CG2 . VAL B 117 ? 0.3603 0.4187 0.5073 0.0419  0.1026  0.0257  489  VAL B CG2 
2556 N  N   . GLU B 118 ? 0.4431 0.5113 0.6207 0.0597  0.1801  0.0022  490  GLU B N   
2557 C  CA  . GLU B 118 ? 0.4712 0.5519 0.6514 0.0611  0.2065  -0.0041 490  GLU B CA  
2558 C  C   . GLU B 118 ? 0.4697 0.5722 0.7033 0.0764  0.2210  -0.0028 490  GLU B C   
2559 O  O   . GLU B 118 ? 0.4711 0.6036 0.7344 0.0751  0.2337  0.0035  490  GLU B O   
2560 C  CB  . GLU B 118 ? 0.5051 0.5621 0.6384 0.0611  0.2202  -0.0229 490  GLU B CB  
2561 C  CG  . GLU B 118 ? 0.5729 0.6451 0.6964 0.0627  0.2489  -0.0295 490  GLU B CG  
2562 C  CD  . GLU B 118 ? 0.6519 0.7122 0.7133 0.0551  0.2529  -0.0392 490  GLU B CD  
2563 O  OE1 . GLU B 118 ? 0.6610 0.7040 0.6925 0.0467  0.2314  -0.0384 490  GLU B OE1 
2564 O  OE2 . GLU B 118 ? 0.6987 0.7705 0.7414 0.0587  0.2778  -0.0471 490  GLU B OE2 
2565 N  N   . ALA B 119 ? 0.4703 0.5587 0.7212 0.0912  0.2192  -0.0068 491  ALA B N   
2566 C  CA  . ALA B 119 ? 0.4725 0.5797 0.7784 0.1099  0.2317  -0.0039 491  ALA B CA  
2567 C  C   . ALA B 119 ? 0.4463 0.5935 0.7995 0.1110  0.2159  0.0153  491  ALA B C   
2568 O  O   . ALA B 119 ? 0.4492 0.6273 0.8512 0.1212  0.2290  0.0184  491  ALA B O   
2569 C  CB  . ALA B 119 ? 0.4812 0.5593 0.7977 0.1262  0.2317  -0.0081 491  ALA B CB  
2570 N  N   . MET B 120 ? 0.4218 0.5711 0.7629 0.1010  0.1877  0.0259  492  MET B N   
2571 C  CA  . MET B 120 ? 0.4070 0.5969 0.7885 0.0990  0.1688  0.0389  492  MET B CA  
2572 C  C   . MET B 120 ? 0.4009 0.6148 0.7922 0.0804  0.1741  0.0382  492  MET B C   
2573 O  O   . MET B 120 ? 0.3804 0.6324 0.8156 0.0766  0.1619  0.0446  492  MET B O   
2574 C  CB  . MET B 120 ? 0.3942 0.5794 0.7586 0.0973  0.1372  0.0478  492  MET B CB  
2575 C  CG  . MET B 120 ? 0.4209 0.5971 0.7962 0.1185  0.1307  0.0579  492  MET B CG  
2576 S  SD  . MET B 120 ? 0.4544 0.6250 0.8000 0.1176  0.0986  0.0705  492  MET B SD  
2577 C  CE  . MET B 120 ? 0.4055 0.6363 0.7902 0.1165  0.0728  0.0775  492  MET B CE  
2578 N  N   . ALA B 121 ? 0.4154 0.6083 0.7678 0.0688  0.1921  0.0310  493  ALA B N   
2579 C  CA  . ALA B 121 ? 0.4190 0.6274 0.7765 0.0511  0.2021  0.0347  493  ALA B CA  
2580 C  C   . ALA B 121 ? 0.4017 0.6197 0.7685 0.0347  0.1756  0.0406  493  ALA B C   
2581 O  O   . ALA B 121 ? 0.4026 0.6473 0.8080 0.0225  0.1780  0.0451  493  ALA B O   
2582 C  CB  . ALA B 121 ? 0.4219 0.6669 0.8326 0.0559  0.2277  0.0371  493  ALA B CB  
2583 N  N   . VAL B 122 ? 0.3982 0.5936 0.7309 0.0339  0.1518  0.0388  494  VAL B N   
2584 C  CA  . VAL B 122 ? 0.3880 0.5901 0.7251 0.0212  0.1259  0.0397  494  VAL B CA  
2585 C  C   . VAL B 122 ? 0.3936 0.5638 0.6850 0.0065  0.1274  0.0389  494  VAL B C   
2586 O  O   . VAL B 122 ? 0.4019 0.5442 0.6492 0.0099  0.1392  0.0373  494  VAL B O   
2587 C  CB  . VAL B 122 ? 0.3786 0.5843 0.7126 0.0330  0.0993  0.0400  494  VAL B CB  
2588 C  CG1 . VAL B 122 ? 0.3760 0.5415 0.6546 0.0374  0.0965  0.0383  494  VAL B CG1 
2589 C  CG2 . VAL B 122 ? 0.3854 0.6156 0.7396 0.0232  0.0725  0.0372  494  VAL B CG2 
2590 N  N   . LYS B 123 ? 0.3917 0.5670 0.6966 -0.0092 0.1155  0.0391  495  LYS B N   
2591 C  CA  . LYS B 123 ? 0.4035 0.5501 0.6749 -0.0218 0.1201  0.0421  495  LYS B CA  
2592 C  C   . LYS B 123 ? 0.3884 0.5122 0.6251 -0.0233 0.0969  0.0363  495  LYS B C   
2593 O  O   . LYS B 123 ? 0.3840 0.5192 0.6394 -0.0279 0.0760  0.0295  495  LYS B O   
2594 C  CB  . LYS B 123 ? 0.4116 0.5704 0.7230 -0.0390 0.1293  0.0480  495  LYS B CB  
2595 C  CG  . LYS B 123 ? 0.4444 0.5720 0.7263 -0.0501 0.1358  0.0563  495  LYS B CG  
2596 C  CD  . LYS B 123 ? 0.4946 0.6307 0.8242 -0.0680 0.1482  0.0652  495  LYS B CD  
2597 C  CE  . LYS B 123 ? 0.5375 0.6822 0.8721 -0.0679 0.1832  0.0820  495  LYS B CE  
2598 N  NZ  . LYS B 123 ? 0.5657 0.7333 0.9678 -0.0841 0.1982  0.0901  495  LYS B NZ  
2599 N  N   . LYS B 124 ? 0.3885 0.4835 0.5758 -0.0192 0.1009  0.0373  496  LYS B N   
2600 C  CA  . LYS B 124 ? 0.3702 0.4442 0.5253 -0.0199 0.0828  0.0328  496  LYS B CA  
2601 C  C   . LYS B 124 ? 0.3711 0.4352 0.5323 -0.0334 0.0782  0.0345  496  LYS B C   
2602 O  O   . LYS B 124 ? 0.3892 0.4476 0.5548 -0.0405 0.0944  0.0443  496  LYS B O   
2603 C  CB  . LYS B 124 ? 0.3738 0.4242 0.4822 -0.0131 0.0892  0.0326  496  LYS B CB  
2604 C  CG  . LYS B 124 ? 0.3639 0.3969 0.4439 -0.0122 0.0721  0.0280  496  LYS B CG  
2605 C  CD  . LYS B 124 ? 0.3564 0.3703 0.3970 -0.0082 0.0778  0.0262  496  LYS B CD  
2606 C  CE  . LYS B 124 ? 0.3464 0.3474 0.3668 -0.0080 0.0621  0.0224  496  LYS B CE  
2607 N  NZ  . LYS B 124 ? 0.3256 0.3170 0.3262 -0.0022 0.0632  0.0165  496  LYS B NZ  
2608 N  N   . PRO B 125 ? 0.3559 0.4176 0.5183 -0.0363 0.0577  0.0253  497  PRO B N   
2609 C  CA  . PRO B 125 ? 0.3614 0.4089 0.5340 -0.0484 0.0548  0.0245  497  PRO B CA  
2610 C  C   . PRO B 125 ? 0.3702 0.3886 0.5068 -0.0474 0.0640  0.0353  497  PRO B C   
2611 O  O   . PRO B 125 ? 0.3688 0.3783 0.4676 -0.0379 0.0629  0.0358  497  PRO B O   
2612 C  CB  . PRO B 125 ? 0.3548 0.4060 0.5272 -0.0480 0.0315  0.0083  497  PRO B CB  
2613 C  CG  . PRO B 125 ? 0.3433 0.4052 0.4928 -0.0343 0.0237  0.0065  497  PRO B CG  
2614 C  CD  . PRO B 125 ? 0.3384 0.4106 0.4942 -0.0280 0.0386  0.0160  497  PRO B CD  
2615 N  N   . GLY B 126 ? 0.3801 0.3856 0.5320 -0.0568 0.0733  0.0451  498  GLY B N   
2616 C  CA  . GLY B 126 ? 0.3852 0.3648 0.5071 -0.0546 0.0790  0.0583  498  GLY B CA  
2617 C  C   . GLY B 126 ? 0.3817 0.3434 0.5069 -0.0563 0.0635  0.0493  498  GLY B C   
2618 O  O   . GLY B 126 ? 0.3649 0.3349 0.5121 -0.0602 0.0493  0.0308  498  GLY B O   
2619 N  N   . PRO B 127 ? 0.3982 0.3376 0.5005 -0.0519 0.0657  0.0613  499  PRO B N   
2620 C  CA  . PRO B 127 ? 0.4028 0.3243 0.5075 -0.0503 0.0528  0.0523  499  PRO B CA  
2621 C  C   . PRO B 127 ? 0.4186 0.3313 0.5709 -0.0624 0.0510  0.0425  499  PRO B C   
2622 O  O   . PRO B 127 ? 0.4121 0.3203 0.5719 -0.0622 0.0372  0.0223  499  PRO B O   
2623 C  CB  . PRO B 127 ? 0.4216 0.3242 0.5012 -0.0428 0.0595  0.0740  499  PRO B CB  
2624 C  CG  . PRO B 127 ? 0.4216 0.3396 0.4656 -0.0367 0.0673  0.0836  499  PRO B CG  
2625 C  CD  . PRO B 127 ? 0.4159 0.3499 0.4845 -0.0452 0.0787  0.0824  499  PRO B CD  
2626 N  N   . SER B 128 ? 0.4382 0.3507 0.6239 -0.0735 0.0657  0.0547  500  SER B N   
2627 C  CA  . SER B 128 ? 0.4687 0.3711 0.7089 -0.0883 0.0664  0.0455  500  SER B CA  
2628 C  C   . SER B 128 ? 0.4566 0.3872 0.7332 -0.0990 0.0555  0.0201  500  SER B C   
2629 O  O   . SER B 128 ? 0.4647 0.3907 0.7918 -0.1138 0.0549  0.0083  500  SER B O   
2630 C  CB  . SER B 128 ? 0.4925 0.3806 0.7594 -0.0970 0.0902  0.0740  500  SER B CB  
2631 O  OG  . SER B 128 ? 0.5465 0.4031 0.7962 -0.0890 0.0962  0.0946  500  SER B OG  
2632 N  N   . CYS B 129 ? 0.4373 0.3977 0.6929 -0.0918 0.0468  0.0119  501  CYS B N   
2633 C  CA  . CYS B 129 ? 0.4394 0.4324 0.7291 -0.0992 0.0341  -0.0094 501  CYS B CA  
2634 C  C   . CYS B 129 ? 0.4393 0.4335 0.7332 -0.1005 0.0116  -0.0398 501  CYS B C   
2635 O  O   . CYS B 129 ? 0.4422 0.4161 0.7040 -0.0918 0.0064  -0.0440 501  CYS B O   
2636 C  CB  . CYS B 129 ? 0.4191 0.4424 0.6884 -0.0887 0.0328  -0.0054 501  CYS B CB  
2637 S  SG  . CYS B 129 ? 0.4749 0.5010 0.7451 -0.0881 0.0619  0.0237  501  CYS B SG  
2638 N  N   . SER B 130 ? 0.4477 0.4684 0.7827 -0.1113 -0.0013 -0.0621 502  SER B N   
2639 C  CA  . SER B 130 ? 0.4603 0.4880 0.7990 -0.1132 -0.0234 -0.0958 502  SER B CA  
2640 C  C   . SER B 130 ? 0.4477 0.4937 0.7328 -0.0951 -0.0381 -0.1015 502  SER B C   
2641 O  O   . SER B 130 ? 0.4197 0.4805 0.6795 -0.0840 -0.0344 -0.0834 502  SER B O   
2642 C  CB  . SER B 130 ? 0.4688 0.5297 0.8643 -0.1291 -0.0363 -0.1194 502  SER B CB  
2643 O  OG  . SER B 130 ? 0.4555 0.5591 0.8509 -0.1229 -0.0422 -0.1126 502  SER B OG  
2644 N  N   . ARG B 131 ? 0.4727 0.5168 0.7429 -0.0922 -0.0529 -0.1272 503  ARG B N   
2645 C  CA  . ARG B 131 ? 0.4769 0.5411 0.6988 -0.0759 -0.0660 -0.1336 503  ARG B CA  
2646 C  C   . ARG B 131 ? 0.4593 0.5691 0.6816 -0.0707 -0.0783 -0.1314 503  ARG B C   
2647 O  O   . ARG B 131 ? 0.4433 0.5623 0.6296 -0.0559 -0.0769 -0.1141 503  ARG B O   
2648 C  CB  . ARG B 131 ? 0.5097 0.5736 0.7240 -0.0758 -0.0802 -0.1676 503  ARG B CB  
2649 C  CG  . ARG B 131 ? 0.5484 0.6191 0.7061 -0.0576 -0.0845 -0.1677 503  ARG B CG  
2650 C  CD  . ARG B 131 ? 0.6404 0.7319 0.7868 -0.0557 -0.1024 -0.2052 503  ARG B CD  
2651 N  NE  . ARG B 131 ? 0.6891 0.7842 0.7819 -0.0382 -0.1009 -0.2021 503  ARG B NE  
2652 C  CZ  . ARG B 131 ? 0.7029 0.8325 0.7589 -0.0251 -0.1091 -0.1940 503  ARG B CZ  
2653 N  NH1 . ARG B 131 ? 0.7018 0.8669 0.7682 -0.0255 -0.1218 -0.1889 503  ARG B NH1 
2654 N  NH2 . ARG B 131 ? 0.6920 0.8218 0.7041 -0.0107 -0.1034 -0.1890 503  ARG B NH2 
2655 N  N   . GLN B 132 ? 0.4682 0.6067 0.7358 -0.0827 -0.0900 -0.1481 504  GLN B N   
2656 C  CA  . GLN B 132 ? 0.4632 0.6505 0.7359 -0.0757 -0.1045 -0.1459 504  GLN B CA  
2657 C  C   . GLN B 132 ? 0.4329 0.6225 0.7087 -0.0686 -0.0880 -0.1128 504  GLN B C   
2658 O  O   . GLN B 132 ? 0.4222 0.6389 0.6812 -0.0538 -0.0947 -0.1015 504  GLN B O   
2659 C  CB  . GLN B 132 ? 0.4842 0.7099 0.8078 -0.0899 -0.1251 -0.1757 504  GLN B CB  
2660 C  CG  . GLN B 132 ? 0.5035 0.7337 0.8945 -0.1081 -0.1147 -0.1708 504  GLN B CG  
2661 C  CD  . GLN B 132 ? 0.5701 0.8453 1.0158 -0.1227 -0.1383 -0.2031 504  GLN B CD  
2662 O  OE1 . GLN B 132 ? 0.6146 0.8943 1.0613 -0.1298 -0.1567 -0.2387 504  GLN B OE1 
2663 N  NE2 . GLN B 132 ? 0.5696 0.8808 1.0641 -0.1275 -0.1381 -0.1934 504  GLN B NE2 
2664 N  N   . GLU B 133 ? 0.4216 0.5822 0.7169 -0.0777 -0.0655 -0.0970 505  GLU B N   
2665 C  CA  . GLU B 133 ? 0.4046 0.5644 0.6970 -0.0703 -0.0471 -0.0692 505  GLU B CA  
2666 C  C   . GLU B 133 ? 0.3797 0.5185 0.6149 -0.0533 -0.0398 -0.0527 505  GLU B C   
2667 O  O   . GLU B 133 ? 0.3661 0.5183 0.5907 -0.0408 -0.0366 -0.0389 505  GLU B O   
2668 C  CB  . GLU B 133 ? 0.4118 0.5510 0.7373 -0.0843 -0.0240 -0.0566 505  GLU B CB  
2669 C  CG  . GLU B 133 ? 0.4316 0.5720 0.7508 -0.0761 -0.0031 -0.0318 505  GLU B CG  
2670 C  CD  . GLU B 133 ? 0.4960 0.6239 0.8464 -0.0888 0.0216  -0.0175 505  GLU B CD  
2671 O  OE1 . GLU B 133 ? 0.5404 0.6717 0.9392 -0.1062 0.0215  -0.0262 505  GLU B OE1 
2672 O  OE2 . GLU B 133 ? 0.5062 0.6220 0.8333 -0.0815 0.0420  0.0020  505  GLU B OE2 
2673 N  N   . LYS B 134 ? 0.3766 0.4830 0.5808 -0.0531 -0.0370 -0.0552 506  LYS B N   
2674 C  CA  . LYS B 134 ? 0.3554 0.4457 0.5106 -0.0392 -0.0333 -0.0446 506  LYS B CA  
2675 C  C   . LYS B 134 ? 0.3576 0.4745 0.4916 -0.0263 -0.0492 -0.0491 506  LYS B C   
2676 O  O   . LYS B 134 ? 0.3477 0.4641 0.4576 -0.0139 -0.0442 -0.0339 506  LYS B O   
2677 C  CB  . LYS B 134 ? 0.3553 0.4126 0.4903 -0.0416 -0.0299 -0.0492 506  LYS B CB  
2678 C  CG  . LYS B 134 ? 0.3632 0.3927 0.5134 -0.0508 -0.0135 -0.0379 506  LYS B CG  
2679 C  CD  . LYS B 134 ? 0.3366 0.3348 0.4642 -0.0481 -0.0098 -0.0362 506  LYS B CD  
2680 C  CE  . LYS B 134 ? 0.3540 0.3279 0.4959 -0.0551 0.0058  -0.0201 506  LYS B CE  
2681 N  NZ  . LYS B 134 ? 0.3618 0.3075 0.4865 -0.0502 0.0081  -0.0157 506  LYS B NZ  
2682 N  N   . GLU B 135 ? 0.3642 0.5048 0.5084 -0.0294 -0.0678 -0.0700 507  GLU B N   
2683 C  CA  . GLU B 135 ? 0.3798 0.5516 0.5010 -0.0164 -0.0844 -0.0739 507  GLU B CA  
2684 C  C   . GLU B 135 ? 0.3655 0.5664 0.4998 -0.0060 -0.0867 -0.0563 507  GLU B C   
2685 O  O   . GLU B 135 ? 0.3652 0.5707 0.4717 0.0097  -0.0856 -0.0396 507  GLU B O   
2686 C  CB  . GLU B 135 ? 0.4001 0.5958 0.5324 -0.0233 -0.1052 -0.1046 507  GLU B CB  
2687 C  CG  . GLU B 135 ? 0.4670 0.6881 0.5596 -0.0097 -0.1207 -0.1128 507  GLU B CG  
2688 C  CD  . GLU B 135 ? 0.5612 0.8152 0.6688 -0.0170 -0.1443 -0.1477 507  GLU B CD  
2689 O  OE1 . GLU B 135 ? 0.5898 0.8238 0.7167 -0.0317 -0.1439 -0.1733 507  GLU B OE1 
2690 O  OE2 . GLU B 135 ? 0.6006 0.9012 0.7032 -0.0077 -0.1637 -0.1499 507  GLU B OE2 
2691 N  N   . ALA B 136 ? 0.3487 0.5683 0.5297 -0.0145 -0.0878 -0.0588 508  ALA B N   
2692 C  CA  . ALA B 136 ? 0.3335 0.5811 0.5364 -0.0040 -0.0877 -0.0423 508  ALA B CA  
2693 C  C   . ALA B 136 ? 0.3161 0.5350 0.5018 0.0058  -0.0650 -0.0179 508  ALA B C   
2694 O  O   . ALA B 136 ? 0.3187 0.5500 0.4985 0.0222  -0.0653 -0.0018 508  ALA B O   
2695 C  CB  . ALA B 136 ? 0.3223 0.5947 0.5856 -0.0172 -0.0892 -0.0505 508  ALA B CB  
2696 N  N   . TRP B 137 ? 0.3026 0.4837 0.4805 -0.0033 -0.0461 -0.0157 509  TRP B N   
2697 C  CA  . TRP B 137 ? 0.3020 0.4570 0.4614 0.0044  -0.0264 0.0012  509  TRP B CA  
2698 C  C   . TRP B 137 ? 0.3154 0.4580 0.4350 0.0169  -0.0282 0.0092  509  TRP B C   
2699 O  O   . TRP B 137 ? 0.3141 0.4544 0.4305 0.0293  -0.0206 0.0237  509  TRP B O   
2700 C  CB  . TRP B 137 ? 0.2942 0.4164 0.4472 -0.0072 -0.0092 0.0010  509  TRP B CB  
2701 C  CG  . TRP B 137 ? 0.2804 0.3810 0.4152 -0.0006 0.0091  0.0128  509  TRP B CG  
2702 C  CD1 . TRP B 137 ? 0.2788 0.3528 0.3777 0.0027  0.0139  0.0154  509  TRP B CD1 
2703 C  CD2 . TRP B 137 ? 0.2584 0.3640 0.4123 0.0035  0.0251  0.0202  509  TRP B CD2 
2704 N  NE1 . TRP B 137 ? 0.2632 0.3250 0.3571 0.0072  0.0302  0.0216  509  TRP B NE1 
2705 C  CE2 . TRP B 137 ? 0.2621 0.3415 0.3871 0.0086  0.0385  0.0243  509  TRP B CE2 
2706 C  CE3 . TRP B 137 ? 0.2435 0.3752 0.4389 0.0031  0.0303  0.0220  509  TRP B CE3 
2707 C  CZ2 . TRP B 137 ? 0.2413 0.3176 0.3736 0.0140  0.0570  0.0276  509  TRP B CZ2 
2708 C  CZ3 . TRP B 137 ? 0.2438 0.3734 0.4478 0.0097  0.0506  0.0283  509  TRP B CZ3 
2709 C  CH2 . TRP B 137 ? 0.2420 0.3428 0.4124 0.0153  0.0638  0.0298  509  TRP B CH2 
2710 N  N   . ILE B 138 ? 0.3285 0.4619 0.4218 0.0134  -0.0362 -0.0003 510  ILE B N   
2711 C  CA  . ILE B 138 ? 0.3419 0.4652 0.3994 0.0233  -0.0359 0.0071  510  ILE B CA  
2712 C  C   . ILE B 138 ? 0.3553 0.5075 0.4099 0.0390  -0.0458 0.0191  510  ILE B C   
2713 O  O   . ILE B 138 ? 0.3636 0.5058 0.4067 0.0499  -0.0368 0.0369  510  ILE B O   
2714 C  CB  . ILE B 138 ? 0.3435 0.4557 0.3779 0.0171  -0.0411 -0.0075 510  ILE B CB  
2715 C  CG1 . ILE B 138 ? 0.3316 0.4120 0.3678 0.0062  -0.0288 -0.0107 510  ILE B CG1 
2716 C  CG2 . ILE B 138 ? 0.3523 0.4634 0.3531 0.0279  -0.0405 0.0003  510  ILE B CG2 
2717 C  CD1 . ILE B 138 ? 0.3103 0.3786 0.3373 -0.0001 -0.0330 -0.0256 510  ILE B CD1 
2718 N  N   . HIS B 139 ? 0.3734 0.5620 0.4416 0.0402  -0.0645 0.0100  511  HIS B N   
2719 C  CA  . HIS B 139 ? 0.3928 0.6161 0.4590 0.0574  -0.0769 0.0239  511  HIS B CA  
2720 C  C   . HIS B 139 ? 0.3867 0.6092 0.4790 0.0684  -0.0658 0.0455  511  HIS B C   
2721 O  O   . HIS B 139 ? 0.4051 0.6276 0.4860 0.0848  -0.0622 0.0676  511  HIS B O   
2722 C  CB  . HIS B 139 ? 0.4062 0.6748 0.4863 0.0556  -0.1021 0.0062  511  HIS B CB  
2723 C  CG  . HIS B 139 ? 0.4606 0.7702 0.5282 0.0754  -0.1187 0.0207  511  HIS B CG  
2724 N  ND1 . HIS B 139 ? 0.4887 0.8265 0.5874 0.0882  -0.1241 0.0378  511  HIS B ND1 
2725 C  CD2 . HIS B 139 ? 0.4991 0.8285 0.5253 0.0866  -0.1305 0.0228  511  HIS B CD2 
2726 C  CE1 . HIS B 139 ? 0.5135 0.8868 0.5906 0.1071  -0.1403 0.0518  511  HIS B CE1 
2727 N  NE2 . HIS B 139 ? 0.5325 0.9017 0.5627 0.1062  -0.1439 0.0433  511  HIS B NE2 
2728 N  N   . ALA B 140 ? 0.3667 0.5865 0.4952 0.0598  -0.0578 0.0399  512  ALA B N   
2729 C  CA  . ALA B 140 ? 0.3592 0.5763 0.5143 0.0705  -0.0440 0.0562  512  ALA B CA  
2730 C  C   . ALA B 140 ? 0.3550 0.5308 0.4881 0.0760  -0.0239 0.0690  512  ALA B C   
2731 O  O   . ALA B 140 ? 0.3601 0.5336 0.5003 0.0922  -0.0177 0.0879  512  ALA B O   
2732 C  CB  . ALA B 140 ? 0.3471 0.5668 0.5407 0.0588  -0.0340 0.0461  512  ALA B CB  
2733 N  N   . LYS B 141 ? 0.3431 0.4871 0.4530 0.0624  -0.0147 0.0582  513  LYS B N   
2734 C  CA  . LYS B 141 ? 0.3424 0.4486 0.4362 0.0626  0.0033  0.0633  513  LYS B CA  
2735 C  C   . LYS B 141 ? 0.3630 0.4610 0.4360 0.0736  0.0037  0.0794  513  LYS B C   
2736 O  O   . LYS B 141 ? 0.3696 0.4493 0.4513 0.0824  0.0170  0.0923  513  LYS B O   
2737 C  CB  . LYS B 141 ? 0.3340 0.4177 0.4088 0.0461  0.0079  0.0480  513  LYS B CB  
2738 C  CG  . LYS B 141 ? 0.3339 0.3846 0.3985 0.0428  0.0250  0.0467  513  LYS B CG  
2739 C  CD  . LYS B 141 ? 0.3172 0.3545 0.3654 0.0287  0.0258  0.0340  513  LYS B CD  
2740 C  CE  . LYS B 141 ? 0.3224 0.3331 0.3525 0.0256  0.0357  0.0312  513  LYS B CE  
2741 N  NZ  . LYS B 141 ? 0.3290 0.3306 0.3453 0.0147  0.0363  0.0219  513  LYS B NZ  
2742 N  N   . TYR B 142 ? 0.3654 0.4758 0.4128 0.0730  -0.0087 0.0782  514  TYR B N   
2743 C  CA  . TYR B 142 ? 0.3912 0.4923 0.4161 0.0812  -0.0040 0.0943  514  TYR B CA  
2744 C  C   . TYR B 142 ? 0.4163 0.5477 0.4364 0.0995  -0.0145 0.1154  514  TYR B C   
2745 O  O   . TYR B 142 ? 0.4414 0.5622 0.4549 0.1102  -0.0047 0.1382  514  TYR B O   
2746 C  CB  . TYR B 142 ? 0.3836 0.4760 0.3792 0.0709  -0.0051 0.0823  514  TYR B CB  
2747 C  CG  . TYR B 142 ? 0.3536 0.4183 0.3507 0.0556  0.0038  0.0660  514  TYR B CG  
2748 C  CD1 . TYR B 142 ? 0.3395 0.4076 0.3354 0.0444  -0.0041 0.0465  514  TYR B CD1 
2749 C  CD2 . TYR B 142 ? 0.3526 0.3887 0.3536 0.0527  0.0194  0.0699  514  TYR B CD2 
2750 C  CE1 . TYR B 142 ? 0.2990 0.3443 0.2941 0.0330  0.0033  0.0361  514  TYR B CE1 
2751 C  CE2 . TYR B 142 ? 0.3332 0.3498 0.3320 0.0400  0.0247  0.0547  514  TYR B CE2 
2752 C  CZ  . TYR B 142 ? 0.3187 0.3411 0.3126 0.0316  0.0164  0.0402  514  TYR B CZ  
2753 O  OH  . TYR B 142 ? 0.3097 0.3158 0.2995 0.0219  0.0207  0.0300  514  TYR B OH  
2754 N  N   . VAL B 143 ? 0.4202 0.5903 0.4444 0.1027  -0.0345 0.1082  515  VAL B N   
2755 C  CA  . VAL B 143 ? 0.4504 0.6576 0.4650 0.1214  -0.0489 0.1271  515  VAL B CA  
2756 C  C   . VAL B 143 ? 0.4634 0.6845 0.5148 0.1368  -0.0495 0.1459  515  VAL B C   
2757 O  O   . VAL B 143 ? 0.4865 0.7059 0.5376 0.1549  -0.0434 0.1757  515  VAL B O   
2758 C  CB  . VAL B 143 ? 0.4584 0.7071 0.4551 0.1182  -0.0738 0.1066  515  VAL B CB  
2759 C  CG1 . VAL B 143 ? 0.4739 0.7663 0.4533 0.1398  -0.0904 0.1272  515  VAL B CG1 
2760 C  CG2 . VAL B 143 ? 0.4427 0.6753 0.4063 0.1054  -0.0707 0.0875  515  VAL B CG2 
2761 N  N   . GLU B 144 ? 0.4571 0.6913 0.5435 0.1302  -0.0547 0.1302  516  GLU B N   
2762 C  CA  . GLU B 144 ? 0.4704 0.7192 0.5991 0.1452  -0.0530 0.1457  516  GLU B CA  
2763 C  C   . GLU B 144 ? 0.4598 0.6629 0.6058 0.1479  -0.0256 0.1558  516  GLU B C   
2764 O  O   . GLU B 144 ? 0.4715 0.6768 0.6463 0.1662  -0.0193 0.1763  516  GLU B O   
2765 C  CB  . GLU B 144 ? 0.4593 0.7367 0.6254 0.1357  -0.0629 0.1249  516  GLU B CB  
2766 C  CG  . GLU B 144 ? 0.5108 0.8360 0.6720 0.1305  -0.0916 0.1083  516  GLU B CG  
2767 C  CD  . GLU B 144 ? 0.5462 0.8890 0.7491 0.1133  -0.0959 0.0837  516  GLU B CD  
2768 O  OE1 . GLU B 144 ? 0.5435 0.8810 0.7358 0.0932  -0.1010 0.0586  516  GLU B OE1 
2769 O  OE2 . GLU B 144 ? 0.5443 0.9046 0.7936 0.1204  -0.0917 0.0907  516  GLU B OE2 
2770 N  N   . LYS B 145 ? 0.4365 0.5999 0.5667 0.1303  -0.0102 0.1399  517  LYS B N   
2771 C  CA  . LYS B 145 ? 0.4368 0.5568 0.5802 0.1289  0.0145  0.1406  517  LYS B CA  
2772 C  C   . LYS B 145 ? 0.4251 0.5515 0.6101 0.1332  0.0226  0.1350  517  LYS B C   
2773 O  O   . LYS B 145 ? 0.4354 0.5420 0.6449 0.1450  0.0391  0.1445  517  LYS B O   
2774 C  CB  . LYS B 145 ? 0.4666 0.5638 0.6063 0.1432  0.0256  0.1672  517  LYS B CB  
2775 C  CG  . LYS B 145 ? 0.4911 0.5812 0.5903 0.1372  0.0229  0.1725  517  LYS B CG  
2776 C  CD  . LYS B 145 ? 0.5585 0.6210 0.6613 0.1485  0.0394  0.2002  517  LYS B CD  
2777 C  CE  . LYS B 145 ? 0.5770 0.6452 0.6431 0.1487  0.0369  0.2146  517  LYS B CE  
2778 N  NZ  . LYS B 145 ? 0.5455 0.5980 0.5910 0.1269  0.0398  0.1886  517  LYS B NZ  
2779 N  N   . LYS B 146 ? 0.4068 0.5599 0.6018 0.1225  0.0128  0.1178  518  LYS B N   
2780 C  CA  . LYS B 146 ? 0.3946 0.5691 0.6329 0.1262  0.0173  0.1132  518  LYS B CA  
2781 C  C   . LYS B 146 ? 0.3856 0.5267 0.6347 0.1217  0.0441  0.1022  518  LYS B C   
2782 O  O   . LYS B 146 ? 0.3888 0.5416 0.6759 0.1311  0.0548  0.1029  518  LYS B O   
2783 C  CB  . LYS B 146 ? 0.3776 0.5876 0.6241 0.1116  0.0006  0.0970  518  LYS B CB  
2784 C  CG  . LYS B 146 ? 0.3805 0.6175 0.6756 0.1102  0.0062  0.0902  518  LYS B CG  
2785 C  CD  . LYS B 146 ? 0.3848 0.6606 0.6950 0.0957  -0.0140 0.0762  518  LYS B CD  
2786 C  CE  . LYS B 146 ? 0.4001 0.7066 0.7664 0.0930  -0.0067 0.0712  518  LYS B CE  
2787 N  NZ  . LYS B 146 ? 0.3965 0.7555 0.7963 0.0862  -0.0320 0.0624  518  LYS B NZ  
2788 N  N   . PHE B 147 ? 0.3739 0.4773 0.5904 0.1086  0.0548  0.0909  519  PHE B N   
2789 C  CA  . PHE B 147 ? 0.3782 0.4547 0.5973 0.1031  0.0777  0.0760  519  PHE B CA  
2790 C  C   . PHE B 147 ? 0.4005 0.4373 0.6144 0.1091  0.0934  0.0766  519  PHE B C   
2791 O  O   . PHE B 147 ? 0.4111 0.4244 0.6200 0.1033  0.1106  0.0593  519  PHE B O   
2792 C  CB  . PHE B 147 ? 0.3639 0.4336 0.5548 0.0821  0.0783  0.0584  519  PHE B CB  
2793 C  CG  . PHE B 147 ? 0.3510 0.4524 0.5475 0.0729  0.0622  0.0570  519  PHE B CG  
2794 C  CD1 . PHE B 147 ? 0.3411 0.4389 0.5082 0.0604  0.0481  0.0524  519  PHE B CD1 
2795 C  CD2 . PHE B 147 ? 0.3324 0.4681 0.5691 0.0765  0.0616  0.0586  519  PHE B CD2 
2796 C  CE1 . PHE B 147 ? 0.3456 0.4690 0.5223 0.0510  0.0338  0.0474  519  PHE B CE1 
2797 C  CE2 . PHE B 147 ? 0.3387 0.5033 0.5874 0.0653  0.0464  0.0541  519  PHE B CE2 
2798 C  CZ  . PHE B 147 ? 0.3190 0.4756 0.5376 0.0522  0.0326  0.0476  519  PHE B CZ  
2799 N  N   . LEU B 148 ? 0.4142 0.4441 0.6296 0.1205  0.0880  0.0961  520  LEU B N   
2800 C  CA  . LEU B 148 ? 0.4429 0.4329 0.6628 0.1256  0.1039  0.0988  520  LEU B CA  
2801 C  C   . LEU B 148 ? 0.4646 0.4425 0.7239 0.1398  0.1237  0.0951  520  LEU B C   
2802 O  O   . LEU B 148 ? 0.4650 0.4712 0.7545 0.1535  0.1221  0.1035  520  LEU B O   
2803 C  CB  . LEU B 148 ? 0.4503 0.4386 0.6672 0.1364  0.0960  0.1270  520  LEU B CB  
2804 C  CG  . LEU B 148 ? 0.4553 0.4252 0.6391 0.1239  0.0930  0.1287  520  LEU B CG  
2805 C  CD1 . LEU B 148 ? 0.3877 0.3702 0.5363 0.1047  0.0806  0.1101  520  LEU B CD1 
2806 C  CD2 . LEU B 148 ? 0.4701 0.4492 0.6520 0.1388  0.0864  0.1623  520  LEU B CD2 
2807 N  N   . THR B 149 ? 0.4887 0.4265 0.7506 0.1364  0.1423  0.0799  521  THR B N   
2808 C  CA  . THR B 149 ? 0.5225 0.4401 0.8257 0.1531  0.1629  0.0778  521  THR B CA  
2809 C  C   . THR B 149 ? 0.5450 0.4610 0.8778 0.1746  0.1600  0.1137  521  THR B C   
2810 O  O   . THR B 149 ? 0.5425 0.4631 0.8561 0.1731  0.1462  0.1354  521  THR B O   
2811 C  CB  . THR B 149 ? 0.5460 0.4174 0.8463 0.1434  0.1816  0.0512  521  THR B CB  
2812 O  OG1 . THR B 149 ? 0.5539 0.4004 0.8438 0.1358  0.1773  0.0622  521  THR B OG1 
2813 C  CG2 . THR B 149 ? 0.5217 0.3972 0.7872 0.1244  0.1835  0.0176  521  THR B CG2 
2814 N  N   . LYS B 150 ? 0.5721 0.4834 0.9508 0.1962  0.1736  0.1216  522  LYS B N   
2815 C  CA  . LYS B 150 ? 0.6083 0.5161 1.0177 0.2201  0.1724  0.1599  522  LYS B CA  
2816 C  C   . LYS B 150 ? 0.6385 0.4986 1.0435 0.2154  0.1819  0.1709  522  LYS B C   
2817 O  O   . LYS B 150 ? 0.6511 0.5156 1.0516 0.2247  0.1731  0.2068  522  LYS B O   
2818 C  CB  . LYS B 150 ? 0.6313 0.5387 1.0974 0.2456  0.1884  0.1642  522  LYS B CB  
2819 C  CG  . LYS B 150 ? 0.6615 0.5777 1.1633 0.2757  0.1836  0.2097  522  LYS B CG  
2820 C  CD  . LYS B 150 ? 0.6913 0.5968 1.2561 0.3021  0.2043  0.2112  522  LYS B CD  
2821 C  CE  . LYS B 150 ? 0.7344 0.6218 1.3361 0.3309  0.2080  0.2568  522  LYS B CE  
2822 N  NZ  . LYS B 150 ? 0.7582 0.6467 1.4260 0.3620  0.2233  0.2649  522  LYS B NZ  
2823 N  N   . LEU B 151 ? 0.6549 0.4725 1.0613 0.2005  0.2000  0.1391  523  LEU B N   
2824 C  CA  . LEU B 151 ? 0.6839 0.4531 1.0985 0.1928  0.2127  0.1425  523  LEU B CA  
2825 C  C   . LEU B 151 ? 0.6685 0.4284 1.0427 0.1623  0.2083  0.1108  523  LEU B C   
2826 O  O   . LEU B 151 ? 0.6478 0.4222 0.9985 0.1499  0.2050  0.0778  523  LEU B O   
2827 C  CB  . LEU B 151 ? 0.7275 0.4515 1.1941 0.2044  0.2393  0.1294  523  LEU B CB  
2828 C  CG  . LEU B 151 ? 0.7730 0.4800 1.2937 0.2350  0.2513  0.1680  523  LEU B CG  
2829 C  CD1 . LEU B 151 ? 0.7534 0.5122 1.2753 0.2590  0.2330  0.2076  523  LEU B CD1 
2830 C  CD2 . LEU B 151 ? 0.7972 0.4688 1.3675 0.2463  0.2772  0.1407  523  LEU B CD2 
2831 N  N   . PRO B 152 ? 0.6766 0.4154 1.0440 0.1510  0.2087  0.1231  524  PRO B N   
2832 C  CA  . PRO B 152 ? 0.6576 0.3926 0.9915 0.1232  0.2027  0.0951  524  PRO B CA  
2833 C  C   . PRO B 152 ? 0.6751 0.3764 1.0226 0.1084  0.2169  0.0505  524  PRO B C   
2834 O  O   . PRO B 152 ? 0.7153 0.3776 1.1067 0.1149  0.2363  0.0461  524  PRO B O   
2835 C  CB  . PRO B 152 ? 0.6661 0.3908 0.9996 0.1189  0.2025  0.1257  524  PRO B CB  
2836 C  CG  . PRO B 152 ? 0.7056 0.4095 1.0816 0.1423  0.2166  0.1633  524  PRO B CG  
2837 C  CD  . PRO B 152 ? 0.6981 0.4264 1.0834 0.1647  0.2120  0.1692  524  PRO B CD  
2838 N  N   . LEU B 197 ? 0.6243 0.6923 0.9989 0.0427  0.2597  0.0401  569  LEU B N   
2839 C  CA  . LEU B 197 ? 0.6098 0.6996 1.0603 0.0574  0.2554  0.0702  569  LEU B CA  
2840 C  C   . LEU B 197 ? 0.5846 0.6763 1.0292 0.0614  0.2226  0.0935  569  LEU B C   
2841 O  O   . LEU B 197 ? 0.5666 0.6858 1.0506 0.0659  0.2050  0.1257  569  LEU B O   
2842 C  CB  . LEU B 197 ? 0.6314 0.7149 1.1533 0.0706  0.2914  0.0607  569  LEU B CB  
2843 C  CG  . LEU B 197 ? 0.6642 0.7613 1.2329 0.0724  0.3258  0.0521  569  LEU B CG  
2844 C  CD1 . LEU B 197 ? 0.6947 0.7706 1.3117 0.0812  0.3683  0.0262  569  LEU B CD1 
2845 C  CD2 . LEU B 197 ? 0.6594 0.7965 1.2945 0.0805  0.3156  0.0903  569  LEU B CD2 
2846 N  N   . HIS B 198 ? 0.5794 0.6451 0.9752 0.0582  0.2145  0.0779  570  HIS B N   
2847 C  CA  . HIS B 198 ? 0.5585 0.6252 0.9411 0.0600  0.1853  0.0967  570  HIS B CA  
2848 C  C   . HIS B 198 ? 0.5466 0.5982 0.8494 0.0480  0.1649  0.0843  570  HIS B C   
2849 O  O   . HIS B 198 ? 0.5525 0.5798 0.8220 0.0461  0.1696  0.0636  570  HIS B O   
2850 C  CB  . HIS B 198 ? 0.5653 0.6186 0.9883 0.0717  0.1949  0.0980  570  HIS B CB  
2851 C  CG  . HIS B 198 ? 0.5792 0.6509 1.0905 0.0854  0.2087  0.1207  570  HIS B CG  
2852 N  ND1 . HIS B 198 ? 0.5693 0.6708 1.1212 0.0904  0.1867  0.1602  570  HIS B ND1 
2853 C  CD2 . HIS B 198 ? 0.6090 0.6758 1.1791 0.0945  0.2428  0.1105  570  HIS B CD2 
2854 C  CE1 . HIS B 198 ? 0.5847 0.7000 1.2203 0.1034  0.2048  0.1772  570  HIS B CE1 
2855 N  NE2 . HIS B 198 ? 0.6095 0.7024 1.2598 0.1072  0.2405  0.1463  570  HIS B NE2 
2856 N  N   . PRO B 199 ? 0.5278 0.5945 0.8033 0.0394  0.1430  0.0973  571  PRO B N   
2857 C  CA  . PRO B 199 ? 0.5174 0.5695 0.7245 0.0287  0.1264  0.0866  571  PRO B CA  
2858 C  C   . PRO B 199 ? 0.4992 0.5368 0.6817 0.0309  0.1119  0.0853  571  PRO B C   
2859 O  O   . PRO B 199 ? 0.5032 0.5201 0.6435 0.0271  0.1123  0.0673  571  PRO B O   
2860 C  CB  . PRO B 199 ? 0.5068 0.5798 0.7079 0.0202  0.1079  0.1042  571  PRO B CB  
2861 C  CG  . PRO B 199 ? 0.5096 0.6075 0.7672 0.0238  0.1206  0.1173  571  PRO B CG  
2862 C  CD  . PRO B 199 ? 0.5156 0.6141 0.8263 0.0380  0.1344  0.1221  571  PRO B CD  
2863 N  N   . GLY B 200 ? 0.4798 0.5313 0.6896 0.0358  0.0989  0.1062  572  GLY B N   
2864 C  CA  . GLY B 200 ? 0.4672 0.5084 0.6587 0.0376  0.0867  0.1069  572  GLY B CA  
2865 C  C   . GLY B 200 ? 0.4735 0.4908 0.6656 0.0433  0.1032  0.0877  572  GLY B C   
2866 O  O   . GLY B 200 ? 0.4804 0.4806 0.6318 0.0398  0.0976  0.0740  572  GLY B O   
2867 N  N   . ALA B 201 ? 0.4691 0.4856 0.7100 0.0511  0.1244  0.0861  573  ALA B N   
2868 C  CA  . ALA B 201 ? 0.4741 0.4670 0.7195 0.0541  0.1437  0.0645  573  ALA B CA  
2869 C  C   . ALA B 201 ? 0.4812 0.4570 0.6746 0.0436  0.1526  0.0353  573  ALA B C   
2870 O  O   . ALA B 201 ? 0.4895 0.4475 0.6570 0.0398  0.1547  0.0182  573  ALA B O   
2871 C  CB  . ALA B 201 ? 0.4839 0.4778 0.7981 0.0642  0.1690  0.0669  573  ALA B CB  
2872 N  N   . LEU B 202 ? 0.4756 0.4596 0.6546 0.0375  0.1567  0.0316  574  LEU B N   
2873 C  CA  . LEU B 202 ? 0.4818 0.4549 0.6099 0.0254  0.1624  0.0095  574  LEU B CA  
2874 C  C   . LEU B 202 ? 0.4725 0.4388 0.5487 0.0197  0.1384  0.0109  574  LEU B C   
2875 O  O   . LEU B 202 ? 0.4800 0.4337 0.5238 0.0129  0.1401  -0.0054 574  LEU B O   
2876 C  CB  . LEU B 202 ? 0.4858 0.4716 0.6114 0.0195  0.1702  0.0101  574  LEU B CB  
2877 C  CG  . LEU B 202 ? 0.4983 0.4772 0.5754 0.0051  0.1792  -0.0102 574  LEU B CG  
2878 C  CD1 . LEU B 202 ? 0.5128 0.4790 0.5904 0.0001  0.2052  -0.0374 574  LEU B CD1 
2879 C  CD2 . LEU B 202 ? 0.4934 0.4872 0.5715 -0.0007 0.1852  -0.0049 574  LEU B CD2 
2880 N  N   . LEU B 203 ? 0.4530 0.4288 0.5244 0.0217  0.1171  0.0301  575  LEU B N   
2881 C  CA  . LEU B 203 ? 0.4447 0.4135 0.4763 0.0183  0.0972  0.0317  575  LEU B CA  
2882 C  C   . LEU B 203 ? 0.4506 0.4075 0.4788 0.0214  0.0964  0.0240  575  LEU B C   
2883 O  O   . LEU B 203 ? 0.4476 0.3946 0.4425 0.0155  0.0938  0.0122  575  LEU B O   
2884 C  CB  . LEU B 203 ? 0.4300 0.4106 0.4653 0.0196  0.0787  0.0508  575  LEU B CB  
2885 C  CG  . LEU B 203 ? 0.4352 0.4083 0.4348 0.0165  0.0610  0.0517  575  LEU B CG  
2886 C  CD1 . LEU B 203 ? 0.4287 0.3912 0.3919 0.0093  0.0595  0.0431  575  LEU B CD1 
2887 C  CD2 . LEU B 203 ? 0.4424 0.4282 0.4469 0.0146  0.0469  0.0665  575  LEU B CD2 
2888 N  N   . PHE B 204 ? 0.4479 0.4082 0.5134 0.0297  0.0982  0.0330  576  PHE B N   
2889 C  CA  . PHE B 204 ? 0.4519 0.4015 0.5222 0.0326  0.0991  0.0276  576  PHE B CA  
2890 C  C   . PHE B 204 ? 0.4772 0.4119 0.5317 0.0257  0.1144  0.0030  576  PHE B C   
2891 O  O   . PHE B 204 ? 0.4810 0.4083 0.5075 0.0208  0.1072  -0.0053 576  PHE B O   
2892 C  CB  . PHE B 204 ? 0.4449 0.4008 0.5677 0.0419  0.1041  0.0426  576  PHE B CB  
2893 C  CG  . PHE B 204 ? 0.4381 0.3827 0.5717 0.0446  0.1058  0.0396  576  PHE B CG  
2894 C  CD1 . PHE B 204 ? 0.4455 0.3736 0.5964 0.0439  0.1265  0.0208  576  PHE B CD1 
2895 C  CD2 . PHE B 204 ? 0.4092 0.3601 0.5372 0.0463  0.0886  0.0546  576  PHE B CD2 
2896 C  CE1 . PHE B 204 ? 0.4532 0.3698 0.6164 0.0449  0.1284  0.0180  576  PHE B CE1 
2897 C  CE2 . PHE B 204 ? 0.4290 0.3707 0.5686 0.0479  0.0903  0.0535  576  PHE B CE2 
2898 C  CZ  . PHE B 204 ? 0.4356 0.3596 0.5939 0.0474  0.1096  0.0357  576  PHE B CZ  
2899 N  N   . ARG B 205 ? 0.5031 0.4357 0.5753 0.0238  0.1360  -0.0091 577  ARG B N   
2900 C  CA  . ARG B 205 ? 0.5448 0.4654 0.5983 0.0130  0.1532  -0.0359 577  ARG B CA  
2901 C  C   . ARG B 205 ? 0.5514 0.4737 0.5475 0.0000  0.1410  -0.0427 577  ARG B C   
2902 O  O   . ARG B 205 ? 0.5654 0.4814 0.5363 -0.0093 0.1397  -0.0561 577  ARG B O   
2903 C  CB  . ARG B 205 ? 0.5671 0.4878 0.6477 0.0120  0.1806  -0.0482 577  ARG B CB  
2904 C  CG  . ARG B 205 ? 0.6412 0.5462 0.7263 0.0032  0.2069  -0.0781 577  ARG B CG  
2905 C  CD  . ARG B 205 ? 0.7294 0.6352 0.8450 0.0028  0.2377  -0.0915 577  ARG B CD  
2906 N  NE  . ARG B 205 ? 0.7482 0.6639 0.9238 0.0203  0.2400  -0.0679 577  ARG B NE  
2907 C  CZ  . ARG B 205 ? 0.7821 0.7105 0.9823 0.0232  0.2534  -0.0638 577  ARG B CZ  
2908 N  NH1 . ARG B 205 ? 0.8150 0.7463 0.9832 0.0098  0.2680  -0.0832 577  ARG B NH1 
2909 N  NH2 . ARG B 205 ? 0.7732 0.7146 1.0310 0.0385  0.2517  -0.0383 577  ARG B NH2 
2910 N  N   . ALA B 206 ? 0.5462 0.4783 0.5251 -0.0011 0.1312  -0.0312 578  ALA B N   
2911 C  CA  . ALA B 206 ? 0.5545 0.4897 0.4864 -0.0130 0.1212  -0.0331 578  ALA B CA  
2912 C  C   . ALA B 206 ? 0.5457 0.4789 0.4556 -0.0120 0.0989  -0.0244 578  ALA B C   
2913 O  O   . ALA B 206 ? 0.5491 0.4844 0.4251 -0.0222 0.0910  -0.0264 578  ALA B O   
2914 C  CB  . ALA B 206 ? 0.5496 0.4938 0.4769 -0.0138 0.1184  -0.0214 578  ALA B CB  
2915 N  N   . SER B 207 ? 0.5321 0.4637 0.4636 -0.0004 0.0894  -0.0132 579  SER B N   
2916 C  CA  . SER B 207 ? 0.5318 0.4620 0.4494 0.0022  0.0714  -0.0056 579  SER B CA  
2917 C  C   . SER B 207 ? 0.5531 0.4787 0.4665 -0.0021 0.0727  -0.0169 579  SER B C   
2918 O  O   . SER B 207 ? 0.5446 0.4716 0.4433 -0.0027 0.0590  -0.0124 579  SER B O   
2919 C  CB  . SER B 207 ? 0.5115 0.4443 0.4515 0.0132  0.0631  0.0089  579  SER B CB  
2920 O  OG  . SER B 207 ? 0.5133 0.4523 0.4588 0.0147  0.0613  0.0187  579  SER B OG  
2921 N  N   . GLY B 208 ? 0.5738 0.4938 0.5035 -0.0053 0.0903  -0.0317 580  GLY B N   
2922 C  CA  . GLY B 208 ? 0.5930 0.5070 0.5228 -0.0112 0.0937  -0.0446 580  GLY B CA  
2923 C  C   . GLY B 208 ? 0.6272 0.5450 0.5198 -0.0291 0.0944  -0.0592 580  GLY B C   
2924 O  O   . GLY B 208 ? 0.6361 0.5608 0.5056 -0.0361 0.0941  -0.0583 580  GLY B O   
2925 N  N   . HIS B 209 ? 0.6452 0.5610 0.5314 -0.0385 0.0943  -0.0710 581  HIS B N   
2926 C  CA  . HIS B 209 ? 0.6822 0.6069 0.5304 -0.0596 0.0917  -0.0834 581  HIS B CA  
2927 C  C   . HIS B 209 ? 0.7081 0.6302 0.5446 -0.0748 0.1147  -0.1067 581  HIS B C   
2928 O  O   . HIS B 209 ? 0.7220 0.6298 0.5856 -0.0732 0.1369  -0.1238 581  HIS B O   
2929 C  CB  . HIS B 209 ? 0.6948 0.6196 0.5424 -0.0679 0.0863  -0.0912 581  HIS B CB  
2930 C  CG  . HIS B 209 ? 0.7466 0.6866 0.5547 -0.0918 0.0791  -0.1002 581  HIS B CG  
2931 N  ND1 . HIS B 209 ? 0.7602 0.7194 0.5448 -0.0952 0.0561  -0.0805 581  HIS B ND1 
2932 C  CD2 . HIS B 209 ? 0.8019 0.7428 0.5906 -0.1154 0.0919  -0.1259 581  HIS B CD2 
2933 C  CE1 . HIS B 209 ? 0.7934 0.7682 0.5458 -0.1200 0.0523  -0.0901 581  HIS B CE1 
2934 N  NE2 . HIS B 209 ? 0.8239 0.7881 0.5747 -0.1341 0.0740  -0.1195 581  HIS B NE2 
2935 N  N   . PRO B 210 ? 0.7271 0.6632 0.5256 -0.0897 0.1110  -0.1066 582  PRO B N   
2936 C  CA  . PRO B 210 ? 0.7100 0.6611 0.4859 -0.0885 0.0868  -0.0816 582  PRO B CA  
2937 C  C   . PRO B 210 ? 0.6805 0.6287 0.4696 -0.0735 0.0874  -0.0663 582  PRO B C   
2938 O  O   . PRO B 210 ? 0.6969 0.6414 0.4933 -0.0748 0.1068  -0.0771 582  PRO B O   
2939 C  CB  . PRO B 210 ? 0.7446 0.7131 0.4756 -0.1154 0.0860  -0.0897 582  PRO B CB  
2940 C  CG  . PRO B 210 ? 0.7783 0.7391 0.5068 -0.1288 0.1157  -0.1208 582  PRO B CG  
2941 C  CD  . PRO B 210 ? 0.7622 0.7007 0.5372 -0.1119 0.1323  -0.1325 582  PRO B CD  
2942 N  N   . PRO B 211 ? 0.6438 0.5937 0.4388 -0.0600 0.0681  -0.0428 583  PRO B N   
2943 C  CA  . PRO B 211 ? 0.6178 0.5635 0.4283 -0.0477 0.0703  -0.0315 583  PRO B CA  
2944 C  C   . PRO B 211 ? 0.6229 0.5770 0.4095 -0.0584 0.0722  -0.0269 583  PRO B C   
2945 O  O   . PRO B 211 ? 0.6442 0.6091 0.4025 -0.0704 0.0607  -0.0189 583  PRO B O   
2946 C  CB  . PRO B 211 ? 0.5898 0.5331 0.4114 -0.0333 0.0514  -0.0121 583  PRO B CB  
2947 C  CG  . PRO B 211 ? 0.5989 0.5445 0.4187 -0.0349 0.0423  -0.0140 583  PRO B CG  
2948 C  CD  . PRO B 211 ? 0.6260 0.5803 0.4200 -0.0548 0.0469  -0.0275 583  PRO B CD  
2949 N  N   . SER B 212 ? 0.6051 0.5568 0.4059 -0.0548 0.0865  -0.0298 584  SER B N   
2950 C  CA  . SER B 212 ? 0.6071 0.5668 0.3900 -0.0635 0.0886  -0.0226 584  SER B CA  
2951 C  C   . SER B 212 ? 0.5666 0.5223 0.3656 -0.0505 0.0775  -0.0028 584  SER B C   
2952 O  O   . SER B 212 ? 0.5564 0.5087 0.3832 -0.0404 0.0849  -0.0028 584  SER B O   
2953 C  CB  . SER B 212 ? 0.6257 0.5880 0.4129 -0.0715 0.1149  -0.0411 584  SER B CB  
2954 O  OG  . SER B 212 ? 0.6596 0.6291 0.4402 -0.0755 0.1177  -0.0312 584  SER B OG  
2955 N  N   . LEU B 213 ? 0.5502 0.5069 0.3340 -0.0516 0.0597  0.0146  585  LEU B N   
2956 C  CA  . LEU B 213 ? 0.5205 0.4708 0.3179 -0.0420 0.0507  0.0303  585  LEU B CA  
2957 C  C   . LEU B 213 ? 0.5093 0.4629 0.3101 -0.0465 0.0606  0.0331  585  LEU B C   
2958 O  O   . LEU B 213 ? 0.4798 0.4291 0.3019 -0.0382 0.0597  0.0382  585  LEU B O   
2959 C  CB  . LEU B 213 ? 0.5308 0.4785 0.3176 -0.0417 0.0324  0.0477  585  LEU B CB  
2960 C  CG  . LEU B 213 ? 0.5377 0.4804 0.3352 -0.0314 0.0225  0.0476  585  LEU B CG  
2961 C  CD1 . LEU B 213 ? 0.5898 0.5357 0.3776 -0.0341 0.0076  0.0638  585  LEU B CD1 
2962 C  CD2 . LEU B 213 ? 0.5289 0.4606 0.3492 -0.0182 0.0211  0.0491  585  LEU B CD2 
2963 N  N   . PRO B 214 ? 0.5172 0.4810 0.2966 -0.0614 0.0702  0.0299  586  PRO B N   
2964 C  CA  . PRO B 214 ? 0.5232 0.4924 0.3096 -0.0657 0.0826  0.0310  586  PRO B CA  
2965 C  C   . PRO B 214 ? 0.5105 0.4806 0.3305 -0.0566 0.0986  0.0189  586  PRO B C   
2966 O  O   . PRO B 214 ? 0.5010 0.4736 0.3412 -0.0528 0.1003  0.0264  586  PRO B O   
2967 C  CB  . PRO B 214 ? 0.5532 0.5357 0.3077 -0.0852 0.0927  0.0262  586  PRO B CB  
2968 C  CG  . PRO B 214 ? 0.5665 0.5514 0.2942 -0.0922 0.0762  0.0344  586  PRO B CG  
2969 C  CD  . PRO B 214 ? 0.5480 0.5219 0.2939 -0.0772 0.0675  0.0292  586  PRO B CD  
2970 N  N   . THR B 215 ? 0.5121 0.4805 0.3416 -0.0534 0.1091  0.0022  587  THR B N   
2971 C  CA  . THR B 215 ? 0.4919 0.4610 0.3620 -0.0429 0.1240  -0.0055 587  THR B CA  
2972 C  C   . THR B 215 ? 0.4626 0.4283 0.3597 -0.0284 0.1094  0.0084  587  THR B C   
2973 O  O   . THR B 215 ? 0.4508 0.4241 0.3789 -0.0228 0.1140  0.0150  587  THR B O   
2974 C  CB  . THR B 215 ? 0.5045 0.4696 0.3826 -0.0439 0.1416  -0.0272 587  THR B CB  
2975 O  OG1 . THR B 215 ? 0.5320 0.5025 0.3784 -0.0619 0.1558  -0.0426 587  THR B OG1 
2976 C  CG2 . THR B 215 ? 0.4821 0.4491 0.4092 -0.0333 0.1603  -0.0319 587  THR B CG2 
2977 N  N   . MET B 216 ? 0.4492 0.4065 0.3345 -0.0240 0.0920  0.0134  588  MET B N   
2978 C  CA  . MET B 216 ? 0.4269 0.3818 0.3289 -0.0139 0.0778  0.0252  588  MET B CA  
2979 C  C   . MET B 216 ? 0.4203 0.3788 0.3237 -0.0165 0.0707  0.0376  588  MET B C   
2980 O  O   . MET B 216 ? 0.4134 0.3784 0.3398 -0.0122 0.0674  0.0448  588  MET B O   
2981 C  CB  . MET B 216 ? 0.4265 0.3721 0.3115 -0.0110 0.0626  0.0271  588  MET B CB  
2982 C  CG  . MET B 216 ? 0.4546 0.3972 0.3429 -0.0080 0.0663  0.0165  588  MET B CG  
2983 S  SD  . MET B 216 ? 0.4689 0.4051 0.3369 -0.0070 0.0500  0.0190  588  MET B SD  
2984 C  CE  . MET B 216 ? 0.4103 0.3434 0.2920 0.0029  0.0378  0.0306  588  MET B CE  
2985 N  N   . ALA B 217 ? 0.4389 0.3941 0.3178 -0.0252 0.0674  0.0417  589  ALA B N   
2986 C  CA  . ALA B 217 ? 0.4441 0.3999 0.3237 -0.0301 0.0622  0.0526  589  ALA B CA  
2987 C  C   . ALA B 217 ? 0.4444 0.4153 0.3484 -0.0323 0.0748  0.0531  589  ALA B C   
2988 O  O   . ALA B 217 ? 0.4295 0.4064 0.3507 -0.0325 0.0694  0.0612  589  ALA B O   
2989 C  CB  . ALA B 217 ? 0.4537 0.4040 0.3062 -0.0397 0.0587  0.0590  589  ALA B CB  
2990 N  N   . ASP B 218 ? 0.4547 0.4330 0.3610 -0.0351 0.0922  0.0435  590  ASP B N   
2991 C  CA  . ASP B 218 ? 0.4606 0.4545 0.3958 -0.0359 0.1086  0.0427  590  ASP B CA  
2992 C  C   . ASP B 218 ? 0.4426 0.4450 0.4187 -0.0247 0.1071  0.0476  590  ASP B C   
2993 O  O   . ASP B 218 ? 0.4386 0.4554 0.4401 -0.0254 0.1059  0.0585  590  ASP B O   
2994 C  CB  . ASP B 218 ? 0.4836 0.4810 0.4129 -0.0412 0.1311  0.0267  590  ASP B CB  
2995 C  CG  . ASP B 218 ? 0.5107 0.5242 0.4623 -0.0460 0.1507  0.0259  590  ASP B CG  
2996 O  OD1 . ASP B 218 ? 0.5160 0.5400 0.4904 -0.0449 0.1454  0.0396  590  ASP B OD1 
2997 O  OD2 . ASP B 218 ? 0.5520 0.5692 0.4990 -0.0521 0.1729  0.0101  590  ASP B OD2 
2998 N  N   . ALA B 219 ? 0.4310 0.4267 0.4140 -0.0159 0.1053  0.0424  591  ALA B N   
2999 C  CA  . ALA B 219 ? 0.4170 0.4224 0.4395 -0.0059 0.1027  0.0511  591  ALA B CA  
3000 C  C   . ALA B 219 ? 0.4103 0.4226 0.4329 -0.0078 0.0822  0.0666  591  ALA B C   
3001 O  O   . ALA B 219 ? 0.4060 0.4376 0.4614 -0.0068 0.0798  0.0796  591  ALA B O   
3002 C  CB  . ALA B 219 ? 0.4089 0.4037 0.4353 0.0023  0.1039  0.0435  591  ALA B CB  
3003 N  N   . LEU B 220 ? 0.4135 0.4114 0.4011 -0.0116 0.0681  0.0650  592  LEU B N   
3004 C  CA  . LEU B 220 ? 0.4128 0.4131 0.3942 -0.0166 0.0514  0.0741  592  LEU B CA  
3005 C  C   . LEU B 220 ? 0.4144 0.4264 0.4031 -0.0268 0.0510  0.0818  592  LEU B C   
3006 O  O   . LEU B 220 ? 0.4031 0.4300 0.4058 -0.0318 0.0417  0.0913  592  LEU B O   
3007 C  CB  . LEU B 220 ? 0.4185 0.3975 0.3652 -0.0181 0.0417  0.0682  592  LEU B CB  
3008 C  CG  . LEU B 220 ? 0.4346 0.4063 0.3769 -0.0098 0.0373  0.0638  592  LEU B CG  
3009 C  CD1 . LEU B 220 ? 0.4571 0.4097 0.3717 -0.0090 0.0338  0.0572  592  LEU B CD1 
3010 C  CD2 . LEU B 220 ? 0.4152 0.3960 0.3655 -0.0107 0.0265  0.0701  592  LEU B CD2 
3011 N  N   . ALA B 221 ? 0.4217 0.4294 0.4001 -0.0318 0.0608  0.0782  593  ALA B N   
3012 C  CA  . ALA B 221 ? 0.4342 0.4531 0.4205 -0.0422 0.0619  0.0857  593  ALA B CA  
3013 C  C   . ALA B 221 ? 0.4294 0.4763 0.4593 -0.0402 0.0681  0.0948  593  ALA B C   
3014 O  O   . ALA B 221 ? 0.4317 0.4953 0.4767 -0.0487 0.0613  0.1054  593  ALA B O   
3015 C  CB  . ALA B 221 ? 0.4478 0.4592 0.4150 -0.0483 0.0729  0.0816  593  ALA B CB  
3016 N  N   . HIS B 222 ? 0.4239 0.4764 0.4773 -0.0293 0.0812  0.0912  594  HIS B N   
3017 C  CA  . HIS B 222 ? 0.4169 0.4957 0.5217 -0.0241 0.0892  0.1020  594  HIS B CA  
3018 C  C   . HIS B 222 ? 0.4047 0.4975 0.5339 -0.0190 0.0748  0.1159  594  HIS B C   
3019 O  O   . HIS B 222 ? 0.4001 0.5131 0.5774 -0.0111 0.0815  0.1273  594  HIS B O   
3020 C  CB  . HIS B 222 ? 0.4175 0.4941 0.5423 -0.0155 0.1142  0.0906  594  HIS B CB  
3021 C  CG  . HIS B 222 ? 0.4265 0.5003 0.5344 -0.0238 0.1305  0.0803  594  HIS B CG  
3022 N  ND1 . HIS B 222 ? 0.4409 0.5361 0.5809 -0.0272 0.1441  0.0863  594  HIS B ND1 
3023 C  CD2 . HIS B 222 ? 0.4213 0.4767 0.4831 -0.0312 0.1341  0.0673  594  HIS B CD2 
3024 C  CE1 . HIS B 222 ? 0.4362 0.5251 0.5481 -0.0367 0.1571  0.0755  594  HIS B CE1 
3025 N  NE2 . HIS B 222 ? 0.4482 0.5137 0.5119 -0.0397 0.1504  0.0650  594  HIS B NE2 
3026 N  N   . GLY B 223 ? 0.4065 0.4897 0.5047 -0.0240 0.0563  0.1161  595  GLY B N   
3027 C  CA  . GLY B 223 ? 0.4005 0.5012 0.5144 -0.0243 0.0406  0.1306  595  GLY B CA  
3028 C  C   . GLY B 223 ? 0.3970 0.4916 0.5200 -0.0120 0.0416  0.1307  595  GLY B C   
3029 O  O   . GLY B 223 ? 0.3932 0.5083 0.5396 -0.0113 0.0312  0.1476  595  GLY B O   
3030 N  N   . ALA B 224 ? 0.4030 0.4721 0.5082 -0.0040 0.0531  0.1136  596  ALA B N   
3031 C  CA  . ALA B 224 ? 0.4035 0.4624 0.5085 0.0049  0.0519  0.1110  596  ALA B CA  
3032 C  C   . ALA B 224 ? 0.4058 0.4671 0.4883 -0.0009 0.0324  0.1170  596  ALA B C   
3033 O  O   . ALA B 224 ? 0.4121 0.4633 0.4586 -0.0099 0.0241  0.1095  596  ALA B O   
3034 C  CB  . ALA B 224 ? 0.4025 0.4341 0.4800 0.0087  0.0630  0.0901  596  ALA B CB  
3035 N  N   . ASP B 225 ? 0.4126 0.4874 0.5181 0.0035  0.0267  0.1308  597  ASP B N   
3036 C  CA  . ASP B 225 ? 0.4208 0.4984 0.5025 -0.0027 0.0112  0.1344  597  ASP B CA  
3037 C  C   . ASP B 225 ? 0.4223 0.4710 0.4725 0.0027  0.0150  0.1157  597  ASP B C   
3038 O  O   . ASP B 225 ? 0.4199 0.4571 0.4831 0.0130  0.0257  0.1103  597  ASP B O   
3039 C  CB  . ASP B 225 ? 0.4251 0.5280 0.5419 -0.0003 0.0043  0.1579  597  ASP B CB  
3040 C  CG  . ASP B 225 ? 0.4529 0.5624 0.5423 -0.0094 -0.0105 0.1617  597  ASP B CG  
3041 O  OD1 . ASP B 225 ? 0.4716 0.5637 0.5175 -0.0161 -0.0133 0.1437  597  ASP B OD1 
3042 O  OD2 . ASP B 225 ? 0.4723 0.6054 0.5860 -0.0101 -0.0183 0.1838  597  ASP B OD2 
3043 N  N   . VAL B 226 ? 0.4240 0.4612 0.4358 -0.0050 0.0075  0.1054  598  VAL B N   
3044 C  CA  . VAL B 226 ? 0.4181 0.4300 0.4034 0.0001  0.0107  0.0893  598  VAL B CA  
3045 C  C   . VAL B 226 ? 0.4113 0.4249 0.4023 0.0058  0.0088  0.0927  598  VAL B C   
3046 O  O   . VAL B 226 ? 0.4046 0.4015 0.3850 0.0120  0.0131  0.0821  598  VAL B O   
3047 C  CB  . VAL B 226 ? 0.4204 0.4178 0.3717 -0.0079 0.0059  0.0783  598  VAL B CB  
3048 C  CG1 . VAL B 226 ? 0.4102 0.4181 0.3492 -0.0183 -0.0038 0.0806  598  VAL B CG1 
3049 C  CG2 . VAL B 226 ? 0.4197 0.3936 0.3525 -0.0012 0.0101  0.0656  598  VAL B CG2 
3050 N  N   . ASN B 227 ? 0.4108 0.4477 0.4205 0.0024  0.0017  0.1098  599  ASN B N   
3051 C  CA  . ASN B 227 ? 0.4097 0.4540 0.4299 0.0057  -0.0011 0.1190  599  ASN B CA  
3052 C  C   . ASN B 227 ? 0.4122 0.4702 0.4796 0.0134  0.0033  0.1374  599  ASN B C   
3053 O  O   . ASN B 227 ? 0.4188 0.4958 0.5046 0.0120  -0.0035 0.1567  599  ASN B O   
3054 C  CB  . ASN B 227 ? 0.4105 0.4743 0.4130 -0.0077 -0.0138 0.1274  599  ASN B CB  
3055 C  CG  . ASN B 227 ? 0.4185 0.4659 0.3804 -0.0146 -0.0145 0.1076  599  ASN B CG  
3056 O  OD1 . ASN B 227 ? 0.4174 0.4736 0.3607 -0.0285 -0.0206 0.1054  599  ASN B OD1 
3057 N  ND2 . ASN B 227 ? 0.4115 0.4348 0.3622 -0.0054 -0.0075 0.0926  599  ASN B ND2 
3058 N  N   . TRP B 228 ? 0.4159 0.4653 0.5048 0.0208  0.0158  0.1320  600  TRP B N   
3059 C  CA  . TRP B 228 ? 0.4213 0.4795 0.5622 0.0297  0.0252  0.1460  600  TRP B CA  
3060 C  C   . TRP B 228 ? 0.4290 0.4795 0.5858 0.0366  0.0285  0.1497  600  TRP B C   
3061 O  O   . TRP B 228 ? 0.4293 0.4589 0.5596 0.0377  0.0317  0.1318  600  TRP B O   
3062 C  CB  . TRP B 228 ? 0.4222 0.4647 0.5729 0.0353  0.0431  0.1296  600  TRP B CB  
3063 C  CG  . TRP B 228 ? 0.4315 0.4824 0.6411 0.0444  0.0573  0.1410  600  TRP B CG  
3064 C  CD1 . TRP B 228 ? 0.4317 0.5081 0.6807 0.0448  0.0563  0.1614  600  TRP B CD1 
3065 C  CD2 . TRP B 228 ? 0.4305 0.4637 0.6702 0.0540  0.0766  0.1316  600  TRP B CD2 
3066 N  NE1 . TRP B 228 ? 0.4245 0.5000 0.7306 0.0562  0.0749  0.1665  600  TRP B NE1 
3067 C  CE2 . TRP B 228 ? 0.4353 0.4825 0.7359 0.0616  0.0886  0.1468  600  TRP B CE2 
3068 C  CE3 . TRP B 228 ? 0.4235 0.4311 0.6469 0.0559  0.0854  0.1116  600  TRP B CE3 
3069 C  CZ2 . TRP B 228 ? 0.4225 0.4549 0.7690 0.0716  0.1118  0.1402  600  TRP B CZ2 
3070 C  CZ3 . TRP B 228 ? 0.4240 0.4178 0.6876 0.0633  0.1066  0.1041  600  TRP B CZ3 
3071 C  CH2 . TRP B 228 ? 0.4358 0.4402 0.7612 0.0715  0.1208  0.1174  600  TRP B CH2 
3072 N  N   . VAL B 229 ? 0.4360 0.5055 0.6390 0.0405  0.0268  0.1754  601  VAL B N   
3073 C  CA  . VAL B 229 ? 0.4448 0.5094 0.6680 0.0458  0.0288  0.1840  601  VAL B CA  
3074 C  C   . VAL B 229 ? 0.4623 0.5130 0.7382 0.0581  0.0493  0.1825  601  VAL B C   
3075 O  O   . VAL B 229 ? 0.4600 0.5254 0.7833 0.0632  0.0547  0.1990  601  VAL B O   
3076 C  CB  . VAL B 229 ? 0.4458 0.5432 0.6839 0.0394  0.0114  0.2178  601  VAL B CB  
3077 C  CG1 . VAL B 229 ? 0.4531 0.5487 0.7297 0.0464  0.0154  0.2347  601  VAL B CG1 
3078 C  CG2 . VAL B 229 ? 0.4353 0.5411 0.6164 0.0253  -0.0041 0.2120  601  VAL B CG2 
3079 N  N   . ASN B 230 ? 0.4810 0.5036 0.7507 0.0619  0.0622  0.1611  602  ASN B N   
3080 C  CA  . ASN B 230 ? 0.5073 0.5135 0.8270 0.0713  0.0846  0.1555  602  ASN B CA  
3081 C  C   . ASN B 230 ? 0.5204 0.5381 0.8967 0.0777  0.0829  0.1873  602  ASN B C   
3082 O  O   . ASN B 230 ? 0.5208 0.5241 0.9038 0.0788  0.0862  0.1858  602  ASN B O   
3083 C  CB  . ASN B 230 ? 0.5172 0.4916 0.8103 0.0695  0.0989  0.1211  602  ASN B CB  
3084 C  CG  . ASN B 230 ? 0.5402 0.4955 0.8730 0.0749  0.1267  0.1041  602  ASN B CG  
3085 O  OD1 . ASN B 230 ? 0.5542 0.5170 0.9456 0.0835  0.1375  0.1204  602  ASN B OD1 
3086 N  ND2 . ASN B 230 ? 0.5728 0.5046 0.8749 0.0688  0.1392  0.0711  602  ASN B ND2 
3087 N  N   . GLY B 231 ? 0.5310 0.5772 0.9493 0.0807  0.0765  0.2184  603  GLY B N   
3088 C  CA  . GLY B 231 ? 0.5518 0.6192 1.0237 0.0847  0.0686  0.2585  603  GLY B CA  
3089 C  C   . GLY B 231 ? 0.5783 0.6253 1.1198 0.0979  0.0921  0.2614  603  GLY B C   
3090 O  O   . GLY B 231 ? 0.5925 0.6120 1.1452 0.1034  0.1167  0.2314  603  GLY B O   
3091 N  N   . GLY B 232 ? 0.5953 0.6557 1.1845 0.1015  0.0855  0.2975  604  GLY B N   
3092 C  CA  . GLY B 232 ? 0.6185 0.6551 1.2775 0.1135  0.1081  0.3020  604  GLY B CA  
3093 C  C   . GLY B 232 ? 0.6275 0.6242 1.2510 0.1099  0.1211  0.2640  604  GLY B C   
3094 O  O   . GLY B 232 ? 0.6444 0.6246 1.3051 0.1135  0.1296  0.2719  604  GLY B O   
3095 N  N   . GLN B 233 ? 0.6162 0.5996 1.1698 0.1019  0.1213  0.2253  605  GLN B N   
3096 C  CA  . GLN B 233 ? 0.6212 0.5727 1.1317 0.0954  0.1304  0.1876  605  GLN B CA  
3097 C  C   . GLN B 233 ? 0.6047 0.5641 1.0706 0.0867  0.1091  0.1956  605  GLN B C   
3098 O  O   . GLN B 233 ? 0.6062 0.5761 1.1038 0.0881  0.1016  0.2261  605  GLN B O   
3099 C  CB  . GLN B 233 ? 0.6217 0.5618 1.0792 0.0897  0.1372  0.1491  605  GLN B CB  
3100 C  CG  . GLN B 233 ? 0.6532 0.5776 1.1488 0.0955  0.1656  0.1301  605  GLN B CG  
3101 C  CD  . GLN B 233 ? 0.7017 0.5904 1.2170 0.0943  0.1914  0.1017  605  GLN B CD  
3102 O  OE1 . GLN B 233 ? 0.7002 0.5748 1.1781 0.0855  0.1867  0.0856  605  GLN B OE1 
3103 N  NE2 . GLN B 233 ? 0.7280 0.6023 1.3047 0.1023  0.2204  0.0946  605  GLN B NE2 
3104 N  N   . ASP B 234 ? 0.5838 0.5395 0.9801 0.0778  0.1003  0.1699  606  ASP B N   
3105 C  CA  . ASP B 234 ? 0.5642 0.5267 0.9175 0.0697  0.0833  0.1727  606  ASP B CA  
3106 C  C   . ASP B 234 ? 0.5325 0.5228 0.8407 0.0635  0.0617  0.1835  606  ASP B C   
3107 O  O   . ASP B 234 ? 0.5230 0.5205 0.7935 0.0565  0.0494  0.1835  606  ASP B O   
3108 C  CB  . ASP B 234 ? 0.5753 0.5123 0.8908 0.0639  0.0909  0.1366  606  ASP B CB  
3109 C  CG  . ASP B 234 ? 0.6022 0.5329 0.8725 0.0602  0.0929  0.1075  606  ASP B CG  
3110 O  OD1 . ASP B 234 ? 0.5955 0.5339 0.8723 0.0635  0.0954  0.1098  606  ASP B OD1 
3111 O  OD2 . ASP B 234 ? 0.6336 0.5534 0.8637 0.0533  0.0915  0.0843  606  ASP B OD2 
3112 N  N   . ASN B 235 ? 0.5082 0.5135 0.8233 0.0653  0.0589  0.1916  607  ASN B N   
3113 C  CA  . ASN B 235 ? 0.4807 0.5087 0.7536 0.0575  0.0415  0.1962  607  ASN B CA  
3114 C  C   . ASN B 235 ? 0.4641 0.4782 0.6762 0.0519  0.0393  0.1651  607  ASN B C   
3115 O  O   . ASN B 235 ? 0.4632 0.4910 0.6368 0.0441  0.0257  0.1664  607  ASN B O   
3116 C  CB  . ASN B 235 ? 0.4805 0.5389 0.7522 0.0501  0.0233  0.2280  607  ASN B CB  
3117 C  CG  . ASN B 235 ? 0.4833 0.5672 0.8135 0.0535  0.0195  0.2665  607  ASN B CG  
3118 O  OD1 . ASN B 235 ? 0.5062 0.6172 0.8437 0.0467  0.0054  0.2973  607  ASN B OD1 
3119 N  ND2 . ASN B 235 ? 0.4708 0.5482 0.8443 0.0633  0.0323  0.2663  607  ASN B ND2 
3120 N  N   . ALA B 236 ? 0.4476 0.4354 0.6528 0.0547  0.0533  0.1377  608  ALA B N   
3121 C  CA  . ALA B 236 ? 0.4363 0.4130 0.5902 0.0497  0.0508  0.1123  608  ALA B CA  
3122 C  C   . ALA B 236 ? 0.4298 0.4138 0.5652 0.0476  0.0474  0.1089  608  ALA B C   
3123 O  O   . ALA B 236 ? 0.4335 0.4261 0.5984 0.0507  0.0521  0.1190  608  ALA B O   
3124 C  CB  . ALA B 236 ? 0.4455 0.3979 0.5965 0.0498  0.0649  0.0870  608  ALA B CB  
3125 N  N   . THR B 237 ? 0.4147 0.3955 0.5054 0.0425  0.0397  0.0960  609  THR B N   
3126 C  CA  . THR B 237 ? 0.4007 0.3859 0.4701 0.0389  0.0356  0.0922  609  THR B CA  
3127 C  C   . THR B 237 ? 0.4001 0.3673 0.4453 0.0377  0.0426  0.0699  609  THR B C   
3128 O  O   . THR B 237 ? 0.3941 0.3485 0.4335 0.0379  0.0477  0.0574  609  THR B O   
3129 C  CB  . THR B 237 ? 0.3974 0.3919 0.4360 0.0325  0.0219  0.0958  609  THR B CB  
3130 O  OG1 . THR B 237 ? 0.4076 0.3900 0.4225 0.0326  0.0209  0.0831  609  THR B OG1 
3131 C  CG2 . THR B 237 ? 0.3867 0.4046 0.4416 0.0291  0.0132  0.1188  609  THR B CG2 
3132 N  N   . PRO B 238 ? 0.3947 0.3632 0.4256 0.0346  0.0422  0.0663  610  PRO B N   
3133 C  CA  . PRO B 238 ? 0.3972 0.3525 0.4005 0.0312  0.0460  0.0493  610  PRO B CA  
3134 C  C   . PRO B 238 ? 0.3909 0.3388 0.3662 0.0296  0.0375  0.0429  610  PRO B C   
3135 O  O   . PRO B 238 ? 0.3849 0.3240 0.3477 0.0273  0.0410  0.0313  610  PRO B O   
3136 C  CB  . PRO B 238 ? 0.3927 0.3538 0.3857 0.0272  0.0427  0.0529  610  PRO B CB  
3137 C  CG  . PRO B 238 ? 0.3932 0.3704 0.4202 0.0293  0.0443  0.0680  610  PRO B CG  
3138 C  CD  . PRO B 238 ? 0.3921 0.3767 0.4343 0.0325  0.0380  0.0796  610  PRO B CD  
3139 N  N   . LEU B 239 ? 0.3799 0.3335 0.3470 0.0296  0.0274  0.0505  611  LEU B N   
3140 C  CA  . LEU B 239 ? 0.3882 0.3364 0.3353 0.0295  0.0212  0.0455  611  LEU B CA  
3141 C  C   . LEU B 239 ? 0.3894 0.3357 0.3449 0.0317  0.0231  0.0426  611  LEU B C   
3142 O  O   . LEU B 239 ? 0.4018 0.3426 0.3452 0.0309  0.0215  0.0352  611  LEU B O   
3143 C  CB  . LEU B 239 ? 0.3884 0.3428 0.3263 0.0275  0.0141  0.0509  611  LEU B CB  
3144 C  CG  . LEU B 239 ? 0.3915 0.3405 0.3141 0.0282  0.0107  0.0454  611  LEU B CG  
3145 C  CD1 . LEU B 239 ? 0.4323 0.3694 0.3426 0.0290  0.0101  0.0394  611  LEU B CD1 
3146 C  CD2 . LEU B 239 ? 0.4113 0.3661 0.3256 0.0232  0.0081  0.0471  611  LEU B CD2 
3147 N  N   . ILE B 240 ? 0.3899 0.3423 0.3685 0.0337  0.0259  0.0506  612  ILE B N   
3148 C  CA  . ILE B 240 ? 0.4003 0.3489 0.3917 0.0346  0.0297  0.0477  612  ILE B CA  
3149 C  C   . ILE B 240 ? 0.4127 0.3499 0.4039 0.0318  0.0386  0.0330  612  ILE B C   
3150 O  O   . ILE B 240 ? 0.4218 0.3545 0.4065 0.0285  0.0387  0.0243  612  ILE B O   
3151 C  CB  . ILE B 240 ? 0.4029 0.3593 0.4246 0.0370  0.0319  0.0623  612  ILE B CB  
3152 C  CG1 . ILE B 240 ? 0.3931 0.3631 0.4067 0.0354  0.0228  0.0738  612  ILE B CG1 
3153 C  CG2 . ILE B 240 ? 0.3990 0.3457 0.4421 0.0374  0.0405  0.0570  612  ILE B CG2 
3154 C  CD1 . ILE B 240 ? 0.4145 0.4004 0.4531 0.0349  0.0207  0.0953  612  ILE B CD1 
3155 N  N   . GLN B 241 ? 0.4249 0.3596 0.4214 0.0313  0.0462  0.0297  613  GLN B N   
3156 C  CA  . GLN B 241 ? 0.4511 0.3766 0.4437 0.0258  0.0574  0.0134  613  GLN B CA  
3157 C  C   . GLN B 241 ? 0.4606 0.3853 0.4175 0.0185  0.0503  0.0046  613  GLN B C   
3158 O  O   . GLN B 241 ? 0.4784 0.3994 0.4259 0.0104  0.0543  -0.0083 613  GLN B O   
3159 C  CB  . GLN B 241 ? 0.4618 0.3879 0.4701 0.0272  0.0684  0.0136  613  GLN B CB  
3160 C  CG  . GLN B 241 ? 0.5194 0.4365 0.5285 0.0207  0.0855  -0.0053 613  GLN B CG  
3161 C  CD  . GLN B 241 ? 0.5631 0.4702 0.6073 0.0221  0.1015  -0.0127 613  GLN B CD  
3162 O  OE1 . GLN B 241 ? 0.5575 0.4641 0.6240 0.0276  0.0976  -0.0022 613  GLN B OE1 
3163 N  NE2 . GLN B 241 ? 0.5883 0.4867 0.6384 0.0161  0.1213  -0.0317 613  GLN B NE2 
3164 N  N   . ALA B 242 ? 0.4530 0.3823 0.3924 0.0202  0.0396  0.0126  614  ALA B N   
3165 C  CA  . ALA B 242 ? 0.4594 0.3897 0.3720 0.0148  0.0317  0.0104  614  ALA B CA  
3166 C  C   . ALA B 242 ? 0.4545 0.3879 0.3642 0.0151  0.0229  0.0119  614  ALA B C   
3167 O  O   . ALA B 242 ? 0.4689 0.4063 0.3637 0.0083  0.0175  0.0094  614  ALA B O   
3168 C  CB  . ALA B 242 ? 0.4464 0.3772 0.3485 0.0172  0.0253  0.0193  614  ALA B CB  
3169 N  N   . THR B 243 ? 0.4349 0.3699 0.3599 0.0219  0.0211  0.0178  615  THR B N   
3170 C  CA  . THR B 243 ? 0.4327 0.3722 0.3617 0.0225  0.0158  0.0188  615  THR B CA  
3171 C  C   . THR B 243 ? 0.4527 0.3912 0.3862 0.0146  0.0204  0.0088  615  THR B C   
3172 O  O   . THR B 243 ? 0.4669 0.4115 0.3921 0.0088  0.0140  0.0066  615  THR B O   
3173 C  CB  . THR B 243 ? 0.4126 0.3556 0.3562 0.0289  0.0157  0.0268  615  THR B CB  
3174 O  OG1 . THR B 243 ? 0.4001 0.3438 0.3366 0.0324  0.0130  0.0324  615  THR B OG1 
3175 C  CG2 . THR B 243 ? 0.3954 0.3449 0.3435 0.0297  0.0113  0.0285  615  THR B CG2 
3176 N  N   . ALA B 244 ? 0.4597 0.3910 0.4090 0.0137  0.0318  0.0031  616  ALA B N   
3177 C  CA  . ALA B 244 ? 0.4798 0.4057 0.4353 0.0044  0.0399  -0.0105 616  ALA B CA  
3178 C  C   . ALA B 244 ? 0.5020 0.4309 0.4307 -0.0084 0.0385  -0.0222 616  ALA B C   
3179 O  O   . ALA B 244 ? 0.5243 0.4566 0.4462 -0.0199 0.0369  -0.0314 616  ALA B O   
3180 C  CB  . ALA B 244 ? 0.4803 0.3949 0.4620 0.0064  0.0559  -0.0153 616  ALA B CB  
3181 N  N   . ALA B 245 ? 0.5057 0.4357 0.4185 -0.0082 0.0382  -0.0204 617  ALA B N   
3182 C  CA  . ALA B 245 ? 0.5220 0.4582 0.4062 -0.0215 0.0360  -0.0272 617  ALA B CA  
3183 C  C   . ALA B 245 ? 0.5238 0.4739 0.3920 -0.0241 0.0180  -0.0152 617  ALA B C   
3184 O  O   . ALA B 245 ? 0.5399 0.5001 0.3847 -0.0374 0.0128  -0.0165 617  ALA B O   
3185 C  CB  . ALA B 245 ? 0.5259 0.4594 0.4024 -0.0200 0.0424  -0.0262 617  ALA B CB  
3186 N  N   . ASN B 246 ? 0.5064 0.4591 0.3888 -0.0122 0.0089  -0.0023 618  ASN B N   
3187 C  CA  . ASN B 246 ? 0.5115 0.4771 0.3886 -0.0118 -0.0062 0.0110  618  ASN B CA  
3188 C  C   . ASN B 246 ? 0.5219 0.4899 0.3825 -0.0133 -0.0114 0.0203  618  ASN B C   
3189 O  O   . ASN B 246 ? 0.5320 0.5137 0.3798 -0.0225 -0.0219 0.0283  618  ASN B O   
3190 C  CB  . ASN B 246 ? 0.5211 0.5010 0.3918 -0.0262 -0.0130 0.0071  618  ASN B CB  
3191 C  CG  . ASN B 246 ? 0.5264 0.5227 0.4059 -0.0225 -0.0285 0.0242  618  ASN B CG  
3192 O  OD1 . ASN B 246 ? 0.5268 0.5200 0.4226 -0.0072 -0.0305 0.0352  618  ASN B OD1 
3193 N  ND2 . ASN B 246 ? 0.5224 0.5375 0.3933 -0.0375 -0.0386 0.0260  618  ASN B ND2 
3194 N  N   . SER B 247 ? 0.5118 0.4684 0.3737 -0.0057 -0.0048 0.0211  619  SER B N   
3195 C  CA  . SER B 247 ? 0.5149 0.4719 0.3628 -0.0081 -0.0080 0.0295  619  SER B CA  
3196 C  C   . SER B 247 ? 0.4988 0.4482 0.3592 0.0050  -0.0114 0.0409  619  SER B C   
3197 O  O   . SER B 247 ? 0.4870 0.4266 0.3548 0.0118  -0.0045 0.0376  619  SER B O   
3198 C  CB  . SER B 247 ? 0.5205 0.4721 0.3572 -0.0148 0.0042  0.0191  619  SER B CB  
3199 O  OG  . SER B 247 ? 0.5283 0.4787 0.3559 -0.0150 0.0018  0.0293  619  SER B OG  
3200 N  N   . LEU B 248 ? 0.4975 0.4527 0.3619 0.0072  -0.0219 0.0546  620  LEU B N   
3201 C  CA  . LEU B 248 ? 0.5019 0.4479 0.3804 0.0183  -0.0234 0.0640  620  LEU B CA  
3202 C  C   . LEU B 248 ? 0.4953 0.4308 0.3649 0.0167  -0.0196 0.0662  620  LEU B C   
3203 O  O   . LEU B 248 ? 0.4763 0.3997 0.3542 0.0234  -0.0151 0.0646  620  LEU B O   
3204 C  CB  . LEU B 248 ? 0.5149 0.4704 0.4063 0.0208  -0.0343 0.0805  620  LEU B CB  
3205 C  CG  . LEU B 248 ? 0.5359 0.4880 0.4546 0.0340  -0.0334 0.0845  620  LEU B CG  
3206 C  CD1 . LEU B 248 ? 0.5769 0.5409 0.5140 0.0361  -0.0444 0.1054  620  LEU B CD1 
3207 C  CD2 . LEU B 248 ? 0.5734 0.5060 0.4984 0.0418  -0.0240 0.0793  620  LEU B CD2 
3208 N  N   . LEU B 249 ? 0.5057 0.4474 0.3569 0.0055  -0.0207 0.0685  621  LEU B N   
3209 C  CA  . LEU B 249 ? 0.5175 0.4520 0.3600 0.0019  -0.0167 0.0715  621  LEU B CA  
3210 C  C   . LEU B 249 ? 0.4981 0.4247 0.3427 0.0042  -0.0056 0.0585  621  LEU B C   
3211 O  O   . LEU B 249 ? 0.4874 0.4044 0.3373 0.0073  -0.0033 0.0608  621  LEU B O   
3212 C  CB  . LEU B 249 ? 0.5478 0.4946 0.3680 -0.0128 -0.0194 0.0772  621  LEU B CB  
3213 C  CG  . LEU B 249 ? 0.5892 0.5442 0.4097 -0.0161 -0.0328 0.1003  621  LEU B CG  
3214 C  CD1 . LEU B 249 ? 0.6144 0.5765 0.4536 -0.0088 -0.0427 0.1086  621  LEU B CD1 
3215 C  CD2 . LEU B 249 ? 0.6364 0.6097 0.4291 -0.0350 -0.0363 0.1061  621  LEU B CD2 
3216 N  N   . ALA B 250 ? 0.4921 0.4234 0.3356 0.0019  0.0012  0.0459  622  ALA B N   
3217 C  CA  . ALA B 250 ? 0.4799 0.4076 0.3327 0.0046  0.0113  0.0374  622  ALA B CA  
3218 C  C   . ALA B 250 ? 0.4679 0.3908 0.3360 0.0139  0.0096  0.0388  622  ALA B C   
3219 O  O   . ALA B 250 ? 0.4701 0.3907 0.3436 0.0148  0.0123  0.0399  622  ALA B O   
3220 C  CB  . ALA B 250 ? 0.4797 0.4118 0.3348 0.0006  0.0205  0.0249  622  ALA B CB  
3221 N  N   . CYS B 251 ? 0.4621 0.3860 0.3365 0.0189  0.0052  0.0389  623  CYS B N   
3222 C  CA  . CYS B 251 ? 0.4584 0.3795 0.3430 0.0253  0.0045  0.0393  623  CYS B CA  
3223 C  C   . CYS B 251 ? 0.4638 0.3760 0.3463 0.0258  0.0029  0.0433  623  CYS B C   
3224 O  O   . CYS B 251 ? 0.4593 0.3696 0.3439 0.0251  0.0053  0.0409  623  CYS B O   
3225 C  CB  . CYS B 251 ? 0.4503 0.3750 0.3423 0.0299  0.0014  0.0391  623  CYS B CB  
3226 S  SG  . CYS B 251 ? 0.5002 0.4327 0.3991 0.0284  0.0043  0.0334  623  CYS B SG  
3227 N  N   . GLU B 252 ? 0.4765 0.3839 0.3560 0.0256  -0.0013 0.0501  624  GLU B N   
3228 C  CA  . GLU B 252 ? 0.4876 0.3826 0.3706 0.0264  -0.0011 0.0540  624  GLU B CA  
3229 C  C   . GLU B 252 ? 0.4779 0.3696 0.3538 0.0196  0.0021  0.0529  624  GLU B C   
3230 O  O   . GLU B 252 ? 0.4697 0.3537 0.3480 0.0178  0.0049  0.0489  624  GLU B O   
3231 C  CB  . GLU B 252 ? 0.5143 0.4066 0.4016 0.0278  -0.0070 0.0668  624  GLU B CB  
3232 C  CG  . GLU B 252 ? 0.5666 0.4421 0.4650 0.0297  -0.0054 0.0727  624  GLU B CG  
3233 C  CD  . GLU B 252 ? 0.6163 0.4804 0.5282 0.0355  0.0020  0.0620  624  GLU B CD  
3234 O  OE1 . GLU B 252 ? 0.6470 0.5187 0.5579 0.0377  0.0046  0.0522  624  GLU B OE1 
3235 O  OE2 . GLU B 252 ? 0.6452 0.4923 0.5689 0.0366  0.0065  0.0629  624  GLU B OE2 
3236 N  N   . PHE B 253 ? 0.4702 0.3693 0.3374 0.0142  0.0028  0.0550  625  PHE B N   
3237 C  CA  . PHE B 253 ? 0.4687 0.3686 0.3326 0.0077  0.0070  0.0549  625  PHE B CA  
3238 C  C   . PHE B 253 ? 0.4528 0.3581 0.3246 0.0074  0.0101  0.0491  625  PHE B C   
3239 O  O   . PHE B 253 ? 0.4612 0.3639 0.3341 0.0024  0.0105  0.0497  625  PHE B O   
3240 C  CB  . PHE B 253 ? 0.4772 0.3863 0.3319 0.0017  0.0106  0.0557  625  PHE B CB  
3241 C  CG  . PHE B 253 ? 0.5010 0.4124 0.3547 -0.0051 0.0161  0.0573  625  PHE B CG  
3242 C  CD1 . PHE B 253 ? 0.5023 0.4051 0.3537 -0.0096 0.0137  0.0652  625  PHE B CD1 
3243 C  CD2 . PHE B 253 ? 0.5096 0.4317 0.3691 -0.0071 0.0250  0.0514  625  PHE B CD2 
3244 C  CE1 . PHE B 253 ? 0.5346 0.4415 0.3866 -0.0171 0.0189  0.0673  625  PHE B CE1 
3245 C  CE2 . PHE B 253 ? 0.5302 0.4575 0.3932 -0.0132 0.0311  0.0537  625  PHE B CE2 
3246 C  CZ  . PHE B 253 ? 0.5333 0.4539 0.3909 -0.0188 0.0274  0.0617  625  PHE B CZ  
3247 N  N   . LEU B 254 ? 0.4397 0.3538 0.3181 0.0114  0.0114  0.0453  626  LEU B N   
3248 C  CA  . LEU B 254 ? 0.4214 0.3452 0.3101 0.0108  0.0122  0.0449  626  LEU B CA  
3249 C  C   . LEU B 254 ? 0.4277 0.3484 0.3132 0.0087  0.0089  0.0427  626  LEU B C   
3250 O  O   . LEU B 254 ? 0.4266 0.3558 0.3141 0.0020  0.0076  0.0441  626  LEU B O   
3251 C  CB  . LEU B 254 ? 0.4144 0.3462 0.3135 0.0159  0.0143  0.0438  626  LEU B CB  
3252 C  CG  . LEU B 254 ? 0.4129 0.3481 0.3189 0.0161  0.0217  0.0417  626  LEU B CG  
3253 C  CD1 . LEU B 254 ? 0.3905 0.3273 0.3060 0.0204  0.0244  0.0380  626  LEU B CD1 
3254 C  CD2 . LEU B 254 ? 0.3853 0.3303 0.3069 0.0137  0.0267  0.0463  626  LEU B CD2 
3255 N  N   . LEU B 255 ? 0.4250 0.3355 0.3066 0.0130  0.0082  0.0391  627  LEU B N   
3256 C  CA  . LEU B 255 ? 0.4338 0.3383 0.3124 0.0104  0.0092  0.0328  627  LEU B CA  
3257 C  C   . LEU B 255 ? 0.4518 0.3442 0.3258 0.0026  0.0107  0.0302  627  LEU B C   
3258 O  O   . LEU B 255 ? 0.4542 0.3483 0.3230 -0.0065 0.0120  0.0236  627  LEU B O   
3259 C  CB  . LEU B 255 ? 0.4319 0.3288 0.3144 0.0185  0.0108  0.0298  627  LEU B CB  
3260 C  CG  . LEU B 255 ? 0.4202 0.3301 0.3069 0.0228  0.0102  0.0300  627  LEU B CG  
3261 C  CD1 . LEU B 255 ? 0.4027 0.3083 0.2971 0.0308  0.0110  0.0293  627  LEU B CD1 
3262 C  CD2 . LEU B 255 ? 0.4263 0.3480 0.3092 0.0162  0.0115  0.0269  627  LEU B CD2 
3263 N  N   . GLN B 256 ? 0.4513 0.3330 0.3264 0.0041  0.0104  0.0357  628  GLN B N   
3264 C  CA  . GLN B 256 ? 0.4779 0.3467 0.3517 -0.0039 0.0121  0.0352  628  GLN B CA  
3265 C  C   . GLN B 256 ? 0.4791 0.3610 0.3496 -0.0147 0.0107  0.0357  628  GLN B C   
3266 O  O   . GLN B 256 ? 0.5008 0.3763 0.3689 -0.0252 0.0120  0.0310  628  GLN B O   
3267 C  CB  . GLN B 256 ? 0.4925 0.3511 0.3688 -0.0014 0.0109  0.0458  628  GLN B CB  
3268 C  CG  . GLN B 256 ? 0.5130 0.3591 0.3986 0.0075  0.0107  0.0502  628  GLN B CG  
3269 C  CD  . GLN B 256 ? 0.5545 0.3818 0.4503 0.0077  0.0174  0.0407  628  GLN B CD  
3270 O  OE1 . GLN B 256 ? 0.5848 0.4036 0.4774 -0.0021 0.0219  0.0317  628  GLN B OE1 
3271 N  NE2 . GLN B 256 ? 0.5678 0.3893 0.4775 0.0178  0.0194  0.0416  628  GLN B NE2 
3272 N  N   . ASN B 257 ? 0.4650 0.3655 0.3389 -0.0125 0.0089  0.0412  629  ASN B N   
3273 C  CA  . ASN B 257 ? 0.4681 0.3862 0.3473 -0.0207 0.0074  0.0455  629  ASN B CA  
3274 C  C   . ASN B 257 ? 0.4691 0.4063 0.3516 -0.0248 0.0037  0.0459  629  ASN B C   
3275 O  O   . ASN B 257 ? 0.4658 0.4237 0.3605 -0.0283 0.0013  0.0547  629  ASN B O   
3276 C  CB  . ASN B 257 ? 0.4567 0.3838 0.3442 -0.0165 0.0105  0.0526  629  ASN B CB  
3277 C  CG  . ASN B 257 ? 0.4635 0.3802 0.3458 -0.0202 0.0132  0.0555  629  ASN B CG  
3278 O  OD1 . ASN B 257 ? 0.4863 0.4041 0.3703 -0.0296 0.0130  0.0577  629  ASN B OD1 
3279 N  ND2 . ASN B 257 ? 0.4456 0.3539 0.3209 -0.0149 0.0148  0.0569  629  ASN B ND2 
3280 N  N   . GLY B 258 ? 0.4692 0.4020 0.3434 -0.0245 0.0035  0.0385  630  GLY B N   
3281 C  CA  . GLY B 258 ? 0.4686 0.4211 0.3401 -0.0336 -0.0007 0.0395  630  GLY B CA  
3282 C  C   . GLY B 258 ? 0.4518 0.4204 0.3324 -0.0263 -0.0027 0.0475  630  GLY B C   
3283 O  O   . GLY B 258 ? 0.4531 0.4428 0.3334 -0.0349 -0.0078 0.0536  630  GLY B O   
3284 N  N   . ALA B 259 ? 0.4364 0.3967 0.3252 -0.0125 0.0006  0.0486  631  ALA B N   
3285 C  CA  . ALA B 259 ? 0.4245 0.3962 0.3238 -0.0061 0.0000  0.0549  631  ALA B CA  
3286 C  C   . ALA B 259 ? 0.4319 0.4086 0.3192 -0.0111 -0.0010 0.0505  631  ALA B C   
3287 O  O   . ALA B 259 ? 0.4477 0.4094 0.3213 -0.0118 0.0031  0.0378  631  ALA B O   
3288 C  CB  . ALA B 259 ? 0.4063 0.3662 0.3123 0.0061  0.0045  0.0526  631  ALA B CB  
3289 N  N   . ASN B 260 ? 0.4237 0.4227 0.3183 -0.0154 -0.0055 0.0622  632  ASN B N   
3290 C  CA  . ASN B 260 ? 0.4377 0.4465 0.3200 -0.0222 -0.0059 0.0603  632  ASN B CA  
3291 C  C   . ASN B 260 ? 0.4293 0.4275 0.3173 -0.0097 -0.0008 0.0568  632  ASN B C   
3292 O  O   . ASN B 260 ? 0.4170 0.4190 0.3240 -0.0015 -0.0015 0.0669  632  ASN B O   
3293 C  CB  . ASN B 260 ? 0.4338 0.4740 0.3246 -0.0318 -0.0143 0.0797  632  ASN B CB  
3294 C  CG  . ASN B 260 ? 0.4498 0.5048 0.3257 -0.0411 -0.0149 0.0804  632  ASN B CG  
3295 O  OD1 . ASN B 260 ? 0.4643 0.5059 0.3310 -0.0361 -0.0073 0.0677  632  ASN B OD1 
3296 N  ND2 . ASN B 260 ? 0.4662 0.5521 0.3403 -0.0561 -0.0240 0.0968  632  ASN B ND2 
3297 N  N   . VAL B 261 ? 0.4448 0.4299 0.3196 -0.0088 0.0052  0.0422  633  VAL B N   
3298 C  CA  . VAL B 261 ? 0.4441 0.4206 0.3264 0.0025  0.0095  0.0389  633  VAL B CA  
3299 C  C   . VAL B 261 ? 0.4433 0.4376 0.3315 0.0011  0.0087  0.0484  633  VAL B C   
3300 O  O   . VAL B 261 ? 0.4327 0.4236 0.3328 0.0098  0.0104  0.0499  633  VAL B O   
3301 C  CB  . VAL B 261 ? 0.4540 0.4136 0.3287 0.0051  0.0173  0.0232  633  VAL B CB  
3302 C  CG1 . VAL B 261 ? 0.4565 0.4241 0.3162 -0.0063 0.0236  0.0136  633  VAL B CG1 
3303 C  CG2 . VAL B 261 ? 0.4333 0.3856 0.3215 0.0179  0.0192  0.0232  633  VAL B CG2 
3304 N  N   . ASN B 262 ? 0.4584 0.4735 0.3384 -0.0116 0.0051  0.0561  634  ASN B N   
3305 C  CA  . ASN B 262 ? 0.4726 0.5080 0.3573 -0.0156 0.0035  0.0689  634  ASN B CA  
3306 C  C   . ASN B 262 ? 0.4721 0.5242 0.3799 -0.0152 -0.0045 0.0931  634  ASN B C   
3307 O  O   . ASN B 262 ? 0.4855 0.5560 0.4001 -0.0196 -0.0070 0.1082  634  ASN B O   
3308 C  CB  . ASN B 262 ? 0.4869 0.5391 0.3458 -0.0330 0.0056  0.0637  634  ASN B CB  
3309 C  CG  . ASN B 262 ? 0.5119 0.5479 0.3570 -0.0316 0.0182  0.0402  634  ASN B CG  
3310 O  OD1 . ASN B 262 ? 0.5470 0.5803 0.3715 -0.0432 0.0239  0.0245  634  ASN B OD1 
3311 N  ND2 . ASN B 262 ? 0.4817 0.5068 0.3414 -0.0180 0.0234  0.0374  634  ASN B ND2 
3312 N  N   . GLN B 263 ? 0.4625 0.5093 0.3856 -0.0100 -0.0074 0.0981  635  GLN B N   
3313 C  CA  . GLN B 263 ? 0.4566 0.5187 0.4101 -0.0080 -0.0124 0.1213  635  GLN B CA  
3314 C  C   . GLN B 263 ? 0.4372 0.4887 0.4165 0.0041  -0.0071 0.1254  635  GLN B C   
3315 O  O   . GLN B 263 ? 0.4275 0.4567 0.4096 0.0137  -0.0006 0.1108  635  GLN B O   
3316 C  CB  . GLN B 263 ? 0.4500 0.5109 0.4163 -0.0062 -0.0143 0.1243  635  GLN B CB  
3317 C  CG  . GLN B 263 ? 0.4801 0.5627 0.4827 -0.0059 -0.0194 0.1514  635  GLN B CG  
3318 C  CD  . GLN B 263 ? 0.5181 0.6025 0.5359 -0.0044 -0.0197 0.1541  635  GLN B CD  
3319 O  OE1 . GLN B 263 ? 0.5493 0.6349 0.5442 -0.0132 -0.0230 0.1449  635  GLN B OE1 
3320 N  NE2 . GLN B 263 ? 0.4963 0.5804 0.5553 0.0061  -0.0144 0.1659  635  GLN B NE2 
3321 N  N   . ALA B 264 ? 0.4324 0.5016 0.4304 0.0015  -0.0103 0.1464  636  ALA B N   
3322 C  CA  . ALA B 264 ? 0.4219 0.4814 0.4452 0.0101  -0.0046 0.1509  636  ALA B CA  
3323 C  C   . ALA B 264 ? 0.4130 0.4698 0.4805 0.0183  -0.0016 0.1658  636  ALA B C   
3324 O  O   . ALA B 264 ? 0.4118 0.4841 0.4958 0.0163  -0.0065 0.1821  636  ALA B O   
3325 C  CB  . ALA B 264 ? 0.4196 0.4981 0.4394 0.0020  -0.0078 0.1653  636  ALA B CB  
3326 N  N   . ASP B 265 ? 0.4093 0.4470 0.4984 0.0265  0.0075  0.1596  637  ASP B N   
3327 C  CA  . ASP B 265 ? 0.4070 0.4394 0.5442 0.0340  0.0145  0.1724  637  ASP B CA  
3328 C  C   . ASP B 265 ? 0.4153 0.4684 0.5828 0.0311  0.0091  0.2050  637  ASP B C   
3329 O  O   . ASP B 265 ? 0.4222 0.4978 0.5671 0.0210  -0.0013 0.2173  637  ASP B O   
3330 C  CB  . ASP B 265 ? 0.4083 0.4117 0.5550 0.0403  0.0277  0.1506  637  ASP B CB  
3331 C  CG  . ASP B 265 ? 0.4171 0.4152 0.5554 0.0375  0.0281  0.1459  637  ASP B CG  
3332 O  OD1 . ASP B 265 ? 0.3959 0.4114 0.5360 0.0328  0.0215  0.1649  637  ASP B OD1 
3333 O  OD2 . ASP B 265 ? 0.4227 0.4012 0.5525 0.0385  0.0351  0.1235  637  ASP B OD2 
3334 N  N   . SER B 266 ? 0.4143 0.4599 0.6334 0.0388  0.0173  0.2186  638  SER B N   
3335 C  CA  . SER B 266 ? 0.4211 0.4847 0.6800 0.0375  0.0129  0.2546  638  SER B CA  
3336 C  C   . SER B 266 ? 0.4271 0.4948 0.6713 0.0306  0.0097  0.2597  638  SER B C   
3337 O  O   . SER B 266 ? 0.4386 0.5324 0.6956 0.0237  0.0004  0.2923  638  SER B O   
3338 C  CB  . SER B 266 ? 0.4262 0.4710 0.7481 0.0491  0.0276  0.2617  638  SER B CB  
3339 O  OG  . SER B 266 ? 0.4366 0.4912 0.7894 0.0547  0.0285  0.2740  638  SER B OG  
3340 N  N   . ALA B 267 ? 0.4158 0.4603 0.6359 0.0316  0.0173  0.2301  639  ALA B N   
3341 C  CA  . ALA B 267 ? 0.4191 0.4663 0.6280 0.0256  0.0164  0.2320  639  ALA B CA  
3342 C  C   . ALA B 267 ? 0.4213 0.4873 0.5765 0.0156  0.0076  0.2242  639  ALA B C   
3343 O  O   . ALA B 267 ? 0.4251 0.4939 0.5647 0.0106  0.0087  0.2199  639  ALA B O   
3344 C  CB  . ALA B 267 ? 0.4144 0.4305 0.6305 0.0300  0.0288  0.2062  639  ALA B CB  
3345 N  N   . GLY B 268 ? 0.4192 0.4975 0.5485 0.0123  0.0009  0.2209  640  GLY B N   
3346 C  CA  . GLY B 268 ? 0.4181 0.5105 0.4987 0.0022  -0.0040 0.2093  640  GLY B CA  
3347 C  C   . GLY B 268 ? 0.4129 0.4833 0.4657 0.0068  0.0027  0.1753  640  GLY B C   
3348 O  O   . GLY B 268 ? 0.4221 0.4998 0.4428 0.0004  0.0029  0.1640  640  GLY B O   
3349 N  N   . ARG B 269 ? 0.4042 0.4493 0.4709 0.0169  0.0089  0.1597  641  ARG B N   
3350 C  CA  . ARG B 269 ? 0.4015 0.4286 0.4468 0.0207  0.0131  0.1324  641  ARG B CA  
3351 C  C   . ARG B 269 ? 0.4083 0.4284 0.4334 0.0227  0.0115  0.1186  641  ARG B C   
3352 O  O   . ARG B 269 ? 0.4129 0.4226 0.4517 0.0273  0.0138  0.1166  641  ARG B O   
3353 C  CB  . ARG B 269 ? 0.3974 0.4036 0.4653 0.0264  0.0202  0.1229  641  ARG B CB  
3354 C  CG  . ARG B 269 ? 0.3950 0.4032 0.4849 0.0239  0.0231  0.1332  641  ARG B CG  
3355 C  CD  . ARG B 269 ? 0.3692 0.3552 0.4835 0.0266  0.0314  0.1220  641  ARG B CD  
3356 N  NE  . ARG B 269 ? 0.3968 0.3712 0.5344 0.0313  0.0371  0.1233  641  ARG B NE  
3357 C  CZ  . ARG B 269 ? 0.3974 0.3509 0.5594 0.0326  0.0480  0.1119  641  ARG B CZ  
3358 N  NH1 . ARG B 269 ? 0.3751 0.3170 0.5390 0.0277  0.0526  0.0982  641  ARG B NH1 
3359 N  NH2 . ARG B 269 ? 0.3686 0.3135 0.5536 0.0374  0.0556  0.1128  641  ARG B NH2 
3360 N  N   . GLY B 270 ? 0.4118 0.4367 0.4066 0.0187  0.0096  0.1085  642  GLY B N   
3361 C  CA  . GLY B 270 ? 0.4066 0.4222 0.3826 0.0199  0.0088  0.0947  642  GLY B CA  
3362 C  C   . GLY B 270 ? 0.4085 0.4049 0.3805 0.0267  0.0122  0.0773  642  GLY B C   
3363 O  O   . GLY B 270 ? 0.4137 0.4053 0.3964 0.0294  0.0147  0.0745  642  GLY B O   
3364 N  N   . PRO B 271 ? 0.4030 0.3901 0.3601 0.0280  0.0115  0.0670  643  PRO B N   
3365 C  CA  . PRO B 271 ? 0.3892 0.3620 0.3408 0.0326  0.0125  0.0545  643  PRO B CA  
3366 C  C   . PRO B 271 ? 0.3839 0.3578 0.3341 0.0346  0.0133  0.0493  643  PRO B C   
3367 O  O   . PRO B 271 ? 0.3772 0.3465 0.3329 0.0367  0.0125  0.0452  643  PRO B O   
3368 C  CB  . PRO B 271 ? 0.3937 0.3606 0.3295 0.0316  0.0111  0.0495  643  PRO B CB  
3369 C  CG  . PRO B 271 ? 0.3995 0.3757 0.3389 0.0270  0.0095  0.0589  643  PRO B CG  
3370 C  CD  . PRO B 271 ? 0.4074 0.3993 0.3537 0.0233  0.0087  0.0695  643  PRO B CD  
3371 N  N   . LEU B 272 ? 0.3820 0.3640 0.3254 0.0326  0.0155  0.0490  644  LEU B N   
3372 C  CA  . LEU B 272 ? 0.3841 0.3701 0.3326 0.0351  0.0185  0.0453  644  LEU B CA  
3373 C  C   . LEU B 272 ? 0.3759 0.3690 0.3407 0.0342  0.0184  0.0517  644  LEU B C   
3374 O  O   . LEU B 272 ? 0.3670 0.3591 0.3410 0.0367  0.0173  0.0485  644  LEU B O   
3375 C  CB  . LEU B 272 ? 0.3874 0.3807 0.3257 0.0316  0.0250  0.0407  644  LEU B CB  
3376 C  CG  . LEU B 272 ? 0.3908 0.3886 0.3389 0.0356  0.0312  0.0357  644  LEU B CG  
3377 C  CD1 . LEU B 272 ? 0.3643 0.3522 0.3236 0.0443  0.0286  0.0322  644  LEU B CD1 
3378 C  CD2 . LEU B 272 ? 0.3915 0.3956 0.3289 0.0305  0.0420  0.0273  644  LEU B CD2 
3379 N  N   . HIS B 273 ? 0.3726 0.3739 0.3433 0.0296  0.0187  0.0624  645  HIS B N   
3380 C  CA  . HIS B 273 ? 0.3688 0.3728 0.3592 0.0284  0.0194  0.0693  645  HIS B CA  
3381 C  C   . HIS B 273 ? 0.3652 0.3552 0.3646 0.0305  0.0182  0.0620  645  HIS B C   
3382 O  O   . HIS B 273 ? 0.3771 0.3675 0.3853 0.0293  0.0182  0.0584  645  HIS B O   
3383 C  CB  . HIS B 273 ? 0.3664 0.3789 0.3689 0.0241  0.0192  0.0862  645  HIS B CB  
3384 C  CG  . HIS B 273 ? 0.3567 0.3887 0.3484 0.0173  0.0197  0.0957  645  HIS B CG  
3385 N  ND1 . HIS B 273 ? 0.3844 0.4252 0.3592 0.0121  0.0172  0.0993  645  HIS B ND1 
3386 C  CD2 . HIS B 273 ? 0.3713 0.4179 0.3652 0.0121  0.0229  0.1023  645  HIS B CD2 
3387 C  CE1 . HIS B 273 ? 0.3833 0.4439 0.3470 0.0027  0.0187  0.1065  645  HIS B CE1 
3388 N  NE2 . HIS B 273 ? 0.4093 0.4737 0.3846 0.0031  0.0228  0.1089  645  HIS B NE2 
3389 N  N   . HIS B 274 ? 0.3603 0.3402 0.3566 0.0317  0.0177  0.0592  646  HIS B N   
3390 C  CA  . HIS B 274 ? 0.3682 0.3361 0.3686 0.0306  0.0189  0.0495  646  HIS B CA  
3391 C  C   . HIS B 274 ? 0.3729 0.3409 0.3610 0.0298  0.0144  0.0401  646  HIS B C   
3392 O  O   . HIS B 274 ? 0.3816 0.3474 0.3738 0.0246  0.0140  0.0336  646  HIS B O   
3393 C  CB  . HIS B 274 ? 0.3716 0.3305 0.3702 0.0315  0.0214  0.0475  646  HIS B CB  
3394 C  CG  . HIS B 274 ? 0.3643 0.3232 0.3862 0.0323  0.0264  0.0581  646  HIS B CG  
3395 N  ND1 . HIS B 274 ? 0.3653 0.3136 0.4102 0.0310  0.0346  0.0547  646  HIS B ND1 
3396 C  CD2 . HIS B 274 ? 0.3579 0.3273 0.3867 0.0335  0.0244  0.0736  646  HIS B CD2 
3397 C  CE1 . HIS B 274 ? 0.3728 0.3241 0.4431 0.0338  0.0379  0.0698  646  HIS B CE1 
3398 N  NE2 . HIS B 274 ? 0.3626 0.3292 0.4227 0.0348  0.0303  0.0830  646  HIS B NE2 
3399 N  N   . ALA B 275 ? 0.3703 0.3410 0.3452 0.0337  0.0110  0.0401  647  ALA B N   
3400 C  CA  . ALA B 275 ? 0.3847 0.3580 0.3548 0.0340  0.0056  0.0366  647  ALA B CA  
3401 C  C   . ALA B 275 ? 0.3847 0.3697 0.3688 0.0327  0.0042  0.0385  647  ALA B C   
3402 O  O   . ALA B 275 ? 0.3931 0.3835 0.3799 0.0279  -0.0013 0.0366  647  ALA B O   
3403 C  CB  . ALA B 275 ? 0.3731 0.3445 0.3342 0.0397  0.0042  0.0378  647  ALA B CB  
3404 N  N   . THR B 276 ? 0.3795 0.3714 0.3718 0.0349  0.0089  0.0429  648  THR B N   
3405 C  CA  . THR B 276 ? 0.3796 0.3840 0.3875 0.0331  0.0096  0.0457  648  THR B CA  
3406 C  C   . THR B 276 ? 0.3831 0.3860 0.4015 0.0249  0.0089  0.0444  648  THR B C   
3407 O  O   . THR B 276 ? 0.3851 0.3963 0.4118 0.0203  0.0046  0.0428  648  THR B O   
3408 C  CB  . THR B 276 ? 0.3822 0.3953 0.3929 0.0349  0.0168  0.0505  648  THR B CB  
3409 O  OG1 . THR B 276 ? 0.3949 0.4063 0.3946 0.0400  0.0199  0.0471  648  THR B OG1 
3410 C  CG2 . THR B 276 ? 0.3677 0.3961 0.3958 0.0337  0.0189  0.0532  648  THR B CG2 
3411 N  N   . ILE B 277 ? 0.3832 0.3757 0.4042 0.0225  0.0133  0.0452  649  ILE B N   
3412 C  CA  . ILE B 277 ? 0.3875 0.3732 0.4224 0.0144  0.0159  0.0413  649  ILE B CA  
3413 C  C   . ILE B 277 ? 0.4030 0.3852 0.4292 0.0066  0.0117  0.0287  649  ILE B C   
3414 O  O   . ILE B 277 ? 0.4068 0.3912 0.4416 -0.0033 0.0111  0.0231  649  ILE B O   
3415 C  CB  . ILE B 277 ? 0.3970 0.3693 0.4420 0.0151  0.0231  0.0448  649  ILE B CB  
3416 C  CG1 . ILE B 277 ? 0.3798 0.3605 0.4369 0.0179  0.0255  0.0615  649  ILE B CG1 
3417 C  CG2 . ILE B 277 ? 0.3867 0.3450 0.4470 0.0067  0.0294  0.0350  649  ILE B CG2 
3418 C  CD1 . ILE B 277 ? 0.3969 0.3719 0.4626 0.0211  0.0288  0.0714  649  ILE B CD1 
3419 N  N   . LEU B 278 ? 0.4031 0.3816 0.4108 0.0088  0.0086  0.0246  650  LEU B N   
3420 C  CA  . LEU B 278 ? 0.4172 0.3952 0.4119 -0.0014 0.0046  0.0140  650  LEU B CA  
3421 C  C   . LEU B 278 ? 0.4158 0.4122 0.4060 -0.0031 -0.0073 0.0193  650  LEU B C   
3422 O  O   . LEU B 278 ? 0.4281 0.4311 0.4063 -0.0141 -0.0140 0.0144  650  LEU B O   
3423 C  CB  . LEU B 278 ? 0.4176 0.3839 0.3960 -0.0002 0.0081  0.0086  650  LEU B CB  
3424 C  CG  . LEU B 278 ? 0.4387 0.3887 0.4291 0.0007  0.0208  0.0038  650  LEU B CG  
3425 C  CD1 . LEU B 278 ? 0.4300 0.3723 0.4096 0.0050  0.0247  0.0024  650  LEU B CD1 
3426 C  CD2 . LEU B 278 ? 0.4156 0.3567 0.4148 -0.0125 0.0290  -0.0112 650  LEU B CD2 
3427 N  N   . GLY B 279 ? 0.4045 0.4110 0.4060 0.0070  -0.0093 0.0299  651  GLY B N   
3428 C  CA  . GLY B 279 ? 0.4122 0.4369 0.4195 0.0088  -0.0189 0.0382  651  GLY B CA  
3429 C  C   . GLY B 279 ? 0.4254 0.4501 0.4192 0.0118  -0.0256 0.0424  651  GLY B C   
3430 O  O   . GLY B 279 ? 0.4315 0.4724 0.4285 0.0077  -0.0365 0.0501  651  GLY B O   
3431 N  N   . HIS B 280 ? 0.4273 0.4358 0.4080 0.0180  -0.0200 0.0398  652  HIS B N   
3432 C  CA  . HIS B 280 ? 0.4314 0.4375 0.4008 0.0211  -0.0250 0.0449  652  HIS B CA  
3433 C  C   . HIS B 280 ? 0.4213 0.4277 0.4047 0.0348  -0.0232 0.0535  652  HIS B C   
3434 O  O   . HIS B 280 ? 0.4209 0.4143 0.3998 0.0415  -0.0153 0.0501  652  HIS B O   
3435 C  CB  . HIS B 280 ? 0.4356 0.4250 0.3856 0.0188  -0.0191 0.0369  652  HIS B CB  
3436 C  CG  . HIS B 280 ? 0.4602 0.4475 0.3983 0.0050  -0.0175 0.0259  652  HIS B CG  
3437 N  ND1 . HIS B 280 ? 0.4663 0.4388 0.3992 0.0036  -0.0070 0.0162  652  HIS B ND1 
3438 C  CD2 . HIS B 280 ? 0.4783 0.4769 0.4099 -0.0093 -0.0236 0.0220  652  HIS B CD2 
3439 C  CE1 . HIS B 280 ? 0.4741 0.4458 0.3990 -0.0100 -0.0040 0.0043  652  HIS B CE1 
3440 N  NE2 . HIS B 280 ? 0.4741 0.4616 0.3948 -0.0196 -0.0143 0.0065  652  HIS B NE2 
3441 N  N   . THR B 281 ? 0.4177 0.4399 0.4203 0.0377  -0.0299 0.0641  653  THR B N   
3442 C  CA  . THR B 281 ? 0.4124 0.4351 0.4372 0.0510  -0.0247 0.0706  653  THR B CA  
3443 C  C   . THR B 281 ? 0.4158 0.4216 0.4340 0.0577  -0.0214 0.0718  653  THR B C   
3444 O  O   . THR B 281 ? 0.4159 0.4096 0.4368 0.0649  -0.0097 0.0650  653  THR B O   
3445 C  CB  . THR B 281 ? 0.4090 0.4550 0.4636 0.0531  -0.0331 0.0850  653  THR B CB  
3446 O  OG1 . THR B 281 ? 0.4157 0.4767 0.4761 0.0453  -0.0350 0.0822  653  THR B OG1 
3447 C  CG2 . THR B 281 ? 0.4033 0.4490 0.4890 0.0681  -0.0233 0.0898  653  THR B CG2 
3448 N  N   . GLY B 282 ? 0.4231 0.4289 0.4310 0.0530  -0.0312 0.0800  654  GLY B N   
3449 C  CA  . GLY B 282 ? 0.4343 0.4234 0.4347 0.0570  -0.0289 0.0822  654  GLY B CA  
3450 C  C   . GLY B 282 ? 0.4349 0.4052 0.4147 0.0563  -0.0187 0.0676  654  GLY B C   
3451 O  O   . GLY B 282 ? 0.4397 0.3959 0.4227 0.0622  -0.0110 0.0647  654  GLY B O   
3452 N  N   . LEU B 283 ? 0.4316 0.4022 0.3933 0.0483  -0.0181 0.0588  655  LEU B N   
3453 C  CA  . LEU B 283 ? 0.4292 0.3873 0.3775 0.0477  -0.0098 0.0489  655  LEU B CA  
3454 C  C   . LEU B 283 ? 0.4254 0.3825 0.3825 0.0529  -0.0008 0.0438  655  LEU B C   
3455 O  O   . LEU B 283 ? 0.4307 0.3784 0.3807 0.0535  0.0052  0.0391  655  LEU B O   
3456 C  CB  . LEU B 283 ? 0.4264 0.3855 0.3627 0.0396  -0.0094 0.0428  655  LEU B CB  
3457 C  CG  . LEU B 283 ? 0.4513 0.4091 0.3718 0.0315  -0.0136 0.0428  655  LEU B CG  
3458 C  CD1 . LEU B 283 ? 0.4256 0.3812 0.3399 0.0244  -0.0080 0.0330  655  LEU B CD1 
3459 C  CD2 . LEU B 283 ? 0.4800 0.4275 0.3918 0.0334  -0.0125 0.0458  655  LEU B CD2 
3460 N  N   . ALA B 284 ? 0.4225 0.3912 0.3935 0.0544  0.0004  0.0444  656  ALA B N   
3461 C  CA  . ALA B 284 ? 0.4256 0.3966 0.4035 0.0575  0.0104  0.0395  656  ALA B CA  
3462 C  C   . ALA B 284 ? 0.4363 0.3983 0.4214 0.0637  0.0180  0.0364  656  ALA B C   
3463 O  O   . ALA B 284 ? 0.4428 0.3998 0.4198 0.0617  0.0277  0.0275  656  ALA B O   
3464 C  CB  . ALA B 284 ? 0.4206 0.4072 0.4155 0.0580  0.0109  0.0420  656  ALA B CB  
3465 N  N   A CYS B 285 ? 0.4489 0.4098 0.4509 0.0697  0.0139  0.0442  657  CYS B N   
3466 N  N   B CYS B 285 ? 0.4437 0.4045 0.4452 0.0696  0.0137  0.0442  657  CYS B N   
3467 C  CA  A CYS B 285 ? 0.4687 0.4170 0.4855 0.0768  0.0224  0.0426  657  CYS B CA  
3468 C  CA  B CYS B 285 ? 0.4575 0.4065 0.4748 0.0769  0.0220  0.0430  657  CYS B CA  
3469 C  C   A CYS B 285 ? 0.4739 0.4041 0.4696 0.0722  0.0252  0.0355  657  CYS B C   
3470 C  C   B CYS B 285 ? 0.4692 0.3991 0.4673 0.0730  0.0251  0.0364  657  CYS B C   
3471 O  O   A CYS B 285 ? 0.4853 0.4057 0.4771 0.0706  0.0376  0.0229  657  CYS B O   
3472 O  O   B CYS B 285 ? 0.4835 0.4020 0.4817 0.0729  0.0378  0.0247  657  CYS B O   
3473 C  CB  A CYS B 285 ? 0.4733 0.4251 0.5152 0.0836  0.0141  0.0588  657  CYS B CB  
3474 C  CB  B CYS B 285 ? 0.4591 0.4140 0.5034 0.0839  0.0138  0.0594  657  CYS B CB  
3475 S  SG  A CYS B 285 ? 0.4902 0.4652 0.5691 0.0906  0.0127  0.0692  657  CYS B SG  
3476 S  SG  B CYS B 285 ? 0.4549 0.3946 0.5335 0.0957  0.0263  0.0611  657  CYS B SG  
3477 N  N   . LEU B 286 ? 0.4708 0.3984 0.4522 0.0680  0.0145  0.0425  658  LEU B N   
3478 C  CA  . LEU B 286 ? 0.4798 0.3933 0.4425 0.0625  0.0158  0.0379  658  LEU B CA  
3479 C  C   . LEU B 286 ? 0.4808 0.3939 0.4278 0.0561  0.0237  0.0249  658  LEU B C   
3480 O  O   . LEU B 286 ? 0.4995 0.4011 0.4418 0.0529  0.0319  0.0157  658  LEU B O   
3481 C  CB  . LEU B 286 ? 0.4773 0.3945 0.4243 0.0569  0.0051  0.0450  658  LEU B CB  
3482 C  CG  . LEU B 286 ? 0.4979 0.4036 0.4295 0.0513  0.0051  0.0439  658  LEU B CG  
3483 C  CD1 . LEU B 286 ? 0.4701 0.3617 0.4126 0.0545  0.0059  0.0502  658  LEU B CD1 
3484 C  CD2 . LEU B 286 ? 0.5029 0.4160 0.4207 0.0454  -0.0020 0.0482  658  LEU B CD2 
3485 N  N   . PHE B 287 ? 0.4656 0.3924 0.4057 0.0528  0.0213  0.0250  659  PHE B N   
3486 C  CA  . PHE B 287 ? 0.4647 0.3971 0.3910 0.0451  0.0260  0.0185  659  PHE B CA  
3487 C  C   . PHE B 287 ? 0.4833 0.4153 0.4109 0.0434  0.0384  0.0073  659  PHE B C   
3488 O  O   . PHE B 287 ? 0.4949 0.4249 0.4069 0.0341  0.0435  -0.0012 659  PHE B O   
3489 C  CB  . PHE B 287 ? 0.4458 0.3925 0.3711 0.0427  0.0211  0.0246  659  PHE B CB  
3490 C  CG  . PHE B 287 ? 0.4346 0.3795 0.3582 0.0422  0.0135  0.0307  659  PHE B CG  
3491 C  CD1 . PHE B 287 ? 0.4168 0.3519 0.3323 0.0406  0.0112  0.0309  659  PHE B CD1 
3492 C  CD2 . PHE B 287 ? 0.4179 0.3702 0.3485 0.0421  0.0107  0.0346  659  PHE B CD2 
3493 C  CE1 . PHE B 287 ? 0.4167 0.3514 0.3300 0.0390  0.0073  0.0343  659  PHE B CE1 
3494 C  CE2 . PHE B 287 ? 0.4110 0.3602 0.3401 0.0401  0.0076  0.0360  659  PHE B CE2 
3495 C  CZ  . PHE B 287 ? 0.3957 0.3369 0.3154 0.0386  0.0064  0.0355  659  PHE B CZ  
3496 N  N   . LEU B 288 ? 0.4899 0.4251 0.4362 0.0508  0.0441  0.0063  660  LEU B N   
3497 C  CA  . LEU B 288 ? 0.5183 0.4522 0.4688 0.0493  0.0602  -0.0073 660  LEU B CA  
3498 C  C   . LEU B 288 ? 0.5469 0.4599 0.4974 0.0480  0.0695  -0.0187 660  LEU B C   
3499 O  O   . LEU B 288 ? 0.5721 0.4825 0.5067 0.0372  0.0807  -0.0341 660  LEU B O   
3500 C  CB  . LEU B 288 ? 0.5122 0.4546 0.4900 0.0589  0.0662  -0.0051 660  LEU B CB  
3501 C  CG  . LEU B 288 ? 0.4976 0.4612 0.4737 0.0562  0.0620  0.0015  660  LEU B CG  
3502 C  CD1 . LEU B 288 ? 0.5087 0.4823 0.5158 0.0658  0.0647  0.0067  660  LEU B CD1 
3503 C  CD2 . LEU B 288 ? 0.4969 0.4716 0.4512 0.0436  0.0705  -0.0067 660  LEU B CD2 
3504 N  N   . LYS B 289 ? 0.5586 0.4578 0.5261 0.0569  0.0646  -0.0106 661  LYS B N   
3505 C  CA  . LYS B 289 ? 0.5965 0.4724 0.5693 0.0563  0.0725  -0.0181 661  LYS B CA  
3506 C  C   . LYS B 289 ? 0.6034 0.4738 0.5457 0.0415  0.0708  -0.0266 661  LYS B C   
3507 O  O   . LYS B 289 ? 0.6321 0.4853 0.5726 0.0353  0.0821  -0.0407 661  LYS B O   
3508 C  CB  . LYS B 289 ? 0.5961 0.4630 0.5909 0.0668  0.0629  -0.0005 661  LYS B CB  
3509 C  CG  . LYS B 289 ? 0.6395 0.5086 0.6743 0.0811  0.0670  0.0085  661  LYS B CG  
3510 C  CD  . LYS B 289 ? 0.6736 0.5507 0.7231 0.0879  0.0491  0.0337  661  LYS B CD  
3511 C  CE  . LYS B 289 ? 0.7080 0.5673 0.7589 0.0871  0.0445  0.0430  661  LYS B CE  
3512 N  NZ  . LYS B 289 ? 0.7193 0.5921 0.7595 0.0846  0.0247  0.0633  661  LYS B NZ  
3513 N  N   . ARG B 290 ? 0.5833 0.4688 0.5054 0.0355  0.0577  -0.0180 662  ARG B N   
3514 C  CA  . ARG B 290 ? 0.5951 0.4816 0.4935 0.0219  0.0537  -0.0214 662  ARG B CA  
3515 C  C   . ARG B 290 ? 0.5953 0.4998 0.4729 0.0082  0.0565  -0.0288 662  ARG B C   
3516 O  O   . ARG B 290 ? 0.5993 0.5144 0.4607 -0.0025 0.0485  -0.0244 662  ARG B O   
3517 C  CB  . ARG B 290 ? 0.5785 0.4719 0.4725 0.0233  0.0388  -0.0057 662  ARG B CB  
3518 C  CG  . ARG B 290 ? 0.6111 0.4917 0.5176 0.0317  0.0337  0.0039  662  ARG B CG  
3519 C  CD  . ARG B 290 ? 0.6872 0.5487 0.5927 0.0266  0.0379  -0.0011 662  ARG B CD  
3520 N  NE  . ARG B 290 ? 0.7547 0.6026 0.6798 0.0364  0.0365  0.0089  662  ARG B NE  
3521 C  CZ  . ARG B 290 ? 0.7717 0.6185 0.6955 0.0368  0.0275  0.0223  662  ARG B CZ  
3522 N  NH1 . ARG B 290 ? 0.7863 0.6244 0.7283 0.0442  0.0251  0.0348  662  ARG B NH1 
3523 N  NH2 . ARG B 290 ? 0.7671 0.6232 0.6733 0.0293  0.0212  0.0247  662  ARG B NH2 
3524 N  N   . GLY B 291 ? 0.6023 0.5137 0.4817 0.0078  0.0672  -0.0376 663  GLY B N   
3525 C  CA  . GLY B 291 ? 0.6001 0.5310 0.4562 -0.0087 0.0709  -0.0446 663  GLY B CA  
3526 C  C   . GLY B 291 ? 0.5764 0.5332 0.4279 -0.0103 0.0601  -0.0278 663  GLY B C   
3527 O  O   . GLY B 291 ? 0.5834 0.5604 0.4147 -0.0262 0.0587  -0.0268 663  GLY B O   
3528 N  N   . ALA B 292 ? 0.5404 0.4980 0.4110 0.0042  0.0525  -0.0139 664  ALA B N   
3529 C  CA  . ALA B 292 ? 0.5200 0.4981 0.3925 0.0036  0.0450  0.0010  664  ALA B CA  
3530 C  C   . ALA B 292 ? 0.5315 0.5264 0.3962 -0.0047 0.0545  -0.0040 664  ALA B C   
3531 O  O   . ALA B 292 ? 0.5325 0.5210 0.4028 -0.0015 0.0681  -0.0178 664  ALA B O   
3532 C  CB  . ALA B 292 ? 0.4942 0.4678 0.3882 0.0180  0.0389  0.0109  664  ALA B CB  
3533 N  N   . ASP B 293 ? 0.5307 0.5483 0.3847 -0.0159 0.0482  0.0086  665  ASP B N   
3534 C  CA  . ASP B 293 ? 0.5555 0.5938 0.3979 -0.0273 0.0559  0.0075  665  ASP B CA  
3535 C  C   . ASP B 293 ? 0.5455 0.5870 0.4096 -0.0159 0.0586  0.0141  665  ASP B C   
3536 O  O   . ASP B 293 ? 0.5231 0.5667 0.4041 -0.0084 0.0483  0.0308  665  ASP B O   
3537 C  CB  . ASP B 293 ? 0.5651 0.6303 0.3906 -0.0446 0.0458  0.0244  665  ASP B CB  
3538 C  CG  . ASP B 293 ? 0.6202 0.7110 0.4286 -0.0603 0.0535  0.0248  665  ASP B CG  
3539 O  OD1 . ASP B 293 ? 0.6645 0.7512 0.4744 -0.0574 0.0690  0.0095  665  ASP B OD1 
3540 O  OD2 . ASP B 293 ? 0.6726 0.7903 0.4672 -0.0765 0.0444  0.0422  665  ASP B OD2 
3541 N  N   . LEU B 294 ? 0.5634 0.6052 0.4288 -0.0156 0.0741  -0.0006 666  LEU B N   
3542 C  CA  . LEU B 294 ? 0.5624 0.6086 0.4506 -0.0056 0.0789  0.0030  666  LEU B CA  
3543 C  C   . LEU B 294 ? 0.5596 0.6308 0.4444 -0.0150 0.0760  0.0191  666  LEU B C   
3544 O  O   . LEU B 294 ? 0.5467 0.6209 0.4531 -0.0070 0.0718  0.0306  666  LEU B O   
3545 C  CB  . LEU B 294 ? 0.5866 0.6289 0.4799 -0.0040 0.0994  -0.0178 666  LEU B CB  
3546 C  CG  . LEU B 294 ? 0.5925 0.6128 0.5127 0.0133  0.1039  -0.0261 666  LEU B CG  
3547 C  CD1 . LEU B 294 ? 0.6423 0.6561 0.5637 0.0107  0.1273  -0.0495 666  LEU B CD1 
3548 C  CD2 . LEU B 294 ? 0.6036 0.6306 0.5539 0.0260  0.0988  -0.0135 666  LEU B CD2 
3549 N  N   . GLY B 295 ? 0.5753 0.6655 0.4328 -0.0337 0.0781  0.0204  667  GLY B N   
3550 C  CA  . GLY B 295 ? 0.5774 0.6948 0.4302 -0.0454 0.0754  0.0390  667  GLY B CA  
3551 C  C   . GLY B 295 ? 0.5647 0.6933 0.4181 -0.0508 0.0572  0.0657  667  GLY B C   
3552 O  O   . GLY B 295 ? 0.5839 0.7389 0.4280 -0.0654 0.0539  0.0837  667  GLY B O   
3553 N  N   . ALA B 296 ? 0.5358 0.6464 0.4027 -0.0397 0.0461  0.0701  668  ALA B N   
3554 C  CA  . ALA B 296 ? 0.5149 0.6343 0.3926 -0.0416 0.0311  0.0957  668  ALA B CA  
3555 C  C   . ALA B 296 ? 0.4944 0.6155 0.4021 -0.0340 0.0282  0.1142  668  ALA B C   
3556 O  O   . ALA B 296 ? 0.4784 0.5802 0.4059 -0.0200 0.0310  0.1061  668  ALA B O   
3557 C  CB  . ALA B 296 ? 0.4915 0.5910 0.3760 -0.0323 0.0236  0.0921  668  ALA B CB  
3558 N  N   . ARG B 297 ? 0.4917 0.6370 0.4027 -0.0452 0.0226  0.1396  669  ARG B N   
3559 C  CA  . ARG B 297 ? 0.4768 0.6234 0.4195 -0.0402 0.0203  0.1600  669  ARG B CA  
3560 C  C   . ARG B 297 ? 0.4510 0.5900 0.4239 -0.0330 0.0101  0.1800  669  ARG B C   
3561 O  O   . ARG B 297 ? 0.4504 0.6037 0.4197 -0.0400 0.0014  0.1952  669  ARG B O   
3562 C  CB  . ARG B 297 ? 0.5064 0.6839 0.4411 -0.0563 0.0220  0.1790  669  ARG B CB  
3563 C  CG  . ARG B 297 ? 0.5469 0.7326 0.4561 -0.0634 0.0366  0.1574  669  ARG B CG  
3564 C  CD  . ARG B 297 ? 0.6135 0.8199 0.5299 -0.0720 0.0417  0.1734  669  ARG B CD  
3565 N  NE  . ARG B 297 ? 0.6628 0.8732 0.5642 -0.0746 0.0587  0.1499  669  ARG B NE  
3566 C  CZ  . ARG B 297 ? 0.6516 0.8472 0.5747 -0.0613 0.0671  0.1364  669  ARG B CZ  
3567 N  NH1 . ARG B 297 ? 0.6359 0.8107 0.5916 -0.0466 0.0597  0.1415  669  ARG B NH1 
3568 N  NH2 . ARG B 297 ? 0.6643 0.8676 0.5777 -0.0641 0.0838  0.1171  669  ARG B NH2 
3569 N  N   . ASP B 298 ? 0.4182 0.5354 0.4219 -0.0201 0.0123  0.1786  670  ASP B N   
3570 C  CA  . ASP B 298 ? 0.4039 0.5104 0.4428 -0.0127 0.0077  0.1944  670  ASP B CA  
3571 C  C   . ASP B 298 ? 0.4081 0.5321 0.4758 -0.0187 0.0042  0.2287  670  ASP B C   
3572 O  O   . ASP B 298 ? 0.4159 0.5638 0.4696 -0.0309 0.0036  0.2412  670  ASP B O   
3573 C  CB  . ASP B 298 ? 0.3875 0.4630 0.4447 0.0003  0.0135  0.1752  670  ASP B CB  
3574 C  CG  . ASP B 298 ? 0.3955 0.4659 0.4679 0.0003  0.0192  0.1737  670  ASP B CG  
3575 O  OD1 . ASP B 298 ? 0.4061 0.4949 0.4825 -0.0078 0.0194  0.1911  670  ASP B OD1 
3576 O  OD2 . ASP B 298 ? 0.4192 0.4689 0.4990 0.0068  0.0232  0.1552  670  ASP B OD2 
3577 N  N   . SER B 299 ? 0.3994 0.5109 0.5089 -0.0106 0.0035  0.2436  671  SER B N   
3578 C  CA  . SER B 299 ? 0.4134 0.5389 0.5612 -0.0144 0.0001  0.2808  671  SER B CA  
3579 C  C   . SER B 299 ? 0.4189 0.5413 0.5787 -0.0174 0.0063  0.2846  671  SER B C   
3580 O  O   . SER B 299 ? 0.4351 0.5759 0.6156 -0.0249 0.0030  0.3168  671  SER B O   
3581 C  CB  . SER B 299 ? 0.4075 0.5164 0.6055 -0.0029 0.0017  0.2935  671  SER B CB  
3582 O  OG  . SER B 299 ? 0.3973 0.4706 0.6166 0.0074  0.0137  0.2704  671  SER B OG  
3583 N  N   . GLU B 300 ? 0.4101 0.5120 0.5577 -0.0128 0.0143  0.2538  672  GLU B N   
3584 C  CA  . GLU B 300 ? 0.4134 0.5144 0.5699 -0.0169 0.0201  0.2542  672  GLU B CA  
3585 C  C   . GLU B 300 ? 0.4218 0.5485 0.5396 -0.0277 0.0207  0.2499  672  GLU B C   
3586 O  O   . GLU B 300 ? 0.4187 0.5504 0.5406 -0.0324 0.0260  0.2506  672  GLU B O   
3587 C  CB  . GLU B 300 ? 0.4010 0.4707 0.5695 -0.0087 0.0277  0.2261  672  GLU B CB  
3588 C  CG  . GLU B 300 ? 0.4042 0.4481 0.6131 -0.0008 0.0314  0.2286  672  GLU B CG  
3589 C  CD  . GLU B 300 ? 0.4246 0.4391 0.6414 0.0030  0.0393  0.1990  672  GLU B CD  
3590 O  OE1 . GLU B 300 ? 0.4495 0.4639 0.6544 -0.0014 0.0410  0.1844  672  GLU B OE1 
3591 O  OE2 . GLU B 300 ? 0.4555 0.4486 0.6909 0.0091  0.0443  0.1902  672  GLU B OE2 
3592 N  N   . GLY B 301 ? 0.4325 0.5755 0.5142 -0.0325 0.0169  0.2445  673  GLY B N   
3593 C  CA  . GLY B 301 ? 0.4466 0.6124 0.4901 -0.0438 0.0212  0.2356  673  GLY B CA  
3594 C  C   . GLY B 301 ? 0.4413 0.5922 0.4669 -0.0366 0.0299  0.1999  673  GLY B C   
3595 O  O   . GLY B 301 ? 0.4595 0.6257 0.4630 -0.0437 0.0378  0.1899  673  GLY B O   
3596 N  N   . ARG B 302 ? 0.4222 0.5453 0.4591 -0.0231 0.0292  0.1821  674  ARG B N   
3597 C  CA  . ARG B 302 ? 0.4094 0.5193 0.4371 -0.0153 0.0351  0.1537  674  ARG B CA  
3598 C  C   . ARG B 302 ? 0.4100 0.5149 0.4102 -0.0123 0.0350  0.1354  674  ARG B C   
3599 O  O   . ARG B 302 ? 0.3991 0.4945 0.3972 -0.0092 0.0286  0.1367  674  ARG B O   
3600 C  CB  . ARG B 302 ? 0.3972 0.4823 0.4505 -0.0056 0.0337  0.1452  674  ARG B CB  
3601 C  CG  . ARG B 302 ? 0.3843 0.4663 0.4702 -0.0086 0.0344  0.1606  674  ARG B CG  
3602 C  CD  . ARG B 302 ? 0.3739 0.4295 0.4805 -0.0024 0.0341  0.1481  674  ARG B CD  
3603 N  NE  . ARG B 302 ? 0.3800 0.4205 0.4857 0.0037  0.0312  0.1448  674  ARG B NE  
3604 C  CZ  . ARG B 302 ? 0.3811 0.3992 0.4980 0.0078  0.0326  0.1310  674  ARG B CZ  
3605 N  NH1 . ARG B 302 ? 0.3685 0.3772 0.4960 0.0050  0.0353  0.1187  674  ARG B NH1 
3606 N  NH2 . ARG B 302 ? 0.3723 0.3795 0.4888 0.0129  0.0319  0.1286  674  ARG B NH2 
3607 N  N   . ASP B 303 ? 0.4140 0.5248 0.3968 -0.0133 0.0435  0.1184  675  ASP B N   
3608 C  CA  . ASP B 303 ? 0.4197 0.5190 0.3848 -0.0081 0.0457  0.0978  675  ASP B CA  
3609 C  C   . ASP B 303 ? 0.3996 0.4792 0.3816 0.0052  0.0448  0.0849  675  ASP B C   
3610 O  O   . ASP B 303 ? 0.4026 0.4808 0.4063 0.0078  0.0434  0.0895  675  ASP B O   
3611 C  CB  . ASP B 303 ? 0.4451 0.5584 0.3868 -0.0162 0.0578  0.0848  675  ASP B CB  
3612 C  CG  . ASP B 303 ? 0.4885 0.6102 0.4425 -0.0143 0.0696  0.0780  675  ASP B CG  
3613 O  OD1 . ASP B 303 ? 0.5140 0.6336 0.4939 -0.0084 0.0667  0.0850  675  ASP B OD1 
3614 O  OD2 . ASP B 303 ? 0.5527 0.6843 0.4913 -0.0202 0.0834  0.0643  675  ASP B OD2 
3615 N  N   . PRO B 304 ? 0.3883 0.4537 0.3609 0.0119  0.0445  0.0704  676  PRO B N   
3616 C  CA  . PRO B 304 ? 0.3680 0.4199 0.3560 0.0222  0.0416  0.0623  676  PRO B CA  
3617 C  C   . PRO B 304 ? 0.3664 0.4282 0.3720 0.0250  0.0477  0.0590  676  PRO B C   
3618 O  O   . PRO B 304 ? 0.3597 0.4185 0.3828 0.0287  0.0422  0.0601  676  PRO B O   
3619 C  CB  . PRO B 304 ? 0.3683 0.4070 0.3426 0.0271  0.0418  0.0504  676  PRO B CB  
3620 C  CG  . PRO B 304 ? 0.3783 0.4183 0.3337 0.0194  0.0392  0.0553  676  PRO B CG  
3621 C  CD  . PRO B 304 ? 0.3850 0.4461 0.3349 0.0089  0.0444  0.0636  676  PRO B CD  
3622 N  N   . LEU B 305 ? 0.3797 0.4554 0.3812 0.0216  0.0595  0.0549  677  LEU B N   
3623 C  CA  . LEU B 305 ? 0.3811 0.4691 0.4041 0.0246  0.0669  0.0530  677  LEU B CA  
3624 C  C   . LEU B 305 ? 0.3842 0.4811 0.4247 0.0199  0.0615  0.0661  677  LEU B C   
3625 O  O   . LEU B 305 ? 0.3760 0.4748 0.4386 0.0238  0.0575  0.0666  677  LEU B O   
3626 C  CB  . LEU B 305 ? 0.3946 0.4969 0.4097 0.0199  0.0844  0.0445  677  LEU B CB  
3627 C  CG  . LEU B 305 ? 0.3878 0.5047 0.4302 0.0244  0.0958  0.0412  677  LEU B CG  
3628 C  CD1 . LEU B 305 ? 0.3524 0.4604 0.4212 0.0383  0.0907  0.0381  677  LEU B CD1 
3629 C  CD2 . LEU B 305 ? 0.3805 0.5093 0.4132 0.0189  0.1175  0.0282  677  LEU B CD2 
3630 N  N   . THR B 306 ? 0.3957 0.4988 0.4278 0.0104  0.0607  0.0782  678  THR B N   
3631 C  CA  . THR B 306 ? 0.4026 0.5105 0.4533 0.0050  0.0568  0.0920  678  THR B CA  
3632 C  C   . THR B 306 ? 0.3899 0.4806 0.4561 0.0091  0.0464  0.0901  678  THR B C   
3633 O  O   . THR B 306 ? 0.3891 0.4837 0.4759 0.0069  0.0450  0.0914  678  THR B O   
3634 C  CB  . THR B 306 ? 0.4157 0.5298 0.4578 -0.0047 0.0553  0.1094  678  THR B CB  
3635 O  OG1 . THR B 306 ? 0.4530 0.5889 0.4783 -0.0134 0.0653  0.1115  678  THR B OG1 
3636 C  CG2 . THR B 306 ? 0.4147 0.5282 0.4823 -0.0094 0.0519  0.1248  678  THR B CG2 
3637 N  N   . ILE B 307 ? 0.3799 0.4530 0.4348 0.0132  0.0400  0.0857  679  ILE B N   
3638 C  CA  . ILE B 307 ? 0.3721 0.4292 0.4362 0.0147  0.0325  0.0809  679  ILE B CA  
3639 C  C   . ILE B 307 ? 0.3686 0.4293 0.4400 0.0179  0.0290  0.0715  679  ILE B C   
3640 O  O   . ILE B 307 ? 0.3721 0.4315 0.4567 0.0130  0.0242  0.0698  679  ILE B O   
3641 C  CB  . ILE B 307 ? 0.3661 0.4060 0.4159 0.0181  0.0284  0.0776  679  ILE B CB  
3642 C  CG1 . ILE B 307 ? 0.3783 0.4195 0.4262 0.0148  0.0299  0.0913  679  ILE B CG1 
3643 C  CG2 . ILE B 307 ? 0.3505 0.3751 0.4078 0.0169  0.0236  0.0702  679  ILE B CG2 
3644 C  CD1 . ILE B 307 ? 0.3533 0.3819 0.3921 0.0179  0.0266  0.0906  679  ILE B CD1 
3645 N  N   . ALA B 308 ? 0.3716 0.4370 0.4361 0.0251  0.0312  0.0659  680  ALA B N   
3646 C  CA  . ALA B 308 ? 0.3739 0.4459 0.4511 0.0295  0.0268  0.0621  680  ALA B CA  
3647 C  C   . ALA B 308 ? 0.3745 0.4666 0.4771 0.0254  0.0282  0.0671  680  ALA B C   
3648 O  O   . ALA B 308 ? 0.3692 0.4689 0.4861 0.0231  0.0196  0.0678  680  ALA B O   
3649 C  CB  . ALA B 308 ? 0.3690 0.4406 0.4418 0.0392  0.0319  0.0572  680  ALA B CB  
3650 N  N   . MET B 309 ? 0.3776 0.4807 0.4846 0.0226  0.0385  0.0715  681  MET B N   
3651 C  CA  . MET B 309 ? 0.4014 0.5248 0.5334 0.0176  0.0415  0.0771  681  MET B CA  
3652 C  C   . MET B 309 ? 0.4027 0.5216 0.5434 0.0066  0.0340  0.0813  681  MET B C   
3653 O  O   . MET B 309 ? 0.4031 0.5331 0.5632 0.0013  0.0282  0.0821  681  MET B O   
3654 C  CB  . MET B 309 ? 0.4054 0.5430 0.5368 0.0154  0.0561  0.0808  681  MET B CB  
3655 C  CG  . MET B 309 ? 0.4715 0.6341 0.6316 0.0145  0.0631  0.0840  681  MET B CG  
3656 S  SD  . MET B 309 ? 0.5590 0.7323 0.7399 0.0287  0.0684  0.0767  681  MET B SD  
3657 C  CE  . MET B 309 ? 0.5438 0.7035 0.6948 0.0339  0.0827  0.0651  681  MET B CE  
3658 N  N   . GLU B 310 ? 0.4063 0.5091 0.5352 0.0024  0.0345  0.0843  682  GLU B N   
3659 C  CA  . GLU B 310 ? 0.4189 0.5114 0.5595 -0.0077 0.0310  0.0868  682  GLU B CA  
3660 C  C   . GLU B 310 ? 0.4205 0.5023 0.5608 -0.0118 0.0214  0.0754  682  GLU B C   
3661 O  O   . GLU B 310 ? 0.4327 0.5133 0.5875 -0.0232 0.0191  0.0731  682  GLU B O   
3662 C  CB  . GLU B 310 ? 0.4244 0.5019 0.5588 -0.0089 0.0347  0.0948  682  GLU B CB  
3663 C  CG  . GLU B 310 ? 0.4466 0.5399 0.5844 -0.0120 0.0425  0.1102  682  GLU B CG  
3664 C  CD  . GLU B 310 ? 0.4873 0.5720 0.6181 -0.0126 0.0435  0.1231  682  GLU B CD  
3665 O  OE1 . GLU B 310 ? 0.4947 0.5614 0.6180 -0.0080 0.0395  0.1183  682  GLU B OE1 
3666 O  OE2 . GLU B 310 ? 0.4943 0.5935 0.6282 -0.0184 0.0481  0.1398  682  GLU B OE2 
3667 N  N   . THR B 311 ? 0.4059 0.4812 0.5286 -0.0048 0.0164  0.0682  683  THR B N   
3668 C  CA  . THR B 311 ? 0.4131 0.4834 0.5304 -0.0109 0.0068  0.0585  683  THR B CA  
3669 C  C   . THR B 311 ? 0.4071 0.5014 0.5348 -0.0109 -0.0016 0.0608  683  THR B C   
3670 O  O   . THR B 311 ? 0.4129 0.5104 0.5341 -0.0169 -0.0122 0.0563  683  THR B O   
3671 C  CB  . THR B 311 ? 0.4205 0.4736 0.5144 -0.0048 0.0051  0.0521  683  THR B CB  
3672 O  OG1 . THR B 311 ? 0.4282 0.4871 0.5147 0.0080  0.0067  0.0564  683  THR B OG1 
3673 C  CG2 . THR B 311 ? 0.4160 0.4470 0.5060 -0.0056 0.0123  0.0508  683  THR B CG2 
3674 N  N   . ALA B 312 ? 0.3898 0.5032 0.5351 -0.0049 0.0035  0.0691  684  ALA B N   
3675 C  CA  . ALA B 312 ? 0.3869 0.5260 0.5523 -0.0019 -0.0022 0.0749  684  ALA B CA  
3676 C  C   . ALA B 312 ? 0.3811 0.5195 0.5376 0.0055  -0.0111 0.0751  684  ALA B C   
3677 O  O   . ALA B 312 ? 0.3905 0.5449 0.5557 -0.0006 -0.0241 0.0794  684  ALA B O   
3678 C  CB  . ALA B 312 ? 0.3835 0.5412 0.5690 -0.0174 -0.0106 0.0773  684  ALA B CB  
3679 N  N   . ASN B 313 ? 0.3725 0.4942 0.5121 0.0169  -0.0047 0.0720  685  ASN B N   
3680 C  CA  . ASN B 313 ? 0.3702 0.4898 0.5048 0.0251  -0.0110 0.0741  685  ASN B CA  
3681 C  C   . ASN B 313 ? 0.3670 0.4961 0.5234 0.0399  -0.0014 0.0791  685  ASN B C   
3682 O  O   . ASN B 313 ? 0.3669 0.4826 0.5127 0.0474  0.0114  0.0730  685  ASN B O   
3683 C  CB  . ASN B 313 ? 0.3706 0.4635 0.4737 0.0266  -0.0096 0.0661  685  ASN B CB  
3684 C  CG  . ASN B 313 ? 0.3885 0.4783 0.4836 0.0306  -0.0185 0.0691  685  ASN B CG  
3685 O  OD1 . ASN B 313 ? 0.3995 0.5006 0.5140 0.0397  -0.0199 0.0779  685  ASN B OD1 
3686 N  ND2 . ASN B 313 ? 0.3923 0.4669 0.4618 0.0238  -0.0233 0.0629  685  ASN B ND2 
3687 N  N   . ALA B 314 ? 0.3678 0.5212 0.5566 0.0429  -0.0068 0.0900  686  ALA B N   
3688 C  CA  . ALA B 314 ? 0.3702 0.5328 0.5893 0.0579  0.0053  0.0944  686  ALA B CA  
3689 C  C   . ALA B 314 ? 0.3753 0.5175 0.5859 0.0699  0.0101  0.0915  686  ALA B C   
3690 O  O   . ALA B 314 ? 0.3812 0.5157 0.5991 0.0798  0.0282  0.0841  686  ALA B O   
3691 C  CB  . ALA B 314 ? 0.3610 0.5567 0.6247 0.0593  -0.0030 0.1106  686  ALA B CB  
3692 N  N   . ASP B 315 ? 0.3750 0.5087 0.5692 0.0671  -0.0047 0.0960  687  ASP B N   
3693 C  CA  . ASP B 315 ? 0.3834 0.4978 0.5711 0.0769  -0.0017 0.0954  687  ASP B CA  
3694 C  C   . ASP B 315 ? 0.3755 0.4632 0.5315 0.0778  0.0120  0.0786  687  ASP B C   
3695 O  O   . ASP B 315 ? 0.3847 0.4598 0.5465 0.0873  0.0250  0.0730  687  ASP B O   
3696 C  CB  . ASP B 315 ? 0.3905 0.5040 0.5635 0.0706  -0.0210 0.1051  687  ASP B CB  
3697 C  CG  . ASP B 315 ? 0.4204 0.5641 0.6256 0.0688  -0.0369 0.1262  687  ASP B CG  
3698 O  OD1 . ASP B 315 ? 0.4473 0.6111 0.6947 0.0768  -0.0319 0.1351  687  ASP B OD1 
3699 O  OD2 . ASP B 315 ? 0.4388 0.5885 0.6275 0.0583  -0.0544 0.1348  687  ASP B OD2 
3700 N  N   . ILE B 316 ? 0.3607 0.4403 0.4859 0.0672  0.0093  0.0710  688  ILE B N   
3701 C  CA  . ILE B 316 ? 0.3548 0.4146 0.4521 0.0664  0.0196  0.0590  688  ILE B CA  
3702 C  C   . ILE B 316 ? 0.3524 0.4180 0.4558 0.0680  0.0371  0.0521  688  ILE B C   
3703 O  O   . ILE B 316 ? 0.3590 0.4128 0.4486 0.0697  0.0487  0.0427  688  ILE B O   
3704 C  CB  . ILE B 316 ? 0.3496 0.3994 0.4188 0.0561  0.0121  0.0560  688  ILE B CB  
3705 C  CG1 . ILE B 316 ? 0.3574 0.4007 0.4160 0.0534  -0.0011 0.0593  688  ILE B CG1 
3706 C  CG2 . ILE B 316 ? 0.3474 0.3832 0.3938 0.0549  0.0213  0.0483  688  ILE B CG2 
3707 C  CD1 . ILE B 316 ? 0.3800 0.4110 0.4140 0.0441  -0.0048 0.0535  688  ILE B CD1 
3708 N  N   . VAL B 317 ? 0.3412 0.4265 0.4642 0.0653  0.0394  0.0563  689  VAL B N   
3709 C  CA  . VAL B 317 ? 0.3453 0.4408 0.4772 0.0660  0.0577  0.0507  689  VAL B CA  
3710 C  C   . VAL B 317 ? 0.3560 0.4470 0.5044 0.0770  0.0730  0.0433  689  VAL B C   
3711 O  O   . VAL B 317 ? 0.3657 0.4487 0.4978 0.0752  0.0888  0.0304  689  VAL B O   
3712 C  CB  . VAL B 317 ? 0.3404 0.4609 0.4994 0.0626  0.0578  0.0585  689  VAL B CB  
3713 C  CG1 . VAL B 317 ? 0.3369 0.4708 0.5099 0.0645  0.0794  0.0525  689  VAL B CG1 
3714 C  CG2 . VAL B 317 ? 0.3427 0.4637 0.4859 0.0499  0.0486  0.0627  689  VAL B CG2 
3715 N  N   . THR B 318 ? 0.3646 0.4612 0.5466 0.0871  0.0681  0.0520  690  THR B N   
3716 C  CA  . THR B 318 ? 0.3850 0.4767 0.5967 0.1000  0.0838  0.0477  690  THR B CA  
3717 C  C   . THR B 318 ? 0.4036 0.4667 0.5884 0.1006  0.0900  0.0351  690  THR B C   
3718 O  O   . THR B 318 ? 0.4138 0.4672 0.5960 0.1014  0.1114  0.0185  690  THR B O   
3719 C  CB  . THR B 318 ? 0.3800 0.4846 0.6351 0.1100  0.0714  0.0670  690  THR B CB  
3720 O  OG1 . THR B 318 ? 0.3687 0.5027 0.6475 0.1065  0.0640  0.0786  690  THR B OG1 
3721 C  CG2 . THR B 318 ? 0.4006 0.4998 0.6988 0.1256  0.0892  0.0658  690  THR B CG2 
3722 N  N   . LEU B 319 ? 0.4030 0.4537 0.5660 0.0978  0.0717  0.0417  691  LEU B N   
3723 C  CA  . LEU B 319 ? 0.4224 0.4481 0.5569 0.0957  0.0735  0.0322  691  LEU B CA  
3724 C  C   . LEU B 319 ? 0.4319 0.4520 0.5346 0.0860  0.0878  0.0147  691  LEU B C   
3725 O  O   . LEU B 319 ? 0.4515 0.4575 0.5493 0.0860  0.1038  -0.0002 691  LEU B O   
3726 C  CB  . LEU B 319 ? 0.4160 0.4365 0.5261 0.0899  0.0521  0.0415  691  LEU B CB  
3727 C  CG  . LEU B 319 ? 0.4396 0.4422 0.5451 0.0934  0.0450  0.0457  691  LEU B CG  
3728 C  CD1 . LEU B 319 ? 0.4582 0.4594 0.6054 0.1062  0.0495  0.0545  691  LEU B CD1 
3729 C  CD2 . LEU B 319 ? 0.4559 0.4633 0.5439 0.0863  0.0245  0.0565  691  LEU B CD2 
3730 N  N   . LEU B 320 ? 0.4216 0.4540 0.5044 0.0761  0.0823  0.0171  692  LEU B N   
3731 C  CA  . LEU B 320 ? 0.4366 0.4697 0.4880 0.0642  0.0916  0.0066  692  LEU B CA  
3732 C  C   . LEU B 320 ? 0.4610 0.5015 0.5194 0.0625  0.1156  -0.0079 692  LEU B C   
3733 O  O   . LEU B 320 ? 0.4770 0.5116 0.5100 0.0531  0.1276  -0.0225 692  LEU B O   
3734 C  CB  . LEU B 320 ? 0.4209 0.4674 0.4593 0.0553  0.0808  0.0173  692  LEU B CB  
3735 C  CG  . LEU B 320 ? 0.4135 0.4500 0.4382 0.0534  0.0622  0.0262  692  LEU B CG  
3736 C  CD1 . LEU B 320 ? 0.3984 0.4461 0.4231 0.0465  0.0546  0.0365  692  LEU B CD1 
3737 C  CD2 . LEU B 320 ? 0.4364 0.4589 0.4327 0.0482  0.0616  0.0205  692  LEU B CD2 
3738 N  N   . ARG B 321 ? 0.4716 0.5272 0.5647 0.0698  0.1231  -0.0044 693  ARG B N   
3739 C  CA  . ARG B 321 ? 0.4993 0.5640 0.6051 0.0691  0.1489  -0.0189 693  ARG B CA  
3740 C  C   . ARG B 321 ? 0.5268 0.5712 0.6469 0.0766  0.1668  -0.0354 693  ARG B C   
3741 O  O   . ARG B 321 ? 0.5514 0.5931 0.6595 0.0689  0.1902  -0.0565 693  ARG B O   
3742 C  CB  . ARG B 321 ? 0.4948 0.5823 0.6414 0.0764  0.1517  -0.0085 693  ARG B CB  
3743 C  CG  . ARG B 321 ? 0.5050 0.6146 0.6378 0.0644  0.1492  -0.0015 693  ARG B CG  
3744 C  CD  . ARG B 321 ? 0.5762 0.7000 0.7059 0.0567  0.1767  -0.0167 693  ARG B CD  
3745 N  NE  . ARG B 321 ? 0.6387 0.7592 0.7189 0.0395  0.1822  -0.0274 693  ARG B NE  
3746 C  CZ  . ARG B 321 ? 0.6975 0.8269 0.7613 0.0280  0.2071  -0.0456 693  ARG B CZ  
3747 N  NH1 . ARG B 321 ? 0.7007 0.8399 0.7963 0.0337  0.2322  -0.0576 693  ARG B NH1 
3748 N  NH2 . ARG B 321 ? 0.7376 0.8681 0.7534 0.0093  0.2076  -0.0519 693  ARG B NH2 
3749 N  N   . LEU B 322 ? 0.5303 0.5609 0.6763 0.0900  0.1565  -0.0259 694  LEU B N   
3750 C  CA  . LEU B 322 ? 0.5655 0.5729 0.7314 0.0983  0.1727  -0.0385 694  LEU B CA  
3751 C  C   . LEU B 322 ? 0.5887 0.5741 0.7105 0.0858  0.1753  -0.0551 694  LEU B C   
3752 O  O   . LEU B 322 ? 0.6211 0.5892 0.7456 0.0839  0.1979  -0.0767 694  LEU B O   
3753 C  CB  . LEU B 322 ? 0.5531 0.5542 0.7598 0.1147  0.1584  -0.0183 694  LEU B CB  
3754 C  CG  . LEU B 322 ? 0.5488 0.5708 0.8138 0.1291  0.1599  -0.0021 694  LEU B CG  
3755 C  CD1 . LEU B 322 ? 0.5373 0.5543 0.8349 0.1415  0.1417  0.0215  694  LEU B CD1 
3756 C  CD2 . LEU B 322 ? 0.5701 0.5924 0.8721 0.1359  0.1940  -0.0198 694  LEU B CD2 
3757 N  N   . ALA B 323 ? 0.5796 0.5660 0.6636 0.0765  0.1532  -0.0456 695  ALA B N   
3758 C  CA  . ALA B 323 ? 0.6049 0.5768 0.6474 0.0628  0.1531  -0.0581 695  ALA B CA  
3759 C  C   . ALA B 323 ? 0.6417 0.6250 0.6541 0.0452  0.1709  -0.0772 695  ALA B C   
3760 O  O   . ALA B 323 ? 0.6710 0.6413 0.6627 0.0340  0.1848  -0.0978 695  ALA B O   
3761 C  CB  . ALA B 323 ? 0.5718 0.5453 0.5886 0.0583  0.1268  -0.0416 695  ALA B CB  
3762 N  N   . LYS B 324 ? 0.6533 0.6619 0.6625 0.0406  0.1709  -0.0704 696  LYS B N   
3763 C  CA  . LYS B 324 ? 0.7046 0.7297 0.6839 0.0217  0.1872  -0.0850 696  LYS B CA  
3764 C  C   . LYS B 324 ? 0.7579 0.7745 0.7514 0.0211  0.2202  -0.1130 696  LYS B C   
3765 O  O   . LYS B 324 ? 0.7920 0.8088 0.7519 0.0019  0.2364  -0.1352 696  LYS B O   
3766 C  CB  . LYS B 324 ? 0.6896 0.7432 0.6704 0.0187  0.1811  -0.0687 696  LYS B CB  
3767 C  CG  . LYS B 324 ? 0.7371 0.8133 0.6896 -0.0014 0.1982  -0.0795 696  LYS B CG  
3768 C  CD  . LYS B 324 ? 0.7634 0.8562 0.6741 -0.0202 0.1808  -0.0648 696  LYS B CD  
3769 C  CE  . LYS B 324 ? 0.7987 0.9221 0.6900 -0.0386 0.1946  -0.0661 696  LYS B CE  
3770 N  NZ  . LYS B 324 ? 0.8051 0.9496 0.6582 -0.0592 0.1791  -0.0487 696  LYS B NZ  
3771 N  N   . MET B 325 ? 0.7754 0.7856 0.8206 0.0410  0.2306  -0.1120 697  MET B N   
3772 C  CA  . MET B 325 ? 0.8327 0.8329 0.9042 0.0441  0.2652  -0.1380 697  MET B CA  
3773 C  C   . MET B 325 ? 0.8672 0.8344 0.9313 0.0409  0.2756  -0.1586 697  MET B C   
3774 O  O   . MET B 325 ? 0.9051 0.8646 0.9535 0.0268  0.3036  -0.1894 697  MET B O   
3775 C  CB  . MET B 325 ? 0.8265 0.8301 0.9648 0.0683  0.2716  -0.1262 697  MET B CB  
3776 C  CG  . MET B 325 ? 0.8315 0.8684 0.9842 0.0707  0.2656  -0.1089 697  MET B CG  
3777 S  SD  . MET B 325 ? 0.9358 0.9986 1.0633 0.0508  0.2949  -0.1303 697  MET B SD  
3778 C  CE  . MET B 325 ? 0.8969 0.9754 0.9564 0.0279  0.2671  -0.1160 697  MET B CE  
3779 N  N   . ARG B 326 ? 0.8603 0.8089 0.9342 0.0518  0.2539  -0.1423 698  ARG B N   
3780 C  CA  . ARG B 326 ? 0.8988 0.8148 0.9693 0.0494  0.2607  -0.1575 698  ARG B CA  
3781 C  C   . ARG B 326 ? 0.9281 0.8438 0.9370 0.0215  0.2625  -0.1774 698  ARG B C   
3782 O  O   . ARG B 326 ? 0.9706 0.8654 0.9711 0.0103  0.2845  -0.2060 698  ARG B O   
3783 C  CB  . ARG B 326 ? 0.8732 0.7753 0.9616 0.0643  0.2337  -0.1314 698  ARG B CB  
3784 C  CG  . ARG B 326 ? 0.9140 0.7814 1.0060 0.0634  0.2401  -0.1432 698  ARG B CG  
3785 C  CD  . ARG B 326 ? 0.9193 0.7737 1.0478 0.0828  0.2208  -0.1156 698  ARG B CD  
3786 N  NE  . ARG B 326 ? 0.9298 0.7859 1.1227 0.1048  0.2298  -0.1031 698  ARG B NE  
3787 C  CZ  . ARG B 326 ? 0.9437 0.7748 1.1870 0.1179  0.2476  -0.1064 698  ARG B CZ  
3788 N  NH1 . ARG B 326 ? 0.9784 0.7771 1.2143 0.1106  0.2600  -0.1247 698  ARG B NH1 
3789 N  NH2 . ARG B 326 ? 0.9298 0.7694 1.2354 0.1382  0.2528  -0.0895 698  ARG B NH2 
3790 N  N   . GLU B 327 ? 0.9146 0.8548 0.8839 0.0094  0.2396  -0.1616 699  GLU B N   
3791 C  CA  . GLU B 327 ? 0.9407 0.8907 0.8531 -0.0183 0.2363  -0.1726 699  GLU B CA  
3792 C  C   . GLU B 327 ? 0.9860 0.9485 0.8749 -0.0394 0.2660  -0.2022 699  GLU B C   
3793 O  O   . GLU B 327 ? 1.0195 0.9776 0.8712 -0.0632 0.2762  -0.2255 699  GLU B O   
3794 C  CB  . GLU B 327 ? 0.9078 0.8828 0.7969 -0.0221 0.2053  -0.1428 699  GLU B CB  
3795 C  CG  . GLU B 327 ? 0.9391 0.9414 0.7777 -0.0496 0.2005  -0.1435 699  GLU B CG  
3796 C  CD  . GLU B 327 ? 0.9306 0.9542 0.7629 -0.0473 0.1715  -0.1098 699  GLU B CD  
3797 O  OE1 . GLU B 327 ? 0.9029 0.9139 0.7483 -0.0343 0.1515  -0.0931 699  GLU B OE1 
3798 O  OE2 . GLU B 327 ? 0.9269 0.9793 0.7433 -0.0588 0.1701  -0.1002 699  GLU B OE2 
3799 N  N   . ALA B 328 ? 0.9889 0.9680 0.8998 -0.0322 0.2808  -0.2022 700  ALA B N   
3800 C  CA  . ALA B 328 ? 1.0337 1.0262 0.9273 -0.0508 0.3131  -0.2312 700  ALA B CA  
3801 C  C   . ALA B 328 ? 1.0795 1.0403 0.9963 -0.0494 0.3489  -0.2681 700  ALA B C   
3802 O  O   . ALA B 328 ? 1.1242 1.0904 1.0231 -0.0683 0.3810  -0.3005 700  ALA B O   
3803 C  CB  . ALA B 328 ? 1.0190 1.0379 0.9364 -0.0414 0.3193  -0.2189 700  ALA B CB  
3804 N  N   . GLU B 329 ? 1.0713 0.9993 1.0291 -0.0277 0.3441  -0.2627 701  GLU B N   
3805 C  CA  . GLU B 329 ? 1.1152 1.0069 1.1061 -0.0226 0.3762  -0.2932 701  GLU B CA  
3806 C  C   . GLU B 329 ? 1.1247 1.0140 1.1812 0.0005  0.4035  -0.2972 701  GLU B C   
3807 O  O   . GLU B 329 ? 1.0951 0.9788 1.2063 0.0291  0.3903  -0.2698 701  GLU B O   
3808 C  CB  . GLU B 329 ? 1.1736 1.0588 1.1155 -0.0565 0.4023  -0.3357 701  GLU B CB  
3809 C  CG  . GLU B 329 ? 1.1825 1.0408 1.1011 -0.0685 0.3918  -0.3439 701  GLU B CG  
3810 C  CD  . GLU B 329 ? 1.1477 1.0287 1.0168 -0.0816 0.3508  -0.3165 701  GLU B CD  
3811 O  OE1 . GLU B 329 ? 1.1029 0.9754 0.9917 -0.0624 0.3221  -0.2859 701  GLU B OE1 
3812 O  OE2 . GLU B 329 ? 1.1625 1.0719 0.9749 -0.1115 0.3479  -0.3244 701  GLU B OE2 
3813 ZN ZN  . ZN  C .   ? 0.6127 0.3773 0.4728 -0.0276 -0.0244 -0.0268 999  ZN  A ZN  
3814 S  S   . SO4 D .   ? 2.8046 0.6475 1.0162 0.5467  -0.6940 0.0021  1133 SO4 A S   
3815 O  O1  . SO4 D .   ? 2.8763 0.6711 1.0756 0.5987  -0.7638 -0.0059 1133 SO4 A O1  
3816 O  O2  . SO4 D .   ? 2.6793 0.6258 1.0135 0.5296  -0.6651 -0.0225 1133 SO4 A O2  
3817 O  O3  . SO4 D .   ? 2.9253 0.6455 1.0195 0.5220  -0.6623 0.0352  1133 SO4 A O3  
3818 O  O4  . SO4 D .   ? 2.7424 0.6515 0.9602 0.5365  -0.6847 0.0004  1133 SO4 A O4  
3819 S  S   . SO4 E .   ? 1.7464 1.1719 0.9247 0.1227  -0.0371 -0.1156 1135 SO4 A S   
3820 O  O1  . SO4 E .   ? 1.7305 1.1758 0.9381 0.1504  -0.0766 -0.1260 1135 SO4 A O1  
3821 O  O2  . SO4 E .   ? 1.6747 1.1633 0.9343 0.1133  -0.0121 -0.1072 1135 SO4 A O2  
3822 O  O3  . SO4 E .   ? 1.8171 1.1687 0.9022 0.1184  -0.0426 -0.1057 1135 SO4 A O3  
3823 O  O4  . SO4 E .   ? 1.7715 1.1893 0.9358 0.1086  -0.0160 -0.1253 1135 SO4 A O4  
3824 ZN ZN  . ZN  F .   ? 0.4806 0.4451 0.5009 -0.0185 0.0024  -0.0056 999  ZN  B ZN  
3830 O  O   . HOH H .   ? 0.3614 0.2772 0.2447 -0.0276 -0.0631 0.0017  1000 HOH A O   
3831 O  O   . HOH H .   ? 0.4709 0.3875 0.3375 -0.0420 0.0203  -0.0773 1002 HOH A O   
3832 O  O   . HOH H .   ? 0.4888 0.3907 0.4335 -0.0009 0.0298  -0.0634 1004 HOH A O   
3833 O  O   . HOH H .   ? 0.7401 0.5892 0.6190 -0.0232 -0.0480 0.0116  1005 HOH A O   
3834 O  O   . HOH H .   ? 0.7147 0.3983 0.2221 -0.0381 0.0100  -0.0108 1007 HOH A O   
3835 O  O   . HOH H .   ? 0.6050 0.4009 0.2343 -0.0054 0.0417  -0.0277 1008 HOH A O   
3836 O  O   . HOH H .   ? 0.4185 0.3250 0.2731 -0.0613 0.0180  -0.0884 1009 HOH A O   
3837 O  O   . HOH H .   ? 0.5450 0.5196 0.5049 -0.1530 -0.0190 -0.0080 1010 HOH A O   
3838 O  O   . HOH H .   ? 0.6378 0.3798 0.2288 -0.0451 -0.0319 -0.0083 1013 HOH A O   
3839 O  O   . HOH H .   ? 0.5464 0.5278 0.4671 -0.0780 0.0309  -0.0001 1014 HOH A O   
3840 O  O   . HOH H .   ? 0.3856 0.3634 0.1862 0.0036  0.0472  -0.0217 1015 HOH A O   
3841 O  O   . HOH H .   ? 0.4411 0.3248 0.3215 -0.0269 -0.0700 0.0134  1017 HOH A O   
3842 O  O   . HOH H .   ? 0.5703 0.3645 0.2357 -0.0331 -0.0058 -0.0049 1019 HOH A O   
3843 O  O   . HOH H .   ? 0.5077 0.5054 0.3322 -0.0136 0.0237  -0.0437 1022 HOH A O   
3844 O  O   . HOH H .   ? 0.5061 0.5216 0.3506 0.0106  0.0660  0.0013  1024 HOH A O   
3845 O  O   . HOH H .   ? 0.5810 0.4575 0.2924 0.0141  0.0720  -0.0184 1028 HOH A O   
3846 O  O   . HOH H .   ? 0.6990 0.3250 0.1363 -0.0350 0.0278  -0.0221 1029 HOH A O   
3847 O  O   . HOH H .   ? 0.5903 0.4447 0.3036 -0.0176 0.0280  -0.0183 1030 HOH A O   
3848 O  O   . HOH H .   ? 0.4704 0.4202 0.3198 -0.0965 -0.0041 -0.0776 1032 HOH A O   
3849 O  O   . HOH H .   ? 0.7391 0.6921 0.6339 -0.0103 0.0021  -0.0458 1034 HOH A O   
3850 O  O   . HOH H .   ? 0.7433 0.4787 0.3100 0.0104  0.0946  -0.0206 1037 HOH A O   
3851 O  O   . HOH H .   ? 0.7648 0.6443 0.6308 -0.0276 0.0515  -0.1106 1039 HOH A O   
3852 O  O   . HOH H .   ? 0.6132 0.5632 0.6024 -0.0088 -0.0473 0.0078  1041 HOH A O   
3853 O  O   . HOH H .   ? 0.5720 0.4633 0.3115 -0.0210 -0.0068 -0.0288 1043 HOH A O   
3854 O  O   . HOH H .   ? 0.4467 0.4241 0.2844 -0.0572 0.0130  -0.0798 1044 HOH A O   
3855 O  O   . HOH H .   ? 0.4890 0.4264 0.3944 -0.0096 0.0093  -0.0521 1045 HOH A O   
3856 O  O   . HOH H .   ? 0.7776 0.5501 0.4423 -0.0519 -0.0690 0.0110  1046 HOH A O   
3857 O  O   . HOH H .   ? 0.7395 0.4650 0.3302 -0.0756 -0.0983 0.0013  1048 HOH A O   
3858 O  O   . HOH H .   ? 0.7968 0.6659 0.5151 0.0262  0.1222  0.0029  1050 HOH A O   
3859 O  O   . HOH H .   ? 0.5642 0.4447 0.3768 -0.0635 -0.1067 0.0147  1053 HOH A O   
3860 O  O   . HOH H .   ? 0.6708 0.5233 0.4521 -0.0342 0.0127  -0.0053 1054 HOH A O   
3861 O  O   . HOH H .   ? 0.6656 0.5014 0.4103 -0.0323 0.0113  -0.0023 1056 HOH A O   
3862 O  O   . HOH H .   ? 0.6665 0.5299 0.5483 -0.0598 0.0139  -0.0366 1057 HOH A O   
3863 O  O   . HOH H .   ? 0.6282 0.5350 0.4589 -0.0479 0.0366  -0.1119 1058 HOH A O   
3864 O  O   . HOH H .   ? 0.3969 0.3757 0.2464 -0.0399 0.0175  -0.0668 1059 HOH A O   
3865 O  O   . HOH H .   ? 0.5182 0.4574 0.4087 -0.0147 0.0233  -0.0701 1060 HOH A O   
3866 O  O   . HOH H .   ? 0.4260 0.4065 0.2516 -0.0127 0.0135  -0.0465 1061 HOH A O   
3867 O  O   . HOH H .   ? 0.6184 0.5968 0.4368 -0.0043 0.0547  -0.0159 1063 HOH A O   
3868 O  O   . HOH H .   ? 0.6716 0.4386 0.2838 -0.0367 -0.0196 -0.0267 1065 HOH A O   
3869 O  O   . HOH H .   ? 0.7545 0.5759 0.5247 -0.0367 -0.0103 0.0063  1066 HOH A O   
3870 O  O   . HOH H .   ? 0.8211 0.7110 0.7950 -0.0518 -0.1704 0.0943  1070 HOH A O   
3871 O  O   . HOH H .   ? 0.6881 0.6896 0.6540 -0.0993 0.0319  0.0237  1072 HOH A O   
3872 O  O   . HOH H .   ? 0.6834 0.6664 0.7296 -0.0461 -0.1239 0.0660  1073 HOH A O   
3873 O  O   . HOH H .   ? 0.4203 0.3414 0.2756 -0.0502 0.0209  -0.0868 1074 HOH A O   
3874 O  O   . HOH H .   ? 0.6970 0.5478 0.5814 -0.0247 -0.0655 0.0230  1075 HOH A O   
3875 O  O   . HOH H .   ? 0.3703 0.3451 0.1676 -0.0015 0.0364  -0.0295 1077 HOH A O   
3876 O  O   . HOH H .   ? 0.5655 0.3302 0.1873 -0.0458 -0.0425 -0.0098 1078 HOH A O   
3877 O  O   . HOH H .   ? 0.6356 0.5794 0.4628 -0.1144 -0.0147 -0.0874 1080 HOH A O   
3878 O  O   . HOH H .   ? 0.5398 0.5384 0.3814 -0.0254 0.0227  -0.0463 1083 HOH A O   
3879 O  O   . HOH H .   ? 0.5444 0.5024 0.3990 -0.0178 0.0119  -0.0549 1085 HOH A O   
3880 O  O   . HOH H .   ? 0.7068 0.5640 0.6220 -0.0099 0.0551  -0.0963 1086 HOH A O   
3881 O  O   . HOH H .   ? 0.7304 0.7293 0.5849 -0.0147 0.0240  -0.0638 1092 HOH A O   
3882 O  O   . HOH H .   ? 0.4895 0.5175 0.3509 0.0047  0.0649  0.0044  1094 HOH A O   
3883 O  O   . HOH H .   ? 0.6212 0.5710 0.4954 -0.0180 0.0179  -0.0652 1097 HOH A O   
3884 O  O   . HOH H .   ? 0.6265 0.4356 0.3088 -0.0283 0.0199  -0.0034 1099 HOH A O   
3885 O  O   . HOH H .   ? 0.5580 0.6308 0.6343 -0.1784 -0.0220 0.0608  1100 HOH A O   
3886 O  O   . HOH H .   ? 0.6575 0.4468 0.3611 -0.0569 -0.0950 0.0200  1102 HOH A O   
3887 O  O   . HOH H .   ? 0.7692 0.6289 0.5631 -0.0818 0.0271  -0.1297 1103 HOH A O   
3888 O  O   . HOH H .   ? 0.8147 0.6319 0.5054 -0.0552 -0.0551 -0.0156 1105 HOH A O   
3889 O  O   . HOH H .   ? 0.7174 0.7189 0.6650 -0.0854 0.0356  0.0165  1107 HOH A O   
3890 O  O   . HOH H .   ? 0.6908 0.4568 0.3247 -0.0480 -0.0503 -0.0020 1112 HOH A O   
3891 O  O   . HOH H .   ? 0.5467 0.4613 0.3918 -0.0191 -0.0109 -0.0320 1113 HOH A O   
3892 O  O   . HOH H .   ? 0.9599 0.6310 0.4476 -0.0207 0.0659  -0.0084 1117 HOH A O   
3893 O  O   . HOH H .   ? 0.6071 0.5804 0.4384 0.0144  0.1045  0.0161  1118 HOH A O   
3894 O  O   . HOH H .   ? 0.9436 0.6192 0.4389 -0.0314 0.0359  -0.0075 1119 HOH A O   
3895 O  O   . HOH H .   ? 0.7335 0.5475 0.5081 -0.0494 -0.1009 0.0327  1120 HOH A O   
3896 O  O   . HOH H .   ? 0.5576 0.4251 0.4258 -0.0274 -0.0677 0.0153  1121 HOH A O   
3897 O  O   . HOH H .   ? 0.7841 0.7008 0.6232 -0.0431 0.0418  -0.0060 1123 HOH A O   
3898 O  O   . HOH H .   ? 0.7198 0.5919 0.7084 -0.0016 -0.0388 0.0136  1124 HOH A O   
3899 O  O   . HOH H .   ? 1.0069 0.6239 0.4617 -0.0859 -0.0805 -0.0168 1125 HOH A O   
3900 O  O   . HOH H .   ? 0.5717 0.4743 0.3783 -0.1070 -0.0018 -0.1075 1126 HOH A O   
3901 O  O   . HOH H .   ? 0.8287 0.6432 0.5108 0.0475  0.1962  0.0260  1128 HOH A O   
3902 O  O   . HOH H .   ? 0.7459 0.4022 0.4346 -0.2007 -0.0180 -0.1743 1130 HOH A O   
3903 O  O   . HOH H .   ? 0.6232 0.6272 0.4622 -0.0126 0.0416  -0.0221 1131 HOH A O   
3904 O  O   . HOH I .   ? 0.4323 0.4856 0.2675 -0.0211 0.0202  -0.0351 1001 HOH B O   
3905 O  O   . HOH I .   ? 0.5214 0.5264 0.3252 0.0101  0.0400  -0.0065 1003 HOH B O   
3906 O  O   . HOH I .   ? 0.4500 0.3981 0.2236 0.0173  0.0614  -0.0136 1006 HOH B O   
3907 O  O   . HOH I .   ? 0.4907 0.5437 0.3073 0.0113  0.0298  0.0862  1011 HOH B O   
3908 O  O   . HOH I .   ? 0.4079 0.5010 0.1934 -0.0173 0.0179  0.0475  1012 HOH B O   
3909 O  O   . HOH I .   ? 0.4872 0.5346 0.3039 -0.0237 0.0234  -0.0507 1016 HOH B O   
3910 O  O   . HOH I .   ? 0.5172 0.4671 0.2990 0.0326  0.0706  0.0055  1018 HOH B O   
3911 O  O   . HOH I .   ? 0.5310 0.6242 0.2949 -0.0253 0.0206  0.0578  1020 HOH B O   
3912 O  O   . HOH I .   ? 0.4282 0.4863 0.2042 -0.0253 0.0404  0.0741  1021 HOH B O   
3913 O  O   . HOH I .   ? 0.4118 0.4583 0.2119 0.0008  0.0299  0.0939  1023 HOH B O   
3914 O  O   . HOH I .   ? 0.5776 0.6785 0.3519 -0.0390 0.0054  -0.0045 1025 HOH B O   
3915 O  O   . HOH I .   ? 0.7098 0.7907 0.4944 -0.0195 0.0267  0.0188  1026 HOH B O   
3916 O  O   . HOH I .   ? 0.5908 0.6297 0.4207 -0.0256 0.0365  0.0128  1027 HOH B O   
3917 O  O   . HOH I .   ? 0.5649 0.5405 0.3781 -0.0325 0.0224  0.0337  1031 HOH B O   
3918 O  O   . HOH I .   ? 0.4106 0.5637 0.4054 0.0478  0.0573  0.1133  1033 HOH B O   
3919 O  O   . HOH I .   ? 0.5982 0.6553 0.4076 -0.0173 0.0353  -0.0188 1035 HOH B O   
3920 O  O   . HOH I .   ? 0.5125 0.5679 0.3299 0.0117  0.0228  0.1426  1036 HOH B O   
3921 O  O   . HOH I .   ? 0.4481 0.5709 0.3534 0.0314  0.0236  0.1119  1038 HOH B O   
3922 O  O   . HOH I .   ? 0.3965 0.4641 0.2009 0.0007  0.0239  0.0906  1040 HOH B O   
3923 O  O   . HOH I .   ? 0.5336 0.6370 0.4666 0.0575  0.0356  0.1604  1042 HOH B O   
3924 O  O   . HOH I .   ? 0.7038 0.7831 0.5072 -0.0474 0.0022  -0.0387 1047 HOH B O   
3925 O  O   . HOH I .   ? 0.6347 0.7171 0.4051 -0.0171 0.0140  0.1355  1049 HOH B O   
3926 O  O   . HOH I .   ? 0.4908 0.6160 0.4098 -0.0514 -0.0019 0.0101  1051 HOH B O   
3927 O  O   . HOH I .   ? 0.7302 0.5865 0.4650 -0.0003 0.0392  0.0279  1052 HOH B O   
3928 O  O   . HOH I .   ? 0.6500 0.5663 0.4012 0.0234  0.0593  -0.0033 1055 HOH B O   
3929 O  O   . HOH I .   ? 0.4359 0.4924 0.2240 -0.0272 0.0462  -0.0509 1062 HOH B O   
3930 O  O   . HOH I .   ? 0.4738 0.5829 0.2655 -0.0392 -0.0016 -0.0006 1064 HOH B O   
3931 O  O   . HOH I .   ? 0.7399 0.6964 0.5384 0.0110  0.0449  0.1189  1067 HOH B O   
3932 O  O   . HOH I .   ? 0.8067 0.7486 0.6073 0.0139  0.0469  0.1383  1068 HOH B O   
3933 O  O   . HOH I .   ? 0.4350 0.5289 0.3172 -0.0280 0.0161  -0.0048 1069 HOH B O   
3934 O  O   . HOH I .   ? 0.4586 0.6578 0.4224 -0.0913 -0.0567 0.0538  1071 HOH B O   
3935 O  O   . HOH I .   ? 0.7768 0.8989 0.5933 -0.0159 0.0013  0.0542  1076 HOH B O   
3936 O  O   . HOH I .   ? 0.6039 0.5125 0.3443 0.0197  0.0669  -0.0154 1079 HOH B O   
3937 O  O   . HOH I .   ? 0.4855 0.4829 0.3094 0.0278  0.0733  0.0077  1081 HOH B O   
3938 O  O   . HOH I .   ? 0.5636 0.5389 0.4002 0.0605  0.1117  0.0374  1082 HOH B O   
3939 O  O   . HOH I .   ? 0.6168 0.6772 0.4222 -0.0180 0.0315  -0.0269 1084 HOH B O   
3940 O  O   . HOH I .   ? 0.5605 0.6775 0.4020 -0.0029 0.0094  0.0571  1087 HOH B O   
3941 O  O   . HOH I .   ? 0.7708 0.7514 0.6064 -0.0446 0.0156  0.0365  1088 HOH B O   
3942 O  O   . HOH I .   ? 0.5250 0.6051 0.3056 -0.0394 0.0131  -0.0334 1089 HOH B O   
3943 O  O   . HOH I .   ? 0.6174 0.6599 0.5201 0.0563  0.1056  0.0568  1090 HOH B O   
3944 O  O   . HOH I .   ? 0.4472 0.4591 0.3167 0.0534  0.1096  0.0418  1091 HOH B O   
3945 O  O   . HOH I .   ? 0.6319 0.6923 0.4786 -0.0268 0.0175  -0.0314 1093 HOH B O   
3946 O  O   . HOH I .   ? 0.4953 0.5685 0.3696 0.0345  0.0469  0.0644  1095 HOH B O   
3947 O  O   . HOH I .   ? 0.7313 0.6104 0.4928 0.0151  0.0523  0.0602  1096 HOH B O   
3948 O  O   . HOH I .   ? 0.6849 0.7679 0.5759 -0.0318 0.0204  -0.0068 1098 HOH B O   
3949 O  O   . HOH I .   ? 0.7611 0.6771 0.5177 0.0345  0.0902  -0.0021 1101 HOH B O   
3950 O  O   . HOH I .   ? 0.5089 0.4808 0.3146 0.0302  0.0827  0.0046  1104 HOH B O   
3951 O  O   . HOH I .   ? 0.5200 0.5406 0.3545 -0.0127 0.0229  -0.0440 1106 HOH B O   
3952 O  O   . HOH I .   ? 0.4811 0.5513 0.2750 -0.0215 0.0308  -0.0201 1108 HOH B O   
3953 O  O   . HOH I .   ? 0.6261 0.7134 0.5550 0.0228  0.0771  0.0458  1109 HOH B O   
3954 O  O   . HOH I .   ? 0.5990 0.6795 0.3493 -0.0394 0.0652  0.0384  1110 HOH B O   
3955 O  O   . HOH I .   ? 0.6035 0.7376 0.4511 0.0022  -0.0056 0.1272  1111 HOH B O   
3956 O  O   . HOH I .   ? 0.6387 0.5320 0.3815 0.0287  0.0652  0.0069  1114 HOH B O   
3957 O  O   . HOH I .   ? 0.8567 0.7936 0.6693 -0.0488 0.0095  0.0441  1115 HOH B O   
3958 O  O   . HOH I .   ? 0.6097 0.7364 0.4807 0.0142  0.0079  0.1106  1116 HOH B O   
3959 O  O   . HOH I .   ? 0.8103 0.7265 0.6571 0.1012  0.1362  0.0856  1122 HOH B O   
3960 O  O   . HOH I .   ? 0.6581 0.7594 0.6744 0.1013  0.0922  0.1692  1127 HOH B O   
3961 O  O   . HOH I .   ? 0.4423 0.6676 0.4963 -0.0078 0.0169  0.1102  1129 HOH B O   
3962 O  O   . HOH I .   ? 0.6177 0.7353 0.4711 0.0131  0.0004  0.1532  1132 HOH B O   
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   373 ?   ?   ?   A . n 
A 1 2   PRO 2   374 ?   ?   ?   A . n 
A 1 3   LEU 3   375 ?   ?   ?   A . n 
A 1 4   GLY 4   376 ?   ?   ?   A . n 
A 1 5   SER 5   377 ?   ?   ?   A . n 
A 1 6   GLY 6   378 ?   ?   ?   A . n 
A 1 7   SER 7   379 ?   ?   ?   A . n 
A 1 8   GLY 8   380 ?   ?   ?   A . n 
A 1 9   HIS 9   381 ?   ?   ?   A . n 
A 1 10  LEU 10  382 ?   ?   ?   A . n 
A 1 11  ALA 11  383 ?   ?   ?   A . n 
A 1 12  ILE 12  384 ?   ?   ?   A . n 
A 1 13  GLY 13  385 ?   ?   ?   A . n 
A 1 14  SER 14  386 ?   ?   ?   A . n 
A 1 15  ALA 15  387 ?   ?   ?   A . n 
A 1 16  ALA 16  388 ?   ?   ?   A . n 
A 1 17  THR 17  389 ?   ?   ?   A . n 
A 1 18  LEU 18  390 ?   ?   ?   A . n 
A 1 19  GLY 19  391 ?   ?   ?   A . n 
A 1 20  SER 20  392 ?   ?   ?   A . n 
A 1 21  GLY 21  393 ?   ?   ?   A . n 
A 1 22  GLY 22  394 ?   ?   ?   A . n 
A 1 23  MET 23  395 ?   ?   ?   A . n 
A 1 24  ALA 24  396 ?   ?   ?   A . n 
A 1 25  ARG 25  397 ?   ?   ?   A . n 
A 1 26  GLY 26  398 ?   ?   ?   A . n 
A 1 27  ARG 27  399 ?   ?   ?   A . n 
A 1 28  GLU 28  400 ?   ?   ?   A . n 
A 1 29  PRO 29  401 ?   ?   ?   A . n 
A 1 30  GLY 30  402 ?   ?   ?   A . n 
A 1 31  GLY 31  403 ?   ?   ?   A . n 
A 1 32  VAL 32  404 404 VAL VAL A . n 
A 1 33  GLY 33  405 405 GLY GLY A . n 
A 1 34  HIS 34  406 406 HIS HIS A . n 
A 1 35  VAL 35  407 407 VAL VAL A . n 
A 1 36  VAL 36  408 408 VAL VAL A . n 
A 1 37  ALA 37  409 409 ALA ALA A . n 
A 1 38  GLN 38  410 410 GLN GLN A . n 
A 1 39  VAL 39  411 411 VAL VAL A . n 
A 1 40  GLN 40  412 412 GLN GLN A . n 
A 1 41  SER 41  413 413 SER SER A . n 
A 1 42  VAL 42  414 414 VAL VAL A . n 
A 1 43  ASP 43  415 415 ASP ASP A . n 
A 1 44  GLY 44  416 416 GLY GLY A . n 
A 1 45  ASN 45  417 417 ASN ASN A . n 
A 1 46  ALA 46  418 418 ALA ALA A . n 
A 1 47  GLN 47  419 419 GLN GLN A . n 
A 1 48  CYS 48  420 420 CYS CYS A . n 
A 1 49  CYS 49  421 421 CYS CYS A . n 
A 1 50  ASP 50  422 422 ASP ASP A . n 
A 1 51  CYS 51  423 423 CYS CYS A . n 
A 1 52  ARG 52  424 424 ARG ARG A . n 
A 1 53  GLU 53  425 425 GLU GLU A . n 
A 1 54  PRO 54  426 426 PRO PRO A . n 
A 1 55  ALA 55  427 427 ALA ALA A . n 
A 1 56  PRO 56  428 428 PRO PRO A . n 
A 1 57  GLU 57  429 429 GLU GLU A . n 
A 1 58  TRP 58  430 430 TRP TRP A . n 
A 1 59  ALA 59  431 431 ALA ALA A . n 
A 1 60  SER 60  432 432 SER SER A . n 
A 1 61  ILE 61  433 433 ILE ILE A . n 
A 1 62  ASN 62  434 434 ASN ASN A . n 
A 1 63  LEU 63  435 435 LEU LEU A . n 
A 1 64  GLY 64  436 436 GLY GLY A . n 
A 1 65  VAL 65  437 437 VAL VAL A . n 
A 1 66  THR 66  438 438 THR THR A . n 
A 1 67  LEU 67  439 439 LEU LEU A . n 
A 1 68  CYS 68  440 440 CYS CYS A . n 
A 1 69  ILE 69  441 441 ILE ILE A . n 
A 1 70  GLN 70  442 442 GLN GLN A . n 
A 1 71  CYS 71  443 443 CYS CYS A . n 
A 1 72  SER 72  444 444 SER SER A . n 
A 1 73  GLY 73  445 445 GLY GLY A . n 
A 1 74  ILE 74  446 446 ILE ILE A . n 
A 1 75  HIS 75  447 447 HIS HIS A . n 
A 1 76  ARG 76  448 448 ARG ARG A . n 
A 1 77  SER 77  449 449 SER SER A . n 
A 1 78  LEU 78  450 450 LEU LEU A . n 
A 1 79  GLY 79  451 451 GLY GLY A . n 
A 1 80  VAL 80  452 452 VAL VAL A . n 
A 1 81  HIS 81  453 453 HIS HIS A . n 
A 1 82  PHE 82  454 454 PHE PHE A . n 
A 1 83  SER 83  455 455 SER SER A . n 
A 1 84  LYS 84  456 456 LYS LYS A . n 
A 1 85  VAL 85  457 457 VAL VAL A . n 
A 1 86  ARG 86  458 458 ARG ARG A . n 
A 1 87  SER 87  459 459 SER SER A . n 
A 1 88  LEU 88  460 460 LEU LEU A . n 
A 1 89  THR 89  461 461 THR THR A . n 
A 1 90  LEU 90  462 462 LEU LEU A . n 
A 1 91  ASP 91  463 463 ASP ASP A . n 
A 1 92  SER 92  464 464 SER SER A . n 
A 1 93  TRP 93  465 465 TRP TRP A . n 
A 1 94  GLU 94  466 466 GLU GLU A . n 
A 1 95  PRO 95  467 467 PRO PRO A . n 
A 1 96  GLU 96  468 468 GLU GLU A . n 
A 1 97  LEU 97  469 469 LEU LEU A . n 
A 1 98  VAL 98  470 470 VAL VAL A . n 
A 1 99  LYS 99  471 471 LYS LYS A . n 
A 1 100 LEU 100 472 472 LEU LEU A . n 
A 1 101 MET 101 473 473 MET MET A . n 
A 1 102 CYS 102 474 474 CYS CYS A . n 
A 1 103 GLU 103 475 475 GLU GLU A . n 
A 1 104 LEU 104 476 476 LEU LEU A . n 
A 1 105 GLY 105 477 477 GLY GLY A . n 
A 1 106 ASN 106 478 478 ASN ASN A . n 
A 1 107 VAL 107 479 479 VAL VAL A . n 
A 1 108 ILE 108 480 480 ILE ILE A . n 
A 1 109 ILE 109 481 481 ILE ILE A . n 
A 1 110 ASN 110 482 482 ASN ASN A . n 
A 1 111 GLN 111 483 483 GLN GLN A . n 
A 1 112 ILE 112 484 484 ILE ILE A . n 
A 1 113 TYR 113 485 485 TYR TYR A . n 
A 1 114 GLU 114 486 486 GLU GLU A . n 
A 1 115 ALA 115 487 487 ALA ALA A . n 
A 1 116 ARG 116 488 488 ARG ARG A . n 
A 1 117 VAL 117 489 489 VAL VAL A . n 
A 1 118 GLU 118 490 490 GLU GLU A . n 
A 1 119 ALA 119 491 491 ALA ALA A . n 
A 1 120 MET 120 492 492 MET MET A . n 
A 1 121 ALA 121 493 493 ALA ALA A . n 
A 1 122 VAL 122 494 494 VAL VAL A . n 
A 1 123 LYS 123 495 495 LYS LYS A . n 
A 1 124 LYS 124 496 496 LYS LYS A . n 
A 1 125 PRO 125 497 497 PRO PRO A . n 
A 1 126 GLY 126 498 498 GLY GLY A . n 
A 1 127 PRO 127 499 499 PRO PRO A . n 
A 1 128 SER 128 500 500 SER SER A . n 
A 1 129 CYS 129 501 501 CYS CYS A . n 
A 1 130 SER 130 502 502 SER SER A . n 
A 1 131 ARG 131 503 503 ARG ARG A . n 
A 1 132 GLN 132 504 504 GLN GLN A . n 
A 1 133 GLU 133 505 505 GLU GLU A . n 
A 1 134 LYS 134 506 506 LYS LYS A . n 
A 1 135 GLU 135 507 507 GLU GLU A . n 
A 1 136 ALA 136 508 508 ALA ALA A . n 
A 1 137 TRP 137 509 509 TRP TRP A . n 
A 1 138 ILE 138 510 510 ILE ILE A . n 
A 1 139 HIS 139 511 511 HIS HIS A . n 
A 1 140 ALA 140 512 512 ALA ALA A . n 
A 1 141 LYS 141 513 513 LYS LYS A . n 
A 1 142 TYR 142 514 514 TYR TYR A . n 
A 1 143 VAL 143 515 515 VAL VAL A . n 
A 1 144 GLU 144 516 516 GLU GLU A . n 
A 1 145 LYS 145 517 517 LYS LYS A . n 
A 1 146 LYS 146 518 518 LYS LYS A . n 
A 1 147 PHE 147 519 519 PHE PHE A . n 
A 1 148 LEU 148 520 520 LEU LEU A . n 
A 1 149 THR 149 521 521 THR THR A . n 
A 1 150 LYS 150 522 522 LYS LYS A . n 
A 1 151 LEU 151 523 523 LEU LEU A . n 
A 1 152 PRO 152 524 524 PRO PRO A . n 
A 1 153 GLU 153 525 ?   ?   ?   A . n 
A 1 154 ILE 154 526 ?   ?   ?   A . n 
A 1 155 ARG 155 527 ?   ?   ?   A . n 
A 1 156 GLY 156 528 ?   ?   ?   A . n 
A 1 157 ARG 157 529 ?   ?   ?   A . n 
A 1 158 ARG 158 530 ?   ?   ?   A . n 
A 1 159 GLY 159 531 ?   ?   ?   A . n 
A 1 160 GLY 160 532 ?   ?   ?   A . n 
A 1 161 ARG 161 533 ?   ?   ?   A . n 
A 1 162 GLY 162 534 ?   ?   ?   A . n 
A 1 163 ARG 163 535 ?   ?   ?   A . n 
A 1 164 PRO 164 536 ?   ?   ?   A . n 
A 1 165 ARG 165 537 ?   ?   ?   A . n 
A 1 166 GLY 166 538 ?   ?   ?   A . n 
A 1 167 GLN 167 539 ?   ?   ?   A . n 
A 1 168 PRO 168 540 ?   ?   ?   A . n 
A 1 169 PRO 169 541 ?   ?   ?   A . n 
A 1 170 VAL 170 542 ?   ?   ?   A . n 
A 1 171 PRO 171 543 ?   ?   ?   A . n 
A 1 172 PRO 172 544 ?   ?   ?   A . n 
A 1 173 LYS 173 545 ?   ?   ?   A . n 
A 1 174 PRO 174 546 ?   ?   ?   A . n 
A 1 175 SER 175 547 ?   ?   ?   A . n 
A 1 176 ILE 176 548 ?   ?   ?   A . n 
A 1 177 ARG 177 549 ?   ?   ?   A . n 
A 1 178 PRO 178 550 ?   ?   ?   A . n 
A 1 179 ARG 179 551 ?   ?   ?   A . n 
A 1 180 PRO 180 552 ?   ?   ?   A . n 
A 1 181 GLY 181 553 ?   ?   ?   A . n 
A 1 182 SER 182 554 ?   ?   ?   A . n 
A 1 183 LEU 183 555 ?   ?   ?   A . n 
A 1 184 ARG 184 556 ?   ?   ?   A . n 
A 1 185 SER 185 557 ?   ?   ?   A . n 
A 1 186 LYS 186 558 ?   ?   ?   A . n 
A 1 187 PRO 187 559 ?   ?   ?   A . n 
A 1 188 GLU 188 560 ?   ?   ?   A . n 
A 1 189 PRO 189 561 ?   ?   ?   A . n 
A 1 190 PRO 190 562 ?   ?   ?   A . n 
A 1 191 SER 191 563 ?   ?   ?   A . n 
A 1 192 GLU 192 564 ?   ?   ?   A . n 
A 1 193 ASP 193 565 ?   ?   ?   A . n 
A 1 194 LEU 194 566 ?   ?   ?   A . n 
A 1 195 GLY 195 567 ?   ?   ?   A . n 
A 1 196 SER 196 568 ?   ?   ?   A . n 
A 1 197 LEU 197 569 569 LEU LEU A . n 
A 1 198 HIS 198 570 570 HIS HIS A . n 
A 1 199 PRO 199 571 571 PRO PRO A . n 
A 1 200 GLY 200 572 572 GLY GLY A . n 
A 1 201 ALA 201 573 573 ALA ALA A . n 
A 1 202 LEU 202 574 574 LEU LEU A . n 
A 1 203 LEU 203 575 575 LEU LEU A . n 
A 1 204 PHE 204 576 576 PHE PHE A . n 
A 1 205 ARG 205 577 577 ARG ARG A . n 
A 1 206 ALA 206 578 578 ALA ALA A . n 
A 1 207 SER 207 579 579 SER SER A . n 
A 1 208 GLY 208 580 580 GLY GLY A . n 
A 1 209 HIS 209 581 581 HIS HIS A . n 
A 1 210 PRO 210 582 582 PRO PRO A . n 
A 1 211 PRO 211 583 583 PRO PRO A . n 
A 1 212 SER 212 584 584 SER SER A . n 
A 1 213 LEU 213 585 585 LEU LEU A . n 
A 1 214 PRO 214 586 586 PRO PRO A . n 
A 1 215 THR 215 587 587 THR THR A . n 
A 1 216 MET 216 588 588 MET MET A . n 
A 1 217 ALA 217 589 589 ALA ALA A . n 
A 1 218 ASP 218 590 590 ASP ASP A . n 
A 1 219 ALA 219 591 591 ALA ALA A . n 
A 1 220 LEU 220 592 592 LEU LEU A . n 
A 1 221 ALA 221 593 593 ALA ALA A . n 
A 1 222 HIS 222 594 594 HIS HIS A . n 
A 1 223 GLY 223 595 595 GLY GLY A . n 
A 1 224 ALA 224 596 596 ALA ALA A . n 
A 1 225 ASP 225 597 597 ASP ASP A . n 
A 1 226 VAL 226 598 598 VAL VAL A . n 
A 1 227 ASN 227 599 599 ASN ASN A . n 
A 1 228 TRP 228 600 600 TRP TRP A . n 
A 1 229 VAL 229 601 601 VAL VAL A . n 
A 1 230 ASN 230 602 602 ASN ASN A . n 
A 1 231 GLY 231 603 603 GLY GLY A . n 
A 1 232 GLY 232 604 604 GLY GLY A . n 
A 1 233 GLN 233 605 605 GLN GLN A . n 
A 1 234 ASP 234 606 606 ASP ASP A . n 
A 1 235 ASN 235 607 607 ASN ASN A . n 
A 1 236 ALA 236 608 608 ALA ALA A . n 
A 1 237 THR 237 609 609 THR THR A . n 
A 1 238 PRO 238 610 610 PRO PRO A . n 
A 1 239 LEU 239 611 611 LEU LEU A . n 
A 1 240 ILE 240 612 612 ILE ILE A . n 
A 1 241 GLN 241 613 613 GLN GLN A . n 
A 1 242 ALA 242 614 614 ALA ALA A . n 
A 1 243 THR 243 615 615 THR THR A . n 
A 1 244 ALA 244 616 616 ALA ALA A . n 
A 1 245 ALA 245 617 617 ALA ALA A . n 
A 1 246 ASN 246 618 618 ASN ASN A . n 
A 1 247 SER 247 619 619 SER SER A . n 
A 1 248 LEU 248 620 620 LEU LEU A . n 
A 1 249 LEU 249 621 621 LEU LEU A . n 
A 1 250 ALA 250 622 622 ALA ALA A . n 
A 1 251 CYS 251 623 623 CYS CYS A . n 
A 1 252 GLU 252 624 624 GLU GLU A . n 
A 1 253 PHE 253 625 625 PHE PHE A . n 
A 1 254 LEU 254 626 626 LEU LEU A . n 
A 1 255 LEU 255 627 627 LEU LEU A . n 
A 1 256 GLN 256 628 628 GLN GLN A . n 
A 1 257 ASN 257 629 629 ASN ASN A . n 
A 1 258 GLY 258 630 630 GLY GLY A . n 
A 1 259 ALA 259 631 631 ALA ALA A . n 
A 1 260 ASN 260 632 632 ASN ASN A . n 
A 1 261 VAL 261 633 633 VAL VAL A . n 
A 1 262 ASN 262 634 634 ASN ASN A . n 
A 1 263 GLN 263 635 635 GLN GLN A . n 
A 1 264 ALA 264 636 636 ALA ALA A . n 
A 1 265 ASP 265 637 637 ASP ASP A . n 
A 1 266 SER 266 638 638 SER SER A . n 
A 1 267 ALA 267 639 639 ALA ALA A . n 
A 1 268 GLY 268 640 640 GLY GLY A . n 
A 1 269 ARG 269 641 641 ARG ARG A . n 
A 1 270 GLY 270 642 642 GLY GLY A . n 
A 1 271 PRO 271 643 643 PRO PRO A . n 
A 1 272 LEU 272 644 644 LEU LEU A . n 
A 1 273 HIS 273 645 645 HIS HIS A . n 
A 1 274 HIS 274 646 646 HIS HIS A . n 
A 1 275 ALA 275 647 647 ALA ALA A . n 
A 1 276 THR 276 648 648 THR THR A . n 
A 1 277 ILE 277 649 649 ILE ILE A . n 
A 1 278 LEU 278 650 650 LEU LEU A . n 
A 1 279 GLY 279 651 651 GLY GLY A . n 
A 1 280 HIS 280 652 652 HIS HIS A . n 
A 1 281 THR 281 653 653 THR THR A . n 
A 1 282 GLY 282 654 654 GLY GLY A . n 
A 1 283 LEU 283 655 655 LEU LEU A . n 
A 1 284 ALA 284 656 656 ALA ALA A . n 
A 1 285 CYS 285 657 657 CYS CYS A . n 
A 1 286 LEU 286 658 658 LEU LEU A . n 
A 1 287 PHE 287 659 659 PHE PHE A . n 
A 1 288 LEU 288 660 660 LEU LEU A . n 
A 1 289 LYS 289 661 661 LYS LYS A . n 
A 1 290 ARG 290 662 662 ARG ARG A . n 
A 1 291 GLY 291 663 663 GLY GLY A . n 
A 1 292 ALA 292 664 664 ALA ALA A . n 
A 1 293 ASP 293 665 665 ASP ASP A . n 
A 1 294 LEU 294 666 666 LEU LEU A . n 
A 1 295 GLY 295 667 667 GLY GLY A . n 
A 1 296 ALA 296 668 668 ALA ALA A . n 
A 1 297 ARG 297 669 669 ARG ARG A . n 
A 1 298 ASP 298 670 670 ASP ASP A . n 
A 1 299 SER 299 671 671 SER SER A . n 
A 1 300 GLU 300 672 672 GLU GLU A . n 
A 1 301 GLY 301 673 673 GLY GLY A . n 
A 1 302 ARG 302 674 674 ARG ARG A . n 
A 1 303 ASP 303 675 675 ASP ASP A . n 
A 1 304 PRO 304 676 676 PRO PRO A . n 
A 1 305 LEU 305 677 677 LEU LEU A . n 
A 1 306 THR 306 678 678 THR THR A . n 
A 1 307 ILE 307 679 679 ILE ILE A . n 
A 1 308 ALA 308 680 680 ALA ALA A . n 
A 1 309 MET 309 681 681 MET MET A . n 
A 1 310 GLU 310 682 682 GLU GLU A . n 
A 1 311 THR 311 683 683 THR THR A . n 
A 1 312 ALA 312 684 684 ALA ALA A . n 
A 1 313 ASN 313 685 685 ASN ASN A . n 
A 1 314 ALA 314 686 686 ALA ALA A . n 
A 1 315 ASP 315 687 687 ASP ASP A . n 
A 1 316 ILE 316 688 688 ILE ILE A . n 
A 1 317 VAL 317 689 689 VAL VAL A . n 
A 1 318 THR 318 690 690 THR THR A . n 
A 1 319 LEU 319 691 691 LEU LEU A . n 
A 1 320 LEU 320 692 692 LEU LEU A . n 
A 1 321 ARG 321 693 693 ARG ARG A . n 
A 1 322 LEU 322 694 694 LEU LEU A . n 
A 1 323 ALA 323 695 695 ALA ALA A . n 
A 1 324 LYS 324 696 696 LYS LYS A . n 
A 1 325 MET 325 697 697 MET MET A . n 
A 1 326 ARG 326 698 ?   ?   ?   A . n 
A 1 327 GLU 327 699 ?   ?   ?   A . n 
A 1 328 ALA 328 700 ?   ?   ?   A . n 
A 1 329 GLU 329 701 ?   ?   ?   A . n 
A 1 330 ALA 330 702 ?   ?   ?   A . n 
A 1 331 ALA 331 703 ?   ?   ?   A . n 
A 1 332 GLN 332 704 ?   ?   ?   A . n 
A 1 333 GLY 333 705 ?   ?   ?   A . n 
A 1 334 GLN 334 706 ?   ?   ?   A . n 
A 1 335 ALA 335 707 ?   ?   ?   A . n 
A 1 336 GLY 336 708 ?   ?   ?   A . n 
A 1 337 ASP 337 709 ?   ?   ?   A . n 
A 1 338 GLU 338 710 ?   ?   ?   A . n 
A 1 339 THR 339 711 ?   ?   ?   A . n 
A 1 340 TYR 340 712 ?   ?   ?   A . n 
A 1 341 LEU 341 713 ?   ?   ?   A . n 
A 1 342 ASP 342 714 ?   ?   ?   A . n 
A 1 343 ILE 343 715 ?   ?   ?   A . n 
A 1 344 PHE 344 716 ?   ?   ?   A . n 
A 1 345 ARG 345 717 ?   ?   ?   A . n 
A 1 346 ASP 346 718 ?   ?   ?   A . n 
A 1 347 PHE 347 719 ?   ?   ?   A . n 
A 1 348 SER 348 720 ?   ?   ?   A . n 
A 1 349 LEU 349 721 ?   ?   ?   A . n 
A 1 350 MET 350 722 ?   ?   ?   A . n 
A 1 351 ALA 351 723 ?   ?   ?   A . n 
A 1 352 SER 352 724 ?   ?   ?   A . n 
A 1 353 ASP 353 725 ?   ?   ?   A . n 
A 1 354 ASP 354 726 ?   ?   ?   A . n 
A 1 355 PRO 355 727 ?   ?   ?   A . n 
A 1 356 GLU 356 728 ?   ?   ?   A . n 
A 1 357 LYS 357 729 ?   ?   ?   A . n 
A 1 358 LEU 358 730 ?   ?   ?   A . n 
A 1 359 SER 359 731 ?   ?   ?   A . n 
A 1 360 ARG 360 732 ?   ?   ?   A . n 
A 1 361 ARG 361 733 ?   ?   ?   A . n 
A 1 362 SER 362 734 ?   ?   ?   A . n 
A 1 363 HIS 363 735 ?   ?   ?   A . n 
A 1 364 ASP 364 736 ?   ?   ?   A . n 
A 1 365 LEU 365 737 ?   ?   ?   A . n 
A 1 366 HIS 366 738 ?   ?   ?   A . n 
A 1 367 THR 367 739 ?   ?   ?   A . n 
A 1 368 LEU 368 740 ?   ?   ?   A . n 
B 1 1   GLY 1   373 ?   ?   ?   B . n 
B 1 2   PRO 2   374 ?   ?   ?   B . n 
B 1 3   LEU 3   375 ?   ?   ?   B . n 
B 1 4   GLY 4   376 ?   ?   ?   B . n 
B 1 5   SER 5   377 ?   ?   ?   B . n 
B 1 6   GLY 6   378 ?   ?   ?   B . n 
B 1 7   SER 7   379 ?   ?   ?   B . n 
B 1 8   GLY 8   380 ?   ?   ?   B . n 
B 1 9   HIS 9   381 ?   ?   ?   B . n 
B 1 10  LEU 10  382 ?   ?   ?   B . n 
B 1 11  ALA 11  383 ?   ?   ?   B . n 
B 1 12  ILE 12  384 ?   ?   ?   B . n 
B 1 13  GLY 13  385 ?   ?   ?   B . n 
B 1 14  SER 14  386 ?   ?   ?   B . n 
B 1 15  ALA 15  387 ?   ?   ?   B . n 
B 1 16  ALA 16  388 ?   ?   ?   B . n 
B 1 17  THR 17  389 ?   ?   ?   B . n 
B 1 18  LEU 18  390 ?   ?   ?   B . n 
B 1 19  GLY 19  391 ?   ?   ?   B . n 
B 1 20  SER 20  392 ?   ?   ?   B . n 
B 1 21  GLY 21  393 ?   ?   ?   B . n 
B 1 22  GLY 22  394 ?   ?   ?   B . n 
B 1 23  MET 23  395 ?   ?   ?   B . n 
B 1 24  ALA 24  396 ?   ?   ?   B . n 
B 1 25  ARG 25  397 ?   ?   ?   B . n 
B 1 26  GLY 26  398 ?   ?   ?   B . n 
B 1 27  ARG 27  399 ?   ?   ?   B . n 
B 1 28  GLU 28  400 ?   ?   ?   B . n 
B 1 29  PRO 29  401 ?   ?   ?   B . n 
B 1 30  GLY 30  402 ?   ?   ?   B . n 
B 1 31  GLY 31  403 ?   ?   ?   B . n 
B 1 32  VAL 32  404 404 VAL VAL B . n 
B 1 33  GLY 33  405 405 GLY GLY B . n 
B 1 34  HIS 34  406 406 HIS HIS B . n 
B 1 35  VAL 35  407 407 VAL VAL B . n 
B 1 36  VAL 36  408 408 VAL VAL B . n 
B 1 37  ALA 37  409 409 ALA ALA B . n 
B 1 38  GLN 38  410 410 GLN GLN B . n 
B 1 39  VAL 39  411 411 VAL VAL B . n 
B 1 40  GLN 40  412 412 GLN GLN B . n 
B 1 41  SER 41  413 413 SER SER B . n 
B 1 42  VAL 42  414 414 VAL VAL B . n 
B 1 43  ASP 43  415 415 ASP ASP B . n 
B 1 44  GLY 44  416 416 GLY GLY B . n 
B 1 45  ASN 45  417 417 ASN ASN B . n 
B 1 46  ALA 46  418 418 ALA ALA B . n 
B 1 47  GLN 47  419 419 GLN GLN B . n 
B 1 48  CYS 48  420 420 CYS CYS B . n 
B 1 49  CYS 49  421 421 CYS CYS B . n 
B 1 50  ASP 50  422 422 ASP ASP B . n 
B 1 51  CYS 51  423 423 CYS CYS B . n 
B 1 52  ARG 52  424 424 ARG ARG B . n 
B 1 53  GLU 53  425 425 GLU GLU B . n 
B 1 54  PRO 54  426 426 PRO PRO B . n 
B 1 55  ALA 55  427 427 ALA ALA B . n 
B 1 56  PRO 56  428 428 PRO PRO B . n 
B 1 57  GLU 57  429 429 GLU GLU B . n 
B 1 58  TRP 58  430 430 TRP TRP B . n 
B 1 59  ALA 59  431 431 ALA ALA B . n 
B 1 60  SER 60  432 432 SER SER B . n 
B 1 61  ILE 61  433 433 ILE ILE B . n 
B 1 62  ASN 62  434 434 ASN ASN B . n 
B 1 63  LEU 63  435 435 LEU LEU B . n 
B 1 64  GLY 64  436 436 GLY GLY B . n 
B 1 65  VAL 65  437 437 VAL VAL B . n 
B 1 66  THR 66  438 438 THR THR B . n 
B 1 67  LEU 67  439 439 LEU LEU B . n 
B 1 68  CYS 68  440 440 CYS CYS B . n 
B 1 69  ILE 69  441 441 ILE ILE B . n 
B 1 70  GLN 70  442 442 GLN GLN B . n 
B 1 71  CYS 71  443 443 CYS CYS B . n 
B 1 72  SER 72  444 444 SER SER B . n 
B 1 73  GLY 73  445 445 GLY GLY B . n 
B 1 74  ILE 74  446 446 ILE ILE B . n 
B 1 75  HIS 75  447 447 HIS HIS B . n 
B 1 76  ARG 76  448 448 ARG ARG B . n 
B 1 77  SER 77  449 449 SER SER B . n 
B 1 78  LEU 78  450 450 LEU LEU B . n 
B 1 79  GLY 79  451 451 GLY GLY B . n 
B 1 80  VAL 80  452 452 VAL VAL B . n 
B 1 81  HIS 81  453 453 HIS HIS B . n 
B 1 82  PHE 82  454 454 PHE PHE B . n 
B 1 83  SER 83  455 455 SER SER B . n 
B 1 84  LYS 84  456 456 LYS LYS B . n 
B 1 85  VAL 85  457 457 VAL VAL B . n 
B 1 86  ARG 86  458 458 ARG ARG B . n 
B 1 87  SER 87  459 459 SER SER B . n 
B 1 88  LEU 88  460 460 LEU LEU B . n 
B 1 89  THR 89  461 461 THR THR B . n 
B 1 90  LEU 90  462 462 LEU LEU B . n 
B 1 91  ASP 91  463 463 ASP ASP B . n 
B 1 92  SER 92  464 464 SER SER B . n 
B 1 93  TRP 93  465 465 TRP TRP B . n 
B 1 94  GLU 94  466 466 GLU GLU B . n 
B 1 95  PRO 95  467 467 PRO PRO B . n 
B 1 96  GLU 96  468 468 GLU GLU B . n 
B 1 97  LEU 97  469 469 LEU LEU B . n 
B 1 98  VAL 98  470 470 VAL VAL B . n 
B 1 99  LYS 99  471 471 LYS LYS B . n 
B 1 100 LEU 100 472 472 LEU LEU B . n 
B 1 101 MET 101 473 473 MET MET B . n 
B 1 102 CYS 102 474 474 CYS CYS B . n 
B 1 103 GLU 103 475 475 GLU GLU B . n 
B 1 104 LEU 104 476 476 LEU LEU B . n 
B 1 105 GLY 105 477 477 GLY GLY B . n 
B 1 106 ASN 106 478 478 ASN ASN B . n 
B 1 107 VAL 107 479 479 VAL VAL B . n 
B 1 108 ILE 108 480 480 ILE ILE B . n 
B 1 109 ILE 109 481 481 ILE ILE B . n 
B 1 110 ASN 110 482 482 ASN ASN B . n 
B 1 111 GLN 111 483 483 GLN GLN B . n 
B 1 112 ILE 112 484 484 ILE ILE B . n 
B 1 113 TYR 113 485 485 TYR TYR B . n 
B 1 114 GLU 114 486 486 GLU GLU B . n 
B 1 115 ALA 115 487 487 ALA ALA B . n 
B 1 116 ARG 116 488 488 ARG ARG B . n 
B 1 117 VAL 117 489 489 VAL VAL B . n 
B 1 118 GLU 118 490 490 GLU GLU B . n 
B 1 119 ALA 119 491 491 ALA ALA B . n 
B 1 120 MET 120 492 492 MET MET B . n 
B 1 121 ALA 121 493 493 ALA ALA B . n 
B 1 122 VAL 122 494 494 VAL VAL B . n 
B 1 123 LYS 123 495 495 LYS LYS B . n 
B 1 124 LYS 124 496 496 LYS LYS B . n 
B 1 125 PRO 125 497 497 PRO PRO B . n 
B 1 126 GLY 126 498 498 GLY GLY B . n 
B 1 127 PRO 127 499 499 PRO PRO B . n 
B 1 128 SER 128 500 500 SER SER B . n 
B 1 129 CYS 129 501 501 CYS CYS B . n 
B 1 130 SER 130 502 502 SER SER B . n 
B 1 131 ARG 131 503 503 ARG ARG B . n 
B 1 132 GLN 132 504 504 GLN GLN B . n 
B 1 133 GLU 133 505 505 GLU GLU B . n 
B 1 134 LYS 134 506 506 LYS LYS B . n 
B 1 135 GLU 135 507 507 GLU GLU B . n 
B 1 136 ALA 136 508 508 ALA ALA B . n 
B 1 137 TRP 137 509 509 TRP TRP B . n 
B 1 138 ILE 138 510 510 ILE ILE B . n 
B 1 139 HIS 139 511 511 HIS HIS B . n 
B 1 140 ALA 140 512 512 ALA ALA B . n 
B 1 141 LYS 141 513 513 LYS LYS B . n 
B 1 142 TYR 142 514 514 TYR TYR B . n 
B 1 143 VAL 143 515 515 VAL VAL B . n 
B 1 144 GLU 144 516 516 GLU GLU B . n 
B 1 145 LYS 145 517 517 LYS LYS B . n 
B 1 146 LYS 146 518 518 LYS LYS B . n 
B 1 147 PHE 147 519 519 PHE PHE B . n 
B 1 148 LEU 148 520 520 LEU LEU B . n 
B 1 149 THR 149 521 521 THR THR B . n 
B 1 150 LYS 150 522 522 LYS LYS B . n 
B 1 151 LEU 151 523 523 LEU LEU B . n 
B 1 152 PRO 152 524 524 PRO PRO B . n 
B 1 153 GLU 153 525 ?   ?   ?   B . n 
B 1 154 ILE 154 526 ?   ?   ?   B . n 
B 1 155 ARG 155 527 ?   ?   ?   B . n 
B 1 156 GLY 156 528 ?   ?   ?   B . n 
B 1 157 ARG 157 529 ?   ?   ?   B . n 
B 1 158 ARG 158 530 ?   ?   ?   B . n 
B 1 159 GLY 159 531 ?   ?   ?   B . n 
B 1 160 GLY 160 532 ?   ?   ?   B . n 
B 1 161 ARG 161 533 ?   ?   ?   B . n 
B 1 162 GLY 162 534 ?   ?   ?   B . n 
B 1 163 ARG 163 535 ?   ?   ?   B . n 
B 1 164 PRO 164 536 ?   ?   ?   B . n 
B 1 165 ARG 165 537 ?   ?   ?   B . n 
B 1 166 GLY 166 538 ?   ?   ?   B . n 
B 1 167 GLN 167 539 ?   ?   ?   B . n 
B 1 168 PRO 168 540 ?   ?   ?   B . n 
B 1 169 PRO 169 541 ?   ?   ?   B . n 
B 1 170 VAL 170 542 ?   ?   ?   B . n 
B 1 171 PRO 171 543 ?   ?   ?   B . n 
B 1 172 PRO 172 544 ?   ?   ?   B . n 
B 1 173 LYS 173 545 ?   ?   ?   B . n 
B 1 174 PRO 174 546 ?   ?   ?   B . n 
B 1 175 SER 175 547 ?   ?   ?   B . n 
B 1 176 ILE 176 548 ?   ?   ?   B . n 
B 1 177 ARG 177 549 ?   ?   ?   B . n 
B 1 178 PRO 178 550 ?   ?   ?   B . n 
B 1 179 ARG 179 551 ?   ?   ?   B . n 
B 1 180 PRO 180 552 ?   ?   ?   B . n 
B 1 181 GLY 181 553 ?   ?   ?   B . n 
B 1 182 SER 182 554 ?   ?   ?   B . n 
B 1 183 LEU 183 555 ?   ?   ?   B . n 
B 1 184 ARG 184 556 ?   ?   ?   B . n 
B 1 185 SER 185 557 ?   ?   ?   B . n 
B 1 186 LYS 186 558 ?   ?   ?   B . n 
B 1 187 PRO 187 559 ?   ?   ?   B . n 
B 1 188 GLU 188 560 ?   ?   ?   B . n 
B 1 189 PRO 189 561 ?   ?   ?   B . n 
B 1 190 PRO 190 562 ?   ?   ?   B . n 
B 1 191 SER 191 563 ?   ?   ?   B . n 
B 1 192 GLU 192 564 ?   ?   ?   B . n 
B 1 193 ASP 193 565 ?   ?   ?   B . n 
B 1 194 LEU 194 566 ?   ?   ?   B . n 
B 1 195 GLY 195 567 ?   ?   ?   B . n 
B 1 196 SER 196 568 ?   ?   ?   B . n 
B 1 197 LEU 197 569 569 LEU LEU B . n 
B 1 198 HIS 198 570 570 HIS HIS B . n 
B 1 199 PRO 199 571 571 PRO PRO B . n 
B 1 200 GLY 200 572 572 GLY GLY B . n 
B 1 201 ALA 201 573 573 ALA ALA B . n 
B 1 202 LEU 202 574 574 LEU LEU B . n 
B 1 203 LEU 203 575 575 LEU LEU B . n 
B 1 204 PHE 204 576 576 PHE PHE B . n 
B 1 205 ARG 205 577 577 ARG ARG B . n 
B 1 206 ALA 206 578 578 ALA ALA B . n 
B 1 207 SER 207 579 579 SER SER B . n 
B 1 208 GLY 208 580 580 GLY GLY B . n 
B 1 209 HIS 209 581 581 HIS HIS B . n 
B 1 210 PRO 210 582 582 PRO PRO B . n 
B 1 211 PRO 211 583 583 PRO PRO B . n 
B 1 212 SER 212 584 584 SER SER B . n 
B 1 213 LEU 213 585 585 LEU LEU B . n 
B 1 214 PRO 214 586 586 PRO PRO B . n 
B 1 215 THR 215 587 587 THR THR B . n 
B 1 216 MET 216 588 588 MET MET B . n 
B 1 217 ALA 217 589 589 ALA ALA B . n 
B 1 218 ASP 218 590 590 ASP ASP B . n 
B 1 219 ALA 219 591 591 ALA ALA B . n 
B 1 220 LEU 220 592 592 LEU LEU B . n 
B 1 221 ALA 221 593 593 ALA ALA B . n 
B 1 222 HIS 222 594 594 HIS HIS B . n 
B 1 223 GLY 223 595 595 GLY GLY B . n 
B 1 224 ALA 224 596 596 ALA ALA B . n 
B 1 225 ASP 225 597 597 ASP ASP B . n 
B 1 226 VAL 226 598 598 VAL VAL B . n 
B 1 227 ASN 227 599 599 ASN ASN B . n 
B 1 228 TRP 228 600 600 TRP TRP B . n 
B 1 229 VAL 229 601 601 VAL VAL B . n 
B 1 230 ASN 230 602 602 ASN ASN B . n 
B 1 231 GLY 231 603 603 GLY GLY B . n 
B 1 232 GLY 232 604 604 GLY GLY B . n 
B 1 233 GLN 233 605 605 GLN GLN B . n 
B 1 234 ASP 234 606 606 ASP ASP B . n 
B 1 235 ASN 235 607 607 ASN ASN B . n 
B 1 236 ALA 236 608 608 ALA ALA B . n 
B 1 237 THR 237 609 609 THR THR B . n 
B 1 238 PRO 238 610 610 PRO PRO B . n 
B 1 239 LEU 239 611 611 LEU LEU B . n 
B 1 240 ILE 240 612 612 ILE ILE B . n 
B 1 241 GLN 241 613 613 GLN GLN B . n 
B 1 242 ALA 242 614 614 ALA ALA B . n 
B 1 243 THR 243 615 615 THR THR B . n 
B 1 244 ALA 244 616 616 ALA ALA B . n 
B 1 245 ALA 245 617 617 ALA ALA B . n 
B 1 246 ASN 246 618 618 ASN ASN B . n 
B 1 247 SER 247 619 619 SER SER B . n 
B 1 248 LEU 248 620 620 LEU LEU B . n 
B 1 249 LEU 249 621 621 LEU LEU B . n 
B 1 250 ALA 250 622 622 ALA ALA B . n 
B 1 251 CYS 251 623 623 CYS CYS B . n 
B 1 252 GLU 252 624 624 GLU GLU B . n 
B 1 253 PHE 253 625 625 PHE PHE B . n 
B 1 254 LEU 254 626 626 LEU LEU B . n 
B 1 255 LEU 255 627 627 LEU LEU B . n 
B 1 256 GLN 256 628 628 GLN GLN B . n 
B 1 257 ASN 257 629 629 ASN ASN B . n 
B 1 258 GLY 258 630 630 GLY GLY B . n 
B 1 259 ALA 259 631 631 ALA ALA B . n 
B 1 260 ASN 260 632 632 ASN ASN B . n 
B 1 261 VAL 261 633 633 VAL VAL B . n 
B 1 262 ASN 262 634 634 ASN ASN B . n 
B 1 263 GLN 263 635 635 GLN GLN B . n 
B 1 264 ALA 264 636 636 ALA ALA B . n 
B 1 265 ASP 265 637 637 ASP ASP B . n 
B 1 266 SER 266 638 638 SER SER B . n 
B 1 267 ALA 267 639 639 ALA ALA B . n 
B 1 268 GLY 268 640 640 GLY GLY B . n 
B 1 269 ARG 269 641 641 ARG ARG B . n 
B 1 270 GLY 270 642 642 GLY GLY B . n 
B 1 271 PRO 271 643 643 PRO PRO B . n 
B 1 272 LEU 272 644 644 LEU LEU B . n 
B 1 273 HIS 273 645 645 HIS HIS B . n 
B 1 274 HIS 274 646 646 HIS HIS B . n 
B 1 275 ALA 275 647 647 ALA ALA B . n 
B 1 276 THR 276 648 648 THR THR B . n 
B 1 277 ILE 277 649 649 ILE ILE B . n 
B 1 278 LEU 278 650 650 LEU LEU B . n 
B 1 279 GLY 279 651 651 GLY GLY B . n 
B 1 280 HIS 280 652 652 HIS HIS B . n 
B 1 281 THR 281 653 653 THR THR B . n 
B 1 282 GLY 282 654 654 GLY GLY B . n 
B 1 283 LEU 283 655 655 LEU LEU B . n 
B 1 284 ALA 284 656 656 ALA ALA B . n 
B 1 285 CYS 285 657 657 CYS CYS B . n 
B 1 286 LEU 286 658 658 LEU LEU B . n 
B 1 287 PHE 287 659 659 PHE PHE B . n 
B 1 288 LEU 288 660 660 LEU LEU B . n 
B 1 289 LYS 289 661 661 LYS LYS B . n 
B 1 290 ARG 290 662 662 ARG ARG B . n 
B 1 291 GLY 291 663 663 GLY GLY B . n 
B 1 292 ALA 292 664 664 ALA ALA B . n 
B 1 293 ASP 293 665 665 ASP ASP B . n 
B 1 294 LEU 294 666 666 LEU LEU B . n 
B 1 295 GLY 295 667 667 GLY GLY B . n 
B 1 296 ALA 296 668 668 ALA ALA B . n 
B 1 297 ARG 297 669 669 ARG ARG B . n 
B 1 298 ASP 298 670 670 ASP ASP B . n 
B 1 299 SER 299 671 671 SER SER B . n 
B 1 300 GLU 300 672 672 GLU GLU B . n 
B 1 301 GLY 301 673 673 GLY GLY B . n 
B 1 302 ARG 302 674 674 ARG ARG B . n 
B 1 303 ASP 303 675 675 ASP ASP B . n 
B 1 304 PRO 304 676 676 PRO PRO B . n 
B 1 305 LEU 305 677 677 LEU LEU B . n 
B 1 306 THR 306 678 678 THR THR B . n 
B 1 307 ILE 307 679 679 ILE ILE B . n 
B 1 308 ALA 308 680 680 ALA ALA B . n 
B 1 309 MET 309 681 681 MET MET B . n 
B 1 310 GLU 310 682 682 GLU GLU B . n 
B 1 311 THR 311 683 683 THR THR B . n 
B 1 312 ALA 312 684 684 ALA ALA B . n 
B 1 313 ASN 313 685 685 ASN ASN B . n 
B 1 314 ALA 314 686 686 ALA ALA B . n 
B 1 315 ASP 315 687 687 ASP ASP B . n 
B 1 316 ILE 316 688 688 ILE ILE B . n 
B 1 317 VAL 317 689 689 VAL VAL B . n 
B 1 318 THR 318 690 690 THR THR B . n 
B 1 319 LEU 319 691 691 LEU LEU B . n 
B 1 320 LEU 320 692 692 LEU LEU B . n 
B 1 321 ARG 321 693 693 ARG ARG B . n 
B 1 322 LEU 322 694 694 LEU LEU B . n 
B 1 323 ALA 323 695 695 ALA ALA B . n 
B 1 324 LYS 324 696 696 LYS LYS B . n 
B 1 325 MET 325 697 697 MET MET B . n 
B 1 326 ARG 326 698 698 ARG ARG B . n 
B 1 327 GLU 327 699 699 GLU GLU B . n 
B 1 328 ALA 328 700 700 ALA ALA B . n 
B 1 329 GLU 329 701 701 GLU GLU B . n 
B 1 330 ALA 330 702 ?   ?   ?   B . n 
B 1 331 ALA 331 703 ?   ?   ?   B . n 
B 1 332 GLN 332 704 ?   ?   ?   B . n 
B 1 333 GLY 333 705 ?   ?   ?   B . n 
B 1 334 GLN 334 706 ?   ?   ?   B . n 
B 1 335 ALA 335 707 ?   ?   ?   B . n 
B 1 336 GLY 336 708 ?   ?   ?   B . n 
B 1 337 ASP 337 709 ?   ?   ?   B . n 
B 1 338 GLU 338 710 ?   ?   ?   B . n 
B 1 339 THR 339 711 ?   ?   ?   B . n 
B 1 340 TYR 340 712 ?   ?   ?   B . n 
B 1 341 LEU 341 713 ?   ?   ?   B . n 
B 1 342 ASP 342 714 ?   ?   ?   B . n 
B 1 343 ILE 343 715 ?   ?   ?   B . n 
B 1 344 PHE 344 716 ?   ?   ?   B . n 
B 1 345 ARG 345 717 ?   ?   ?   B . n 
B 1 346 ASP 346 718 ?   ?   ?   B . n 
B 1 347 PHE 347 719 ?   ?   ?   B . n 
B 1 348 SER 348 720 ?   ?   ?   B . n 
B 1 349 LEU 349 721 ?   ?   ?   B . n 
B 1 350 MET 350 722 ?   ?   ?   B . n 
B 1 351 ALA 351 723 ?   ?   ?   B . n 
B 1 352 SER 352 724 ?   ?   ?   B . n 
B 1 353 ASP 353 725 ?   ?   ?   B . n 
B 1 354 ASP 354 726 ?   ?   ?   B . n 
B 1 355 PRO 355 727 ?   ?   ?   B . n 
B 1 356 GLU 356 728 ?   ?   ?   B . n 
B 1 357 LYS 357 729 ?   ?   ?   B . n 
B 1 358 LEU 358 730 ?   ?   ?   B . n 
B 1 359 SER 359 731 ?   ?   ?   B . n 
B 1 360 ARG 360 732 ?   ?   ?   B . n 
B 1 361 ARG 361 733 ?   ?   ?   B . n 
B 1 362 SER 362 734 ?   ?   ?   B . n 
B 1 363 HIS 363 735 ?   ?   ?   B . n 
B 1 364 ASP 364 736 ?   ?   ?   B . n 
B 1 365 LEU 365 737 ?   ?   ?   B . n 
B 1 366 HIS 366 738 ?   ?   ?   B . n 
B 1 367 THR 367 739 ?   ?   ?   B . n 
B 1 368 LEU 368 740 ?   ?   ?   B . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA monomeric 1 
2 author_and_software_defined_assembly PISA monomeric 1 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,D,E,H 
2 1 B,F,G,I   
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  SG ? A CYS 48 ? A CYS 420 ? 1_555 ZN ? C ZN . ? A ZN 999 ? 1_555 SG ? A CYS 51 ? A CYS 423 ? 1_555 112.8 ? 
2  SG ? A CYS 48 ? A CYS 420 ? 1_555 ZN ? C ZN . ? A ZN 999 ? 1_555 SG ? A CYS 68 ? A CYS 440 ? 1_555 109.1 ? 
3  SG ? A CYS 51 ? A CYS 423 ? 1_555 ZN ? C ZN . ? A ZN 999 ? 1_555 SG ? A CYS 68 ? A CYS 440 ? 1_555 105.8 ? 
4  SG ? A CYS 48 ? A CYS 420 ? 1_555 ZN ? C ZN . ? A ZN 999 ? 1_555 SG ? A CYS 71 ? A CYS 443 ? 1_555 108.0 ? 
5  SG ? A CYS 51 ? A CYS 423 ? 1_555 ZN ? C ZN . ? A ZN 999 ? 1_555 SG ? A CYS 71 ? A CYS 443 ? 1_555 112.3 ? 
6  SG ? A CYS 68 ? A CYS 440 ? 1_555 ZN ? C ZN . ? A ZN 999 ? 1_555 SG ? A CYS 71 ? A CYS 443 ? 1_555 108.8 ? 
7  SG ? B CYS 48 ? B CYS 420 ? 1_555 ZN ? F ZN . ? B ZN 999 ? 1_555 SG ? B CYS 51 ? B CYS 423 ? 1_555 113.0 ? 
8  SG ? B CYS 48 ? B CYS 420 ? 1_555 ZN ? F ZN . ? B ZN 999 ? 1_555 SG ? B CYS 68 ? B CYS 440 ? 1_555 110.6 ? 
9  SG ? B CYS 51 ? B CYS 423 ? 1_555 ZN ? F ZN . ? B ZN 999 ? 1_555 SG ? B CYS 68 ? B CYS 440 ? 1_555 104.8 ? 
10 SG ? B CYS 48 ? B CYS 420 ? 1_555 ZN ? F ZN . ? B ZN 999 ? 1_555 SG ? B CYS 71 ? B CYS 443 ? 1_555 110.5 ? 
11 SG ? B CYS 51 ? B CYS 423 ? 1_555 ZN ? F ZN . ? B ZN 999 ? 1_555 SG ? B CYS 71 ? B CYS 443 ? 1_555 113.5 ? 
12 SG ? B CYS 68 ? B CYS 440 ? 1_555 ZN ? F ZN . ? B ZN 999 ? 1_555 SG ? B CYS 71 ? B CYS 443 ? 1_555 103.9 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2010-09-22 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2013-01-16 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Database references'       
3 3 'Structure model' 'Refinement description'    
# 
loop_
_pdbx_refine_tls.pdbx_refine_id 
_pdbx_refine_tls.id 
_pdbx_refine_tls.details 
_pdbx_refine_tls.method 
_pdbx_refine_tls.origin_x 
_pdbx_refine_tls.origin_y 
_pdbx_refine_tls.origin_z 
_pdbx_refine_tls.T[1][1] 
_pdbx_refine_tls.T[2][2] 
_pdbx_refine_tls.T[3][3] 
_pdbx_refine_tls.T[1][2] 
_pdbx_refine_tls.T[1][3] 
_pdbx_refine_tls.T[2][3] 
_pdbx_refine_tls.L[1][1] 
_pdbx_refine_tls.L[2][2] 
_pdbx_refine_tls.L[3][3] 
_pdbx_refine_tls.L[1][2] 
_pdbx_refine_tls.L[1][3] 
_pdbx_refine_tls.L[2][3] 
_pdbx_refine_tls.S[1][1] 
_pdbx_refine_tls.S[2][2] 
_pdbx_refine_tls.S[3][3] 
_pdbx_refine_tls.S[1][2] 
_pdbx_refine_tls.S[1][3] 
_pdbx_refine_tls.S[2][3] 
_pdbx_refine_tls.S[2][1] 
_pdbx_refine_tls.S[3][1] 
_pdbx_refine_tls.S[3][2] 
'X-RAY DIFFRACTION' 1 ? refined 32.2430 -46.0940 6.1050   0.0872 0.0073 0.0126 -0.0096 0.0033  -0.0044 4.7834 4.6235 3.9035 
-0.8533 1.3526  -0.5208 0.0272 0.0940  -0.1211 -0.0395 -0.0396 -0.1764 0.2666  -0.2897 -0.0306 
'X-RAY DIFFRACTION' 2 ? refined 20.0330 -67.5850 -5.2910  0.0722 0.0503 0.0520 -0.0098 0.0172  -0.0380 4.0359 2.3635 1.9641 2.1488 
1.4431  0.9103  0.0639 0.0518  -0.1156 0.1209  -0.2509 -0.0268 0.0492  0.0391  -0.0398 
'X-RAY DIFFRACTION' 3 ? refined 18.3040 -32.2260 -14.4350 0.0575 0.0431 0.0211 0.0082  0.0181  0.0136  5.6580 3.4449 2.5553 
-0.7913 -0.9131 0.1107  0.1781 -0.0425 -0.1355 0.2592  0.1530  0.1492  -0.0283 -0.0715 -0.1044 
'X-RAY DIFFRACTION' 4 ? refined 32.8420 -12.3050 -25.9600 0.1054 0.0618 0.0447 0.0342  0.0116  0.0451  4.4348 2.4987 1.7426 1.9279 
-0.9699 -0.8774 0.0109 0.0698  -0.0806 0.1690  0.2451  0.0213  0.0276  0.0825  -0.0056 
'X-RAY DIFFRACTION' 5 ? refined 26.9060 -37.8870 -8.7920  0.7821 0.4949 0.2996 0.1268  -0.0050 -0.0657 2.3391 3.1316 1.5991 0.1065 
-0.4104 1.8174  0.1939 0.0364  -0.2302 -0.0799 0.2081  -0.0948 1.2987  0.9011  -0.0169 
'X-RAY DIFFRACTION' 6 ? refined 26.0890 -41.2730 -6.7660  0.2071 0.2060 0.0211 -0.0071 0.0276  -0.0363 0.5079 1.2990 0.6406 0.2389 
-0.1069 -0.5408 0.0013 0.0592  -0.0605 0.1076  -0.0450 0.0416  0.1232  -0.0396 -0.0933 
# 
loop_
_pdbx_refine_tls_group.pdbx_refine_id 
_pdbx_refine_tls_group.id 
_pdbx_refine_tls_group.refine_tls_id 
_pdbx_refine_tls_group.beg_auth_asym_id 
_pdbx_refine_tls_group.beg_auth_seq_id 
_pdbx_refine_tls_group.end_auth_asym_id 
_pdbx_refine_tls_group.end_auth_seq_id 
_pdbx_refine_tls_group.selection_details 
_pdbx_refine_tls_group.beg_label_asym_id 
_pdbx_refine_tls_group.beg_label_seq_id 
_pdbx_refine_tls_group.end_label_asym_id 
_pdbx_refine_tls_group.end_label_seq_id 
_pdbx_refine_tls_group.selection 
'X-RAY DIFFRACTION' 1  1 A 404  A 524  ? . . . . ? 
'X-RAY DIFFRACTION' 2  1 A 999  A 999  ? . . . . ? 
'X-RAY DIFFRACTION' 3  2 A 569  A 697  ? . . . . ? 
'X-RAY DIFFRACTION' 4  3 B 404  B 524  ? . . . . ? 
'X-RAY DIFFRACTION' 5  3 B 999  B 999  ? . . . . ? 
'X-RAY DIFFRACTION' 6  4 B 569  B 701  ? . . . . ? 
'X-RAY DIFFRACTION' 7  5 A 1133 A 1135 ? . . . . ? 
'X-RAY DIFFRACTION' 8  5 B 1134 B 1134 ? . . . . ? 
'X-RAY DIFFRACTION' 9  6 A 1000 A 1131 ? . . . . ? 
'X-RAY DIFFRACTION' 10 6 B 1001 B 1132 ? . . . . ? 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
ADSC     'data collection' Quantum  ? 1 
SOLVE    phasing           .        ? 2 
REFMAC   refinement        5.5.0088 ? 3 
HKL-2000 'data reduction'  .        ? 4 
HKL-2000 'data scaling'    .        ? 5 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   N 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   LEU 
_pdbx_validate_close_contact.auth_seq_id_1    569 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   O 
_pdbx_validate_close_contact.auth_asym_id_2   A 
_pdbx_validate_close_contact.auth_comp_id_2   HOH 
_pdbx_validate_close_contact.auth_seq_id_2    1124 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.19 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 HIS A 406 ? ? -37.47  102.94  
2 1 ASP A 415 ? ? -43.07  108.74  
3 1 LEU A 476 ? ? -107.21 -115.94 
4 1 GLN A 605 ? ? -86.89  -109.52 
5 1 ASP B 415 ? ? -39.13  112.29  
6 1 LEU B 476 ? ? -110.51 -118.05 
7 1 GLN B 605 ? ? -79.95  -120.55 
8 1 ASP B 637 ? ? -77.35  -168.59 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1   1 Y 1 A GLY 373 ? A GLY 1   
2   1 Y 1 A PRO 374 ? A PRO 2   
3   1 Y 1 A LEU 375 ? A LEU 3   
4   1 Y 1 A GLY 376 ? A GLY 4   
5   1 Y 1 A SER 377 ? A SER 5   
6   1 Y 1 A GLY 378 ? A GLY 6   
7   1 Y 1 A SER 379 ? A SER 7   
8   1 Y 1 A GLY 380 ? A GLY 8   
9   1 Y 1 A HIS 381 ? A HIS 9   
10  1 Y 1 A LEU 382 ? A LEU 10  
11  1 Y 1 A ALA 383 ? A ALA 11  
12  1 Y 1 A ILE 384 ? A ILE 12  
13  1 Y 1 A GLY 385 ? A GLY 13  
14  1 Y 1 A SER 386 ? A SER 14  
15  1 Y 1 A ALA 387 ? A ALA 15  
16  1 Y 1 A ALA 388 ? A ALA 16  
17  1 Y 1 A THR 389 ? A THR 17  
18  1 Y 1 A LEU 390 ? A LEU 18  
19  1 Y 1 A GLY 391 ? A GLY 19  
20  1 Y 1 A SER 392 ? A SER 20  
21  1 Y 1 A GLY 393 ? A GLY 21  
22  1 Y 1 A GLY 394 ? A GLY 22  
23  1 Y 1 A MET 395 ? A MET 23  
24  1 Y 1 A ALA 396 ? A ALA 24  
25  1 Y 1 A ARG 397 ? A ARG 25  
26  1 Y 1 A GLY 398 ? A GLY 26  
27  1 Y 1 A ARG 399 ? A ARG 27  
28  1 Y 1 A GLU 400 ? A GLU 28  
29  1 Y 1 A PRO 401 ? A PRO 29  
30  1 Y 1 A GLY 402 ? A GLY 30  
31  1 Y 1 A GLY 403 ? A GLY 31  
32  1 Y 1 A GLU 525 ? A GLU 153 
33  1 Y 1 A ILE 526 ? A ILE 154 
34  1 Y 1 A ARG 527 ? A ARG 155 
35  1 Y 1 A GLY 528 ? A GLY 156 
36  1 Y 1 A ARG 529 ? A ARG 157 
37  1 Y 1 A ARG 530 ? A ARG 158 
38  1 Y 1 A GLY 531 ? A GLY 159 
39  1 Y 1 A GLY 532 ? A GLY 160 
40  1 Y 1 A ARG 533 ? A ARG 161 
41  1 Y 1 A GLY 534 ? A GLY 162 
42  1 Y 1 A ARG 535 ? A ARG 163 
43  1 Y 1 A PRO 536 ? A PRO 164 
44  1 Y 1 A ARG 537 ? A ARG 165 
45  1 Y 1 A GLY 538 ? A GLY 166 
46  1 Y 1 A GLN 539 ? A GLN 167 
47  1 Y 1 A PRO 540 ? A PRO 168 
48  1 Y 1 A PRO 541 ? A PRO 169 
49  1 Y 1 A VAL 542 ? A VAL 170 
50  1 Y 1 A PRO 543 ? A PRO 171 
51  1 Y 1 A PRO 544 ? A PRO 172 
52  1 Y 1 A LYS 545 ? A LYS 173 
53  1 Y 1 A PRO 546 ? A PRO 174 
54  1 Y 1 A SER 547 ? A SER 175 
55  1 Y 1 A ILE 548 ? A ILE 176 
56  1 Y 1 A ARG 549 ? A ARG 177 
57  1 Y 1 A PRO 550 ? A PRO 178 
58  1 Y 1 A ARG 551 ? A ARG 179 
59  1 Y 1 A PRO 552 ? A PRO 180 
60  1 Y 1 A GLY 553 ? A GLY 181 
61  1 Y 1 A SER 554 ? A SER 182 
62  1 Y 1 A LEU 555 ? A LEU 183 
63  1 Y 1 A ARG 556 ? A ARG 184 
64  1 Y 1 A SER 557 ? A SER 185 
65  1 Y 1 A LYS 558 ? A LYS 186 
66  1 Y 1 A PRO 559 ? A PRO 187 
67  1 Y 1 A GLU 560 ? A GLU 188 
68  1 Y 1 A PRO 561 ? A PRO 189 
69  1 Y 1 A PRO 562 ? A PRO 190 
70  1 Y 1 A SER 563 ? A SER 191 
71  1 Y 1 A GLU 564 ? A GLU 192 
72  1 Y 1 A ASP 565 ? A ASP 193 
73  1 Y 1 A LEU 566 ? A LEU 194 
74  1 Y 1 A GLY 567 ? A GLY 195 
75  1 Y 1 A SER 568 ? A SER 196 
76  1 Y 1 A ARG 698 ? A ARG 326 
77  1 Y 1 A GLU 699 ? A GLU 327 
78  1 Y 1 A ALA 700 ? A ALA 328 
79  1 Y 1 A GLU 701 ? A GLU 329 
80  1 Y 1 A ALA 702 ? A ALA 330 
81  1 Y 1 A ALA 703 ? A ALA 331 
82  1 Y 1 A GLN 704 ? A GLN 332 
83  1 Y 1 A GLY 705 ? A GLY 333 
84  1 Y 1 A GLN 706 ? A GLN 334 
85  1 Y 1 A ALA 707 ? A ALA 335 
86  1 Y 1 A GLY 708 ? A GLY 336 
87  1 Y 1 A ASP 709 ? A ASP 337 
88  1 Y 1 A GLU 710 ? A GLU 338 
89  1 Y 1 A THR 711 ? A THR 339 
90  1 Y 1 A TYR 712 ? A TYR 340 
91  1 Y 1 A LEU 713 ? A LEU 341 
92  1 Y 1 A ASP 714 ? A ASP 342 
93  1 Y 1 A ILE 715 ? A ILE 343 
94  1 Y 1 A PHE 716 ? A PHE 344 
95  1 Y 1 A ARG 717 ? A ARG 345 
96  1 Y 1 A ASP 718 ? A ASP 346 
97  1 Y 1 A PHE 719 ? A PHE 347 
98  1 Y 1 A SER 720 ? A SER 348 
99  1 Y 1 A LEU 721 ? A LEU 349 
100 1 Y 1 A MET 722 ? A MET 350 
101 1 Y 1 A ALA 723 ? A ALA 351 
102 1 Y 1 A SER 724 ? A SER 352 
103 1 Y 1 A ASP 725 ? A ASP 353 
104 1 Y 1 A ASP 726 ? A ASP 354 
105 1 Y 1 A PRO 727 ? A PRO 355 
106 1 Y 1 A GLU 728 ? A GLU 356 
107 1 Y 1 A LYS 729 ? A LYS 357 
108 1 Y 1 A LEU 730 ? A LEU 358 
109 1 Y 1 A SER 731 ? A SER 359 
110 1 Y 1 A ARG 732 ? A ARG 360 
111 1 Y 1 A ARG 733 ? A ARG 361 
112 1 Y 1 A SER 734 ? A SER 362 
113 1 Y 1 A HIS 735 ? A HIS 363 
114 1 Y 1 A ASP 736 ? A ASP 364 
115 1 Y 1 A LEU 737 ? A LEU 365 
116 1 Y 1 A HIS 738 ? A HIS 366 
117 1 Y 1 A THR 739 ? A THR 367 
118 1 Y 1 A LEU 740 ? A LEU 368 
119 1 Y 1 B GLY 373 ? B GLY 1   
120 1 Y 1 B PRO 374 ? B PRO 2   
121 1 Y 1 B LEU 375 ? B LEU 3   
122 1 Y 1 B GLY 376 ? B GLY 4   
123 1 Y 1 B SER 377 ? B SER 5   
124 1 Y 1 B GLY 378 ? B GLY 6   
125 1 Y 1 B SER 379 ? B SER 7   
126 1 Y 1 B GLY 380 ? B GLY 8   
127 1 Y 1 B HIS 381 ? B HIS 9   
128 1 Y 1 B LEU 382 ? B LEU 10  
129 1 Y 1 B ALA 383 ? B ALA 11  
130 1 Y 1 B ILE 384 ? B ILE 12  
131 1 Y 1 B GLY 385 ? B GLY 13  
132 1 Y 1 B SER 386 ? B SER 14  
133 1 Y 1 B ALA 387 ? B ALA 15  
134 1 Y 1 B ALA 388 ? B ALA 16  
135 1 Y 1 B THR 389 ? B THR 17  
136 1 Y 1 B LEU 390 ? B LEU 18  
137 1 Y 1 B GLY 391 ? B GLY 19  
138 1 Y 1 B SER 392 ? B SER 20  
139 1 Y 1 B GLY 393 ? B GLY 21  
140 1 Y 1 B GLY 394 ? B GLY 22  
141 1 Y 1 B MET 395 ? B MET 23  
142 1 Y 1 B ALA 396 ? B ALA 24  
143 1 Y 1 B ARG 397 ? B ARG 25  
144 1 Y 1 B GLY 398 ? B GLY 26  
145 1 Y 1 B ARG 399 ? B ARG 27  
146 1 Y 1 B GLU 400 ? B GLU 28  
147 1 Y 1 B PRO 401 ? B PRO 29  
148 1 Y 1 B GLY 402 ? B GLY 30  
149 1 Y 1 B GLY 403 ? B GLY 31  
150 1 Y 1 B GLU 525 ? B GLU 153 
151 1 Y 1 B ILE 526 ? B ILE 154 
152 1 Y 1 B ARG 527 ? B ARG 155 
153 1 Y 1 B GLY 528 ? B GLY 156 
154 1 Y 1 B ARG 529 ? B ARG 157 
155 1 Y 1 B ARG 530 ? B ARG 158 
156 1 Y 1 B GLY 531 ? B GLY 159 
157 1 Y 1 B GLY 532 ? B GLY 160 
158 1 Y 1 B ARG 533 ? B ARG 161 
159 1 Y 1 B GLY 534 ? B GLY 162 
160 1 Y 1 B ARG 535 ? B ARG 163 
161 1 Y 1 B PRO 536 ? B PRO 164 
162 1 Y 1 B ARG 537 ? B ARG 165 
163 1 Y 1 B GLY 538 ? B GLY 166 
164 1 Y 1 B GLN 539 ? B GLN 167 
165 1 Y 1 B PRO 540 ? B PRO 168 
166 1 Y 1 B PRO 541 ? B PRO 169 
167 1 Y 1 B VAL 542 ? B VAL 170 
168 1 Y 1 B PRO 543 ? B PRO 171 
169 1 Y 1 B PRO 544 ? B PRO 172 
170 1 Y 1 B LYS 545 ? B LYS 173 
171 1 Y 1 B PRO 546 ? B PRO 174 
172 1 Y 1 B SER 547 ? B SER 175 
173 1 Y 1 B ILE 548 ? B ILE 176 
174 1 Y 1 B ARG 549 ? B ARG 177 
175 1 Y 1 B PRO 550 ? B PRO 178 
176 1 Y 1 B ARG 551 ? B ARG 179 
177 1 Y 1 B PRO 552 ? B PRO 180 
178 1 Y 1 B GLY 553 ? B GLY 181 
179 1 Y 1 B SER 554 ? B SER 182 
180 1 Y 1 B LEU 555 ? B LEU 183 
181 1 Y 1 B ARG 556 ? B ARG 184 
182 1 Y 1 B SER 557 ? B SER 185 
183 1 Y 1 B LYS 558 ? B LYS 186 
184 1 Y 1 B PRO 559 ? B PRO 187 
185 1 Y 1 B GLU 560 ? B GLU 188 
186 1 Y 1 B PRO 561 ? B PRO 189 
187 1 Y 1 B PRO 562 ? B PRO 190 
188 1 Y 1 B SER 563 ? B SER 191 
189 1 Y 1 B GLU 564 ? B GLU 192 
190 1 Y 1 B ASP 565 ? B ASP 193 
191 1 Y 1 B LEU 566 ? B LEU 194 
192 1 Y 1 B GLY 567 ? B GLY 195 
193 1 Y 1 B SER 568 ? B SER 196 
194 1 Y 1 B ALA 702 ? B ALA 330 
195 1 Y 1 B ALA 703 ? B ALA 331 
196 1 Y 1 B GLN 704 ? B GLN 332 
197 1 Y 1 B GLY 705 ? B GLY 333 
198 1 Y 1 B GLN 706 ? B GLN 334 
199 1 Y 1 B ALA 707 ? B ALA 335 
200 1 Y 1 B GLY 708 ? B GLY 336 
201 1 Y 1 B ASP 709 ? B ASP 337 
202 1 Y 1 B GLU 710 ? B GLU 338 
203 1 Y 1 B THR 711 ? B THR 339 
204 1 Y 1 B TYR 712 ? B TYR 340 
205 1 Y 1 B LEU 713 ? B LEU 341 
206 1 Y 1 B ASP 714 ? B ASP 342 
207 1 Y 1 B ILE 715 ? B ILE 343 
208 1 Y 1 B PHE 716 ? B PHE 344 
209 1 Y 1 B ARG 717 ? B ARG 345 
210 1 Y 1 B ASP 718 ? B ASP 346 
211 1 Y 1 B PHE 719 ? B PHE 347 
212 1 Y 1 B SER 720 ? B SER 348 
213 1 Y 1 B LEU 721 ? B LEU 349 
214 1 Y 1 B MET 722 ? B MET 350 
215 1 Y 1 B ALA 723 ? B ALA 351 
216 1 Y 1 B SER 724 ? B SER 352 
217 1 Y 1 B ASP 725 ? B ASP 353 
218 1 Y 1 B ASP 726 ? B ASP 354 
219 1 Y 1 B PRO 727 ? B PRO 355 
220 1 Y 1 B GLU 728 ? B GLU 356 
221 1 Y 1 B LYS 729 ? B LYS 357 
222 1 Y 1 B LEU 730 ? B LEU 358 
223 1 Y 1 B SER 731 ? B SER 359 
224 1 Y 1 B ARG 732 ? B ARG 360 
225 1 Y 1 B ARG 733 ? B ARG 361 
226 1 Y 1 B SER 734 ? B SER 362 
227 1 Y 1 B HIS 735 ? B HIS 363 
228 1 Y 1 B ASP 736 ? B ASP 364 
229 1 Y 1 B LEU 737 ? B LEU 365 
230 1 Y 1 B HIS 738 ? B HIS 366 
231 1 Y 1 B THR 739 ? B THR 367 
232 1 Y 1 B LEU 740 ? B LEU 368 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'ZINC ION'    ZN  
3 'SULFATE ION' SO4 
4 water         HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 ZN  1  999  999  ZN  ZN  A . 
D 3 SO4 1  1133 1133 SO4 SO4 A . 
E 3 SO4 1  1135 1135 SO4 SO4 A . 
F 2 ZN  1  999  999  ZN  ZN  B . 
G 3 SO4 1  1134 1134 SO4 SO4 B . 
H 4 HOH 1  1000 1000 HOH HOH A . 
H 4 HOH 2  1002 1002 HOH HOH A . 
H 4 HOH 3  1004 1004 HOH HOH A . 
H 4 HOH 4  1005 1005 HOH HOH A . 
H 4 HOH 5  1007 1007 HOH HOH A . 
H 4 HOH 6  1008 1008 HOH HOH A . 
H 4 HOH 7  1009 1009 HOH HOH A . 
H 4 HOH 8  1010 1010 HOH HOH A . 
H 4 HOH 9  1013 1013 HOH HOH A . 
H 4 HOH 10 1014 1014 HOH HOH A . 
H 4 HOH 11 1015 1015 HOH HOH A . 
H 4 HOH 12 1017 1017 HOH HOH A . 
H 4 HOH 13 1019 1019 HOH HOH A . 
H 4 HOH 14 1022 1022 HOH HOH A . 
H 4 HOH 15 1024 1024 HOH HOH A . 
H 4 HOH 16 1028 1028 HOH HOH A . 
H 4 HOH 17 1029 1029 HOH HOH A . 
H 4 HOH 18 1030 1030 HOH HOH A . 
H 4 HOH 19 1032 1032 HOH HOH A . 
H 4 HOH 20 1034 1034 HOH HOH A . 
H 4 HOH 21 1037 1037 HOH HOH A . 
H 4 HOH 22 1039 1039 HOH HOH A . 
H 4 HOH 23 1041 1041 HOH HOH A . 
H 4 HOH 24 1043 1043 HOH HOH A . 
H 4 HOH 25 1044 1044 HOH HOH A . 
H 4 HOH 26 1045 1045 HOH HOH A . 
H 4 HOH 27 1046 1046 HOH HOH A . 
H 4 HOH 28 1048 1048 HOH HOH A . 
H 4 HOH 29 1050 1050 HOH HOH A . 
H 4 HOH 30 1053 1053 HOH HOH A . 
H 4 HOH 31 1054 1054 HOH HOH A . 
H 4 HOH 32 1056 1056 HOH HOH A . 
H 4 HOH 33 1057 1057 HOH HOH A . 
H 4 HOH 34 1058 1058 HOH HOH A . 
H 4 HOH 35 1059 1059 HOH HOH A . 
H 4 HOH 36 1060 1060 HOH HOH A . 
H 4 HOH 37 1061 1061 HOH HOH A . 
H 4 HOH 38 1063 1063 HOH HOH A . 
H 4 HOH 39 1065 1065 HOH HOH A . 
H 4 HOH 40 1066 1066 HOH HOH A . 
H 4 HOH 41 1070 1070 HOH HOH A . 
H 4 HOH 42 1072 1072 HOH HOH A . 
H 4 HOH 43 1073 1073 HOH HOH A . 
H 4 HOH 44 1074 1074 HOH HOH A . 
H 4 HOH 45 1075 1075 HOH HOH A . 
H 4 HOH 46 1077 1077 HOH HOH A . 
H 4 HOH 47 1078 1078 HOH HOH A . 
H 4 HOH 48 1080 1080 HOH HOH A . 
H 4 HOH 49 1083 1083 HOH HOH A . 
H 4 HOH 50 1085 1085 HOH HOH A . 
H 4 HOH 51 1086 1086 HOH HOH A . 
H 4 HOH 52 1092 1092 HOH HOH A . 
H 4 HOH 53 1094 1094 HOH HOH A . 
H 4 HOH 54 1097 1097 HOH HOH A . 
H 4 HOH 55 1099 1099 HOH HOH A . 
H 4 HOH 56 1100 1100 HOH HOH A . 
H 4 HOH 57 1102 1102 HOH HOH A . 
H 4 HOH 58 1103 1103 HOH HOH A . 
H 4 HOH 59 1105 1105 HOH HOH A . 
H 4 HOH 60 1107 1107 HOH HOH A . 
H 4 HOH 61 1112 1112 HOH HOH A . 
H 4 HOH 62 1113 1113 HOH HOH A . 
H 4 HOH 63 1117 1117 HOH HOH A . 
H 4 HOH 64 1118 1118 HOH HOH A . 
H 4 HOH 65 1119 1119 HOH HOH A . 
H 4 HOH 66 1120 1120 HOH HOH A . 
H 4 HOH 67 1121 1121 HOH HOH A . 
H 4 HOH 68 1123 1123 HOH HOH A . 
H 4 HOH 69 1124 1124 HOH HOH A . 
H 4 HOH 70 1125 1125 HOH HOH A . 
H 4 HOH 71 1126 1126 HOH HOH A . 
H 4 HOH 72 1128 1128 HOH HOH A . 
H 4 HOH 73 1130 1130 HOH HOH A . 
H 4 HOH 74 1131 1131 HOH HOH A . 
I 4 HOH 1  1001 1001 HOH HOH B . 
I 4 HOH 2  1003 1003 HOH HOH B . 
I 4 HOH 3  1006 1006 HOH HOH B . 
I 4 HOH 4  1011 1011 HOH HOH B . 
I 4 HOH 5  1012 1012 HOH HOH B . 
I 4 HOH 6  1016 1016 HOH HOH B . 
I 4 HOH 7  1018 1018 HOH HOH B . 
I 4 HOH 8  1020 1020 HOH HOH B . 
I 4 HOH 9  1021 1021 HOH HOH B . 
I 4 HOH 10 1023 1023 HOH HOH B . 
I 4 HOH 11 1025 1025 HOH HOH B . 
I 4 HOH 12 1026 1026 HOH HOH B . 
I 4 HOH 13 1027 1027 HOH HOH B . 
I 4 HOH 14 1031 1031 HOH HOH B . 
I 4 HOH 15 1033 1033 HOH HOH B . 
I 4 HOH 16 1035 1035 HOH HOH B . 
I 4 HOH 17 1036 1036 HOH HOH B . 
I 4 HOH 18 1038 1038 HOH HOH B . 
I 4 HOH 19 1040 1040 HOH HOH B . 
I 4 HOH 20 1042 1042 HOH HOH B . 
I 4 HOH 21 1047 1047 HOH HOH B . 
I 4 HOH 22 1049 1049 HOH HOH B . 
I 4 HOH 23 1051 1051 HOH HOH B . 
I 4 HOH 24 1052 1052 HOH HOH B . 
I 4 HOH 25 1055 1055 HOH HOH B . 
I 4 HOH 26 1062 1062 HOH HOH B . 
I 4 HOH 27 1064 1064 HOH HOH B . 
I 4 HOH 28 1067 1067 HOH HOH B . 
I 4 HOH 29 1068 1068 HOH HOH B . 
I 4 HOH 30 1069 1069 HOH HOH B . 
I 4 HOH 31 1071 1071 HOH HOH B . 
I 4 HOH 32 1076 1076 HOH HOH B . 
I 4 HOH 33 1079 1079 HOH HOH B . 
I 4 HOH 34 1081 1081 HOH HOH B . 
I 4 HOH 35 1082 1082 HOH HOH B . 
I 4 HOH 36 1084 1084 HOH HOH B . 
I 4 HOH 37 1087 1087 HOH HOH B . 
I 4 HOH 38 1088 1088 HOH HOH B . 
I 4 HOH 39 1089 1089 HOH HOH B . 
I 4 HOH 40 1090 1090 HOH HOH B . 
I 4 HOH 41 1091 1091 HOH HOH B . 
I 4 HOH 42 1093 1093 HOH HOH B . 
I 4 HOH 43 1095 1095 HOH HOH B . 
I 4 HOH 44 1096 1096 HOH HOH B . 
I 4 HOH 45 1098 1098 HOH HOH B . 
I 4 HOH 46 1101 1101 HOH HOH B . 
I 4 HOH 47 1104 1104 HOH HOH B . 
I 4 HOH 48 1106 1106 HOH HOH B . 
I 4 HOH 49 1108 1108 HOH HOH B . 
I 4 HOH 50 1109 1109 HOH HOH B . 
I 4 HOH 51 1110 1110 HOH HOH B . 
I 4 HOH 52 1111 1111 HOH HOH B . 
I 4 HOH 53 1114 1114 HOH HOH B . 
I 4 HOH 54 1115 1115 HOH HOH B . 
I 4 HOH 55 1116 1116 HOH HOH B . 
I 4 HOH 56 1122 1122 HOH HOH B . 
I 4 HOH 57 1127 1127 HOH HOH B . 
I 4 HOH 58 1129 1129 HOH HOH B . 
I 4 HOH 59 1132 1132 HOH HOH B . 
#