data_3K0J
# 
_entry.id   3K0J 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3K0J         
NDB   NA0199       
RCSB  RCSB055392   
WWPDB D_1000055392 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3K0J 
_pdbx_database_status.recvd_initial_deposition_date   2009-09-24 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Kulshina, N.'        1 
'Edwards, T.E.'       2 
;Ferre-D'Amare, A.R.
;
3 
# 
_citation.id                        primary 
_citation.title                     
;Thermodynamic analysis of ligand binding and ligand binding-induced tertiary structure formation by the thiamine pyrophosphate riboswitch.
;
_citation.journal_abbrev            Rna 
_citation.journal_volume            16 
_citation.page_first                186 
_citation.page_last                 196 
_citation.year                      2010 
_citation.journal_id_ASTM           RNARFU 
_citation.country                   UK 
_citation.journal_id_ISSN           1355-8382 
_citation.journal_id_CSD            2122 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19948769 
_citation.pdbx_database_id_DOI      10.1261/rna.1847310 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Kulshina, N.'        1 
primary 'Edwards, T.E.'       2 
primary 
;Ferre-D'Amare, A.R.
;
3 
# 
_cell.entry_id           3K0J 
_cell.length_a           52.250 
_cell.length_b           71.600 
_cell.length_c           128.350 
_cell.angle_alpha        90.00 
_cell.angle_beta         94.62 
_cell.angle_gamma        90.00 
_cell.Z_PDB              8 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3K0J 
_symmetry.space_group_name_H-M             'P 1 21 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                4 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'U1 small nuclear ribonucleoprotein A' 11079.939 4 ? Y231H,Q236R 'UNP residues 2-97, RRM 1 domain' ? 
2 polymer     syn 'RNA (87-MER)'                         28019.666 2 ? ?           ?                                 ? 
3 non-polymer syn 'THIAMINE DIPHOSPHATE'                 425.314   2 ? ?           ?                                 ? 
4 non-polymer syn 'MAGNESIUM ION'                        24.305    8 ? ?           ?                                 ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'U1 snRNP protein A, U1A protein, U1-A' 
# 
loop_
_entity_poly.entity_id 
_entity_poly.type 
_entity_poly.nstd_linkage 
_entity_poly.nstd_monomer 
_entity_poly.pdbx_seq_one_letter_code 
_entity_poly.pdbx_seq_one_letter_code_can 
_entity_poly.pdbx_strand_id 
_entity_poly.pdbx_target_identifier 
1 'polypeptide(L)'   no no 
;AVPETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKP
MRIQYAKTDSDIIAKM
;
;AVPETRPNHTIYINNLNEKIKKDELKKSLHAIFSRFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKP
MRIQYAKTDSDIIAKM
;
A,B,C,D ? 
2 polyribonucleotide no no 
;GCGACUCGGGGUGCCCUCCAUUGCACUCCGGAGGCUGAGAAAUACCCGUAUCACCUGAUCUGGAUAAUGCCAGCGUAGGG
AAGUCGC
;
;GCGACUCGGGGUGCCCUCCAUUGCACUCCGGAGGCUGAGAAAUACCCGUAUCACCUGAUCUGGAUAAUGCCAGCGUAGGG
AAGUCGC
;
E,F     ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1  ALA n 
1 2  VAL n 
1 3  PRO n 
1 4  GLU n 
1 5  THR n 
1 6  ARG n 
1 7  PRO n 
1 8  ASN n 
1 9  HIS n 
1 10 THR n 
1 11 ILE n 
1 12 TYR n 
1 13 ILE n 
1 14 ASN n 
1 15 ASN n 
1 16 LEU n 
1 17 ASN n 
1 18 GLU n 
1 19 LYS n 
1 20 ILE n 
1 21 LYS n 
1 22 LYS n 
1 23 ASP n 
1 24 GLU n 
1 25 LEU n 
1 26 LYS n 
1 27 LYS n 
1 28 SER n 
1 29 LEU n 
1 30 HIS n 
1 31 ALA n 
1 32 ILE n 
1 33 PHE n 
1 34 SER n 
1 35 ARG n 
1 36 PHE n 
1 37 GLY n 
1 38 GLN n 
1 39 ILE n 
1 40 LEU n 
1 41 ASP n 
1 42 ILE n 
1 43 LEU n 
1 44 VAL n 
1 45 SER n 
1 46 ARG n 
1 47 SER n 
1 48 LEU n 
1 49 LYS n 
1 50 MET n 
1 51 ARG n 
1 52 GLY n 
1 53 GLN n 
1 54 ALA n 
1 55 PHE n 
1 56 VAL n 
1 57 ILE n 
1 58 PHE n 
1 59 LYS n 
1 60 GLU n 
1 61 VAL n 
1 62 SER n 
1 63 SER n 
1 64 ALA n 
1 65 THR n 
1 66 ASN n 
1 67 ALA n 
1 68 LEU n 
1 69 ARG n 
1 70 SER n 
1 71 MET n 
1 72 GLN n 
1 73 GLY n 
1 74 PHE n 
1 75 PRO n 
1 76 PHE n 
1 77 TYR n 
1 78 ASP n 
1 79 LYS n 
1 80 PRO n 
1 81 MET n 
1 82 ARG n 
1 83 ILE n 
1 84 GLN n 
1 85 TYR n 
1 86 ALA n 
1 87 LYS n 
1 88 THR n 
1 89 ASP n 
1 90 SER n 
1 91 ASP n 
1 92 ILE n 
1 93 ILE n 
1 94 ALA n 
1 95 LYS n 
1 96 MET n 
2 1  G   n 
2 2  C   n 
2 3  G   n 
2 4  A   n 
2 5  C   n 
2 6  U   n 
2 7  C   n 
2 8  G   n 
2 9  G   n 
2 10 G   n 
2 11 G   n 
2 12 U   n 
2 13 G   n 
2 14 C   n 
2 15 C   n 
2 16 C   n 
2 17 U   n 
2 18 C   n 
2 19 C   n 
2 20 A   n 
2 21 U   n 
2 22 U   n 
2 23 G   n 
2 24 C   n 
2 25 A   n 
2 26 C   n 
2 27 U   n 
2 28 C   n 
2 29 C   n 
2 30 G   n 
2 31 G   n 
2 32 A   n 
2 33 G   n 
2 34 G   n 
2 35 C   n 
2 36 U   n 
2 37 G   n 
2 38 A   n 
2 39 G   n 
2 40 A   n 
2 41 A   n 
2 42 A   n 
2 43 U   n 
2 44 A   n 
2 45 C   n 
2 46 C   n 
2 47 C   n 
2 48 G   n 
2 49 U   n 
2 50 A   n 
2 51 U   n 
2 52 C   n 
2 53 A   n 
2 54 C   n 
2 55 C   n 
2 56 U   n 
2 57 G   n 
2 58 A   n 
2 59 U   n 
2 60 C   n 
2 61 U   n 
2 62 G   n 
2 63 G   n 
2 64 A   n 
2 65 U   n 
2 66 A   n 
2 67 A   n 
2 68 U   n 
2 69 G   n 
2 70 C   n 
2 71 C   n 
2 72 A   n 
2 73 G   n 
2 74 C   n 
2 75 G   n 
2 76 U   n 
2 77 A   n 
2 78 G   n 
2 79 G   n 
2 80 G   n 
2 81 A   n 
2 82 A   n 
2 83 G   n 
2 84 U   n 
2 85 C   n 
2 86 G   n 
2 87 C   n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'SNRPA, U1A protein' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   'thiM RNA in vitro transcription' 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
_struct_ref.pdbx_db_isoform 
1 UNP SNRPA_HUMAN P09012 1 
;AVPETRPNHTIYINNLNEKIKKDELKKSLYAIFSQFGQILDILVSRSLKMRGQAFVIFKEVSSATNALRSMQGFPFYDKP
MRIQYAKTDSDIIAKM
;
2 ? 
2 PDB 3K0J        3K0J   2 
;GCGACUCGGGGUGCCCUCCAUUGCACUCCGGAGGCUGAGAAAUACCCGUAUCACCUGAUCUGGAUAAUGCCAGCGUAGGG
AAGUCGC
;
1 ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3K0J A 1 ? 96 ? P09012 2   ? 97  ? 202 297 
2 1 3K0J B 1 ? 96 ? P09012 2   ? 97  ? 302 397 
3 1 3K0J C 1 ? 96 ? P09012 2   ? 97  ? 402 497 
4 1 3K0J D 1 ? 96 ? P09012 2   ? 97  ? 502 597 
5 2 3K0J E 1 ? 87 ? 3K0J   4   ? 90  ? 4   90  
6 2 3K0J F 1 ? 87 ? 3K0J   104 ? 190 ? 104 190 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3K0J HIS A 30 ? UNP P09012 TYR 31 ENGINEERED 231 1 
1 3K0J ARG A 35 ? UNP P09012 GLN 36 ENGINEERED 236 2 
2 3K0J HIS B 30 ? UNP P09012 TYR 31 ENGINEERED 331 3 
2 3K0J ARG B 35 ? UNP P09012 GLN 36 ENGINEERED 336 4 
3 3K0J HIS C 30 ? UNP P09012 TYR 31 ENGINEERED 431 5 
3 3K0J ARG C 35 ? UNP P09012 GLN 36 ENGINEERED 436 6 
4 3K0J HIS D 30 ? UNP P09012 TYR 31 ENGINEERED 531 7 
4 3K0J ARG D 35 ? UNP P09012 GLN 36 ENGINEERED 536 8 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A   'RNA linking'       y "ADENOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O7 P'      347.221 
ALA 'L-peptide linking' y ALANINE                      ? 'C3 H7 N O2'           89.093  
ARG 'L-peptide linking' y ARGININE                     ? 'C6 H15 N4 O2 1'       175.209 
ASN 'L-peptide linking' y ASPARAGINE                   ? 'C4 H8 N2 O3'          132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'              ? 'C4 H7 N O4'           133.103 
C   'RNA linking'       y "CYTIDINE-5'-MONOPHOSPHATE"  ? 'C9 H14 N3 O8 P'       323.197 
G   'RNA linking'       y "GUANOSINE-5'-MONOPHOSPHATE" ? 'C10 H14 N5 O8 P'      363.221 
GLN 'L-peptide linking' y GLUTAMINE                    ? 'C5 H10 N2 O3'         146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'              ? 'C5 H9 N O4'           147.129 
GLY 'peptide linking'   y GLYCINE                      ? 'C2 H5 N O2'           75.067  
HIS 'L-peptide linking' y HISTIDINE                    ? 'C6 H10 N3 O2 1'       156.162 
ILE 'L-peptide linking' y ISOLEUCINE                   ? 'C6 H13 N O2'          131.173 
LEU 'L-peptide linking' y LEUCINE                      ? 'C6 H13 N O2'          131.173 
LYS 'L-peptide linking' y LYSINE                       ? 'C6 H15 N2 O2 1'       147.195 
MET 'L-peptide linking' y METHIONINE                   ? 'C5 H11 N O2 S'        149.211 
MG  non-polymer         . 'MAGNESIUM ION'              ? 'Mg 2'                 24.305  
PHE 'L-peptide linking' y PHENYLALANINE                ? 'C9 H11 N O2'          165.189 
PRO 'L-peptide linking' y PROLINE                      ? 'C5 H9 N O2'           115.130 
SER 'L-peptide linking' y SERINE                       ? 'C3 H7 N O3'           105.093 
THR 'L-peptide linking' y THREONINE                    ? 'C4 H9 N O3'           119.119 
TPP non-polymer         . 'THIAMINE DIPHOSPHATE'       ? 'C12 H19 N4 O7 P2 S 1' 425.314 
TYR 'L-peptide linking' y TYROSINE                     ? 'C9 H11 N O3'          181.189 
U   'RNA linking'       y "URIDINE-5'-MONOPHOSPHATE"   ? 'C9 H13 N2 O9 P'       324.181 
VAL 'L-peptide linking' y VALINE                       ? 'C5 H11 N O2'          117.146 
# 
_exptl.entry_id          3K0J 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.38 
_exptl_crystal.density_percent_sol   48.42 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.temp            298 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              5.6 
_exptl_crystal_grow.pdbx_pH_range   ? 
_exptl_crystal_grow.pdbx_details    
'20% (v/v) PEG 550 MME, 20% MPD, and 80 mM sodium citrate (pH 5.6), VAPOR DIFFUSION, temperature 298K' 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   ? 
_diffrn_detector.details                
'vertically collimating premirror, LN2 cooled double-crystal silicon (111) monochromator, toroidal focusing M2 mirror' 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Liquid Nitrogen cooled Dual Crystal' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   . 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ALS BEAMLINE 5.0.2' 
_diffrn_source.pdbx_synchrotron_site       ALS 
_diffrn_source.pdbx_synchrotron_beamline   5.0.2 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        ? 
# 
_reflns.entry_id                     3K0J 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             30.0 
_reflns.d_resolution_high            3.1 
_reflns.number_obs                   17359 
_reflns.number_all                   17454 
_reflns.percent_possible_obs         ? 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.169 
_reflns.pdbx_netI_over_sigmaI        9.3 
_reflns.B_iso_Wilson_estimate        . 
_reflns.pdbx_redundancy              4.4 
_reflns.R_free_details               ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             3.1 
_reflns_shell.d_res_low              3.2 
_reflns_shell.percent_possible_all   ? 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.556 
_reflns_shell.meanI_over_sigI_obs    2.6 
_reflns_shell.pdbx_redundancy        4.2 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      ? 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.entry_id                                 3K0J 
_refine.ls_number_reflns_obs                     16145 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               65867.98 
_refine.pdbx_data_cutoff_low_absF                0.000000 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             29.50 
_refine.ls_d_res_high                            3.10 
_refine.ls_percent_reflns_obs                    93.1 
_refine.ls_R_factor_obs                          0.197 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.197 
_refine.ls_R_factor_R_free                       0.279 
_refine.ls_R_factor_R_free_error                 0.007 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 9.9 
_refine.ls_number_reflns_R_free                  1595 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               42.6 
_refine.aniso_B[1][1]                            -4.38 
_refine.aniso_B[2][2]                            9.21 
_refine.aniso_B[3][3]                            -4.82 
_refine.aniso_B[1][2]                            -0.00 
_refine.aniso_B[1][3]                            1.04 
_refine.aniso_B[2][3]                            0.00 
_refine.solvent_model_details                    'FLAT MODEL' 
_refine.solvent_model_param_ksol                 0.3 
_refine.solvent_model_param_bsol                 23.1472 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  'BULK SOLVENT MODEL USED' 
_refine.pdbx_starting_model                      ? 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             RESTRAINED 
_refine.pdbx_stereochemistry_target_values       ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_analyze.pdbx_refine_id                  'X-RAY DIFFRACTION' 
_refine_analyze.entry_id                        3K0J 
_refine_analyze.Luzzati_coordinate_error_obs    0.34 
_refine_analyze.Luzzati_sigma_a_obs             0.41 
_refine_analyze.Luzzati_d_res_low_obs           5.00 
_refine_analyze.Luzzati_coordinate_error_free   0.50 
_refine_analyze.Luzzati_sigma_a_free            0.60 
_refine_analyze.Luzzati_d_res_low_free          ? 
_refine_analyze.number_disordered_residues      ? 
_refine_analyze.occupancy_sum_hydrogen          ? 
_refine_analyze.occupancy_sum_non_hydrogen      ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2775 
_refine_hist.pdbx_number_atoms_nucleic_acid   3642 
_refine_hist.pdbx_number_atoms_ligand         60 
_refine_hist.number_atoms_solvent             0 
_refine_hist.number_atoms_total               6477 
_refine_hist.d_res_high                       3.10 
_refine_hist.d_res_low                        29.50 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
c_bond_d                0.978 ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_na             ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_bond_d_prot           ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d               ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_na            ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_d_prot          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg             1.9   ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_na          ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_angle_deg_prot        ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d      21.2  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_dihedral_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d      2.53  ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_na   ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_improper_angle_d_prot ?     ?    ? ? 'X-RAY DIFFRACTION' ? 
c_mcbond_it             3.33  1.50 ? ? 'X-RAY DIFFRACTION' ? 
c_mcangle_it            5.36  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scbond_it             4.76  2.00 ? ? 'X-RAY DIFFRACTION' ? 
c_scangle_it            6.88  2.50 ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       3.10 
_refine_ls_shell.d_res_low                        3.29 
_refine_ls_shell.number_reflns_R_work             2306 
_refine_ls_shell.R_factor_R_work                  0.263 
_refine_ls_shell.percent_reflns_obs               89.0 
_refine_ls_shell.R_factor_R_free                  0.353 
_refine_ls_shell.R_factor_R_free_error            0.023 
_refine_ls_shell.percent_reflns_R_free            9.6 
_refine_ls_shell.number_reflns_R_free             244 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.number_reflns_obs                ? 
# 
loop_
_pdbx_xplor_file.pdbx_refine_id 
_pdbx_xplor_file.serial_no 
_pdbx_xplor_file.param_file 
_pdbx_xplor_file.topol_file 
'X-RAY DIFFRACTION' 1 protein_rep.param protein.top    
'X-RAY DIFFRACTION' 2 dna-rna_rep.param dna-rna.top    
'X-RAY DIFFRACTION' 3 water_rep.param   water.top      
'X-RAY DIFFRACTION' 4 ion.param         ion.top        
'X-RAY DIFFRACTION' 5 tpp_may16a.param  tpp_may16a.top 
# 
_struct_ncs_dom.id            1 
_struct_ncs_dom.details       ? 
_struct_ncs_dom.pdbx_ens_id   1 
# 
_struct_ncs_ens.id        1 
_struct_ncs_ens.details   ? 
# 
_struct.entry_id                  3K0J 
_struct.title                     
'Crystal structure of the E. coli ThiM riboswitch in complex with thiamine pyrophosphate and the U1A crystallization module' 
_struct.pdbx_descriptor           'U1 small nuclear ribonucleoprotein A/RNA complex' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3K0J 
_struct_keywords.pdbx_keywords   'RNA/RNA BINDING PROTEIN' 
_struct_keywords.text            
;riboswitch, RNA, thi-box, ThiM, U1A protein, Acetylation, mRNA processing, mRNA splicing, Nucleus, Phosphoprotein, Ribonucleoprotein, RNA-binding, Spliceosome, RNA-RNA BINDING PROTEIN COMPLEX
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 1 ? 
D N N 1 ? 
E N N 2 ? 
F N N 2 ? 
G N N 3 ? 
H N N 4 ? 
I N N 4 ? 
J N N 4 ? 
K N N 4 ? 
L N N 4 ? 
M N N 4 ? 
N N N 3 ? 
O N N 4 ? 
P N N 4 ? 
# 
loop_
_struct_biol.id 
_struct_biol.details 
1 ? 
2 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1  1  LYS A 21 ? SER A 34 ? LYS A 222 SER A 235 1 ? 14 
HELX_P HELX_P2  2  ARG A 35 ? GLY A 37 ? ARG A 236 GLY A 238 5 ? 3  
HELX_P HELX_P3  3  SER A 47 ? ARG A 51 ? SER A 248 ARG A 252 5 ? 5  
HELX_P HELX_P4  4  GLU A 60 ? GLN A 72 ? GLU A 261 GLN A 273 1 ? 13 
HELX_P HELX_P5  5  SER A 90 ? LYS A 95 ? SER A 291 LYS A 296 1 ? 6  
HELX_P HELX_P6  6  ASP B 23 ? SER B 34 ? ASP B 324 SER B 335 1 ? 12 
HELX_P HELX_P7  7  GLU B 60 ? SER B 70 ? GLU B 361 SER B 371 1 ? 11 
HELX_P HELX_P8  8  SER B 90 ? LYS B 95 ? SER B 391 LYS B 396 1 ? 6  
HELX_P HELX_P9  9  LYS C 21 ? SER C 34 ? LYS C 422 SER C 435 1 ? 14 
HELX_P HELX_P10 10 GLU C 60 ? GLN C 72 ? GLU C 461 GLN C 473 1 ? 13 
HELX_P HELX_P11 11 LYS D 21 ? ARG D 35 ? LYS D 522 ARG D 536 1 ? 15 
HELX_P HELX_P12 12 GLU D 60 ? GLN D 72 ? GLU D 561 GLN D 573 1 ? 13 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1   metalc ? ? E G   57 O6  ? ? ? 1_555 I MG .  MG ? ? E G   60  E MG 702 1_555 ? ? ? ? ? ? ?                    2.097 ? 
metalc2   metalc ? ? E G   62 O6  ? ? ? 1_555 M MG .  MG ? ? E G   65  E MG 707 1_555 ? ? ? ? ? ? ?                    2.112 ? 
metalc3   metalc ? ? E G   75 O6  ? ? ? 1_555 I MG .  MG ? ? E G   78  E MG 702 1_555 ? ? ? ? ? ? ?                    2.042 ? 
metalc4   metalc ? ? F G   57 O6  ? ? ? 1_555 O MG .  MG ? ? F G   160 F MG 703 1_555 ? ? ? ? ? ? ?                    2.137 ? 
metalc5   metalc ? ? F G   75 O6  ? ? ? 1_555 O MG .  MG ? ? F G   178 F MG 703 1_555 ? ? ? ? ? ? ?                    1.818 ? 
metalc6   metalc ? ? G TPP .  O2A ? ? ? 1_555 H MG .  MG ? ? E TPP 601 E MG 701 1_555 ? ? ? ? ? ? ?                    2.340 ? 
metalc7   metalc ? ? G TPP .  O1B ? ? ? 1_555 I MG .  MG ? ? E TPP 601 E MG 702 1_555 ? ? ? ? ? ? ?                    1.817 ? 
metalc8   metalc ? ? N TPP .  O3A ? ? ? 1_555 P MG .  MG ? ? F TPP 602 F MG 708 1_555 ? ? ? ? ? ? ?                    1.872 ? 
metalc9   metalc ? ? G TPP .  O3B ? ? ? 1_555 H MG .  MG ? ? E TPP 601 E MG 701 1_555 ? ? ? ? ? ? ?                    2.537 ? 
metalc10  metalc ? ? N TPP .  O7  ? ? ? 1_555 P MG .  MG ? ? F TPP 602 F MG 708 1_555 ? ? ? ? ? ? ?                    2.727 ? 
metalc11  metalc ? ? G TPP .  O3A ? ? ? 1_555 H MG .  MG ? ? E TPP 601 E MG 701 1_555 ? ? ? ? ? ? ?                    2.815 ? 
metalc12  metalc ? ? E G   33 O6  ? ? ? 1_555 K MG .  MG ? ? E G   36  E MG 705 1_555 ? ? ? ? ? ? ?                    2.818 ? 
metalc13  metalc ? ? E U   61 O4  ? ? ? 1_555 M MG .  MG ? ? E U   64  E MG 707 1_555 ? ? ? ? ? ? ?                    2.901 ? 
metalc14  metalc ? ? N TPP .  O2A ? ? ? 1_555 P MG .  MG ? ? F TPP 602 F MG 708 1_555 ? ? ? ? ? ? ?                    2.910 ? 
hydrog1   hydrog ? ? E G   1  N1  ? ? ? 1_555 E C  87 N3 ? ? E G   4   E C  90  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog2   hydrog ? ? E G   1  N2  ? ? ? 1_555 E C  87 O2 ? ? E G   4   E C  90  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog3   hydrog ? ? E G   1  O6  ? ? ? 1_555 E C  87 N4 ? ? E G   4   E C  90  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog4   hydrog ? ? E C   2  N3  ? ? ? 1_555 E G  86 N1 ? ? E C   5   E G  89  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog5   hydrog ? ? E C   2  N4  ? ? ? 1_555 E G  86 O6 ? ? E C   5   E G  89  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog6   hydrog ? ? E C   2  O2  ? ? ? 1_555 E G  86 N2 ? ? E C   5   E G  89  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog7   hydrog ? ? E G   3  N1  ? ? ? 1_555 E C  85 N3 ? ? E G   6   E C  88  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog8   hydrog ? ? E G   3  N2  ? ? ? 1_555 E C  85 O2 ? ? E G   6   E C  88  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog9   hydrog ? ? E G   3  O6  ? ? ? 1_555 E C  85 N4 ? ? E G   6   E C  88  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog10  hydrog ? ? E A   4  N1  ? ? ? 1_555 E U  84 N3 ? ? E A   7   E U  87  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog11  hydrog ? ? E A   4  N6  ? ? ? 1_555 E U  84 O4 ? ? E A   7   E U  87  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog12  hydrog ? ? E C   5  N3  ? ? ? 1_555 E G  83 N1 ? ? E C   8   E G  86  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog13  hydrog ? ? E C   5  N4  ? ? ? 1_555 E G  83 O6 ? ? E C   8   E G  86  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog14  hydrog ? ? E C   5  O2  ? ? ? 1_555 E G  83 N2 ? ? E C   8   E G  86  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog15  hydrog ? ? E U   6  N3  ? ? ? 1_555 E A  82 N1 ? ? E U   9   E A  85  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog16  hydrog ? ? E U   6  O4  ? ? ? 1_555 E A  82 N6 ? ? E U   9   E A  85  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog17  hydrog ? ? E C   7  N3  ? ? ? 1_555 E G  48 N1 ? ? E C   10  E G  51  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog18  hydrog ? ? E C   7  N4  ? ? ? 1_555 E G  48 O6 ? ? E C   10  E G  51  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog19  hydrog ? ? E C   7  O2  ? ? ? 1_555 E G  48 N2 ? ? E C   10  E G  51  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog20  hydrog ? ? E G   8  N1  ? ? ? 1_555 E C  47 N3 ? ? E G   11  E C  50  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog21  hydrog ? ? E G   8  N2  ? ? ? 1_555 E C  47 O2 ? ? E G   11  E C  50  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog22  hydrog ? ? E G   8  O6  ? ? ? 1_555 E C  47 N4 ? ? E G   11  E C  50  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog23  hydrog ? ? E G   8  N2  ? ? ? 1_555 E A  81 N3 ? ? E G   11  E A  84  1_555 ? ? ? ? ? ? 'G-A MISPAIR'        ?     ? 
hydrog24  hydrog ? ? E G   9  N1  ? ? ? 1_555 E C  46 N3 ? ? E G   12  E C  49  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog25  hydrog ? ? E G   9  N2  ? ? ? 1_555 E C  46 O2 ? ? E G   12  E C  49  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog26  hydrog ? ? E G   9  O6  ? ? ? 1_555 E C  46 N4 ? ? E G   12  E C  49  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog27  hydrog ? ? E G   9  N2  ? ? ? 1_555 E A  53 N3 ? ? E G   12  E A  56  1_555 ? ? ? ? ? ? 'G-A MISPAIR'        ?     ? 
hydrog28  hydrog ? ? E G   10 N1  ? ? ? 1_555 E C  45 N3 ? ? E G   13  E C  48  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog29  hydrog ? ? E G   10 N2  ? ? ? 1_555 E C  45 O2 ? ? E G   13  E C  48  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog30  hydrog ? ? E G   10 O6  ? ? ? 1_555 E C  45 N4 ? ? E G   13  E C  48  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog31  hydrog ? ? E G   11 N2  ? ? ? 1_555 E G  39 N3 ? ? E G   14  E G  42  1_555 ? ? ? ? ? ? TYPE_4_PAIR          ?     ? 
hydrog32  hydrog ? ? E G   11 N3  ? ? ? 1_555 E G  39 N2 ? ? E G   14  E G  42  1_555 ? ? ? ? ? ? TYPE_4_PAIR          ?     ? 
hydrog33  hydrog ? ? E G   11 N1  ? ? ? 1_555 E A  44 N1 ? ? E G   14  E A  47  1_555 ? ? ? ? ? ? TYPE_8_PAIR          ?     ? 
hydrog34  hydrog ? ? E G   11 O6  ? ? ? 1_555 E A  44 N6 ? ? E G   14  E A  47  1_555 ? ? ? ? ? ? TYPE_8_PAIR          ?     ? 
hydrog35  hydrog ? ? E U   12 O4  ? ? ? 1_555 E A  42 N6 ? ? E U   15  E A  45  1_555 ? ? ? ? ? ? 'U-A PAIR'           ?     ? 
hydrog36  hydrog ? ? E G   13 N1  ? ? ? 1_555 E C  35 N3 ? ? E G   16  E C  38  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog37  hydrog ? ? E G   13 N2  ? ? ? 1_555 E C  35 O2 ? ? E G   16  E C  38  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog38  hydrog ? ? E G   13 O6  ? ? ? 1_555 E C  35 N4 ? ? E G   16  E C  38  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog39  hydrog ? ? E G   13 N2  ? ? ? 1_555 E U  68 O2 ? ? E G   16  E U  71  1_555 ? ? ? ? ? ? 'G-U MISPAIR'        ?     ? 
hydrog40  hydrog ? ? E C   14 N3  ? ? ? 1_555 E G  34 N1 ? ? E C   17  E G  37  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog41  hydrog ? ? E C   14 N4  ? ? ? 1_555 E G  34 O6 ? ? E C   17  E G  37  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog42  hydrog ? ? E C   14 O2  ? ? ? 1_555 E G  34 N2 ? ? E C   17  E G  37  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog43  hydrog ? ? E C   15 N3  ? ? ? 1_555 E G  33 N1 ? ? E C   18  E G  36  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog44  hydrog ? ? E C   15 N4  ? ? ? 1_555 E G  33 O6 ? ? E C   18  E G  36  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog45  hydrog ? ? E C   15 O2  ? ? ? 1_555 E G  33 N2 ? ? E C   18  E G  36  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog46  hydrog ? ? E U   17 N3  ? ? ? 1_555 E A  32 N1 ? ? E U   20  E A  35  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog47  hydrog ? ? E U   17 O4  ? ? ? 1_555 E A  32 N6 ? ? E U   20  E A  35  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog48  hydrog ? ? E C   18 O2  ? ? ? 1_555 E G  31 N2 ? ? E C   21  E G  34  1_555 ? ? ? ? ? ? 'C-G PAIR'           ?     ? 
hydrog49  hydrog ? ? E C   19 O2  ? ? ? 1_555 E G  30 N2 ? ? E C   22  E G  33  1_555 ? ? ? ? ? ? 'C-G PAIR'           ?     ? 
hydrog50  hydrog ? ? E U   36 N3  ? ? ? 1_555 E A  40 N7 ? ? E U   39  E A  43  1_555 ? ? ? ? ? ? 'REVERSED HOOGSTEEN' ?     ? 
hydrog51  hydrog ? ? E U   36 O2  ? ? ? 1_555 E A  40 N6 ? ? E U   39  E A  43  1_555 ? ? ? ? ? ? 'REVERSED HOOGSTEEN' ?     ? 
hydrog52  hydrog ? ? E A   53 N7  ? ? ? 1_555 E G  80 N2 ? ? E A   56  E G  83  1_555 ? ? ? ? ? ? 'A-G MISPAIR'        ?     ? 
hydrog53  hydrog ? ? E C   54 N3  ? ? ? 1_555 E G  79 N1 ? ? E C   57  E G  82  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog54  hydrog ? ? E C   54 N4  ? ? ? 1_555 E G  79 O6 ? ? E C   57  E G  82  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog55  hydrog ? ? E C   54 O2  ? ? ? 1_555 E G  79 N2 ? ? E C   57  E G  82  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog56  hydrog ? ? E C   55 N3  ? ? ? 1_555 E G  78 N1 ? ? E C   58  E G  81  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog57  hydrog ? ? E C   55 N4  ? ? ? 1_555 E G  78 O6 ? ? E C   58  E G  81  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog58  hydrog ? ? E C   55 O2  ? ? ? 1_555 E G  78 N2 ? ? E C   58  E G  81  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog59  hydrog ? ? E U   56 N3  ? ? ? 1_555 E A  77 N1 ? ? E U   59  E A  80  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog60  hydrog ? ? E U   56 O4  ? ? ? 1_555 E A  77 N6 ? ? E U   59  E A  80  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog61  hydrog ? ? E G   57 N1  ? ? ? 1_555 E G  75 O6 ? ? E G   60  E G  78  1_555 ? ? ? ? ? ? TYPE_6_PAIR          ?     ? 
hydrog62  hydrog ? ? E G   57 N2  ? ? ? 1_555 E G  75 N7 ? ? E G   60  E G  78  1_555 ? ? ? ? ? ? TYPE_6_PAIR          ?     ? 
hydrog63  hydrog ? ? E A   58 N6  ? ? ? 1_555 E C  74 O2 ? ? E A   61  E C  77  1_555 ? ? ? ? ? ? 'A-C MISPAIR'        ?     ? 
hydrog64  hydrog ? ? E C   60 N3  ? ? ? 1_555 E G  73 N1 ? ? E C   63  E G  76  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog65  hydrog ? ? E C   60 N4  ? ? ? 1_555 E G  73 O6 ? ? E C   63  E G  76  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog66  hydrog ? ? E C   60 O2  ? ? ? 1_555 E G  73 N2 ? ? E C   63  E G  76  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog67  hydrog ? ? E U   61 N3  ? ? ? 1_555 E A  72 N1 ? ? E U   64  E A  75  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog68  hydrog ? ? E U   61 O4  ? ? ? 1_555 E A  72 N6 ? ? E U   64  E A  75  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog69  hydrog ? ? E G   62 N1  ? ? ? 1_555 E C  71 N3 ? ? E G   65  E C  74  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog70  hydrog ? ? E G   62 N2  ? ? ? 1_555 E C  71 O2 ? ? E G   65  E C  74  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog71  hydrog ? ? E G   62 O6  ? ? ? 1_555 E C  71 N4 ? ? E G   65  E C  74  1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog72  hydrog ? ? E G   63 N1  ? ? ? 1_555 E C  70 N3 ? ? E G   66  E C  73  1_555 ? ? ? ? ? ? 'G-C PAIR'           ?     ? 
hydrog73  hydrog ? ? F G   1  O6  ? ? ? 1_555 F G  86 N1 ? ? F G   104 F G  189 1_555 ? ? ? ? ? ? 'G-G MISPAIR'        ?     ? 
hydrog74  hydrog ? ? F G   1  N1  ? ? ? 1_555 F C  87 N3 ? ? F G   104 F C  190 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog75  hydrog ? ? F G   1  N2  ? ? ? 1_555 F C  87 O2 ? ? F G   104 F C  190 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog76  hydrog ? ? F G   1  O6  ? ? ? 1_555 F C  87 N4 ? ? F G   104 F C  190 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog77  hydrog ? ? F C   2  N3  ? ? ? 1_555 F G  86 N1 ? ? F C   105 F G  189 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog78  hydrog ? ? F C   2  N4  ? ? ? 1_555 F G  86 O6 ? ? F C   105 F G  189 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog79  hydrog ? ? F C   2  O2  ? ? ? 1_555 F G  86 N2 ? ? F C   105 F G  189 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog80  hydrog ? ? F G   3  N1  ? ? ? 1_555 F C  85 N3 ? ? F G   106 F C  188 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog81  hydrog ? ? F G   3  N2  ? ? ? 1_555 F C  85 O2 ? ? F G   106 F C  188 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog82  hydrog ? ? F G   3  O6  ? ? ? 1_555 F C  85 N4 ? ? F G   106 F C  188 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog83  hydrog ? ? F A   4  N1  ? ? ? 1_555 F U  84 N3 ? ? F A   107 F U  187 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog84  hydrog ? ? F A   4  N6  ? ? ? 1_555 F U  84 O4 ? ? F A   107 F U  187 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog85  hydrog ? ? F C   5  N3  ? ? ? 1_555 F G  83 N1 ? ? F C   108 F G  186 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog86  hydrog ? ? F C   5  N4  ? ? ? 1_555 F G  83 O6 ? ? F C   108 F G  186 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog87  hydrog ? ? F C   5  O2  ? ? ? 1_555 F G  83 N2 ? ? F C   108 F G  186 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog88  hydrog ? ? F U   6  N3  ? ? ? 1_555 F A  82 N1 ? ? F U   109 F A  185 1_555 ? ? ? ? ? ? 'U-A PAIR'           ?     ? 
hydrog89  hydrog ? ? F C   7  O2  ? ? ? 1_555 F G  48 N1 ? ? F C   110 F G  151 1_555 ? ? ? ? ? ? 'C-G PAIR'           ?     ? 
hydrog90  hydrog ? ? F G   8  N1  ? ? ? 1_555 F C  47 N3 ? ? F G   111 F C  150 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog91  hydrog ? ? F G   8  N2  ? ? ? 1_555 F C  47 O2 ? ? F G   111 F C  150 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog92  hydrog ? ? F G   8  O6  ? ? ? 1_555 F C  47 N4 ? ? F G   111 F C  150 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog93  hydrog ? ? F G   8  N2  ? ? ? 1_555 F A  81 N3 ? ? F G   111 F A  184 1_555 ? ? ? ? ? ? 'G-A MISPAIR'        ?     ? 
hydrog94  hydrog ? ? F G   9  N1  ? ? ? 1_555 F C  46 N3 ? ? F G   112 F C  149 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog95  hydrog ? ? F G   9  N2  ? ? ? 1_555 F C  46 O2 ? ? F G   112 F C  149 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog96  hydrog ? ? F G   9  O6  ? ? ? 1_555 F C  46 N4 ? ? F G   112 F C  149 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog97  hydrog ? ? F G   9  N2  ? ? ? 1_555 F A  53 N3 ? ? F G   112 F A  156 1_555 ? ? ? ? ? ? 'G-A MISPAIR'        ?     ? 
hydrog98  hydrog ? ? F G   10 N1  ? ? ? 1_555 F C  45 N3 ? ? F G   113 F C  148 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog99  hydrog ? ? F G   10 N2  ? ? ? 1_555 F C  45 O2 ? ? F G   113 F C  148 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog100 hydrog ? ? F G   10 O6  ? ? ? 1_555 F C  45 N4 ? ? F G   113 F C  148 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog101 hydrog ? ? F G   11 N2  ? ? ? 1_555 F G  39 N3 ? ? F G   114 F G  142 1_555 ? ? ? ? ? ? TYPE_4_PAIR          ?     ? 
hydrog102 hydrog ? ? F G   11 N3  ? ? ? 1_555 F G  39 N2 ? ? F G   114 F G  142 1_555 ? ? ? ? ? ? TYPE_4_PAIR          ?     ? 
hydrog103 hydrog ? ? F G   11 N1  ? ? ? 1_555 F A  44 N1 ? ? F G   114 F A  147 1_555 ? ? ? ? ? ? 'G-A MISPAIR'        ?     ? 
hydrog104 hydrog ? ? F U   12 N3  ? ? ? 1_555 F A  42 N1 ? ? F U   115 F A  145 1_555 ? ? ? ? ? ? 'U-A PAIR'           ?     ? 
hydrog105 hydrog ? ? F G   13 N1  ? ? ? 1_555 F C  35 N3 ? ? F G   116 F C  138 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog106 hydrog ? ? F G   13 N2  ? ? ? 1_555 F C  35 O2 ? ? F G   116 F C  138 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog107 hydrog ? ? F G   13 O6  ? ? ? 1_555 F C  35 N4 ? ? F G   116 F C  138 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog108 hydrog ? ? F G   13 N2  ? ? ? 1_555 F U  68 O2 ? ? F G   116 F U  171 1_555 ? ? ? ? ? ? 'G-U MISPAIR'        ?     ? 
hydrog109 hydrog ? ? F C   14 N3  ? ? ? 1_555 F G  34 N1 ? ? F C   117 F G  137 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog110 hydrog ? ? F C   14 N4  ? ? ? 1_555 F G  34 O6 ? ? F C   117 F G  137 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog111 hydrog ? ? F C   14 O2  ? ? ? 1_555 F G  34 N2 ? ? F C   117 F G  137 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog112 hydrog ? ? F C   15 N3  ? ? ? 1_555 F G  33 N1 ? ? F C   118 F G  136 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog113 hydrog ? ? F C   15 N4  ? ? ? 1_555 F G  33 O6 ? ? F C   118 F G  136 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog114 hydrog ? ? F C   15 O2  ? ? ? 1_555 F G  33 N2 ? ? F C   118 F G  136 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog115 hydrog ? ? F U   17 N3  ? ? ? 1_555 F A  32 N1 ? ? F U   120 F A  135 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog116 hydrog ? ? F U   17 O4  ? ? ? 1_555 F A  32 N6 ? ? F U   120 F A  135 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog117 hydrog ? ? F C   18 N3  ? ? ? 1_555 F G  31 N1 ? ? F C   121 F G  134 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog118 hydrog ? ? F C   18 N4  ? ? ? 1_555 F G  31 O6 ? ? F C   121 F G  134 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog119 hydrog ? ? F C   18 O2  ? ? ? 1_555 F G  31 N2 ? ? F C   121 F G  134 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog120 hydrog ? ? F C   19 O2  ? ? ? 1_555 F G  30 N1 ? ? F C   122 F G  133 1_555 ? ? ? ? ? ? 'C-G PAIR'           ?     ? 
hydrog121 hydrog ? ? F U   21 O2  ? ? ? 1_555 F G  23 N2 ? ? F U   124 F G  126 1_555 ? ? ? ? ? ? 'U-G MISPAIR'        ?     ? 
hydrog122 hydrog ? ? F G   34 N2  ? ? ? 1_555 F A  66 N1 ? ? F G   137 F A  169 1_555 ? ? ? ? ? ? 'G-A MISPAIR'        ?     ? 
hydrog123 hydrog ? ? F U   36 N3  ? ? ? 1_555 F A  40 N7 ? ? F U   139 F A  143 1_555 ? ? ? ? ? ? 'REVERSED HOOGSTEEN' ?     ? 
hydrog124 hydrog ? ? F U   36 O2  ? ? ? 1_555 F A  40 N6 ? ? F U   139 F A  143 1_555 ? ? ? ? ? ? 'REVERSED HOOGSTEEN' ?     ? 
hydrog125 hydrog ? ? F A   50 N7  ? ? ? 1_555 F A  81 N6 ? ? F A   153 F A  184 1_555 ? ? ? ? ? ? 'A-A MISPAIR'        ?     ? 
hydrog126 hydrog ? ? F A   53 N7  ? ? ? 1_555 F G  80 N2 ? ? F A   156 F G  183 1_555 ? ? ? ? ? ? 'A-G MISPAIR'        ?     ? 
hydrog127 hydrog ? ? F C   54 N3  ? ? ? 1_555 F G  79 N1 ? ? F C   157 F G  182 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog128 hydrog ? ? F C   54 N4  ? ? ? 1_555 F G  79 O6 ? ? F C   157 F G  182 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog129 hydrog ? ? F C   54 O2  ? ? ? 1_555 F G  79 N2 ? ? F C   157 F G  182 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog130 hydrog ? ? F C   55 N3  ? ? ? 1_555 F G  78 N1 ? ? F C   158 F G  181 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog131 hydrog ? ? F C   55 N4  ? ? ? 1_555 F G  78 O6 ? ? F C   158 F G  181 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog132 hydrog ? ? F C   55 O2  ? ? ? 1_555 F G  78 N2 ? ? F C   158 F G  181 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog133 hydrog ? ? F U   56 N3  ? ? ? 1_555 F A  77 N1 ? ? F U   159 F A  180 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog134 hydrog ? ? F U   56 O4  ? ? ? 1_555 F A  77 N6 ? ? F U   159 F A  180 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog135 hydrog ? ? F G   57 N2  ? ? ? 1_555 F C  74 O2 ? ? F G   160 F C  177 1_555 ? ? ? ? ? ? 'G-C PAIR'           ?     ? 
hydrog136 hydrog ? ? F G   57 N1  ? ? ? 1_555 F G  75 O6 ? ? F G   160 F G  178 1_555 ? ? ? ? ? ? TYPE_6_PAIR          ?     ? 
hydrog137 hydrog ? ? F G   57 N2  ? ? ? 1_555 F G  75 N7 ? ? F G   160 F G  178 1_555 ? ? ? ? ? ? TYPE_6_PAIR          ?     ? 
hydrog138 hydrog ? ? F A   58 N6  ? ? ? 1_555 F C  74 O2 ? ? F A   161 F C  177 1_555 ? ? ? ? ? ? 'A-C MISPAIR'        ?     ? 
hydrog139 hydrog ? ? F C   60 N3  ? ? ? 1_555 F G  73 N1 ? ? F C   163 F G  176 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog140 hydrog ? ? F C   60 N4  ? ? ? 1_555 F G  73 O6 ? ? F C   163 F G  176 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog141 hydrog ? ? F C   60 O2  ? ? ? 1_555 F G  73 N2 ? ? F C   163 F G  176 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog142 hydrog ? ? F U   61 N3  ? ? ? 1_555 F A  72 N1 ? ? F U   164 F A  175 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog143 hydrog ? ? F U   61 O4  ? ? ? 1_555 F A  72 N6 ? ? F U   164 F A  175 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog144 hydrog ? ? F G   62 N1  ? ? ? 1_555 F C  71 N3 ? ? F G   165 F C  174 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog145 hydrog ? ? F G   62 N2  ? ? ? 1_555 F C  71 O2 ? ? F G   165 F C  174 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog146 hydrog ? ? F G   62 O6  ? ? ? 1_555 F C  71 N4 ? ? F G   165 F C  174 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog147 hydrog ? ? F G   63 N1  ? ? ? 1_555 F C  70 N3 ? ? F G   166 F C  173 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog148 hydrog ? ? F G   63 N2  ? ? ? 1_555 F C  70 O2 ? ? F G   166 F C  173 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
hydrog149 hydrog ? ? F G   63 O6  ? ? ? 1_555 F C  70 N4 ? ? F G   166 F C  173 1_555 ? ? ? ? ? ? WATSON-CRICK         ?     ? 
# 
loop_
_struct_conn_type.id 
_struct_conn_type.criteria 
_struct_conn_type.reference 
metalc ? ? 
hydrog ? ? 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 4 ? 
B ? 2 ? 
C ? 3 ? 
D ? 2 ? 
E ? 4 ? 
F ? 4 ? 
G ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
B 1 2 ? anti-parallel 
C 1 2 ? anti-parallel 
C 2 3 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
E 2 3 ? anti-parallel 
E 3 4 ? anti-parallel 
F 1 2 ? anti-parallel 
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
G 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 39 ? SER A 45 ? ILE A 240 SER A 246 
A 2 GLN A 53 ? PHE A 58 ? GLN A 254 PHE A 259 
A 3 THR A 10 ? ASN A 14 ? THR A 211 ASN A 215 
A 4 ARG A 82 ? TYR A 85 ? ARG A 283 TYR A 286 
B 1 PRO A 75 ? PHE A 76 ? PRO A 276 PHE A 277 
B 2 LYS A 79 ? PRO A 80 ? LYS A 280 PRO A 281 
C 1 THR B 10 ? ILE B 13 ? THR B 311 ILE B 314 
C 2 ALA B 54 ? PHE B 58 ? ALA B 355 PHE B 359 
C 3 ILE B 39 ? VAL B 44 ? ILE B 340 VAL B 345 
D 1 PRO B 75 ? PHE B 76 ? PRO B 376 PHE B 377 
D 2 LYS B 79 ? PRO B 80 ? LYS B 380 PRO B 381 
E 1 ILE C 39 ? VAL C 44 ? ILE C 440 VAL C 445 
E 2 ALA C 54 ? PHE C 58 ? ALA C 455 PHE C 459 
E 3 THR C 10 ? ASN C 14 ? THR C 411 ASN C 415 
E 4 ARG C 82 ? TYR C 85 ? ARG C 483 TYR C 486 
F 1 ILE D 39 ? LEU D 43 ? ILE D 540 LEU D 544 
F 2 GLN D 53 ? PHE D 58 ? GLN D 554 PHE D 559 
F 3 THR D 10 ? ASN D 14 ? THR D 511 ASN D 515 
F 4 ARG D 82 ? TYR D 85 ? ARG D 583 TYR D 586 
G 1 PRO D 75 ? PHE D 76 ? PRO D 576 PHE D 577 
G 2 LYS D 79 ? PRO D 80 ? LYS D 580 PRO D 581 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N LEU A 40 ? N LEU A 241 O ILE A 57 ? O ILE A 258 
A 2 3 O ALA A 54 ? O ALA A 255 N ILE A 13 ? N ILE A 214 
A 3 4 N TYR A 12 ? N TYR A 213 O GLN A 84 ? O GLN A 285 
B 1 2 N PHE A 76 ? N PHE A 277 O LYS A 79 ? O LYS A 280 
C 1 2 N ILE B 13 ? N ILE B 314 O ALA B 54 ? O ALA B 355 
C 2 3 O PHE B 55 ? O PHE B 356 N LEU B 43 ? N LEU B 344 
D 1 2 N PHE B 76 ? N PHE B 377 O LYS B 79 ? O LYS B 380 
E 1 2 N LEU C 40 ? N LEU C 441 O ILE C 57 ? O ILE C 458 
E 2 3 O VAL C 56 ? O VAL C 457 N ILE C 11 ? N ILE C 412 
E 3 4 N TYR C 12 ? N TYR C 413 O GLN C 84 ? O GLN C 485 
F 1 2 N ASP D 41 ? N ASP D 542 O ILE D 57 ? O ILE D 558 
F 2 3 O VAL D 56 ? O VAL D 557 N ILE D 11 ? N ILE D 512 
F 3 4 N TYR D 12 ? N TYR D 513 O GLN D 84 ? O GLN D 585 
G 1 2 N PHE D 76 ? N PHE D 577 O LYS D 79 ? O LYS D 580 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE TPP E 601' 
AC2 Software ? ? ? ? 12 'BINDING SITE FOR RESIDUE TPP F 602' 
AC3 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE MG E 701'  
AC4 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG E 702'  
AC5 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE MG F 703'  
AC6 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE MG E 704'  
AC7 Software ? ? ? ? 1  'BINDING SITE FOR RESIDUE MG E 705'  
AC8 Software ? ? ? ? 2  'BINDING SITE FOR RESIDUE MG E 706'  
AC9 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG E 707'  
BC1 Software ? ? ? ? 3  'BINDING SITE FOR RESIDUE MG F 708'  
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 12 G   E 11 ? G   E 14  . ? 1_555 ? 
2  AC1 12 U   E 12 ? U   E 15  . ? 1_555 ? 
3  AC1 12 G   E 37 ? G   E 40  . ? 1_555 ? 
4  AC1 12 G   E 39 ? G   E 42  . ? 1_555 ? 
5  AC1 12 A   E 40 ? A   E 43  . ? 1_555 ? 
6  AC1 12 C   E 54 ? C   E 57  . ? 1_555 ? 
7  AC1 12 G   E 69 ? G   E 72  . ? 1_555 ? 
8  AC1 12 G   E 73 ? G   E 76  . ? 1_555 ? 
9  AC1 12 C   E 74 ? C   E 77  . ? 1_555 ? 
10 AC1 12 G   E 75 ? G   E 78  . ? 1_555 ? 
11 AC1 12 MG  H .  ? MG  E 701 . ? 1_555 ? 
12 AC1 12 MG  I .  ? MG  E 702 . ? 1_555 ? 
13 AC2 12 G   F 11 ? G   F 114 . ? 1_555 ? 
14 AC2 12 G   F 37 ? G   F 140 . ? 1_555 ? 
15 AC2 12 G   F 39 ? G   F 142 . ? 1_555 ? 
16 AC2 12 A   F 40 ? A   F 143 . ? 1_555 ? 
17 AC2 12 C   F 54 ? C   F 157 . ? 1_555 ? 
18 AC2 12 C   F 55 ? C   F 158 . ? 1_555 ? 
19 AC2 12 G   F 69 ? G   F 172 . ? 1_555 ? 
20 AC2 12 A   F 72 ? A   F 175 . ? 1_555 ? 
21 AC2 12 G   F 73 ? G   F 176 . ? 1_555 ? 
22 AC2 12 C   F 74 ? C   F 177 . ? 1_555 ? 
23 AC2 12 MG  O .  ? MG  F 703 . ? 1_555 ? 
24 AC2 12 MG  P .  ? MG  F 708 . ? 1_555 ? 
25 AC3 1  TPP G .  ? TPP E 601 . ? 1_555 ? 
26 AC4 3  G   E 57 ? G   E 60  . ? 1_555 ? 
27 AC4 3  G   E 75 ? G   E 78  . ? 1_555 ? 
28 AC4 3  TPP G .  ? TPP E 601 . ? 1_555 ? 
29 AC5 5  U   F 56 ? U   F 159 . ? 1_555 ? 
30 AC5 5  G   F 57 ? G   F 160 . ? 1_555 ? 
31 AC5 5  G   F 75 ? G   F 178 . ? 1_555 ? 
32 AC5 5  TPP N .  ? TPP F 602 . ? 1_555 ? 
33 AC5 5  MG  P .  ? MG  F 708 . ? 1_555 ? 
34 AC6 1  C   E 71 ? C   E 74  . ? 1_555 ? 
35 AC7 1  G   E 33 ? G   E 36  . ? 1_555 ? 
36 AC8 2  A   E 77 ? A   E 80  . ? 1_555 ? 
37 AC8 2  G   E 78 ? G   E 81  . ? 1_555 ? 
38 AC9 3  U   E 61 ? U   E 64  . ? 1_555 ? 
39 AC9 3  G   E 62 ? G   E 65  . ? 1_555 ? 
40 AC9 3  G   E 63 ? G   E 66  . ? 1_555 ? 
41 BC1 3  G   F 75 ? G   F 178 . ? 1_555 ? 
42 BC1 3  TPP N .  ? TPP F 602 . ? 1_555 ? 
43 BC1 3  MG  O .  ? MG  F 703 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3K0J 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3K0J 
_atom_sites.fract_transf_matrix[1][1]   0.019139 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.001547 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.013966 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007817 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
MG 
N  
O  
P  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N     . THR A 1 5  ? -7.811  1.265   -42.949  1.00 55.42  ? 206 THR A N     1 
ATOM   2    C  CA    . THR A 1 5  ? -7.533  0.986   -44.392  1.00 59.98  ? 206 THR A CA    1 
ATOM   3    C  C     . THR A 1 5  ? -8.505  -0.026  -45.010  1.00 55.87  ? 206 THR A C     1 
ATOM   4    O  O     . THR A 1 5  ? -9.127  -0.825  -44.305  1.00 47.88  ? 206 THR A O     1 
ATOM   5    C  CB    . THR A 1 5  ? -6.067  0.483   -44.594  1.00 64.50  ? 206 THR A CB    1 
ATOM   6    O  OG1   . THR A 1 5  ? -5.895  0.037   -45.947  1.00 63.33  ? 206 THR A OG1   1 
ATOM   7    C  CG2   . THR A 1 5  ? -5.737  -0.651  -43.627  1.00 62.78  ? 206 THR A CG2   1 
ATOM   8    N  N     . ARG A 1 6  ? -8.633  0.023   -46.333  1.00 55.91  ? 207 ARG A N     1 
ATOM   9    C  CA    . ARG A 1 6  ? -9.527  -0.883  -47.057  1.00 57.28  ? 207 ARG A CA    1 
ATOM   10   C  C     . ARG A 1 6  ? -8.855  -2.226  -47.251  1.00 55.35  ? 207 ARG A C     1 
ATOM   11   O  O     . ARG A 1 6  ? -7.638  -2.300  -47.394  1.00 59.28  ? 207 ARG A O     1 
ATOM   12   C  CB    . ARG A 1 6  ? -9.901  -0.297  -48.426  1.00 57.33  ? 207 ARG A CB    1 
ATOM   13   N  N     . PRO A 1 7  ? -9.640  -3.313  -47.254  1.00 51.26  ? 208 PRO A N     1 
ATOM   14   C  CA    . PRO A 1 7  ? -9.069  -4.647  -47.439  1.00 44.58  ? 208 PRO A CA    1 
ATOM   15   C  C     . PRO A 1 7  ? -8.450  -4.694  -48.815  1.00 38.72  ? 208 PRO A C     1 
ATOM   16   O  O     . PRO A 1 7  ? -8.812  -3.911  -49.683  1.00 35.43  ? 208 PRO A O     1 
ATOM   17   C  CB    . PRO A 1 7  ? -10.285 -5.561  -47.329  1.00 47.50  ? 208 PRO A CB    1 
ATOM   18   C  CG    . PRO A 1 7  ? -11.190 -4.808  -46.420  1.00 51.01  ? 208 PRO A CG    1 
ATOM   19   C  CD    . PRO A 1 7  ? -11.079 -3.403  -46.966  1.00 49.66  ? 208 PRO A CD    1 
ATOM   20   N  N     . ASN A 1 8  ? -7.521  -5.608  -49.022  1.00 34.56  ? 209 ASN A N     1 
ATOM   21   C  CA    . ASN A 1 8  ? -6.881  -5.708  -50.318  1.00 32.94  ? 209 ASN A CA    1 
ATOM   22   C  C     . ASN A 1 8  ? -6.379  -7.123  -50.439  1.00 32.35  ? 209 ASN A C     1 
ATOM   23   O  O     . ASN A 1 8  ? -6.212  -7.793  -49.434  1.00 38.80  ? 209 ASN A O     1 
ATOM   24   C  CB    . ASN A 1 8  ? -5.710  -4.742  -50.376  1.00 34.03  ? 209 ASN A CB    1 
ATOM   25   C  CG    . ASN A 1 8  ? -5.215  -4.517  -51.773  1.00 35.70  ? 209 ASN A CG    1 
ATOM   26   O  OD1   . ASN A 1 8  ? -5.103  -5.449  -52.571  1.00 39.62  ? 209 ASN A OD1   1 
ATOM   27   N  ND2   . ASN A 1 8  ? -4.898  -3.274  -52.081  1.00 36.22  ? 209 ASN A ND2   1 
ATOM   28   N  N     . HIS A 1 9  ? -6.144  -7.595  -51.652  1.00 32.48  ? 210 HIS A N     1 
ATOM   29   C  CA    . HIS A 1 9  ? -5.628  -8.945  -51.804  1.00 35.94  ? 210 HIS A CA    1 
ATOM   30   C  C     . HIS A 1 9  ? -4.216  -8.982  -51.264  1.00 36.80  ? 210 HIS A C     1 
ATOM   31   O  O     . HIS A 1 9  ? -3.721  -10.031 -50.852  1.00 41.11  ? 210 HIS A O     1 
ATOM   32   C  CB    . HIS A 1 9  ? -5.584  -9.345  -53.270  1.00 38.91  ? 210 HIS A CB    1 
ATOM   33   C  CG    . HIS A 1 9  ? -6.910  -9.267  -53.943  1.00 38.65  ? 210 HIS A CG    1 
ATOM   34   N  ND1   . HIS A 1 9  ? -7.622  -8.091  -54.037  1.00 33.79  ? 210 HIS A ND1   1 
ATOM   35   C  CD2   . HIS A 1 9  ? -7.673  -10.223 -54.518  1.00 32.21  ? 210 HIS A CD2   1 
ATOM   36   C  CE1   . HIS A 1 9  ? -8.771  -8.329  -54.641  1.00 36.87  ? 210 HIS A CE1   1 
ATOM   37   N  NE2   . HIS A 1 9  ? -8.827  -9.615  -54.941  1.00 36.08  ? 210 HIS A NE2   1 
ATOM   38   N  N     . THR A 1 10 ? -3.578  -7.818  -51.262  1.00 31.35  ? 211 THR A N     1 
ATOM   39   C  CA    . THR A 1 10 ? -2.205  -7.702  -50.819  1.00 26.43  ? 211 THR A CA    1 
ATOM   40   C  C     . THR A 1 10 ? -2.017  -7.082  -49.436  1.00 24.41  ? 211 THR A C     1 
ATOM   41   O  O     . THR A 1 10 ? -2.535  -6.010  -49.137  1.00 22.47  ? 211 THR A O     1 
ATOM   42   C  CB    . THR A 1 10 ? -1.388  -6.893  -51.860  1.00 26.24  ? 211 THR A CB    1 
ATOM   43   O  OG1   . THR A 1 10 ? -1.530  -7.500  -53.151  1.00 27.74  ? 211 THR A OG1   1 
ATOM   44   C  CG2   . THR A 1 10 ? 0.088   -6.862  -51.491  1.00 29.22  ? 211 THR A CG2   1 
ATOM   45   N  N     . ILE A 1 11 ? -1.269  -7.778  -48.589  1.00 23.70  ? 212 ILE A N     1 
ATOM   46   C  CA    . ILE A 1 11 ? -0.969  -7.280  -47.260  1.00 22.10  ? 212 ILE A CA    1 
ATOM   47   C  C     . ILE A 1 11 ? 0.438   -6.712  -47.316  1.00 22.61  ? 212 ILE A C     1 
ATOM   48   O  O     . ILE A 1 11 ? 1.285   -7.206  -48.061  1.00 22.96  ? 212 ILE A O     1 
ATOM   49   C  CB    . ILE A 1 11 ? -0.995  -8.400  -46.194  1.00 20.71  ? 212 ILE A CB    1 
ATOM   50   C  CG1   . ILE A 1 11 ? -0.082  -9.547  -46.615  1.00 20.00  ? 212 ILE A CG1   1 
ATOM   51   C  CG2   . ILE A 1 11 ? -2.408  -8.887  -45.982  1.00 19.96  ? 212 ILE A CG2   1 
ATOM   52   C  CD1   . ILE A 1 11 ? -0.009  -10.665 -45.606  1.00 20.51  ? 212 ILE A CD1   1 
ATOM   53   N  N     . TYR A 1 12 ? 0.686   -5.673  -46.530  1.00 21.75  ? 213 TYR A N     1 
ATOM   54   C  CA    . TYR A 1 12 ? 2.001   -5.057  -46.487  1.00 21.17  ? 213 TYR A CA    1 
ATOM   55   C  C     . TYR A 1 12 ? 2.671   -5.368  -45.177  1.00 22.93  ? 213 TYR A C     1 
ATOM   56   O  O     . TYR A 1 12 ? 2.172   -4.991  -44.121  1.00 26.17  ? 213 TYR A O     1 
ATOM   57   C  CB    . TYR A 1 12 ? 1.895   -3.557  -46.622  1.00 20.06  ? 213 TYR A CB    1 
ATOM   58   C  CG    . TYR A 1 12 ? 3.195   -2.861  -46.351  1.00 21.92  ? 213 TYR A CG    1 
ATOM   59   C  CD1   . TYR A 1 12 ? 3.376   -2.112  -45.191  1.00 20.94  ? 213 TYR A CD1   1 
ATOM   60   C  CD2   . TYR A 1 12 ? 4.230   -2.905  -47.280  1.00 20.15  ? 213 TYR A CD2   1 
ATOM   61   C  CE1   . TYR A 1 12 ? 4.560   -1.409  -44.971  1.00 28.67  ? 213 TYR A CE1   1 
ATOM   62   C  CE2   . TYR A 1 12 ? 5.415   -2.209  -47.071  1.00 23.86  ? 213 TYR A CE2   1 
ATOM   63   C  CZ    . TYR A 1 12 ? 5.577   -1.459  -45.920  1.00 28.49  ? 213 TYR A CZ    1 
ATOM   64   O  OH    . TYR A 1 12 ? 6.739   -0.741  -45.733  1.00 32.19  ? 213 TYR A OH    1 
ATOM   65   N  N     . ILE A 1 13 ? 3.822   -6.026  -45.254  1.00 24.69  ? 214 ILE A N     1 
ATOM   66   C  CA    . ILE A 1 13 ? 4.564   -6.420  -44.065  1.00 23.82  ? 214 ILE A CA    1 
ATOM   67   C  C     . ILE A 1 13 ? 5.877   -5.669  -43.942  1.00 20.20  ? 214 ILE A C     1 
ATOM   68   O  O     . ILE A 1 13 ? 6.574   -5.492  -44.929  1.00 20.00  ? 214 ILE A O     1 
ATOM   69   C  CB    . ILE A 1 13 ? 4.893   -7.922  -44.108  1.00 23.95  ? 214 ILE A CB    1 
ATOM   70   C  CG1   . ILE A 1 13 ? 3.652   -8.722  -44.503  1.00 22.49  ? 214 ILE A CG1   1 
ATOM   71   C  CG2   . ILE A 1 13 ? 5.408   -8.380  -42.756  1.00 21.18  ? 214 ILE A CG2   1 
ATOM   72   C  CD1   . ILE A 1 13 ? 3.961   -10.165 -44.837  1.00 20.05  ? 214 ILE A CD1   1 
ATOM   73   N  N     . ASN A 1 14 ? 6.206   -5.226  -42.731  1.00 20.40  ? 215 ASN A N     1 
ATOM   74   C  CA    . ASN A 1 14 ? 7.469   -4.532  -42.493  1.00 22.45  ? 215 ASN A CA    1 
ATOM   75   C  C     . ASN A 1 14 ? 8.026   -4.801  -41.082  1.00 21.62  ? 215 ASN A C     1 
ATOM   76   O  O     . ASN A 1 14 ? 7.396   -5.482  -40.274  1.00 19.93  ? 215 ASN A O     1 
ATOM   77   C  CB    . ASN A 1 14 ? 7.337   -3.022  -42.752  1.00 19.92  ? 215 ASN A CB    1 
ATOM   78   C  CG    . ASN A 1 14 ? 6.528   -2.312  -41.701  1.00 23.21  ? 215 ASN A CG    1 
ATOM   79   O  OD1   . ASN A 1 14 ? 6.848   -1.186  -41.326  1.00 24.33  ? 215 ASN A OD1   1 
ATOM   80   N  ND2   . ASN A 1 14 ? 5.465   -2.953  -41.227  1.00 25.48  ? 215 ASN A ND2   1 
ATOM   81   N  N     . ASN A 1 15 ? 9.208   -4.259  -40.802  1.00 17.65  ? 216 ASN A N     1 
ATOM   82   C  CA    . ASN A 1 15 ? 9.890   -4.463  -39.534  1.00 16.70  ? 216 ASN A CA    1 
ATOM   83   C  C     . ASN A 1 15 ? 10.498  -5.855  -39.653  1.00 18.09  ? 216 ASN A C     1 
ATOM   84   O  O     . ASN A 1 15 ? 10.822  -6.517  -38.668  1.00 18.72  ? 216 ASN A O     1 
ATOM   85   C  CB    . ASN A 1 15 ? 8.912   -4.376  -38.354  1.00 20.26  ? 216 ASN A CB    1 
ATOM   86   C  CG    . ASN A 1 15 ? 9.581   -4.660  -37.003  1.00 27.42  ? 216 ASN A CG    1 
ATOM   87   O  OD1   . ASN A 1 15 ? 10.626  -4.087  -36.666  1.00 28.20  ? 216 ASN A OD1   1 
ATOM   88   N  ND2   . ASN A 1 15 ? 8.968   -5.544  -36.222  1.00 23.13  ? 216 ASN A ND2   1 
ATOM   89   N  N     . LEU A 1 16 ? 10.640  -6.302  -40.891  1.00 15.79  ? 217 LEU A N     1 
ATOM   90   C  CA    . LEU A 1 16 ? 11.229  -7.599  -41.155  1.00 13.32  ? 217 LEU A CA    1 
ATOM   91   C  C     . LEU A 1 16 ? 12.720  -7.455  -40.906  1.00 13.75  ? 217 LEU A C     1 
ATOM   92   O  O     . LEU A 1 16 ? 13.276  -6.367  -41.028  1.00 18.14  ? 217 LEU A O     1 
ATOM   93   C  CB    . LEU A 1 16 ? 11.018  -8.009  -42.617  1.00 3.17   ? 217 LEU A CB    1 
ATOM   94   C  CG    . LEU A 1 16 ? 9.622   -8.161  -43.224  1.00 5.43   ? 217 LEU A CG    1 
ATOM   95   C  CD1   . LEU A 1 16 ? 9.755   -8.461  -44.707  1.00 3.17   ? 217 LEU A CD1   1 
ATOM   96   C  CD2   . LEU A 1 16 ? 8.859   -9.267  -42.546  1.00 3.17   ? 217 LEU A CD2   1 
ATOM   97   N  N     . ASN A 1 17 ? 13.363  -8.554  -40.539  1.00 16.05  ? 218 ASN A N     1 
ATOM   98   C  CA    . ASN A 1 17 ? 14.800  -8.560  -40.326  1.00 14.43  ? 218 ASN A CA    1 
ATOM   99   C  C     . ASN A 1 17 ? 15.422  -8.282  -41.696  1.00 17.36  ? 218 ASN A C     1 
ATOM   100  O  O     . ASN A 1 17 ? 15.164  -8.995  -42.683  1.00 9.68   ? 218 ASN A O     1 
ATOM   101  C  CB    . ASN A 1 17 ? 15.238  -9.923  -39.792  1.00 17.86  ? 218 ASN A CB    1 
ATOM   102  C  CG    . ASN A 1 17 ? 16.734  -10.029 -39.604  1.00 18.60  ? 218 ASN A CG    1 
ATOM   103  O  OD1   . ASN A 1 17 ? 17.199  -10.483 -38.566  1.00 26.76  ? 218 ASN A OD1   1 
ATOM   104  N  ND2   . ASN A 1 17 ? 17.496  -9.623  -40.610  1.00 21.73  ? 218 ASN A ND2   1 
ATOM   105  N  N     . GLU A 1 18 ? 16.238  -7.238  -41.754  1.00 17.24  ? 219 GLU A N     1 
ATOM   106  C  CA    . GLU A 1 18 ? 16.864  -6.845  -43.001  1.00 24.80  ? 219 GLU A CA    1 
ATOM   107  C  C     . GLU A 1 18 ? 18.030  -7.697  -43.517  1.00 26.34  ? 219 GLU A C     1 
ATOM   108  O  O     . GLU A 1 18 ? 18.463  -7.510  -44.656  1.00 30.07  ? 219 GLU A O     1 
ATOM   109  C  CB    . GLU A 1 18 ? 17.325  -5.399  -42.894  1.00 26.09  ? 219 GLU A CB    1 
ATOM   110  C  CG    . GLU A 1 18 ? 16.220  -4.383  -42.760  1.00 27.93  ? 219 GLU A CG    1 
ATOM   111  C  CD    . GLU A 1 18 ? 16.779  -2.974  -42.672  1.00 33.49  ? 219 GLU A CD    1 
ATOM   112  O  OE1   . GLU A 1 18 ? 17.654  -2.638  -43.502  1.00 27.00  ? 219 GLU A OE1   1 
ATOM   113  O  OE2   . GLU A 1 18 ? 16.350  -2.207  -41.779  1.00 34.11  ? 219 GLU A OE2   1 
ATOM   114  N  N     . LYS A 1 19 ? 18.550  -8.614  -42.704  1.00 23.83  ? 220 LYS A N     1 
ATOM   115  C  CA    . LYS A 1 19 ? 19.677  -9.444  -43.136  1.00 26.09  ? 220 LYS A CA    1 
ATOM   116  C  C     . LYS A 1 19 ? 19.230  -10.744 -43.780  1.00 27.73  ? 220 LYS A C     1 
ATOM   117  O  O     . LYS A 1 19 ? 20.052  -11.575 -44.175  1.00 27.88  ? 220 LYS A O     1 
ATOM   118  C  CB    . LYS A 1 19 ? 20.613  -9.730  -41.957  1.00 23.77  ? 220 LYS A CB    1 
ATOM   119  C  CG    . LYS A 1 19 ? 21.686  -8.656  -41.748  1.00 34.81  ? 220 LYS A CG    1 
ATOM   120  C  CD    . LYS A 1 19 ? 22.048  -8.456  -40.270  1.00 44.31  ? 220 LYS A CD    1 
ATOM   121  C  CE    . LYS A 1 19 ? 22.688  -9.694  -39.641  1.00 50.25  ? 220 LYS A CE    1 
ATOM   122  N  NZ    . LYS A 1 19 ? 22.795  -9.570  -38.152  1.00 45.83  ? 220 LYS A NZ    1 
ATOM   123  N  N     . ILE A 1 20 ? 17.917  -10.900 -43.901  1.00 29.07  ? 221 ILE A N     1 
ATOM   124  C  CA    . ILE A 1 20 ? 17.342  -12.094 -44.497  1.00 25.31  ? 221 ILE A CA    1 
ATOM   125  C  C     . ILE A 1 20 ? 17.312  -11.898 -45.997  1.00 25.51  ? 221 ILE A C     1 
ATOM   126  O  O     . ILE A 1 20 ? 16.832  -10.871 -46.473  1.00 21.73  ? 221 ILE A O     1 
ATOM   127  C  CB    . ILE A 1 20 ? 15.894  -12.342 -44.015  1.00 21.30  ? 221 ILE A CB    1 
ATOM   128  C  CG1   . ILE A 1 20 ? 15.807  -12.256 -42.484  1.00 17.88  ? 221 ILE A CG1   1 
ATOM   129  C  CG2   . ILE A 1 20 ? 15.425  -13.688 -44.503  1.00 8.81   ? 221 ILE A CG2   1 
ATOM   130  C  CD1   . ILE A 1 20 ? 16.826  -13.094 -41.731  1.00 19.50  ? 221 ILE A CD1   1 
ATOM   131  N  N     . LYS A 1 21 ? 17.827  -12.893 -46.723  1.00 28.38  ? 222 LYS A N     1 
ATOM   132  C  CA    . LYS A 1 21 ? 17.895  -12.892 -48.187  1.00 21.68  ? 222 LYS A CA    1 
ATOM   133  C  C     . LYS A 1 21 ? 16.528  -12.853 -48.838  1.00 24.46  ? 222 LYS A C     1 
ATOM   134  O  O     . LYS A 1 21 ? 15.548  -13.397 -48.313  1.00 22.21  ? 222 LYS A O     1 
ATOM   135  C  CB    . LYS A 1 21 ? 18.623  -14.134 -48.687  1.00 18.41  ? 222 LYS A CB    1 
ATOM   136  C  CG    . LYS A 1 21 ? 20.113  -14.117 -48.468  1.00 24.35  ? 222 LYS A CG    1 
ATOM   137  C  CD    . LYS A 1 21 ? 20.742  -15.440 -48.881  1.00 26.65  ? 222 LYS A CD    1 
ATOM   138  C  CE    . LYS A 1 21 ? 22.256  -15.392 -48.752  1.00 31.50  ? 222 LYS A CE    1 
ATOM   139  N  NZ    . LYS A 1 21 ? 22.694  -15.028 -47.377  1.00 37.15  ? 222 LYS A NZ    1 
ATOM   140  N  N     . LYS A 1 22 ? 16.476  -12.218 -50.001  1.00 20.92  ? 223 LYS A N     1 
ATOM   141  C  CA    . LYS A 1 22 ? 15.235  -12.103 -50.732  1.00 22.40  ? 223 LYS A CA    1 
ATOM   142  C  C     . LYS A 1 22 ? 14.534  -13.451 -50.809  1.00 26.88  ? 223 LYS A C     1 
ATOM   143  O  O     . LYS A 1 22 ? 13.354  -13.561 -50.481  1.00 28.44  ? 223 LYS A O     1 
ATOM   144  C  CB    . LYS A 1 22 ? 15.506  -11.581 -52.124  1.00 9.48   ? 223 LYS A CB    1 
ATOM   145  N  N     . ASP A 1 23 ? 15.277  -14.478 -51.219  1.00 28.40  ? 224 ASP A N     1 
ATOM   146  C  CA    . ASP A 1 23 ? 14.727  -15.814 -51.388  1.00 27.55  ? 224 ASP A CA    1 
ATOM   147  C  C     . ASP A 1 23 ? 14.344  -16.588 -50.141  1.00 31.03  ? 224 ASP A C     1 
ATOM   148  O  O     . ASP A 1 23 ? 13.467  -17.451 -50.204  1.00 32.71  ? 224 ASP A O     1 
ATOM   149  C  CB    . ASP A 1 23 ? 15.671  -16.644 -52.242  1.00 36.95  ? 224 ASP A CB    1 
ATOM   150  C  CG    . ASP A 1 23 ? 15.150  -16.832 -53.652  1.00 46.58  ? 224 ASP A CG    1 
ATOM   151  O  OD1   . ASP A 1 23 ? 14.105  -17.502 -53.803  1.00 55.42  ? 224 ASP A OD1   1 
ATOM   152  O  OD2   . ASP A 1 23 ? 15.769  -16.310 -54.606  1.00 47.19  ? 224 ASP A OD2   1 
ATOM   153  N  N     . GLU A 1 24 ? 14.996  -16.307 -49.016  1.00 30.49  ? 225 GLU A N     1 
ATOM   154  C  CA    . GLU A 1 24 ? 14.648  -16.989 -47.774  1.00 26.30  ? 225 GLU A CA    1 
ATOM   155  C  C     . GLU A 1 24 ? 13.393  -16.308 -47.275  1.00 26.44  ? 225 GLU A C     1 
ATOM   156  O  O     . GLU A 1 24 ? 12.496  -16.946 -46.733  1.00 26.90  ? 225 GLU A O     1 
ATOM   157  C  CB    . GLU A 1 24 ? 15.761  -16.853 -46.745  1.00 28.62  ? 225 GLU A CB    1 
ATOM   158  C  CG    . GLU A 1 24 ? 17.032  -17.552 -47.152  1.00 31.78  ? 225 GLU A CG    1 
ATOM   159  C  CD    . GLU A 1 24 ? 16.791  -18.980 -47.609  1.00 30.36  ? 225 GLU A CD    1 
ATOM   160  O  OE1   . GLU A 1 24 ? 16.417  -19.836 -46.782  1.00 23.67  ? 225 GLU A OE1   1 
ATOM   161  O  OE2   . GLU A 1 24 ? 16.974  -19.244 -48.812  1.00 33.90  ? 225 GLU A OE2   1 
ATOM   162  N  N     . LEU A 1 25 ? 13.348  -14.995 -47.478  1.00 25.25  ? 226 LEU A N     1 
ATOM   163  C  CA    . LEU A 1 25 ? 12.202  -14.184 -47.101  1.00 21.35  ? 226 LEU A CA    1 
ATOM   164  C  C     . LEU A 1 25 ? 10.987  -14.731 -47.842  1.00 20.60  ? 226 LEU A C     1 
ATOM   165  O  O     . LEU A 1 25 ? 9.998   -15.115 -47.223  1.00 24.48  ? 226 LEU A O     1 
ATOM   166  C  CB    . LEU A 1 25 ? 12.447  -12.734 -47.505  1.00 19.11  ? 226 LEU A CB    1 
ATOM   167  C  CG    . LEU A 1 25 ? 12.540  -11.705 -46.379  1.00 21.06  ? 226 LEU A CG    1 
ATOM   168  C  CD1   . LEU A 1 25 ? 13.534  -10.637 -46.766  1.00 19.97  ? 226 LEU A CD1   1 
ATOM   169  C  CD2   . LEU A 1 25 ? 11.181  -11.101 -46.100  1.00 20.60  ? 226 LEU A CD2   1 
ATOM   170  N  N     . LYS A 1 26 ? 11.072  -14.766 -49.170  1.00 20.11  ? 227 LYS A N     1 
ATOM   171  C  CA    . LYS A 1 26 ? 9.987   -15.281 -49.993  1.00 17.56  ? 227 LYS A CA    1 
ATOM   172  C  C     . LYS A 1 26 ? 9.568   -16.652 -49.472  1.00 19.93  ? 227 LYS A C     1 
ATOM   173  O  O     . LYS A 1 26 ? 8.405   -16.838 -49.093  1.00 19.99  ? 227 LYS A O     1 
ATOM   174  C  CB    . LYS A 1 26 ? 10.413  -15.418 -51.463  1.00 14.16  ? 227 LYS A CB    1 
ATOM   175  C  CG    . LYS A 1 26 ? 10.435  -14.152 -52.329  1.00 8.52   ? 227 LYS A CG    1 
ATOM   176  C  CD    . LYS A 1 26 ? 10.545  -14.590 -53.814  1.00 23.06  ? 227 LYS A CD    1 
ATOM   177  C  CE    . LYS A 1 26 ? 11.023  -13.519 -54.810  1.00 15.54  ? 227 LYS A CE    1 
ATOM   178  N  NZ    . LYS A 1 26 ? 10.046  -12.433 -55.110  1.00 22.11  ? 227 LYS A NZ    1 
ATOM   179  N  N     . LYS A 1 27 ? 10.517  -17.598 -49.449  1.00 19.33  ? 228 LYS A N     1 
ATOM   180  C  CA    . LYS A 1 27 ? 10.264  -18.971 -48.983  1.00 18.96  ? 228 LYS A CA    1 
ATOM   181  C  C     . LYS A 1 27 ? 9.652   -18.994 -47.597  1.00 21.23  ? 228 LYS A C     1 
ATOM   182  O  O     . LYS A 1 27 ? 8.588   -19.573 -47.387  1.00 21.43  ? 228 LYS A O     1 
ATOM   183  C  CB    . LYS A 1 27 ? 11.550  -19.804 -48.924  1.00 14.41  ? 228 LYS A CB    1 
ATOM   184  C  CG    . LYS A 1 27 ? 12.225  -20.113 -50.254  1.00 17.50  ? 228 LYS A CG    1 
ATOM   185  C  CD    . LYS A 1 27 ? 12.867  -21.500 -50.206  1.00 15.04  ? 228 LYS A CD    1 
ATOM   186  C  CE    . LYS A 1 27 ? 13.840  -21.745 -51.347  1.00 11.10  ? 228 LYS A CE    1 
ATOM   187  N  NZ    . LYS A 1 27 ? 15.094  -20.942 -51.188  1.00 11.18  ? 228 LYS A NZ    1 
ATOM   188  N  N     . SER A 1 28 ? 10.344  -18.367 -46.650  1.00 19.97  ? 229 SER A N     1 
ATOM   189  C  CA    . SER A 1 28 ? 9.879   -18.319 -45.274  1.00 15.68  ? 229 SER A CA    1 
ATOM   190  C  C     . SER A 1 28 ? 8.547   -17.627 -45.145  1.00 11.60  ? 229 SER A C     1 
ATOM   191  O  O     . SER A 1 28 ? 7.714   -18.050 -44.351  1.00 14.39  ? 229 SER A O     1 
ATOM   192  C  CB    . SER A 1 28 ? 10.907  -17.628 -44.381  1.00 17.41  ? 229 SER A CB    1 
ATOM   193  O  OG    . SER A 1 28 ? 11.984  -18.501 -44.087  1.00 16.48  ? 229 SER A OG    1 
ATOM   194  N  N     . LEU A 1 29 ? 8.344   -16.566 -45.918  1.00 7.80   ? 230 LEU A N     1 
ATOM   195  C  CA    . LEU A 1 29 ? 7.085   -15.838 -45.866  1.00 14.08  ? 230 LEU A CA    1 
ATOM   196  C  C     . LEU A 1 29 ? 5.924   -16.672 -46.388  1.00 20.36  ? 230 LEU A C     1 
ATOM   197  O  O     . LEU A 1 29 ? 4.787   -16.527 -45.915  1.00 22.00  ? 230 LEU A O     1 
ATOM   198  C  CB    . LEU A 1 29 ? 7.170   -14.524 -46.640  1.00 8.95   ? 230 LEU A CB    1 
ATOM   199  C  CG    . LEU A 1 29 ? 7.855   -13.386 -45.884  1.00 10.05  ? 230 LEU A CG    1 
ATOM   200  C  CD1   . LEU A 1 29 ? 7.607   -12.093 -46.596  1.00 18.46  ? 230 LEU A CD1   1 
ATOM   201  C  CD2   . LEU A 1 29 ? 7.309   -13.269 -44.502  1.00 8.30   ? 230 LEU A CD2   1 
ATOM   202  N  N     . HIS A 1 30 ? 6.198   -17.541 -47.359  1.00 17.17  ? 231 HIS A N     1 
ATOM   203  C  CA    . HIS A 1 30 ? 5.151   -18.410 -47.891  1.00 14.43  ? 231 HIS A CA    1 
ATOM   204  C  C     . HIS A 1 30 ? 4.782   -19.406 -46.797  1.00 14.60  ? 231 HIS A C     1 
ATOM   205  O  O     . HIS A 1 30 ? 3.673   -19.913 -46.760  1.00 8.70   ? 231 HIS A O     1 
ATOM   206  C  CB    . HIS A 1 30 ? 5.641   -19.184 -49.113  1.00 19.20  ? 231 HIS A CB    1 
ATOM   207  C  CG    . HIS A 1 30 ? 4.626   -20.136 -49.662  1.00 26.13  ? 231 HIS A CG    1 
ATOM   208  N  ND1   . HIS A 1 30 ? 3.579   -19.729 -50.462  1.00 29.68  ? 231 HIS A ND1   1 
ATOM   209  C  CD2   . HIS A 1 30 ? 4.454   -21.467 -49.470  1.00 29.94  ? 231 HIS A CD2   1 
ATOM   210  C  CE1   . HIS A 1 30 ? 2.804   -20.765 -50.736  1.00 26.99  ? 231 HIS A CE1   1 
ATOM   211  N  NE2   . HIS A 1 30 ? 3.312   -21.832 -50.145  1.00 32.08  ? 231 HIS A NE2   1 
ATOM   212  N  N     . ALA A 1 31 ? 5.732   -19.675 -45.904  1.00 17.05  ? 232 ALA A N     1 
ATOM   213  C  CA    . ALA A 1 31 ? 5.544   -20.603 -44.794  1.00 16.03  ? 232 ALA A CA    1 
ATOM   214  C  C     . ALA A 1 31 ? 4.532   -20.081 -43.772  1.00 20.12  ? 232 ALA A C     1 
ATOM   215  O  O     . ALA A 1 31 ? 3.587   -20.780 -43.373  1.00 22.86  ? 232 ALA A O     1 
ATOM   216  C  CB    . ALA A 1 31 ? 6.866   -20.842 -44.129  1.00 10.65  ? 232 ALA A CB    1 
ATOM   217  N  N     . ILE A 1 32 ? 4.742   -18.846 -43.345  1.00 18.69  ? 233 ILE A N     1 
ATOM   218  C  CA    . ILE A 1 32 ? 3.855   -18.219 -42.386  1.00 24.21  ? 233 ILE A CA    1 
ATOM   219  C  C     . ILE A 1 32 ? 2.455   -17.996 -42.960  1.00 26.63  ? 233 ILE A C     1 
ATOM   220  O  O     . ILE A 1 32 ? 1.457   -18.313 -42.312  1.00 23.04  ? 233 ILE A O     1 
ATOM   221  C  CB    . ILE A 1 32 ? 4.422   -16.829 -41.919  1.00 27.74  ? 233 ILE A CB    1 
ATOM   222  C  CG1   . ILE A 1 32 ? 5.078   -16.954 -40.541  1.00 28.48  ? 233 ILE A CG1   1 
ATOM   223  C  CG2   . ILE A 1 32 ? 3.307   -15.787 -41.838  1.00 24.76  ? 233 ILE A CG2   1 
ATOM   224  C  CD1   . ILE A 1 32 ? 6.581   -16.979 -40.564  1.00 30.89  ? 233 ILE A CD1   1 
ATOM   225  N  N     . PHE A 1 33 ? 2.396   -17.480 -44.187  1.00 24.40  ? 234 PHE A N     1 
ATOM   226  C  CA    . PHE A 1 33 ? 1.131   -17.121 -44.818  1.00 21.73  ? 234 PHE A CA    1 
ATOM   227  C  C     . PHE A 1 33 ? 0.301   -18.049 -45.696  1.00 20.67  ? 234 PHE A C     1 
ATOM   228  O  O     . PHE A 1 33 ? -0.788  -17.657 -46.106  1.00 23.45  ? 234 PHE A O     1 
ATOM   229  C  CB    . PHE A 1 33 ? 1.336   -15.805 -45.565  1.00 21.26  ? 234 PHE A CB    1 
ATOM   230  C  CG    . PHE A 1 33 ? 1.612   -14.648 -44.662  1.00 22.29  ? 234 PHE A CG    1 
ATOM   231  C  CD1   . PHE A 1 33 ? 0.601   -14.107 -43.880  1.00 26.82  ? 234 PHE A CD1   1 
ATOM   232  C  CD2   . PHE A 1 33 ? 2.892   -14.139 -44.540  1.00 29.80  ? 234 PHE A CD2   1 
ATOM   233  C  CE1   . PHE A 1 33 ? 0.863   -13.076 -42.979  1.00 30.24  ? 234 PHE A CE1   1 
ATOM   234  C  CE2   . PHE A 1 33 ? 3.168   -13.108 -43.646  1.00 30.86  ? 234 PHE A CE2   1 
ATOM   235  C  CZ    . PHE A 1 33 ? 2.149   -12.576 -42.862  1.00 30.06  ? 234 PHE A CZ    1 
ATOM   236  N  N     . SER A 1 34 ? 0.771   -19.256 -45.992  1.00 20.54  ? 235 SER A N     1 
ATOM   237  C  CA    . SER A 1 34 ? -0.008  -20.177 -46.837  1.00 17.66  ? 235 SER A CA    1 
ATOM   238  C  C     . SER A 1 34 ? -1.412  -20.415 -46.284  1.00 13.65  ? 235 SER A C     1 
ATOM   239  O  O     . SER A 1 34 ? -2.420  -20.155 -46.943  1.00 3.44   ? 235 SER A O     1 
ATOM   240  C  CB    . SER A 1 34 ? 0.706   -21.518 -46.949  1.00 20.55  ? 235 SER A CB    1 
ATOM   241  O  OG    . SER A 1 34 ? 1.833   -21.418 -47.794  1.00 34.23  ? 235 SER A OG    1 
ATOM   242  N  N     . ARG A 1 35 ? -1.431  -20.937 -45.067  1.00 7.41   ? 236 ARG A N     1 
ATOM   243  C  CA    . ARG A 1 35 ? -2.618  -21.235 -44.302  1.00 7.29   ? 236 ARG A CA    1 
ATOM   244  C  C     . ARG A 1 35 ? -3.888  -20.538 -44.733  1.00 13.29  ? 236 ARG A C     1 
ATOM   245  O  O     . ARG A 1 35 ? -4.902  -21.178 -44.972  1.00 21.72  ? 236 ARG A O     1 
ATOM   246  C  CB    . ARG A 1 35 ? -2.358  -20.859 -42.855  1.00 8.27   ? 236 ARG A CB    1 
ATOM   247  C  CG    . ARG A 1 35 ? -1.028  -21.333 -42.348  1.00 18.93  ? 236 ARG A CG    1 
ATOM   248  C  CD    . ARG A 1 35 ? -0.693  -20.742 -40.998  1.00 14.57  ? 236 ARG A CD    1 
ATOM   249  N  NE    . ARG A 1 35 ? 0.566   -21.295 -40.519  1.00 17.92  ? 236 ARG A NE    1 
ATOM   250  C  CZ    . ARG A 1 35 ? 0.704   -22.551 -40.111  1.00 29.54  ? 236 ARG A CZ    1 
ATOM   251  N  NH1   . ARG A 1 35 ? -0.336  -23.375 -40.121  1.00 33.12  ? 236 ARG A NH1   1 
ATOM   252  N  NH2   . ARG A 1 35 ? 1.876   -22.987 -39.688  1.00 36.31  ? 236 ARG A NH2   1 
ATOM   253  N  N     . PHE A 1 36 ? -3.812  -19.214 -44.806  1.00 14.89  ? 237 PHE A N     1 
ATOM   254  C  CA    . PHE A 1 36 ? -4.933  -18.333 -45.132  1.00 10.68  ? 237 PHE A CA    1 
ATOM   255  C  C     . PHE A 1 36 ? -5.515  -18.328 -46.527  1.00 12.87  ? 237 PHE A C     1 
ATOM   256  O  O     . PHE A 1 36 ? -6.660  -17.933 -46.709  1.00 14.47  ? 237 PHE A O     1 
ATOM   257  C  CB    . PHE A 1 36 ? -4.530  -16.918 -44.774  1.00 15.51  ? 237 PHE A CB    1 
ATOM   258  C  CG    . PHE A 1 36 ? -3.819  -16.846 -43.498  1.00 14.99  ? 237 PHE A CG    1 
ATOM   259  C  CD1   . PHE A 1 36 ? -4.527  -16.833 -42.306  1.00 12.39  ? 237 PHE A CD1   1 
ATOM   260  C  CD2   . PHE A 1 36 ? -2.438  -16.933 -43.470  1.00 15.71  ? 237 PHE A CD2   1 
ATOM   261  C  CE1   . PHE A 1 36 ? -3.876  -16.918 -41.099  1.00 18.13  ? 237 PHE A CE1   1 
ATOM   262  C  CE2   . PHE A 1 36 ? -1.763  -17.021 -42.269  1.00 23.98  ? 237 PHE A CE2   1 
ATOM   263  C  CZ    . PHE A 1 36 ? -2.483  -17.014 -41.073  1.00 26.99  ? 237 PHE A CZ    1 
ATOM   264  N  N     . GLY A 1 37 ? -4.742  -18.730 -47.522  1.00 10.49  ? 238 GLY A N     1 
ATOM   265  C  CA    . GLY A 1 37 ? -5.289  -18.720 -48.858  1.00 18.23  ? 238 GLY A CA    1 
ATOM   266  C  C     . GLY A 1 37 ? -4.229  -18.958 -49.898  1.00 27.33  ? 238 GLY A C     1 
ATOM   267  O  O     . GLY A 1 37 ? -3.032  -19.009 -49.583  1.00 22.47  ? 238 GLY A O     1 
ATOM   268  N  N     . GLN A 1 38 ? -4.677  -19.114 -51.140  1.00 31.53  ? 239 GLN A N     1 
ATOM   269  C  CA    . GLN A 1 38 ? -3.770  -19.346 -52.248  1.00 31.46  ? 239 GLN A CA    1 
ATOM   270  C  C     . GLN A 1 38 ? -3.053  -18.027 -52.499  1.00 30.31  ? 239 GLN A C     1 
ATOM   271  O  O     . GLN A 1 38 ? -3.675  -16.983 -52.676  1.00 29.67  ? 239 GLN A O     1 
ATOM   272  C  CB    . GLN A 1 38 ? -4.550  -19.778 -53.488  1.00 29.80  ? 239 GLN A CB    1 
ATOM   273  C  CG    . GLN A 1 38 ? -3.767  -20.656 -54.439  1.00 33.78  ? 239 GLN A CG    1 
ATOM   274  C  CD    . GLN A 1 38 ? -3.648  -20.073 -55.841  1.00 39.62  ? 239 GLN A CD    1 
ATOM   275  O  OE1   . GLN A 1 38 ? -4.646  -19.684 -56.459  1.00 37.36  ? 239 GLN A OE1   1 
ATOM   276  N  NE2   . GLN A 1 38 ? -2.419  -20.023 -56.356  1.00 39.13  ? 239 GLN A NE2   1 
ATOM   277  N  N     . ILE A 1 39 ? -1.733  -18.076 -52.471  1.00 31.55  ? 240 ILE A N     1 
ATOM   278  C  CA    . ILE A 1 39 ? -0.930  -16.891 -52.689  1.00 29.89  ? 240 ILE A CA    1 
ATOM   279  C  C     . ILE A 1 39 ? -0.545  -16.843 -54.153  1.00 29.43  ? 240 ILE A C     1 
ATOM   280  O  O     . ILE A 1 39 ? -0.289  -17.878 -54.775  1.00 27.18  ? 240 ILE A O     1 
ATOM   281  C  CB    . ILE A 1 39 ? 0.336   -16.923 -51.809  1.00 29.34  ? 240 ILE A CB    1 
ATOM   282  C  CG1   . ILE A 1 39 ? -0.073  -16.801 -50.340  1.00 31.14  ? 240 ILE A CG1   1 
ATOM   283  C  CG2   . ILE A 1 39 ? 1.292   -15.809 -52.204  1.00 30.78  ? 240 ILE A CG2   1 
ATOM   284  C  CD1   . ILE A 1 39 ? 1.034   -17.057 -49.363  1.00 28.63  ? 240 ILE A CD1   1 
ATOM   285  N  N     . LEU A 1 40 ? -0.516  -15.636 -54.702  1.00 26.65  ? 241 LEU A N     1 
ATOM   286  C  CA    . LEU A 1 40 ? -0.167  -15.450 -56.092  1.00 20.81  ? 241 LEU A CA    1 
ATOM   287  C  C     . LEU A 1 40 ? 1.288   -15.039 -56.212  1.00 23.98  ? 241 LEU A C     1 
ATOM   288  O  O     . LEU A 1 40 ? 1.908   -15.232 -57.253  1.00 20.62  ? 241 LEU A O     1 
ATOM   289  C  CB    . LEU A 1 40 ? -1.070  -14.392 -56.714  1.00 22.85  ? 241 LEU A CB    1 
ATOM   290  C  CG    . LEU A 1 40 ? -2.562  -14.733 -56.660  1.00 23.04  ? 241 LEU A CG    1 
ATOM   291  C  CD1   . LEU A 1 40 ? -3.379  -13.577 -57.219  1.00 23.99  ? 241 LEU A CD1   1 
ATOM   292  C  CD2   . LEU A 1 40 ? -2.819  -16.014 -57.442  1.00 15.38  ? 241 LEU A CD2   1 
ATOM   293  N  N     . ASP A 1 41 ? 1.847   -14.486 -55.144  1.00 27.29  ? 242 ASP A N     1 
ATOM   294  C  CA    . ASP A 1 41 ? 3.242   -14.068 -55.200  1.00 34.05  ? 242 ASP A CA    1 
ATOM   295  C  C     . ASP A 1 41 ? 3.675   -13.267 -53.980  1.00 36.01  ? 242 ASP A C     1 
ATOM   296  O  O     . ASP A 1 41 ? 2.848   -12.685 -53.274  1.00 40.33  ? 242 ASP A O     1 
ATOM   297  C  CB    . ASP A 1 41 ? 3.479   -13.222 -56.453  1.00 35.85  ? 242 ASP A CB    1 
ATOM   298  C  CG    . ASP A 1 41 ? 4.859   -13.391 -57.008  1.00 34.40  ? 242 ASP A CG    1 
ATOM   299  O  OD1   . ASP A 1 41 ? 5.150   -14.475 -57.554  1.00 34.00  ? 242 ASP A OD1   1 
ATOM   300  O  OD2   . ASP A 1 41 ? 5.652   -12.442 -56.892  1.00 39.93  ? 242 ASP A OD2   1 
ATOM   301  N  N     . ILE A 1 42 ? 4.985   -13.244 -53.751  1.00 32.02  ? 243 ILE A N     1 
ATOM   302  C  CA    . ILE A 1 42 ? 5.576   -12.512 -52.642  1.00 27.72  ? 243 ILE A CA    1 
ATOM   303  C  C     . ILE A 1 42 ? 6.663   -11.664 -53.259  1.00 20.01  ? 243 ILE A C     1 
ATOM   304  O  O     . ILE A 1 42 ? 7.582   -12.177 -53.875  1.00 16.90  ? 243 ILE A O     1 
ATOM   305  C  CB    . ILE A 1 42 ? 6.216   -13.462 -51.601  1.00 37.34  ? 243 ILE A CB    1 
ATOM   306  C  CG1   . ILE A 1 42 ? 5.179   -14.487 -51.107  1.00 36.26  ? 243 ILE A CG1   1 
ATOM   307  C  CG2   . ILE A 1 42 ? 6.786   -12.641 -50.432  1.00 38.28  ? 243 ILE A CG2   1 
ATOM   308  C  CD1   . ILE A 1 42 ? 5.740   -15.536 -50.148  1.00 32.73  ? 243 ILE A CD1   1 
ATOM   309  N  N     . LEU A 1 43 ? 6.566   -10.359 -53.088  1.00 20.90  ? 244 LEU A N     1 
ATOM   310  C  CA    . LEU A 1 43 ? 7.549   -9.474  -53.681  1.00 25.37  ? 244 LEU A CA    1 
ATOM   311  C  C     . LEU A 1 43 ? 8.479   -8.813  -52.674  1.00 26.54  ? 244 LEU A C     1 
ATOM   312  O  O     . LEU A 1 43 ? 8.040   -7.996  -51.857  1.00 24.71  ? 244 LEU A O     1 
ATOM   313  C  CB    . LEU A 1 43 ? 6.811   -8.428  -54.505  1.00 26.62  ? 244 LEU A CB    1 
ATOM   314  C  CG    . LEU A 1 43 ? 6.019   -9.140  -55.598  1.00 23.82  ? 244 LEU A CG    1 
ATOM   315  C  CD1   . LEU A 1 43 ? 4.969   -8.227  -56.197  1.00 25.61  ? 244 LEU A CD1   1 
ATOM   316  C  CD2   . LEU A 1 43 ? 7.003   -9.641  -56.638  1.00 23.77  ? 244 LEU A CD2   1 
ATOM   317  N  N     . VAL A 1 44 ? 9.764   -9.172  -52.751  1.00 22.18  ? 245 VAL A N     1 
ATOM   318  C  CA    . VAL A 1 44 ? 10.783  -8.635  -51.850  1.00 20.63  ? 245 VAL A CA    1 
ATOM   319  C  C     . VAL A 1 44 ? 11.819  -7.734  -52.536  1.00 17.85  ? 245 VAL A C     1 
ATOM   320  O  O     . VAL A 1 44 ? 12.235  -7.980  -53.658  1.00 17.15  ? 245 VAL A O     1 
ATOM   321  C  CB    . VAL A 1 44 ? 11.548  -9.768  -51.121  1.00 19.46  ? 245 VAL A CB    1 
ATOM   322  C  CG1   . VAL A 1 44 ? 12.360  -9.185  -49.971  1.00 20.34  ? 245 VAL A CG1   1 
ATOM   323  C  CG2   . VAL A 1 44 ? 10.579  -10.815 -50.609  1.00 19.34  ? 245 VAL A CG2   1 
ATOM   324  N  N     . SER A 1 45 ? 12.226  -6.681  -51.843  1.00 20.97  ? 246 SER A N     1 
ATOM   325  C  CA    . SER A 1 45 ? 13.213  -5.754  -52.362  1.00 18.52  ? 246 SER A CA    1 
ATOM   326  C  C     . SER A 1 45 ? 14.132  -5.372  -51.218  1.00 22.06  ? 246 SER A C     1 
ATOM   327  O  O     . SER A 1 45 ? 13.664  -5.044  -50.130  1.00 26.97  ? 246 SER A O     1 
ATOM   328  C  CB    . SER A 1 45 ? 12.540  -4.507  -52.894  1.00 18.59  ? 246 SER A CB    1 
ATOM   329  O  OG    . SER A 1 45 ? 13.504  -3.510  -53.144  1.00 23.72  ? 246 SER A OG    1 
ATOM   330  N  N     . ARG A 1 46 ? 15.436  -5.416  -51.463  1.00 19.27  ? 247 ARG A N     1 
ATOM   331  C  CA    . ARG A 1 46 ? 16.415  -5.085  -50.442  1.00 15.94  ? 247 ARG A CA    1 
ATOM   332  C  C     . ARG A 1 46 ? 17.000  -3.712  -50.692  1.00 21.38  ? 247 ARG A C     1 
ATOM   333  O  O     . ARG A 1 46 ? 17.961  -3.303  -50.058  1.00 18.70  ? 247 ARG A O     1 
ATOM   334  C  CB    . ARG A 1 46 ? 17.519  -6.135  -50.427  1.00 15.51  ? 247 ARG A CB    1 
ATOM   335  C  CG    . ARG A 1 46 ? 16.979  -7.551  -50.313  1.00 16.54  ? 247 ARG A CG    1 
ATOM   336  C  CD    . ARG A 1 46 ? 17.483  -8.256  -49.078  1.00 13.99  ? 247 ARG A CD    1 
ATOM   337  N  NE    . ARG A 1 46 ? 18.896  -8.583  -49.190  1.00 26.00  ? 247 ARG A NE    1 
ATOM   338  C  CZ    . ARG A 1 46 ? 19.599  -9.196  -48.246  1.00 30.96  ? 247 ARG A CZ    1 
ATOM   339  N  NH1   . ARG A 1 46 ? 19.023  -9.554  -47.108  1.00 33.65  ? 247 ARG A NH1   1 
ATOM   340  N  NH2   . ARG A 1 46 ? 20.881  -9.455  -48.444  1.00 39.19  ? 247 ARG A NH2   1 
ATOM   341  N  N     . SER A 1 47 ? 16.404  -2.996  -51.632  1.00 31.81  ? 248 SER A N     1 
ATOM   342  C  CA    . SER A 1 47 ? 16.856  -1.653  -51.947  1.00 39.10  ? 248 SER A CA    1 
ATOM   343  C  C     . SER A 1 47 ? 16.566  -0.743  -50.759  1.00 37.13  ? 248 SER A C     1 
ATOM   344  O  O     . SER A 1 47 ? 15.477  -0.787  -50.183  1.00 42.21  ? 248 SER A O     1 
ATOM   345  C  CB    . SER A 1 47 ? 16.141  -1.130  -53.205  1.00 46.90  ? 248 SER A CB    1 
ATOM   346  O  OG    . SER A 1 47 ? 14.730  -1.263  -53.113  1.00 59.12  ? 248 SER A OG    1 
ATOM   347  N  N     . LEU A 1 48 ? 17.552  0.061   -50.386  1.00 29.50  ? 249 LEU A N     1 
ATOM   348  C  CA    . LEU A 1 48 ? 17.406  0.987   -49.278  1.00 27.39  ? 249 LEU A CA    1 
ATOM   349  C  C     . LEU A 1 48 ? 15.947  1.365   -49.054  1.00 28.31  ? 249 LEU A C     1 
ATOM   350  O  O     . LEU A 1 48 ? 15.402  1.154   -47.975  1.00 28.50  ? 249 LEU A O     1 
ATOM   351  C  CB    . LEU A 1 48 ? 18.226  2.250   -49.551  1.00 24.91  ? 249 LEU A CB    1 
ATOM   352  C  CG    . LEU A 1 48 ? 17.909  3.498   -48.720  1.00 19.91  ? 249 LEU A CG    1 
ATOM   353  C  CD1   . LEU A 1 48 ? 18.485  3.351   -47.333  1.00 14.27  ? 249 LEU A CD1   1 
ATOM   354  C  CD2   . LEU A 1 48 ? 18.474  4.729   -49.404  1.00 15.01  ? 249 LEU A CD2   1 
ATOM   355  N  N     . LYS A 1 49 ? 15.309  1.911   -50.080  1.00 29.88  ? 250 LYS A N     1 
ATOM   356  C  CA    . LYS A 1 49 ? 13.916  2.322   -49.958  1.00 34.82  ? 250 LYS A CA    1 
ATOM   357  C  C     . LYS A 1 49 ? 13.005  1.193   -49.470  1.00 33.75  ? 250 LYS A C     1 
ATOM   358  O  O     . LYS A 1 49 ? 12.270  1.350   -48.495  1.00 29.74  ? 250 LYS A O     1 
ATOM   359  C  CB    . LYS A 1 49 ? 13.377  2.840   -51.307  1.00 43.90  ? 250 LYS A CB    1 
ATOM   360  C  CG    . LYS A 1 49 ? 14.135  4.005   -51.967  1.00 48.97  ? 250 LYS A CG    1 
ATOM   361  C  CD    . LYS A 1 49 ? 13.885  5.365   -51.294  1.00 55.57  ? 250 LYS A CD    1 
ATOM   362  C  CE    . LYS A 1 49 ? 14.658  5.524   -49.973  1.00 61.95  ? 250 LYS A CE    1 
ATOM   363  N  NZ    . LYS A 1 49 ? 14.541  6.888   -49.365  1.00 57.37  ? 250 LYS A NZ    1 
ATOM   364  N  N     . MET A 1 50 ? 13.068  0.048   -50.140  1.00 34.76  ? 251 MET A N     1 
ATOM   365  C  CA    . MET A 1 50 ? 12.194  -1.060  -49.798  1.00 39.30  ? 251 MET A CA    1 
ATOM   366  C  C     . MET A 1 50 ? 12.723  -2.261  -49.038  1.00 35.97  ? 251 MET A C     1 
ATOM   367  O  O     . MET A 1 50 ? 12.107  -3.327  -49.077  1.00 35.88  ? 251 MET A O     1 
ATOM   368  C  CB    . MET A 1 50 ? 11.507  -1.559  -51.062  1.00 44.05  ? 251 MET A CB    1 
ATOM   369  C  CG    . MET A 1 50 ? 10.103  -1.036  -51.230  1.00 47.91  ? 251 MET A CG    1 
ATOM   370  S  SD    . MET A 1 50 ? 9.323   -1.950  -52.538  1.00 56.32  ? 251 MET A SD    1 
ATOM   371  C  CE    . MET A 1 50 ? 9.414   -3.618  -51.852  1.00 56.57  ? 251 MET A CE    1 
ATOM   372  N  N     . ARG A 1 51 ? 13.840  -2.111  -48.340  1.00 32.37  ? 252 ARG A N     1 
ATOM   373  C  CA    . ARG A 1 51 ? 14.370  -3.238  -47.588  1.00 30.11  ? 252 ARG A CA    1 
ATOM   374  C  C     . ARG A 1 51 ? 13.600  -3.454  -46.291  1.00 30.61  ? 252 ARG A C     1 
ATOM   375  O  O     . ARG A 1 51 ? 13.024  -2.524  -45.720  1.00 30.90  ? 252 ARG A O     1 
ATOM   376  C  CB    . ARG A 1 51 ? 15.856  -3.040  -47.295  1.00 30.86  ? 252 ARG A CB    1 
ATOM   377  C  CG    . ARG A 1 51 ? 16.201  -1.936  -46.323  1.00 25.47  ? 252 ARG A CG    1 
ATOM   378  C  CD    . ARG A 1 51 ? 17.612  -1.448  -46.601  1.00 37.19  ? 252 ARG A CD    1 
ATOM   379  N  NE    . ARG A 1 51 ? 18.485  -2.534  -47.044  1.00 49.68  ? 252 ARG A NE    1 
ATOM   380  C  CZ    . ARG A 1 51 ? 19.725  -2.372  -47.498  1.00 53.08  ? 252 ARG A CZ    1 
ATOM   381  N  NH1   . ARG A 1 51 ? 20.254  -1.155  -47.575  1.00 46.81  ? 252 ARG A NH1   1 
ATOM   382  N  NH2   . ARG A 1 51 ? 20.438  -3.431  -47.878  1.00 53.02  ? 252 ARG A NH2   1 
ATOM   383  N  N     . GLY A 1 52 ? 13.577  -4.695  -45.831  1.00 27.08  ? 253 GLY A N     1 
ATOM   384  C  CA    . GLY A 1 52 ? 12.864  -4.985  -44.607  1.00 21.54  ? 253 GLY A CA    1 
ATOM   385  C  C     . GLY A 1 52 ? 11.360  -5.003  -44.796  1.00 19.49  ? 253 GLY A C     1 
ATOM   386  O  O     . GLY A 1 52 ? 10.615  -5.099  -43.826  1.00 22.91  ? 253 GLY A O     1 
ATOM   387  N  N     . GLN A 1 53 ? 10.899  -4.918  -46.036  1.00 12.99  ? 254 GLN A N     1 
ATOM   388  C  CA    . GLN A 1 53 ? 9.471   -4.935  -46.287  1.00 9.05   ? 254 GLN A CA    1 
ATOM   389  C  C     . GLN A 1 53 ? 9.154   -6.014  -47.294  1.00 9.07   ? 254 GLN A C     1 
ATOM   390  O  O     . GLN A 1 53 ? 10.056  -6.598  -47.892  1.00 8.75   ? 254 GLN A O     1 
ATOM   391  C  CB    . GLN A 1 53 ? 9.018   -3.587  -46.824  1.00 12.29  ? 254 GLN A CB    1 
ATOM   392  C  CG    . GLN A 1 53 ? 9.512   -2.418  -46.014  1.00 20.51  ? 254 GLN A CG    1 
ATOM   393  C  CD    . GLN A 1 53 ? 9.623   -1.159  -46.837  1.00 21.96  ? 254 GLN A CD    1 
ATOM   394  O  OE1   . GLN A 1 53 ? 8.623   -0.549  -47.203  1.00 22.10  ? 254 GLN A OE1   1 
ATOM   395  N  NE2   . GLN A 1 53 ? 10.851  -0.769  -47.144  1.00 21.06  ? 254 GLN A NE2   1 
ATOM   396  N  N     . ALA A 1 54 ? 7.864   -6.262  -47.488  1.00 8.65   ? 255 ALA A N     1 
ATOM   397  C  CA    . ALA A 1 54 ? 7.415   -7.277  -48.425  1.00 9.37   ? 255 ALA A CA    1 
ATOM   398  C  C     . ALA A 1 54 ? 5.932   -7.140  -48.700  1.00 8.45   ? 255 ALA A C     1 
ATOM   399  O  O     . ALA A 1 54 ? 5.200   -6.556  -47.915  1.00 8.54   ? 255 ALA A O     1 
ATOM   400  C  CB    . ALA A 1 54 ? 7.713   -8.656  -47.872  1.00 6.86   ? 255 ALA A CB    1 
ATOM   401  N  N     . PHE A 1 55 ? 5.497   -7.674  -49.832  1.00 11.62  ? 256 PHE A N     1 
ATOM   402  C  CA    . PHE A 1 55 ? 4.089   -7.635  -50.205  1.00 14.74  ? 256 PHE A CA    1 
ATOM   403  C  C     . PHE A 1 55 ? 3.640   -9.045  -50.517  1.00 20.15  ? 256 PHE A C     1 
ATOM   404  O  O     . PHE A 1 55 ? 4.256   -9.729  -51.332  1.00 22.78  ? 256 PHE A O     1 
ATOM   405  C  CB    . PHE A 1 55 ? 3.857   -6.796  -51.462  1.00 14.18  ? 256 PHE A CB    1 
ATOM   406  C  CG    . PHE A 1 55 ? 4.283   -5.370  -51.336  1.00 9.34   ? 256 PHE A CG    1 
ATOM   407  C  CD1   . PHE A 1 55 ? 5.613   -5.017  -51.463  1.00 10.27  ? 256 PHE A CD1   1 
ATOM   408  C  CD2   . PHE A 1 55 ? 3.352   -4.382  -51.084  1.00 6.96   ? 256 PHE A CD2   1 
ATOM   409  C  CE1   . PHE A 1 55 ? 6.005   -3.708  -51.339  1.00 5.39   ? 256 PHE A CE1   1 
ATOM   410  C  CE2   . PHE A 1 55 ? 3.737   -3.074  -50.958  1.00 9.17   ? 256 PHE A CE2   1 
ATOM   411  C  CZ    . PHE A 1 55 ? 5.067   -2.733  -51.086  1.00 8.73   ? 256 PHE A CZ    1 
ATOM   412  N  N     . VAL A 1 56 ? 2.576   -9.494  -49.874  1.00 22.56  ? 257 VAL A N     1 
ATOM   413  C  CA    . VAL A 1 56 ? 2.083   -10.824 -50.161  1.00 22.88  ? 257 VAL A CA    1 
ATOM   414  C  C     . VAL A 1 56 ? 0.753   -10.676 -50.882  1.00 26.38  ? 257 VAL A C     1 
ATOM   415  O  O     . VAL A 1 56 ? -0.205  -10.127 -50.338  1.00 20.37  ? 257 VAL A O     1 
ATOM   416  C  CB    . VAL A 1 56 ? 1.904   -11.655 -48.877  1.00 22.85  ? 257 VAL A CB    1 
ATOM   417  C  CG1   . VAL A 1 56 ? 1.313   -13.019 -49.223  1.00 15.82  ? 257 VAL A CG1   1 
ATOM   418  C  CG2   . VAL A 1 56 ? 3.247   -11.811 -48.176  1.00 9.35   ? 257 VAL A CG2   1 
ATOM   419  N  N     . ILE A 1 57 ? 0.717   -11.160 -52.119  1.00 29.84  ? 258 ILE A N     1 
ATOM   420  C  CA    . ILE A 1 57 ? -0.470  -11.095 -52.954  1.00 31.79  ? 258 ILE A CA    1 
ATOM   421  C  C     . ILE A 1 57 ? -1.312  -12.349 -52.805  1.00 35.49  ? 258 ILE A C     1 
ATOM   422  O  O     . ILE A 1 57 ? -0.855  -13.453 -53.088  1.00 35.20  ? 258 ILE A O     1 
ATOM   423  C  CB    . ILE A 1 57 ? -0.077  -10.940 -54.413  1.00 32.02  ? 258 ILE A CB    1 
ATOM   424  C  CG1   . ILE A 1 57 ? 0.681   -9.627  -54.591  1.00 34.88  ? 258 ILE A CG1   1 
ATOM   425  C  CG2   . ILE A 1 57 ? -1.307  -10.984 -55.289  1.00 31.94  ? 258 ILE A CG2   1 
ATOM   426  C  CD1   . ILE A 1 57 ? 1.411   -9.513  -55.913  1.00 43.23  ? 258 ILE A CD1   1 
ATOM   427  N  N     . PHE A 1 58 ? -2.550  -12.158 -52.367  1.00 38.91  ? 259 PHE A N     1 
ATOM   428  C  CA    . PHE A 1 58 ? -3.487  -13.251 -52.152  1.00 42.16  ? 259 PHE A CA    1 
ATOM   429  C  C     . PHE A 1 58 ? -4.550  -13.347 -53.235  1.00 41.51  ? 259 PHE A C     1 
ATOM   430  O  O     . PHE A 1 58 ? -5.086  -12.337 -53.690  1.00 41.48  ? 259 PHE A O     1 
ATOM   431  C  CB    . PHE A 1 58 ? -4.209  -13.064 -50.825  1.00 47.84  ? 259 PHE A CB    1 
ATOM   432  C  CG    . PHE A 1 58 ? -3.467  -13.584 -49.638  1.00 48.70  ? 259 PHE A CG    1 
ATOM   433  C  CD1   . PHE A 1 58 ? -3.052  -14.906 -49.586  1.00 50.03  ? 259 PHE A CD1   1 
ATOM   434  C  CD2   . PHE A 1 58 ? -3.293  -12.784 -48.515  1.00 47.83  ? 259 PHE A CD2   1 
ATOM   435  C  CE1   . PHE A 1 58 ? -2.487  -15.429 -48.428  1.00 49.13  ? 259 PHE A CE1   1 
ATOM   436  C  CE2   . PHE A 1 58 ? -2.729  -13.297 -47.353  1.00 46.73  ? 259 PHE A CE2   1 
ATOM   437  C  CZ    . PHE A 1 58 ? -2.329  -14.622 -47.308  1.00 47.87  ? 259 PHE A CZ    1 
ATOM   438  N  N     . LYS A 1 59 ? -4.875  -14.571 -53.624  1.00 43.77  ? 260 LYS A N     1 
ATOM   439  C  CA    . LYS A 1 59 ? -5.904  -14.801 -54.628  1.00 43.53  ? 260 LYS A CA    1 
ATOM   440  C  C     . LYS A 1 59 ? -7.219  -14.250 -54.075  1.00 40.33  ? 260 LYS A C     1 
ATOM   441  O  O     . LYS A 1 59 ? -8.013  -13.678 -54.812  1.00 37.44  ? 260 LYS A O     1 
ATOM   442  C  CB    . LYS A 1 59 ? -6.033  -16.306 -54.909  1.00 44.97  ? 260 LYS A CB    1 
ATOM   443  C  CG    . LYS A 1 59 ? -7.089  -16.702 -55.931  1.00 47.78  ? 260 LYS A CG    1 
ATOM   444  C  CD    . LYS A 1 59 ? -7.230  -18.227 -55.991  1.00 51.87  ? 260 LYS A CD    1 
ATOM   445  C  CE    . LYS A 1 59 ? -8.307  -18.703 -56.988  1.00 53.24  ? 260 LYS A CE    1 
ATOM   446  N  NZ    . LYS A 1 59 ? -7.840  -18.868 -58.404  1.00 46.54  ? 260 LYS A NZ    1 
ATOM   447  N  N     . GLU A 1 60 ? -7.433  -14.417 -52.771  1.00 39.40  ? 261 GLU A N     1 
ATOM   448  C  CA    . GLU A 1 60 ? -8.654  -13.937 -52.124  1.00 41.87  ? 261 GLU A CA    1 
ATOM   449  C  C     . GLU A 1 60 ? -8.359  -12.795 -51.174  1.00 40.54  ? 261 GLU A C     1 
ATOM   450  O  O     . GLU A 1 60 ? -7.279  -12.738 -50.588  1.00 43.94  ? 261 GLU A O     1 
ATOM   451  C  CB    . GLU A 1 60 ? -9.318  -15.050 -51.317  1.00 41.99  ? 261 GLU A CB    1 
ATOM   452  C  CG    . GLU A 1 60 ? -9.768  -16.251 -52.119  1.00 49.56  ? 261 GLU A CG    1 
ATOM   453  C  CD    . GLU A 1 60 ? -10.949 -15.947 -53.007  1.00 52.08  ? 261 GLU A CD    1 
ATOM   454  O  OE1   . GLU A 1 60 ? -11.983 -15.459 -52.489  1.00 51.32  ? 261 GLU A OE1   1 
ATOM   455  O  OE2   . GLU A 1 60 ? -10.839 -16.205 -54.224  1.00 53.53  ? 261 GLU A OE2   1 
ATOM   456  N  N     . VAL A 1 61 ? -9.321  -11.891 -51.018  1.00 34.58  ? 262 VAL A N     1 
ATOM   457  C  CA    . VAL A 1 61 ? -9.145  -10.773 -50.100  1.00 30.74  ? 262 VAL A CA    1 
ATOM   458  C  C     . VAL A 1 61 ? -9.553  -11.266 -48.716  1.00 32.46  ? 262 VAL A C     1 
ATOM   459  O  O     . VAL A 1 61 ? -8.994  -10.834 -47.708  1.00 36.91  ? 262 VAL A O     1 
ATOM   460  C  CB    . VAL A 1 61 ? -10.004 -9.541  -50.504  1.00 25.51  ? 262 VAL A CB    1 
ATOM   461  C  CG1   . VAL A 1 61 ? -9.891  -8.449  -49.480  1.00 9.52   ? 262 VAL A CG1   1 
ATOM   462  C  CG2   . VAL A 1 61 ? -9.524  -9.005  -51.800  1.00 21.61  ? 262 VAL A CG2   1 
ATOM   463  N  N     . SER A 1 62 ? -10.524 -12.177 -48.665  1.00 31.81  ? 263 SER A N     1 
ATOM   464  C  CA    . SER A 1 62 ? -10.956 -12.722 -47.381  1.00 26.92  ? 263 SER A CA    1 
ATOM   465  C  C     . SER A 1 62 ? -9.691  -13.281 -46.754  1.00 24.73  ? 263 SER A C     1 
ATOM   466  O  O     . SER A 1 62 ? -9.468  -13.145 -45.551  1.00 24.67  ? 263 SER A O     1 
ATOM   467  C  CB    . SER A 1 62 ? -11.990 -13.837 -47.575  1.00 20.11  ? 263 SER A CB    1 
ATOM   468  O  OG    . SER A 1 62 ? -11.487 -14.871 -48.402  1.00 15.73  ? 263 SER A OG    1 
ATOM   469  N  N     . SER A 1 63 ? -8.856  -13.879 -47.604  1.00 20.92  ? 264 SER A N     1 
ATOM   470  C  CA    . SER A 1 63 ? -7.586  -14.466 -47.197  1.00 19.14  ? 264 SER A CA    1 
ATOM   471  C  C     . SER A 1 63 ? -6.637  -13.478 -46.536  1.00 17.48  ? 264 SER A C     1 
ATOM   472  O  O     . SER A 1 63 ? -6.059  -13.780 -45.494  1.00 24.03  ? 264 SER A O     1 
ATOM   473  C  CB    . SER A 1 63 ? -6.875  -15.093 -48.398  1.00 21.70  ? 264 SER A CB    1 
ATOM   474  O  OG    . SER A 1 63 ? -7.113  -16.487 -48.484  1.00 21.56  ? 264 SER A OG    1 
ATOM   475  N  N     . ALA A 1 64 ? -6.461  -12.307 -47.133  1.00 11.81  ? 265 ALA A N     1 
ATOM   476  C  CA    . ALA A 1 64 ? -5.556  -11.317 -46.559  1.00 14.51  ? 265 ALA A CA    1 
ATOM   477  C  C     . ALA A 1 64 ? -6.013  -10.860 -45.166  1.00 15.19  ? 265 ALA A C     1 
ATOM   478  O  O     . ALA A 1 64 ? -5.210  -10.770 -44.219  1.00 3.17   ? 265 ALA A O     1 
ATOM   479  C  CB    . ALA A 1 64 ? -5.427  -10.133 -47.498  1.00 15.76  ? 265 ALA A CB    1 
ATOM   480  N  N     . THR A 1 65 ? -7.304  -10.572 -45.043  1.00 16.82  ? 266 THR A N     1 
ATOM   481  C  CA    . THR A 1 65 ? -7.857  -10.153 -43.766  1.00 21.68  ? 266 THR A CA    1 
ATOM   482  C  C     . THR A 1 65 ? -7.553  -11.290 -42.805  1.00 25.80  ? 266 THR A C     1 
ATOM   483  O  O     . THR A 1 65 ? -7.018  -11.091 -41.717  1.00 25.34  ? 266 THR A O     1 
ATOM   484  C  CB    . THR A 1 65 ? -9.377  -9.994  -43.846  1.00 20.53  ? 266 THR A CB    1 
ATOM   485  O  OG1   . THR A 1 65 ? -9.724  -9.295  -45.045  1.00 17.22  ? 266 THR A OG1   1 
ATOM   486  C  CG2   . THR A 1 65 ? -9.892  -9.219  -42.645  1.00 18.23  ? 266 THR A CG2   1 
ATOM   487  N  N     . ASN A 1 66 ? -7.903  -12.492 -43.248  1.00 27.90  ? 267 ASN A N     1 
ATOM   488  C  CA    . ASN A 1 66 ? -7.701  -13.715 -42.494  1.00 30.90  ? 267 ASN A CA    1 
ATOM   489  C  C     . ASN A 1 66 ? -6.247  -13.853 -42.060  1.00 29.21  ? 267 ASN A C     1 
ATOM   490  O  O     . ASN A 1 66 ? -5.952  -14.436 -41.020  1.00 28.87  ? 267 ASN A O     1 
ATOM   491  C  CB    . ASN A 1 66 ? -8.106  -14.904 -43.362  1.00 40.24  ? 267 ASN A CB    1 
ATOM   492  C  CG    . ASN A 1 66 ? -8.773  -16.002 -42.568  1.00 54.61  ? 267 ASN A CG    1 
ATOM   493  O  OD1   . ASN A 1 66 ? -9.572  -15.731 -41.667  1.00 62.05  ? 267 ASN A OD1   1 
ATOM   494  N  ND2   . ASN A 1 66 ? -8.467  -17.255 -42.907  1.00 59.11  ? 267 ASN A ND2   1 
ATOM   495  N  N     . ALA A 1 67 ? -5.337  -13.312 -42.860  1.00 26.66  ? 268 ALA A N     1 
ATOM   496  C  CA    . ALA A 1 67 ? -3.922  -13.382 -42.536  1.00 26.89  ? 268 ALA A CA    1 
ATOM   497  C  C     . ALA A 1 67 ? -3.504  -12.240 -41.615  1.00 28.22  ? 268 ALA A C     1 
ATOM   498  O  O     . ALA A 1 67 ? -3.008  -12.472 -40.511  1.00 31.36  ? 268 ALA A O     1 
ATOM   499  C  CB    . ALA A 1 67 ? -3.094  -13.361 -43.807  1.00 24.46  ? 268 ALA A CB    1 
ATOM   500  N  N     . LEU A 1 68 ? -3.712  -11.008 -42.062  1.00 23.13  ? 269 LEU A N     1 
ATOM   501  C  CA    . LEU A 1 68 ? -3.341  -9.843  -41.269  1.00 24.96  ? 269 LEU A CA    1 
ATOM   502  C  C     . LEU A 1 68 ? -3.893  -9.887  -39.845  1.00 30.75  ? 269 LEU A C     1 
ATOM   503  O  O     . LEU A 1 68 ? -3.154  -9.713  -38.872  1.00 32.20  ? 269 LEU A O     1 
ATOM   504  C  CB    . LEU A 1 68 ? -3.798  -8.568  -41.994  1.00 19.89  ? 269 LEU A CB    1 
ATOM   505  C  CG    . LEU A 1 68 ? -4.176  -7.233  -41.335  1.00 13.91  ? 269 LEU A CG    1 
ATOM   506  C  CD1   . LEU A 1 68 ? -3.343  -6.923  -40.129  1.00 15.02  ? 269 LEU A CD1   1 
ATOM   507  C  CD2   . LEU A 1 68 ? -4.016  -6.144  -42.375  1.00 14.96  ? 269 LEU A CD2   1 
ATOM   508  N  N     . ARG A 1 69 ? -5.188  -10.139 -39.717  1.00 32.91  ? 270 ARG A N     1 
ATOM   509  C  CA    . ARG A 1 69 ? -5.804  -10.165 -38.405  1.00 28.99  ? 270 ARG A CA    1 
ATOM   510  C  C     . ARG A 1 69 ? -5.112  -11.157 -37.515  1.00 24.54  ? 270 ARG A C     1 
ATOM   511  O  O     . ARG A 1 69 ? -4.798  -10.849 -36.365  1.00 26.22  ? 270 ARG A O     1 
ATOM   512  C  CB    . ARG A 1 69 ? -7.290  -10.511 -38.507  1.00 34.91  ? 270 ARG A CB    1 
ATOM   513  C  CG    . ARG A 1 69 ? -8.105  -10.022 -37.312  1.00 43.30  ? 270 ARG A CG    1 
ATOM   514  C  CD    . ARG A 1 69 ? -9.610  -10.022 -37.594  1.00 49.91  ? 270 ARG A CD    1 
ATOM   515  N  NE    . ARG A 1 69 ? -9.987  -9.112  -38.679  1.00 52.75  ? 270 ARG A NE    1 
ATOM   516  C  CZ    . ARG A 1 69 ? -11.229 -8.960  -39.138  1.00 48.72  ? 270 ARG A CZ    1 
ATOM   517  N  NH1   . ARG A 1 69 ? -12.228 -9.654  -38.608  1.00 45.11  ? 270 ARG A NH1   1 
ATOM   518  N  NH2   . ARG A 1 69 ? -11.470 -8.121  -40.138  1.00 44.21  ? 270 ARG A NH2   1 
ATOM   519  N  N     . SER A 1 70 ? -4.852  -12.343 -38.050  1.00 18.41  ? 271 SER A N     1 
ATOM   520  C  CA    . SER A 1 70 ? -4.206  -13.386 -37.261  1.00 20.10  ? 271 SER A CA    1 
ATOM   521  C  C     . SER A 1 70 ? -2.700  -13.232 -37.011  1.00 18.22  ? 271 SER A C     1 
ATOM   522  O  O     . SER A 1 70 ? -2.254  -13.344 -35.871  1.00 11.79  ? 271 SER A O     1 
ATOM   523  C  CB    . SER A 1 70 ? -4.495  -14.759 -37.875  1.00 14.15  ? 271 SER A CB    1 
ATOM   524  O  OG    . SER A 1 70 ? -4.051  -14.817 -39.210  1.00 16.63  ? 271 SER A OG    1 
ATOM   525  N  N     . MET A 1 71 ? -1.919  -12.955 -38.049  1.00 14.76  ? 272 MET A N     1 
ATOM   526  C  CA    . MET A 1 71 ? -0.475  -12.838 -37.873  1.00 18.83  ? 272 MET A CA    1 
ATOM   527  C  C     . MET A 1 71 ? 0.069   -11.495 -37.395  1.00 21.95  ? 272 MET A C     1 
ATOM   528  O  O     . MET A 1 71 ? 1.285   -11.315 -37.302  1.00 16.77  ? 272 MET A O     1 
ATOM   529  C  CB    . MET A 1 71 ? 0.237   -13.224 -39.164  1.00 25.72  ? 272 MET A CB    1 
ATOM   530  C  CG    . MET A 1 71 ? 0.028   -14.663 -39.582  1.00 29.20  ? 272 MET A CG    1 
ATOM   531  S  SD    . MET A 1 71 ? 0.624   -15.828 -38.359  1.00 28.54  ? 272 MET A SD    1 
ATOM   532  C  CE    . MET A 1 71 ? 2.382   -15.706 -38.549  1.00 23.08  ? 272 MET A CE    1 
ATOM   533  N  N     . GLN A 1 72 ? -0.819  -10.559 -37.083  1.00 26.03  ? 273 GLN A N     1 
ATOM   534  C  CA    . GLN A 1 72 ? -0.401  -9.236  -36.617  1.00 28.27  ? 273 GLN A CA    1 
ATOM   535  C  C     . GLN A 1 72 ? 0.497   -9.263  -35.383  1.00 24.19  ? 273 GLN A C     1 
ATOM   536  O  O     . GLN A 1 72 ? 0.066   -9.683  -34.313  1.00 22.53  ? 273 GLN A O     1 
ATOM   537  C  CB    . GLN A 1 72 ? -1.624  -8.375  -36.299  1.00 33.60  ? 273 GLN A CB    1 
ATOM   538  C  CG    . GLN A 1 72 ? -1.268  -6.945  -35.947  1.00 33.18  ? 273 GLN A CG    1 
ATOM   539  C  CD    . GLN A 1 72 ? -0.653  -6.218  -37.127  1.00 34.87  ? 273 GLN A CD    1 
ATOM   540  O  OE1   . GLN A 1 72 ? -1.360  -5.677  -37.981  1.00 23.40  ? 273 GLN A OE1   1 
ATOM   541  N  NE2   . GLN A 1 72 ? 0.673   -6.224  -37.192  1.00 37.10  ? 273 GLN A NE2   1 
ATOM   542  N  N     . GLY A 1 73 ? 1.734   -8.794  -35.543  1.00 22.22  ? 274 GLY A N     1 
ATOM   543  C  CA    . GLY A 1 73 ? 2.679   -8.747  -34.442  1.00 20.17  ? 274 GLY A CA    1 
ATOM   544  C  C     . GLY A 1 73 ? 3.398   -10.048 -34.157  1.00 21.97  ? 274 GLY A C     1 
ATOM   545  O  O     . GLY A 1 73 ? 4.266   -10.115 -33.286  1.00 18.97  ? 274 GLY A O     1 
ATOM   546  N  N     . PHE A 1 74 ? 3.042   -11.093 -34.891  1.00 26.61  ? 275 PHE A N     1 
ATOM   547  C  CA    . PHE A 1 74 ? 3.662   -12.391 -34.684  1.00 34.79  ? 275 PHE A CA    1 
ATOM   548  C  C     . PHE A 1 74 ? 5.140   -12.405 -35.019  1.00 35.14  ? 275 PHE A C     1 
ATOM   549  O  O     . PHE A 1 74 ? 5.575   -11.753 -35.964  1.00 34.57  ? 275 PHE A O     1 
ATOM   550  C  CB    . PHE A 1 74 ? 2.897   -13.440 -35.517  1.00 43.60  ? 275 PHE A CB    1 
ATOM   551  C  CG    . PHE A 1 74 ? 1.712   -14.005 -34.787  1.00 52.50  ? 275 PHE A CG    1 
ATOM   552  C  CD1   . PHE A 1 74 ? 0.684   -13.146 -34.397  1.00 57.08  ? 275 PHE A CD1   1 
ATOM   553  C  CD2   . PHE A 1 74 ? 1.618   -15.354 -34.464  1.00 56.01  ? 275 PHE A CD2   1 
ATOM   554  C  CE1   . PHE A 1 74 ? -0.421  -13.620 -33.688  1.00 56.69  ? 275 PHE A CE1   1 
ATOM   555  C  CE2   . PHE A 1 74 ? 0.514   -15.842 -33.754  1.00 61.45  ? 275 PHE A CE2   1 
ATOM   556  C  CZ    . PHE A 1 74 ? -0.506  -14.971 -33.364  1.00 58.39  ? 275 PHE A CZ    1 
ATOM   557  N  N     . PRO A 1 75 ? 5.935   -13.152 -34.231  1.00 35.02  ? 276 PRO A N     1 
ATOM   558  C  CA    . PRO A 1 75 ? 7.346   -13.262 -34.429  1.00 32.53  ? 276 PRO A CA    1 
ATOM   559  C  C     . PRO A 1 75 ? 7.647   -13.885 -35.756  1.00 31.91  ? 276 PRO A C     1 
ATOM   560  O  O     . PRO A 1 75 ? 6.880   -14.637 -36.346  1.00 30.73  ? 276 PRO A O     1 
ATOM   561  C  CB    . PRO A 1 75 ? 7.848   -14.170 -33.299  1.00 31.10  ? 276 PRO A CB    1 
ATOM   562  C  CG    . PRO A 1 75 ? 6.657   -14.991 -32.942  1.00 19.27  ? 276 PRO A CG    1 
ATOM   563  C  CD    . PRO A 1 75 ? 5.459   -14.122 -33.221  1.00 34.10  ? 276 PRO A CD    1 
ATOM   564  N  N     . PHE A 1 76 ? 8.785   -13.432 -36.248  1.00 32.90  ? 277 PHE A N     1 
ATOM   565  C  CA    . PHE A 1 76 ? 9.369   -13.767 -37.529  1.00 33.99  ? 277 PHE A CA    1 
ATOM   566  C  C     . PHE A 1 76 ? 10.877  -13.519 -37.379  1.00 33.82  ? 277 PHE A C     1 
ATOM   567  O  O     . PHE A 1 76 ? 11.303  -12.417 -37.012  1.00 39.08  ? 277 PHE A O     1 
ATOM   568  C  CB    . PHE A 1 76 ? 8.873   -12.862 -38.711  1.00 34.36  ? 277 PHE A CB    1 
ATOM   569  C  CG    . PHE A 1 76 ? 9.168   -13.354 -40.119  1.00 32.22  ? 277 PHE A CG    1 
ATOM   570  C  CD1   . PHE A 1 76 ? 8.728   -14.611 -40.539  1.00 24.81  ? 277 PHE A CD1   1 
ATOM   571  C  CD2   . PHE A 1 76 ? 9.910   -12.615 -41.032  1.00 33.00  ? 277 PHE A CD2   1 
ATOM   572  C  CE1   . PHE A 1 76 ? 8.961   -15.088 -41.809  1.00 25.67  ? 277 PHE A CE1   1 
ATOM   573  C  CE2   . PHE A 1 76 ? 10.145  -13.088 -42.305  1.00 24.24  ? 277 PHE A CE2   1 
ATOM   574  C  CZ    . PHE A 1 76 ? 9.671   -14.309 -42.708  1.00 25.89  ? 277 PHE A CZ    1 
ATOM   575  N  N     . TYR A 1 77 ? 11.650  -14.569 -37.637  1.00 32.29  ? 278 TYR A N     1 
ATOM   576  C  CA    . TYR A 1 77 ? 13.131  -14.548 -37.553  1.00 40.46  ? 278 TYR A CA    1 
ATOM   577  C  C     . TYR A 1 77 ? 13.744  -13.618 -36.500  1.00 48.74  ? 278 TYR A C     1 
ATOM   578  O  O     . TYR A 1 77 ? 14.575  -12.780 -36.860  1.00 54.56  ? 278 TYR A O     1 
ATOM   579  C  CB    . TYR A 1 77 ? 13.709  -14.056 -38.825  1.00 38.08  ? 278 TYR A CB    1 
ATOM   580  C  CG    . TYR A 1 77 ? 13.935  -15.113 -39.819  1.00 32.55  ? 278 TYR A CG    1 
ATOM   581  C  CD1   . TYR A 1 77 ? 14.949  -16.021 -39.682  1.00 32.33  ? 278 TYR A CD1   1 
ATOM   582  C  CD2   . TYR A 1 77 ? 13.095  -15.158 -40.901  1.00 34.80  ? 278 TYR A CD2   1 
ATOM   583  C  CE1   . TYR A 1 77 ? 15.194  -16.951 -40.681  1.00 35.61  ? 278 TYR A CE1   1 
ATOM   584  C  CE2   . TYR A 1 77 ? 13.329  -16.058 -41.912  1.00 34.12  ? 278 TYR A CE2   1 
ATOM   585  C  CZ    . TYR A 1 77 ? 14.385  -16.951 -41.777  1.00 36.23  ? 278 TYR A CZ    1 
ATOM   586  O  OH    . TYR A 1 77 ? 14.622  -17.849 -42.789  1.00 36.44  ? 278 TYR A OH    1 
ATOM   587  N  N     . ASP A 1 78 ? 13.405  -13.694 -35.216  1.00 48.42  ? 279 ASP A N     1 
ATOM   588  C  CA    . ASP A 1 78 ? 14.027  -12.807 -34.231  1.00 50.49  ? 279 ASP A CA    1 
ATOM   589  C  C     . ASP A 1 78 ? 13.335  -11.475 -34.073  1.00 42.54  ? 279 ASP A C     1 
ATOM   590  O  O     . ASP A 1 78 ? 13.710  -10.681 -33.197  1.00 47.85  ? 279 ASP A O     1 
ATOM   591  C  CB    . ASP A 1 78 ? 15.491  -12.535 -34.549  1.00 64.41  ? 279 ASP A CB    1 
ATOM   592  C  CG    . ASP A 1 78 ? 16.232  -11.786 -33.438  1.00 80.35  ? 279 ASP A CG    1 
ATOM   593  O  OD1   . ASP A 1 78 ? 15.565  -11.169 -32.581  1.00 94.29  ? 279 ASP A OD1   1 
ATOM   594  O  OD2   . ASP A 1 78 ? 17.480  -11.809 -33.424  1.00 88.66  ? 279 ASP A OD2   1 
ATOM   595  N  N     . LYS A 1 79 ? 12.298  -11.174 -34.839  1.00 34.81  ? 280 LYS A N     1 
ATOM   596  C  CA    . LYS A 1 79 ? 11.632  -9.895  -34.555  1.00 30.86  ? 280 LYS A CA    1 
ATOM   597  C  C     . LYS A 1 79 ? 10.182  -9.890  -35.049  1.00 30.94  ? 280 LYS A C     1 
ATOM   598  O  O     . LYS A 1 79 ? 9.850   -10.618 -35.981  1.00 30.68  ? 280 LYS A O     1 
ATOM   599  C  CB    . LYS A 1 79 ? 12.475  -8.730  -35.148  1.00 27.79  ? 280 LYS A CB    1 
ATOM   600  C  CG    . LYS A 1 79 ? 12.122  -8.249  -36.553  1.00 34.65  ? 280 LYS A CG    1 
ATOM   601  C  CD    . LYS A 1 79 ? 13.151  -7.250  -37.090  1.00 24.84  ? 280 LYS A CD    1 
ATOM   602  C  CE    . LYS A 1 79 ? 12.874  -5.813  -36.645  1.00 29.23  ? 280 LYS A CE    1 
ATOM   603  N  NZ    . LYS A 1 79 ? 13.850  -4.848  -37.217  1.00 34.22  ? 280 LYS A NZ    1 
ATOM   604  N  N     . PRO A 1 80 ? 9.275   -9.105  -34.425  1.00 33.93  ? 281 PRO A N     1 
ATOM   605  C  CA    . PRO A 1 80 ? 7.919   -9.090  -34.865  1.00 33.43  ? 281 PRO A CA    1 
ATOM   606  C  C     . PRO A 1 80 ? 7.842   -8.564  -36.283  1.00 34.91  ? 281 PRO A C     1 
ATOM   607  O  O     . PRO A 1 80 ? 8.816   -8.104  -36.858  1.00 48.36  ? 281 PRO A O     1 
ATOM   608  C  CB    . PRO A 1 80 ? 7.198   -8.183  -33.874  1.00 30.56  ? 281 PRO A CB    1 
ATOM   609  C  CG    . PRO A 1 80 ? 8.245   -7.282  -33.331  1.00 27.58  ? 281 PRO A CG    1 
ATOM   610  C  CD    . PRO A 1 80 ? 9.555   -8.004  -33.481  1.00 32.77  ? 281 PRO A CD    1 
ATOM   611  N  N     . MET A 1 81 ? 6.649   -8.641  -36.815  1.00 28.19  ? 282 MET A N     1 
ATOM   612  C  CA    . MET A 1 81 ? 6.309   -8.183  -38.137  1.00 29.51  ? 282 MET A CA    1 
ATOM   613  C  C     . MET A 1 81 ? 4.974   -7.453  -38.098  1.00 25.26  ? 282 MET A C     1 
ATOM   614  O  O     . MET A 1 81 ? 4.025   -7.932  -37.504  1.00 26.85  ? 282 MET A O     1 
ATOM   615  C  CB    . MET A 1 81 ? 6.278   -9.346  -39.139  1.00 29.11  ? 282 MET A CB    1 
ATOM   616  C  CG    . MET A 1 81 ? 5.126   -10.297 -38.916  1.00 31.24  ? 282 MET A CG    1 
ATOM   617  S  SD    . MET A 1 81 ? 5.095   -11.648 -40.122  1.00 28.57  ? 282 MET A SD    1 
ATOM   618  C  CE    . MET A 1 81 ? 4.629   -13.028 -39.074  1.00 28.51  ? 282 MET A CE    1 
ATOM   619  N  N     . ARG A 1 82 ? 4.910   -6.295  -38.728  1.00 17.78  ? 283 ARG A N     1 
ATOM   620  C  CA    . ARG A 1 82 ? 3.700   -5.487  -38.823  1.00 19.97  ? 283 ARG A CA    1 
ATOM   621  C  C     . ARG A 1 82 ? 3.030   -5.820  -40.142  1.00 25.58  ? 283 ARG A C     1 
ATOM   622  O  O     . ARG A 1 82 ? 3.703   -6.115  -41.122  1.00 24.91  ? 283 ARG A O     1 
ATOM   623  C  CB    . ARG A 1 82 ? 4.012   -4.006  -38.755  1.00 14.58  ? 283 ARG A CB    1 
ATOM   624  C  CG    . ARG A 1 82 ? 4.891   -3.670  -37.557  1.00 19.03  ? 283 ARG A CG    1 
ATOM   625  C  CD    . ARG A 1 82 ? 5.653   -2.377  -37.763  1.00 21.24  ? 283 ARG A CD    1 
ATOM   626  N  NE    . ARG A 1 82 ? 6.519   -2.088  -36.626  1.00 24.01  ? 283 ARG A NE    1 
ATOM   627  C  CZ    . ARG A 1 82 ? 7.426   -1.119  -36.610  1.00 28.37  ? 283 ARG A CZ    1 
ATOM   628  N  NH1   . ARG A 1 82 ? 7.584   -0.348  -37.675  1.00 21.98  ? 283 ARG A NH1   1 
ATOM   629  N  NH2   . ARG A 1 82 ? 8.171   -0.923  -35.529  1.00 29.94  ? 283 ARG A NH2   1 
ATOM   630  N  N     . ILE A 1 83 ? 1.701   -5.756  -40.154  1.00 26.98  ? 284 ILE A N     1 
ATOM   631  C  CA    . ILE A 1 83 ? 0.939   -6.043  -41.353  1.00 23.34  ? 284 ILE A CA    1 
ATOM   632  C  C     . ILE A 1 83 ? -0.198  -5.056  -41.483  1.00 24.00  ? 284 ILE A C     1 
ATOM   633  O  O     . ILE A 1 83 ? -0.882  -4.751  -40.507  1.00 17.62  ? 284 ILE A O     1 
ATOM   634  C  CB    . ILE A 1 83 ? 0.308   -7.428  -41.318  1.00 22.78  ? 284 ILE A CB    1 
ATOM   635  C  CG1   . ILE A 1 83 ? 1.196   -8.405  -40.557  1.00 18.73  ? 284 ILE A CG1   1 
ATOM   636  C  CG2   . ILE A 1 83 ? 0.092   -7.905  -42.735  1.00 22.61  ? 284 ILE A CG2   1 
ATOM   637  C  CD1   . ILE A 1 83 ? 0.485   -9.674  -40.182  1.00 18.41  ? 284 ILE A CD1   1 
ATOM   638  N  N     . GLN A 1 84 ? -0.381  -4.560  -42.701  1.00 26.98  ? 285 GLN A N     1 
ATOM   639  C  CA    . GLN A 1 84 ? -1.447  -3.622  -43.027  1.00 29.24  ? 285 GLN A CA    1 
ATOM   640  C  C     . GLN A 1 84 ? -1.870  -4.041  -44.402  1.00 30.91  ? 285 GLN A C     1 
ATOM   641  O  O     . GLN A 1 84 ? -1.211  -4.861  -45.033  1.00 26.20  ? 285 GLN A O     1 
ATOM   642  C  CB    . GLN A 1 84 ? -0.945  -2.185  -43.130  1.00 23.62  ? 285 GLN A CB    1 
ATOM   643  C  CG    . GLN A 1 84 ? -0.275  -1.641  -41.905  1.00 24.69  ? 285 GLN A CG    1 
ATOM   644  C  CD    . GLN A 1 84 ? 0.862   -0.726  -42.275  1.00 29.15  ? 285 GLN A CD    1 
ATOM   645  O  OE1   . GLN A 1 84 ? 0.671   0.295   -42.933  1.00 23.23  ? 285 GLN A OE1   1 
ATOM   646  N  NE2   . GLN A 1 84 ? 2.066   -1.097  -41.863  1.00 38.08  ? 285 GLN A NE2   1 
ATOM   647  N  N     . TYR A 1 85 ? -2.971  -3.472  -44.863  1.00 37.02  ? 286 TYR A N     1 
ATOM   648  C  CA    . TYR A 1 85 ? -3.454  -3.762  -46.197  1.00 39.73  ? 286 TYR A CA    1 
ATOM   649  C  C     . TYR A 1 85 ? -2.629  -2.874  -47.105  1.00 36.67  ? 286 TYR A C     1 
ATOM   650  O  O     . TYR A 1 85 ? -2.360  -1.725  -46.763  1.00 34.98  ? 286 TYR A O     1 
ATOM   651  C  CB    . TYR A 1 85 ? -4.933  -3.393  -46.328  1.00 46.22  ? 286 TYR A CB    1 
ATOM   652  C  CG    . TYR A 1 85 ? -5.894  -4.419  -45.773  1.00 48.97  ? 286 TYR A CG    1 
ATOM   653  C  CD1   . TYR A 1 85 ? -5.865  -5.744  -46.219  1.00 50.88  ? 286 TYR A CD1   1 
ATOM   654  C  CD2   . TYR A 1 85 ? -6.852  -4.061  -44.832  1.00 44.88  ? 286 TYR A CD2   1 
ATOM   655  C  CE1   . TYR A 1 85 ? -6.764  -6.679  -45.743  1.00 49.80  ? 286 TYR A CE1   1 
ATOM   656  C  CE2   . TYR A 1 85 ? -7.757  -4.989  -44.352  1.00 46.78  ? 286 TYR A CE2   1 
ATOM   657  C  CZ    . TYR A 1 85 ? -7.707  -6.291  -44.809  1.00 51.40  ? 286 TYR A CZ    1 
ATOM   658  O  OH    . TYR A 1 85 ? -8.602  -7.206  -44.324  1.00 56.92  ? 286 TYR A OH    1 
ATOM   659  N  N     . ALA A 1 86 ? -2.203  -3.402  -48.246  1.00 33.68  ? 287 ALA A N     1 
ATOM   660  C  CA    . ALA A 1 86 ? -1.427  -2.595  -49.174  1.00 29.58  ? 287 ALA A CA    1 
ATOM   661  C  C     . ALA A 1 86 ? -2.303  -1.396  -49.556  1.00 31.01  ? 287 ALA A C     1 
ATOM   662  O  O     . ALA A 1 86 ? -3.535  -1.487  -49.541  1.00 32.79  ? 287 ALA A O     1 
ATOM   663  C  CB    . ALA A 1 86 ? -1.066  -3.411  -50.392  1.00 22.44  ? 287 ALA A CB    1 
ATOM   664  N  N     . LYS A 1 87 ? -1.672  -0.274  -49.889  1.00 30.65  ? 288 LYS A N     1 
ATOM   665  C  CA    . LYS A 1 87 ? -2.396  0.943   -50.237  1.00 26.98  ? 288 LYS A CA    1 
ATOM   666  C  C     . LYS A 1 87 ? -3.141  0.838   -51.562  1.00 28.37  ? 288 LYS A C     1 
ATOM   667  O  O     . LYS A 1 87 ? -4.209  1.432   -51.743  1.00 26.90  ? 288 LYS A O     1 
ATOM   668  C  CB    . LYS A 1 87 ? -1.425  2.127   -50.290  1.00 28.87  ? 288 LYS A CB    1 
ATOM   669  C  CG    . LYS A 1 87 ? -0.635  2.396   -49.000  1.00 36.34  ? 288 LYS A CG    1 
ATOM   670  C  CD    . LYS A 1 87 ? -1.465  3.030   -47.867  1.00 46.42  ? 288 LYS A CD    1 
ATOM   671  C  CE    . LYS A 1 87 ? -2.434  2.049   -47.179  1.00 53.03  ? 288 LYS A CE    1 
ATOM   672  N  NZ    . LYS A 1 87 ? -3.196  2.642   -46.021  1.00 45.55  ? 288 LYS A NZ    1 
ATOM   673  N  N     . THR A 1 88 ? -2.581  0.070   -52.485  1.00 28.70  ? 289 THR A N     1 
ATOM   674  C  CA    . THR A 1 88 ? -3.179  -0.083  -53.800  1.00 32.86  ? 289 THR A CA    1 
ATOM   675  C  C     . THR A 1 88 ? -2.950  -1.479  -54.363  1.00 35.00  ? 289 THR A C     1 
ATOM   676  O  O     . THR A 1 88 ? -1.976  -2.139  -54.010  1.00 35.68  ? 289 THR A O     1 
ATOM   677  C  CB    . THR A 1 88 ? -2.559  0.926   -54.754  1.00 37.13  ? 289 THR A CB    1 
ATOM   678  O  OG1   . THR A 1 88 ? -1.129  0.849   -54.643  1.00 41.92  ? 289 THR A OG1   1 
ATOM   679  C  CG2   . THR A 1 88 ? -3.022  2.342   -54.408  1.00 36.43  ? 289 THR A CG2   1 
ATOM   680  N  N     . ASP A 1 89 ? -3.840  -1.925  -55.246  1.00 36.19  ? 290 ASP A N     1 
ATOM   681  C  CA    . ASP A 1 89 ? -3.693  -3.248  -55.849  1.00 36.25  ? 290 ASP A CA    1 
ATOM   682  C  C     . ASP A 1 89 ? -2.319  -3.365  -56.477  1.00 34.47  ? 290 ASP A C     1 
ATOM   683  O  O     . ASP A 1 89 ? -1.687  -2.361  -56.816  1.00 34.55  ? 290 ASP A O     1 
ATOM   684  C  CB    . ASP A 1 89 ? -4.745  -3.484  -56.936  1.00 36.08  ? 290 ASP A CB    1 
ATOM   685  C  CG    . ASP A 1 89 ? -6.147  -3.567  -56.381  1.00 42.27  ? 290 ASP A CG    1 
ATOM   686  O  OD1   . ASP A 1 89 ? -6.772  -4.645  -56.486  1.00 42.79  ? 290 ASP A OD1   1 
ATOM   687  O  OD2   . ASP A 1 89 ? -6.625  -2.551  -55.836  1.00 42.83  ? 290 ASP A OD2   1 
ATOM   688  N  N     . SER A 1 90 ? -1.860  -4.598  -56.626  1.00 30.02  ? 291 SER A N     1 
ATOM   689  C  CA    . SER A 1 90 ? -0.572  -4.854  -57.238  1.00 25.35  ? 291 SER A CA    1 
ATOM   690  C  C     . SER A 1 90 ? -0.882  -5.097  -58.714  1.00 27.25  ? 291 SER A C     1 
ATOM   691  O  O     . SER A 1 90 ? -2.001  -5.475  -59.046  1.00 22.72  ? 291 SER A O     1 
ATOM   692  C  CB    . SER A 1 90 ? 0.047   -6.085  -56.596  1.00 24.55  ? 291 SER A CB    1 
ATOM   693  O  OG    . SER A 1 90 ? -0.076  -6.002  -55.187  1.00 7.28   ? 291 SER A OG    1 
ATOM   694  N  N     . ASP A 1 91 ? 0.092   -4.873  -59.596  1.00 29.23  ? 292 ASP A N     1 
ATOM   695  C  CA    . ASP A 1 91 ? -0.130  -5.055  -61.026  1.00 26.14  ? 292 ASP A CA    1 
ATOM   696  C  C     . ASP A 1 91 ? -0.834  -6.344  -61.363  1.00 24.43  ? 292 ASP A C     1 
ATOM   697  O  O     . ASP A 1 91 ? -1.883  -6.328  -61.988  1.00 25.36  ? 292 ASP A O     1 
ATOM   698  C  CB    . ASP A 1 91 ? 1.181   -4.980  -61.787  1.00 29.59  ? 292 ASP A CB    1 
ATOM   699  C  CG    . ASP A 1 91 ? 1.713   -3.574  -61.860  1.00 39.66  ? 292 ASP A CG    1 
ATOM   700  O  OD1   . ASP A 1 91 ? 0.884   -2.639  -61.851  1.00 46.06  ? 292 ASP A OD1   1 
ATOM   701  O  OD2   . ASP A 1 91 ? 2.945   -3.395  -61.940  1.00 47.74  ? 292 ASP A OD2   1 
ATOM   702  N  N     . ILE A 1 92 ? -0.255  -7.456  -60.939  1.00 24.12  ? 293 ILE A N     1 
ATOM   703  C  CA    . ILE A 1 92 ? -0.820  -8.776  -61.171  1.00 22.44  ? 293 ILE A CA    1 
ATOM   704  C  C     . ILE A 1 92 ? -2.310  -8.861  -60.821  1.00 27.63  ? 293 ILE A C     1 
ATOM   705  O  O     . ILE A 1 92 ? -3.033  -9.713  -61.353  1.00 26.64  ? 293 ILE A O     1 
ATOM   706  C  CB    . ILE A 1 92 ? -0.091  -9.805  -60.339  1.00 20.21  ? 293 ILE A CB    1 
ATOM   707  C  CG1   . ILE A 1 92 ? -0.698  -11.187 -60.580  1.00 23.69  ? 293 ILE A CG1   1 
ATOM   708  C  CG2   . ILE A 1 92 ? -0.137  -9.379  -58.880  1.00 14.89  ? 293 ILE A CG2   1 
ATOM   709  C  CD1   . ILE A 1 92 ? 0.024   -12.315 -59.883  1.00 27.55  ? 293 ILE A CD1   1 
ATOM   710  N  N     . ILE A 1 93 ? -2.762  -7.998  -59.913  1.00 27.13  ? 294 ILE A N     1 
ATOM   711  C  CA    . ILE A 1 93 ? -4.173  -7.972  -59.518  1.00 27.93  ? 294 ILE A CA    1 
ATOM   712  C  C     . ILE A 1 93 ? -4.944  -6.964  -60.359  1.00 28.09  ? 294 ILE A C     1 
ATOM   713  O  O     . ILE A 1 93 ? -5.912  -7.303  -61.021  1.00 28.23  ? 294 ILE A O     1 
ATOM   714  C  CB    . ILE A 1 93 ? -4.360  -7.573  -58.034  1.00 24.76  ? 294 ILE A CB    1 
ATOM   715  C  CG1   . ILE A 1 93 ? -3.873  -8.692  -57.108  1.00 26.21  ? 294 ILE A CG1   1 
ATOM   716  C  CG2   . ILE A 1 93 ? -5.812  -7.225  -57.779  1.00 16.65  ? 294 ILE A CG2   1 
ATOM   717  C  CD1   . ILE A 1 93 ? -4.578  -10.026 -57.287  1.00 22.61  ? 294 ILE A CD1   1 
ATOM   718  N  N     . ALA A 1 94 ? -4.504  -5.715  -60.306  1.00 38.04  ? 295 ALA A N     1 
ATOM   719  C  CA    . ALA A 1 94 ? -5.130  -4.634  -61.047  1.00 41.18  ? 295 ALA A CA    1 
ATOM   720  C  C     . ALA A 1 94 ? -5.808  -5.154  -62.291  1.00 44.10  ? 295 ALA A C     1 
ATOM   721  O  O     . ALA A 1 94 ? -7.013  -5.005  -62.448  1.00 44.41  ? 295 ALA A O     1 
ATOM   722  C  CB    . ALA A 1 94 ? -4.089  -3.607  -61.425  1.00 46.71  ? 295 ALA A CB    1 
ATOM   723  N  N     . LYS A 1 95 ? -5.026  -5.780  -63.166  1.00 48.76  ? 296 LYS A N     1 
ATOM   724  C  CA    . LYS A 1 95 ? -5.538  -6.326  -64.424  1.00 51.93  ? 296 LYS A CA    1 
ATOM   725  C  C     . LYS A 1 95 ? -6.425  -7.564  -64.270  1.00 53.11  ? 296 LYS A C     1 
ATOM   726  O  O     . LYS A 1 95 ? -6.178  -8.602  -64.881  1.00 55.58  ? 296 LYS A O     1 
ATOM   727  C  CB    . LYS A 1 95 ? -4.368  -6.622  -65.373  1.00 50.97  ? 296 LYS A CB    1 
ATOM   728  C  CG    . LYS A 1 95 ? -3.230  -7.420  -64.748  1.00 50.82  ? 296 LYS A CG    1 
ATOM   729  C  CD    . LYS A 1 95 ? -1.847  -6.936  -65.217  1.00 49.52  ? 296 LYS A CD    1 
ATOM   730  C  CE    . LYS A 1 95 ? -1.548  -5.498  -64.748  1.00 44.69  ? 296 LYS A CE    1 
ATOM   731  N  NZ    . LYS A 1 95 ? -0.182  -5.016  -65.134  1.00 24.59  ? 296 LYS A NZ    1 
ATOM   732  N  N     . MET A 1 96 ? -7.461  -7.439  -63.451  1.00 53.48  ? 297 MET A N     1 
ATOM   733  C  CA    . MET A 1 96 ? -8.407  -8.519  -63.217  1.00 54.55  ? 297 MET A CA    1 
ATOM   734  C  C     . MET A 1 96 ? -9.775  -7.898  -62.915  1.00 59.89  ? 297 MET A C     1 
ATOM   735  O  O     . MET A 1 96 ? -10.414 -8.307  -61.921  1.00 64.80  ? 297 MET A O     1 
ATOM   736  C  CB    . MET A 1 96 ? -7.951  -9.387  -62.035  1.00 52.95  ? 297 MET A CB    1 
ATOM   737  C  CG    . MET A 1 96 ? -6.624  -10.122 -62.244  1.00 51.97  ? 297 MET A CG    1 
ATOM   738  S  SD    . MET A 1 96 ? -6.196  -11.256 -60.882  1.00 48.73  ? 297 MET A SD    1 
ATOM   739  C  CE    . MET A 1 96 ? -6.649  -12.873 -61.571  1.00 48.17  ? 297 MET A CE    1 
ATOM   740  O  OXT   . MET A 1 96 ? -10.200 -7.004  -63.682  1.00 61.04  ? 297 MET A OXT   1 
ATOM   741  N  N     . THR B 1 5  ? 4.302   -40.233 -20.103  1.00 75.04  ? 306 THR B N     1 
ATOM   742  C  CA    . THR B 1 5  ? 3.989   -40.690 -18.716  1.00 76.34  ? 306 THR B CA    1 
ATOM   743  C  C     . THR B 1 5  ? 2.518   -40.427 -18.441  1.00 72.88  ? 306 THR B C     1 
ATOM   744  O  O     . THR B 1 5  ? 1.842   -39.760 -19.226  1.00 73.33  ? 306 THR B O     1 
ATOM   745  C  CB    . THR B 1 5  ? 4.824   -39.915 -17.658  1.00 78.79  ? 306 THR B CB    1 
ATOM   746  O  OG1   . THR B 1 5  ? 6.217   -40.007 -17.983  1.00 81.76  ? 306 THR B OG1   1 
ATOM   747  C  CG2   . THR B 1 5  ? 4.598   -40.490 -16.258  1.00 77.03  ? 306 THR B CG2   1 
ATOM   748  N  N     . ARG B 1 6  ? 2.026   -40.961 -17.330  1.00 67.71  ? 307 ARG B N     1 
ATOM   749  C  CA    . ARG B 1 6  ? 0.642   -40.752 -16.942  1.00 62.99  ? 307 ARG B CA    1 
ATOM   750  C  C     . ARG B 1 6  ? 0.542   -39.309 -16.434  1.00 58.96  ? 307 ARG B C     1 
ATOM   751  O  O     . ARG B 1 6  ? 1.460   -38.808 -15.784  1.00 58.99  ? 307 ARG B O     1 
ATOM   752  C  CB    . ARG B 1 6  ? 0.251   -41.743 -15.843  1.00 61.61  ? 307 ARG B CB    1 
ATOM   753  N  N     . PRO B 1 7  ? -0.562  -38.617 -16.747  1.00 54.49  ? 308 PRO B N     1 
ATOM   754  C  CA    . PRO B 1 7  ? -0.816  -37.230 -16.342  1.00 52.82  ? 308 PRO B CA    1 
ATOM   755  C  C     . PRO B 1 7  ? -0.509  -36.901 -14.878  1.00 50.68  ? 308 PRO B C     1 
ATOM   756  O  O     . PRO B 1 7  ? -0.562  -37.775 -14.017  1.00 51.60  ? 308 PRO B O     1 
ATOM   757  C  CB    . PRO B 1 7  ? -2.287  -37.052 -16.683  1.00 54.59  ? 308 PRO B CB    1 
ATOM   758  C  CG    . PRO B 1 7  ? -2.404  -37.834 -17.947  1.00 55.81  ? 308 PRO B CG    1 
ATOM   759  C  CD    . PRO B 1 7  ? -1.638  -39.107 -17.627  1.00 53.45  ? 308 PRO B CD    1 
ATOM   760  N  N     . ASN B 1 8  ? -0.195  -35.634 -14.610  1.00 50.98  ? 309 ASN B N     1 
ATOM   761  C  CA    . ASN B 1 8  ? 0.130   -35.171 -13.260  1.00 51.85  ? 309 ASN B CA    1 
ATOM   762  C  C     . ASN B 1 8  ? -0.101  -33.664 -13.092  1.00 51.29  ? 309 ASN B C     1 
ATOM   763  O  O     . ASN B 1 8  ? -0.075  -32.915 -14.068  1.00 51.11  ? 309 ASN B O     1 
ATOM   764  C  CB    . ASN B 1 8  ? 1.590   -35.498 -12.938  1.00 53.27  ? 309 ASN B CB    1 
ATOM   765  C  CG    . ASN B 1 8  ? 1.981   -35.106 -11.521  1.00 57.96  ? 309 ASN B CG    1 
ATOM   766  O  OD1   . ASN B 1 8  ? 1.941   -33.931 -11.146  1.00 54.96  ? 309 ASN B OD1   1 
ATOM   767  N  ND2   . ASN B 1 8  ? 2.366   -36.096 -10.725  1.00 63.41  ? 309 ASN B ND2   1 
ATOM   768  N  N     . HIS B 1 9  ? -0.320  -33.232 -11.849  1.00 50.00  ? 310 HIS B N     1 
ATOM   769  C  CA    . HIS B 1 9  ? -0.552  -31.820 -11.524  1.00 46.02  ? 310 HIS B CA    1 
ATOM   770  C  C     . HIS B 1 9  ? 0.606   -30.926 -11.945  1.00 42.34  ? 310 HIS B C     1 
ATOM   771  O  O     . HIS B 1 9  ? 0.434   -29.736 -12.201  1.00 39.22  ? 310 HIS B O     1 
ATOM   772  C  CB    . HIS B 1 9  ? -0.741  -31.636 -10.018  1.00 49.18  ? 310 HIS B CB    1 
ATOM   773  C  CG    . HIS B 1 9  ? -2.030  -32.178 -9.484   1.00 55.99  ? 310 HIS B CG    1 
ATOM   774  N  ND1   . HIS B 1 9  ? -2.998  -31.370 -8.924   1.00 59.29  ? 310 HIS B ND1   1 
ATOM   775  C  CD2   . HIS B 1 9  ? -2.487  -33.447 -9.372   1.00 53.20  ? 310 HIS B CD2   1 
ATOM   776  C  CE1   . HIS B 1 9  ? -3.994  -32.118 -8.487   1.00 57.14  ? 310 HIS B CE1   1 
ATOM   777  N  NE2   . HIS B 1 9  ? -3.710  -33.382 -8.746   1.00 55.35  ? 310 HIS B NE2   1 
ATOM   778  N  N     . THR B 1 10 ? 1.795   -31.504 -11.995  1.00 40.40  ? 311 THR B N     1 
ATOM   779  C  CA    . THR B 1 10 ? 2.982   -30.748 -12.347  1.00 38.59  ? 311 THR B CA    1 
ATOM   780  C  C     . THR B 1 10 ? 3.585   -31.172 -13.677  1.00 40.08  ? 311 THR B C     1 
ATOM   781  O  O     . THR B 1 10 ? 3.637   -32.366 -13.996  1.00 40.48  ? 311 THR B O     1 
ATOM   782  C  CB    . THR B 1 10 ? 4.054   -30.916 -11.268  1.00 32.88  ? 311 THR B CB    1 
ATOM   783  O  OG1   . THR B 1 10 ? 3.476   -30.660 -9.987   1.00 28.46  ? 311 THR B OG1   1 
ATOM   784  C  CG2   . THR B 1 10 ? 5.193   -29.953 -11.501  1.00 35.46  ? 311 THR B CG2   1 
ATOM   785  N  N     . ILE B 1 11 ? 4.029   -30.188 -14.457  1.00 38.58  ? 312 ILE B N     1 
ATOM   786  C  CA    . ILE B 1 11 ? 4.674   -30.477 -15.731  1.00 37.20  ? 312 ILE B CA    1 
ATOM   787  C  C     . ILE B 1 11 ? 6.143   -30.106 -15.574  1.00 32.68  ? 312 ILE B C     1 
ATOM   788  O  O     . ILE B 1 11 ? 6.476   -29.097 -14.959  1.00 29.74  ? 312 ILE B O     1 
ATOM   789  C  CB    . ILE B 1 11 ? 4.066   -29.672 -16.941  1.00 38.69  ? 312 ILE B CB    1 
ATOM   790  C  CG1   . ILE B 1 11 ? 4.427   -28.189 -16.841  1.00 39.02  ? 312 ILE B CG1   1 
ATOM   791  C  CG2   . ILE B 1 11 ? 2.554   -29.858 -17.003  1.00 32.64  ? 312 ILE B CG2   1 
ATOM   792  C  CD1   . ILE B 1 11 ? 3.977   -27.361 -18.032  1.00 32.89  ? 312 ILE B CD1   1 
ATOM   793  N  N     . TYR B 1 12 ? 7.016   -30.941 -16.115  1.00 29.39  ? 313 TYR B N     1 
ATOM   794  C  CA    . TYR B 1 12 ? 8.446   -30.703 -16.046  1.00 30.43  ? 313 TYR B CA    1 
ATOM   795  C  C     . TYR B 1 12 ? 8.931   -30.066 -17.345  1.00 31.99  ? 313 TYR B C     1 
ATOM   796  O  O     . TYR B 1 12 ? 9.002   -30.730 -18.382  1.00 34.83  ? 313 TYR B O     1 
ATOM   797  C  CB    . TYR B 1 12 ? 9.172   -32.032 -15.806  1.00 32.04  ? 313 TYR B CB    1 
ATOM   798  C  CG    . TYR B 1 12 ? 10.682  -31.981 -15.960  1.00 35.72  ? 313 TYR B CG    1 
ATOM   799  C  CD1   . TYR B 1 12 ? 11.305  -32.391 -17.144  1.00 35.28  ? 313 TYR B CD1   1 
ATOM   800  C  CD2   . TYR B 1 12 ? 11.487  -31.510 -14.925  1.00 32.26  ? 313 TYR B CD2   1 
ATOM   801  C  CE1   . TYR B 1 12 ? 12.691  -32.327 -17.282  1.00 32.66  ? 313 TYR B CE1   1 
ATOM   802  C  CE2   . TYR B 1 12 ? 12.864  -31.445 -15.057  1.00 26.37  ? 313 TYR B CE2   1 
ATOM   803  C  CZ    . TYR B 1 12 ? 13.456  -31.848 -16.228  1.00 29.75  ? 313 TYR B CZ    1 
ATOM   804  O  OH    . TYR B 1 12 ? 14.815  -31.776 -16.371  1.00 29.51  ? 313 TYR B OH    1 
ATOM   805  N  N     . ILE B 1 13 ? 9.249   -28.778 -17.299  1.00 29.25  ? 314 ILE B N     1 
ATOM   806  C  CA    . ILE B 1 13 ? 9.749   -28.133 -18.489  1.00 28.99  ? 314 ILE B CA    1 
ATOM   807  C  C     . ILE B 1 13 ? 11.266  -28.177 -18.447  1.00 28.50  ? 314 ILE B C     1 
ATOM   808  O  O     . ILE B 1 13 ? 11.871  -27.833 -17.421  1.00 28.69  ? 314 ILE B O     1 
ATOM   809  C  CB    . ILE B 1 13 ? 9.225   -26.688 -18.579  1.00 29.42  ? 314 ILE B CB    1 
ATOM   810  C  CG1   . ILE B 1 13 ? 7.696   -26.647 -18.638  1.00 35.46  ? 314 ILE B CG1   1 
ATOM   811  C  CG2   . ILE B 1 13 ? 9.818   -25.981 -19.788  1.00 25.71  ? 314 ILE B CG2   1 
ATOM   812  C  CD1   . ILE B 1 13 ? 7.120   -25.269 -18.394  1.00 33.18  ? 314 ILE B CD1   1 
ATOM   813  N  N     . ASN B 1 14 ? 11.931  -28.568 -19.545  1.00 27.54  ? 315 ASN B N     1 
ATOM   814  C  CA    . ASN B 1 14 ? 13.422  -28.601 -19.586  1.00 28.18  ? 315 ASN B CA    1 
ATOM   815  C  C     . ASN B 1 14 ? 13.998  -27.836 -20.799  1.00 25.28  ? 315 ASN B C     1 
ATOM   816  O  O     . ASN B 1 14 ? 13.236  -27.390 -21.650  1.00 17.39  ? 315 ASN B O     1 
ATOM   817  C  CB    . ASN B 1 14 ? 13.894  -30.077 -19.587  1.00 30.51  ? 315 ASN B CB    1 
ATOM   818  C  CG    . ASN B 1 14 ? 13.625  -30.758 -20.914  1.00 34.09  ? 315 ASN B CG    1 
ATOM   819  O  OD1   . ASN B 1 14 ? 13.058  -30.158 -21.827  1.00 39.23  ? 315 ASN B OD1   1 
ATOM   820  N  ND2   . ASN B 1 14 ? 14.050  -32.011 -21.031  1.00 37.02  ? 315 ASN B ND2   1 
ATOM   821  N  N     . ASN B 1 15 ? 15.304  -27.709 -20.877  1.00 26.91  ? 316 ASN B N     1 
ATOM   822  C  CA    . ASN B 1 15 ? 15.899  -27.010 -22.025  1.00 33.97  ? 316 ASN B CA    1 
ATOM   823  C  C     . ASN B 1 15 ? 15.604  -25.484 -21.939  1.00 31.07  ? 316 ASN B C     1 
ATOM   824  O  O     . ASN B 1 15 ? 15.478  -24.798 -22.958  1.00 32.88  ? 316 ASN B O     1 
ATOM   825  C  CB    . ASN B 1 15 ? 15.367  -27.629 -23.320  1.00 44.67  ? 316 ASN B CB    1 
ATOM   826  C  CG    . ASN B 1 15 ? 16.104  -27.132 -24.548  1.00 55.45  ? 316 ASN B CG    1 
ATOM   827  O  OD1   . ASN B 1 15 ? 17.022  -26.318 -24.447  1.00 65.35  ? 316 ASN B OD1   1 
ATOM   828  N  ND2   . ASN B 1 15 ? 15.703  -27.623 -25.715  1.00 61.50  ? 316 ASN B ND2   1 
ATOM   829  N  N     . LEU B 1 16 ? 15.556  -24.974 -20.701  1.00 28.39  ? 317 LEU B N     1 
ATOM   830  C  CA    . LEU B 1 16 ? 15.289  -23.508 -20.424  1.00 24.79  ? 317 LEU B CA    1 
ATOM   831  C  C     . LEU B 1 16 ? 16.606  -22.605 -20.591  1.00 28.17  ? 317 LEU B C     1 
ATOM   832  O  O     . LEU B 1 16 ? 17.613  -22.941 -19.995  1.00 35.10  ? 317 LEU B O     1 
ATOM   833  C  CB    . LEU B 1 16 ? 14.629  -23.455 -19.020  1.00 24.08  ? 317 LEU B CB    1 
ATOM   834  C  CG    . LEU B 1 16 ? 13.371  -24.301 -18.766  1.00 32.77  ? 317 LEU B CG    1 
ATOM   835  C  CD1   . LEU B 1 16 ? 12.891  -24.129 -17.338  1.00 36.51  ? 317 LEU B CD1   1 
ATOM   836  C  CD2   . LEU B 1 16 ? 12.259  -23.926 -19.726  1.00 24.67  ? 317 LEU B CD2   1 
ATOM   837  N  N     . ASN B 1 17 ? 16.596  -21.486 -21.378  1.00 28.41  ? 318 ASN B N     1 
ATOM   838  C  CA    . ASN B 1 17 ? 17.778  -20.601 -21.561  1.00 25.56  ? 318 ASN B CA    1 
ATOM   839  C  C     . ASN B 1 17 ? 18.520  -20.427 -20.218  1.00 26.35  ? 318 ASN B C     1 
ATOM   840  O  O     . ASN B 1 17 ? 18.118  -19.607 -19.382  1.00 23.39  ? 318 ASN B O     1 
ATOM   841  C  CB    . ASN B 1 17 ? 17.405  -19.247 -22.126  1.00 23.14  ? 318 ASN B CB    1 
ATOM   842  C  CG    . ASN B 1 17 ? 18.619  -18.448 -22.584  1.00 25.05  ? 318 ASN B CG    1 
ATOM   843  O  OD1   . ASN B 1 17 ? 19.563  -18.219 -21.822  1.00 15.05  ? 318 ASN B OD1   1 
ATOM   844  N  ND2   . ASN B 1 17 ? 18.586  -18.020 -23.842  1.00 29.05  ? 318 ASN B ND2   1 
ATOM   845  N  N     . GLU B 1 18 ? 19.613  -21.199 -20.016  1.00 21.88  ? 319 GLU B N     1 
ATOM   846  C  CA    . GLU B 1 18 ? 20.353  -21.152 -18.758  1.00 22.76  ? 319 GLU B CA    1 
ATOM   847  C  C     . GLU B 1 18 ? 20.810  -19.774 -18.267  1.00 19.39  ? 319 GLU B C     1 
ATOM   848  O  O     . GLU B 1 18 ? 21.205  -19.617 -17.116  1.00 14.70  ? 319 GLU B O     1 
ATOM   849  C  CB    . GLU B 1 18 ? 21.562  -22.074 -18.848  1.00 22.21  ? 319 GLU B CB    1 
ATOM   850  C  CG    . GLU B 1 18 ? 21.214  -23.541 -18.935  1.00 33.38  ? 319 GLU B CG    1 
ATOM   851  C  CD    . GLU B 1 18 ? 22.438  -24.387 -19.175  1.00 37.30  ? 319 GLU B CD    1 
ATOM   852  O  OE1   . GLU B 1 18 ? 23.464  -24.104 -18.518  1.00 37.79  ? 319 GLU B OE1   1 
ATOM   853  O  OE2   . GLU B 1 18 ? 22.373  -25.320 -20.009  1.00 38.68  ? 319 GLU B OE2   1 
ATOM   854  N  N     . LYS B 1 19 ? 20.760  -18.771 -19.121  1.00 17.26  ? 320 LYS B N     1 
ATOM   855  C  CA    . LYS B 1 19 ? 21.201  -17.466 -18.690  1.00 18.74  ? 320 LYS B CA    1 
ATOM   856  C  C     . LYS B 1 19 ? 20.158  -16.705 -17.877  1.00 21.96  ? 320 LYS B C     1 
ATOM   857  O  O     . LYS B 1 19 ? 20.514  -15.783 -17.143  1.00 23.09  ? 320 LYS B O     1 
ATOM   858  C  CB    . LYS B 1 19 ? 21.630  -16.642 -19.896  1.00 21.96  ? 320 LYS B CB    1 
ATOM   859  N  N     . ILE B 1 20 ? 18.886  -17.093 -17.987  1.00 21.47  ? 321 ILE B N     1 
ATOM   860  C  CA    . ILE B 1 20 ? 17.795  -16.405 -17.275  1.00 23.41  ? 321 ILE B CA    1 
ATOM   861  C  C     . ILE B 1 20 ? 17.807  -16.511 -15.748  1.00 25.05  ? 321 ILE B C     1 
ATOM   862  O  O     . ILE B 1 20 ? 18.101  -17.566 -15.182  1.00 24.20  ? 321 ILE B O     1 
ATOM   863  C  CB    . ILE B 1 20 ? 16.407  -16.877 -17.759  1.00 26.88  ? 321 ILE B CB    1 
ATOM   864  C  CG1   . ILE B 1 20 ? 16.342  -16.855 -19.286  1.00 28.02  ? 321 ILE B CG1   1 
ATOM   865  C  CG2   . ILE B 1 20 ? 15.334  -15.974 -17.185  1.00 23.81  ? 321 ILE B CG2   1 
ATOM   866  C  CD1   . ILE B 1 20 ? 16.750  -15.525 -19.906  1.00 34.85  ? 321 ILE B CD1   1 
ATOM   867  N  N     . LYS B 1 21 ? 17.450  -15.408 -15.091  1.00 26.53  ? 322 LYS B N     1 
ATOM   868  C  CA    . LYS B 1 21 ? 17.444  -15.324 -13.636  1.00 27.06  ? 322 LYS B CA    1 
ATOM   869  C  C     . LYS B 1 21 ? 16.336  -16.136 -12.948  1.00 27.05  ? 322 LYS B C     1 
ATOM   870  O  O     . LYS B 1 21 ? 15.185  -16.136 -13.389  1.00 23.90  ? 322 LYS B O     1 
ATOM   871  C  CB    . LYS B 1 21 ? 17.376  -13.851 -13.216  1.00 27.46  ? 322 LYS B CB    1 
ATOM   872  C  CG    . LYS B 1 21 ? 17.535  -13.626 -11.722  1.00 41.23  ? 322 LYS B CG    1 
ATOM   873  C  CD    . LYS B 1 21 ? 18.823  -14.276 -11.197  1.00 45.40  ? 322 LYS B CD    1 
ATOM   874  C  CE    . LYS B 1 21 ? 18.892  -14.257 -9.670   1.00 39.68  ? 322 LYS B CE    1 
ATOM   875  N  NZ    . LYS B 1 21 ? 17.702  -14.893 -9.035   1.00 35.66  ? 322 LYS B NZ    1 
ATOM   876  N  N     . LYS B 1 22 ? 16.711  -16.819 -11.864  1.00 24.69  ? 323 LYS B N     1 
ATOM   877  C  CA    . LYS B 1 22 ? 15.808  -17.667 -11.078  1.00 28.96  ? 323 LYS B CA    1 
ATOM   878  C  C     . LYS B 1 22 ? 14.422  -17.084 -10.868  1.00 28.94  ? 323 LYS B C     1 
ATOM   879  O  O     . LYS B 1 22 ? 13.422  -17.809 -10.819  1.00 24.36  ? 323 LYS B O     1 
ATOM   880  C  CB    . LYS B 1 22 ? 16.436  -17.985 -9.714   1.00 27.68  ? 323 LYS B CB    1 
ATOM   881  N  N     . ASP B 1 23 ? 14.361  -15.772 -10.724  1.00 29.21  ? 324 ASP B N     1 
ATOM   882  C  CA    . ASP B 1 23 ? 13.083  -15.136 -10.509  1.00 32.65  ? 324 ASP B CA    1 
ATOM   883  C  C     . ASP B 1 23 ? 12.410  -14.789 -11.828  1.00 30.84  ? 324 ASP B C     1 
ATOM   884  O  O     . ASP B 1 23 ? 11.266  -15.173 -12.043  1.00 32.67  ? 324 ASP B O     1 
ATOM   885  C  CB    . ASP B 1 23 ? 13.254  -13.900 -9.614   1.00 41.65  ? 324 ASP B CB    1 
ATOM   886  C  CG    . ASP B 1 23 ? 13.386  -14.263 -8.123   1.00 40.09  ? 324 ASP B CG    1 
ATOM   887  O  OD1   . ASP B 1 23 ? 12.444  -14.883 -7.564   1.00 31.35  ? 324 ASP B OD1   1 
ATOM   888  O  OD2   . ASP B 1 23 ? 14.429  -13.924 -7.516   1.00 38.17  ? 324 ASP B OD2   1 
ATOM   889  N  N     . GLU B 1 24 ? 13.119  -14.085 -12.711  1.00 30.55  ? 325 GLU B N     1 
ATOM   890  C  CA    . GLU B 1 24 ? 12.580  -13.711 -14.022  1.00 24.20  ? 325 GLU B CA    1 
ATOM   891  C  C     . GLU B 1 24 ? 12.029  -14.955 -14.725  1.00 23.09  ? 325 GLU B C     1 
ATOM   892  O  O     . GLU B 1 24 ? 11.047  -14.893 -15.464  1.00 19.47  ? 325 GLU B O     1 
ATOM   893  C  CB    . GLU B 1 24 ? 13.682  -13.082 -14.884  1.00 22.21  ? 325 GLU B CB    1 
ATOM   894  C  CG    . GLU B 1 24 ? 14.262  -11.770 -14.345  1.00 23.62  ? 325 GLU B CG    1 
ATOM   895  C  CD    . GLU B 1 24 ? 13.240  -10.650 -14.324  1.00 27.85  ? 325 GLU B CD    1 
ATOM   896  O  OE1   . GLU B 1 24 ? 12.584  -10.428 -15.359  1.00 31.81  ? 325 GLU B OE1   1 
ATOM   897  O  OE2   . GLU B 1 24 ? 13.091  -9.984  -13.282  1.00 20.26  ? 325 GLU B OE2   1 
ATOM   898  N  N     . LEU B 1 25 ? 12.678  -16.086 -14.464  1.00 23.98  ? 326 LEU B N     1 
ATOM   899  C  CA    . LEU B 1 25 ? 12.311  -17.377 -15.035  1.00 21.33  ? 326 LEU B CA    1 
ATOM   900  C  C     . LEU B 1 25 ? 10.975  -17.873 -14.516  1.00 20.63  ? 326 LEU B C     1 
ATOM   901  O  O     . LEU B 1 25 ? 10.273  -18.607 -15.193  1.00 20.82  ? 326 LEU B O     1 
ATOM   902  C  CB    . LEU B 1 25 ? 13.403  -18.393 -14.716  1.00 19.10  ? 326 LEU B CB    1 
ATOM   903  C  CG    . LEU B 1 25 ? 13.383  -19.748 -15.411  1.00 19.89  ? 326 LEU B CG    1 
ATOM   904  C  CD1   . LEU B 1 25 ? 13.052  -19.598 -16.886  1.00 20.54  ? 326 LEU B CD1   1 
ATOM   905  C  CD2   . LEU B 1 25 ? 14.744  -20.371 -15.240  1.00 6.98   ? 326 LEU B CD2   1 
ATOM   906  N  N     . LYS B 1 26 ? 10.637  -17.488 -13.295  1.00 22.74  ? 327 LYS B N     1 
ATOM   907  C  CA    . LYS B 1 26 ? 9.365   -17.872 -12.705  1.00 23.49  ? 327 LYS B CA    1 
ATOM   908  C  C     . LYS B 1 26 ? 8.324   -16.865 -13.185  1.00 25.52  ? 327 LYS B C     1 
ATOM   909  O  O     . LYS B 1 26 ? 7.227   -17.235 -13.603  1.00 24.00  ? 327 LYS B O     1 
ATOM   910  C  CB    . LYS B 1 26 ? 9.431   -17.802 -11.185  1.00 24.51  ? 327 LYS B CB    1 
ATOM   911  C  CG    . LYS B 1 26 ? 10.182  -18.904 -10.476  1.00 33.53  ? 327 LYS B CG    1 
ATOM   912  C  CD    . LYS B 1 26 ? 10.108  -18.643 -8.967   1.00 38.57  ? 327 LYS B CD    1 
ATOM   913  C  CE    . LYS B 1 26 ? 10.717  -19.755 -8.127   1.00 40.92  ? 327 LYS B CE    1 
ATOM   914  N  NZ    . LYS B 1 26 ? 10.651  -19.433 -6.669   1.00 30.63  ? 327 LYS B NZ    1 
ATOM   915  N  N     . LYS B 1 27 ? 8.684   -15.584 -13.109  1.00 26.96  ? 328 LYS B N     1 
ATOM   916  C  CA    . LYS B 1 27 ? 7.798   -14.501 -13.516  1.00 25.67  ? 328 LYS B CA    1 
ATOM   917  C  C     . LYS B 1 27 ? 7.368   -14.664 -14.951  1.00 25.22  ? 328 LYS B C     1 
ATOM   918  O  O     . LYS B 1 27 ? 6.283   -14.229 -15.333  1.00 26.87  ? 328 LYS B O     1 
ATOM   919  C  CB    . LYS B 1 27 ? 8.468   -13.134 -13.363  1.00 20.49  ? 328 LYS B CB    1 
ATOM   920  C  CG    . LYS B 1 27 ? 8.749   -12.716 -11.939  1.00 17.33  ? 328 LYS B CG    1 
ATOM   921  C  CD    . LYS B 1 27 ? 8.926   -11.218 -11.861  1.00 14.38  ? 328 LYS B CD    1 
ATOM   922  C  CE    . LYS B 1 27 ? 9.805   -10.824 -10.697  1.00 23.61  ? 328 LYS B CE    1 
ATOM   923  N  NZ    . LYS B 1 27 ? 11.216  -11.312 -10.850  1.00 28.54  ? 328 LYS B NZ    1 
ATOM   924  N  N     . SER B 1 28 ? 8.215   -15.293 -15.751  1.00 23.60  ? 329 SER B N     1 
ATOM   925  C  CA    . SER B 1 28 ? 7.878   -15.489 -17.146  1.00 22.87  ? 329 SER B CA    1 
ATOM   926  C  C     . SER B 1 28 ? 7.160   -16.816 -17.387  1.00 19.47  ? 329 SER B C     1 
ATOM   927  O  O     . SER B 1 28 ? 6.247   -16.885 -18.211  1.00 12.42  ? 329 SER B O     1 
ATOM   928  C  CB    . SER B 1 28 ? 9.138   -15.373 -17.995  1.00 21.98  ? 329 SER B CB    1 
ATOM   929  O  OG    . SER B 1 28 ? 9.684   -14.078 -17.831  1.00 10.22  ? 329 SER B OG    1 
ATOM   930  N  N     . LEU B 1 29 ? 7.549   -17.864 -16.664  1.00 17.68  ? 330 LEU B N     1 
ATOM   931  C  CA    . LEU B 1 29 ? 6.886   -19.153 -16.841  1.00 20.28  ? 330 LEU B CA    1 
ATOM   932  C  C     . LEU B 1 29 ? 5.451   -19.025 -16.391  1.00 20.79  ? 330 LEU B C     1 
ATOM   933  O  O     . LEU B 1 29 ? 4.544   -19.602 -16.990  1.00 19.68  ? 330 LEU B O     1 
ATOM   934  C  CB    . LEU B 1 29 ? 7.584   -20.261 -16.043  1.00 9.73   ? 330 LEU B CB    1 
ATOM   935  C  CG    . LEU B 1 29 ? 8.857   -20.807 -16.701  1.00 14.02  ? 330 LEU B CG    1 
ATOM   936  C  CD1   . LEU B 1 29 ? 9.433   -21.907 -15.866  1.00 18.25  ? 330 LEU B CD1   1 
ATOM   937  C  CD2   . LEU B 1 29 ? 8.549   -21.331 -18.106  1.00 19.18  ? 330 LEU B CD2   1 
ATOM   938  N  N     . HIS B 1 30 ? 5.254   -18.247 -15.333  1.00 24.64  ? 331 HIS B N     1 
ATOM   939  C  CA    . HIS B 1 30 ? 3.933   -18.036 -14.791  1.00 27.10  ? 331 HIS B CA    1 
ATOM   940  C  C     . HIS B 1 30 ? 3.095   -17.248 -15.768  1.00 28.84  ? 331 HIS B C     1 
ATOM   941  O  O     . HIS B 1 30 ? 1.914   -17.531 -15.940  1.00 31.13  ? 331 HIS B O     1 
ATOM   942  C  CB    . HIS B 1 30 ? 4.005   -17.268 -13.480  1.00 33.82  ? 331 HIS B CB    1 
ATOM   943  C  CG    . HIS B 1 30 ? 2.659   -16.935 -12.912  1.00 40.80  ? 331 HIS B CG    1 
ATOM   944  N  ND1   . HIS B 1 30 ? 1.924   -17.829 -12.161  1.00 39.28  ? 331 HIS B ND1   1 
ATOM   945  C  CD2   . HIS B 1 30 ? 1.885   -15.831 -13.047  1.00 35.71  ? 331 HIS B CD2   1 
ATOM   946  C  CE1   . HIS B 1 30 ? 0.756   -17.292 -11.861  1.00 38.16  ? 331 HIS B CE1   1 
ATOM   947  N  NE2   . HIS B 1 30 ? 0.706   -16.081 -12.388  1.00 38.64  ? 331 HIS B NE2   1 
ATOM   948  N  N     . ALA B 1 31 ? 3.708   -16.255 -16.403  1.00 29.64  ? 332 ALA B N     1 
ATOM   949  C  CA    . ALA B 1 31 ? 3.009   -15.406 -17.363  1.00 26.16  ? 332 ALA B CA    1 
ATOM   950  C  C     . ALA B 1 31 ? 2.760   -16.096 -18.693  1.00 24.57  ? 332 ALA B C     1 
ATOM   951  O  O     . ALA B 1 31 ? 2.316   -15.467 -19.647  1.00 27.91  ? 332 ALA B O     1 
ATOM   952  C  CB    . ALA B 1 31 ? 3.789   -14.136 -17.592  1.00 25.27  ? 332 ALA B CB    1 
ATOM   953  N  N     . ILE B 1 32 ? 3.041   -17.391 -18.752  1.00 24.83  ? 333 ILE B N     1 
ATOM   954  C  CA    . ILE B 1 32 ? 2.843   -18.159 -19.971  1.00 21.66  ? 333 ILE B CA    1 
ATOM   955  C  C     . ILE B 1 32 ? 1.830   -19.263 -19.775  1.00 22.84  ? 333 ILE B C     1 
ATOM   956  O  O     . ILE B 1 32 ? 1.098   -19.609 -20.703  1.00 18.94  ? 333 ILE B O     1 
ATOM   957  C  CB    . ILE B 1 32 ? 4.152   -18.778 -20.432  1.00 18.15  ? 333 ILE B CB    1 
ATOM   958  C  CG1   . ILE B 1 32 ? 5.102   -17.658 -20.850  1.00 25.92  ? 333 ILE B CG1   1 
ATOM   959  C  CG2   . ILE B 1 32 ? 3.903   -19.751 -21.558  1.00 10.63  ? 333 ILE B CG2   1 
ATOM   960  C  CD1   . ILE B 1 32 ? 6.421   -18.136 -21.398  1.00 35.89  ? 333 ILE B CD1   1 
ATOM   961  N  N     . PHE B 1 33 ? 1.789   -19.797 -18.554  1.00 24.48  ? 334 PHE B N     1 
ATOM   962  C  CA    . PHE B 1 33 ? 0.878   -20.884 -18.190  1.00 26.24  ? 334 PHE B CA    1 
ATOM   963  C  C     . PHE B 1 33 ? -0.369  -20.486 -17.388  1.00 24.84  ? 334 PHE B C     1 
ATOM   964  O  O     . PHE B 1 33 ? -1.404  -21.150 -17.459  1.00 20.13  ? 334 PHE B O     1 
ATOM   965  C  CB    . PHE B 1 33 ? 1.669   -21.950 -17.443  1.00 21.41  ? 334 PHE B CB    1 
ATOM   966  C  CG    . PHE B 1 33 ? 2.703   -22.600 -18.286  1.00 22.04  ? 334 PHE B CG    1 
ATOM   967  C  CD1   . PHE B 1 33 ? 2.333   -23.471 -19.301  1.00 26.40  ? 334 PHE B CD1   1 
ATOM   968  C  CD2   . PHE B 1 33 ? 4.039   -22.307 -18.114  1.00 23.29  ? 334 PHE B CD2   1 
ATOM   969  C  CE1   . PHE B 1 33 ? 3.282   -24.040 -20.135  1.00 21.19  ? 334 PHE B CE1   1 
ATOM   970  C  CE2   . PHE B 1 33 ? 4.996   -22.874 -18.946  1.00 24.41  ? 334 PHE B CE2   1 
ATOM   971  C  CZ    . PHE B 1 33 ? 4.613   -23.741 -19.958  1.00 17.06  ? 334 PHE B CZ    1 
ATOM   972  N  N     . SER B 1 34 ? -0.260  -19.410 -16.620  1.00 26.57  ? 335 SER B N     1 
ATOM   973  C  CA    . SER B 1 34 ? -1.376  -18.909 -15.825  1.00 27.12  ? 335 SER B CA    1 
ATOM   974  C  C     . SER B 1 34 ? -2.720  -19.138 -16.530  1.00 25.99  ? 335 SER B C     1 
ATOM   975  O  O     . SER B 1 34 ? -3.704  -19.563 -15.919  1.00 22.53  ? 335 SER B O     1 
ATOM   976  C  CB    . SER B 1 34 ? -1.170  -17.412 -15.573  1.00 24.05  ? 335 SER B CB    1 
ATOM   977  O  OG    . SER B 1 34 ? -2.368  -16.793 -15.160  1.00 27.20  ? 335 SER B OG    1 
ATOM   978  N  N     . ARG B 1 35 ? -2.728  -18.855 -17.828  1.00 26.61  ? 336 ARG B N     1 
ATOM   979  C  CA    . ARG B 1 35 ? -3.904  -18.978 -18.680  1.00 24.58  ? 336 ARG B CA    1 
ATOM   980  C  C     . ARG B 1 35 ? -4.669  -20.296 -18.573  1.00 25.97  ? 336 ARG B C     1 
ATOM   981  O  O     . ARG B 1 35 ? -5.895  -20.324 -18.701  1.00 26.13  ? 336 ARG B O     1 
ATOM   982  C  CB    . ARG B 1 35 ? -3.487  -18.766 -20.126  1.00 20.81  ? 336 ARG B CB    1 
ATOM   983  C  CG    . ARG B 1 35 ? -2.507  -19.807 -20.603  1.00 23.35  ? 336 ARG B CG    1 
ATOM   984  C  CD    . ARG B 1 35 ? -2.046  -19.538 -22.019  1.00 25.45  ? 336 ARG B CD    1 
ATOM   985  N  NE    . ARG B 1 35 ? -1.228  -18.328 -22.169  1.00 22.00  ? 336 ARG B NE    1 
ATOM   986  C  CZ    . ARG B 1 35 ? -1.681  -17.168 -22.642  1.00 18.60  ? 336 ARG B CZ    1 
ATOM   987  N  NH1   . ARG B 1 35 ? -2.955  -17.044 -23.002  1.00 16.56  ? 336 ARG B NH1   1 
ATOM   988  N  NH2   . ARG B 1 35 ? -0.849  -16.151 -22.815  1.00 8.99   ? 336 ARG B NH2   1 
ATOM   989  N  N     . PHE B 1 36 ? -3.956  -21.387 -18.335  1.00 25.92  ? 337 PHE B N     1 
ATOM   990  C  CA    . PHE B 1 36 ? -4.605  -22.683 -18.250  1.00 29.50  ? 337 PHE B CA    1 
ATOM   991  C  C     . PHE B 1 36 ? -5.376  -22.892 -16.961  1.00 30.09  ? 337 PHE B C     1 
ATOM   992  O  O     . PHE B 1 36 ? -6.577  -23.152 -16.987  1.00 35.83  ? 337 PHE B O     1 
ATOM   993  C  CB    . PHE B 1 36 ? -3.569  -23.787 -18.465  1.00 28.22  ? 337 PHE B CB    1 
ATOM   994  C  CG    . PHE B 1 36 ? -2.888  -23.700 -19.805  1.00 34.41  ? 337 PHE B CG    1 
ATOM   995  C  CD1   . PHE B 1 36 ? -3.617  -23.857 -20.980  1.00 35.93  ? 337 PHE B CD1   1 
ATOM   996  C  CD2   . PHE B 1 36 ? -1.534  -23.400 -19.900  1.00 35.47  ? 337 PHE B CD2   1 
ATOM   997  C  CE1   . PHE B 1 36 ? -3.012  -23.713 -22.229  1.00 32.24  ? 337 PHE B CE1   1 
ATOM   998  C  CE2   . PHE B 1 36 ? -0.923  -23.255 -21.143  1.00 32.48  ? 337 PHE B CE2   1 
ATOM   999  C  CZ    . PHE B 1 36 ? -1.669  -23.412 -22.307  1.00 32.02  ? 337 PHE B CZ    1 
ATOM   1000 N  N     . GLY B 1 37 ? -4.699  -22.767 -15.832  1.00 32.47  ? 338 GLY B N     1 
ATOM   1001 C  CA    . GLY B 1 37 ? -5.372  -22.950 -14.561  1.00 37.52  ? 338 GLY B CA    1 
ATOM   1002 C  C     . GLY B 1 37 ? -4.651  -22.196 -13.467  1.00 39.99  ? 338 GLY B C     1 
ATOM   1003 O  O     . GLY B 1 37 ? -3.814  -21.345 -13.755  1.00 45.96  ? 338 GLY B O     1 
ATOM   1004 N  N     . GLN B 1 38 ? -4.974  -22.491 -12.213  1.00 38.29  ? 339 GLN B N     1 
ATOM   1005 C  CA    . GLN B 1 38 ? -4.310  -21.831 -11.104  1.00 34.28  ? 339 GLN B CA    1 
ATOM   1006 C  C     . GLN B 1 38 ? -3.020  -22.587 -10.816  1.00 34.00  ? 339 GLN B C     1 
ATOM   1007 O  O     . GLN B 1 38 ? -2.978  -23.815 -10.886  1.00 32.79  ? 339 GLN B O     1 
ATOM   1008 C  CB    . GLN B 1 38 ? -5.208  -21.829 -9.875   1.00 35.79  ? 339 GLN B CB    1 
ATOM   1009 C  CG    . GLN B 1 38 ? -4.541  -21.283 -8.627   1.00 38.63  ? 339 GLN B CG    1 
ATOM   1010 C  CD    . GLN B 1 38 ? -5.393  -21.485 -7.387   1.00 39.65  ? 339 GLN B CD    1 
ATOM   1011 O  OE1   . GLN B 1 38 ? -4.872  -21.596 -6.271   1.00 35.61  ? 339 GLN B OE1   1 
ATOM   1012 N  NE2   . GLN B 1 38 ? -6.713  -21.529 -7.575   1.00 34.02  ? 339 GLN B NE2   1 
ATOM   1013 N  N     . ILE B 1 39 ? -1.967  -21.848 -10.494  1.00 35.08  ? 340 ILE B N     1 
ATOM   1014 C  CA    . ILE B 1 39 ? -0.673  -22.459 -10.223  1.00 37.27  ? 340 ILE B CA    1 
ATOM   1015 C  C     . ILE B 1 39 ? -0.256  -22.370 -8.753   1.00 37.86  ? 340 ILE B C     1 
ATOM   1016 O  O     . ILE B 1 39 ? -0.052  -21.284 -8.208   1.00 37.54  ? 340 ILE B O     1 
ATOM   1017 C  CB    . ILE B 1 39 ? 0.422   -21.809 -11.107  1.00 35.32  ? 340 ILE B CB    1 
ATOM   1018 C  CG1   . ILE B 1 39 ? 0.061   -21.997 -12.582  1.00 24.85  ? 340 ILE B CG1   1 
ATOM   1019 C  CG2   . ILE B 1 39 ? 1.790   -22.418 -10.795  1.00 35.69  ? 340 ILE B CG2   1 
ATOM   1020 C  CD1   . ILE B 1 39 ? 1.022   -21.359 -13.526  1.00 17.73  ? 340 ILE B CD1   1 
ATOM   1021 N  N     . LEU B 1 40 ? -0.127  -23.519 -8.108   1.00 38.46  ? 341 LEU B N     1 
ATOM   1022 C  CA    . LEU B 1 40 ? 0.276   -23.527 -6.712   1.00 41.37  ? 341 LEU B CA    1 
ATOM   1023 C  C     . LEU B 1 40 ? 1.649   -22.885 -6.640   1.00 41.45  ? 341 LEU B C     1 
ATOM   1024 O  O     . LEU B 1 40 ? 1.807   -21.790 -6.096   1.00 42.18  ? 341 LEU B O     1 
ATOM   1025 C  CB    . LEU B 1 40 ? 0.313   -24.961 -6.189   1.00 40.14  ? 341 LEU B CB    1 
ATOM   1026 C  CG    . LEU B 1 40 ? -1.007  -25.691 -6.471   1.00 40.39  ? 341 LEU B CG    1 
ATOM   1027 C  CD1   . LEU B 1 40 ? -0.971  -27.088 -5.874   1.00 39.99  ? 341 LEU B CD1   1 
ATOM   1028 C  CD2   . LEU B 1 40 ? -2.163  -24.885 -5.906   1.00 29.68  ? 341 LEU B CD2   1 
ATOM   1029 N  N     . ASP B 1 41 ? 2.641   -23.556 -7.210   1.00 39.61  ? 342 ASP B N     1 
ATOM   1030 C  CA    . ASP B 1 41 ? 3.979   -23.003 -7.211   1.00 35.54  ? 342 ASP B CA    1 
ATOM   1031 C  C     . ASP B 1 41 ? 4.762   -23.329 -8.481   1.00 37.58  ? 342 ASP B C     1 
ATOM   1032 O  O     . ASP B 1 41 ? 4.365   -24.181 -9.274   1.00 41.82  ? 342 ASP B O     1 
ATOM   1033 C  CB    . ASP B 1 41 ? 4.744   -23.480 -5.980   1.00 27.03  ? 342 ASP B CB    1 
ATOM   1034 C  CG    . ASP B 1 41 ? 5.826   -22.510 -5.573   1.00 30.24  ? 342 ASP B CG    1 
ATOM   1035 O  OD1   . ASP B 1 41 ? 5.726   -21.334 -5.981   1.00 28.83  ? 342 ASP B OD1   1 
ATOM   1036 O  OD2   . ASP B 1 41 ? 6.761   -22.904 -4.843   1.00 38.43  ? 342 ASP B OD2   1 
ATOM   1037 N  N     . ILE B 1 42 ? 5.864   -22.612 -8.669   1.00 35.58  ? 343 ILE B N     1 
ATOM   1038 C  CA    . ILE B 1 42 ? 6.757   -22.778 -9.807   1.00 25.57  ? 343 ILE B CA    1 
ATOM   1039 C  C     . ILE B 1 42 ? 8.120   -22.981 -9.186   1.00 25.87  ? 343 ILE B C     1 
ATOM   1040 O  O     . ILE B 1 42 ? 8.699   -22.052 -8.629   1.00 25.21  ? 343 ILE B O     1 
ATOM   1041 C  CB    . ILE B 1 42 ? 6.784   -21.509 -10.692  1.00 25.04  ? 343 ILE B CB    1 
ATOM   1042 C  CG1   . ILE B 1 42 ? 5.533   -21.462 -11.572  1.00 24.58  ? 343 ILE B CG1   1 
ATOM   1043 C  CG2   . ILE B 1 42 ? 8.053   -21.474 -11.532  1.00 17.50  ? 343 ILE B CG2   1 
ATOM   1044 C  CD1   . ILE B 1 42 ? 5.337   -20.144 -12.306  1.00 23.01  ? 343 ILE B CD1   1 
ATOM   1045 N  N     . LEU B 1 43 ? 8.628   -24.200 -9.277   1.00 30.23  ? 344 LEU B N     1 
ATOM   1046 C  CA    . LEU B 1 43 ? 9.921   -24.526 -8.687   1.00 36.00  ? 344 LEU B CA    1 
ATOM   1047 C  C     . LEU B 1 43 ? 11.101  -24.413 -9.633   1.00 34.35  ? 344 LEU B C     1 
ATOM   1048 O  O     . LEU B 1 43 ? 11.196  -25.161 -10.603  1.00 35.45  ? 344 LEU B O     1 
ATOM   1049 C  CB    . LEU B 1 43 ? 9.874   -25.935 -8.098   1.00 36.22  ? 344 LEU B CB    1 
ATOM   1050 C  CG    . LEU B 1 43 ? 8.876   -26.058 -6.950   1.00 29.30  ? 344 LEU B CG    1 
ATOM   1051 C  CD1   . LEU B 1 43 ? 8.777   -27.498 -6.535   1.00 28.41  ? 344 LEU B CD1   1 
ATOM   1052 C  CD2   . LEU B 1 43 ? 9.310   -25.169 -5.793   1.00 27.69  ? 344 LEU B CD2   1 
ATOM   1053 N  N     . VAL B 1 44 ? 12.004  -23.486 -9.315   1.00 29.52  ? 345 VAL B N     1 
ATOM   1054 C  CA    . VAL B 1 44 ? 13.196  -23.229 -10.112  1.00 30.39  ? 345 VAL B CA    1 
ATOM   1055 C  C     . VAL B 1 44 ? 14.483  -23.433 -9.300   1.00 31.43  ? 345 VAL B C     1 
ATOM   1056 O  O     . VAL B 1 44 ? 14.504  -23.245 -8.084   1.00 35.76  ? 345 VAL B O     1 
ATOM   1057 C  CB    . VAL B 1 44 ? 13.152  -21.780 -10.700  1.00 27.88  ? 345 VAL B CB    1 
ATOM   1058 C  CG1   . VAL B 1 44 ? 14.525  -21.332 -11.144  1.00 31.99  ? 345 VAL B CG1   1 
ATOM   1059 C  CG2   . VAL B 1 44 ? 12.216  -21.736 -11.888  1.00 27.57  ? 345 VAL B CG2   1 
ATOM   1060 N  N     . SER B 1 45 ? 15.547  -23.835 -9.991   1.00 29.89  ? 346 SER B N     1 
ATOM   1061 C  CA    . SER B 1 45 ? 16.858  -24.070 -9.392   1.00 25.91  ? 346 SER B CA    1 
ATOM   1062 C  C     . SER B 1 45 ? 17.902  -23.925 -10.495  1.00 26.39  ? 346 SER B C     1 
ATOM   1063 O  O     . SER B 1 45 ? 17.731  -24.471 -11.590  1.00 30.38  ? 346 SER B O     1 
ATOM   1064 C  CB    . SER B 1 45 ? 16.928  -25.481 -8.805   1.00 28.55  ? 346 SER B CB    1 
ATOM   1065 O  OG    . SER B 1 45 ? 18.246  -25.811 -8.396   1.00 24.96  ? 346 SER B OG    1 
ATOM   1066 N  N     . ARG B 1 46 ? 18.976  -23.192 -10.216  1.00 19.50  ? 347 ARG B N     1 
ATOM   1067 C  CA    . ARG B 1 46 ? 20.020  -22.995 -11.210  1.00 16.74  ? 347 ARG B CA    1 
ATOM   1068 C  C     . ARG B 1 46 ? 21.268  -23.794 -10.881  1.00 23.22  ? 347 ARG B C     1 
ATOM   1069 O  O     . ARG B 1 46 ? 22.349  -23.547 -11.414  1.00 28.99  ? 347 ARG B O     1 
ATOM   1070 C  CB    . ARG B 1 46 ? 20.359  -21.517 -11.334  1.00 7.11   ? 347 ARG B CB    1 
ATOM   1071 C  CG    . ARG B 1 46 ? 19.162  -20.657 -11.685  1.00 15.42  ? 347 ARG B CG    1 
ATOM   1072 C  CD    . ARG B 1 46 ? 19.573  -19.225 -11.959  1.00 21.55  ? 347 ARG B CD    1 
ATOM   1073 N  NE    . ARG B 1 46 ? 20.399  -19.141 -13.157  1.00 24.23  ? 347 ARG B NE    1 
ATOM   1074 C  CZ    . ARG B 1 46 ? 20.974  -18.027 -13.586  1.00 25.04  ? 347 ARG B CZ    1 
ATOM   1075 N  NH1   . ARG B 1 46 ? 20.814  -16.901 -12.910  1.00 33.52  ? 347 ARG B NH1   1 
ATOM   1076 N  NH2   . ARG B 1 46 ? 21.706  -18.038 -14.689  1.00 31.39  ? 347 ARG B NH2   1 
ATOM   1077 N  N     . SER B 1 47 ? 21.112  -24.768 -9.998   1.00 29.47  ? 348 SER B N     1 
ATOM   1078 C  CA    . SER B 1 47 ? 22.224  -25.617 -9.613   1.00 27.04  ? 348 SER B CA    1 
ATOM   1079 C  C     . SER B 1 47 ? 22.509  -26.599 -10.752  1.00 24.25  ? 348 SER B C     1 
ATOM   1080 O  O     . SER B 1 47 ? 21.584  -27.059 -11.427  1.00 19.00  ? 348 SER B O     1 
ATOM   1081 C  CB    . SER B 1 47 ? 21.885  -26.353 -8.305   1.00 27.82  ? 348 SER B CB    1 
ATOM   1082 O  OG    . SER B 1 47 ? 20.499  -26.662 -8.218   1.00 19.65  ? 348 SER B OG    1 
ATOM   1083 N  N     . LEU B 1 48 ? 23.793  -26.892 -10.954  1.00 17.51  ? 349 LEU B N     1 
ATOM   1084 C  CA    . LEU B 1 48 ? 24.281  -27.794 -11.996  1.00 14.71  ? 349 LEU B CA    1 
ATOM   1085 C  C     . LEU B 1 48 ? 23.339  -28.892 -12.496  1.00 17.34  ? 349 LEU B C     1 
ATOM   1086 O  O     . LEU B 1 48 ? 23.084  -28.988 -13.695  1.00 25.74  ? 349 LEU B O     1 
ATOM   1087 C  CB    . LEU B 1 48 ? 25.592  -28.428 -11.535  1.00 13.76  ? 349 LEU B CB    1 
ATOM   1088 C  CG    . LEU B 1 48 ? 26.386  -29.374 -12.448  1.00 9.61   ? 349 LEU B CG    1 
ATOM   1089 C  CD1   . LEU B 1 48 ? 26.741  -28.704 -13.764  1.00 3.17   ? 349 LEU B CD1   1 
ATOM   1090 C  CD2   . LEU B 1 48 ? 27.654  -29.789 -11.709  1.00 7.52   ? 349 LEU B CD2   1 
ATOM   1091 N  N     . LYS B 1 49 ? 22.828  -29.730 -11.604  1.00 12.90  ? 350 LYS B N     1 
ATOM   1092 C  CA    . LYS B 1 49 ? 21.930  -30.799 -12.027  1.00 15.43  ? 350 LYS B CA    1 
ATOM   1093 C  C     . LYS B 1 49 ? 20.536  -30.281 -12.393  1.00 23.32  ? 350 LYS B C     1 
ATOM   1094 O  O     . LYS B 1 49 ? 19.942  -30.719 -13.382  1.00 26.83  ? 350 LYS B O     1 
ATOM   1095 C  CB    . LYS B 1 49 ? 21.826  -31.854 -10.936  1.00 8.25   ? 350 LYS B CB    1 
ATOM   1096 N  N     . MET B 1 50 ? 20.025  -29.340 -11.602  1.00 27.22  ? 351 MET B N     1 
ATOM   1097 C  CA    . MET B 1 50 ? 18.703  -28.772 -11.835  1.00 31.60  ? 351 MET B CA    1 
ATOM   1098 C  C     . MET B 1 50 ? 18.631  -27.739 -12.957  1.00 31.74  ? 351 MET B C     1 
ATOM   1099 O  O     . MET B 1 50 ? 17.711  -27.783 -13.773  1.00 30.36  ? 351 MET B O     1 
ATOM   1100 C  CB    . MET B 1 50 ? 18.166  -28.153 -10.545  1.00 35.58  ? 351 MET B CB    1 
ATOM   1101 C  CG    . MET B 1 50 ? 17.767  -29.177 -9.497   1.00 46.09  ? 351 MET B CG    1 
ATOM   1102 S  SD    . MET B 1 50 ? 16.351  -30.191 -9.986   1.00 55.39  ? 351 MET B SD    1 
ATOM   1103 C  CE    . MET B 1 50 ? 14.996  -29.216 -9.265   1.00 44.90  ? 351 MET B CE    1 
ATOM   1104 N  N     . ARG B 1 51 ? 19.595  -26.821 -12.998  1.00 27.15  ? 352 ARG B N     1 
ATOM   1105 C  CA    . ARG B 1 51 ? 19.628  -25.770 -14.015  1.00 23.73  ? 352 ARG B CA    1 
ATOM   1106 C  C     . ARG B 1 51 ? 19.045  -26.137 -15.385  1.00 26.15  ? 352 ARG B C     1 
ATOM   1107 O  O     . ARG B 1 51 ? 19.085  -27.294 -15.810  1.00 26.08  ? 352 ARG B O     1 
ATOM   1108 C  CB    . ARG B 1 51 ? 21.053  -25.263 -14.198  1.00 15.78  ? 352 ARG B CB    1 
ATOM   1109 C  CG    . ARG B 1 51 ? 22.046  -26.326 -14.567  1.00 16.83  ? 352 ARG B CG    1 
ATOM   1110 C  CD    . ARG B 1 51 ? 23.387  -25.712 -14.920  1.00 17.17  ? 352 ARG B CD    1 
ATOM   1111 N  NE    . ARG B 1 51 ? 23.890  -24.855 -13.858  1.00 26.46  ? 352 ARG B NE    1 
ATOM   1112 C  CZ    . ARG B 1 51 ? 25.135  -24.400 -13.799  1.00 35.82  ? 352 ARG B CZ    1 
ATOM   1113 N  NH1   . ARG B 1 51 ? 26.000  -24.719 -14.750  1.00 33.25  ? 352 ARG B NH1   1 
ATOM   1114 N  NH2   . ARG B 1 51 ? 25.520  -23.644 -12.780  1.00 38.16  ? 352 ARG B NH2   1 
ATOM   1115 N  N     . GLY B 1 52 ? 18.503  -25.126 -16.064  1.00 25.76  ? 353 GLY B N     1 
ATOM   1116 C  CA    . GLY B 1 52 ? 17.898  -25.310 -17.372  1.00 14.60  ? 353 GLY B CA    1 
ATOM   1117 C  C     . GLY B 1 52 ? 16.481  -25.852 -17.296  1.00 16.21  ? 353 GLY B C     1 
ATOM   1118 O  O     . GLY B 1 52 ? 15.745  -25.816 -18.275  1.00 14.20  ? 353 GLY B O     1 
ATOM   1119 N  N     . GLN B 1 53 ? 16.090  -26.324 -16.116  1.00 20.71  ? 354 GLN B N     1 
ATOM   1120 C  CA    . GLN B 1 53 ? 14.775  -26.924 -15.907  1.00 20.69  ? 354 GLN B CA    1 
ATOM   1121 C  C     . GLN B 1 53 ? 13.861  -26.144 -14.950  1.00 21.32  ? 354 GLN B C     1 
ATOM   1122 O  O     . GLN B 1 53 ? 14.261  -25.126 -14.355  1.00 18.36  ? 354 GLN B O     1 
ATOM   1123 C  CB    . GLN B 1 53 ? 14.990  -28.346 -15.391  1.00 21.00  ? 354 GLN B CB    1 
ATOM   1124 C  CG    . GLN B 1 53 ? 16.238  -28.990 -16.006  1.00 31.96  ? 354 GLN B CG    1 
ATOM   1125 C  CD    . GLN B 1 53 ? 16.841  -30.109 -15.165  1.00 36.51  ? 354 GLN B CD    1 
ATOM   1126 O  OE1   . GLN B 1 53 ? 18.049  -30.350 -15.212  1.00 31.12  ? 354 GLN B OE1   1 
ATOM   1127 N  NE2   . GLN B 1 53 ? 16.002  -30.803 -14.402  1.00 41.03  ? 354 GLN B NE2   1 
ATOM   1128 N  N     . ALA B 1 54 ? 12.627  -26.630 -14.820  1.00 20.13  ? 355 ALA B N     1 
ATOM   1129 C  CA    . ALA B 1 54 ? 11.626  -26.018 -13.944  1.00 23.00  ? 355 ALA B CA    1 
ATOM   1130 C  C     . ALA B 1 54 ? 10.386  -26.910 -13.765  1.00 26.63  ? 355 ALA B C     1 
ATOM   1131 O  O     . ALA B 1 54 ? 10.100  -27.773 -14.605  1.00 29.80  ? 355 ALA B O     1 
ATOM   1132 C  CB    . ALA B 1 54 ? 11.217  -24.661 -14.498  1.00 20.89  ? 355 ALA B CB    1 
ATOM   1133 N  N     . PHE B 1 55 ? 9.658   -26.701 -12.667  1.00 23.18  ? 356 PHE B N     1 
ATOM   1134 C  CA    . PHE B 1 55 ? 8.448   -27.475 -12.371  1.00 26.38  ? 356 PHE B CA    1 
ATOM   1135 C  C     . PHE B 1 55 ? 7.280   -26.542 -12.049  1.00 28.70  ? 356 PHE B C     1 
ATOM   1136 O  O     . PHE B 1 55 ? 7.447   -25.600 -11.279  1.00 33.70  ? 356 PHE B O     1 
ATOM   1137 C  CB    . PHE B 1 55 ? 8.669   -28.368 -11.153  1.00 24.27  ? 356 PHE B CB    1 
ATOM   1138 C  CG    . PHE B 1 55 ? 9.689   -29.450 -11.344  1.00 25.18  ? 356 PHE B CG    1 
ATOM   1139 C  CD1   . PHE B 1 55 ? 9.310   -30.706 -11.795  1.00 25.72  ? 356 PHE B CD1   1 
ATOM   1140 C  CD2   . PHE B 1 55 ? 11.022  -29.236 -10.990  1.00 24.99  ? 356 PHE B CD2   1 
ATOM   1141 C  CE1   . PHE B 1 55 ? 10.241  -31.737 -11.881  1.00 27.40  ? 356 PHE B CE1   1 
ATOM   1142 C  CE2   . PHE B 1 55 ? 11.960  -30.252 -11.073  1.00 14.72  ? 356 PHE B CE2   1 
ATOM   1143 C  CZ    . PHE B 1 55 ? 11.568  -31.511 -11.518  1.00 23.01  ? 356 PHE B CZ    1 
ATOM   1144 N  N     . VAL B 1 56 ? 6.104   -26.793 -12.620  1.00 29.88  ? 357 VAL B N     1 
ATOM   1145 C  CA    . VAL B 1 56 ? 4.946   -25.951 -12.321  1.00 35.93  ? 357 VAL B CA    1 
ATOM   1146 C  C     . VAL B 1 56 ? 3.793   -26.785 -11.803  1.00 39.66  ? 357 VAL B C     1 
ATOM   1147 O  O     . VAL B 1 56 ? 3.201   -27.587 -12.532  1.00 39.76  ? 357 VAL B O     1 
ATOM   1148 C  CB    . VAL B 1 56 ? 4.437   -25.126 -13.541  1.00 36.02  ? 357 VAL B CB    1 
ATOM   1149 C  CG1   . VAL B 1 56 ? 5.430   -24.050 -13.900  1.00 34.73  ? 357 VAL B CG1   1 
ATOM   1150 C  CG2   . VAL B 1 56 ? 4.193   -26.025 -14.718  1.00 38.54  ? 357 VAL B CG2   1 
ATOM   1151 N  N     . ILE B 1 57 ? 3.493   -26.584 -10.523  1.00 42.08  ? 358 ILE B N     1 
ATOM   1152 C  CA    . ILE B 1 57 ? 2.420   -27.286 -9.845   1.00 39.28  ? 358 ILE B CA    1 
ATOM   1153 C  C     . ILE B 1 57 ? 1.124   -26.558 -10.121  1.00 40.87  ? 358 ILE B C     1 
ATOM   1154 O  O     . ILE B 1 57 ? 0.944   -25.416 -9.699   1.00 38.25  ? 358 ILE B O     1 
ATOM   1155 C  CB    . ILE B 1 57 ? 2.616   -27.282 -8.328   1.00 39.84  ? 358 ILE B CB    1 
ATOM   1156 C  CG1   . ILE B 1 57 ? 4.101   -27.390 -7.980   1.00 38.22  ? 358 ILE B CG1   1 
ATOM   1157 C  CG2   . ILE B 1 57 ? 1.832   -28.424 -7.712   1.00 43.73  ? 358 ILE B CG2   1 
ATOM   1158 C  CD1   . ILE B 1 57 ? 4.763   -28.639 -8.468   1.00 31.77  ? 358 ILE B CD1   1 
ATOM   1159 N  N     . PHE B 1 58 ? 0.225   -27.215 -10.839  1.00 43.30  ? 359 PHE B N     1 
ATOM   1160 C  CA    . PHE B 1 58 ? -1.072  -26.629 -11.144  1.00 47.91  ? 359 PHE B CA    1 
ATOM   1161 C  C     . PHE B 1 58 ? -2.045  -27.080 -10.057  1.00 52.03  ? 359 PHE B C     1 
ATOM   1162 O  O     . PHE B 1 58 ? -1.711  -27.925 -9.218   1.00 50.28  ? 359 PHE B O     1 
ATOM   1163 C  CB    . PHE B 1 58 ? -1.571  -27.109 -12.517  1.00 45.30  ? 359 PHE B CB    1 
ATOM   1164 C  CG    . PHE B 1 58 ? -0.912  -26.427 -13.689  1.00 34.74  ? 359 PHE B CG    1 
ATOM   1165 C  CD1   . PHE B 1 58 ? -1.279  -25.142 -14.057  1.00 31.01  ? 359 PHE B CD1   1 
ATOM   1166 C  CD2   . PHE B 1 58 ? 0.069   -27.076 -14.425  1.00 30.48  ? 359 PHE B CD2   1 
ATOM   1167 C  CE1   . PHE B 1 58 ? -0.677  -24.518 -15.143  1.00 33.12  ? 359 PHE B CE1   1 
ATOM   1168 C  CE2   . PHE B 1 58 ? 0.676   -26.460 -15.509  1.00 25.86  ? 359 PHE B CE2   1 
ATOM   1169 C  CZ    . PHE B 1 58 ? 0.303   -25.179 -15.871  1.00 26.53  ? 359 PHE B CZ    1 
ATOM   1170 N  N     . LYS B 1 59 ? -3.246  -26.516 -10.066  1.00 55.80  ? 360 LYS B N     1 
ATOM   1171 C  CA    . LYS B 1 59 ? -4.240  -26.897 -9.078   1.00 57.90  ? 360 LYS B CA    1 
ATOM   1172 C  C     . LYS B 1 59 ? -4.803  -28.257 -9.489   1.00 57.86  ? 360 LYS B C     1 
ATOM   1173 O  O     . LYS B 1 59 ? -4.790  -29.207 -8.700   1.00 51.21  ? 360 LYS B O     1 
ATOM   1174 C  CB    . LYS B 1 59 ? -5.349  -25.846 -9.015   1.00 58.72  ? 360 LYS B CB    1 
ATOM   1175 C  CG    . LYS B 1 59 ? -6.233  -25.944 -7.779   1.00 61.58  ? 360 LYS B CG    1 
ATOM   1176 C  CD    . LYS B 1 59 ? -7.114  -24.704 -7.631   1.00 63.93  ? 360 LYS B CD    1 
ATOM   1177 C  CE    . LYS B 1 59 ? -8.048  -24.515 -8.825   1.00 65.36  ? 360 LYS B CE    1 
ATOM   1178 N  NZ    . LYS B 1 59 ? -8.719  -23.177 -8.828   1.00 63.44  ? 360 LYS B NZ    1 
ATOM   1179 N  N     . GLU B 1 60 ? -5.275  -28.341 -10.737  1.00 59.32  ? 361 GLU B N     1 
ATOM   1180 C  CA    . GLU B 1 60 ? -5.840  -29.579 -11.287  1.00 60.04  ? 361 GLU B CA    1 
ATOM   1181 C  C     . GLU B 1 60 ? -4.935  -30.137 -12.396  1.00 58.89  ? 361 GLU B C     1 
ATOM   1182 O  O     . GLU B 1 60 ? -4.143  -29.398 -12.989  1.00 57.48  ? 361 GLU B O     1 
ATOM   1183 C  CB    . GLU B 1 60 ? -7.245  -29.333 -11.858  1.00 59.77  ? 361 GLU B CB    1 
ATOM   1184 C  CG    . GLU B 1 60 ? -8.247  -28.666 -10.911  1.00 62.55  ? 361 GLU B CG    1 
ATOM   1185 C  CD    . GLU B 1 60 ? -8.425  -29.412 -9.600   1.00 65.29  ? 361 GLU B CD    1 
ATOM   1186 O  OE1   . GLU B 1 60 ? -8.447  -30.662 -9.627   1.00 70.16  ? 361 GLU B OE1   1 
ATOM   1187 O  OE2   . GLU B 1 60 ? -8.557  -28.748 -8.546   1.00 60.01  ? 361 GLU B OE2   1 
ATOM   1188 N  N     . VAL B 1 61 ? -5.076  -31.432 -12.680  1.00 56.11  ? 362 VAL B N     1 
ATOM   1189 C  CA    . VAL B 1 61 ? -4.265  -32.114 -13.695  1.00 52.64  ? 362 VAL B CA    1 
ATOM   1190 C  C     . VAL B 1 61 ? -4.656  -31.770 -15.120  1.00 50.25  ? 362 VAL B C     1 
ATOM   1191 O  O     . VAL B 1 61 ? -3.805  -31.678 -16.005  1.00 50.84  ? 362 VAL B O     1 
ATOM   1192 C  CB    . VAL B 1 61 ? -4.366  -33.639 -13.560  1.00 52.12  ? 362 VAL B CB    1 
ATOM   1193 C  CG1   . VAL B 1 61 ? -3.116  -34.299 -14.121  1.00 45.19  ? 362 VAL B CG1   1 
ATOM   1194 C  CG2   . VAL B 1 61 ? -4.581  -34.013 -12.113  1.00 58.84  ? 362 VAL B CG2   1 
ATOM   1195 N  N     . SER B 1 62 ? -5.948  -31.605 -15.350  1.00 48.05  ? 363 SER B N     1 
ATOM   1196 C  CA    . SER B 1 62 ? -6.416  -31.268 -16.682  1.00 46.89  ? 363 SER B CA    1 
ATOM   1197 C  C     . SER B 1 62 ? -5.631  -30.080 -17.210  1.00 44.14  ? 363 SER B C     1 
ATOM   1198 O  O     . SER B 1 62 ? -5.154  -30.100 -18.343  1.00 42.82  ? 363 SER B O     1 
ATOM   1199 C  CB    . SER B 1 62 ? -7.893  -30.917 -16.640  1.00 47.73  ? 363 SER B CB    1 
ATOM   1200 O  OG    . SER B 1 62 ? -8.104  -29.850 -15.741  1.00 52.16  ? 363 SER B OG    1 
ATOM   1201 N  N     . SER B 1 63 ? -5.497  -29.050 -16.381  1.00 41.23  ? 364 SER B N     1 
ATOM   1202 C  CA    . SER B 1 63 ? -4.773  -27.852 -16.775  1.00 43.94  ? 364 SER B CA    1 
ATOM   1203 C  C     . SER B 1 63 ? -3.384  -28.160 -17.320  1.00 46.74  ? 364 SER B C     1 
ATOM   1204 O  O     . SER B 1 63 ? -3.035  -27.738 -18.423  1.00 50.52  ? 364 SER B O     1 
ATOM   1205 C  CB    . SER B 1 63 ? -4.660  -26.885 -15.597  1.00 44.23  ? 364 SER B CB    1 
ATOM   1206 O  OG    . SER B 1 63 ? -5.727  -25.953 -15.606  1.00 44.14  ? 364 SER B OG    1 
ATOM   1207 N  N     . ALA B 1 64 ? -2.591  -28.891 -16.546  1.00 44.53  ? 365 ALA B N     1 
ATOM   1208 C  CA    . ALA B 1 64 ? -1.241  -29.240 -16.969  1.00 41.41  ? 365 ALA B CA    1 
ATOM   1209 C  C     . ALA B 1 64 ? -1.294  -30.028 -18.268  1.00 38.44  ? 365 ALA B C     1 
ATOM   1210 O  O     . ALA B 1 64 ? -0.333  -30.045 -19.033  1.00 35.30  ? 365 ALA B O     1 
ATOM   1211 C  CB    . ALA B 1 64 ? -0.552  -30.056 -15.887  1.00 46.63  ? 365 ALA B CB    1 
ATOM   1212 N  N     . THR B 1 65 ? -2.422  -30.688 -18.507  1.00 37.23  ? 366 THR B N     1 
ATOM   1213 C  CA    . THR B 1 65 ? -2.596  -31.465 -19.725  1.00 37.51  ? 366 THR B CA    1 
ATOM   1214 C  C     . THR B 1 65 ? -2.730  -30.524 -20.910  1.00 34.58  ? 366 THR B C     1 
ATOM   1215 O  O     . THR B 1 65 ? -2.101  -30.722 -21.941  1.00 34.53  ? 366 THR B O     1 
ATOM   1216 C  CB    . THR B 1 65 ? -3.839  -32.364 -19.636  1.00 37.42  ? 366 THR B CB    1 
ATOM   1217 O  OG1   . THR B 1 65 ? -3.559  -33.464 -18.765  1.00 39.11  ? 366 THR B OG1   1 
ATOM   1218 C  CG2   . THR B 1 65 ? -4.228  -32.891 -21.004  1.00 38.57  ? 366 THR B CG2   1 
ATOM   1219 N  N     . ASN B 1 66 ? -3.553  -29.498 -20.755  1.00 34.72  ? 367 ASN B N     1 
ATOM   1220 C  CA    . ASN B 1 66 ? -3.747  -28.521 -21.810  1.00 36.25  ? 367 ASN B CA    1 
ATOM   1221 C  C     . ASN B 1 66 ? -2.572  -27.553 -21.807  1.00 36.73  ? 367 ASN B C     1 
ATOM   1222 O  O     . ASN B 1 66 ? -2.358  -26.797 -22.756  1.00 43.20  ? 367 ASN B O     1 
ATOM   1223 C  CB    . ASN B 1 66 ? -5.056  -27.772 -21.591  1.00 39.08  ? 367 ASN B CB    1 
ATOM   1224 C  CG    . ASN B 1 66 ? -6.241  -28.705 -21.514  1.00 43.63  ? 367 ASN B CG    1 
ATOM   1225 O  OD1   . ASN B 1 66 ? -6.407  -29.442 -20.538  1.00 35.79  ? 367 ASN B OD1   1 
ATOM   1226 N  ND2   . ASN B 1 66 ? -7.067  -28.695 -22.556  1.00 49.73  ? 367 ASN B ND2   1 
ATOM   1227 N  N     . ALA B 1 67 ? -1.808  -27.577 -20.728  1.00 31.42  ? 368 ALA B N     1 
ATOM   1228 C  CA    . ALA B 1 67 ? -0.649  -26.719 -20.631  1.00 27.22  ? 368 ALA B CA    1 
ATOM   1229 C  C     . ALA B 1 67 ? 0.462   -27.447 -21.341  1.00 25.16  ? 368 ALA B C     1 
ATOM   1230 O  O     . ALA B 1 67 ? 1.406   -26.835 -21.808  1.00 27.76  ? 368 ALA B O     1 
ATOM   1231 C  CB    . ALA B 1 67 ? -0.278  -26.496 -19.181  1.00 30.58  ? 368 ALA B CB    1 
ATOM   1232 N  N     . LEU B 1 68 ? 0.334   -28.768 -21.413  1.00 27.28  ? 369 LEU B N     1 
ATOM   1233 C  CA    . LEU B 1 68 ? 1.321   -29.636 -22.057  1.00 26.85  ? 369 LEU B CA    1 
ATOM   1234 C  C     . LEU B 1 68 ? 1.007   -29.713 -23.552  1.00 27.00  ? 369 LEU B C     1 
ATOM   1235 O  O     . LEU B 1 68 ? 1.827   -29.384 -24.414  1.00 20.61  ? 369 LEU B O     1 
ATOM   1236 C  CB    . LEU B 1 68 ? 1.240   -31.045 -21.449  1.00 27.82  ? 369 LEU B CB    1 
ATOM   1237 C  CG    . LEU B 1 68 ? 2.499   -31.872 -21.139  1.00 35.17  ? 369 LEU B CG    1 
ATOM   1238 C  CD1   . LEU B 1 68 ? 2.068   -33.279 -20.768  1.00 26.27  ? 369 LEU B CD1   1 
ATOM   1239 C  CD2   . LEU B 1 68 ? 3.447   -31.926 -22.325  1.00 35.57  ? 369 LEU B CD2   1 
ATOM   1240 N  N     . ARG B 1 69 ? -0.203  -30.159 -23.844  1.00 30.18  ? 370 ARG B N     1 
ATOM   1241 C  CA    . ARG B 1 69 ? -0.651  -30.291 -25.209  1.00 32.38  ? 370 ARG B CA    1 
ATOM   1242 C  C     . ARG B 1 69 ? -0.438  -28.994 -25.977  1.00 33.59  ? 370 ARG B C     1 
ATOM   1243 O  O     . ARG B 1 69 ? 0.182   -28.989 -27.043  1.00 36.12  ? 370 ARG B O     1 
ATOM   1244 C  CB    . ARG B 1 69 ? -2.119  -30.677 -25.223  1.00 31.98  ? 370 ARG B CB    1 
ATOM   1245 N  N     . SER B 1 70 ? -0.926  -27.895 -25.411  1.00 32.76  ? 371 SER B N     1 
ATOM   1246 C  CA    . SER B 1 70 ? -0.846  -26.590 -26.056  1.00 34.77  ? 371 SER B CA    1 
ATOM   1247 C  C     . SER B 1 70 ? 0.457   -25.792 -26.059  1.00 33.65  ? 371 SER B C     1 
ATOM   1248 O  O     . SER B 1 70 ? 0.572   -24.841 -26.821  1.00 29.19  ? 371 SER B O     1 
ATOM   1249 C  CB    . SER B 1 70 ? -1.949  -25.687 -25.510  1.00 38.50  ? 371 SER B CB    1 
ATOM   1250 O  OG    . SER B 1 70 ? -1.954  -24.448 -26.201  1.00 47.04  ? 371 SER B OG    1 
ATOM   1251 N  N     . MET B 1 71 ? 1.433   -26.147 -25.229  1.00 36.56  ? 372 MET B N     1 
ATOM   1252 C  CA    . MET B 1 71 ? 2.688   -25.386 -25.191  1.00 35.11  ? 372 MET B CA    1 
ATOM   1253 C  C     . MET B 1 71 ? 3.928   -26.185 -25.527  1.00 31.58  ? 372 MET B C     1 
ATOM   1254 O  O     . MET B 1 71 ? 5.033   -25.645 -25.501  1.00 33.13  ? 372 MET B O     1 
ATOM   1255 C  CB    . MET B 1 71 ? 2.892   -24.733 -23.816  1.00 32.36  ? 372 MET B CB    1 
ATOM   1256 C  CG    . MET B 1 71 ? 1.940   -23.587 -23.517  1.00 32.76  ? 372 MET B CG    1 
ATOM   1257 S  SD    . MET B 1 71 ? 2.169   -22.148 -24.597  1.00 32.14  ? 372 MET B SD    1 
ATOM   1258 C  CE    . MET B 1 71 ? 1.405   -20.872 -23.617  1.00 22.17  ? 372 MET B CE    1 
ATOM   1259 N  N     . GLN B 1 72 ? 3.754   -27.464 -25.829  1.00 25.73  ? 373 GLN B N     1 
ATOM   1260 C  CA    . GLN B 1 72 ? 4.889   -28.302 -26.165  1.00 27.01  ? 373 GLN B CA    1 
ATOM   1261 C  C     . GLN B 1 72 ? 5.656   -27.674 -27.328  1.00 29.37  ? 373 GLN B C     1 
ATOM   1262 O  O     . GLN B 1 72 ? 5.120   -27.527 -28.422  1.00 28.29  ? 373 GLN B O     1 
ATOM   1263 C  CB    . GLN B 1 72 ? 4.411   -29.694 -26.556  1.00 31.46  ? 373 GLN B CB    1 
ATOM   1264 C  CG    . GLN B 1 72 ? 5.538   -30.649 -26.793  1.00 30.61  ? 373 GLN B CG    1 
ATOM   1265 C  CD    . GLN B 1 72 ? 6.408   -30.778 -25.573  1.00 34.58  ? 373 GLN B CD    1 
ATOM   1266 O  OE1   . GLN B 1 72 ? 6.089   -31.524 -24.649  1.00 30.05  ? 373 GLN B OE1   1 
ATOM   1267 N  NE2   . GLN B 1 72 ? 7.511   -30.034 -25.550  1.00 33.85  ? 373 GLN B NE2   1 
ATOM   1268 N  N     . GLY B 1 73 ? 6.908   -27.296 -27.086  1.00 30.57  ? 374 GLY B N     1 
ATOM   1269 C  CA    . GLY B 1 73 ? 7.706   -26.680 -28.130  1.00 27.22  ? 374 GLY B CA    1 
ATOM   1270 C  C     . GLY B 1 73 ? 7.691   -25.161 -28.093  1.00 28.75  ? 374 GLY B C     1 
ATOM   1271 O  O     . GLY B 1 73 ? 8.670   -24.521 -28.467  1.00 30.58  ? 374 GLY B O     1 
ATOM   1272 N  N     . PHE B 1 74 ? 6.584   -24.585 -27.635  1.00 30.56  ? 375 PHE B N     1 
ATOM   1273 C  CA    . PHE B 1 74 ? 6.424   -23.136 -27.554  1.00 29.16  ? 375 PHE B CA    1 
ATOM   1274 C  C     . PHE B 1 74 ? 7.730   -22.378 -27.309  1.00 26.17  ? 375 PHE B C     1 
ATOM   1275 O  O     . PHE B 1 74 ? 8.594   -22.823 -26.564  1.00 27.48  ? 375 PHE B O     1 
ATOM   1276 C  CB    . PHE B 1 74 ? 5.402   -22.794 -26.460  1.00 37.70  ? 375 PHE B CB    1 
ATOM   1277 C  CG    . PHE B 1 74 ? 4.998   -21.336 -26.426  1.00 44.80  ? 375 PHE B CG    1 
ATOM   1278 C  CD1   . PHE B 1 74 ? 5.831   -20.373 -25.859  1.00 43.61  ? 375 PHE B CD1   1 
ATOM   1279 C  CD2   . PHE B 1 74 ? 3.781   -20.923 -26.965  1.00 47.31  ? 375 PHE B CD2   1 
ATOM   1280 C  CE1   . PHE B 1 74 ? 5.457   -19.022 -25.826  1.00 42.04  ? 375 PHE B CE1   1 
ATOM   1281 C  CE2   . PHE B 1 74 ? 3.400   -19.574 -26.936  1.00 46.82  ? 375 PHE B CE2   1 
ATOM   1282 C  CZ    . PHE B 1 74 ? 4.243   -18.625 -26.364  1.00 43.55  ? 375 PHE B CZ    1 
ATOM   1283 N  N     . PRO B 1 75 ? 7.886   -21.217 -27.957  1.00 25.19  ? 376 PRO B N     1 
ATOM   1284 C  CA    . PRO B 1 75 ? 9.039   -20.308 -27.891  1.00 27.18  ? 376 PRO B CA    1 
ATOM   1285 C  C     . PRO B 1 75 ? 9.204   -19.589 -26.550  1.00 22.51  ? 376 PRO B C     1 
ATOM   1286 O  O     . PRO B 1 75 ? 8.303   -18.884 -26.112  1.00 26.00  ? 376 PRO B O     1 
ATOM   1287 C  CB    . PRO B 1 75 ? 8.756   -19.311 -29.021  1.00 27.40  ? 376 PRO B CB    1 
ATOM   1288 C  CG    . PRO B 1 75 ? 7.964   -20.103 -29.982  1.00 27.97  ? 376 PRO B CG    1 
ATOM   1289 C  CD    . PRO B 1 75 ? 7.013   -20.838 -29.079  1.00 28.71  ? 376 PRO B CD    1 
ATOM   1290 N  N     . PHE B 1 76 ? 10.361  -19.734 -25.917  1.00 19.90  ? 377 PHE B N     1 
ATOM   1291 C  CA    . PHE B 1 76 ? 10.589  -19.079 -24.631  1.00 26.34  ? 377 PHE B CA    1 
ATOM   1292 C  C     . PHE B 1 76 ? 11.978  -18.459 -24.553  1.00 25.31  ? 377 PHE B C     1 
ATOM   1293 O  O     . PHE B 1 76 ? 12.978  -19.174 -24.524  1.00 29.52  ? 377 PHE B O     1 
ATOM   1294 C  CB    . PHE B 1 76 ? 10.424  -20.098 -23.497  1.00 33.08  ? 377 PHE B CB    1 
ATOM   1295 C  CG    . PHE B 1 76 ? 10.552  -19.512 -22.116  1.00 33.51  ? 377 PHE B CG    1 
ATOM   1296 C  CD1   . PHE B 1 76 ? 9.448   -18.984 -21.468  1.00 33.60  ? 377 PHE B CD1   1 
ATOM   1297 C  CD2   . PHE B 1 76 ? 11.782  -19.493 -21.465  1.00 38.89  ? 377 PHE B CD2   1 
ATOM   1298 C  CE1   . PHE B 1 76 ? 9.563   -18.446 -20.193  1.00 36.95  ? 377 PHE B CE1   1 
ATOM   1299 C  CE2   . PHE B 1 76 ? 11.909  -18.956 -20.188  1.00 36.42  ? 377 PHE B CE2   1 
ATOM   1300 C  CZ    . PHE B 1 76 ? 10.797  -18.432 -19.551  1.00 39.02  ? 377 PHE B CZ    1 
ATOM   1301 N  N     . TYR B 1 77 ? 12.042  -17.133 -24.521  1.00 23.27  ? 378 TYR B N     1 
ATOM   1302 C  CA    . TYR B 1 77 ? 13.324  -16.443 -24.428  1.00 23.20  ? 378 TYR B CA    1 
ATOM   1303 C  C     . TYR B 1 77 ? 14.367  -16.922 -25.430  1.00 26.96  ? 378 TYR B C     1 
ATOM   1304 O  O     . TYR B 1 77 ? 15.533  -17.032 -25.062  1.00 32.67  ? 378 TYR B O     1 
ATOM   1305 C  CB    . TYR B 1 77 ? 13.923  -16.629 -23.034  1.00 20.39  ? 378 TYR B CB    1 
ATOM   1306 C  CG    . TYR B 1 77 ? 13.518  -15.634 -21.976  1.00 27.55  ? 378 TYR B CG    1 
ATOM   1307 C  CD1   . TYR B 1 77 ? 13.753  -14.274 -22.141  1.00 37.96  ? 378 TYR B CD1   1 
ATOM   1308 C  CD2   . TYR B 1 77 ? 12.996  -16.062 -20.760  1.00 36.31  ? 378 TYR B CD2   1 
ATOM   1309 C  CE1   . TYR B 1 77 ? 13.486  -13.358 -21.109  1.00 47.49  ? 378 TYR B CE1   1 
ATOM   1310 C  CE2   . TYR B 1 77 ? 12.727  -15.159 -19.721  1.00 45.89  ? 378 TYR B CE2   1 
ATOM   1311 C  CZ    . TYR B 1 77 ? 12.980  -13.809 -19.900  1.00 46.37  ? 378 TYR B CZ    1 
ATOM   1312 O  OH    . TYR B 1 77 ? 12.781  -12.923 -18.860  1.00 46.25  ? 378 TYR B OH    1 
ATOM   1313 N  N     . ASP B 1 78 ? 13.972  -17.213 -26.670  1.00 29.48  ? 379 ASP B N     1 
ATOM   1314 C  CA    . ASP B 1 78 ? 14.904  -17.693 -27.717  1.00 31.62  ? 379 ASP B CA    1 
ATOM   1315 C  C     . ASP B 1 78 ? 15.084  -19.224 -27.805  1.00 28.39  ? 379 ASP B C     1 
ATOM   1316 O  O     . ASP B 1 78 ? 15.942  -19.705 -28.552  1.00 30.22  ? 379 ASP B O     1 
ATOM   1317 C  CB    . ASP B 1 78 ? 16.296  -17.041 -27.560  1.00 31.32  ? 379 ASP B CB    1 
ATOM   1318 C  CG    . ASP B 1 78 ? 17.348  -18.004 -26.982  1.00 38.08  ? 379 ASP B CG    1 
ATOM   1319 O  OD1   . ASP B 1 78 ? 17.026  -18.757 -26.038  1.00 36.79  ? 379 ASP B OD1   1 
ATOM   1320 O  OD2   . ASP B 1 78 ? 18.507  -18.001 -27.461  1.00 43.63  ? 379 ASP B OD2   1 
ATOM   1321 N  N     . LYS B 1 79 ? 14.285  -19.989 -27.065  1.00 21.14  ? 380 LYS B N     1 
ATOM   1322 C  CA    . LYS B 1 79 ? 14.419  -21.437 -27.109  1.00 20.17  ? 380 LYS B CA    1 
ATOM   1323 C  C     . LYS B 1 79 ? 13.152  -22.265 -26.892  1.00 21.04  ? 380 LYS B C     1 
ATOM   1324 O  O     . LYS B 1 79 ? 12.359  -21.996 -25.991  1.00 18.30  ? 380 LYS B O     1 
ATOM   1325 C  CB    . LYS B 1 79 ? 15.484  -21.878 -26.111  1.00 21.89  ? 380 LYS B CB    1 
ATOM   1326 C  CG    . LYS B 1 79 ? 16.901  -21.600 -26.546  1.00 9.39   ? 380 LYS B CG    1 
ATOM   1327 C  CD    . LYS B 1 79 ? 17.884  -22.094 -25.506  1.00 12.85  ? 380 LYS B CD    1 
ATOM   1328 C  CE    . LYS B 1 79 ? 17.633  -23.543 -25.132  1.00 13.77  ? 380 LYS B CE    1 
ATOM   1329 N  NZ    . LYS B 1 79 ? 18.615  -24.007 -24.129  1.00 12.94  ? 380 LYS B NZ    1 
ATOM   1330 N  N     . PRO B 1 80 ? 12.961  -23.303 -27.722  1.00 22.13  ? 381 PRO B N     1 
ATOM   1331 C  CA    . PRO B 1 80 ? 11.809  -24.212 -27.668  1.00 25.84  ? 381 PRO B CA    1 
ATOM   1332 C  C     . PRO B 1 80 ? 11.762  -25.082 -26.413  1.00 28.48  ? 381 PRO B C     1 
ATOM   1333 O  O     . PRO B 1 80 ? 12.492  -26.074 -26.296  1.00 29.22  ? 381 PRO B O     1 
ATOM   1334 C  CB    . PRO B 1 80 ? 11.963  -25.041 -28.942  1.00 21.54  ? 381 PRO B CB    1 
ATOM   1335 C  CG    . PRO B 1 80 ? 13.438  -25.062 -29.152  1.00 22.75  ? 381 PRO B CG    1 
ATOM   1336 C  CD    . PRO B 1 80 ? 13.841  -23.646 -28.854  1.00 18.05  ? 381 PRO B CD    1 
ATOM   1337 N  N     . MET B 1 81 ? 10.888  -24.714 -25.484  1.00 27.68  ? 382 MET B N     1 
ATOM   1338 C  CA    . MET B 1 81 ? 10.752  -25.456 -24.239  1.00 32.87  ? 382 MET B CA    1 
ATOM   1339 C  C     . MET B 1 81 ? 10.069  -26.807 -24.367  1.00 31.13  ? 382 MET B C     1 
ATOM   1340 O  O     . MET B 1 81 ? 8.968   -26.916 -24.909  1.00 30.24  ? 382 MET B O     1 
ATOM   1341 C  CB    . MET B 1 81 ? 10.012  -24.620 -23.194  1.00 37.85  ? 382 MET B CB    1 
ATOM   1342 C  CG    . MET B 1 81 ? 8.744   -23.960 -23.686  1.00 42.67  ? 382 MET B CG    1 
ATOM   1343 S  SD    . MET B 1 81 ? 7.937   -23.007 -22.389  1.00 33.08  ? 382 MET B SD    1 
ATOM   1344 C  CE    . MET B 1 81 ? 6.279   -23.481 -22.672  1.00 43.44  ? 382 MET B CE    1 
ATOM   1345 N  N     . ARG B 1 82 ? 10.749  -27.831 -23.854  1.00 29.17  ? 383 ARG B N     1 
ATOM   1346 C  CA    . ARG B 1 82 ? 10.254  -29.196 -23.861  1.00 25.50  ? 383 ARG B CA    1 
ATOM   1347 C  C     . ARG B 1 82 ? 9.523   -29.474 -22.565  1.00 29.33  ? 383 ARG B C     1 
ATOM   1348 O  O     . ARG B 1 82 ? 10.080  -29.346 -21.475  1.00 32.70  ? 383 ARG B O     1 
ATOM   1349 C  CB    . ARG B 1 82 ? 11.409  -30.170 -24.036  1.00 18.86  ? 383 ARG B CB    1 
ATOM   1350 C  CG    . ARG B 1 82 ? 11.894  -30.208 -25.459  1.00 30.67  ? 383 ARG B CG    1 
ATOM   1351 C  CD    . ARG B 1 82 ? 13.352  -29.827 -25.595  1.00 36.26  ? 383 ARG B CD    1 
ATOM   1352 N  NE    . ARG B 1 82 ? 14.231  -30.846 -25.033  1.00 40.28  ? 383 ARG B NE    1 
ATOM   1353 C  CZ    . ARG B 1 82 ? 15.547  -30.860 -25.192  1.00 39.95  ? 383 ARG B CZ    1 
ATOM   1354 N  NH1   . ARG B 1 82 ? 16.138  -29.913 -25.902  1.00 40.37  ? 383 ARG B NH1   1 
ATOM   1355 N  NH2   . ARG B 1 82 ? 16.274  -31.812 -24.628  1.00 49.80  ? 383 ARG B NH2   1 
ATOM   1356 N  N     . ILE B 1 83 ? 8.265   -29.864 -22.705  1.00 29.96  ? 384 ILE B N     1 
ATOM   1357 C  CA    . ILE B 1 83 ? 7.396   -30.146 -21.577  1.00 29.28  ? 384 ILE B CA    1 
ATOM   1358 C  C     . ILE B 1 83 ? 7.010   -31.618 -21.482  1.00 30.00  ? 384 ILE B C     1 
ATOM   1359 O  O     . ILE B 1 83 ? 6.992   -32.344 -22.473  1.00 31.17  ? 384 ILE B O     1 
ATOM   1360 C  CB    . ILE B 1 83 ? 6.112   -29.316 -21.696  1.00 28.24  ? 384 ILE B CB    1 
ATOM   1361 C  CG1   . ILE B 1 83 ? 6.467   -27.833 -21.803  1.00 27.74  ? 384 ILE B CG1   1 
ATOM   1362 C  CG2   . ILE B 1 83 ? 5.211   -29.577 -20.516  1.00 27.66  ? 384 ILE B CG2   1 
ATOM   1363 C  CD1   . ILE B 1 83 ? 5.321   -26.978 -22.261  1.00 28.78  ? 384 ILE B CD1   1 
ATOM   1364 N  N     . GLN B 1 84 ? 6.697   -32.047 -20.272  1.00 29.79  ? 385 GLN B N     1 
ATOM   1365 C  CA    . GLN B 1 84 ? 6.286   -33.412 -20.021  1.00 36.85  ? 385 GLN B CA    1 
ATOM   1366 C  C     . GLN B 1 84 ? 5.796   -33.531 -18.584  1.00 39.79  ? 385 GLN B C     1 
ATOM   1367 O  O     . GLN B 1 84 ? 6.234   -32.788 -17.709  1.00 38.60  ? 385 GLN B O     1 
ATOM   1368 C  CB    . GLN B 1 84 ? 7.446   -34.382 -20.277  1.00 39.58  ? 385 GLN B CB    1 
ATOM   1369 C  CG    . GLN B 1 84 ? 8.847   -33.832 -19.997  1.00 38.84  ? 385 GLN B CG    1 
ATOM   1370 C  CD    . GLN B 1 84 ? 9.916   -34.922 -20.064  1.00 41.44  ? 385 GLN B CD    1 
ATOM   1371 O  OE1   . GLN B 1 84 ? 11.107  -34.662 -19.886  1.00 36.28  ? 385 GLN B OE1   1 
ATOM   1372 N  NE2   . GLN B 1 84 ? 9.485   -36.153 -20.316  1.00 40.73  ? 385 GLN B NE2   1 
ATOM   1373 N  N     . TYR B 1 85 ? 4.867   -34.447 -18.343  1.00 40.64  ? 386 TYR B N     1 
ATOM   1374 C  CA    . TYR B 1 85 ? 4.354   -34.628 -16.998  1.00 41.96  ? 386 TYR B CA    1 
ATOM   1375 C  C     . TYR B 1 85 ? 5.516   -35.095 -16.139  1.00 48.71  ? 386 TYR B C     1 
ATOM   1376 O  O     . TYR B 1 85 ? 6.436   -35.751 -16.638  1.00 51.43  ? 386 TYR B O     1 
ATOM   1377 C  CB    . TYR B 1 85 ? 3.258   -35.689 -16.972  1.00 38.94  ? 386 TYR B CB    1 
ATOM   1378 C  CG    . TYR B 1 85 ? 1.976   -35.317 -17.674  1.00 30.63  ? 386 TYR B CG    1 
ATOM   1379 C  CD1   . TYR B 1 85 ? 1.215   -34.233 -17.257  1.00 32.12  ? 386 TYR B CD1   1 
ATOM   1380 C  CD2   . TYR B 1 85 ? 1.497   -36.090 -18.723  1.00 23.68  ? 386 TYR B CD2   1 
ATOM   1381 C  CE1   . TYR B 1 85 ? -0.003  -33.935 -17.874  1.00 34.99  ? 386 TYR B CE1   1 
ATOM   1382 C  CE2   . TYR B 1 85 ? 0.295   -35.805 -19.340  1.00 23.38  ? 386 TYR B CE2   1 
ATOM   1383 C  CZ    . TYR B 1 85 ? -0.455  -34.732 -18.918  1.00 32.78  ? 386 TYR B CZ    1 
ATOM   1384 O  OH    . TYR B 1 85 ? -1.656  -34.472 -19.544  1.00 30.05  ? 386 TYR B OH    1 
ATOM   1385 N  N     . ALA B 1 86 ? 5.470   -34.758 -14.853  1.00 51.33  ? 387 ALA B N     1 
ATOM   1386 C  CA    . ALA B 1 86 ? 6.518   -35.146 -13.915  1.00 52.50  ? 387 ALA B CA    1 
ATOM   1387 C  C     . ALA B 1 86 ? 6.538   -36.662 -13.706  1.00 56.14  ? 387 ALA B C     1 
ATOM   1388 O  O     . ALA B 1 86 ? 5.514   -37.337 -13.859  1.00 57.94  ? 387 ALA B O     1 
ATOM   1389 C  CB    . ALA B 1 86 ? 6.306   -34.434 -12.587  1.00 47.09  ? 387 ALA B CB    1 
ATOM   1390 N  N     . LYS B 1 87 ? 7.706   -37.199 -13.370  1.00 57.68  ? 388 LYS B N     1 
ATOM   1391 C  CA    . LYS B 1 87 ? 7.822   -38.631 -13.137  1.00 57.19  ? 388 LYS B CA    1 
ATOM   1392 C  C     . LYS B 1 87 ? 7.039   -39.023 -11.895  1.00 56.44  ? 388 LYS B C     1 
ATOM   1393 O  O     . LYS B 1 87 ? 6.592   -40.164 -11.779  1.00 59.32  ? 388 LYS B O     1 
ATOM   1394 C  CB    . LYS B 1 87 ? 9.294   -39.041 -12.997  1.00 55.13  ? 388 LYS B CB    1 
ATOM   1395 C  CG    . LYS B 1 87 ? 9.964   -39.281 -14.345  1.00 57.49  ? 388 LYS B CG    1 
ATOM   1396 C  CD    . LYS B 1 87 ? 11.493  -39.317 -14.294  1.00 58.34  ? 388 LYS B CD    1 
ATOM   1397 C  CE    . LYS B 1 87 ? 12.064  -39.457 -15.716  1.00 62.16  ? 388 LYS B CE    1 
ATOM   1398 N  NZ    . LYS B 1 87 ? 13.531  -39.203 -15.833  1.00 63.84  ? 388 LYS B NZ    1 
ATOM   1399 N  N     . THR B 1 88 ? 6.861   -38.076 -10.975  1.00 53.49  ? 389 THR B N     1 
ATOM   1400 C  CA    . THR B 1 88 ? 6.124   -38.337 -9.735   1.00 54.90  ? 389 THR B CA    1 
ATOM   1401 C  C     . THR B 1 88 ? 5.562   -37.054 -9.094   1.00 55.14  ? 389 THR B C     1 
ATOM   1402 O  O     . THR B 1 88 ? 6.130   -35.974 -9.262   1.00 57.09  ? 389 THR B O     1 
ATOM   1403 C  CB    . THR B 1 88 ? 7.029   -39.039 -8.669   1.00 53.75  ? 389 THR B CB    1 
ATOM   1404 O  OG1   . THR B 1 88 ? 7.645   -38.048 -7.835   1.00 53.90  ? 389 THR B OG1   1 
ATOM   1405 C  CG2   . THR B 1 88 ? 8.130   -39.864 -9.336   1.00 42.94  ? 389 THR B CG2   1 
ATOM   1406 N  N     . ASP B 1 89 ? 4.459   -37.183 -8.355   1.00 49.00  ? 390 ASP B N     1 
ATOM   1407 C  CA    . ASP B 1 89 ? 3.830   -36.050 -7.669   1.00 42.11  ? 390 ASP B CA    1 
ATOM   1408 C  C     . ASP B 1 89 ? 4.871   -35.150 -6.987   1.00 41.78  ? 390 ASP B C     1 
ATOM   1409 O  O     . ASP B 1 89 ? 5.988   -35.582 -6.700   1.00 38.80  ? 390 ASP B O     1 
ATOM   1410 C  CB    . ASP B 1 89 ? 2.846   -36.566 -6.609   1.00 41.03  ? 390 ASP B CB    1 
ATOM   1411 C  CG    . ASP B 1 89 ? 1.444   -36.784 -7.152   1.00 42.66  ? 390 ASP B CG    1 
ATOM   1412 O  OD1   . ASP B 1 89 ? 0.572   -35.908 -6.941   1.00 44.34  ? 390 ASP B OD1   1 
ATOM   1413 O  OD2   . ASP B 1 89 ? 1.212   -37.830 -7.790   1.00 40.96  ? 390 ASP B OD2   1 
ATOM   1414 N  N     . SER B 1 90 ? 4.496   -33.902 -6.725   1.00 41.78  ? 391 SER B N     1 
ATOM   1415 C  CA    . SER B 1 90 ? 5.387   -32.944 -6.068   1.00 45.49  ? 391 SER B CA    1 
ATOM   1416 C  C     . SER B 1 90 ? 5.121   -33.014 -4.577   1.00 46.09  ? 391 SER B C     1 
ATOM   1417 O  O     . SER B 1 90 ? 4.371   -33.870 -4.135   1.00 50.28  ? 391 SER B O     1 
ATOM   1418 C  CB    . SER B 1 90 ? 5.088   -31.534 -6.557   1.00 50.06  ? 391 SER B CB    1 
ATOM   1419 O  OG    . SER B 1 90 ? 4.678   -31.557 -7.911   1.00 52.97  ? 391 SER B OG    1 
ATOM   1420 N  N     . ASP B 1 91 ? 5.714   -32.115 -3.796   1.00 47.41  ? 392 ASP B N     1 
ATOM   1421 C  CA    . ASP B 1 91 ? 5.482   -32.140 -2.352   1.00 48.33  ? 392 ASP B CA    1 
ATOM   1422 C  C     . ASP B 1 91 ? 4.177   -31.453 -1.960   1.00 49.68  ? 392 ASP B C     1 
ATOM   1423 O  O     . ASP B 1 91 ? 3.222   -32.107 -1.538   1.00 45.58  ? 392 ASP B O     1 
ATOM   1424 C  CB    . ASP B 1 91 ? 6.646   -31.495 -1.586   1.00 42.60  ? 392 ASP B CB    1 
ATOM   1425 C  CG    . ASP B 1 91 ? 7.674   -32.515 -1.099   1.00 41.74  ? 392 ASP B CG    1 
ATOM   1426 O  OD1   . ASP B 1 91 ? 8.451   -32.171 -0.183   1.00 33.03  ? 392 ASP B OD1   1 
ATOM   1427 O  OD2   . ASP B 1 91 ? 7.712   -33.650 -1.628   1.00 36.44  ? 392 ASP B OD2   1 
ATOM   1428 N  N     . ILE B 1 92 ? 4.133   -30.135 -2.103   1.00 53.68  ? 393 ILE B N     1 
ATOM   1429 C  CA    . ILE B 1 92 ? 2.935   -29.393 -1.743   1.00 55.14  ? 393 ILE B CA    1 
ATOM   1430 C  C     . ILE B 1 92 ? 1.704   -30.107 -2.274   1.00 54.97  ? 393 ILE B C     1 
ATOM   1431 O  O     . ILE B 1 92 ? 0.618   -29.969 -1.727   1.00 57.83  ? 393 ILE B O     1 
ATOM   1432 C  CB    . ILE B 1 92 ? 2.955   -27.953 -2.312   1.00 56.14  ? 393 ILE B CB    1 
ATOM   1433 C  CG1   . ILE B 1 92 ? 2.885   -27.994 -3.841   1.00 58.80  ? 393 ILE B CG1   1 
ATOM   1434 C  CG2   . ILE B 1 92 ? 4.213   -27.225 -1.846   1.00 54.85  ? 393 ILE B CG2   1 
ATOM   1435 C  CD1   . ILE B 1 92 ? 2.815   -26.618 -4.503   1.00 56.83  ? 393 ILE B CD1   1 
ATOM   1436 N  N     . ILE B 1 93 ? 1.878   -30.879 -3.339   1.00 54.56  ? 394 ILE B N     1 
ATOM   1437 C  CA    . ILE B 1 93 ? 0.761   -31.599 -3.924   1.00 57.41  ? 394 ILE B CA    1 
ATOM   1438 C  C     . ILE B 1 93 ? 0.546   -32.947 -3.236   1.00 59.64  ? 394 ILE B C     1 
ATOM   1439 O  O     . ILE B 1 93 ? -0.588  -33.330 -2.948   1.00 60.87  ? 394 ILE B O     1 
ATOM   1440 C  CB    . ILE B 1 93 ? 0.983   -31.836 -5.429   1.00 58.02  ? 394 ILE B CB    1 
ATOM   1441 C  CG1   . ILE B 1 93 ? -0.335  -32.216 -6.094   1.00 58.38  ? 394 ILE B CG1   1 
ATOM   1442 C  CG2   . ILE B 1 93 ? 1.983   -32.949 -5.646   1.00 59.53  ? 394 ILE B CG2   1 
ATOM   1443 C  CD1   . ILE B 1 93 ? -1.366  -31.115 -6.051   1.00 61.65  ? 394 ILE B CD1   1 
ATOM   1444 N  N     . ALA B 1 94 ? 1.635   -33.659 -2.967   1.00 58.87  ? 395 ALA B N     1 
ATOM   1445 C  CA    . ALA B 1 94 ? 1.554   -34.963 -2.322   1.00 61.69  ? 395 ALA B CA    1 
ATOM   1446 C  C     . ALA B 1 94 ? 0.853   -34.882 -0.971   1.00 66.87  ? 395 ALA B C     1 
ATOM   1447 O  O     . ALA B 1 94 ? 0.434   -35.901 -0.415   1.00 69.81  ? 395 ALA B O     1 
ATOM   1448 C  CB    . ALA B 1 94 ? 2.949   -35.543 -2.144   1.00 59.05  ? 395 ALA B CB    1 
ATOM   1449 N  N     . LYS B 1 95 ? 0.727   -33.669 -0.444   1.00 68.34  ? 396 LYS B N     1 
ATOM   1450 C  CA    . LYS B 1 95 ? 0.086   -33.460 0.849    1.00 69.62  ? 396 LYS B CA    1 
ATOM   1451 C  C     . LYS B 1 95 ? -1.388  -33.066 0.746    1.00 72.33  ? 396 LYS B C     1 
ATOM   1452 O  O     . LYS B 1 95 ? -1.921  -32.398 1.632    1.00 70.39  ? 396 LYS B O     1 
ATOM   1453 C  CB    . LYS B 1 95 ? 0.850   -32.390 1.635    1.00 69.04  ? 396 LYS B CB    1 
ATOM   1454 C  CG    . LYS B 1 95 ? 2.118   -32.883 2.331    1.00 70.36  ? 396 LYS B CG    1 
ATOM   1455 C  CD    . LYS B 1 95 ? 3.114   -33.547 1.380    1.00 70.04  ? 396 LYS B CD    1 
ATOM   1456 C  CE    . LYS B 1 95 ? 4.359   -34.029 2.132    1.00 64.06  ? 396 LYS B CE    1 
ATOM   1457 N  NZ    . LYS B 1 95 ? 5.296   -34.789 1.258    1.00 61.99  ? 396 LYS B NZ    1 
ATOM   1458 N  N     . MET B 1 96 ? -2.046  -33.486 -0.331   1.00 76.86  ? 397 MET B N     1 
ATOM   1459 C  CA    . MET B 1 96 ? -3.459  -33.171 -0.541   1.00 79.32  ? 397 MET B CA    1 
ATOM   1460 C  C     . MET B 1 96 ? -4.391  -34.233 0.066    1.00 79.90  ? 397 MET B C     1 
ATOM   1461 O  O     . MET B 1 96 ? -3.910  -35.349 0.374    1.00 76.48  ? 397 MET B O     1 
ATOM   1462 C  CB    . MET B 1 96 ? -3.742  -33.029 -2.045   1.00 78.64  ? 397 MET B CB    1 
ATOM   1463 C  CG    . MET B 1 96 ? -4.094  -31.612 -2.504   1.00 77.74  ? 397 MET B CG    1 
ATOM   1464 S  SD    . MET B 1 96 ? -2.809  -30.381 -2.192   1.00 72.10  ? 397 MET B SD    1 
ATOM   1465 C  CE    . MET B 1 96 ? -3.353  -29.715 -0.621   1.00 71.52  ? 397 MET B CE    1 
ATOM   1466 N  N     . PRO C 1 3  ? 7.309   -29.643 -60.466  1.00 81.51  ? 404 PRO C N     1 
ATOM   1467 C  CA    . PRO C 1 3  ? 7.278   -30.936 -59.742  1.00 85.15  ? 404 PRO C CA    1 
ATOM   1468 C  C     . PRO C 1 3  ? 5.872   -31.222 -59.219  1.00 89.88  ? 404 PRO C C     1 
ATOM   1469 O  O     . PRO C 1 3  ? 4.897   -30.673 -59.737  1.00 90.86  ? 404 PRO C O     1 
ATOM   1470 C  CB    . PRO C 1 3  ? 8.281   -30.831 -58.605  1.00 82.71  ? 404 PRO C CB    1 
ATOM   1471 C  CG    . PRO C 1 3  ? 9.265   -29.813 -59.177  1.00 80.98  ? 404 PRO C CG    1 
ATOM   1472 C  CD    . PRO C 1 3  ? 8.384   -28.793 -59.928  1.00 80.77  ? 404 PRO C CD    1 
ATOM   1473 N  N     . GLU C 1 4  ? 5.846   -31.994 -58.287  1.00 92.75  ? 405 GLU C N     1 
ATOM   1474 C  CA    . GLU C 1 4  ? 4.642   -32.186 -57.647  1.00 92.78  ? 405 GLU C CA    1 
ATOM   1475 C  C     . GLU C 1 4  ? 5.171   -32.639 -56.350  1.00 92.94  ? 405 GLU C C     1 
ATOM   1476 O  O     . GLU C 1 4  ? 6.054   -33.479 -56.272  1.00 95.11  ? 405 GLU C O     1 
ATOM   1477 C  CB    . GLU C 1 4  ? 3.761   -33.254 -58.271  1.00 93.47  ? 405 GLU C CB    1 
ATOM   1478 N  N     . THR C 1 5  ? 4.604   -32.076 -55.325  1.00 92.72  ? 406 THR C N     1 
ATOM   1479 C  CA    . THR C 1 5  ? 4.905   -32.452 -53.968  1.00 91.57  ? 406 THR C CA    1 
ATOM   1480 C  C     . THR C 1 5  ? 4.127   -33.661 -53.723  1.00 90.91  ? 406 THR C C     1 
ATOM   1481 O  O     . THR C 1 5  ? 2.897   -33.573 -53.573  1.00 93.03  ? 406 THR C O     1 
ATOM   1482 C  CB    . THR C 1 5  ? 4.252   -31.569 -52.930  1.00 91.25  ? 406 THR C CB    1 
ATOM   1483 O  OG1   . THR C 1 5  ? 2.977   -32.120 -52.564  1.00 91.25  ? 406 THR C OG1   1 
ATOM   1484 C  CG2   . THR C 1 5  ? 4.047   -30.176 -53.485  1.00 86.87  ? 406 THR C CG2   1 
ATOM   1485 N  N     . ARG C 1 6  ? 4.730   -34.789 -53.704  1.00 84.32  ? 407 ARG C N     1 
ATOM   1486 C  CA    . ARG C 1 6  ? 3.973   -35.970 -53.503  1.00 76.38  ? 407 ARG C CA    1 
ATOM   1487 C  C     . ARG C 1 6  ? 4.011   -36.357 -52.063  1.00 70.98  ? 407 ARG C C     1 
ATOM   1488 O  O     . ARG C 1 6  ? 5.044   -36.561 -51.424  1.00 69.25  ? 407 ARG C O     1 
ATOM   1489 C  CB    . ARG C 1 6  ? 4.515   -37.111 -54.360  1.00 74.49  ? 407 ARG C CB    1 
ATOM   1490 N  N     . PRO C 1 7  ? 2.801   -36.455 -51.594  1.00 64.58  ? 408 PRO C N     1 
ATOM   1491 C  CA    . PRO C 1 7  ? 2.475   -36.757 -50.196  1.00 61.70  ? 408 PRO C CA    1 
ATOM   1492 C  C     . PRO C 1 7  ? 2.815   -38.161 -49.700  1.00 60.73  ? 408 PRO C C     1 
ATOM   1493 O  O     . PRO C 1 7  ? 2.381   -39.166 -50.271  1.00 58.70  ? 408 PRO C O     1 
ATOM   1494 C  CB    . PRO C 1 7  ? 0.972   -36.462 -50.136  1.00 57.09  ? 408 PRO C CB    1 
ATOM   1495 C  CG    . PRO C 1 7  ? 0.721   -35.468 -51.225  1.00 59.35  ? 408 PRO C CG    1 
ATOM   1496 C  CD    . PRO C 1 7  ? 1.667   -35.868 -52.334  1.00 60.88  ? 408 PRO C CD    1 
ATOM   1497 N  N     . ASN C 1 8  ? 3.614   -38.214 -48.632  1.00 59.04  ? 409 ASN C N     1 
ATOM   1498 C  CA    . ASN C 1 8  ? 4.015   -39.479 -48.007  1.00 57.25  ? 409 ASN C CA    1 
ATOM   1499 C  C     . ASN C 1 8  ? 4.145   -39.302 -46.496  1.00 54.44  ? 409 ASN C C     1 
ATOM   1500 O  O     . ASN C 1 8  ? 3.901   -38.204 -45.983  1.00 56.92  ? 409 ASN C O     1 
ATOM   1501 C  CB    . ASN C 1 8  ? 5.343   -39.988 -48.581  1.00 58.94  ? 409 ASN C CB    1 
ATOM   1502 C  CG    . ASN C 1 8  ? 6.516   -39.092 -48.240  1.00 55.78  ? 409 ASN C CG    1 
ATOM   1503 O  OD1   . ASN C 1 8  ? 6.677   -38.009 -48.806  1.00 55.42  ? 409 ASN C OD1   1 
ATOM   1504 N  ND2   . ASN C 1 8  ? 7.344   -39.541 -47.307  1.00 54.57  ? 409 ASN C ND2   1 
ATOM   1505 N  N     . HIS C 1 9  ? 4.520   -40.369 -45.789  1.00 48.28  ? 410 HIS C N     1 
ATOM   1506 C  CA    . HIS C 1 9  ? 4.624   -40.318 -44.329  1.00 40.96  ? 410 HIS C CA    1 
ATOM   1507 C  C     . HIS C 1 9  ? 5.884   -39.728 -43.696  1.00 30.83  ? 410 HIS C C     1 
ATOM   1508 O  O     . HIS C 1 9  ? 6.032   -39.753 -42.477  1.00 27.40  ? 410 HIS C O     1 
ATOM   1509 C  CB    . HIS C 1 9  ? 4.383   -41.709 -43.739  1.00 47.04  ? 410 HIS C CB    1 
ATOM   1510 C  CG    . HIS C 1 9  ? 5.496   -42.676 -43.986  1.00 57.32  ? 410 HIS C CG    1 
ATOM   1511 N  ND1   . HIS C 1 9  ? 5.565   -43.903 -43.360  1.00 63.02  ? 410 HIS C ND1   1 
ATOM   1512 C  CD2   . HIS C 1 9  ? 6.588   -42.599 -44.785  1.00 62.40  ? 410 HIS C CD2   1 
ATOM   1513 C  CE1   . HIS C 1 9  ? 6.652   -44.539 -43.760  1.00 66.66  ? 410 HIS C CE1   1 
ATOM   1514 N  NE2   . HIS C 1 9  ? 7.290   -43.769 -44.625  1.00 67.08  ? 410 HIS C NE2   1 
ATOM   1515 N  N     . THR C 1 10 ? 6.796   -39.202 -44.499  1.00 26.15  ? 411 THR C N     1 
ATOM   1516 C  CA    . THR C 1 10 ? 8.000   -38.605 -43.933  1.00 25.09  ? 411 THR C CA    1 
ATOM   1517 C  C     . THR C 1 10 ? 8.040   -37.127 -44.279  1.00 25.95  ? 411 THR C C     1 
ATOM   1518 O  O     . THR C 1 10 ? 7.730   -36.750 -45.409  1.00 28.53  ? 411 THR C O     1 
ATOM   1519 C  CB    . THR C 1 10 ? 9.275   -39.244 -44.484  1.00 20.63  ? 411 THR C CB    1 
ATOM   1520 O  OG1   . THR C 1 10 ? 9.216   -40.662 -44.310  1.00 25.09  ? 411 THR C OG1   1 
ATOM   1521 C  CG2   . THR C 1 10 ? 10.488  -38.698 -43.754  1.00 6.98   ? 411 THR C CG2   1 
ATOM   1522 N  N     . ILE C 1 11 ? 8.410   -36.290 -43.313  1.00 23.65  ? 412 ILE C N     1 
ATOM   1523 C  CA    . ILE C 1 11 ? 8.487   -34.859 -43.573  1.00 22.34  ? 412 ILE C CA    1 
ATOM   1524 C  C     . ILE C 1 11 ? 9.933   -34.382 -43.562  1.00 26.61  ? 412 ILE C C     1 
ATOM   1525 O  O     . ILE C 1 11 ? 10.794  -34.954 -42.885  1.00 26.54  ? 412 ILE C O     1 
ATOM   1526 C  CB    . ILE C 1 11 ? 7.669   -34.045 -42.557  1.00 17.42  ? 412 ILE C CB    1 
ATOM   1527 C  CG1   . ILE C 1 11 ? 8.413   -33.952 -41.231  1.00 13.29  ? 412 ILE C CG1   1 
ATOM   1528 C  CG2   . ILE C 1 11 ? 6.315   -34.698 -42.358  1.00 18.08  ? 412 ILE C CG2   1 
ATOM   1529 C  CD1   . ILE C 1 11 ? 7.708   -33.119 -40.199  1.00 15.01  ? 412 ILE C CD1   1 
ATOM   1530 N  N     . TYR C 1 12 ? 10.193  -33.338 -44.342  1.00 27.81  ? 413 TYR C N     1 
ATOM   1531 C  CA    . TYR C 1 12 ? 11.527  -32.772 -44.456  1.00 25.76  ? 413 TYR C CA    1 
ATOM   1532 C  C     . TYR C 1 12 ? 11.505  -31.290 -44.130  1.00 25.93  ? 413 TYR C C     1 
ATOM   1533 O  O     . TYR C 1 12 ? 10.994  -30.460 -44.893  1.00 27.01  ? 413 TYR C O     1 
ATOM   1534 C  CB    . TYR C 1 12 ? 12.084  -33.009 -45.862  1.00 20.60  ? 413 TYR C CB    1 
ATOM   1535 C  CG    . TYR C 1 12 ? 13.232  -32.105 -46.240  1.00 27.51  ? 413 TYR C CG    1 
ATOM   1536 C  CD1   . TYR C 1 12 ? 13.003  -30.914 -46.936  1.00 33.95  ? 413 TYR C CD1   1 
ATOM   1537 C  CD2   . TYR C 1 12 ? 14.552  -32.432 -45.904  1.00 26.41  ? 413 TYR C CD2   1 
ATOM   1538 C  CE1   . TYR C 1 12 ? 14.058  -30.069 -47.293  1.00 32.98  ? 413 TYR C CE1   1 
ATOM   1539 C  CE2   . TYR C 1 12 ? 15.620  -31.590 -46.255  1.00 27.81  ? 413 TYR C CE2   1 
ATOM   1540 C  CZ    . TYR C 1 12 ? 15.357  -30.411 -46.950  1.00 31.61  ? 413 TYR C CZ    1 
ATOM   1541 O  OH    . TYR C 1 12 ? 16.376  -29.563 -47.294  1.00 30.39  ? 413 TYR C OH    1 
ATOM   1542 N  N     . ILE C 1 13 ? 12.063  -30.979 -42.970  1.00 24.41  ? 414 ILE C N     1 
ATOM   1543 C  CA    . ILE C 1 13 ? 12.134  -29.618 -42.491  1.00 23.46  ? 414 ILE C CA    1 
ATOM   1544 C  C     . ILE C 1 13 ? 13.503  -29.057 -42.845  1.00 25.95  ? 414 ILE C C     1 
ATOM   1545 O  O     . ILE C 1 13 ? 14.496  -29.787 -42.899  1.00 28.60  ? 414 ILE C O     1 
ATOM   1546 C  CB    . ILE C 1 13 ? 11.965  -29.556 -40.961  1.00 19.96  ? 414 ILE C CB    1 
ATOM   1547 C  CG1   . ILE C 1 13 ? 10.710  -30.321 -40.522  1.00 19.97  ? 414 ILE C CG1   1 
ATOM   1548 C  CG2   . ILE C 1 13 ? 11.862  -28.113 -40.525  1.00 31.18  ? 414 ILE C CG2   1 
ATOM   1549 C  CD1   . ILE C 1 13 ? 10.961  -31.728 -39.993  1.00 3.32   ? 414 ILE C CD1   1 
ATOM   1550 N  N     . ASN C 1 14 ? 13.556  -27.759 -43.094  1.00 22.84  ? 415 ASN C N     1 
ATOM   1551 C  CA    . ASN C 1 14 ? 14.815  -27.115 -43.419  1.00 27.35  ? 415 ASN C CA    1 
ATOM   1552 C  C     . ASN C 1 14 ? 14.739  -25.696 -42.878  1.00 26.05  ? 415 ASN C C     1 
ATOM   1553 O  O     . ASN C 1 14 ? 13.694  -25.288 -42.373  1.00 20.94  ? 415 ASN C O     1 
ATOM   1554 C  CB    . ASN C 1 14 ? 15.053  -27.126 -44.939  1.00 33.41  ? 415 ASN C CB    1 
ATOM   1555 C  CG    . ASN C 1 14 ? 13.858  -26.616 -45.724  1.00 40.89  ? 415 ASN C CG    1 
ATOM   1556 O  OD1   . ASN C 1 14 ? 13.544  -25.418 -45.706  1.00 39.37  ? 415 ASN C OD1   1 
ATOM   1557 N  ND2   . ASN C 1 14 ? 13.173  -27.529 -46.413  1.00 40.97  ? 415 ASN C ND2   1 
ATOM   1558 N  N     . ASN C 1 15 ? 15.837  -24.951 -42.983  1.00 22.95  ? 416 ASN C N     1 
ATOM   1559 C  CA    . ASN C 1 15 ? 15.877  -23.594 -42.471  1.00 18.64  ? 416 ASN C CA    1 
ATOM   1560 C  C     . ASN C 1 15 ? 15.916  -23.702 -40.935  1.00 21.56  ? 416 ASN C C     1 
ATOM   1561 O  O     . ASN C 1 15 ? 15.454  -22.818 -40.220  1.00 27.60  ? 416 ASN C O     1 
ATOM   1562 C  CB    . ASN C 1 15 ? 14.635  -22.827 -42.955  1.00 6.50   ? 416 ASN C CB    1 
ATOM   1563 C  CG    . ASN C 1 15 ? 14.641  -21.365 -42.542  1.00 12.83  ? 416 ASN C CG    1 
ATOM   1564 O  OD1   . ASN C 1 15 ? 15.633  -20.664 -42.704  1.00 14.54  ? 416 ASN C OD1   1 
ATOM   1565 N  ND2   . ASN C 1 15 ? 13.522  -20.897 -42.018  1.00 17.42  ? 416 ASN C ND2   1 
ATOM   1566 N  N     . LEU C 1 16 ? 16.462  -24.808 -40.437  1.00 18.08  ? 417 LEU C N     1 
ATOM   1567 C  CA    . LEU C 1 16 ? 16.580  -25.029 -39.002  1.00 18.56  ? 417 LEU C CA    1 
ATOM   1568 C  C     . LEU C 1 16 ? 17.850  -24.352 -38.540  1.00 18.86  ? 417 LEU C C     1 
ATOM   1569 O  O     . LEU C 1 16 ? 18.797  -24.246 -39.301  1.00 19.65  ? 417 LEU C O     1 
ATOM   1570 C  CB    . LEU C 1 16 ? 16.652  -26.522 -38.693  1.00 23.00  ? 417 LEU C CB    1 
ATOM   1571 C  CG    . LEU C 1 16 ? 15.356  -27.321 -38.836  1.00 27.13  ? 417 LEU C CG    1 
ATOM   1572 C  CD1   . LEU C 1 16 ? 15.670  -28.791 -38.830  1.00 24.15  ? 417 LEU C CD1   1 
ATOM   1573 C  CD2   . LEU C 1 16 ? 14.400  -26.971 -37.703  1.00 31.24  ? 417 LEU C CD2   1 
ATOM   1574 N  N     . ASN C 1 17 ? 17.879  -23.903 -37.292  1.00 23.98  ? 418 ASN C N     1 
ATOM   1575 C  CA    . ASN C 1 17 ? 19.050  -23.207 -36.782  1.00 32.20  ? 418 ASN C CA    1 
ATOM   1576 C  C     . ASN C 1 17 ? 20.326  -24.037 -36.760  1.00 35.52  ? 418 ASN C C     1 
ATOM   1577 O  O     . ASN C 1 17 ? 20.435  -25.043 -36.043  1.00 37.10  ? 418 ASN C O     1 
ATOM   1578 C  CB    . ASN C 1 17 ? 18.784  -22.666 -35.386  1.00 39.23  ? 418 ASN C CB    1 
ATOM   1579 C  CG    . ASN C 1 17 ? 19.791  -21.620 -34.984  1.00 43.37  ? 418 ASN C CG    1 
ATOM   1580 O  OD1   . ASN C 1 17 ? 20.980  -21.909 -34.860  1.00 40.07  ? 418 ASN C OD1   1 
ATOM   1581 N  ND2   . ASN C 1 17 ? 19.325  -20.388 -34.795  1.00 47.84  ? 418 ASN C ND2   1 
ATOM   1582 N  N     . GLU C 1 18 ? 21.304  -23.581 -37.534  1.00 35.01  ? 419 GLU C N     1 
ATOM   1583 C  CA    . GLU C 1 18 ? 22.580  -24.263 -37.647  1.00 31.30  ? 419 GLU C CA    1 
ATOM   1584 C  C     . GLU C 1 18 ? 23.405  -24.251 -36.367  1.00 28.98  ? 419 GLU C C     1 
ATOM   1585 O  O     . GLU C 1 18 ? 24.170  -25.175 -36.123  1.00 33.95  ? 419 GLU C O     1 
ATOM   1586 C  CB    . GLU C 1 18 ? 23.375  -23.654 -38.789  1.00 31.50  ? 419 GLU C CB    1 
ATOM   1587 N  N     . LYS C 1 19 ? 23.240  -23.221 -35.541  1.00 30.37  ? 420 LYS C N     1 
ATOM   1588 C  CA    . LYS C 1 19 ? 24.003  -23.087 -34.292  1.00 27.95  ? 420 LYS C CA    1 
ATOM   1589 C  C     . LYS C 1 19 ? 23.686  -24.070 -33.177  1.00 26.49  ? 420 LYS C C     1 
ATOM   1590 O  O     . LYS C 1 19 ? 24.520  -24.303 -32.317  1.00 29.48  ? 420 LYS C O     1 
ATOM   1591 C  CB    . LYS C 1 19 ? 23.866  -21.674 -33.755  1.00 29.27  ? 420 LYS C CB    1 
ATOM   1592 N  N     . ILE C 1 20 ? 22.487  -24.639 -33.191  1.00 30.67  ? 421 ILE C N     1 
ATOM   1593 C  CA    . ILE C 1 20 ? 22.039  -25.592 -32.171  1.00 29.31  ? 421 ILE C CA    1 
ATOM   1594 C  C     . ILE C 1 20 ? 22.654  -26.987 -32.275  1.00 31.53  ? 421 ILE C C     1 
ATOM   1595 O  O     . ILE C 1 20 ? 22.779  -27.525 -33.374  1.00 33.31  ? 421 ILE C O     1 
ATOM   1596 C  CB    . ILE C 1 20 ? 20.491  -25.723 -32.220  1.00 27.32  ? 421 ILE C CB    1 
ATOM   1597 C  CG1   . ILE C 1 20 ? 19.850  -24.688 -31.291  1.00 30.85  ? 421 ILE C CG1   1 
ATOM   1598 C  CG2   . ILE C 1 20 ? 20.055  -27.116 -31.846  1.00 20.38  ? 421 ILE C CG2   1 
ATOM   1599 C  CD1   . ILE C 1 20 ? 20.255  -23.247 -31.581  1.00 24.33  ? 421 ILE C CD1   1 
ATOM   1600 N  N     . LYS C 1 21 ? 23.032  -27.565 -31.131  1.00 31.50  ? 422 LYS C N     1 
ATOM   1601 C  CA    . LYS C 1 21 ? 23.597  -28.916 -31.106  1.00 35.83  ? 422 LYS C CA    1 
ATOM   1602 C  C     . LYS C 1 21 ? 22.627  -29.883 -31.755  1.00 39.12  ? 422 LYS C C     1 
ATOM   1603 O  O     . LYS C 1 21 ? 21.461  -29.976 -31.368  1.00 39.68  ? 422 LYS C O     1 
ATOM   1604 C  CB    . LYS C 1 21 ? 23.868  -29.408 -29.679  1.00 34.19  ? 422 LYS C CB    1 
ATOM   1605 C  CG    . LYS C 1 21 ? 25.173  -28.922 -29.103  1.00 42.67  ? 422 LYS C CG    1 
ATOM   1606 C  CD    . LYS C 1 21 ? 25.770  -29.889 -28.086  1.00 39.02  ? 422 LYS C CD    1 
ATOM   1607 C  CE    . LYS C 1 21 ? 27.154  -29.394 -27.657  1.00 37.48  ? 422 LYS C CE    1 
ATOM   1608 N  NZ    . LYS C 1 21 ? 27.893  -30.379 -26.835  1.00 32.56  ? 422 LYS C NZ    1 
ATOM   1609 N  N     . LYS C 1 22 ? 23.119  -30.618 -32.738  1.00 41.17  ? 423 LYS C N     1 
ATOM   1610 C  CA    . LYS C 1 22 ? 22.289  -31.564 -33.450  1.00 40.93  ? 423 LYS C CA    1 
ATOM   1611 C  C     . LYS C 1 22 ? 21.602  -32.543 -32.495  1.00 39.59  ? 423 LYS C C     1 
ATOM   1612 O  O     . LYS C 1 22 ? 20.476  -32.976 -32.745  1.00 38.20  ? 423 LYS C O     1 
ATOM   1613 C  CB    . LYS C 1 22 ? 23.142  -32.277 -34.516  1.00 44.80  ? 423 LYS C CB    1 
ATOM   1614 C  CG    . LYS C 1 22 ? 23.221  -31.524 -35.881  1.00 45.86  ? 423 LYS C CG    1 
ATOM   1615 C  CD    . LYS C 1 22 ? 23.414  -30.007 -35.715  1.00 51.37  ? 423 LYS C CD    1 
ATOM   1616 C  CE    . LYS C 1 22 ? 22.728  -29.208 -36.836  1.00 55.99  ? 423 LYS C CE    1 
ATOM   1617 N  NZ    . LYS C 1 22 ? 22.420  -27.783 -36.452  1.00 49.78  ? 423 LYS C NZ    1 
ATOM   1618 N  N     . ASP C 1 23 ? 22.262  -32.856 -31.385  1.00 39.74  ? 424 ASP C N     1 
ATOM   1619 C  CA    . ASP C 1 23 ? 21.703  -33.780 -30.395  1.00 39.95  ? 424 ASP C CA    1 
ATOM   1620 C  C     . ASP C 1 23 ? 20.478  -33.192 -29.722  1.00 33.58  ? 424 ASP C C     1 
ATOM   1621 O  O     . ASP C 1 23 ? 19.458  -33.864 -29.586  1.00 26.43  ? 424 ASP C O     1 
ATOM   1622 C  CB    . ASP C 1 23 ? 22.756  -34.129 -29.329  1.00 55.80  ? 424 ASP C CB    1 
ATOM   1623 C  CG    . ASP C 1 23 ? 22.176  -34.928 -28.154  1.00 62.52  ? 424 ASP C CG    1 
ATOM   1624 O  OD1   . ASP C 1 23 ? 21.329  -35.817 -28.404  1.00 65.28  ? 424 ASP C OD1   1 
ATOM   1625 O  OD2   . ASP C 1 23 ? 22.581  -34.672 -26.989  1.00 57.42  ? 424 ASP C OD2   1 
ATOM   1626 N  N     . GLU C 1 24 ? 20.598  -31.939 -29.291  1.00 34.26  ? 425 GLU C N     1 
ATOM   1627 C  CA    . GLU C 1 24 ? 19.503  -31.241 -28.630  1.00 35.42  ? 425 GLU C CA    1 
ATOM   1628 C  C     . GLU C 1 24 ? 18.410  -30.984 -29.647  1.00 35.63  ? 425 GLU C C     1 
ATOM   1629 O  O     . GLU C 1 24 ? 17.225  -31.106 -29.343  1.00 38.37  ? 425 GLU C O     1 
ATOM   1630 C  CB    . GLU C 1 24 ? 19.973  -29.906 -28.046  1.00 37.77  ? 425 GLU C CB    1 
ATOM   1631 C  CG    . GLU C 1 24 ? 21.011  -30.009 -26.946  1.00 37.94  ? 425 GLU C CG    1 
ATOM   1632 C  CD    . GLU C 1 24 ? 20.678  -31.084 -25.943  1.00 45.03  ? 425 GLU C CD    1 
ATOM   1633 O  OE1   . GLU C 1 24 ? 19.508  -31.158 -25.522  1.00 46.14  ? 425 GLU C OE1   1 
ATOM   1634 O  OE2   . GLU C 1 24 ? 21.588  -31.856 -25.571  1.00 53.83  ? 425 GLU C OE2   1 
ATOM   1635 N  N     . LEU C 1 25 ? 18.818  -30.635 -30.861  1.00 31.86  ? 426 LEU C N     1 
ATOM   1636 C  CA    . LEU C 1 25 ? 17.871  -30.371 -31.929  1.00 30.71  ? 426 LEU C CA    1 
ATOM   1637 C  C     . LEU C 1 25 ? 16.949  -31.563 -32.131  1.00 26.56  ? 426 LEU C C     1 
ATOM   1638 O  O     . LEU C 1 25 ? 15.740  -31.404 -32.271  1.00 26.79  ? 426 LEU C O     1 
ATOM   1639 C  CB    . LEU C 1 25 ? 18.607  -30.063 -33.233  1.00 34.25  ? 426 LEU C CB    1 
ATOM   1640 C  CG    . LEU C 1 25 ? 17.691  -29.562 -34.353  1.00 37.65  ? 426 LEU C CG    1 
ATOM   1641 C  CD1   . LEU C 1 25 ? 16.785  -28.454 -33.826  1.00 33.83  ? 426 LEU C CD1   1 
ATOM   1642 C  CD2   . LEU C 1 25 ? 18.529  -29.065 -35.511  1.00 38.83  ? 426 LEU C CD2   1 
ATOM   1643 N  N     . LYS C 1 26 ? 17.514  -32.763 -32.142  1.00 23.95  ? 427 LYS C N     1 
ATOM   1644 C  CA    . LYS C 1 26 ? 16.690  -33.945 -32.321  1.00 21.81  ? 427 LYS C CA    1 
ATOM   1645 C  C     . LYS C 1 26 ? 15.666  -34.040 -31.189  1.00 17.02  ? 427 LYS C C     1 
ATOM   1646 O  O     . LYS C 1 26 ? 14.507  -34.379 -31.414  1.00 8.50   ? 427 LYS C O     1 
ATOM   1647 C  CB    . LYS C 1 26 ? 17.549  -35.213 -32.351  1.00 19.52  ? 427 LYS C CB    1 
ATOM   1648 C  CG    . LYS C 1 26 ? 16.822  -36.398 -33.007  1.00 23.10  ? 427 LYS C CG    1 
ATOM   1649 C  CD    . LYS C 1 26 ? 17.478  -37.754 -32.745  1.00 21.39  ? 427 LYS C CD    1 
ATOM   1650 C  CE    . LYS C 1 26 ? 18.829  -37.893 -33.399  1.00 20.03  ? 427 LYS C CE    1 
ATOM   1651 N  NZ    . LYS C 1 26 ? 19.476  -39.165 -32.969  1.00 30.24  ? 427 LYS C NZ    1 
ATOM   1652 N  N     . LYS C 1 27 ? 16.093  -33.731 -29.970  1.00 18.71  ? 428 LYS C N     1 
ATOM   1653 C  CA    . LYS C 1 27 ? 15.188  -33.796 -28.830  1.00 24.51  ? 428 LYS C CA    1 
ATOM   1654 C  C     . LYS C 1 27 ? 14.067  -32.783 -28.988  1.00 25.31  ? 428 LYS C C     1 
ATOM   1655 O  O     . LYS C 1 27 ? 12.892  -33.127 -28.850  1.00 30.07  ? 428 LYS C O     1 
ATOM   1656 C  CB    . LYS C 1 27 ? 15.939  -33.540 -27.531  1.00 19.36  ? 428 LYS C CB    1 
ATOM   1657 C  CG    . LYS C 1 27 ? 16.924  -34.628 -27.172  1.00 20.10  ? 428 LYS C CG    1 
ATOM   1658 C  CD    . LYS C 1 27 ? 17.727  -34.206 -25.954  1.00 36.10  ? 428 LYS C CD    1 
ATOM   1659 C  CE    . LYS C 1 27 ? 18.749  -35.245 -25.520  1.00 42.65  ? 428 LYS C CE    1 
ATOM   1660 N  NZ    . LYS C 1 27 ? 19.584  -34.722 -24.400  1.00 41.10  ? 428 LYS C NZ    1 
ATOM   1661 N  N     . SER C 1 28 ? 14.427  -31.539 -29.280  1.00 20.38  ? 429 SER C N     1 
ATOM   1662 C  CA    . SER C 1 28 ? 13.429  -30.491 -29.468  1.00 19.41  ? 429 SER C CA    1 
ATOM   1663 C  C     . SER C 1 28 ? 12.515  -30.839 -30.647  1.00 20.64  ? 429 SER C C     1 
ATOM   1664 O  O     . SER C 1 28 ? 11.364  -30.410 -30.707  1.00 18.61  ? 429 SER C O     1 
ATOM   1665 C  CB    . SER C 1 28 ? 14.103  -29.132 -29.717  1.00 21.83  ? 429 SER C CB    1 
ATOM   1666 O  OG    . SER C 1 28 ? 14.660  -28.579 -28.536  1.00 17.78  ? 429 SER C OG    1 
ATOM   1667 N  N     . LEU C 1 29 ? 13.023  -31.615 -31.593  1.00 19.31  ? 430 LEU C N     1 
ATOM   1668 C  CA    . LEU C 1 29 ? 12.198  -31.995 -32.725  1.00 18.72  ? 430 LEU C CA    1 
ATOM   1669 C  C     . LEU C 1 29 ? 11.241  -33.111 -32.345  1.00 20.93  ? 430 LEU C C     1 
ATOM   1670 O  O     . LEU C 1 29 ? 10.130  -33.188 -32.868  1.00 19.89  ? 430 LEU C O     1 
ATOM   1671 C  CB    . LEU C 1 29 ? 13.066  -32.424 -33.905  1.00 14.92  ? 430 LEU C CB    1 
ATOM   1672 C  CG    . LEU C 1 29 ? 13.567  -31.245 -34.734  1.00 16.02  ? 430 LEU C CG    1 
ATOM   1673 C  CD1   . LEU C 1 29 ? 14.332  -31.741 -35.943  1.00 13.98  ? 430 LEU C CD1   1 
ATOM   1674 C  CD2   . LEU C 1 29 ? 12.372  -30.411 -35.167  1.00 15.25  ? 430 LEU C CD2   1 
ATOM   1675 N  N     . HIS C 1 30 ? 11.666  -33.974 -31.429  1.00 20.95  ? 431 HIS C N     1 
ATOM   1676 C  CA    . HIS C 1 30 ? 10.812  -35.065 -31.015  1.00 21.49  ? 431 HIS C CA    1 
ATOM   1677 C  C     . HIS C 1 30 ? 9.614   -34.523 -30.273  1.00 23.15  ? 431 HIS C C     1 
ATOM   1678 O  O     . HIS C 1 30 ? 8.476   -34.877 -30.574  1.00 22.28  ? 431 HIS C O     1 
ATOM   1679 C  CB    . HIS C 1 30 ? 11.551  -36.044 -30.112  1.00 27.09  ? 431 HIS C CB    1 
ATOM   1680 C  CG    . HIS C 1 30 ? 10.805  -37.324 -29.904  1.00 37.17  ? 431 HIS C CG    1 
ATOM   1681 N  ND1   . HIS C 1 30 ? 11.406  -38.560 -30.002  1.00 40.83  ? 431 HIS C ND1   1 
ATOM   1682 C  CD2   . HIS C 1 30 ? 9.486   -37.561 -29.701  1.00 40.89  ? 431 HIS C CD2   1 
ATOM   1683 C  CE1   . HIS C 1 30 ? 10.488  -39.502 -29.880  1.00 47.12  ? 431 HIS C CE1   1 
ATOM   1684 N  NE2   . HIS C 1 30 ? 9.314   -38.923 -29.698  1.00 44.36  ? 431 HIS C NE2   1 
ATOM   1685 N  N     . ALA C 1 31 ? 9.882   -33.665 -29.297  1.00 24.47  ? 432 ALA C N     1 
ATOM   1686 C  CA    . ALA C 1 31 ? 8.836   -33.054 -28.482  1.00 27.70  ? 432 ALA C CA    1 
ATOM   1687 C  C     . ALA C 1 31 ? 7.792   -32.362 -29.339  1.00 27.46  ? 432 ALA C C     1 
ATOM   1688 O  O     . ALA C 1 31 ? 6.638   -32.785 -29.435  1.00 25.00  ? 432 ALA C O     1 
ATOM   1689 C  CB    . ALA C 1 31 ? 9.453   -32.037 -27.534  1.00 26.23  ? 432 ALA C CB    1 
ATOM   1690 N  N     . ILE C 1 32 ? 8.229   -31.269 -29.944  1.00 28.86  ? 433 ILE C N     1 
ATOM   1691 C  CA    . ILE C 1 32 ? 7.402   -30.438 -30.801  1.00 28.81  ? 433 ILE C CA    1 
ATOM   1692 C  C     . ILE C 1 32 ? 6.502   -31.258 -31.743  1.00 29.44  ? 433 ILE C C     1 
ATOM   1693 O  O     . ILE C 1 32 ? 5.321   -30.951 -31.909  1.00 29.99  ? 433 ILE C O     1 
ATOM   1694 C  CB    . ILE C 1 32 ? 8.333   -29.465 -31.601  1.00 25.43  ? 433 ILE C CB    1 
ATOM   1695 C  CG1   . ILE C 1 32 ? 7.669   -28.105 -31.782  1.00 20.14  ? 433 ILE C CG1   1 
ATOM   1696 C  CG2   . ILE C 1 32 ? 8.726   -30.072 -32.924  1.00 29.08  ? 433 ILE C CG2   1 
ATOM   1697 C  CD1   . ILE C 1 32 ? 6.390   -28.144 -32.531  1.00 24.11  ? 433 ILE C CD1   1 
ATOM   1698 N  N     . PHE C 1 33 ? 7.046   -32.324 -32.316  1.00 28.41  ? 434 PHE C N     1 
ATOM   1699 C  CA    . PHE C 1 33 ? 6.300   -33.139 -33.263  1.00 31.40  ? 434 PHE C CA    1 
ATOM   1700 C  C     . PHE C 1 33 ? 5.618   -34.406 -32.762  1.00 35.33  ? 434 PHE C C     1 
ATOM   1701 O  O     . PHE C 1 33 ? 4.798   -34.986 -33.479  1.00 36.11  ? 434 PHE C O     1 
ATOM   1702 C  CB    . PHE C 1 33 ? 7.210   -33.494 -34.436  1.00 29.23  ? 434 PHE C CB    1 
ATOM   1703 C  CG    . PHE C 1 33 ? 7.347   -32.397 -35.442  1.00 19.98  ? 434 PHE C CG    1 
ATOM   1704 C  CD1   . PHE C 1 33 ? 6.267   -32.029 -36.230  1.00 13.85  ? 434 PHE C CD1   1 
ATOM   1705 C  CD2   . PHE C 1 33 ? 8.553   -31.724 -35.597  1.00 25.43  ? 434 PHE C CD2   1 
ATOM   1706 C  CE1   . PHE C 1 33 ? 6.381   -31.006 -37.159  1.00 19.48  ? 434 PHE C CE1   1 
ATOM   1707 C  CE2   . PHE C 1 33 ? 8.684   -30.692 -36.526  1.00 25.70  ? 434 PHE C CE2   1 
ATOM   1708 C  CZ    . PHE C 1 33 ? 7.594   -30.333 -37.308  1.00 27.33  ? 434 PHE C CZ    1 
ATOM   1709 N  N     . SER C 1 34 ? 5.948   -34.842 -31.551  1.00 38.60  ? 435 SER C N     1 
ATOM   1710 C  CA    . SER C 1 34 ? 5.345   -36.057 -30.999  1.00 40.65  ? 435 SER C CA    1 
ATOM   1711 C  C     . SER C 1 34 ? 3.848   -35.873 -30.735  1.00 40.76  ? 435 SER C C     1 
ATOM   1712 O  O     . SER C 1 34 ? 3.181   -36.770 -30.220  1.00 41.42  ? 435 SER C O     1 
ATOM   1713 C  CB    . SER C 1 34 ? 6.047   -36.458 -29.695  1.00 39.94  ? 435 SER C CB    1 
ATOM   1714 O  OG    . SER C 1 34 ? 5.667   -35.610 -28.622  1.00 35.51  ? 435 SER C OG    1 
ATOM   1715 N  N     . ARG C 1 35 ? 3.329   -34.704 -31.098  1.00 39.50  ? 436 ARG C N     1 
ATOM   1716 C  CA    . ARG C 1 35 ? 1.923   -34.376 -30.900  1.00 34.69  ? 436 ARG C CA    1 
ATOM   1717 C  C     . ARG C 1 35 ? 1.050   -34.881 -32.032  1.00 31.12  ? 436 ARG C C     1 
ATOM   1718 O  O     . ARG C 1 35 ? -0.133  -35.151 -31.849  1.00 28.11  ? 436 ARG C O     1 
ATOM   1719 C  CB    . ARG C 1 35 ? 1.771   -32.862 -30.791  1.00 36.30  ? 436 ARG C CB    1 
ATOM   1720 C  CG    . ARG C 1 35 ? 2.612   -32.271 -29.682  1.00 44.85  ? 436 ARG C CG    1 
ATOM   1721 C  CD    . ARG C 1 35 ? 2.284   -30.821 -29.445  1.00 45.24  ? 436 ARG C CD    1 
ATOM   1722 N  NE    . ARG C 1 35 ? 2.795   -29.964 -30.502  1.00 44.86  ? 436 ARG C NE    1 
ATOM   1723 C  CZ    . ARG C 1 35 ? 2.735   -28.640 -30.460  1.00 48.79  ? 436 ARG C CZ    1 
ATOM   1724 N  NH1   . ARG C 1 35 ? 2.186   -28.037 -29.414  1.00 51.66  ? 436 ARG C NH1   1 
ATOM   1725 N  NH2   . ARG C 1 35 ? 3.225   -27.916 -31.455  1.00 52.93  ? 436 ARG C NH2   1 
ATOM   1726 N  N     . PHE C 1 36 ? 1.655   -35.010 -33.204  1.00 28.92  ? 437 PHE C N     1 
ATOM   1727 C  CA    . PHE C 1 36 ? 0.961   -35.437 -34.404  1.00 23.79  ? 437 PHE C CA    1 
ATOM   1728 C  C     . PHE C 1 36 ? 0.957   -36.928 -34.640  1.00 30.26  ? 437 PHE C C     1 
ATOM   1729 O  O     . PHE C 1 36 ? 0.811   -37.376 -35.772  1.00 34.56  ? 437 PHE C O     1 
ATOM   1730 C  CB    . PHE C 1 36 ? 1.579   -34.723 -35.591  1.00 18.73  ? 437 PHE C CB    1 
ATOM   1731 C  CG    . PHE C 1 36 ? 1.527   -33.239 -35.464  1.00 18.39  ? 437 PHE C CG    1 
ATOM   1732 C  CD1   . PHE C 1 36 ? 0.327   -32.559 -35.636  1.00 9.93   ? 437 PHE C CD1   1 
ATOM   1733 C  CD2   . PHE C 1 36 ? 2.657   -32.521 -35.112  1.00 22.76  ? 437 PHE C CD2   1 
ATOM   1734 C  CE1   . PHE C 1 36 ? 0.248   -31.203 -35.457  1.00 3.17   ? 437 PHE C CE1   1 
ATOM   1735 C  CE2   . PHE C 1 36 ? 2.584   -31.147 -34.931  1.00 23.33  ? 437 PHE C CE2   1 
ATOM   1736 C  CZ    . PHE C 1 36 ? 1.372   -30.492 -35.106  1.00 17.63  ? 437 PHE C CZ    1 
ATOM   1737 N  N     . GLY C 1 37 ? 1.119   -37.699 -33.573  1.00 33.85  ? 438 GLY C N     1 
ATOM   1738 C  CA    . GLY C 1 37 ? 1.112   -39.138 -33.715  1.00 31.08  ? 438 GLY C CA    1 
ATOM   1739 C  C     . GLY C 1 37 ? 2.455   -39.804 -33.526  1.00 34.82  ? 438 GLY C C     1 
ATOM   1740 O  O     . GLY C 1 37 ? 3.428   -39.192 -33.074  1.00 30.76  ? 438 GLY C O     1 
ATOM   1741 N  N     . GLN C 1 38 ? 2.483   -41.080 -33.898  1.00 40.20  ? 439 GLN C N     1 
ATOM   1742 C  CA    . GLN C 1 38 ? 3.653   -41.945 -33.789  1.00 44.39  ? 439 GLN C CA    1 
ATOM   1743 C  C     . GLN C 1 38 ? 4.858   -41.524 -34.628  1.00 43.82  ? 439 GLN C C     1 
ATOM   1744 O  O     . GLN C 1 38 ? 4.741   -41.208 -35.816  1.00 44.52  ? 439 GLN C O     1 
ATOM   1745 C  CB    . GLN C 1 38 ? 3.246   -43.375 -34.165  1.00 51.31  ? 439 GLN C CB    1 
ATOM   1746 C  CG    . GLN C 1 38 ? 4.283   -44.448 -33.890  1.00 57.51  ? 439 GLN C CG    1 
ATOM   1747 C  CD    . GLN C 1 38 ? 4.568   -44.607 -32.415  1.00 66.12  ? 439 GLN C CD    1 
ATOM   1748 O  OE1   . GLN C 1 38 ? 5.243   -45.551 -31.997  1.00 70.54  ? 439 GLN C OE1   1 
ATOM   1749 N  NE2   . GLN C 1 38 ? 4.060   -43.679 -31.612  1.00 69.22  ? 439 GLN C NE2   1 
ATOM   1750 N  N     . ILE C 1 39 ? 6.023   -41.531 -33.996  1.00 37.58  ? 440 ILE C N     1 
ATOM   1751 C  CA    . ILE C 1 39 ? 7.251   -41.180 -34.682  1.00 32.19  ? 440 ILE C CA    1 
ATOM   1752 C  C     . ILE C 1 39 ? 8.163   -42.411 -34.709  1.00 34.43  ? 440 ILE C C     1 
ATOM   1753 O  O     . ILE C 1 39 ? 8.505   -42.979 -33.670  1.00 31.32  ? 440 ILE C O     1 
ATOM   1754 C  CB    . ILE C 1 39 ? 7.932   -39.972 -33.993  1.00 24.09  ? 440 ILE C CB    1 
ATOM   1755 C  CG1   . ILE C 1 39 ? 7.116   -38.723 -34.291  1.00 20.99  ? 440 ILE C CG1   1 
ATOM   1756 C  CG2   . ILE C 1 39 ? 9.354   -39.782 -34.485  1.00 14.32  ? 440 ILE C CG2   1 
ATOM   1757 C  CD1   . ILE C 1 39 ? 7.691   -37.465 -33.700  1.00 29.75  ? 440 ILE C CD1   1 
ATOM   1758 N  N     . LEU C 1 40 ? 8.517   -42.839 -35.916  1.00 31.30  ? 441 LEU C N     1 
ATOM   1759 C  CA    . LEU C 1 40 ? 9.371   -43.994 -36.090  1.00 27.61  ? 441 LEU C CA    1 
ATOM   1760 C  C     . LEU C 1 40 ? 10.828  -43.638 -36.031  1.00 31.06  ? 441 LEU C C     1 
ATOM   1761 O  O     . LEU C 1 40 ? 11.666  -44.518 -35.864  1.00 36.18  ? 441 LEU C O     1 
ATOM   1762 C  CB    . LEU C 1 40 ? 9.100   -44.673 -37.421  1.00 24.80  ? 441 LEU C CB    1 
ATOM   1763 C  CG    . LEU C 1 40 ? 7.766   -45.390 -37.528  1.00 27.32  ? 441 LEU C CG    1 
ATOM   1764 C  CD1   . LEU C 1 40 ? 7.845   -46.404 -38.658  1.00 25.37  ? 441 LEU C CD1   1 
ATOM   1765 C  CD2   . LEU C 1 40 ? 7.448   -46.083 -36.215  1.00 31.41  ? 441 LEU C CD2   1 
ATOM   1766 N  N     . ASP C 1 41 ? 11.134  -42.355 -36.177  1.00 33.19  ? 442 ASP C N     1 
ATOM   1767 C  CA    . ASP C 1 41 ? 12.520  -41.912 -36.149  1.00 36.27  ? 442 ASP C CA    1 
ATOM   1768 C  C     . ASP C 1 41 ? 12.726  -40.506 -36.703  1.00 33.67  ? 442 ASP C C     1 
ATOM   1769 O  O     . ASP C 1 41 ? 12.008  -40.054 -37.604  1.00 31.45  ? 442 ASP C O     1 
ATOM   1770 C  CB    . ASP C 1 41 ? 13.393  -42.892 -36.938  1.00 41.89  ? 442 ASP C CB    1 
ATOM   1771 C  CG    . ASP C 1 41 ? 14.855  -42.519 -36.915  1.00 51.05  ? 442 ASP C CG    1 
ATOM   1772 O  OD1   . ASP C 1 41 ? 15.400  -42.280 -35.809  1.00 53.77  ? 442 ASP C OD1   1 
ATOM   1773 O  OD2   . ASP C 1 41 ? 15.457  -42.478 -38.009  1.00 55.15  ? 442 ASP C OD2   1 
ATOM   1774 N  N     . ILE C 1 42 ? 13.728  -39.830 -36.154  1.00 26.48  ? 443 ILE C N     1 
ATOM   1775 C  CA    . ILE C 1 42 ? 14.075  -38.488 -36.570  1.00 22.44  ? 443 ILE C CA    1 
ATOM   1776 C  C     . ILE C 1 42 ? 15.529  -38.488 -37.013  1.00 25.18  ? 443 ILE C C     1 
ATOM   1777 O  O     . ILE C 1 42 ? 16.412  -38.894 -36.266  1.00 31.82  ? 443 ILE C O     1 
ATOM   1778 C  CB    . ILE C 1 42 ? 13.861  -37.494 -35.421  1.00 13.95  ? 443 ILE C CB    1 
ATOM   1779 C  CG1   . ILE C 1 42 ? 12.382  -37.499 -35.036  1.00 14.47  ? 443 ILE C CG1   1 
ATOM   1780 C  CG2   . ILE C 1 42 ? 14.278  -36.097 -35.841  1.00 3.91   ? 443 ILE C CG2   1 
ATOM   1781 C  CD1   . ILE C 1 42 ? 12.049  -36.662 -33.815  1.00 22.26  ? 443 ILE C CD1   1 
ATOM   1782 N  N     . LEU C 1 43 ? 15.766  -38.044 -38.242  1.00 25.25  ? 444 LEU C N     1 
ATOM   1783 C  CA    . LEU C 1 43 ? 17.105  -38.003 -38.806  1.00 29.64  ? 444 LEU C CA    1 
ATOM   1784 C  C     . LEU C 1 43 ? 17.608  -36.581 -38.939  1.00 32.81  ? 444 LEU C C     1 
ATOM   1785 O  O     . LEU C 1 43 ? 17.189  -35.860 -39.841  1.00 36.48  ? 444 LEU C O     1 
ATOM   1786 C  CB    . LEU C 1 43 ? 17.105  -38.655 -40.188  1.00 31.46  ? 444 LEU C CB    1 
ATOM   1787 C  CG    . LEU C 1 43 ? 16.658  -40.116 -40.266  1.00 39.24  ? 444 LEU C CG    1 
ATOM   1788 C  CD1   . LEU C 1 43 ? 16.164  -40.413 -41.670  1.00 41.84  ? 444 LEU C CD1   1 
ATOM   1789 C  CD2   . LEU C 1 43 ? 17.805  -41.046 -39.875  1.00 40.91  ? 444 LEU C CD2   1 
ATOM   1790 N  N     . VAL C 1 44 ? 18.500  -36.166 -38.048  1.00 33.39  ? 445 VAL C N     1 
ATOM   1791 C  CA    . VAL C 1 44 ? 19.034  -34.821 -38.143  1.00 37.21  ? 445 VAL C CA    1 
ATOM   1792 C  C     . VAL C 1 44 ? 20.306  -34.904 -38.962  1.00 41.49  ? 445 VAL C C     1 
ATOM   1793 O  O     . VAL C 1 44 ? 21.132  -35.788 -38.734  1.00 41.17  ? 445 VAL C O     1 
ATOM   1794 C  CB    . VAL C 1 44 ? 19.348  -34.237 -36.770  1.00 35.35  ? 445 VAL C CB    1 
ATOM   1795 C  CG1   . VAL C 1 44 ? 19.683  -32.760 -36.907  1.00 38.04  ? 445 VAL C CG1   1 
ATOM   1796 C  CG2   . VAL C 1 44 ? 18.160  -34.420 -35.855  1.00 39.91  ? 445 VAL C CG2   1 
ATOM   1797 N  N     . SER C 1 45 ? 20.455  -33.991 -39.920  1.00 48.54  ? 446 SER C N     1 
ATOM   1798 C  CA    . SER C 1 45 ? 21.620  -33.974 -40.805  1.00 55.24  ? 446 SER C CA    1 
ATOM   1799 C  C     . SER C 1 45 ? 22.948  -33.649 -40.130  1.00 57.88  ? 446 SER C C     1 
ATOM   1800 O  O     . SER C 1 45 ? 22.983  -32.961 -39.099  1.00 55.64  ? 446 SER C O     1 
ATOM   1801 C  CB    . SER C 1 45 ? 21.390  -33.006 -41.972  1.00 56.29  ? 446 SER C CB    1 
ATOM   1802 O  OG    . SER C 1 45 ? 20.681  -33.633 -43.028  1.00 48.40  ? 446 SER C OG    1 
ATOM   1803 N  N     . ARG C 1 46 ? 24.034  -34.140 -40.738  1.00 59.04  ? 447 ARG C N     1 
ATOM   1804 C  CA    . ARG C 1 46 ? 25.385  -33.938 -40.217  1.00 60.59  ? 447 ARG C CA    1 
ATOM   1805 C  C     . ARG C 1 46 ? 26.455  -33.487 -41.222  1.00 59.45  ? 447 ARG C C     1 
ATOM   1806 O  O     . ARG C 1 46 ? 27.641  -33.492 -40.890  1.00 60.19  ? 447 ARG C O     1 
ATOM   1807 C  CB    . ARG C 1 46 ? 25.851  -35.208 -39.518  1.00 59.73  ? 447 ARG C CB    1 
ATOM   1808 N  N     . SER C 1 47 ? 26.061  -33.092 -42.432  1.00 59.21  ? 448 SER C N     1 
ATOM   1809 C  CA    . SER C 1 47 ? 27.039  -32.646 -43.432  1.00 56.97  ? 448 SER C CA    1 
ATOM   1810 C  C     . SER C 1 47 ? 27.052  -31.130 -43.620  1.00 56.82  ? 448 SER C C     1 
ATOM   1811 O  O     . SER C 1 47 ? 25.997  -30.489 -43.665  1.00 50.57  ? 448 SER C O     1 
ATOM   1812 C  CB    . SER C 1 47 ? 26.784  -33.326 -44.782  1.00 53.17  ? 448 SER C CB    1 
ATOM   1813 O  OG    . SER C 1 47 ? 25.488  -33.036 -45.268  1.00 55.46  ? 448 SER C OG    1 
ATOM   1814 N  N     . LEU C 1 48 ? 28.255  -30.569 -43.733  1.00 58.78  ? 449 LEU C N     1 
ATOM   1815 C  CA    . LEU C 1 48 ? 28.427  -29.132 -43.909  1.00 64.23  ? 449 LEU C CA    1 
ATOM   1816 C  C     . LEU C 1 48 ? 27.783  -28.643 -45.196  1.00 64.77  ? 449 LEU C C     1 
ATOM   1817 O  O     . LEU C 1 48 ? 28.109  -27.569 -45.707  1.00 67.58  ? 449 LEU C O     1 
ATOM   1818 C  CB    . LEU C 1 48 ? 29.916  -28.745 -43.883  1.00 69.23  ? 449 LEU C CB    1 
ATOM   1819 C  CG    . LEU C 1 48 ? 30.949  -29.335 -44.862  1.00 76.39  ? 449 LEU C CG    1 
ATOM   1820 C  CD1   . LEU C 1 48 ? 30.560  -29.080 -46.323  1.00 75.58  ? 449 LEU C CD1   1 
ATOM   1821 C  CD2   . LEU C 1 48 ? 32.311  -28.713 -44.553  1.00 73.66  ? 449 LEU C CD2   1 
ATOM   1822 N  N     . LYS C 1 49 ? 26.875  -29.451 -45.723  1.00 62.90  ? 450 LYS C N     1 
ATOM   1823 C  CA    . LYS C 1 49 ? 26.148  -29.102 -46.928  1.00 60.85  ? 450 LYS C CA    1 
ATOM   1824 C  C     . LYS C 1 49 ? 24.663  -29.249 -46.591  1.00 61.08  ? 450 LYS C C     1 
ATOM   1825 O  O     . LYS C 1 49 ? 23.826  -28.488 -47.080  1.00 62.90  ? 450 LYS C O     1 
ATOM   1826 C  CB    . LYS C 1 49 ? 26.532  -30.034 -48.089  1.00 56.54  ? 450 LYS C CB    1 
ATOM   1827 C  CG    . LYS C 1 49 ? 26.120  -31.492 -47.907  1.00 54.11  ? 450 LYS C CG    1 
ATOM   1828 C  CD    . LYS C 1 49 ? 26.184  -32.290 -49.209  1.00 52.10  ? 450 LYS C CD    1 
ATOM   1829 C  CE    . LYS C 1 49 ? 27.595  -32.353 -49.778  1.00 54.74  ? 450 LYS C CE    1 
ATOM   1830 N  NZ    . LYS C 1 49 ? 27.698  -33.343 -50.888  1.00 54.67  ? 450 LYS C NZ    1 
ATOM   1831 N  N     . MET C 1 50 ? 24.354  -30.221 -45.733  1.00 58.49  ? 451 MET C N     1 
ATOM   1832 C  CA    . MET C 1 50 ? 22.984  -30.496 -45.316  1.00 52.99  ? 451 MET C CA    1 
ATOM   1833 C  C     . MET C 1 50 ? 22.722  -29.881 -43.955  1.00 50.99  ? 451 MET C C     1 
ATOM   1834 O  O     . MET C 1 50 ? 21.736  -30.197 -43.293  1.00 50.37  ? 451 MET C O     1 
ATOM   1835 C  CB    . MET C 1 50 ? 22.740  -32.003 -45.268  1.00 51.09  ? 451 MET C CB    1 
ATOM   1836 N  N     . ARG C 1 51 ? 23.616  -28.996 -43.540  1.00 50.38  ? 452 ARG C N     1 
ATOM   1837 C  CA    . ARG C 1 51 ? 23.470  -28.326 -42.258  1.00 51.45  ? 452 ARG C CA    1 
ATOM   1838 C  C     . ARG C 1 51 ? 22.135  -27.589 -42.184  1.00 48.31  ? 452 ARG C C     1 
ATOM   1839 O  O     . ARG C 1 51 ? 21.762  -26.859 -43.108  1.00 49.03  ? 452 ARG C O     1 
ATOM   1840 C  CB    . ARG C 1 51 ? 24.621  -27.339 -42.051  1.00 52.62  ? 452 ARG C CB    1 
ATOM   1841 N  N     . GLY C 1 52 ? 21.411  -27.796 -41.090  1.00 43.24  ? 453 GLY C N     1 
ATOM   1842 C  CA    . GLY C 1 52 ? 20.147  -27.108 -40.915  1.00 35.74  ? 453 GLY C CA    1 
ATOM   1843 C  C     . GLY C 1 52 ? 18.880  -27.821 -41.338  1.00 30.64  ? 453 GLY C C     1 
ATOM   1844 O  O     . GLY C 1 52 ? 17.810  -27.221 -41.315  1.00 31.48  ? 453 GLY C O     1 
ATOM   1845 N  N     . GLN C 1 53 ? 18.975  -29.089 -41.718  1.00 26.69  ? 454 GLN C N     1 
ATOM   1846 C  CA    . GLN C 1 53 ? 17.785  -29.826 -42.132  1.00 26.57  ? 454 GLN C CA    1 
ATOM   1847 C  C     . GLN C 1 53 ? 17.637  -31.122 -41.357  1.00 24.40  ? 454 GLN C C     1 
ATOM   1848 O  O     . GLN C 1 53 ? 18.552  -31.531 -40.639  1.00 25.20  ? 454 GLN C O     1 
ATOM   1849 C  CB    . GLN C 1 53 ? 17.852  -30.135 -43.624  1.00 38.58  ? 454 GLN C CB    1 
ATOM   1850 C  CG    . GLN C 1 53 ? 17.838  -28.902 -44.515  1.00 50.24  ? 454 GLN C CG    1 
ATOM   1851 C  CD    . GLN C 1 53 ? 18.885  -28.969 -45.615  1.00 53.64  ? 454 GLN C CD    1 
ATOM   1852 O  OE1   . GLN C 1 53 ? 18.965  -29.964 -46.344  1.00 48.85  ? 454 GLN C OE1   1 
ATOM   1853 N  NE2   . GLN C 1 53 ? 19.694  -27.906 -45.743  1.00 49.39  ? 454 GLN C NE2   1 
ATOM   1854 N  N     . ALA C 1 54 ? 16.480  -31.765 -41.496  1.00 22.59  ? 455 ALA C N     1 
ATOM   1855 C  CA    . ALA C 1 54 ? 16.222  -33.034 -40.814  1.00 23.47  ? 455 ALA C CA    1 
ATOM   1856 C  C     . ALA C 1 54 ? 14.932  -33.692 -41.289  1.00 23.23  ? 455 ALA C C     1 
ATOM   1857 O  O     . ALA C 1 54 ? 14.062  -33.037 -41.870  1.00 18.51  ? 455 ALA C O     1 
ATOM   1858 C  CB    . ALA C 1 54 ? 16.178  -32.826 -39.296  1.00 22.45  ? 455 ALA C CB    1 
ATOM   1859 N  N     . PHE C 1 55 ? 14.819  -34.994 -41.031  1.00 26.64  ? 456 PHE C N     1 
ATOM   1860 C  CA    . PHE C 1 55 ? 13.649  -35.782 -41.430  1.00 29.00  ? 456 PHE C CA    1 
ATOM   1861 C  C     . PHE C 1 55 ? 12.881  -36.351 -40.245  1.00 22.10  ? 456 PHE C C     1 
ATOM   1862 O  O     . PHE C 1 55 ? 13.478  -36.805 -39.282  1.00 18.29  ? 456 PHE C O     1 
ATOM   1863 C  CB    . PHE C 1 55 ? 14.071  -36.962 -42.322  1.00 31.61  ? 456 PHE C CB    1 
ATOM   1864 C  CG    . PHE C 1 55 ? 14.546  -36.560 -43.683  1.00 32.47  ? 456 PHE C CG    1 
ATOM   1865 C  CD1   . PHE C 1 55 ? 15.744  -35.875 -43.844  1.00 26.44  ? 456 PHE C CD1   1 
ATOM   1866 C  CD2   . PHE C 1 55 ? 13.786  -36.858 -44.808  1.00 31.48  ? 456 PHE C CD2   1 
ATOM   1867 C  CE1   . PHE C 1 55 ? 16.180  -35.490 -45.109  1.00 28.03  ? 456 PHE C CE1   1 
ATOM   1868 C  CE2   . PHE C 1 55 ? 14.214  -36.479 -46.073  1.00 31.79  ? 456 PHE C CE2   1 
ATOM   1869 C  CZ    . PHE C 1 55 ? 15.413  -35.794 -46.225  1.00 28.40  ? 456 PHE C CZ    1 
ATOM   1870 N  N     . VAL C 1 56 ? 11.557  -36.334 -40.329  1.00 19.99  ? 457 VAL C N     1 
ATOM   1871 C  CA    . VAL C 1 56 ? 10.722  -36.892 -39.274  1.00 23.54  ? 457 VAL C CA    1 
ATOM   1872 C  C     . VAL C 1 56 ? 9.832   -37.960 -39.888  1.00 26.13  ? 457 VAL C C     1 
ATOM   1873 O  O     . VAL C 1 56 ? 8.868   -37.668 -40.602  1.00 21.08  ? 457 VAL C O     1 
ATOM   1874 C  CB    . VAL C 1 56 ? 9.850   -35.811 -38.583  1.00 26.33  ? 457 VAL C CB    1 
ATOM   1875 C  CG1   . VAL C 1 56 ? 8.805   -36.464 -37.687  1.00 25.43  ? 457 VAL C CG1   1 
ATOM   1876 C  CG2   . VAL C 1 56 ? 10.729  -34.899 -37.748  1.00 21.96  ? 457 VAL C CG2   1 
ATOM   1877 N  N     . ILE C 1 57 ? 10.179  -39.208 -39.605  1.00 29.81  ? 458 ILE C N     1 
ATOM   1878 C  CA    . ILE C 1 57 ? 9.445   -40.345 -40.130  1.00 33.57  ? 458 ILE C CA    1 
ATOM   1879 C  C     . ILE C 1 57 ? 8.263   -40.724 -39.245  1.00 35.73  ? 458 ILE C C     1 
ATOM   1880 O  O     . ILE C 1 57 ? 8.439   -41.226 -38.141  1.00 39.06  ? 458 ILE C O     1 
ATOM   1881 C  CB    . ILE C 1 57 ? 10.374  -41.559 -40.266  1.00 29.88  ? 458 ILE C CB    1 
ATOM   1882 C  CG1   . ILE C 1 57 ? 11.487  -41.244 -41.253  1.00 24.43  ? 458 ILE C CG1   1 
ATOM   1883 C  CG2   . ILE C 1 57 ? 9.596   -42.764 -40.731  1.00 31.78  ? 458 ILE C CG2   1 
ATOM   1884 C  CD1   . ILE C 1 57 ? 12.522  -42.326 -41.336  1.00 29.11  ? 458 ILE C CD1   1 
ATOM   1885 N  N     . PHE C 1 58 ? 7.057   -40.485 -39.737  1.00 33.89  ? 459 PHE C N     1 
ATOM   1886 C  CA    . PHE C 1 58 ? 5.863   -40.823 -38.981  1.00 33.60  ? 459 PHE C CA    1 
ATOM   1887 C  C     . PHE C 1 58 ? 5.375   -42.235 -39.307  1.00 32.10  ? 459 PHE C C     1 
ATOM   1888 O  O     . PHE C 1 58 ? 5.515   -42.707 -40.433  1.00 27.79  ? 459 PHE C O     1 
ATOM   1889 C  CB    . PHE C 1 58 ? 4.761   -39.810 -39.289  1.00 35.62  ? 459 PHE C CB    1 
ATOM   1890 C  CG    . PHE C 1 58 ? 4.893   -38.521 -38.527  1.00 35.86  ? 459 PHE C CG    1 
ATOM   1891 C  CD1   . PHE C 1 58 ? 4.462   -38.434 -37.211  1.00 30.03  ? 459 PHE C CD1   1 
ATOM   1892 C  CD2   . PHE C 1 58 ? 5.442   -37.395 -39.125  1.00 34.73  ? 459 PHE C CD2   1 
ATOM   1893 C  CE1   . PHE C 1 58 ? 4.573   -37.250 -36.512  1.00 30.08  ? 459 PHE C CE1   1 
ATOM   1894 C  CE2   . PHE C 1 58 ? 5.556   -36.205 -38.428  1.00 27.98  ? 459 PHE C CE2   1 
ATOM   1895 C  CZ    . PHE C 1 58 ? 5.120   -36.133 -37.121  1.00 29.83  ? 459 PHE C CZ    1 
ATOM   1896 N  N     . LYS C 1 59 ? 4.817   -42.918 -38.315  1.00 32.67  ? 460 LYS C N     1 
ATOM   1897 C  CA    . LYS C 1 59 ? 4.292   -44.256 -38.547  1.00 32.22  ? 460 LYS C CA    1 
ATOM   1898 C  C     . LYS C 1 59 ? 3.163   -44.144 -39.567  1.00 34.79  ? 460 LYS C C     1 
ATOM   1899 O  O     . LYS C 1 59 ? 3.090   -44.931 -40.515  1.00 33.56  ? 460 LYS C O     1 
ATOM   1900 C  CB    . LYS C 1 59 ? 3.765   -44.859 -37.240  1.00 36.07  ? 460 LYS C CB    1 
ATOM   1901 C  CG    . LYS C 1 59 ? 2.915   -46.115 -37.420  1.00 34.80  ? 460 LYS C CG    1 
ATOM   1902 C  CD    . LYS C 1 59 ? 2.586   -46.774 -36.092  1.00 26.57  ? 460 LYS C CD    1 
ATOM   1903 C  CE    . LYS C 1 59 ? 1.519   -47.857 -36.256  1.00 28.18  ? 460 LYS C CE    1 
ATOM   1904 N  NZ    . LYS C 1 59 ? 0.133   -47.300 -36.442  1.00 19.59  ? 460 LYS C NZ    1 
ATOM   1905 N  N     . GLU C 1 60 ? 2.292   -43.154 -39.365  1.00 38.14  ? 461 GLU C N     1 
ATOM   1906 C  CA    . GLU C 1 60 ? 1.167   -42.910 -40.267  1.00 39.34  ? 461 GLU C CA    1 
ATOM   1907 C  C     . GLU C 1 60 ? 1.380   -41.689 -41.160  1.00 36.26  ? 461 GLU C C     1 
ATOM   1908 O  O     . GLU C 1 60 ? 2.050   -40.730 -40.785  1.00 32.24  ? 461 GLU C O     1 
ATOM   1909 C  CB    . GLU C 1 60 ? -0.129  -42.759 -39.471  1.00 43.26  ? 461 GLU C CB    1 
ATOM   1910 C  CG    . GLU C 1 60 ? -1.092  -43.915 -39.682  1.00 48.25  ? 461 GLU C CG    1 
ATOM   1911 C  CD    . GLU C 1 60 ? -1.593  -44.508 -38.380  1.00 54.65  ? 461 GLU C CD    1 
ATOM   1912 O  OE1   . GLU C 1 60 ? -2.290  -43.788 -37.631  1.00 52.11  ? 461 GLU C OE1   1 
ATOM   1913 O  OE2   . GLU C 1 60 ? -1.289  -45.695 -38.105  1.00 55.06  ? 461 GLU C OE2   1 
ATOM   1914 N  N     . VAL C 1 61 ? 0.799   -41.737 -42.350  1.00 38.00  ? 462 VAL C N     1 
ATOM   1915 C  CA    . VAL C 1 61 ? 0.947   -40.659 -43.311  1.00 43.57  ? 462 VAL C CA    1 
ATOM   1916 C  C     . VAL C 1 61 ? 0.103   -39.440 -42.979  1.00 44.83  ? 462 VAL C C     1 
ATOM   1917 O  O     . VAL C 1 61 ? 0.558   -38.304 -43.143  1.00 46.70  ? 462 VAL C O     1 
ATOM   1918 C  CB    . VAL C 1 61 ? 0.581   -41.141 -44.707  1.00 47.14  ? 462 VAL C CB    1 
ATOM   1919 C  CG1   . VAL C 1 61 ? 0.951   -40.085 -45.732  1.00 47.78  ? 462 VAL C CG1   1 
ATOM   1920 C  CG2   . VAL C 1 61 ? 1.284   -42.461 -44.990  1.00 52.89  ? 462 VAL C CG2   1 
ATOM   1921 N  N     . SER C 1 62 ? -1.130  -39.676 -42.534  1.00 41.12  ? 463 SER C N     1 
ATOM   1922 C  CA    . SER C 1 62 ? -2.026  -38.588 -42.161  1.00 33.36  ? 463 SER C CA    1 
ATOM   1923 C  C     . SER C 1 62 ? -1.251  -37.734 -41.174  1.00 32.84  ? 463 SER C C     1 
ATOM   1924 O  O     . SER C 1 62 ? -1.204  -36.509 -41.291  1.00 31.77  ? 463 SER C O     1 
ATOM   1925 C  CB    . SER C 1 62 ? -3.283  -39.132 -41.477  1.00 32.46  ? 463 SER C CB    1 
ATOM   1926 O  OG    . SER C 1 62 ? -2.974  -39.753 -40.237  1.00 22.37  ? 463 SER C OG    1 
ATOM   1927 N  N     . SER C 1 63 ? -0.635  -38.403 -40.204  1.00 26.68  ? 464 SER C N     1 
ATOM   1928 C  CA    . SER C 1 63 ? 0.159   -37.730 -39.192  1.00 26.03  ? 464 SER C CA    1 
ATOM   1929 C  C     . SER C 1 63 ? 1.064   -36.706 -39.867  1.00 25.40  ? 464 SER C C     1 
ATOM   1930 O  O     . SER C 1 63 ? 0.943   -35.504 -39.649  1.00 26.25  ? 464 SER C O     1 
ATOM   1931 C  CB    . SER C 1 63 ? 1.000   -38.753 -38.435  1.00 24.98  ? 464 SER C CB    1 
ATOM   1932 O  OG    . SER C 1 63 ? 0.178   -39.764 -37.881  1.00 29.44  ? 464 SER C OG    1 
ATOM   1933 N  N     . ALA C 1 64 ? 1.967   -37.192 -40.701  1.00 21.94  ? 465 ALA C N     1 
ATOM   1934 C  CA    . ALA C 1 64 ? 2.871   -36.317 -41.410  1.00 21.96  ? 465 ALA C CA    1 
ATOM   1935 C  C     . ALA C 1 64 ? 2.127   -35.120 -42.014  1.00 24.42  ? 465 ALA C C     1 
ATOM   1936 O  O     . ALA C 1 64 ? 2.615   -33.990 -41.985  1.00 25.67  ? 465 ALA C O     1 
ATOM   1937 C  CB    . ALA C 1 64 ? 3.575   -37.100 -42.495  1.00 21.51  ? 465 ALA C CB    1 
ATOM   1938 N  N     . THR C 1 65 ? 0.937   -35.351 -42.549  1.00 24.58  ? 466 THR C N     1 
ATOM   1939 C  CA    . THR C 1 65 ? 0.206   -34.252 -43.167  1.00 29.49  ? 466 THR C CA    1 
ATOM   1940 C  C     . THR C 1 65 ? -0.171  -33.154 -42.170  1.00 25.05  ? 466 THR C C     1 
ATOM   1941 O  O     . THR C 1 65 ? 0.066   -31.976 -42.427  1.00 26.00  ? 466 THR C O     1 
ATOM   1942 C  CB    . THR C 1 65 ? -1.067  -34.765 -43.934  1.00 32.53  ? 466 THR C CB    1 
ATOM   1943 O  OG1   . THR C 1 65 ? -0.670  -35.641 -45.000  1.00 27.94  ? 466 THR C OG1   1 
ATOM   1944 C  CG2   . THR C 1 65 ? -1.838  -33.601 -44.544  1.00 27.60  ? 466 THR C CG2   1 
ATOM   1945 N  N     . ASN C 1 66 ? -0.736  -33.531 -41.032  1.00 22.92  ? 467 ASN C N     1 
ATOM   1946 C  CA    . ASN C 1 66 ? -1.133  -32.547 -40.034  1.00 24.45  ? 467 ASN C CA    1 
ATOM   1947 C  C     . ASN C 1 66 ? 0.105   -31.879 -39.495  1.00 24.72  ? 467 ASN C C     1 
ATOM   1948 O  O     . ASN C 1 66 ? 0.114   -30.685 -39.218  1.00 25.64  ? 467 ASN C O     1 
ATOM   1949 C  CB    . ASN C 1 66 ? -1.877  -33.226 -38.896  1.00 32.46  ? 467 ASN C CB    1 
ATOM   1950 C  CG    . ASN C 1 66 ? -2.987  -34.130 -39.394  1.00 47.85  ? 467 ASN C CG    1 
ATOM   1951 O  OD1   . ASN C 1 66 ? -3.961  -33.666 -39.999  1.00 52.20  ? 467 ASN C OD1   1 
ATOM   1952 N  ND2   . ASN C 1 66 ? -2.845  -35.432 -39.151  1.00 51.33  ? 467 ASN C ND2   1 
ATOM   1953 N  N     . ALA C 1 67 ? 1.157   -32.669 -39.348  1.00 28.59  ? 468 ALA C N     1 
ATOM   1954 C  CA    . ALA C 1 67 ? 2.422   -32.167 -38.845  1.00 28.39  ? 468 ALA C CA    1 
ATOM   1955 C  C     . ALA C 1 67 ? 2.848   -30.988 -39.694  1.00 28.24  ? 468 ALA C C     1 
ATOM   1956 O  O     . ALA C 1 67 ? 2.970   -29.872 -39.197  1.00 30.90  ? 468 ALA C O     1 
ATOM   1957 C  CB    . ALA C 1 67 ? 3.484   -33.266 -38.892  1.00 21.26  ? 468 ALA C CB    1 
ATOM   1958 N  N     . LEU C 1 68 ? 3.057   -31.250 -40.981  1.00 29.12  ? 469 LEU C N     1 
ATOM   1959 C  CA    . LEU C 1 68 ? 3.473   -30.228 -41.931  1.00 28.62  ? 469 LEU C CA    1 
ATOM   1960 C  C     . LEU C 1 68 ? 2.621   -28.999 -41.772  1.00 29.44  ? 469 LEU C C     1 
ATOM   1961 O  O     . LEU C 1 68 ? 3.098   -27.948 -41.350  1.00 32.19  ? 469 LEU C O     1 
ATOM   1962 C  CB    . LEU C 1 68 ? 3.335   -30.740 -43.367  1.00 31.44  ? 469 LEU C CB    1 
ATOM   1963 C  CG    . LEU C 1 68 ? 3.964   -29.873 -44.470  1.00 31.95  ? 469 LEU C CG    1 
ATOM   1964 C  CD1   . LEU C 1 68 ? 4.023   -30.668 -45.766  1.00 24.56  ? 469 LEU C CD1   1 
ATOM   1965 C  CD2   . LEU C 1 68 ? 3.187   -28.576 -44.647  1.00 34.64  ? 469 LEU C CD2   1 
ATOM   1966 N  N     . ARG C 1 69 ? 1.352   -29.145 -42.134  1.00 29.39  ? 470 ARG C N     1 
ATOM   1967 C  CA    . ARG C 1 69 ? 0.385   -28.061 -42.049  1.00 30.00  ? 470 ARG C CA    1 
ATOM   1968 C  C     . ARG C 1 69 ? 0.546   -27.208 -40.792  1.00 25.20  ? 470 ARG C C     1 
ATOM   1969 O  O     . ARG C 1 69 ? 0.957   -26.050 -40.848  1.00 20.61  ? 470 ARG C O     1 
ATOM   1970 C  CB    . ARG C 1 69 ? -1.030  -28.639 -42.085  1.00 32.44  ? 470 ARG C CB    1 
ATOM   1971 C  CG    . ARG C 1 69 ? -1.513  -29.088 -43.454  1.00 39.23  ? 470 ARG C CG    1 
ATOM   1972 C  CD    . ARG C 1 69 ? -2.930  -29.619 -43.340  1.00 46.02  ? 470 ARG C CD    1 
ATOM   1973 N  NE    . ARG C 1 69 ? -3.575  -29.076 -42.148  1.00 55.73  ? 470 ARG C NE    1 
ATOM   1974 C  CZ    . ARG C 1 69 ? -4.737  -29.498 -41.666  1.00 63.00  ? 470 ARG C CZ    1 
ATOM   1975 N  NH1   . ARG C 1 69 ? -5.389  -30.473 -42.284  1.00 70.45  ? 470 ARG C NH1   1 
ATOM   1976 N  NH2   . ARG C 1 69 ? -5.235  -28.965 -40.554  1.00 61.41  ? 470 ARG C NH2   1 
ATOM   1977 N  N     . SER C 1 70 ? 0.220   -27.806 -39.657  1.00 21.14  ? 471 SER C N     1 
ATOM   1978 C  CA    . SER C 1 70 ? 0.291   -27.131 -38.376  1.00 20.93  ? 471 SER C CA    1 
ATOM   1979 C  C     . SER C 1 70 ? 1.565   -26.363 -38.092  1.00 16.54  ? 471 SER C C     1 
ATOM   1980 O  O     . SER C 1 70 ? 1.533   -25.151 -37.942  1.00 17.58  ? 471 SER C O     1 
ATOM   1981 C  CB    . SER C 1 70 ? 0.029   -28.145 -37.271  1.00 14.93  ? 471 SER C CB    1 
ATOM   1982 O  OG    . SER C 1 70 ? -1.228  -28.768 -37.505  1.00 23.25  ? 471 SER C OG    1 
ATOM   1983 N  N     . MET C 1 71 ? 2.689   -27.057 -38.027  1.00 16.45  ? 472 MET C N     1 
ATOM   1984 C  CA    . MET C 1 71 ? 3.953   -26.398 -37.720  1.00 20.24  ? 472 MET C CA    1 
ATOM   1985 C  C     . MET C 1 71 ? 4.550   -25.544 -38.828  1.00 20.76  ? 472 MET C C     1 
ATOM   1986 O  O     . MET C 1 71 ? 5.562   -24.893 -38.617  1.00 19.24  ? 472 MET C O     1 
ATOM   1987 C  CB    . MET C 1 71 ? 4.995   -27.437 -37.282  1.00 21.89  ? 472 MET C CB    1 
ATOM   1988 C  CG    . MET C 1 71 ? 4.575   -28.284 -36.096  1.00 20.38  ? 472 MET C CG    1 
ATOM   1989 S  SD    . MET C 1 71 ? 4.162   -27.273 -34.664  1.00 25.92  ? 472 MET C SD    1 
ATOM   1990 C  CE    . MET C 1 71 ? 2.385   -27.217 -34.773  1.00 18.47  ? 472 MET C CE    1 
ATOM   1991 N  N     . GLN C 1 72 ? 3.930   -25.531 -40.000  1.00 22.56  ? 473 GLN C N     1 
ATOM   1992 C  CA    . GLN C 1 72 ? 4.452   -24.759 -41.129  1.00 30.24  ? 473 GLN C CA    1 
ATOM   1993 C  C     . GLN C 1 72 ? 4.765   -23.280 -40.875  1.00 32.45  ? 473 GLN C C     1 
ATOM   1994 O  O     . GLN C 1 72 ? 3.862   -22.455 -40.754  1.00 33.84  ? 473 GLN C O     1 
ATOM   1995 C  CB    . GLN C 1 72 ? 3.486   -24.853 -42.304  1.00 36.36  ? 473 GLN C CB    1 
ATOM   1996 C  CG    . GLN C 1 72 ? 4.009   -24.212 -43.575  1.00 37.30  ? 473 GLN C CG    1 
ATOM   1997 C  CD    . GLN C 1 72 ? 5.108   -25.025 -44.227  1.00 34.89  ? 473 GLN C CD    1 
ATOM   1998 O  OE1   . GLN C 1 72 ? 6.220   -25.124 -43.714  1.00 32.54  ? 473 GLN C OE1   1 
ATOM   1999 N  NE2   . GLN C 1 72 ? 4.793   -25.620 -45.366  1.00 31.91  ? 473 GLN C NE2   1 
ATOM   2000 N  N     . GLY C 1 73 ? 6.052   -22.945 -40.837  1.00 34.15  ? 474 GLY C N     1 
ATOM   2001 C  CA    . GLY C 1 73 ? 6.466   -21.567 -40.610  1.00 33.23  ? 474 GLY C CA    1 
ATOM   2002 C  C     . GLY C 1 73 ? 6.575   -21.248 -39.135  1.00 33.84  ? 474 GLY C C     1 
ATOM   2003 O  O     . GLY C 1 73 ? 6.847   -20.117 -38.725  1.00 33.24  ? 474 GLY C O     1 
ATOM   2004 N  N     . PHE C 1 74 ? 6.357   -22.279 -38.334  1.00 34.53  ? 475 PHE C N     1 
ATOM   2005 C  CA    . PHE C 1 74 ? 6.403   -22.187 -36.885  1.00 28.11  ? 475 PHE C CA    1 
ATOM   2006 C  C     . PHE C 1 74 ? 7.794   -21.808 -36.381  1.00 18.38  ? 475 PHE C C     1 
ATOM   2007 O  O     . PHE C 1 74 ? 8.794   -22.395 -36.795  1.00 13.36  ? 475 PHE C O     1 
ATOM   2008 C  CB    . PHE C 1 74 ? 5.955   -23.536 -36.309  1.00 28.24  ? 475 PHE C CB    1 
ATOM   2009 C  CG    . PHE C 1 74 ? 5.872   -23.567 -34.824  1.00 27.32  ? 475 PHE C CG    1 
ATOM   2010 C  CD1   . PHE C 1 74 ? 7.014   -23.761 -34.055  1.00 27.15  ? 475 PHE C CD1   1 
ATOM   2011 C  CD2   . PHE C 1 74 ? 4.657   -23.388 -34.189  1.00 21.35  ? 475 PHE C CD2   1 
ATOM   2012 C  CE1   . PHE C 1 74 ? 6.948   -23.776 -32.681  1.00 15.06  ? 475 PHE C CE1   1 
ATOM   2013 C  CE2   . PHE C 1 74 ? 4.586   -23.402 -32.820  1.00 19.83  ? 475 PHE C CE2   1 
ATOM   2014 C  CZ    . PHE C 1 74 ? 5.738   -23.597 -32.063  1.00 18.45  ? 475 PHE C CZ    1 
ATOM   2015 N  N     . PRO C 1 75 ? 7.874   -20.809 -35.485  1.00 14.58  ? 476 PRO C N     1 
ATOM   2016 C  CA    . PRO C 1 75 ? 9.169   -20.378 -34.942  1.00 15.25  ? 476 PRO C CA    1 
ATOM   2017 C  C     . PRO C 1 75 ? 9.869   -21.481 -34.160  1.00 15.81  ? 476 PRO C C     1 
ATOM   2018 O  O     . PRO C 1 75 ? 9.247   -22.215 -33.401  1.00 16.49  ? 476 PRO C O     1 
ATOM   2019 C  CB    . PRO C 1 75 ? 8.812   -19.166 -34.073  1.00 4.58   ? 476 PRO C CB    1 
ATOM   2020 C  CG    . PRO C 1 75 ? 7.404   -19.436 -33.673  1.00 13.58  ? 476 PRO C CG    1 
ATOM   2021 C  CD    . PRO C 1 75 ? 6.779   -19.993 -34.936  1.00 12.35  ? 476 PRO C CD    1 
ATOM   2022 N  N     . PHE C 1 76 ? 11.176  -21.585 -34.356  1.00 20.15  ? 477 PHE C N     1 
ATOM   2023 C  CA    . PHE C 1 76 ? 11.977  -22.597 -33.701  1.00 23.09  ? 477 PHE C CA    1 
ATOM   2024 C  C     . PHE C 1 76 ? 13.408  -22.051 -33.655  1.00 27.30  ? 477 PHE C C     1 
ATOM   2025 O  O     . PHE C 1 76 ? 14.086  -21.993 -34.683  1.00 25.20  ? 477 PHE C O     1 
ATOM   2026 C  CB    . PHE C 1 76 ? 11.913  -23.881 -34.536  1.00 26.49  ? 477 PHE C CB    1 
ATOM   2027 C  CG    . PHE C 1 76 ? 12.237  -25.142 -33.774  1.00 27.65  ? 477 PHE C CG    1 
ATOM   2028 C  CD1   . PHE C 1 76 ? 11.364  -25.638 -32.821  1.00 21.78  ? 477 PHE C CD1   1 
ATOM   2029 C  CD2   . PHE C 1 76 ? 13.396  -25.864 -34.056  1.00 29.30  ? 477 PHE C CD2   1 
ATOM   2030 C  CE1   . PHE C 1 76 ? 11.631  -26.825 -32.168  1.00 18.44  ? 477 PHE C CE1   1 
ATOM   2031 C  CE2   . PHE C 1 76 ? 13.669  -27.054 -33.404  1.00 25.47  ? 477 PHE C CE2   1 
ATOM   2032 C  CZ    . PHE C 1 76 ? 12.783  -27.535 -32.462  1.00 23.42  ? 477 PHE C CZ    1 
ATOM   2033 N  N     . TYR C 1 77 ? 13.855  -21.640 -32.469  1.00 31.20  ? 478 TYR C N     1 
ATOM   2034 C  CA    . TYR C 1 77 ? 15.208  -21.104 -32.287  1.00 31.37  ? 478 TYR C CA    1 
ATOM   2035 C  C     . TYR C 1 77 ? 15.480  -19.906 -33.191  1.00 30.08  ? 478 TYR C C     1 
ATOM   2036 O  O     . TYR C 1 77 ? 16.540  -19.814 -33.815  1.00 22.15  ? 478 TYR C O     1 
ATOM   2037 C  CB    . TYR C 1 77 ? 16.266  -22.184 -32.566  1.00 39.54  ? 478 TYR C CB    1 
ATOM   2038 C  CG    . TYR C 1 77 ? 16.466  -23.231 -31.474  1.00 41.30  ? 478 TYR C CG    1 
ATOM   2039 C  CD1   . TYR C 1 77 ? 16.947  -22.876 -30.212  1.00 42.26  ? 478 TYR C CD1   1 
ATOM   2040 C  CD2   . TYR C 1 77 ? 16.211  -24.579 -31.721  1.00 32.72  ? 478 TYR C CD2   1 
ATOM   2041 C  CE1   . TYR C 1 77 ? 17.165  -23.838 -29.235  1.00 38.32  ? 478 TYR C CE1   1 
ATOM   2042 C  CE2   . TYR C 1 77 ? 16.428  -25.538 -30.752  1.00 34.67  ? 478 TYR C CE2   1 
ATOM   2043 C  CZ    . TYR C 1 77 ? 16.903  -25.162 -29.515  1.00 37.19  ? 478 TYR C CZ    1 
ATOM   2044 O  OH    . TYR C 1 77 ? 17.112  -26.118 -28.554  1.00 46.81  ? 478 TYR C OH    1 
ATOM   2045 N  N     . ASP C 1 78 ? 14.513  -18.996 -33.256  1.00 30.88  ? 479 ASP C N     1 
ATOM   2046 C  CA    . ASP C 1 78 ? 14.625  -17.779 -34.058  1.00 27.34  ? 479 ASP C CA    1 
ATOM   2047 C  C     . ASP C 1 78 ? 14.813  -18.052 -35.542  1.00 25.85  ? 479 ASP C C     1 
ATOM   2048 O  O     . ASP C 1 78 ? 15.672  -17.447 -36.182  1.00 23.64  ? 479 ASP C O     1 
ATOM   2049 C  CB    . ASP C 1 78 ? 15.778  -16.903 -33.548  1.00 29.19  ? 479 ASP C CB    1 
ATOM   2050 C  CG    . ASP C 1 78 ? 15.639  -16.545 -32.070  1.00 33.20  ? 479 ASP C CG    1 
ATOM   2051 O  OD1   . ASP C 1 78 ? 14.512  -16.218 -31.642  1.00 31.86  ? 479 ASP C OD1   1 
ATOM   2052 O  OD2   . ASP C 1 78 ? 16.655  -16.580 -31.340  1.00 32.32  ? 479 ASP C OD2   1 
ATOM   2053 N  N     . LYS C 1 79 ? 13.999  -18.968 -36.071  1.00 24.46  ? 480 LYS C N     1 
ATOM   2054 C  CA    . LYS C 1 79 ? 14.004  -19.357 -37.486  1.00 25.68  ? 480 LYS C CA    1 
ATOM   2055 C  C     . LYS C 1 79 ? 12.755  -20.195 -37.818  1.00 25.63  ? 480 LYS C C     1 
ATOM   2056 O  O     . LYS C 1 79 ? 12.612  -21.337 -37.358  1.00 28.53  ? 480 LYS C O     1 
ATOM   2057 C  CB    . LYS C 1 79 ? 15.253  -20.179 -37.841  1.00 30.19  ? 480 LYS C CB    1 
ATOM   2058 C  CG    . LYS C 1 79 ? 16.562  -19.417 -37.868  1.00 27.29  ? 480 LYS C CG    1 
ATOM   2059 C  CD    . LYS C 1 79 ? 17.607  -20.202 -38.617  1.00 23.49  ? 480 LYS C CD    1 
ATOM   2060 C  CE    . LYS C 1 79 ? 17.203  -20.344 -40.074  1.00 20.11  ? 480 LYS C CE    1 
ATOM   2061 N  NZ    . LYS C 1 79 ? 18.124  -21.257 -40.821  1.00 22.83  ? 480 LYS C NZ    1 
ATOM   2062 N  N     . PRO C 1 80 ? 11.849  -19.647 -38.645  1.00 22.99  ? 481 PRO C N     1 
ATOM   2063 C  CA    . PRO C 1 80 ? 10.619  -20.348 -39.031  1.00 22.24  ? 481 PRO C CA    1 
ATOM   2064 C  C     . PRO C 1 80 ? 10.880  -21.689 -39.700  1.00 25.26  ? 481 PRO C C     1 
ATOM   2065 O  O     . PRO C 1 80 ? 11.669  -21.775 -40.636  1.00 25.10  ? 481 PRO C O     1 
ATOM   2066 C  CB    . PRO C 1 80 ? 9.950   -19.362 -39.981  1.00 19.86  ? 481 PRO C CB    1 
ATOM   2067 C  CG    . PRO C 1 80 ? 11.121  -18.663 -40.610  1.00 17.50  ? 481 PRO C CG    1 
ATOM   2068 C  CD    . PRO C 1 80 ? 12.009  -18.407 -39.427  1.00 21.54  ? 481 PRO C CD    1 
ATOM   2069 N  N     . MET C 1 81 ? 10.231  -22.746 -39.229  1.00 28.49  ? 482 MET C N     1 
ATOM   2070 C  CA    . MET C 1 81 ? 10.446  -24.038 -39.866  1.00 30.32  ? 482 MET C CA    1 
ATOM   2071 C  C     . MET C 1 81 ? 9.803   -23.969 -41.235  1.00 29.33  ? 482 MET C C     1 
ATOM   2072 O  O     . MET C 1 81 ? 8.936   -23.139 -41.480  1.00 31.59  ? 482 MET C O     1 
ATOM   2073 C  CB    . MET C 1 81 ? 9.802   -25.181 -39.075  1.00 26.83  ? 482 MET C CB    1 
ATOM   2074 C  CG    . MET C 1 81 ? 10.223  -25.248 -37.621  1.00 35.40  ? 482 MET C CG    1 
ATOM   2075 S  SD    . MET C 1 81 ? 10.040  -26.888 -36.901  1.00 32.25  ? 482 MET C SD    1 
ATOM   2076 C  CE    . MET C 1 81 ? 8.256   -26.975 -36.612  1.00 32.95  ? 482 MET C CE    1 
ATOM   2077 N  N     . ARG C 1 82 ? 10.252  -24.828 -42.133  1.00 28.34  ? 483 ARG C N     1 
ATOM   2078 C  CA    . ARG C 1 82 ? 9.693   -24.905 -43.470  1.00 23.61  ? 483 ARG C CA    1 
ATOM   2079 C  C     . ARG C 1 82 ? 9.651   -26.401 -43.692  1.00 24.06  ? 483 ARG C C     1 
ATOM   2080 O  O     . ARG C 1 82 ? 10.672  -27.081 -43.578  1.00 26.56  ? 483 ARG C O     1 
ATOM   2081 C  CB    . ARG C 1 82 ? 10.603  -24.228 -44.492  1.00 22.84  ? 483 ARG C CB    1 
ATOM   2082 C  CG    . ARG C 1 82 ? 10.756  -22.720 -44.330  1.00 13.46  ? 483 ARG C CG    1 
ATOM   2083 C  CD    . ARG C 1 82 ? 11.298  -22.162 -45.626  1.00 15.12  ? 483 ARG C CD    1 
ATOM   2084 N  NE    . ARG C 1 82 ? 12.421  -21.257 -45.442  1.00 16.80  ? 483 ARG C NE    1 
ATOM   2085 C  CZ    . ARG C 1 82 ? 13.563  -21.349 -46.119  1.00 17.87  ? 483 ARG C CZ    1 
ATOM   2086 N  NH1   . ARG C 1 82 ? 13.737  -22.306 -47.015  1.00 14.54  ? 483 ARG C NH1   1 
ATOM   2087 N  NH2   . ARG C 1 82 ? 14.528  -20.471 -45.919  1.00 10.98  ? 483 ARG C NH2   1 
ATOM   2088 N  N     . ILE C 1 83 ? 8.471   -26.924 -43.981  1.00 22.05  ? 484 ILE C N     1 
ATOM   2089 C  CA    . ILE C 1 83 ? 8.344   -28.356 -44.150  1.00 24.76  ? 484 ILE C CA    1 
ATOM   2090 C  C     . ILE C 1 83 ? 7.637   -28.790 -45.413  1.00 29.70  ? 484 ILE C C     1 
ATOM   2091 O  O     . ILE C 1 83 ? 6.648   -28.195 -45.833  1.00 34.86  ? 484 ILE C O     1 
ATOM   2092 C  CB    . ILE C 1 83 ? 7.563   -28.986 -42.999  1.00 21.27  ? 484 ILE C CB    1 
ATOM   2093 C  CG1   . ILE C 1 83 ? 7.642   -28.122 -41.754  1.00 11.98  ? 484 ILE C CG1   1 
ATOM   2094 C  CG2   . ILE C 1 83 ? 8.127   -30.349 -42.694  1.00 30.02  ? 484 ILE C CG2   1 
ATOM   2095 C  CD1   . ILE C 1 83 ? 6.617   -28.507 -40.749  1.00 3.17   ? 484 ILE C CD1   1 
ATOM   2096 N  N     . GLN C 1 84 ? 8.146   -29.858 -46.001  1.00 29.37  ? 485 GLN C N     1 
ATOM   2097 C  CA    . GLN C 1 84 ? 7.557   -30.414 -47.194  1.00 32.07  ? 485 GLN C CA    1 
ATOM   2098 C  C     . GLN C 1 84 ? 7.710   -31.904 -47.045  1.00 32.98  ? 485 GLN C C     1 
ATOM   2099 O  O     . GLN C 1 84 ? 8.183   -32.386 -46.019  1.00 33.71  ? 485 GLN C O     1 
ATOM   2100 C  CB    . GLN C 1 84 ? 8.291   -29.922 -48.438  1.00 37.12  ? 485 GLN C CB    1 
ATOM   2101 C  CG    . GLN C 1 84 ? 9.795   -30.135 -48.405  1.00 41.69  ? 485 GLN C CG    1 
ATOM   2102 C  CD    . GLN C 1 84 ? 10.510  -29.426 -49.547  1.00 39.43  ? 485 GLN C CD    1 
ATOM   2103 O  OE1   . GLN C 1 84 ? 10.267  -29.707 -50.723  1.00 32.97  ? 485 GLN C OE1   1 
ATOM   2104 N  NE2   . GLN C 1 84 ? 11.394  -28.498 -49.200  1.00 33.73  ? 485 GLN C NE2   1 
ATOM   2105 N  N     . TYR C 1 85 ? 7.300   -32.637 -48.064  1.00 33.56  ? 486 TYR C N     1 
ATOM   2106 C  CA    . TYR C 1 85 ? 7.397   -34.077 -48.027  1.00 32.69  ? 486 TYR C CA    1 
ATOM   2107 C  C     . TYR C 1 85 ? 8.731   -34.464 -48.626  1.00 37.79  ? 486 TYR C C     1 
ATOM   2108 O  O     . TYR C 1 85 ? 9.252   -33.767 -49.501  1.00 41.27  ? 486 TYR C O     1 
ATOM   2109 C  CB    . TYR C 1 85 ? 6.263   -34.688 -48.840  1.00 30.24  ? 486 TYR C CB    1 
ATOM   2110 C  CG    . TYR C 1 85 ? 4.886   -34.467 -48.252  1.00 33.42  ? 486 TYR C CG    1 
ATOM   2111 C  CD1   . TYR C 1 85 ? 4.440   -35.228 -47.172  1.00 35.33  ? 486 TYR C CD1   1 
ATOM   2112 C  CD2   . TYR C 1 85 ? 4.019   -33.520 -48.793  1.00 27.01  ? 486 TYR C CD2   1 
ATOM   2113 C  CE1   . TYR C 1 85 ? 3.164   -35.057 -46.651  1.00 35.98  ? 486 TYR C CE1   1 
ATOM   2114 C  CE2   . TYR C 1 85 ? 2.741   -33.343 -48.278  1.00 30.19  ? 486 TYR C CE2   1 
ATOM   2115 C  CZ    . TYR C 1 85 ? 2.316   -34.116 -47.209  1.00 35.07  ? 486 TYR C CZ    1 
ATOM   2116 O  OH    . TYR C 1 85 ? 1.036   -33.972 -46.709  1.00 39.01  ? 486 TYR C OH    1 
ATOM   2117 N  N     . ALA C 1 86 ? 9.297   -35.562 -48.141  1.00 38.27  ? 487 ALA C N     1 
ATOM   2118 C  CA    . ALA C 1 86 ? 10.562  -36.038 -48.667  1.00 38.57  ? 487 ALA C CA    1 
ATOM   2119 C  C     . ALA C 1 86 ? 10.228  -36.749 -49.973  1.00 43.24  ? 487 ALA C C     1 
ATOM   2120 O  O     . ALA C 1 86 ? 9.165   -37.363 -50.101  1.00 44.64  ? 487 ALA C O     1 
ATOM   2121 C  CB    . ALA C 1 86 ? 11.196  -36.995 -47.696  1.00 33.51  ? 487 ALA C CB    1 
ATOM   2122 N  N     . LYS C 1 87 ? 11.119  -36.654 -50.950  1.00 44.73  ? 488 LYS C N     1 
ATOM   2123 C  CA    . LYS C 1 87 ? 10.879  -37.296 -52.233  1.00 45.27  ? 488 LYS C CA    1 
ATOM   2124 C  C     . LYS C 1 87 ? 10.716  -38.812 -52.108  1.00 48.34  ? 488 LYS C C     1 
ATOM   2125 O  O     . LYS C 1 87 ? 11.430  -39.455 -51.336  1.00 44.41  ? 488 LYS C O     1 
ATOM   2126 C  CB    . LYS C 1 87 ? 12.012  -36.954 -53.205  1.00 42.71  ? 488 LYS C CB    1 
ATOM   2127 C  CG    . LYS C 1 87 ? 11.810  -35.632 -53.937  1.00 43.09  ? 488 LYS C CG    1 
ATOM   2128 C  CD    . LYS C 1 87 ? 11.671  -34.466 -52.974  1.00 45.83  ? 488 LYS C CD    1 
ATOM   2129 C  CE    . LYS C 1 87 ? 11.151  -33.224 -53.681  1.00 46.84  ? 488 LYS C CE    1 
ATOM   2130 N  NZ    . LYS C 1 87 ? 9.701   -33.324 -54.026  1.00 48.93  ? 488 LYS C NZ    1 
ATOM   2131 N  N     . THR C 1 88 ? 9.758   -39.357 -52.864  1.00 51.47  ? 489 THR C N     1 
ATOM   2132 C  CA    . THR C 1 88 ? 9.442   -40.790 -52.899  1.00 57.09  ? 489 THR C CA    1 
ATOM   2133 C  C     . THR C 1 88 ? 9.372   -41.489 -51.534  1.00 62.18  ? 489 THR C C     1 
ATOM   2134 O  O     . THR C 1 88 ? 8.529   -42.405 -51.412  1.00 64.75  ? 489 THR C O     1 
ATOM   2135 C  CB    . THR C 1 88 ? 10.437  -41.572 -53.805  1.00 56.00  ? 489 THR C CB    1 
ATOM   2136 O  OG1   . THR C 1 88 ? 10.450  -40.990 -55.112  1.00 49.82  ? 489 THR C OG1   1 
ATOM   2137 C  CG2   . THR C 1 88 ? 10.020  -43.046 -53.929  1.00 51.75  ? 489 THR C CG2   1 
ATOM   2138 N  N     . THR D 1 5  ? -5.172  -7.133  -9.770   1.00 65.58  ? 506 THR D N     1 
ATOM   2139 C  CA    . THR D 1 5  ? -5.508  -5.709  -9.456   1.00 67.93  ? 506 THR D CA    1 
ATOM   2140 C  C     . THR D 1 5  ? -6.759  -5.224  -10.202  1.00 66.82  ? 506 THR D C     1 
ATOM   2141 O  O     . THR D 1 5  ? -7.204  -5.850  -11.169  1.00 64.33  ? 506 THR D O     1 
ATOM   2142 C  CB    . THR D 1 5  ? -4.315  -4.773  -9.776   1.00 67.27  ? 506 THR D CB    1 
ATOM   2143 O  OG1   . THR D 1 5  ? -3.217  -5.107  -8.918   1.00 68.61  ? 506 THR D OG1   1 
ATOM   2144 C  CG2   . THR D 1 5  ? -4.691  -3.307  -9.556   1.00 61.41  ? 506 THR D CG2   1 
ATOM   2145 N  N     . ARG D 1 6  ? -7.314  -4.109  -9.729   1.00 63.81  ? 507 ARG D N     1 
ATOM   2146 C  CA    . ARG D 1 6  ? -8.522  -3.512  -10.287  1.00 58.93  ? 507 ARG D CA    1 
ATOM   2147 C  C     . ARG D 1 6  ? -8.418  -3.172  -11.764  1.00 54.80  ? 507 ARG D C     1 
ATOM   2148 O  O     . ARG D 1 6  ? -7.823  -2.165  -12.135  1.00 53.25  ? 507 ARG D O     1 
ATOM   2149 C  CB    . ARG D 1 6  ? -8.882  -2.268  -9.499   1.00 61.06  ? 507 ARG D CB    1 
ATOM   2150 N  N     . PRO D 1 7  ? -9.018  -4.008  -12.627  1.00 54.10  ? 508 PRO D N     1 
ATOM   2151 C  CA    . PRO D 1 7  ? -9.018  -3.832  -14.082  1.00 53.75  ? 508 PRO D CA    1 
ATOM   2152 C  C     . PRO D 1 7  ? -9.297  -2.414  -14.582  1.00 51.44  ? 508 PRO D C     1 
ATOM   2153 O  O     . PRO D 1 7  ? -10.446 -1.977  -14.630  1.00 51.22  ? 508 PRO D O     1 
ATOM   2154 C  CB    . PRO D 1 7  ? -10.084 -4.828  -14.540  1.00 50.34  ? 508 PRO D CB    1 
ATOM   2155 C  CG    . PRO D 1 7  ? -9.873  -5.958  -13.591  1.00 47.78  ? 508 PRO D CG    1 
ATOM   2156 C  CD    . PRO D 1 7  ? -9.741  -5.241  -12.260  1.00 52.55  ? 508 PRO D CD    1 
ATOM   2157 N  N     . ASN D 1 8  ? -8.245  -1.694  -14.948  1.00 49.34  ? 509 ASN D N     1 
ATOM   2158 C  CA    . ASN D 1 8  ? -8.421  -0.352  -15.473  1.00 52.22  ? 509 ASN D CA    1 
ATOM   2159 C  C     . ASN D 1 8  ? -8.245  -0.475  -16.983  1.00 54.60  ? 509 ASN D C     1 
ATOM   2160 O  O     . ASN D 1 8  ? -7.932  -1.555  -17.480  1.00 55.48  ? 509 ASN D O     1 
ATOM   2161 C  CB    . ASN D 1 8  ? -7.401  0.618   -14.862  1.00 53.20  ? 509 ASN D CB    1 
ATOM   2162 C  CG    . ASN D 1 8  ? -6.010  0.464   -15.442  1.00 56.44  ? 509 ASN D CG    1 
ATOM   2163 O  OD1   . ASN D 1 8  ? -5.359  -0.566  -15.273  1.00 57.00  ? 509 ASN D OD1   1 
ATOM   2164 N  ND2   . ASN D 1 8  ? -5.545  1.504   -16.131  1.00 57.05  ? 509 ASN D ND2   1 
ATOM   2165 N  N     . HIS D 1 9  ? -8.455  0.612   -17.716  1.00 56.29  ? 510 HIS D N     1 
ATOM   2166 C  CA    . HIS D 1 9  ? -8.331  0.569   -19.171  1.00 55.65  ? 510 HIS D CA    1 
ATOM   2167 C  C     . HIS D 1 9  ? -6.899  0.712   -19.682  1.00 54.88  ? 510 HIS D C     1 
ATOM   2168 O  O     . HIS D 1 9  ? -6.678  0.764   -20.892  1.00 56.02  ? 510 HIS D O     1 
ATOM   2169 C  CB    . HIS D 1 9  ? -9.182  1.665   -19.808  1.00 59.57  ? 510 HIS D CB    1 
ATOM   2170 C  CG    . HIS D 1 9  ? -8.714  3.051   -19.489  1.00 65.00  ? 510 HIS D CG    1 
ATOM   2171 N  ND1   . HIS D 1 9  ? -8.883  4.111   -20.354  1.00 64.15  ? 510 HIS D ND1   1 
ATOM   2172 C  CD2   . HIS D 1 9  ? -8.087  3.552   -18.398  1.00 65.72  ? 510 HIS D CD2   1 
ATOM   2173 C  CE1   . HIS D 1 9  ? -8.378  5.204   -19.811  1.00 64.40  ? 510 HIS D CE1   1 
ATOM   2174 N  NE2   . HIS D 1 9  ? -7.889  4.892   -18.624  1.00 65.21  ? 510 HIS D NE2   1 
ATOM   2175 N  N     . THR D 1 10 ? -5.931  0.791   -18.774  1.00 49.08  ? 511 THR D N     1 
ATOM   2176 C  CA    . THR D 1 10 ? -4.538  0.923   -19.180  1.00 44.44  ? 511 THR D CA    1 
ATOM   2177 C  C     . THR D 1 10 ? -3.685  -0.228  -18.685  1.00 46.24  ? 511 THR D C     1 
ATOM   2178 O  O     . THR D 1 10 ? -3.652  -0.521  -17.488  1.00 48.57  ? 511 THR D O     1 
ATOM   2179 C  CB    . THR D 1 10 ? -3.926  2.218   -18.659  1.00 40.79  ? 511 THR D CB    1 
ATOM   2180 O  OG1   . THR D 1 10 ? -4.649  3.320   -19.200  1.00 45.55  ? 511 THR D OG1   1 
ATOM   2181 C  CG2   . THR D 1 10 ? -2.461  2.330   -19.073  1.00 37.00  ? 511 THR D CG2   1 
ATOM   2182 N  N     . ILE D 1 11 ? -2.992  -0.879  -19.616  1.00 43.86  ? 512 ILE D N     1 
ATOM   2183 C  CA    . ILE D 1 11 ? -2.126  -1.993  -19.268  1.00 40.27  ? 512 ILE D CA    1 
ATOM   2184 C  C     . ILE D 1 11 ? -0.664  -1.562  -19.276  1.00 39.05  ? 512 ILE D C     1 
ATOM   2185 O  O     . ILE D 1 11 ? -0.258  -0.718  -20.074  1.00 40.30  ? 512 ILE D O     1 
ATOM   2186 C  CB    . ILE D 1 11 ? -2.315  -3.181  -20.237  1.00 35.19  ? 512 ILE D CB    1 
ATOM   2187 C  CG1   . ILE D 1 11 ? -1.996  -2.754  -21.668  1.00 30.98  ? 512 ILE D CG1   1 
ATOM   2188 C  CG2   . ILE D 1 11 ? -3.740  -3.698  -20.148  1.00 34.44  ? 512 ILE D CG2   1 
ATOM   2189 C  CD1   . ILE D 1 11 ? -2.050  -3.895  -22.655  1.00 25.41  ? 512 ILE D CD1   1 
ATOM   2190 N  N     . TYR D 1 12 ? 0.115   -2.144  -18.371  1.00 36.75  ? 513 TYR D N     1 
ATOM   2191 C  CA    . TYR D 1 12 ? 1.536   -1.848  -18.250  1.00 39.49  ? 513 TYR D CA    1 
ATOM   2192 C  C     . TYR D 1 12 ? 2.378   -3.084  -18.535  1.00 38.66  ? 513 TYR D C     1 
ATOM   2193 O  O     . TYR D 1 12 ? 2.553   -3.949  -17.676  1.00 35.34  ? 513 TYR D O     1 
ATOM   2194 C  CB    . TYR D 1 12 ? 1.837   -1.312  -16.851  1.00 46.65  ? 513 TYR D CB    1 
ATOM   2195 C  CG    . TYR D 1 12 ? 3.257   -1.527  -16.370  1.00 51.06  ? 513 TYR D CG    1 
ATOM   2196 C  CD1   . TYR D 1 12 ? 3.585   -2.615  -15.557  1.00 52.31  ? 513 TYR D CD1   1 
ATOM   2197 C  CD2   . TYR D 1 12 ? 4.267   -0.631  -16.703  1.00 51.81  ? 513 TYR D CD2   1 
ATOM   2198 C  CE1   . TYR D 1 12 ? 4.886   -2.799  -15.088  1.00 54.36  ? 513 TYR D CE1   1 
ATOM   2199 C  CE2   . TYR D 1 12 ? 5.567   -0.804  -16.240  1.00 52.41  ? 513 TYR D CE2   1 
ATOM   2200 C  CZ    . TYR D 1 12 ? 5.870   -1.885  -15.435  1.00 53.07  ? 513 TYR D CZ    1 
ATOM   2201 O  OH    . TYR D 1 12 ? 7.153   -2.043  -14.978  1.00 50.76  ? 513 TYR D OH    1 
ATOM   2202 N  N     . ILE D 1 13 ? 2.892   -3.156  -19.757  1.00 40.81  ? 514 ILE D N     1 
ATOM   2203 C  CA    . ILE D 1 13 ? 3.711   -4.277  -20.180  1.00 43.04  ? 514 ILE D CA    1 
ATOM   2204 C  C     . ILE D 1 13 ? 5.146   -4.026  -19.777  1.00 40.32  ? 514 ILE D C     1 
ATOM   2205 O  O     . ILE D 1 13 ? 5.584   -2.885  -19.698  1.00 36.91  ? 514 ILE D O     1 
ATOM   2206 C  CB    . ILE D 1 13 ? 3.618   -4.501  -21.701  1.00 44.32  ? 514 ILE D CB    1 
ATOM   2207 C  CG1   . ILE D 1 13 ? 2.173   -4.792  -22.110  1.00 48.62  ? 514 ILE D CG1   1 
ATOM   2208 C  CG2   . ILE D 1 13 ? 4.541   -5.633  -22.129  1.00 45.80  ? 514 ILE D CG2   1 
ATOM   2209 C  CD1   . ILE D 1 13 ? 1.950   -4.789  -23.606  1.00 59.92  ? 514 ILE D CD1   1 
ATOM   2210 N  N     . ASN D 1 14 ? 5.883   -5.094  -19.524  1.00 39.10  ? 515 ASN D N     1 
ATOM   2211 C  CA    . ASN D 1 14 ? 7.273   -4.937  -19.162  1.00 41.53  ? 515 ASN D CA    1 
ATOM   2212 C  C     . ASN D 1 14 ? 8.056   -6.215  -19.380  1.00 39.33  ? 515 ASN D C     1 
ATOM   2213 O  O     . ASN D 1 14 ? 7.486   -7.294  -19.561  1.00 35.69  ? 515 ASN D O     1 
ATOM   2214 C  CB    . ASN D 1 14 ? 7.400   -4.483  -17.706  1.00 43.40  ? 515 ASN D CB    1 
ATOM   2215 C  CG    . ASN D 1 14 ? 7.012   -5.568  -16.722  1.00 44.84  ? 515 ASN D CG    1 
ATOM   2216 O  OD1   . ASN D 1 14 ? 6.643   -6.674  -17.116  1.00 55.35  ? 515 ASN D OD1   1 
ATOM   2217 N  ND2   . ASN D 1 14 ? 7.094   -5.254  -15.434  1.00 51.82  ? 515 ASN D ND2   1 
ATOM   2218 N  N     . ASN D 1 15 ? 9.369   -6.074  -19.373  1.00 38.81  ? 516 ASN D N     1 
ATOM   2219 C  CA    . ASN D 1 15 ? 10.246  -7.177  -19.647  1.00 37.77  ? 516 ASN D CA    1 
ATOM   2220 C  C     . ASN D 1 15 ? 10.485  -7.148  -21.131  1.00 41.29  ? 516 ASN D C     1 
ATOM   2221 O  O     . ASN D 1 15 ? 11.045  -8.079  -21.700  1.00 47.54  ? 516 ASN D O     1 
ATOM   2222 C  CB    . ASN D 1 15 ? 9.630   -8.499  -19.196  1.00 31.58  ? 516 ASN D CB    1 
ATOM   2223 C  CG    . ASN D 1 15 ? 10.582  -9.676  -19.178  1.00 33.02  ? 516 ASN D CG    1 
ATOM   2224 O  OD1   . ASN D 1 15 ? 11.746  -9.542  -19.577  1.00 40.89  ? 516 ASN D OD1   1 
ATOM   2225 N  ND2   . ASN D 1 15 ? 10.091  -10.837 -18.725  1.00 40.10  ? 516 ASN D ND2   1 
ATOM   2226 N  N     . LEU D 1 16 ? 10.065  -6.075  -21.756  1.00 42.24  ? 517 LEU D N     1 
ATOM   2227 C  CA    . LEU D 1 16 ? 10.278  -5.921  -23.181  1.00 37.09  ? 517 LEU D CA    1 
ATOM   2228 C  C     . LEU D 1 16 ? 11.763  -5.688  -23.441  1.00 33.65  ? 517 LEU D C     1 
ATOM   2229 O  O     . LEU D 1 16 ? 12.430  -4.921  -22.742  1.00 24.82  ? 517 LEU D O     1 
ATOM   2230 C  CB    . LEU D 1 16 ? 9.438   -4.775  -23.747  1.00 29.55  ? 517 LEU D CB    1 
ATOM   2231 C  CG    . LEU D 1 16 ? 7.921   -4.914  -23.610  1.00 38.33  ? 517 LEU D CG    1 
ATOM   2232 C  CD1   . LEU D 1 16 ? 7.213   -3.710  -24.212  1.00 39.17  ? 517 LEU D CD1   1 
ATOM   2233 C  CD2   . LEU D 1 16 ? 7.437   -6.200  -24.262  1.00 48.38  ? 517 LEU D CD2   1 
ATOM   2234 N  N     . ASN D 1 17 ? 12.236  -6.396  -24.450  1.00 36.76  ? 518 ASN D N     1 
ATOM   2235 C  CA    . ASN D 1 17 ? 13.623  -6.381  -24.892  1.00 37.58  ? 518 ASN D CA    1 
ATOM   2236 C  C     . ASN D 1 17 ? 14.133  -4.940  -24.867  1.00 34.54  ? 518 ASN D C     1 
ATOM   2237 O  O     . ASN D 1 17 ? 13.686  -4.099  -25.635  1.00 31.78  ? 518 ASN D O     1 
ATOM   2238 C  CB    . ASN D 1 17 ? 13.694  -6.946  -26.307  1.00 39.66  ? 518 ASN D CB    1 
ATOM   2239 C  CG    . ASN D 1 17 ? 15.103  -7.051  -26.823  1.00 41.72  ? 518 ASN D CG    1 
ATOM   2240 O  OD1   . ASN D 1 17 ? 15.472  -8.062  -27.422  1.00 43.54  ? 518 ASN D OD1   1 
ATOM   2241 N  ND2   . ASN D 1 17 ? 15.901  -6.007  -26.611  1.00 32.28  ? 518 ASN D ND2   1 
ATOM   2242 N  N     . GLU D 1 18 ? 15.080  -4.659  -23.987  1.00 36.76  ? 519 GLU D N     1 
ATOM   2243 C  CA    . GLU D 1 18 ? 15.608  -3.308  -23.859  1.00 38.54  ? 519 GLU D CA    1 
ATOM   2244 C  C     . GLU D 1 18 ? 16.404  -2.755  -25.045  1.00 38.38  ? 519 GLU D C     1 
ATOM   2245 O  O     . GLU D 1 18 ? 16.180  -1.628  -25.466  1.00 39.90  ? 519 GLU D O     1 
ATOM   2246 C  CB    . GLU D 1 18 ? 16.443  -3.220  -22.579  1.00 47.49  ? 519 GLU D CB    1 
ATOM   2247 C  CG    . GLU D 1 18 ? 16.566  -4.553  -21.810  1.00 57.87  ? 519 GLU D CG    1 
ATOM   2248 C  CD    . GLU D 1 18 ? 16.641  -4.365  -20.292  1.00 58.20  ? 519 GLU D CD    1 
ATOM   2249 O  OE1   . GLU D 1 18 ? 16.973  -5.342  -19.586  1.00 57.51  ? 519 GLU D OE1   1 
ATOM   2250 O  OE2   . GLU D 1 18 ? 16.359  -3.245  -19.806  1.00 55.32  ? 519 GLU D OE2   1 
ATOM   2251 N  N     . LYS D 1 19 ? 17.317  -3.547  -25.593  1.00 40.04  ? 520 LYS D N     1 
ATOM   2252 C  CA    . LYS D 1 19 ? 18.160  -3.109  -26.711  1.00 39.13  ? 520 LYS D CA    1 
ATOM   2253 C  C     . LYS D 1 19 ? 17.457  -2.752  -28.026  1.00 37.62  ? 520 LYS D C     1 
ATOM   2254 O  O     . LYS D 1 19 ? 18.087  -2.765  -29.084  1.00 41.56  ? 520 LYS D O     1 
ATOM   2255 C  CB    . LYS D 1 19 ? 19.253  -4.162  -26.983  1.00 36.56  ? 520 LYS D CB    1 
ATOM   2256 N  N     . ILE D 1 20 ? 16.176  -2.418  -27.978  1.00 30.81  ? 521 ILE D N     1 
ATOM   2257 C  CA    . ILE D 1 20 ? 15.479  -2.069  -29.205  1.00 33.53  ? 521 ILE D CA    1 
ATOM   2258 C  C     . ILE D 1 20 ? 15.135  -0.591  -29.247  1.00 40.37  ? 521 ILE D C     1 
ATOM   2259 O  O     . ILE D 1 20 ? 14.877  0.015   -28.212  1.00 43.00  ? 521 ILE D O     1 
ATOM   2260 C  CB    . ILE D 1 20 ? 14.190  -2.897  -29.360  1.00 30.32  ? 521 ILE D CB    1 
ATOM   2261 C  CG1   . ILE D 1 20 ? 14.535  -4.386  -29.331  1.00 29.12  ? 521 ILE D CG1   1 
ATOM   2262 C  CG2   . ILE D 1 20 ? 13.475  -2.538  -30.644  1.00 29.87  ? 521 ILE D CG2   1 
ATOM   2263 C  CD1   . ILE D 1 20 ? 15.708  -4.781  -30.183  1.00 10.52  ? 521 ILE D CD1   1 
ATOM   2264 N  N     . LYS D 1 21 ? 15.144  -0.010  -30.445  1.00 48.27  ? 522 LYS D N     1 
ATOM   2265 C  CA    . LYS D 1 21 ? 14.815  1.404   -30.605  1.00 51.04  ? 522 LYS D CA    1 
ATOM   2266 C  C     . LYS D 1 21 ? 13.481  1.623   -29.913  1.00 54.12  ? 522 LYS D C     1 
ATOM   2267 O  O     . LYS D 1 21 ? 12.691  0.689   -29.768  1.00 57.80  ? 522 LYS D O     1 
ATOM   2268 C  CB    . LYS D 1 21 ? 14.720  1.767   -32.082  1.00 48.77  ? 522 LYS D CB    1 
ATOM   2269 N  N     . LYS D 1 22 ? 13.225  2.853   -29.487  1.00 53.56  ? 523 LYS D N     1 
ATOM   2270 C  CA    . LYS D 1 22 ? 11.991  3.150   -28.773  1.00 52.94  ? 523 LYS D CA    1 
ATOM   2271 C  C     . LYS D 1 22 ? 10.780  3.352   -29.666  1.00 50.34  ? 523 LYS D C     1 
ATOM   2272 O  O     . LYS D 1 22 ? 9.753   2.693   -29.495  1.00 48.65  ? 523 LYS D O     1 
ATOM   2273 C  CB    . LYS D 1 22 ? 12.188  4.391   -27.906  1.00 58.86  ? 523 LYS D CB    1 
ATOM   2274 C  CG    . LYS D 1 22 ? 11.030  4.684   -26.974  1.00 65.10  ? 523 LYS D CG    1 
ATOM   2275 C  CD    . LYS D 1 22 ? 11.195  6.043   -26.307  1.00 71.34  ? 523 LYS D CD    1 
ATOM   2276 C  CE    . LYS D 1 22 ? 11.022  7.174   -27.312  1.00 68.43  ? 523 LYS D CE    1 
ATOM   2277 N  NZ    . LYS D 1 22 ? 9.643   7.176   -27.888  1.00 68.55  ? 523 LYS D NZ    1 
ATOM   2278 N  N     . ASP D 1 23 ? 10.897  4.266   -30.620  1.00 48.13  ? 524 ASP D N     1 
ATOM   2279 C  CA    . ASP D 1 23 ? 9.783   4.553   -31.499  1.00 47.50  ? 524 ASP D CA    1 
ATOM   2280 C  C     . ASP D 1 23 ? 9.380   3.350   -32.328  1.00 45.40  ? 524 ASP D C     1 
ATOM   2281 O  O     . ASP D 1 23 ? 8.272   3.297   -32.863  1.00 41.52  ? 524 ASP D O     1 
ATOM   2282 C  CB    . ASP D 1 23 ? 10.115  5.720   -32.413  1.00 55.24  ? 524 ASP D CB    1 
ATOM   2283 C  CG    . ASP D 1 23 ? 8.922   6.153   -33.226  1.00 66.57  ? 524 ASP D CG    1 
ATOM   2284 O  OD1   . ASP D 1 23 ? 7.854   6.372   -32.613  1.00 69.29  ? 524 ASP D OD1   1 
ATOM   2285 O  OD2   . ASP D 1 23 ? 9.043   6.269   -34.467  1.00 73.11  ? 524 ASP D OD2   1 
ATOM   2286 N  N     . GLU D 1 24 ? 10.290  2.391   -32.446  1.00 41.62  ? 525 GLU D N     1 
ATOM   2287 C  CA    . GLU D 1 24 ? 10.013  1.175   -33.195  1.00 38.90  ? 525 GLU D CA    1 
ATOM   2288 C  C     . GLU D 1 24 ? 9.237   0.266   -32.261  1.00 36.09  ? 525 GLU D C     1 
ATOM   2289 O  O     . GLU D 1 24 ? 8.294   -0.422  -32.657  1.00 27.56  ? 525 GLU D O     1 
ATOM   2290 C  CB    . GLU D 1 24 ? 11.317  0.501   -33.610  1.00 42.60  ? 525 GLU D CB    1 
ATOM   2291 C  CG    . GLU D 1 24 ? 12.048  1.181   -34.763  1.00 48.91  ? 525 GLU D CG    1 
ATOM   2292 C  CD    . GLU D 1 24 ? 11.196  1.280   -36.014  1.00 54.01  ? 525 GLU D CD    1 
ATOM   2293 O  OE1   . GLU D 1 24 ? 10.331  0.401   -36.213  1.00 56.68  ? 525 GLU D OE1   1 
ATOM   2294 O  OE2   . GLU D 1 24 ? 11.397  2.226   -36.805  1.00 54.78  ? 525 GLU D OE2   1 
ATOM   2295 N  N     . LEU D 1 25 ? 9.651   0.293   -31.003  1.00 36.21  ? 526 LEU D N     1 
ATOM   2296 C  CA    . LEU D 1 25 ? 9.026   -0.498  -29.963  1.00 37.34  ? 526 LEU D CA    1 
ATOM   2297 C  C     . LEU D 1 25 ? 7.573   -0.094  -29.772  1.00 36.00  ? 526 LEU D C     1 
ATOM   2298 O  O     . LEU D 1 25 ? 6.734   -0.932  -29.460  1.00 35.69  ? 526 LEU D O     1 
ATOM   2299 C  CB    . LEU D 1 25 ? 9.795   -0.331  -28.651  1.00 39.77  ? 526 LEU D CB    1 
ATOM   2300 C  CG    . LEU D 1 25 ? 9.239   -1.074  -27.435  1.00 40.63  ? 526 LEU D CG    1 
ATOM   2301 C  CD1   . LEU D 1 25 ? 8.851   -2.494  -27.819  1.00 34.38  ? 526 LEU D CD1   1 
ATOM   2302 C  CD2   . LEU D 1 25 ? 10.284  -1.067  -26.327  1.00 38.21  ? 526 LEU D CD2   1 
ATOM   2303 N  N     . LYS D 1 26 ? 7.277   1.190   -29.950  1.00 35.39  ? 527 LYS D N     1 
ATOM   2304 C  CA    . LYS D 1 26 ? 5.908   1.666   -29.809  1.00 33.81  ? 527 LYS D CA    1 
ATOM   2305 C  C     . LYS D 1 26 ? 5.067   1.242   -31.009  1.00 36.11  ? 527 LYS D C     1 
ATOM   2306 O  O     . LYS D 1 26 ? 3.918   0.834   -30.851  1.00 37.53  ? 527 LYS D O     1 
ATOM   2307 C  CB    . LYS D 1 26 ? 5.869   3.185   -29.677  1.00 32.49  ? 527 LYS D CB    1 
ATOM   2308 C  CG    . LYS D 1 26 ? 4.457   3.746   -29.529  1.00 35.05  ? 527 LYS D CG    1 
ATOM   2309 C  CD    . LYS D 1 26 ? 4.451   5.248   -29.227  1.00 45.89  ? 527 LYS D CD    1 
ATOM   2310 C  CE    . LYS D 1 26 ? 5.195   5.571   -27.922  1.00 56.10  ? 527 LYS D CE    1 
ATOM   2311 N  NZ    . LYS D 1 26 ? 5.160   7.013   -27.512  1.00 56.74  ? 527 LYS D NZ    1 
ATOM   2312 N  N     . LYS D 1 27 ? 5.639   1.339   -32.207  1.00 35.94  ? 528 LYS D N     1 
ATOM   2313 C  CA    . LYS D 1 27 ? 4.929   0.952   -33.425  1.00 33.90  ? 528 LYS D CA    1 
ATOM   2314 C  C     . LYS D 1 27 ? 4.579   -0.532  -33.362  1.00 30.67  ? 528 LYS D C     1 
ATOM   2315 O  O     . LYS D 1 27 ? 3.474   -0.947  -33.706  1.00 21.41  ? 528 LYS D O     1 
ATOM   2316 C  CB    . LYS D 1 27 ? 5.795   1.209   -34.669  1.00 37.36  ? 528 LYS D CB    1 
ATOM   2317 C  CG    . LYS D 1 27 ? 6.129   2.671   -34.971  1.00 31.11  ? 528 LYS D CG    1 
ATOM   2318 C  CD    . LYS D 1 27 ? 6.679   2.818   -36.393  1.00 30.84  ? 528 LYS D CD    1 
ATOM   2319 C  CE    . LYS D 1 27 ? 6.850   4.280   -36.798  1.00 32.63  ? 528 LYS D CE    1 
ATOM   2320 N  NZ    . LYS D 1 27 ? 7.161   4.461   -38.247  1.00 22.97  ? 528 LYS D NZ    1 
ATOM   2321 N  N     . SER D 1 28 ? 5.537   -1.331  -32.917  1.00 28.89  ? 529 SER D N     1 
ATOM   2322 C  CA    . SER D 1 28 ? 5.317   -2.761  -32.817  1.00 34.57  ? 529 SER D CA    1 
ATOM   2323 C  C     . SER D 1 28 ? 4.226   -3.067  -31.790  1.00 33.05  ? 529 SER D C     1 
ATOM   2324 O  O     . SER D 1 28 ? 3.415   -3.975  -31.982  1.00 31.00  ? 529 SER D O     1 
ATOM   2325 C  CB    . SER D 1 28 ? 6.625   -3.469  -32.437  1.00 38.99  ? 529 SER D CB    1 
ATOM   2326 O  OG    . SER D 1 28 ? 7.636   -3.251  -33.410  1.00 39.41  ? 529 SER D OG    1 
ATOM   2327 N  N     . LEU D 1 29 ? 4.206   -2.308  -30.699  1.00 31.13  ? 530 LEU D N     1 
ATOM   2328 C  CA    . LEU D 1 29 ? 3.208   -2.511  -29.651  1.00 31.74  ? 530 LEU D CA    1 
ATOM   2329 C  C     . LEU D 1 29 ? 1.821   -2.129  -30.140  1.00 32.80  ? 530 LEU D C     1 
ATOM   2330 O  O     . LEU D 1 29 ? 0.837   -2.829  -29.883  1.00 34.48  ? 530 LEU D O     1 
ATOM   2331 C  CB    . LEU D 1 29 ? 3.556   -1.685  -28.410  1.00 30.22  ? 530 LEU D CB    1 
ATOM   2332 C  CG    . LEU D 1 29 ? 4.649   -2.228  -27.491  1.00 23.70  ? 530 LEU D CG    1 
ATOM   2333 C  CD1   . LEU D 1 29 ? 4.837   -1.267  -26.347  1.00 16.98  ? 530 LEU D CD1   1 
ATOM   2334 C  CD2   . LEU D 1 29 ? 4.265   -3.602  -26.969  1.00 17.22  ? 530 LEU D CD2   1 
ATOM   2335 N  N     . HIS D 1 30 ? 1.750   -1.002  -30.836  1.00 29.72  ? 531 HIS D N     1 
ATOM   2336 C  CA    . HIS D 1 30 ? 0.494   -0.529  -31.384  1.00 28.26  ? 531 HIS D CA    1 
ATOM   2337 C  C     . HIS D 1 30 ? -0.002  -1.579  -32.362  1.00 23.92  ? 531 HIS D C     1 
ATOM   2338 O  O     . HIS D 1 30 ? -1.195  -1.785  -32.505  1.00 18.38  ? 531 HIS D O     1 
ATOM   2339 C  CB    . HIS D 1 30 ? 0.709   0.798   -32.108  1.00 32.46  ? 531 HIS D CB    1 
ATOM   2340 C  CG    . HIS D 1 30 ? -0.552  1.418   -32.617  1.00 31.90  ? 531 HIS D CG    1 
ATOM   2341 N  ND1   . HIS D 1 30 ? -1.380  0.787   -33.518  1.00 28.77  ? 531 HIS D ND1   1 
ATOM   2342 C  CD2   . HIS D 1 30 ? -1.123  2.618   -32.355  1.00 32.57  ? 531 HIS D CD2   1 
ATOM   2343 C  CE1   . HIS D 1 30 ? -2.406  1.571   -33.791  1.00 31.34  ? 531 HIS D CE1   1 
ATOM   2344 N  NE2   . HIS D 1 30 ? -2.275  2.688   -33.100  1.00 30.43  ? 531 HIS D NE2   1 
ATOM   2345 N  N     . ALA D 1 31 ? 0.940   -2.239  -33.029  1.00 24.22  ? 532 ALA D N     1 
ATOM   2346 C  CA    . ALA D 1 31 ? 0.636   -3.288  -33.994  1.00 29.96  ? 532 ALA D CA    1 
ATOM   2347 C  C     . ALA D 1 31 ? -0.079  -4.471  -33.327  1.00 34.58  ? 532 ALA D C     1 
ATOM   2348 O  O     . ALA D 1 31 ? -1.196  -4.851  -33.700  1.00 32.79  ? 532 ALA D O     1 
ATOM   2349 C  CB    . ALA D 1 31 ? 1.924   -3.762  -34.639  1.00 27.54  ? 532 ALA D CB    1 
ATOM   2350 N  N     . ILE D 1 32 ? 0.588   -5.051  -32.338  1.00 38.89  ? 533 ILE D N     1 
ATOM   2351 C  CA    . ILE D 1 32 ? 0.054   -6.179  -31.597  1.00 41.01  ? 533 ILE D CA    1 
ATOM   2352 C  C     . ILE D 1 32 ? -1.282  -5.922  -30.913  1.00 42.50  ? 533 ILE D C     1 
ATOM   2353 O  O     . ILE D 1 32 ? -2.220  -6.694  -31.075  1.00 46.07  ? 533 ILE D O     1 
ATOM   2354 C  CB    . ILE D 1 32 ? 1.039   -6.629  -30.507  1.00 39.95  ? 533 ILE D CB    1 
ATOM   2355 C  CG1   . ILE D 1 32 ? 2.129   -7.499  -31.119  1.00 38.71  ? 533 ILE D CG1   1 
ATOM   2356 C  CG2   . ILE D 1 32 ? 0.300   -7.378  -29.409  1.00 40.94  ? 533 ILE D CG2   1 
ATOM   2357 C  CD1   . ILE D 1 32 ? 3.015   -8.152  -30.085  1.00 42.92  ? 533 ILE D CD1   1 
ATOM   2358 N  N     . PHE D 1 33 ? -1.362  -4.839  -30.146  1.00 41.88  ? 534 PHE D N     1 
ATOM   2359 C  CA    . PHE D 1 33 ? -2.566  -4.524  -29.381  1.00 44.59  ? 534 PHE D CA    1 
ATOM   2360 C  C     . PHE D 1 33 ? -3.771  -3.881  -30.079  1.00 48.36  ? 534 PHE D C     1 
ATOM   2361 O  O     . PHE D 1 33 ? -4.891  -3.973  -29.571  1.00 51.91  ? 534 PHE D O     1 
ATOM   2362 C  CB    . PHE D 1 33 ? -2.169  -3.687  -28.156  1.00 38.48  ? 534 PHE D CB    1 
ATOM   2363 C  CG    . PHE D 1 33 ? -1.265  -4.416  -27.186  1.00 28.91  ? 534 PHE D CG    1 
ATOM   2364 C  CD1   . PHE D 1 33 ? -1.706  -5.565  -26.528  1.00 17.83  ? 534 PHE D CD1   1 
ATOM   2365 C  CD2   . PHE D 1 33 ? 0.032   -3.960  -26.945  1.00 25.24  ? 534 PHE D CD2   1 
ATOM   2366 C  CE1   . PHE D 1 33 ? -0.876  -6.240  -25.658  1.00 17.40  ? 534 PHE D CE1   1 
ATOM   2367 C  CE2   . PHE D 1 33 ? 0.873   -4.632  -26.072  1.00 22.70  ? 534 PHE D CE2   1 
ATOM   2368 C  CZ    . PHE D 1 33 ? 0.416   -5.775  -25.428  1.00 22.47  ? 534 PHE D CZ    1 
ATOM   2369 N  N     . SER D 1 34 ? -3.557  -3.235  -31.222  1.00 51.64  ? 535 SER D N     1 
ATOM   2370 C  CA    . SER D 1 34 ? -4.653  -2.592  -31.956  1.00 50.78  ? 535 SER D CA    1 
ATOM   2371 C  C     . SER D 1 34 ? -5.850  -3.513  -32.079  1.00 48.13  ? 535 SER D C     1 
ATOM   2372 O  O     . SER D 1 34 ? -6.995  -3.098  -31.914  1.00 46.01  ? 535 SER D O     1 
ATOM   2373 C  CB    . SER D 1 34 ? -4.204  -2.201  -33.363  1.00 52.53  ? 535 SER D CB    1 
ATOM   2374 O  OG    . SER D 1 34 ? -3.229  -1.181  -33.322  1.00 62.27  ? 535 SER D OG    1 
ATOM   2375 N  N     . ARG D 1 35 ? -5.561  -4.771  -32.377  1.00 45.49  ? 536 ARG D N     1 
ATOM   2376 C  CA    . ARG D 1 35 ? -6.580  -5.787  -32.548  1.00 44.44  ? 536 ARG D CA    1 
ATOM   2377 C  C     . ARG D 1 35 ? -7.533  -5.921  -31.360  1.00 43.37  ? 536 ARG D C     1 
ATOM   2378 O  O     . ARG D 1 35 ? -8.621  -6.473  -31.482  1.00 42.04  ? 536 ARG D O     1 
ATOM   2379 C  CB    . ARG D 1 35 ? -5.886  -7.116  -32.838  1.00 44.38  ? 536 ARG D CB    1 
ATOM   2380 C  CG    . ARG D 1 35 ? -4.887  -6.995  -33.984  1.00 49.31  ? 536 ARG D CG    1 
ATOM   2381 C  CD    . ARG D 1 35 ? -4.441  -8.347  -34.540  1.00 61.14  ? 536 ARG D CD    1 
ATOM   2382 N  NE    . ARG D 1 35 ? -3.254  -8.900  -33.880  1.00 61.10  ? 536 ARG D NE    1 
ATOM   2383 C  CZ    . ARG D 1 35 ? -3.246  -9.469  -32.679  1.00 54.02  ? 536 ARG D CZ    1 
ATOM   2384 N  NH1   . ARG D 1 35 ? -4.369  -9.574  -31.974  1.00 48.62  ? 536 ARG D NH1   1 
ATOM   2385 N  NH2   . ARG D 1 35 ? -2.108  -9.931  -32.185  1.00 48.56  ? 536 ARG D NH2   1 
ATOM   2386 N  N     . PHE D 1 36 ? -7.137  -5.388  -30.215  1.00 45.39  ? 537 PHE D N     1 
ATOM   2387 C  CA    . PHE D 1 36 ? -7.958  -5.490  -29.018  1.00 46.80  ? 537 PHE D CA    1 
ATOM   2388 C  C     . PHE D 1 36 ? -8.875  -4.308  -28.790  1.00 52.32  ? 537 PHE D C     1 
ATOM   2389 O  O     . PHE D 1 36 ? -9.403  -4.125  -27.697  1.00 55.50  ? 537 PHE D O     1 
ATOM   2390 C  CB    . PHE D 1 36 ? -7.056  -5.680  -27.807  1.00 38.74  ? 537 PHE D CB    1 
ATOM   2391 C  CG    . PHE D 1 36 ? -6.301  -6.961  -27.832  1.00 26.40  ? 537 PHE D CG    1 
ATOM   2392 C  CD1   . PHE D 1 36 ? -6.951  -8.158  -27.597  1.00 15.88  ? 537 PHE D CD1   1 
ATOM   2393 C  CD2   . PHE D 1 36 ? -4.946  -6.975  -28.117  1.00 21.54  ? 537 PHE D CD2   1 
ATOM   2394 C  CE1   . PHE D 1 36 ? -6.263  -9.354  -27.645  1.00 20.16  ? 537 PHE D CE1   1 
ATOM   2395 C  CE2   . PHE D 1 36 ? -4.249  -8.167  -28.166  1.00 23.64  ? 537 PHE D CE2   1 
ATOM   2396 C  CZ    . PHE D 1 36 ? -4.909  -9.362  -27.929  1.00 21.20  ? 537 PHE D CZ    1 
ATOM   2397 N  N     . GLY D 1 37 ? -9.079  -3.514  -29.830  1.00 58.18  ? 538 GLY D N     1 
ATOM   2398 C  CA    . GLY D 1 37 ? -9.934  -2.350  -29.706  1.00 61.36  ? 538 GLY D CA    1 
ATOM   2399 C  C     . GLY D 1 37 ? -9.118  -1.135  -30.073  1.00 63.64  ? 538 GLY D C     1 
ATOM   2400 O  O     . GLY D 1 37 ? -7.988  -1.271  -30.547  1.00 67.05  ? 538 GLY D O     1 
ATOM   2401 N  N     . GLN D 1 38 ? -9.668  0.053   -29.866  1.00 63.29  ? 539 GLN D N     1 
ATOM   2402 C  CA    . GLN D 1 38 ? -8.920  1.250   -30.201  1.00 63.48  ? 539 GLN D CA    1 
ATOM   2403 C  C     . GLN D 1 38 ? -7.912  1.568   -29.102  1.00 61.08  ? 539 GLN D C     1 
ATOM   2404 O  O     . GLN D 1 38 ? -8.241  1.577   -27.920  1.00 60.55  ? 539 GLN D O     1 
ATOM   2405 C  CB    . GLN D 1 38 ? -9.861  2.440   -30.419  1.00 63.99  ? 539 GLN D CB    1 
ATOM   2406 C  CG    . GLN D 1 38 ? -10.564 2.931   -29.169  1.00 69.46  ? 539 GLN D CG    1 
ATOM   2407 C  CD    . GLN D 1 38 ? -11.186 4.308   -29.350  1.00 72.18  ? 539 GLN D CD    1 
ATOM   2408 O  OE1   . GLN D 1 38 ? -10.497 5.277   -29.688  1.00 69.06  ? 539 GLN D OE1   1 
ATOM   2409 N  NE2   . GLN D 1 38 ? -12.494 4.401   -29.122  1.00 71.43  ? 539 GLN D NE2   1 
ATOM   2410 N  N     . ILE D 1 39 ? -6.673  1.810   -29.507  1.00 59.75  ? 540 ILE D N     1 
ATOM   2411 C  CA    . ILE D 1 39 ? -5.608  2.145   -28.574  1.00 57.36  ? 540 ILE D CA    1 
ATOM   2412 C  C     . ILE D 1 39 ? -5.560  3.669   -28.475  1.00 55.92  ? 540 ILE D C     1 
ATOM   2413 O  O     . ILE D 1 39 ? -5.113  4.348   -29.403  1.00 55.02  ? 540 ILE D O     1 
ATOM   2414 C  CB    . ILE D 1 39 ? -4.242  1.624   -29.091  1.00 58.45  ? 540 ILE D CB    1 
ATOM   2415 C  CG1   . ILE D 1 39 ? -4.317  0.108   -29.322  1.00 56.21  ? 540 ILE D CG1   1 
ATOM   2416 C  CG2   . ILE D 1 39 ? -3.133  1.983   -28.107  1.00 54.26  ? 540 ILE D CG2   1 
ATOM   2417 C  CD1   . ILE D 1 39 ? -3.130  -0.475  -30.077  1.00 43.55  ? 540 ILE D CD1   1 
ATOM   2418 N  N     . LEU D 1 40 ? -6.029  4.212   -27.359  1.00 52.48  ? 541 LEU D N     1 
ATOM   2419 C  CA    . LEU D 1 40 ? -6.021  5.655   -27.191  1.00 52.41  ? 541 LEU D CA    1 
ATOM   2420 C  C     . LEU D 1 40 ? -4.614  6.222   -27.027  1.00 50.84  ? 541 LEU D C     1 
ATOM   2421 O  O     . LEU D 1 40 ? -4.423  7.434   -27.078  1.00 52.86  ? 541 LEU D O     1 
ATOM   2422 C  CB    . LEU D 1 40 ? -6.910  6.055   -26.012  1.00 53.93  ? 541 LEU D CB    1 
ATOM   2423 C  CG    . LEU D 1 40 ? -8.400  5.771   -26.254  1.00 53.55  ? 541 LEU D CG    1 
ATOM   2424 C  CD1   . LEU D 1 40 ? -9.220  6.148   -25.024  1.00 46.16  ? 541 LEU D CD1   1 
ATOM   2425 C  CD2   . LEU D 1 40 ? -8.867  6.544   -27.485  1.00 47.30  ? 541 LEU D CD2   1 
ATOM   2426 N  N     . ASP D 1 41 ? -3.635  5.342   -26.835  1.00 50.08  ? 542 ASP D N     1 
ATOM   2427 C  CA    . ASP D 1 41 ? -2.234  5.744   -26.712  1.00 45.83  ? 542 ASP D CA    1 
ATOM   2428 C  C     . ASP D 1 41 ? -1.307  4.667   -26.156  1.00 44.00  ? 542 ASP D C     1 
ATOM   2429 O  O     . ASP D 1 41 ? -1.748  3.720   -25.511  1.00 43.36  ? 542 ASP D O     1 
ATOM   2430 C  CB    . ASP D 1 41 ? -2.100  6.992   -25.848  1.00 48.34  ? 542 ASP D CB    1 
ATOM   2431 C  CG    . ASP D 1 41 ? -0.679  7.503   -25.800  1.00 54.35  ? 542 ASP D CG    1 
ATOM   2432 O  OD1   . ASP D 1 41 ? -0.087  7.679   -26.884  1.00 58.48  ? 542 ASP D OD1   1 
ATOM   2433 O  OD2   . ASP D 1 41 ? -0.154  7.726   -24.688  1.00 55.69  ? 542 ASP D OD2   1 
ATOM   2434 N  N     . ILE D 1 42 ? -0.014  4.826   -26.431  1.00 42.82  ? 543 ILE D N     1 
ATOM   2435 C  CA    . ILE D 1 42 ? 1.033   3.922   -25.956  1.00 40.06  ? 543 ILE D CA    1 
ATOM   2436 C  C     . ILE D 1 42 ? 2.183   4.807   -25.515  1.00 44.14  ? 543 ILE D C     1 
ATOM   2437 O  O     . ILE D 1 42 ? 2.571   5.723   -26.248  1.00 42.26  ? 543 ILE D O     1 
ATOM   2438 C  CB    . ILE D 1 42 ? 1.532   2.986   -27.059  1.00 33.88  ? 543 ILE D CB    1 
ATOM   2439 C  CG1   . ILE D 1 42 ? 0.460   1.939   -27.354  1.00 37.95  ? 543 ILE D CG1   1 
ATOM   2440 C  CG2   . ILE D 1 42 ? 2.830   2.318   -26.634  1.00 22.16  ? 543 ILE D CG2   1 
ATOM   2441 C  CD1   . ILE D 1 42 ? 0.786   1.036   -28.516  1.00 43.99  ? 543 ILE D CD1   1 
ATOM   2442 N  N     . LEU D 1 43 ? 2.725   4.542   -24.326  1.00 44.71  ? 544 LEU D N     1 
ATOM   2443 C  CA    . LEU D 1 43 ? 3.815   5.359   -23.812  1.00 46.63  ? 544 LEU D CA    1 
ATOM   2444 C  C     . LEU D 1 43 ? 5.112   4.587   -23.604  1.00 47.59  ? 544 LEU D C     1 
ATOM   2445 O  O     . LEU D 1 43 ? 5.101   3.465   -23.089  1.00 43.41  ? 544 LEU D O     1 
ATOM   2446 C  CB    . LEU D 1 43 ? 3.396   6.017   -22.492  1.00 51.41  ? 544 LEU D CB    1 
ATOM   2447 C  CG    . LEU D 1 43 ? 3.797   7.482   -22.245  1.00 55.90  ? 544 LEU D CG    1 
ATOM   2448 C  CD1   . LEU D 1 43 ? 3.430   7.862   -20.812  1.00 54.83  ? 544 LEU D CD1   1 
ATOM   2449 C  CD2   . LEU D 1 43 ? 5.291   7.689   -22.480  1.00 53.04  ? 544 LEU D CD2   1 
ATOM   2450 N  N     . VAL D 1 44 ? 6.218   5.209   -24.027  1.00 49.36  ? 545 VAL D N     1 
ATOM   2451 C  CA    . VAL D 1 44 ? 7.578   4.668   -23.897  1.00 52.37  ? 545 VAL D CA    1 
ATOM   2452 C  C     . VAL D 1 44 ? 8.569   5.848   -23.917  1.00 52.03  ? 545 VAL D C     1 
ATOM   2453 O  O     . VAL D 1 44 ? 8.523   6.692   -24.810  1.00 49.29  ? 545 VAL D O     1 
ATOM   2454 C  CB    . VAL D 1 44 ? 7.943   3.681   -25.050  1.00 49.34  ? 545 VAL D CB    1 
ATOM   2455 C  CG1   . VAL D 1 44 ? 9.296   3.044   -24.784  1.00 46.99  ? 545 VAL D CG1   1 
ATOM   2456 C  CG2   . VAL D 1 44 ? 6.901   2.598   -25.167  1.00 47.37  ? 545 VAL D CG2   1 
ATOM   2457 N  N     . SER D 1 45 ? 9.454   5.903   -22.925  1.00 55.47  ? 546 SER D N     1 
ATOM   2458 C  CA    . SER D 1 45 ? 10.438  6.979   -22.813  1.00 59.37  ? 546 SER D CA    1 
ATOM   2459 C  C     . SER D 1 45 ? 11.797  6.405   -22.475  1.00 65.09  ? 546 SER D C     1 
ATOM   2460 O  O     . SER D 1 45 ? 11.882  5.412   -21.754  1.00 70.13  ? 546 SER D O     1 
ATOM   2461 C  CB    . SER D 1 45 ? 10.052  7.936   -21.697  1.00 58.90  ? 546 SER D CB    1 
ATOM   2462 O  OG    . SER D 1 45 ? 10.221  7.298   -20.447  1.00 52.11  ? 546 SER D OG    1 
ATOM   2463 N  N     . ARG D 1 46 ? 12.851  7.057   -22.965  1.00 68.19  ? 547 ARG D N     1 
ATOM   2464 C  CA    . ARG D 1 46 ? 14.231  6.621   -22.736  1.00 71.05  ? 547 ARG D CA    1 
ATOM   2465 C  C     . ARG D 1 46 ? 14.605  6.429   -21.262  1.00 73.56  ? 547 ARG D C     1 
ATOM   2466 O  O     . ARG D 1 46 ? 15.788  6.409   -20.919  1.00 72.17  ? 547 ARG D O     1 
ATOM   2467 C  CB    . ARG D 1 46 ? 15.201  7.609   -23.387  1.00 67.63  ? 547 ARG D CB    1 
ATOM   2468 N  N     . SER D 1 47 ? 13.603  6.288   -20.397  1.00 77.04  ? 548 SER D N     1 
ATOM   2469 C  CA    . SER D 1 47 ? 13.839  6.090   -18.971  1.00 80.81  ? 548 SER D CA    1 
ATOM   2470 C  C     . SER D 1 47 ? 14.403  4.695   -18.685  1.00 81.42  ? 548 SER D C     1 
ATOM   2471 O  O     . SER D 1 47 ? 14.008  4.023   -17.727  1.00 81.05  ? 548 SER D O     1 
ATOM   2472 C  CB    . SER D 1 47 ? 12.537  6.291   -18.195  1.00 82.06  ? 548 SER D CB    1 
ATOM   2473 O  OG    . SER D 1 47 ? 12.742  6.095   -16.807  1.00 83.51  ? 548 SER D OG    1 
ATOM   2474 N  N     . MET D 1 50 ? 11.491  3.746   -17.165  1.00 81.98  ? 551 MET D N     1 
ATOM   2475 C  CA    . MET D 1 50 ? 10.783  2.990   -18.188  1.00 78.70  ? 551 MET D CA    1 
ATOM   2476 C  C     . MET D 1 50 ? 11.711  2.474   -19.277  1.00 73.47  ? 551 MET D C     1 
ATOM   2477 O  O     . MET D 1 50 ? 11.656  2.904   -20.430  1.00 70.85  ? 551 MET D O     1 
ATOM   2478 C  CB    . MET D 1 50 ? 9.678   3.841   -18.810  1.00 82.10  ? 551 MET D CB    1 
ATOM   2479 C  CG    . MET D 1 50 ? 9.000   3.194   -19.998  1.00 84.72  ? 551 MET D CG    1 
ATOM   2480 S  SD    . MET D 1 50 ? 7.399   3.924   -20.316  1.00 93.27  ? 551 MET D SD    1 
ATOM   2481 C  CE    . MET D 1 50 ? 7.827   5.672   -20.465  1.00 93.41  ? 551 MET D CE    1 
ATOM   2482 N  N     . ARG D 1 51 ? 12.578  1.554   -18.886  1.00 67.80  ? 552 ARG D N     1 
ATOM   2483 C  CA    . ARG D 1 51 ? 13.492  0.943   -19.820  1.00 61.29  ? 552 ARG D CA    1 
ATOM   2484 C  C     . ARG D 1 51 ? 13.252  -0.554  -19.727  1.00 59.13  ? 552 ARG D C     1 
ATOM   2485 O  O     . ARG D 1 51 ? 13.844  -1.252  -18.897  1.00 55.81  ? 552 ARG D O     1 
ATOM   2486 C  CB    . ARG D 1 51 ? 14.934  1.283   -19.472  1.00 53.39  ? 552 ARG D CB    1 
ATOM   2487 C  CG    . ARG D 1 51 ? 15.895  0.802   -20.516  1.00 52.59  ? 552 ARG D CG    1 
ATOM   2488 C  CD    . ARG D 1 51 ? 17.210  1.513   -20.390  1.00 63.47  ? 552 ARG D CD    1 
ATOM   2489 N  NE    . ARG D 1 51 ? 17.067  2.947   -20.624  1.00 68.06  ? 552 ARG D NE    1 
ATOM   2490 C  CZ    . ARG D 1 51 ? 18.070  3.819   -20.565  1.00 68.53  ? 552 ARG D CZ    1 
ATOM   2491 N  NH1   . ARG D 1 51 ? 19.297  3.405   -20.278  1.00 67.92  ? 552 ARG D NH1   1 
ATOM   2492 N  NH2   . ARG D 1 51 ? 17.848  5.106   -20.791  1.00 67.66  ? 552 ARG D NH2   1 
ATOM   2493 N  N     . GLY D 1 52 ? 12.350  -1.027  -20.580  1.00 54.85  ? 553 GLY D N     1 
ATOM   2494 C  CA    . GLY D 1 52 ? 11.997  -2.430  -20.612  1.00 47.99  ? 553 GLY D CA    1 
ATOM   2495 C  C     . GLY D 1 52 ? 10.532  -2.507  -20.278  1.00 42.99  ? 553 GLY D C     1 
ATOM   2496 O  O     . GLY D 1 52 ? 9.924   -3.569  -20.292  1.00 44.67  ? 553 GLY D O     1 
ATOM   2497 N  N     . GLN D 1 53 ? 9.968   -1.345  -19.988  1.00 38.95  ? 554 GLN D N     1 
ATOM   2498 C  CA    . GLN D 1 53 ? 8.573   -1.237  -19.616  1.00 36.39  ? 554 GLN D CA    1 
ATOM   2499 C  C     . GLN D 1 53 ? 7.856   -0.336  -20.597  1.00 35.51  ? 554 GLN D C     1 
ATOM   2500 O  O     . GLN D 1 53 ? 8.495   0.400   -21.342  1.00 43.18  ? 554 GLN D O     1 
ATOM   2501 C  CB    . GLN D 1 53 ? 8.466   -0.613  -18.233  1.00 43.72  ? 554 GLN D CB    1 
ATOM   2502 C  CG    . GLN D 1 53 ? 9.374   -1.214  -17.182  1.00 51.27  ? 554 GLN D CG    1 
ATOM   2503 C  CD    . GLN D 1 53 ? 9.461   -0.342  -15.938  1.00 54.03  ? 554 GLN D CD    1 
ATOM   2504 O  OE1   . GLN D 1 53 ? 9.240   -0.810  -14.823  1.00 51.83  ? 554 GLN D OE1   1 
ATOM   2505 N  NE2   . GLN D 1 53 ? 9.788   0.934   -16.129  1.00 54.93  ? 554 GLN D NE2   1 
ATOM   2506 N  N     . ALA D 1 54 ? 6.526   -0.378  -20.578  1.00 31.11  ? 555 ALA D N     1 
ATOM   2507 C  CA    . ALA D 1 54 ? 5.700   0.458   -21.450  1.00 23.75  ? 555 ALA D CA    1 
ATOM   2508 C  C     . ALA D 1 54 ? 4.244   0.397   -21.014  1.00 22.04  ? 555 ALA D C     1 
ATOM   2509 O  O     . ALA D 1 54 ? 3.868   -0.450  -20.220  1.00 16.92  ? 555 ALA D O     1 
ATOM   2510 C  CB    . ALA D 1 54 ? 5.825   -0.001  -22.888  1.00 22.60  ? 555 ALA D CB    1 
ATOM   2511 N  N     . PHE D 1 55 ? 3.428   1.308   -21.526  1.00 29.71  ? 556 PHE D N     1 
ATOM   2512 C  CA    . PHE D 1 55 ? 2.012   1.319   -21.189  1.00 33.29  ? 556 PHE D CA    1 
ATOM   2513 C  C     . PHE D 1 55 ? 1.158   1.426   -22.440  1.00 37.42  ? 556 PHE D C     1 
ATOM   2514 O  O     . PHE D 1 55 ? 1.526   2.102   -23.407  1.00 33.06  ? 556 PHE D O     1 
ATOM   2515 C  CB    . PHE D 1 55 ? 1.671   2.492   -20.269  1.00 38.38  ? 556 PHE D CB    1 
ATOM   2516 C  CG    . PHE D 1 55 ? 2.347   2.438   -18.932  1.00 44.10  ? 556 PHE D CG    1 
ATOM   2517 C  CD1   . PHE D 1 55 ? 3.692   2.760   -18.801  1.00 47.89  ? 556 PHE D CD1   1 
ATOM   2518 C  CD2   . PHE D 1 55 ? 1.635   2.074   -17.796  1.00 45.59  ? 556 PHE D CD2   1 
ATOM   2519 C  CE1   . PHE D 1 55 ? 4.319   2.723   -17.555  1.00 44.02  ? 556 PHE D CE1   1 
ATOM   2520 C  CE2   . PHE D 1 55 ? 2.255   2.035   -16.550  1.00 44.23  ? 556 PHE D CE2   1 
ATOM   2521 C  CZ    . PHE D 1 55 ? 3.596   2.360   -16.432  1.00 43.58  ? 556 PHE D CZ    1 
ATOM   2522 N  N     . VAL D 1 56 ? 0.014   0.751   -22.411  1.00 40.84  ? 557 VAL D N     1 
ATOM   2523 C  CA    . VAL D 1 56 ? -0.928  0.782   -23.523  1.00 43.43  ? 557 VAL D CA    1 
ATOM   2524 C  C     . VAL D 1 56 ? -2.306  1.182   -23.002  1.00 41.56  ? 557 VAL D C     1 
ATOM   2525 O  O     . VAL D 1 56 ? -2.961  0.428   -22.282  1.00 38.37  ? 557 VAL D O     1 
ATOM   2526 C  CB    . VAL D 1 56 ? -1.023  -0.581  -24.226  1.00 44.21  ? 557 VAL D CB    1 
ATOM   2527 C  CG1   . VAL D 1 56 ? -2.024  -0.505  -25.373  1.00 40.71  ? 557 VAL D CG1   1 
ATOM   2528 C  CG2   . VAL D 1 56 ? 0.348   -0.987  -24.742  1.00 45.94  ? 557 VAL D CG2   1 
ATOM   2529 N  N     . ILE D 1 57 ? -2.731  2.379   -23.382  1.00 39.70  ? 558 ILE D N     1 
ATOM   2530 C  CA    . ILE D 1 57 ? -4.008  2.922   -22.955  1.00 39.13  ? 558 ILE D CA    1 
ATOM   2531 C  C     . ILE D 1 57 ? -5.156  2.629   -23.919  1.00 39.80  ? 558 ILE D C     1 
ATOM   2532 O  O     . ILE D 1 57 ? -5.175  3.104   -25.055  1.00 33.75  ? 558 ILE D O     1 
ATOM   2533 C  CB    . ILE D 1 57 ? -3.885  4.440   -22.745  1.00 34.48  ? 558 ILE D CB    1 
ATOM   2534 C  CG1   . ILE D 1 57 ? -2.756  4.717   -21.747  1.00 28.16  ? 558 ILE D CG1   1 
ATOM   2535 C  CG2   . ILE D 1 57 ? -5.208  5.010   -22.259  1.00 29.47  ? 558 ILE D CG2   1 
ATOM   2536 C  CD1   . ILE D 1 57 ? -2.442  6.178   -21.557  1.00 18.97  ? 558 ILE D CD1   1 
ATOM   2537 N  N     . PHE D 1 58 ? -6.118  1.847   -23.436  1.00 43.48  ? 559 PHE D N     1 
ATOM   2538 C  CA    . PHE D 1 58 ? -7.290  1.465   -24.213  1.00 48.06  ? 559 PHE D CA    1 
ATOM   2539 C  C     . PHE D 1 58 ? -8.475  2.400   -23.978  1.00 52.74  ? 559 PHE D C     1 
ATOM   2540 O  O     . PHE D 1 58 ? -8.470  3.207   -23.043  1.00 56.90  ? 559 PHE D O     1 
ATOM   2541 C  CB    . PHE D 1 58 ? -7.684  0.025   -23.864  1.00 42.23  ? 559 PHE D CB    1 
ATOM   2542 C  CG    . PHE D 1 58 ? -6.767  -1.009  -24.457  1.00 45.83  ? 559 PHE D CG    1 
ATOM   2543 C  CD1   . PHE D 1 58 ? -6.920  -1.419  -25.781  1.00 46.88  ? 559 PHE D CD1   1 
ATOM   2544 C  CD2   . PHE D 1 58 ? -5.728  -1.551  -23.711  1.00 44.69  ? 559 PHE D CD2   1 
ATOM   2545 C  CE1   . PHE D 1 58 ? -6.048  -2.352  -26.350  1.00 38.31  ? 559 PHE D CE1   1 
ATOM   2546 C  CE2   . PHE D 1 58 ? -4.857  -2.480  -24.270  1.00 34.72  ? 559 PHE D CE2   1 
ATOM   2547 C  CZ    . PHE D 1 58 ? -5.020  -2.879  -25.590  1.00 36.53  ? 559 PHE D CZ    1 
ATOM   2548 N  N     . LYS D 1 59 ? -9.480  2.303   -24.846  1.00 54.54  ? 560 LYS D N     1 
ATOM   2549 C  CA    . LYS D 1 59 ? -10.684 3.115   -24.709  1.00 55.01  ? 560 LYS D CA    1 
ATOM   2550 C  C     . LYS D 1 59 ? -11.509 2.421   -23.638  1.00 56.67  ? 560 LYS D C     1 
ATOM   2551 O  O     . LYS D 1 59 ? -11.851 3.010   -22.614  1.00 53.81  ? 560 LYS D O     1 
ATOM   2552 C  CB    . LYS D 1 59 ? -11.453 3.152   -26.017  1.00 49.87  ? 560 LYS D CB    1 
ATOM   2553 N  N     . GLU D 1 60 ? -11.805 1.150   -23.886  1.00 60.34  ? 561 GLU D N     1 
ATOM   2554 C  CA    . GLU D 1 60 ? -12.573 0.333   -22.959  1.00 59.63  ? 561 GLU D CA    1 
ATOM   2555 C  C     . GLU D 1 60 ? -11.642 -0.518  -22.102  1.00 58.25  ? 561 GLU D C     1 
ATOM   2556 O  O     . GLU D 1 60 ? -10.579 -0.957  -22.550  1.00 54.67  ? 561 GLU D O     1 
ATOM   2557 C  CB    . GLU D 1 60 ? -13.520 -0.583  -23.730  1.00 61.74  ? 561 GLU D CB    1 
ATOM   2558 C  CG    . GLU D 1 60 ? -14.979 -0.416  -23.365  1.00 67.12  ? 561 GLU D CG    1 
ATOM   2559 C  CD    . GLU D 1 60 ? -15.480 0.989   -23.618  1.00 67.70  ? 561 GLU D CD    1 
ATOM   2560 O  OE1   . GLU D 1 60 ? -15.127 1.556   -24.674  1.00 70.67  ? 561 GLU D OE1   1 
ATOM   2561 O  OE2   . GLU D 1 60 ? -16.234 1.519   -22.773  1.00 66.97  ? 561 GLU D OE2   1 
ATOM   2562 N  N     . VAL D 1 61 ? -12.043 -0.737  -20.858  1.00 58.15  ? 562 VAL D N     1 
ATOM   2563 C  CA    . VAL D 1 61 ? -11.253 -1.553  -19.952  1.00 59.18  ? 562 VAL D CA    1 
ATOM   2564 C  C     . VAL D 1 61 ? -11.334 -2.972  -20.517  1.00 61.29  ? 562 VAL D C     1 
ATOM   2565 O  O     . VAL D 1 61 ? -10.353 -3.720  -20.510  1.00 63.52  ? 562 VAL D O     1 
ATOM   2566 C  CB    . VAL D 1 61 ? -11.844 -1.537  -18.517  1.00 54.07  ? 562 VAL D CB    1 
ATOM   2567 C  CG1   . VAL D 1 61 ? -10.884 -2.194  -17.551  1.00 53.49  ? 562 VAL D CG1   1 
ATOM   2568 C  CG2   . VAL D 1 61 ? -12.139 -0.115  -18.087  1.00 52.70  ? 562 VAL D CG2   1 
ATOM   2569 N  N     . SER D 1 62 ? -12.518 -3.324  -21.015  1.00 58.12  ? 563 SER D N     1 
ATOM   2570 C  CA    . SER D 1 62 ? -12.759 -4.634  -21.593  1.00 54.68  ? 563 SER D CA    1 
ATOM   2571 C  C     . SER D 1 62 ? -11.655 -4.953  -22.588  1.00 56.77  ? 563 SER D C     1 
ATOM   2572 O  O     . SER D 1 62 ? -11.024 -6.006  -22.514  1.00 60.90  ? 563 SER D O     1 
ATOM   2573 C  CB    . SER D 1 62 ? -14.114 -4.642  -22.291  1.00 54.46  ? 563 SER D CB    1 
ATOM   2574 O  OG    . SER D 1 62 ? -14.179 -3.621  -23.272  1.00 54.52  ? 563 SER D OG    1 
ATOM   2575 N  N     . SER D 1 63 ? -11.427 -4.033  -23.520  1.00 55.65  ? 564 SER D N     1 
ATOM   2576 C  CA    . SER D 1 63 ? -10.384 -4.197  -24.528  1.00 51.98  ? 564 SER D CA    1 
ATOM   2577 C  C     . SER D 1 63 ? -9.054  -4.467  -23.838  1.00 45.27  ? 564 SER D C     1 
ATOM   2578 O  O     . SER D 1 63 ? -8.318  -5.367  -24.219  1.00 42.86  ? 564 SER D O     1 
ATOM   2579 C  CB    . SER D 1 63 ? -10.262 -2.927  -25.378  1.00 56.98  ? 564 SER D CB    1 
ATOM   2580 O  OG    . SER D 1 63 ? -11.422 -2.712  -26.162  1.00 60.74  ? 564 SER D OG    1 
ATOM   2581 N  N     . ALA D 1 64 ? -8.751  -3.669  -22.823  1.00 40.96  ? 565 ALA D N     1 
ATOM   2582 C  CA    . ALA D 1 64 ? -7.518  -3.821  -22.070  1.00 37.17  ? 565 ALA D CA    1 
ATOM   2583 C  C     . ALA D 1 64 ? -7.490  -5.198  -21.438  1.00 39.58  ? 565 ALA D C     1 
ATOM   2584 O  O     . ALA D 1 64 ? -6.624  -6.014  -21.743  1.00 39.06  ? 565 ALA D O     1 
ATOM   2585 C  CB    . ALA D 1 64 ? -7.434  -2.753  -20.988  1.00 36.46  ? 565 ALA D CB    1 
ATOM   2586 N  N     . THR D 1 65 ? -8.449  -5.447  -20.552  1.00 42.00  ? 566 THR D N     1 
ATOM   2587 C  CA    . THR D 1 65 ? -8.551  -6.721  -19.850  1.00 41.88  ? 566 THR D CA    1 
ATOM   2588 C  C     . THR D 1 65 ? -8.425  -7.899  -20.796  1.00 40.81  ? 566 THR D C     1 
ATOM   2589 O  O     . THR D 1 65 ? -7.790  -8.902  -20.479  1.00 41.54  ? 566 THR D O     1 
ATOM   2590 C  CB    . THR D 1 65 ? -9.886  -6.819  -19.087  1.00 41.41  ? 566 THR D CB    1 
ATOM   2591 O  OG1   . THR D 1 65 ? -9.742  -6.199  -17.802  1.00 40.26  ? 566 THR D OG1   1 
ATOM   2592 C  CG2   . THR D 1 65 ? -10.313 -8.274  -18.920  1.00 38.54  ? 566 THR D CG2   1 
ATOM   2593 N  N     . ASN D 1 66 ? -9.032  -7.764  -21.964  1.00 41.60  ? 567 ASN D N     1 
ATOM   2594 C  CA    . ASN D 1 66 ? -8.997  -8.813  -22.965  1.00 44.52  ? 567 ASN D CA    1 
ATOM   2595 C  C     . ASN D 1 66 ? -7.562  -9.035  -23.468  1.00 44.76  ? 567 ASN D C     1 
ATOM   2596 O  O     . ASN D 1 66 ? -7.073  -10.170 -23.485  1.00 47.51  ? 567 ASN D O     1 
ATOM   2597 C  CB    . ASN D 1 66 ? -9.920  -8.431  -24.125  1.00 46.40  ? 567 ASN D CB    1 
ATOM   2598 C  CG    . ASN D 1 66 ? -10.387 -9.630  -24.913  1.00 50.89  ? 567 ASN D CG    1 
ATOM   2599 O  OD1   . ASN D 1 66 ? -11.024 -10.526 -24.364  1.00 54.35  ? 567 ASN D OD1   1 
ATOM   2600 N  ND2   . ASN D 1 66 ? -10.079 -9.653  -26.209  1.00 49.95  ? 567 ASN D ND2   1 
ATOM   2601 N  N     . ALA D 1 67 ? -6.896  -7.947  -23.864  1.00 40.15  ? 568 ALA D N     1 
ATOM   2602 C  CA    . ALA D 1 67 ? -5.526  -7.997  -24.374  1.00 33.15  ? 568 ALA D CA    1 
ATOM   2603 C  C     . ALA D 1 67 ? -4.579  -8.576  -23.342  1.00 34.76  ? 568 ALA D C     1 
ATOM   2604 O  O     . ALA D 1 67 ? -3.830  -9.512  -23.629  1.00 33.10  ? 568 ALA D O     1 
ATOM   2605 C  CB    . ALA D 1 67 ? -5.064  -6.615  -24.767  1.00 28.00  ? 568 ALA D CB    1 
ATOM   2606 N  N     . LEU D 1 68 ? -4.620  -8.014  -22.137  1.00 35.06  ? 569 LEU D N     1 
ATOM   2607 C  CA    . LEU D 1 68 ? -3.771  -8.469  -21.042  1.00 34.23  ? 569 LEU D CA    1 
ATOM   2608 C  C     . LEU D 1 68 ? -3.826  -9.978  -20.841  1.00 30.25  ? 569 LEU D C     1 
ATOM   2609 O  O     . LEU D 1 68 ? -2.803  -10.648 -20.876  1.00 27.33  ? 569 LEU D O     1 
ATOM   2610 C  CB    . LEU D 1 68 ? -4.166  -7.771  -19.739  1.00 34.38  ? 569 LEU D CB    1 
ATOM   2611 C  CG    . LEU D 1 68 ? -3.391  -8.230  -18.499  1.00 34.25  ? 569 LEU D CG    1 
ATOM   2612 C  CD1   . LEU D 1 68 ? -3.227  -7.068  -17.555  1.00 38.42  ? 569 LEU D CD1   1 
ATOM   2613 C  CD2   . LEU D 1 68 ? -4.108  -9.383  -17.814  1.00 32.02  ? 569 LEU D CD2   1 
ATOM   2614 N  N     . ARG D 1 69 ? -5.019  -10.512 -20.622  1.00 28.88  ? 570 ARG D N     1 
ATOM   2615 C  CA    . ARG D 1 69 ? -5.161  -11.942 -20.414  1.00 32.60  ? 570 ARG D CA    1 
ATOM   2616 C  C     . ARG D 1 69 ? -4.545  -12.698 -21.588  1.00 38.90  ? 570 ARG D C     1 
ATOM   2617 O  O     . ARG D 1 69 ? -3.758  -13.631 -21.403  1.00 36.32  ? 570 ARG D O     1 
ATOM   2618 C  CB    . ARG D 1 69 ? -6.630  -12.296 -20.275  1.00 25.66  ? 570 ARG D CB    1 
ATOM   2619 N  N     . SER D 1 70 ? -4.893  -12.265 -22.795  1.00 41.50  ? 571 SER D N     1 
ATOM   2620 C  CA    . SER D 1 70 ? -4.423  -12.891 -24.021  1.00 43.64  ? 571 SER D CA    1 
ATOM   2621 C  C     . SER D 1 70 ? -2.934  -12.742 -24.315  1.00 45.77  ? 571 SER D C     1 
ATOM   2622 O  O     . SER D 1 70 ? -2.214  -13.734 -24.407  1.00 44.70  ? 571 SER D O     1 
ATOM   2623 C  CB    . SER D 1 70 ? -5.231  -12.345 -25.189  1.00 41.57  ? 571 SER D CB    1 
ATOM   2624 O  OG    . SER D 1 70 ? -6.601  -12.314 -24.838  1.00 39.60  ? 571 SER D OG    1 
ATOM   2625 N  N     . MET D 1 71 ? -2.472  -11.506 -24.469  1.00 47.64  ? 572 MET D N     1 
ATOM   2626 C  CA    . MET D 1 71 ? -1.065  -11.248 -24.775  1.00 46.67  ? 572 MET D CA    1 
ATOM   2627 C  C     . MET D 1 71 ? -0.096  -11.561 -23.637  1.00 46.84  ? 572 MET D C     1 
ATOM   2628 O  O     . MET D 1 71 ? 1.089   -11.247 -23.737  1.00 49.29  ? 572 MET D O     1 
ATOM   2629 C  CB    . MET D 1 71 ? -0.868  -9.783  -25.180  1.00 47.11  ? 572 MET D CB    1 
ATOM   2630 C  CG    . MET D 1 71 ? -1.567  -9.356  -26.453  1.00 46.42  ? 572 MET D CG    1 
ATOM   2631 S  SD    . MET D 1 71 ? -1.074  -10.328 -27.870  1.00 44.41  ? 572 MET D SD    1 
ATOM   2632 C  CE    . MET D 1 71 ? -2.454  -11.495 -27.943  1.00 46.34  ? 572 MET D CE    1 
ATOM   2633 N  N     . GLN D 1 72 ? -0.583  -12.176 -22.563  1.00 43.03  ? 573 GLN D N     1 
ATOM   2634 C  CA    . GLN D 1 72 ? 0.270   -12.488 -21.416  1.00 37.73  ? 573 GLN D CA    1 
ATOM   2635 C  C     . GLN D 1 72 ? 1.319   -13.558 -21.721  1.00 36.02  ? 573 GLN D C     1 
ATOM   2636 O  O     . GLN D 1 72 ? 0.991   -14.723 -21.909  1.00 37.01  ? 573 GLN D O     1 
ATOM   2637 C  CB    . GLN D 1 72 ? -0.594  -12.917 -20.227  1.00 32.06  ? 573 GLN D CB    1 
ATOM   2638 C  CG    . GLN D 1 72 ? 0.178   -13.097 -18.937  1.00 32.13  ? 573 GLN D CG    1 
ATOM   2639 C  CD    . GLN D 1 72 ? 0.787   -11.807 -18.408  1.00 35.10  ? 573 GLN D CD    1 
ATOM   2640 O  OE1   . GLN D 1 72 ? 1.633   -11.831 -17.517  1.00 41.38  ? 573 GLN D OE1   1 
ATOM   2641 N  NE2   . GLN D 1 72 ? 0.353   -10.679 -18.944  1.00 34.45  ? 573 GLN D NE2   1 
ATOM   2642 N  N     . GLY D 1 73 ? 2.584   -13.153 -21.776  1.00 34.05  ? 574 GLY D N     1 
ATOM   2643 C  CA    . GLY D 1 73 ? 3.651   -14.096 -22.063  1.00 35.79  ? 574 GLY D CA    1 
ATOM   2644 C  C     . GLY D 1 73 ? 3.832   -14.438 -23.534  1.00 38.94  ? 574 GLY D C     1 
ATOM   2645 O  O     . GLY D 1 73 ? 4.276   -15.538 -23.870  1.00 40.54  ? 574 GLY D O     1 
ATOM   2646 N  N     . PHE D 1 74 ? 3.502   -13.497 -24.414  1.00 36.12  ? 575 PHE D N     1 
ATOM   2647 C  CA    . PHE D 1 74 ? 3.628   -13.705 -25.852  1.00 33.09  ? 575 PHE D CA    1 
ATOM   2648 C  C     . PHE D 1 74 ? 5.026   -13.349 -26.379  1.00 30.74  ? 575 PHE D C     1 
ATOM   2649 O  O     . PHE D 1 74 ? 5.612   -12.352 -25.972  1.00 28.62  ? 575 PHE D O     1 
ATOM   2650 C  CB    . PHE D 1 74 ? 2.551   -12.889 -26.570  1.00 36.35  ? 575 PHE D CB    1 
ATOM   2651 C  CG    . PHE D 1 74 ? 2.671   -12.894 -28.071  1.00 38.58  ? 575 PHE D CG    1 
ATOM   2652 C  CD1   . PHE D 1 74 ? 3.481   -11.969 -28.721  1.00 33.44  ? 575 PHE D CD1   1 
ATOM   2653 C  CD2   . PHE D 1 74 ? 1.971   -13.829 -28.835  1.00 37.09  ? 575 PHE D CD2   1 
ATOM   2654 C  CE1   . PHE D 1 74 ? 3.585   -11.977 -30.108  1.00 38.95  ? 575 PHE D CE1   1 
ATOM   2655 C  CE2   . PHE D 1 74 ? 2.071   -13.844 -30.224  1.00 32.15  ? 575 PHE D CE2   1 
ATOM   2656 C  CZ    . PHE D 1 74 ? 2.876   -12.919 -30.860  1.00 33.97  ? 575 PHE D CZ    1 
ATOM   2657 N  N     . PRO D 1 75 ? 5.573   -14.176 -27.291  1.00 27.53  ? 576 PRO D N     1 
ATOM   2658 C  CA    . PRO D 1 75 ? 6.887   -14.036 -27.925  1.00 27.06  ? 576 PRO D CA    1 
ATOM   2659 C  C     . PRO D 1 75 ? 7.080   -12.717 -28.656  1.00 28.45  ? 576 PRO D C     1 
ATOM   2660 O  O     . PRO D 1 75 ? 6.762   -12.613 -29.835  1.00 38.04  ? 576 PRO D O     1 
ATOM   2661 C  CB    . PRO D 1 75 ? 6.924   -15.212 -28.891  1.00 24.24  ? 576 PRO D CB    1 
ATOM   2662 C  CG    . PRO D 1 75 ? 6.125   -16.225 -28.211  1.00 25.42  ? 576 PRO D CG    1 
ATOM   2663 C  CD    . PRO D 1 75 ? 4.943   -15.429 -27.734  1.00 30.01  ? 576 PRO D CD    1 
ATOM   2664 N  N     . PHE D 1 76 ? 7.622   -11.722 -27.967  1.00 23.06  ? 577 PHE D N     1 
ATOM   2665 C  CA    . PHE D 1 76 ? 7.841   -10.411 -28.561  1.00 20.14  ? 577 PHE D CA    1 
ATOM   2666 C  C     . PHE D 1 76 ? 9.340   -10.168 -28.545  1.00 20.62  ? 577 PHE D C     1 
ATOM   2667 O  O     . PHE D 1 76 ? 9.968   -10.219 -27.493  1.00 21.38  ? 577 PHE D O     1 
ATOM   2668 C  CB    . PHE D 1 76 ? 7.099   -9.349  -27.726  1.00 19.51  ? 577 PHE D CB    1 
ATOM   2669 C  CG    . PHE D 1 76 ? 6.856   -8.042  -28.440  1.00 16.07  ? 577 PHE D CG    1 
ATOM   2670 C  CD1   . PHE D 1 76 ? 6.235   -8.007  -29.676  1.00 14.30  ? 577 PHE D CD1   1 
ATOM   2671 C  CD2   . PHE D 1 76 ? 7.229   -6.837  -27.853  1.00 21.30  ? 577 PHE D CD2   1 
ATOM   2672 C  CE1   . PHE D 1 76 ? 5.992   -6.790  -30.316  1.00 13.84  ? 577 PHE D CE1   1 
ATOM   2673 C  CE2   . PHE D 1 76 ? 6.987   -5.607  -28.492  1.00 12.27  ? 577 PHE D CE2   1 
ATOM   2674 C  CZ    . PHE D 1 76 ? 6.373   -5.590  -29.715  1.00 15.51  ? 577 PHE D CZ    1 
ATOM   2675 N  N     . TYR D 1 77 ? 9.919   -9.937  -29.717  1.00 26.03  ? 578 TYR D N     1 
ATOM   2676 C  CA    . TYR D 1 77 ? 11.354  -9.673  -29.826  1.00 25.17  ? 578 TYR D CA    1 
ATOM   2677 C  C     . TYR D 1 77 ? 12.200  -10.589 -28.940  1.00 21.99  ? 578 TYR D C     1 
ATOM   2678 O  O     . TYR D 1 77 ? 13.103  -10.121 -28.264  1.00 22.73  ? 578 TYR D O     1 
ATOM   2679 C  CB    . TYR D 1 77 ? 11.644  -8.216  -29.440  1.00 26.92  ? 578 TYR D CB    1 
ATOM   2680 C  CG    . TYR D 1 77 ? 11.308  -7.161  -30.477  1.00 24.79  ? 578 TYR D CG    1 
ATOM   2681 C  CD1   . TYR D 1 77 ? 12.159  -6.922  -31.554  1.00 21.77  ? 578 TYR D CD1   1 
ATOM   2682 C  CD2   . TYR D 1 77 ? 10.174  -6.354  -30.340  1.00 27.84  ? 578 TYR D CD2   1 
ATOM   2683 C  CE1   . TYR D 1 77 ? 11.899  -5.899  -32.470  1.00 35.20  ? 578 TYR D CE1   1 
ATOM   2684 C  CE2   . TYR D 1 77 ? 9.897   -5.325  -31.253  1.00 36.00  ? 578 TYR D CE2   1 
ATOM   2685 C  CZ    . TYR D 1 77 ? 10.767  -5.101  -32.316  1.00 39.00  ? 578 TYR D CZ    1 
ATOM   2686 O  OH    . TYR D 1 77 ? 10.520  -4.085  -33.219  1.00 33.37  ? 578 TYR D OH    1 
ATOM   2687 N  N     . ASP D 1 78 ? 11.899  -11.882 -28.936  1.00 25.24  ? 579 ASP D N     1 
ATOM   2688 C  CA    . ASP D 1 78 ? 12.635  -12.868 -28.139  1.00 30.00  ? 579 ASP D CA    1 
ATOM   2689 C  C     . ASP D 1 78 ? 12.580  -12.675 -26.632  1.00 35.74  ? 579 ASP D C     1 
ATOM   2690 O  O     . ASP D 1 78 ? 13.605  -12.808 -25.967  1.00 39.48  ? 579 ASP D O     1 
ATOM   2691 C  CB    . ASP D 1 78 ? 14.109  -12.904 -28.540  1.00 29.20  ? 579 ASP D CB    1 
ATOM   2692 C  CG    . ASP D 1 78 ? 14.330  -13.527 -29.890  1.00 39.49  ? 579 ASP D CG    1 
ATOM   2693 O  OD1   . ASP D 1 78 ? 13.538  -14.420 -30.263  1.00 51.03  ? 579 ASP D OD1   1 
ATOM   2694 O  OD2   . ASP D 1 78 ? 15.305  -13.139 -30.569  1.00 36.07  ? 579 ASP D OD2   1 
ATOM   2695 N  N     . LYS D 1 79 ? 11.406  -12.381 -26.081  1.00 38.56  ? 580 LYS D N     1 
ATOM   2696 C  CA    . LYS D 1 79 ? 11.293  -12.175 -24.637  1.00 34.38  ? 580 LYS D CA    1 
ATOM   2697 C  C     . LYS D 1 79 ? 9.834   -12.256 -24.172  1.00 37.56  ? 580 LYS D C     1 
ATOM   2698 O  O     . LYS D 1 79 ? 8.981   -11.505 -24.646  1.00 40.55  ? 580 LYS D O     1 
ATOM   2699 C  CB    . LYS D 1 79 ? 11.896  -10.814 -24.272  1.00 25.12  ? 580 LYS D CB    1 
ATOM   2700 C  CG    . LYS D 1 79 ? 12.668  -10.806 -22.977  1.00 19.21  ? 580 LYS D CG    1 
ATOM   2701 C  CD    . LYS D 1 79 ? 13.455  -9.533  -22.835  1.00 23.10  ? 580 LYS D CD    1 
ATOM   2702 C  CE    . LYS D 1 79 ? 14.227  -9.486  -21.525  1.00 29.72  ? 580 LYS D CE    1 
ATOM   2703 N  NZ    . LYS D 1 79 ? 15.012  -8.212  -21.428  1.00 40.70  ? 580 LYS D NZ    1 
ATOM   2704 N  N     . PRO D 1 80 ? 9.530   -13.164 -23.225  1.00 36.62  ? 581 PRO D N     1 
ATOM   2705 C  CA    . PRO D 1 80 ? 8.157   -13.304 -22.734  1.00 35.06  ? 581 PRO D CA    1 
ATOM   2706 C  C     . PRO D 1 80 ? 7.590   -11.980 -22.258  1.00 36.04  ? 581 PRO D C     1 
ATOM   2707 O  O     . PRO D 1 80 ? 8.094   -11.383 -21.314  1.00 37.06  ? 581 PRO D O     1 
ATOM   2708 C  CB    . PRO D 1 80 ? 8.299   -14.312 -21.600  1.00 33.90  ? 581 PRO D CB    1 
ATOM   2709 C  CG    . PRO D 1 80 ? 9.472   -15.129 -22.017  1.00 36.97  ? 581 PRO D CG    1 
ATOM   2710 C  CD    . PRO D 1 80 ? 10.428  -14.068 -22.490  1.00 34.53  ? 581 PRO D CD    1 
ATOM   2711 N  N     . MET D 1 81 ? 6.537   -11.527 -22.922  1.00 36.00  ? 582 MET D N     1 
ATOM   2712 C  CA    . MET D 1 81 ? 5.891   -10.269 -22.577  1.00 32.50  ? 582 MET D CA    1 
ATOM   2713 C  C     . MET D 1 81 ? 5.082   -10.447 -21.292  1.00 33.10  ? 582 MET D C     1 
ATOM   2714 O  O     . MET D 1 81 ? 4.226   -11.341 -21.209  1.00 22.58  ? 582 MET D O     1 
ATOM   2715 C  CB    . MET D 1 81 ? 4.973   -9.854  -23.725  1.00 31.61  ? 582 MET D CB    1 
ATOM   2716 C  CG    . MET D 1 81 ? 4.662   -8.383  -23.814  1.00 26.86  ? 582 MET D CG    1 
ATOM   2717 S  SD    . MET D 1 81 ? 3.966   -8.000  -25.442  1.00 34.54  ? 582 MET D SD    1 
ATOM   2718 C  CE    . MET D 1 81 ? 2.274   -8.268  -25.164  1.00 33.26  ? 582 MET D CE    1 
ATOM   2719 N  N     . ARG D 1 82 ? 5.368   -9.607  -20.294  1.00 32.52  ? 583 ARG D N     1 
ATOM   2720 C  CA    . ARG D 1 82 ? 4.661   -9.649  -19.013  1.00 31.45  ? 583 ARG D CA    1 
ATOM   2721 C  C     . ARG D 1 82 ? 3.781   -8.392  -18.854  1.00 34.02  ? 583 ARG D C     1 
ATOM   2722 O  O     . ARG D 1 82 ? 4.273   -7.264  -18.812  1.00 31.16  ? 583 ARG D O     1 
ATOM   2723 C  CB    . ARG D 1 82 ? 5.673   -9.785  -17.876  1.00 26.93  ? 583 ARG D CB    1 
ATOM   2724 C  CG    . ARG D 1 82 ? 6.625   -10.961 -18.084  1.00 22.52  ? 583 ARG D CG    1 
ATOM   2725 C  CD    . ARG D 1 82 ? 7.330   -11.422 -16.805  1.00 21.12  ? 583 ARG D CD    1 
ATOM   2726 N  NE    . ARG D 1 82 ? 8.186   -10.397 -16.215  1.00 16.84  ? 583 ARG D NE    1 
ATOM   2727 C  CZ    . ARG D 1 82 ? 9.427   -10.622 -15.792  1.00 23.89  ? 583 ARG D CZ    1 
ATOM   2728 N  NH1   . ARG D 1 82 ? 9.955   -11.833 -15.895  1.00 30.57  ? 583 ARG D NH1   1 
ATOM   2729 N  NH2   . ARG D 1 82 ? 10.145  -9.638  -15.275  1.00 27.09  ? 583 ARG D NH2   1 
ATOM   2730 N  N     . ILE D 1 83 ? 2.471   -8.608  -18.768  1.00 34.08  ? 584 ILE D N     1 
ATOM   2731 C  CA    . ILE D 1 83 ? 1.510   -7.516  -18.685  1.00 36.54  ? 584 ILE D CA    1 
ATOM   2732 C  C     . ILE D 1 83 ? 0.623   -7.518  -17.447  1.00 40.18  ? 584 ILE D C     1 
ATOM   2733 O  O     . ILE D 1 83 ? 0.336   -8.567  -16.879  1.00 39.60  ? 584 ILE D O     1 
ATOM   2734 C  CB    . ILE D 1 83 ? 0.555   -7.547  -19.885  1.00 32.26  ? 584 ILE D CB    1 
ATOM   2735 C  CG1   . ILE D 1 83 ? 1.182   -8.320  -21.043  1.00 30.55  ? 584 ILE D CG1   1 
ATOM   2736 C  CG2   . ILE D 1 83 ? 0.235   -6.142  -20.320  1.00 36.50  ? 584 ILE D CG2   1 
ATOM   2737 C  CD1   . ILE D 1 83 ? 0.169   -8.781  -22.071  1.00 20.56  ? 584 ILE D CD1   1 
ATOM   2738 N  N     . GLN D 1 84 ? 0.160   -6.327  -17.073  1.00 43.80  ? 585 GLN D N     1 
ATOM   2739 C  CA    . GLN D 1 84 ? -0.721  -6.130  -15.926  1.00 42.98  ? 585 GLN D CA    1 
ATOM   2740 C  C     . GLN D 1 84 ? -1.404  -4.787  -16.085  1.00 41.25  ? 585 GLN D C     1 
ATOM   2741 O  O     . GLN D 1 84 ? -1.248  -4.138  -17.111  1.00 41.78  ? 585 GLN D O     1 
ATOM   2742 C  CB    . GLN D 1 84 ? 0.083   -6.139  -14.638  1.00 49.22  ? 585 GLN D CB    1 
ATOM   2743 C  CG    . GLN D 1 84 ? 1.164   -5.084  -14.590  1.00 59.17  ? 585 GLN D CG    1 
ATOM   2744 C  CD    . GLN D 1 84 ? 2.385   -5.575  -13.840  1.00 68.85  ? 585 GLN D CD    1 
ATOM   2745 O  OE1   . GLN D 1 84 ? 2.270   -6.161  -12.759  1.00 67.34  ? 585 GLN D OE1   1 
ATOM   2746 N  NE2   . GLN D 1 84 ? 3.566   -5.343  -14.411  1.00 71.65  ? 585 GLN D NE2   1 
ATOM   2747 N  N     . TYR D 1 85 ? -2.160  -4.371  -15.073  1.00 43.47  ? 586 TYR D N     1 
ATOM   2748 C  CA    . TYR D 1 85 ? -2.861  -3.084  -15.110  1.00 45.69  ? 586 TYR D CA    1 
ATOM   2749 C  C     . TYR D 1 85 ? -2.017  -2.012  -14.408  1.00 49.28  ? 586 TYR D C     1 
ATOM   2750 O  O     . TYR D 1 85 ? -1.029  -2.326  -13.741  1.00 48.64  ? 586 TYR D O     1 
ATOM   2751 C  CB    . TYR D 1 85 ? -4.222  -3.196  -14.406  1.00 40.94  ? 586 TYR D CB    1 
ATOM   2752 C  CG    . TYR D 1 85 ? -5.174  -4.214  -15.001  1.00 34.45  ? 586 TYR D CG    1 
ATOM   2753 C  CD1   . TYR D 1 85 ? -5.880  -3.941  -16.169  1.00 34.17  ? 586 TYR D CD1   1 
ATOM   2754 C  CD2   . TYR D 1 85 ? -5.364  -5.456  -14.395  1.00 36.73  ? 586 TYR D CD2   1 
ATOM   2755 C  CE1   . TYR D 1 85 ? -6.759  -4.883  -16.720  1.00 34.85  ? 586 TYR D CE1   1 
ATOM   2756 C  CE2   . TYR D 1 85 ? -6.234  -6.406  -14.936  1.00 31.92  ? 586 TYR D CE2   1 
ATOM   2757 C  CZ    . TYR D 1 85 ? -6.929  -6.112  -16.098  1.00 35.47  ? 586 TYR D CZ    1 
ATOM   2758 O  OH    . TYR D 1 85 ? -7.800  -7.038  -16.628  1.00 30.81  ? 586 TYR D OH    1 
ATOM   2759 N  N     . ALA D 1 86 ? -2.396  -0.749  -14.566  1.00 53.96  ? 587 ALA D N     1 
ATOM   2760 C  CA    . ALA D 1 86 ? -1.671  0.334   -13.909  1.00 61.97  ? 587 ALA D CA    1 
ATOM   2761 C  C     . ALA D 1 86 ? -2.326  0.589   -12.552  1.00 67.86  ? 587 ALA D C     1 
ATOM   2762 O  O     . ALA D 1 86 ? -3.175  -0.190  -12.116  1.00 71.19  ? 587 ALA D O     1 
ATOM   2763 C  CB    . ALA D 1 86 ? -1.711  1.585   -14.756  1.00 63.08  ? 587 ALA D CB    1 
ATOM   2764 N  N     . LYS D 1 87 ? -1.954  1.678   -11.888  1.00 69.76  ? 588 LYS D N     1 
ATOM   2765 C  CA    . LYS D 1 87 ? -2.518  1.969   -10.575  1.00 74.96  ? 588 LYS D CA    1 
ATOM   2766 C  C     . LYS D 1 87 ? -3.447  3.189   -10.512  1.00 79.08  ? 588 LYS D C     1 
ATOM   2767 O  O     . LYS D 1 87 ? -3.734  3.826   -11.531  1.00 79.17  ? 588 LYS D O     1 
ATOM   2768 C  CB    . LYS D 1 87 ? -1.380  2.124   -9.559   1.00 72.15  ? 588 LYS D CB    1 
ATOM   2769 N  N     . THR D 1 88 ? -3.911  3.485   -9.295   1.00 83.94  ? 589 THR D N     1 
ATOM   2770 C  CA    . THR D 1 88 ? -4.799  4.612   -8.990   1.00 83.65  ? 589 THR D CA    1 
ATOM   2771 C  C     . THR D 1 88 ? -5.572  5.154   -10.186  1.00 82.50  ? 589 THR D C     1 
ATOM   2772 O  O     . THR D 1 88 ? -5.240  6.262   -10.665  1.00 78.54  ? 589 THR D O     1 
ATOM   2773 C  CB    . THR D 1 88 ? -4.015  5.785   -8.329   1.00 86.01  ? 589 THR D CB    1 
ATOM   2774 O  OG1   . THR D 1 88 ? -3.011  6.270   -9.232   1.00 86.56  ? 589 THR D OG1   1 
ATOM   2775 C  CG2   . THR D 1 88 ? -3.354  5.322   -7.029   1.00 77.50  ? 589 THR D CG2   1 
ATOM   2776 O  "O5'" . G   E 2 1  ? 30.874  -16.074 -90.009  1.00 74.17  ? 4   G   E "O5'" 1 
ATOM   2777 C  "C5'" . G   E 2 1  ? 31.946  -16.974 -89.686  1.00 79.87  ? 4   G   E "C5'" 1 
ATOM   2778 C  "C4'" . G   E 2 1  ? 33.243  -16.248 -89.411  1.00 80.56  ? 4   G   E "C4'" 1 
ATOM   2779 O  "O4'" . G   E 2 1  ? 33.834  -15.794 -90.660  1.00 82.62  ? 4   G   E "O4'" 1 
ATOM   2780 C  "C3'" . G   E 2 1  ? 33.086  -14.987 -88.581  1.00 82.97  ? 4   G   E "C3'" 1 
ATOM   2781 O  "O3'" . G   E 2 1  ? 33.061  -15.295 -87.194  1.00 84.27  ? 4   G   E "O3'" 1 
ATOM   2782 C  "C2'" . G   E 2 1  ? 34.296  -14.165 -89.009  1.00 80.14  ? 4   G   E "C2'" 1 
ATOM   2783 O  "O2'" . G   E 2 1  ? 35.500  -14.589 -88.401  1.00 76.54  ? 4   G   E "O2'" 1 
ATOM   2784 C  "C1'" . G   E 2 1  ? 34.339  -14.476 -90.505  1.00 79.28  ? 4   G   E "C1'" 1 
ATOM   2785 N  N9    . G   E 2 1  ? 33.503  -13.591 -91.309  1.00 76.27  ? 4   G   E N9    1 
ATOM   2786 C  C8    . G   E 2 1  ? 32.168  -13.757 -91.590  1.00 75.83  ? 4   G   E C8    1 
ATOM   2787 N  N7    . G   E 2 1  ? 31.686  -12.824 -92.362  1.00 76.35  ? 4   G   E N7    1 
ATOM   2788 C  C5    . G   E 2 1  ? 32.764  -11.985 -92.599  1.00 77.37  ? 4   G   E C5    1 
ATOM   2789 C  C6    . G   E 2 1  ? 32.849  -10.798 -93.368  1.00 77.29  ? 4   G   E C6    1 
ATOM   2790 O  O6    . G   E 2 1  ? 31.961  -10.237 -94.015  1.00 77.21  ? 4   G   E O6    1 
ATOM   2791 N  N1    . G   E 2 1  ? 34.129  -10.260 -93.339  1.00 76.79  ? 4   G   E N1    1 
ATOM   2792 C  C2    . G   E 2 1  ? 35.196  -10.795 -92.661  1.00 79.04  ? 4   G   E C2    1 
ATOM   2793 N  N2    . G   E 2 1  ? 36.358  -10.127 -92.766  1.00 77.84  ? 4   G   E N2    1 
ATOM   2794 N  N3    . G   E 2 1  ? 35.130  -11.904 -91.936  1.00 78.59  ? 4   G   E N3    1 
ATOM   2795 C  C4    . G   E 2 1  ? 33.893  -12.442 -91.951  1.00 76.74  ? 4   G   E C4    1 
ATOM   2796 P  P     . C   E 2 2  ? 32.613  -14.166 -86.138  1.00 81.44  ? 5   C   E P     1 
ATOM   2797 O  OP1   . C   E 2 2  ? 32.033  -14.824 -84.935  1.00 79.14  ? 5   C   E OP1   1 
ATOM   2798 O  OP2   . C   E 2 2  ? 31.814  -13.149 -86.879  1.00 72.39  ? 5   C   E OP2   1 
ATOM   2799 O  "O5'" . C   E 2 2  ? 34.000  -13.517 -85.713  1.00 70.74  ? 5   C   E "O5'" 1 
ATOM   2800 C  "C5'" . C   E 2 2  ? 34.101  -12.133 -85.492  1.00 62.47  ? 5   C   E "C5'" 1 
ATOM   2801 C  "C4'" . C   E 2 2  ? 35.381  -11.610 -86.074  1.00 60.31  ? 5   C   E "C4'" 1 
ATOM   2802 O  "O4'" . C   E 2 2  ? 35.439  -11.900 -87.497  1.00 63.18  ? 5   C   E "O4'" 1 
ATOM   2803 C  "C3'" . C   E 2 2  ? 35.451  -10.103 -86.019  1.00 62.71  ? 5   C   E "C3'" 1 
ATOM   2804 O  "O3'" . C   E 2 2  ? 35.789  -9.653  -84.727  1.00 61.98  ? 5   C   E "O3'" 1 
ATOM   2805 C  "C2'" . C   E 2 2  ? 36.426  -9.782  -87.135  1.00 59.87  ? 5   C   E "C2'" 1 
ATOM   2806 O  "O2'" . C   E 2 2  ? 37.780  -10.044 -86.801  1.00 53.73  ? 5   C   E "O2'" 1 
ATOM   2807 C  "C1'" . C   E 2 2  ? 35.926  -10.759 -88.199  1.00 59.71  ? 5   C   E "C1'" 1 
ATOM   2808 N  N1    . C   E 2 2  ? 34.811  -10.213 -88.996  1.00 55.53  ? 5   C   E N1    1 
ATOM   2809 C  C2    . C   E 2 2  ? 34.999  -9.020  -89.701  1.00 53.16  ? 5   C   E C2    1 
ATOM   2810 O  O2    . C   E 2 2  ? 36.087  -8.430  -89.606  1.00 52.29  ? 5   C   E O2    1 
ATOM   2811 N  N3    . C   E 2 2  ? 33.992  -8.539  -90.465  1.00 51.14  ? 5   C   E N3    1 
ATOM   2812 C  C4    . C   E 2 2  ? 32.834  -9.197  -90.534  1.00 47.31  ? 5   C   E C4    1 
ATOM   2813 N  N4    . C   E 2 2  ? 31.878  -8.693  -91.314  1.00 39.69  ? 5   C   E N4    1 
ATOM   2814 C  C5    . C   E 2 2  ? 32.607  -10.401 -89.809  1.00 49.03  ? 5   C   E C5    1 
ATOM   2815 C  C6    . C   E 2 2  ? 33.612  -10.869 -89.061  1.00 52.33  ? 5   C   E C6    1 
ATOM   2816 P  P     . G   E 2 3  ? 34.737  -8.743  -83.947  1.00 64.60  ? 6   G   E P     1 
ATOM   2817 O  OP1   . G   E 2 3  ? 35.208  -8.515  -82.557  1.00 64.16  ? 6   G   E OP1   1 
ATOM   2818 O  OP2   . G   E 2 3  ? 33.405  -9.357  -84.190  1.00 59.77  ? 6   G   E OP2   1 
ATOM   2819 O  "O5'" . G   E 2 3  ? 34.797  -7.377  -84.760  1.00 60.90  ? 6   G   E "O5'" 1 
ATOM   2820 C  "C5'" . G   E 2 3  ? 36.050  -6.796  -85.079  1.00 50.82  ? 6   G   E "C5'" 1 
ATOM   2821 C  "C4'" . G   E 2 3  ? 35.851  -5.580  -85.925  1.00 45.90  ? 6   G   E "C4'" 1 
ATOM   2822 O  "O4'" . G   E 2 3  ? 35.509  -5.954  -87.281  1.00 45.83  ? 6   G   E "O4'" 1 
ATOM   2823 C  "C3'" . G   E 2 3  ? 34.693  -4.704  -85.512  1.00 47.51  ? 6   G   E "C3'" 1 
ATOM   2824 O  "O3'" . G   E 2 3  ? 35.035  -3.941  -84.365  1.00 54.41  ? 6   G   E "O3'" 1 
ATOM   2825 C  "C2'" . G   E 2 3  ? 34.485  -3.872  -86.773  1.00 48.68  ? 6   G   E "C2'" 1 
ATOM   2826 O  "O2'" . G   E 2 3  ? 35.414  -2.808  -86.903  1.00 37.70  ? 6   G   E "O2'" 1 
ATOM   2827 C  "C1'" . G   E 2 3  ? 34.723  -4.925  -87.862  1.00 46.31  ? 6   G   E "C1'" 1 
ATOM   2828 N  N9    . G   E 2 3  ? 33.484  -5.518  -88.355  1.00 43.37  ? 6   G   E N9    1 
ATOM   2829 C  C8    . G   E 2 3  ? 32.867  -6.658  -87.894  1.00 43.94  ? 6   G   E C8    1 
ATOM   2830 N  N7    . G   E 2 3  ? 31.750  -6.924  -88.517  1.00 40.91  ? 6   G   E N7    1 
ATOM   2831 C  C5    . G   E 2 3  ? 31.624  -5.900  -89.449  1.00 40.42  ? 6   G   E C5    1 
ATOM   2832 C  C6    . G   E 2 3  ? 30.605  -5.647  -90.414  1.00 41.40  ? 6   G   E C6    1 
ATOM   2833 O  O6    . G   E 2 3  ? 29.580  -6.303  -90.647  1.00 46.20  ? 6   G   E O6    1 
ATOM   2834 N  N1    . G   E 2 3  ? 30.871  -4.497  -91.150  1.00 35.10  ? 6   G   E N1    1 
ATOM   2835 C  C2    . G   E 2 3  ? 31.974  -3.696  -90.990  1.00 35.52  ? 6   G   E C2    1 
ATOM   2836 N  N2    . G   E 2 3  ? 32.050  -2.638  -91.802  1.00 24.20  ? 6   G   E N2    1 
ATOM   2837 N  N3    . G   E 2 3  ? 32.932  -3.919  -90.099  1.00 35.38  ? 6   G   E N3    1 
ATOM   2838 C  C4    . G   E 2 3  ? 32.691  -5.029  -89.367  1.00 39.42  ? 6   G   E C4    1 
ATOM   2839 P  P     . A   E 2 4  ? 33.989  -2.871  -83.778  1.00 55.75  ? 7   A   E P     1 
ATOM   2840 O  OP1   . A   E 2 4  ? 34.467  -2.393  -82.449  1.00 47.75  ? 7   A   E OP1   1 
ATOM   2841 O  OP2   . A   E 2 4  ? 32.606  -3.404  -83.919  1.00 44.64  ? 7   A   E OP2   1 
ATOM   2842 O  "O5'" . A   E 2 4  ? 34.134  -1.668  -84.796  1.00 45.92  ? 7   A   E "O5'" 1 
ATOM   2843 C  "C5'" . A   E 2 4  ? 33.195  -0.636  -84.795  1.00 37.93  ? 7   A   E "C5'" 1 
ATOM   2844 C  "C4'" . A   E 2 4  ? 33.248  0.087   -86.094  1.00 34.88  ? 7   A   E "C4'" 1 
ATOM   2845 O  "O4'" . A   E 2 4  ? 33.230  -0.860  -87.181  1.00 30.94  ? 7   A   E "O4'" 1 
ATOM   2846 C  "C3'" . A   E 2 4  ? 32.023  0.934   -86.298  1.00 39.73  ? 7   A   E "C3'" 1 
ATOM   2847 O  "O3'" . A   E 2 4  ? 32.227  2.151   -85.627  1.00 44.24  ? 7   A   E "O3'" 1 
ATOM   2848 C  "C2'" . A   E 2 4  ? 31.920  1.029   -87.809  1.00 37.19  ? 7   A   E "C2'" 1 
ATOM   2849 O  "O2'" . A   E 2 4  ? 32.743  2.033   -88.361  1.00 40.49  ? 7   A   E "O2'" 1 
ATOM   2850 C  "C1'" . A   E 2 4  ? 32.397  -0.369  -88.216  1.00 36.89  ? 7   A   E "C1'" 1 
ATOM   2851 N  N9    . A   E 2 4  ? 31.302  -1.317  -88.369  1.00 33.53  ? 7   A   E N9    1 
ATOM   2852 C  C8    . A   E 2 4  ? 31.120  -2.499  -87.699  1.00 34.48  ? 7   A   E C8    1 
ATOM   2853 N  N7    . A   E 2 4  ? 30.040  -3.148  -88.054  1.00 25.75  ? 7   A   E N7    1 
ATOM   2854 C  C5    . A   E 2 4  ? 29.474  -2.340  -89.020  1.00 28.20  ? 7   A   E C5    1 
ATOM   2855 C  C6    . A   E 2 4  ? 28.321  -2.471  -89.778  1.00 32.76  ? 7   A   E C6    1 
ATOM   2856 N  N6    . A   E 2 4  ? 27.494  -3.512  -89.682  1.00 29.12  ? 7   A   E N6    1 
ATOM   2857 N  N1    . A   E 2 4  ? 28.034  -1.483  -90.654  1.00 42.87  ? 7   A   E N1    1 
ATOM   2858 C  C2    . A   E 2 4  ? 28.876  -0.433  -90.747  1.00 39.03  ? 7   A   E C2    1 
ATOM   2859 N  N3    . A   E 2 4  ? 29.999  -0.200  -90.084  1.00 31.21  ? 7   A   E N3    1 
ATOM   2860 C  C4    . A   E 2 4  ? 30.242  -1.204  -89.225  1.00 33.42  ? 7   A   E C4    1 
ATOM   2861 P  P     . C   E 2 5  ? 31.201  2.575   -84.486  1.00 52.52  ? 8   C   E P     1 
ATOM   2862 O  OP1   . C   E 2 5  ? 31.833  3.634   -83.668  1.00 56.48  ? 8   C   E OP1   1 
ATOM   2863 O  OP2   . C   E 2 5  ? 30.727  1.327   -83.833  1.00 47.08  ? 8   C   E OP2   1 
ATOM   2864 O  "O5'" . C   E 2 5  ? 30.020  3.195   -85.349  1.00 43.91  ? 8   C   E "O5'" 1 
ATOM   2865 C  "C5'" . C   E 2 5  ? 30.326  4.049   -86.441  1.00 35.13  ? 8   C   E "C5'" 1 
ATOM   2866 C  "C4'" . C   E 2 5  ? 29.135  4.201   -87.338  1.00 34.54  ? 8   C   E "C4'" 1 
ATOM   2867 O  "O4'" . C   E 2 5  ? 28.978  3.032   -88.176  1.00 39.92  ? 8   C   E "O4'" 1 
ATOM   2868 C  "C3'" . C   E 2 5  ? 27.802  4.318   -86.630  1.00 38.00  ? 8   C   E "C3'" 1 
ATOM   2869 O  "O3'" . C   E 2 5  ? 27.589  5.637   -86.162  1.00 44.22  ? 8   C   E "O3'" 1 
ATOM   2870 C  "C2'" . C   E 2 5  ? 26.830  3.966   -87.744  1.00 34.50  ? 8   C   E "C2'" 1 
ATOM   2871 O  "O2'" . C   E 2 5  ? 26.604  5.077   -88.578  1.00 32.39  ? 8   C   E "O2'" 1 
ATOM   2872 C  "C1'" . C   E 2 5  ? 27.604  2.874   -88.494  1.00 36.23  ? 8   C   E "C1'" 1 
ATOM   2873 N  N1    . C   E 2 5  ? 27.185  1.525   -88.095  1.00 33.75  ? 8   C   E N1    1 
ATOM   2874 C  C2    . C   E 2 5  ? 26.007  1.012   -88.626  1.00 34.24  ? 8   C   E C2    1 
ATOM   2875 O  O2    . C   E 2 5  ? 25.363  1.701   -89.428  1.00 39.37  ? 8   C   E O2    1 
ATOM   2876 N  N3    . C   E 2 5  ? 25.594  -0.214  -88.254  1.00 34.41  ? 8   C   E N3    1 
ATOM   2877 C  C4    . C   E 2 5  ? 26.313  -0.920  -87.383  1.00 32.92  ? 8   C   E C4    1 
ATOM   2878 N  N4    . C   E 2 5  ? 25.858  -2.123  -87.036  1.00 40.04  ? 8   C   E N4    1 
ATOM   2879 C  C5    . C   E 2 5  ? 27.526  -0.423  -86.828  1.00 27.62  ? 8   C   E C5    1 
ATOM   2880 C  C6    . C   E 2 5  ? 27.924  0.790   -87.212  1.00 29.19  ? 8   C   E C6    1 
ATOM   2881 P  P     . U   E 2 6  ? 26.622  5.883   -84.910  1.00 44.09  ? 9   U   E P     1 
ATOM   2882 O  OP1   . U   E 2 6  ? 26.654  7.327   -84.593  1.00 52.15  ? 9   U   E OP1   1 
ATOM   2883 O  OP2   . U   E 2 6  ? 26.969  4.896   -83.855  1.00 47.64  ? 9   U   E OP2   1 
ATOM   2884 O  "O5'" . U   E 2 6  ? 25.185  5.536   -85.495  1.00 41.43  ? 9   U   E "O5'" 1 
ATOM   2885 C  "C5'" . U   E 2 6  ? 24.640  6.293   -86.564  1.00 26.08  ? 9   U   E "C5'" 1 
ATOM   2886 C  "C4'" . U   E 2 6  ? 23.375  5.648   -87.051  1.00 26.56  ? 9   U   E "C4'" 1 
ATOM   2887 O  "O4'" . U   E 2 6  ? 23.678  4.339   -87.595  1.00 27.06  ? 9   U   E "O4'" 1 
ATOM   2888 C  "C3'" . U   E 2 6  ? 22.379  5.333   -85.960  1.00 29.27  ? 9   U   E "C3'" 1 
ATOM   2889 O  "O3'" . U   E 2 6  ? 21.616  6.471   -85.623  1.00 34.20  ? 9   U   E "O3'" 1 
ATOM   2890 C  "C2'" . U   E 2 6  ? 21.522  4.259   -86.611  1.00 26.70  ? 9   U   E "C2'" 1 
ATOM   2891 O  "O2'" . U   E 2 6  ? 20.534  4.782   -87.472  1.00 22.23  ? 9   U   E "O2'" 1 
ATOM   2892 C  "C1'" . U   E 2 6  ? 22.572  3.478   -87.400  1.00 25.24  ? 9   U   E "C1'" 1 
ATOM   2893 N  N1    . U   E 2 6  ? 23.033  2.286   -86.681  1.00 30.53  ? 9   U   E N1    1 
ATOM   2894 C  C2    . U   E 2 6  ? 22.255  1.147   -86.775  1.00 32.77  ? 9   U   E C2    1 
ATOM   2895 O  O2    . U   E 2 6  ? 21.207  1.111   -87.401  1.00 33.16  ? 9   U   E O2    1 
ATOM   2896 N  N3    . U   E 2 6  ? 22.745  0.051   -86.106  1.00 35.48  ? 9   U   E N3    1 
ATOM   2897 C  C4    . U   E 2 6  ? 23.903  -0.020  -85.361  1.00 38.40  ? 9   U   E C4    1 
ATOM   2898 O  O4    . U   E 2 6  ? 24.216  -1.089  -84.830  1.00 36.72  ? 9   U   E O4    1 
ATOM   2899 C  C5    . U   E 2 6  ? 24.648  1.209   -85.297  1.00 39.18  ? 9   U   E C5    1 
ATOM   2900 C  C6    . U   E 2 6  ? 24.196  2.293   -85.945  1.00 34.77  ? 9   U   E C6    1 
ATOM   2901 P  P     . C   E 2 7  ? 21.140  6.675   -84.109  1.00 37.15  ? 10  C   E P     1 
ATOM   2902 O  OP1   . C   E 2 7  ? 20.409  7.968   -84.085  1.00 36.78  ? 10  C   E OP1   1 
ATOM   2903 O  OP2   . C   E 2 7  ? 22.330  6.479   -83.249  1.00 26.86  ? 10  C   E OP2   1 
ATOM   2904 O  "O5'" . C   E 2 7  ? 20.121  5.474   -83.829  1.00 34.38  ? 10  C   E "O5'" 1 
ATOM   2905 C  "C5'" . C   E 2 7  ? 18.727  5.642   -84.069  1.00 29.74  ? 10  C   E "C5'" 1 
ATOM   2906 C  "C4'" . C   E 2 7  ? 18.016  4.310   -84.098  1.00 24.44  ? 10  C   E "C4'" 1 
ATOM   2907 O  "O4'" . C   E 2 7  ? 18.842  3.370   -84.827  1.00 25.41  ? 10  C   E "O4'" 1 
ATOM   2908 C  "C3'" . C   E 2 7  ? 17.797  3.566   -82.791  1.00 29.71  ? 10  C   E "C3'" 1 
ATOM   2909 O  "O3'" . C   E 2 7  ? 16.705  4.048   -82.028  1.00 39.33  ? 10  C   E "O3'" 1 
ATOM   2910 C  "C2'" . C   E 2 7  ? 17.483  2.176   -83.309  1.00 29.72  ? 10  C   E "C2'" 1 
ATOM   2911 O  "O2'" . C   E 2 7  ? 16.189  2.080   -83.887  1.00 16.71  ? 10  C   E "O2'" 1 
ATOM   2912 C  "C1'" . C   E 2 7  ? 18.559  2.046   -84.381  1.00 31.86  ? 10  C   E "C1'" 1 
ATOM   2913 N  N1    . C   E 2 7  ? 19.779  1.473   -83.796  1.00 29.59  ? 10  C   E N1    1 
ATOM   2914 C  C2    . C   E 2 7  ? 19.836  0.091   -83.571  1.00 31.86  ? 10  C   E C2    1 
ATOM   2915 O  O2    . C   E 2 7  ? 18.873  -0.614  -83.902  1.00 36.94  ? 10  C   E O2    1 
ATOM   2916 N  N3    . C   E 2 7  ? 20.937  -0.441  -83.000  1.00 29.26  ? 10  C   E N3    1 
ATOM   2917 C  C4    . C   E 2 7  ? 21.957  0.348   -82.668  1.00 25.22  ? 10  C   E C4    1 
ATOM   2918 N  N4    . C   E 2 7  ? 23.020  -0.213  -82.106  1.00 29.04  ? 10  C   E N4    1 
ATOM   2919 C  C5    . C   E 2 7  ? 21.931  1.751   -82.899  1.00 29.74  ? 10  C   E C5    1 
ATOM   2920 C  C6    . C   E 2 7  ? 20.833  2.268   -83.461  1.00 24.98  ? 10  C   E C6    1 
ATOM   2921 P  P     . G   E 2 8  ? 16.743  3.908   -80.424  1.00 36.02  ? 11  G   E P     1 
ATOM   2922 O  OP1   . G   E 2 8  ? 15.575  4.653   -79.897  1.00 36.64  ? 11  G   E OP1   1 
ATOM   2923 O  OP2   . G   E 2 8  ? 18.109  4.251   -79.956  1.00 28.73  ? 11  G   E OP2   1 
ATOM   2924 O  "O5'" . G   E 2 8  ? 16.519  2.359   -80.146  1.00 21.41  ? 11  G   E "O5'" 1 
ATOM   2925 C  "C5'" . G   E 2 8  ? 15.248  1.777   -80.342  1.00 14.37  ? 11  G   E "C5'" 1 
ATOM   2926 C  "C4'" . G   E 2 8  ? 15.380  0.288   -80.406  1.00 17.75  ? 11  G   E "C4'" 1 
ATOM   2927 O  "O4'" . G   E 2 8  ? 16.565  -0.004  -81.188  1.00 24.85  ? 11  G   E "O4'" 1 
ATOM   2928 C  "C3'" . G   E 2 8  ? 15.669  -0.435  -79.106  1.00 14.39  ? 11  G   E "C3'" 1 
ATOM   2929 O  "O3'" . G   E 2 8  ? 14.476  -0.716  -78.400  1.00 18.95  ? 11  G   E "O3'" 1 
ATOM   2930 C  "C2'" . G   E 2 8  ? 16.227  -1.741  -79.625  1.00 21.18  ? 11  G   E "C2'" 1 
ATOM   2931 O  "O2'" . G   E 2 8  ? 15.168  -2.536  -80.117  1.00 16.43  ? 11  G   E "O2'" 1 
ATOM   2932 C  "C1'" . G   E 2 8  ? 17.100  -1.249  -80.781  1.00 26.00  ? 11  G   E "C1'" 1 
ATOM   2933 N  N9    . G   E 2 8  ? 18.495  -1.053  -80.401  1.00 30.66  ? 11  G   E N9    1 
ATOM   2934 C  C8    . G   E 2 8  ? 19.197  0.126   -80.392  1.00 34.91  ? 11  G   E C8    1 
ATOM   2935 N  N7    . G   E 2 8  ? 20.429  -0.014  -79.977  1.00 32.77  ? 11  G   E N7    1 
ATOM   2936 C  C5    . G   E 2 8  ? 20.548  -1.367  -79.702  1.00 31.91  ? 11  G   E C5    1 
ATOM   2937 C  C6    . G   E 2 8  ? 21.656  -2.114  -79.215  1.00 32.09  ? 11  G   E C6    1 
ATOM   2938 O  O6    . G   E 2 8  ? 22.792  -1.713  -78.918  1.00 29.13  ? 11  G   E O6    1 
ATOM   2939 N  N1    . G   E 2 8  ? 21.338  -3.462  -79.079  1.00 29.45  ? 11  G   E N1    1 
ATOM   2940 C  C2    . G   E 2 8  ? 20.113  -4.019  -79.365  1.00 30.87  ? 11  G   E C2    1 
ATOM   2941 N  N2    . G   E 2 8  ? 19.998  -5.335  -79.153  1.00 30.70  ? 11  G   E N2    1 
ATOM   2942 N  N3    . G   E 2 8  ? 19.077  -3.335  -79.822  1.00 27.82  ? 11  G   E N3    1 
ATOM   2943 C  C4    . G   E 2 8  ? 19.363  -2.024  -79.964  1.00 31.71  ? 11  G   E C4    1 
ATOM   2944 P  P     . G   E 2 9  ? 14.511  -0.815  -76.799  1.00 29.23  ? 12  G   E P     1 
ATOM   2945 O  OP1   . G   E 2 9  ? 13.123  -0.766  -76.299  1.00 32.54  ? 12  G   E OP1   1 
ATOM   2946 O  OP2   . G   E 2 9  ? 15.503  0.186   -76.326  1.00 17.85  ? 12  G   E OP2   1 
ATOM   2947 O  "O5'" . G   E 2 9  ? 15.054  -2.280  -76.514  1.00 18.41  ? 12  G   E "O5'" 1 
ATOM   2948 C  "C5'" . G   E 2 9  ? 14.308  -3.410  -76.926  1.00 18.30  ? 12  G   E "C5'" 1 
ATOM   2949 C  "C4'" . G   E 2 9  ? 15.081  -4.678  -76.642  1.00 25.23  ? 12  G   E "C4'" 1 
ATOM   2950 O  "O4'" . G   E 2 9  ? 16.307  -4.701  -77.416  1.00 29.49  ? 12  G   E "O4'" 1 
ATOM   2951 C  "C3'" . G   E 2 9  ? 15.546  -4.856  -75.209  1.00 24.37  ? 12  G   E "C3'" 1 
ATOM   2952 O  "O3'" . G   E 2 9  ? 14.493  -5.406  -74.439  1.00 28.59  ? 12  G   E "O3'" 1 
ATOM   2953 C  "C2'" . G   E 2 9  ? 16.698  -5.832  -75.379  1.00 20.13  ? 12  G   E "C2'" 1 
ATOM   2954 O  "O2'" . G   E 2 9  ? 16.241  -7.135  -75.663  1.00 22.20  ? 12  G   E "O2'" 1 
ATOM   2955 C  "C1'" . G   E 2 9  ? 17.343  -5.289  -76.648  1.00 25.27  ? 12  G   E "C1'" 1 
ATOM   2956 N  N9    . G   E 2 9  ? 18.355  -4.267  -76.407  1.00 25.69  ? 12  G   E N9    1 
ATOM   2957 C  C8    . G   E 2 9  ? 18.266  -2.930  -76.712  1.00 13.50  ? 12  G   E C8    1 
ATOM   2958 N  N7    . G   E 2 9  ? 19.352  -2.270  -76.426  1.00 18.05  ? 12  G   E N7    1 
ATOM   2959 C  C5    . G   E 2 9  ? 20.208  -3.226  -75.886  1.00 18.64  ? 12  G   E C5    1 
ATOM   2960 C  C6    . G   E 2 9  ? 21.543  -3.106  -75.397  1.00 21.41  ? 12  G   E C6    1 
ATOM   2961 O  O6    . G   E 2 9  ? 22.260  -2.097  -75.339  1.00 23.51  ? 12  G   E O6    1 
ATOM   2962 N  N1    . G   E 2 9  ? 22.034  -4.325  -74.946  1.00 19.01  ? 12  G   E N1    1 
ATOM   2963 C  C2    . G   E 2 9  ? 21.342  -5.504  -74.959  1.00 21.69  ? 12  G   E C2    1 
ATOM   2964 N  N2    . G   E 2 9  ? 21.992  -6.570  -74.482  1.00 19.63  ? 12  G   E N2    1 
ATOM   2965 N  N3    . G   E 2 9  ? 20.103  -5.631  -75.408  1.00 21.46  ? 12  G   E N3    1 
ATOM   2966 C  C4    . G   E 2 9  ? 19.603  -4.460  -75.856  1.00 21.17  ? 12  G   E C4    1 
ATOM   2967 P  P     . G   E 2 10 ? 14.318  -4.965  -72.915  1.00 21.54  ? 13  G   E P     1 
ATOM   2968 O  OP1   . G   E 2 10 ? 13.187  -5.761  -72.397  1.00 16.74  ? 13  G   E OP1   1 
ATOM   2969 O  OP2   . G   E 2 10 ? 14.261  -3.479  -72.849  1.00 15.47  ? 13  G   E OP2   1 
ATOM   2970 O  "O5'" . G   E 2 10 ? 15.663  -5.504  -72.258  1.00 18.49  ? 13  G   E "O5'" 1 
ATOM   2971 C  "C5'" . G   E 2 10 ? 15.946  -6.894  -72.296  1.00 19.71  ? 13  G   E "C5'" 1 
ATOM   2972 C  "C4'" . G   E 2 10 ? 17.267  -7.199  -71.641  1.00 15.60  ? 13  G   E "C4'" 1 
ATOM   2973 O  "O4'" . G   E 2 10 ? 18.339  -6.618  -72.407  1.00 20.83  ? 13  G   E "O4'" 1 
ATOM   2974 C  "C3'" . G   E 2 10 ? 17.500  -6.683  -70.237  1.00 17.76  ? 13  G   E "C3'" 1 
ATOM   2975 O  "O3'" . G   E 2 10 ? 16.892  -7.571  -69.305  1.00 22.72  ? 13  G   E "O3'" 1 
ATOM   2976 C  "C2'" . G   E 2 10 ? 19.020  -6.764  -70.137  1.00 21.68  ? 13  G   E "C2'" 1 
ATOM   2977 O  "O2'" . G   E 2 10 ? 19.478  -8.066  -69.819  1.00 24.52  ? 13  G   E "O2'" 1 
ATOM   2978 C  "C1'" . G   E 2 10 ? 19.451  -6.411  -71.563  1.00 15.32  ? 13  G   E "C1'" 1 
ATOM   2979 N  N9    . G   E 2 10 ? 19.912  -5.036  -71.727  1.00 14.19  ? 13  G   E N9    1 
ATOM   2980 C  C8    . G   E 2 10 ? 19.170  -3.936  -72.088  1.00 11.69  ? 13  G   E C8    1 
ATOM   2981 N  N7    . G   E 2 10 ? 19.876  -2.839  -72.133  1.00 11.00  ? 13  G   E N7    1 
ATOM   2982 C  C5    . G   E 2 10 ? 21.160  -3.241  -71.778  1.00 15.62  ? 13  G   E C5    1 
ATOM   2983 C  C6    . G   E 2 10 ? 22.364  -2.493  -71.637  1.00 13.14  ? 13  G   E C6    1 
ATOM   2984 O  O6    . G   E 2 10 ? 22.541  -1.293  -71.788  1.00 17.89  ? 13  G   E O6    1 
ATOM   2985 N  N1    . G   E 2 10 ? 23.431  -3.301  -71.275  1.00 11.05  ? 13  G   E N1    1 
ATOM   2986 C  C2    . G   E 2 10 ? 23.359  -4.650  -71.064  1.00 18.08  ? 13  G   E C2    1 
ATOM   2987 N  N2    . G   E 2 10 ? 24.501  -5.259  -70.726  1.00 23.44  ? 13  G   E N2    1 
ATOM   2988 N  N3    . G   E 2 10 ? 22.250  -5.357  -71.177  1.00 19.81  ? 13  G   E N3    1 
ATOM   2989 C  C4    . G   E 2 10 ? 21.197  -4.594  -71.536  1.00 15.11  ? 13  G   E C4    1 
ATOM   2990 P  P     . G   E 2 11 ? 16.323  -7.013  -67.908  1.00 24.58  ? 14  G   E P     1 
ATOM   2991 O  OP1   . G   E 2 11 ? 15.195  -7.916  -67.553  1.00 14.86  ? 14  G   E OP1   1 
ATOM   2992 O  OP2   . G   E 2 11 ? 16.097  -5.552  -67.991  1.00 21.98  ? 14  G   E OP2   1 
ATOM   2993 O  "O5'" . G   E 2 11 ? 17.512  -7.253  -66.884  1.00 12.98  ? 14  G   E "O5'" 1 
ATOM   2994 C  "C5'" . G   E 2 11 ? 17.811  -8.567  -66.434  1.00 18.06  ? 14  G   E "C5'" 1 
ATOM   2995 C  "C4'" . G   E 2 11 ? 19.209  -8.614  -65.895  1.00 15.83  ? 14  G   E "C4'" 1 
ATOM   2996 O  "O4'" . G   E 2 11 ? 20.107  -8.142  -66.929  1.00 18.28  ? 14  G   E "O4'" 1 
ATOM   2997 C  "C3'" . G   E 2 11 ? 19.474  -7.691  -64.722  1.00 17.25  ? 14  G   E "C3'" 1 
ATOM   2998 O  "O3'" . G   E 2 11 ? 19.170  -8.369  -63.515  1.00 25.53  ? 14  G   E "O3'" 1 
ATOM   2999 C  "C2'" . G   E 2 11 ? 20.971  -7.492  -64.833  1.00 14.41  ? 14  G   E "C2'" 1 
ATOM   3000 O  "O2'" . G   E 2 11 ? 21.628  -8.651  -64.363  1.00 13.02  ? 14  G   E "O2'" 1 
ATOM   3001 C  "C1'" . G   E 2 11 ? 21.137  -7.375  -66.349  1.00 12.94  ? 14  G   E "C1'" 1 
ATOM   3002 N  N9    . G   E 2 11 ? 21.001  -6.018  -66.860  1.00 16.24  ? 14  G   E N9    1 
ATOM   3003 C  C8    . G   E 2 11 ? 19.832  -5.327  -67.055  1.00 19.29  ? 14  G   E C8    1 
ATOM   3004 N  N7    . G   E 2 11 ? 20.021  -4.134  -67.550  1.00 23.50  ? 14  G   E N7    1 
ATOM   3005 C  C5    . G   E 2 11 ? 21.399  -4.033  -67.685  1.00 16.96  ? 14  G   E C5    1 
ATOM   3006 C  C6    . G   E 2 11 ? 22.195  -2.976  -68.177  1.00 21.08  ? 14  G   E C6    1 
ATOM   3007 O  O6    . G   E 2 11 ? 21.832  -1.872  -68.619  1.00 26.51  ? 14  G   E O6    1 
ATOM   3008 N  N1    . G   E 2 11 ? 23.545  -3.296  -68.133  1.00 19.17  ? 14  G   E N1    1 
ATOM   3009 C  C2    . G   E 2 11 ? 24.061  -4.479  -67.682  1.00 17.35  ? 14  G   E C2    1 
ATOM   3010 N  N2    . G   E 2 11 ? 25.396  -4.601  -67.718  1.00 21.60  ? 14  G   E N2    1 
ATOM   3011 N  N3    . G   E 2 11 ? 23.328  -5.471  -67.229  1.00 20.39  ? 14  G   E N3    1 
ATOM   3012 C  C4    . G   E 2 11 ? 22.017  -5.184  -67.258  1.00 14.96  ? 14  G   E C4    1 
ATOM   3013 P  P     . U   E 2 12 ? 18.388  -7.607  -62.343  1.00 21.48  ? 15  U   E P     1 
ATOM   3014 O  OP1   . U   E 2 12 ? 17.892  -8.626  -61.391  1.00 34.65  ? 15  U   E OP1   1 
ATOM   3015 O  OP2   . U   E 2 12 ? 17.445  -6.639  -62.959  1.00 28.40  ? 15  U   E OP2   1 
ATOM   3016 O  "O5'" . U   E 2 12 ? 19.507  -6.785  -61.585  1.00 27.01  ? 15  U   E "O5'" 1 
ATOM   3017 C  "C5'" . U   E 2 12 ? 20.601  -7.432  -60.955  1.00 23.15  ? 15  U   E "C5'" 1 
ATOM   3018 C  "C4'" . U   E 2 12 ? 21.702  -6.429  -60.756  1.00 26.78  ? 15  U   E "C4'" 1 
ATOM   3019 O  "O4'" . U   E 2 12 ? 22.061  -5.924  -62.064  1.00 23.11  ? 15  U   E "O4'" 1 
ATOM   3020 C  "C3'" . U   E 2 12 ? 21.281  -5.188  -59.970  1.00 22.36  ? 15  U   E "C3'" 1 
ATOM   3021 O  "O3'" . U   E 2 12 ? 21.590  -5.377  -58.587  1.00 31.17  ? 15  U   E "O3'" 1 
ATOM   3022 C  "C2'" . U   E 2 12 ? 22.191  -4.097  -60.530  1.00 15.25  ? 15  U   E "C2'" 1 
ATOM   3023 O  "O2'" . U   E 2 12 ? 23.384  -3.922  -59.796  1.00 28.58  ? 15  U   E "O2'" 1 
ATOM   3024 C  "C1'" . U   E 2 12 ? 22.507  -4.600  -61.942  1.00 11.95  ? 15  U   E "C1'" 1 
ATOM   3025 N  N1    . U   E 2 12 ? 21.924  -3.796  -63.016  1.00 11.06  ? 15  U   E N1    1 
ATOM   3026 C  C2    . U   E 2 12 ? 22.773  -2.924  -63.660  1.00 19.07  ? 15  U   E C2    1 
ATOM   3027 O  O2    . U   E 2 12 ? 23.967  -2.876  -63.427  1.00 24.27  ? 15  U   E O2    1 
ATOM   3028 N  N3    . U   E 2 12 ? 22.180  -2.112  -64.587  1.00 19.28  ? 15  U   E N3    1 
ATOM   3029 C  C4    . U   E 2 12 ? 20.860  -2.097  -64.938  1.00 20.40  ? 15  U   E C4    1 
ATOM   3030 O  O4    . U   E 2 12 ? 20.480  -1.289  -65.784  1.00 24.83  ? 15  U   E O4    1 
ATOM   3031 C  C5    . U   E 2 12 ? 20.041  -3.064  -64.252  1.00 17.44  ? 15  U   E C5    1 
ATOM   3032 C  C6    . U   E 2 12 ? 20.594  -3.865  -63.342  1.00 11.86  ? 15  U   E C6    1 
ATOM   3033 P  P     . G   E 2 13 ? 20.440  -5.302  -57.469  1.00 30.08  ? 16  G   E P     1 
ATOM   3034 O  OP1   . G   E 2 13 ? 19.122  -5.425  -58.135  1.00 20.87  ? 16  G   E OP1   1 
ATOM   3035 O  OP2   . G   E 2 13 ? 20.731  -4.115  -56.617  1.00 29.66  ? 16  G   E OP2   1 
ATOM   3036 O  "O5'" . G   E 2 13 ? 20.725  -6.597  -56.585  1.00 22.96  ? 16  G   E "O5'" 1 
ATOM   3037 C  "C5'" . G   E 2 13 ? 20.153  -7.848  -56.928  1.00 24.72  ? 16  G   E "C5'" 1 
ATOM   3038 C  "C4'" . G   E 2 13 ? 21.136  -8.977  -56.696  1.00 27.40  ? 16  G   E "C4'" 1 
ATOM   3039 O  "O4'" . G   E 2 13 ? 22.301  -8.814  -57.554  1.00 18.15  ? 16  G   E "O4'" 1 
ATOM   3040 C  "C3'" . G   E 2 13 ? 21.762  -9.122  -55.318  1.00 31.51  ? 16  G   E "C3'" 1 
ATOM   3041 O  "O3'" . G   E 2 13 ? 20.897  -9.717  -54.351  1.00 29.05  ? 16  G   E "O3'" 1 
ATOM   3042 C  "C2'" . G   E 2 13 ? 22.931  -10.050 -55.626  1.00 32.58  ? 16  G   E "C2'" 1 
ATOM   3043 O  "O2'" . G   E 2 13 ? 22.496  -11.392 -55.783  1.00 33.38  ? 16  G   E "O2'" 1 
ATOM   3044 C  "C1'" . G   E 2 13 ? 23.405  -9.502  -56.977  1.00 26.01  ? 16  G   E "C1'" 1 
ATOM   3045 N  N9    . G   E 2 13 ? 24.540  -8.583  -56.907  1.00 15.72  ? 16  G   E N9    1 
ATOM   3046 C  C8    . G   E 2 13 ? 24.499  -7.242  -57.165  1.00 17.52  ? 16  G   E C8    1 
ATOM   3047 N  N7    . G   E 2 13 ? 25.665  -6.661  -57.066  1.00 20.67  ? 16  G   E N7    1 
ATOM   3048 C  C5    . G   E 2 13 ? 26.534  -7.678  -56.708  1.00 15.21  ? 16  G   E C5    1 
ATOM   3049 C  C6    . G   E 2 13 ? 27.929  -7.639  -56.467  1.00 13.61  ? 16  G   E C6    1 
ATOM   3050 O  O6    . G   E 2 13 ? 28.684  -6.672  -56.528  1.00 14.86  ? 16  G   E O6    1 
ATOM   3051 N  N1    . G   E 2 13 ? 28.431  -8.887  -56.132  1.00 12.56  ? 16  G   E N1    1 
ATOM   3052 C  C2    . G   E 2 13 ? 27.685  -10.034 -56.043  1.00 22.70  ? 16  G   E C2    1 
ATOM   3053 N  N2    . G   E 2 13 ? 28.368  -11.141 -55.705  1.00 19.27  ? 16  G   E N2    1 
ATOM   3054 N  N3    . G   E 2 13 ? 26.369  -10.090 -56.268  1.00 23.25  ? 16  G   E N3    1 
ATOM   3055 C  C4    . G   E 2 13 ? 25.863  -8.877  -56.596  1.00 18.46  ? 16  G   E C4    1 
ATOM   3056 P  P     . C   E 2 14 ? 21.217  -9.529  -52.784  1.00 28.32  ? 17  C   E P     1 
ATOM   3057 O  OP1   . C   E 2 14 ? 20.127  -10.168 -51.989  1.00 10.11  ? 17  C   E OP1   1 
ATOM   3058 O  OP2   . C   E 2 14 ? 21.530  -8.088  -52.598  1.00 12.39  ? 17  C   E OP2   1 
ATOM   3059 O  "O5'" . C   E 2 14 ? 22.556  -10.364 -52.550  1.00 18.06  ? 17  C   E "O5'" 1 
ATOM   3060 C  "C5'" . C   E 2 14 ? 22.503  -11.787 -52.366  1.00 22.12  ? 17  C   E "C5'" 1 
ATOM   3061 C  "C4'" . C   E 2 14 ? 23.870  -12.331 -52.017  1.00 12.67  ? 17  C   E "C4'" 1 
ATOM   3062 O  "O4'" . C   E 2 14 ? 24.780  -11.993 -53.089  1.00 16.39  ? 17  C   E "O4'" 1 
ATOM   3063 C  "C3'" . C   E 2 14 ? 24.511  -11.712 -50.789  1.00 18.70  ? 17  C   E "C3'" 1 
ATOM   3064 O  "O3'" . C   E 2 14 ? 24.151  -12.389 -49.601  1.00 25.55  ? 17  C   E "O3'" 1 
ATOM   3065 C  "C2'" . C   E 2 14 ? 25.986  -11.910 -51.053  1.00 13.72  ? 17  C   E "C2'" 1 
ATOM   3066 O  "O2'" . C   E 2 14 ? 26.378  -13.221 -50.748  1.00 19.80  ? 17  C   E "O2'" 1 
ATOM   3067 C  "C1'" . C   E 2 14 ? 26.050  -11.663 -52.555  1.00 18.61  ? 17  C   E "C1'" 1 
ATOM   3068 N  N1    . C   E 2 14 ? 26.327  -10.250 -52.840  1.00 20.68  ? 17  C   E N1    1 
ATOM   3069 C  C2    . C   E 2 14 ? 27.641  -9.783  -52.689  1.00 21.05  ? 17  C   E C2    1 
ATOM   3070 O  O2    . C   E 2 14 ? 28.523  -10.587 -52.362  1.00 20.40  ? 17  C   E O2    1 
ATOM   3071 N  N3    . C   E 2 14 ? 27.911  -8.475  -52.902  1.00 17.86  ? 17  C   E N3    1 
ATOM   3072 C  C4    . C   E 2 14 ? 26.928  -7.649  -53.258  1.00 20.88  ? 17  C   E C4    1 
ATOM   3073 N  N4    . C   E 2 14 ? 27.230  -6.367  -53.448  1.00 24.18  ? 17  C   E N4    1 
ATOM   3074 C  C5    . C   E 2 14 ? 25.583  -8.102  -53.434  1.00 22.98  ? 17  C   E C5    1 
ATOM   3075 C  C6    . C   E 2 14 ? 25.331  -9.398  -53.221  1.00 15.30  ? 17  C   E C6    1 
ATOM   3076 P  P     . C   E 2 15 ? 23.987  -11.549 -48.250  1.00 27.55  ? 18  C   E P     1 
ATOM   3077 O  OP1   . C   E 2 15 ? 23.216  -12.369 -47.290  1.00 18.81  ? 18  C   E OP1   1 
ATOM   3078 O  OP2   . C   E 2 15 ? 23.454  -10.241 -48.688  1.00 24.18  ? 18  C   E OP2   1 
ATOM   3079 O  "O5'" . C   E 2 15 ? 25.482  -11.302 -47.729  1.00 21.94  ? 18  C   E "O5'" 1 
ATOM   3080 C  "C5'" . C   E 2 15 ? 26.372  -12.388 -47.498  1.00 15.92  ? 18  C   E "C5'" 1 
ATOM   3081 C  "C4'" . C   E 2 15 ? 27.612  -11.936 -46.740  1.00 22.70  ? 18  C   E "C4'" 1 
ATOM   3082 O  "O4'" . C   E 2 15 ? 28.406  -11.048 -47.571  1.00 24.47  ? 18  C   E "O4'" 1 
ATOM   3083 C  "C3'" . C   E 2 15 ? 27.259  -11.125 -45.489  1.00 27.57  ? 18  C   E "C3'" 1 
ATOM   3084 O  "O3'" . C   E 2 15 ? 27.955  -11.507 -44.302  1.00 26.23  ? 18  C   E "O3'" 1 
ATOM   3085 C  "C2'" . C   E 2 15 ? 27.430  -9.660  -45.871  1.00 30.13  ? 18  C   E "C2'" 1 
ATOM   3086 O  "O2'" . C   E 2 15 ? 28.031  -8.907  -44.839  1.00 35.46  ? 18  C   E "O2'" 1 
ATOM   3087 C  "C1'" . C   E 2 15 ? 28.447  -9.763  -47.004  1.00 30.46  ? 18  C   E "C1'" 1 
ATOM   3088 N  N1    . C   E 2 15 ? 28.416  -8.738  -48.043  1.00 36.13  ? 18  C   E N1    1 
ATOM   3089 C  C2    . C   E 2 15 ? 29.458  -7.818  -48.071  1.00 39.39  ? 18  C   E C2    1 
ATOM   3090 O  O2    . C   E 2 15 ? 30.395  -7.961  -47.282  1.00 35.98  ? 18  C   E O2    1 
ATOM   3091 N  N3    . C   E 2 15 ? 29.426  -6.806  -48.958  1.00 42.95  ? 18  C   E N3    1 
ATOM   3092 C  C4    . C   E 2 15 ? 28.409  -6.706  -49.813  1.00 47.99  ? 18  C   E C4    1 
ATOM   3093 N  N4    . C   E 2 15 ? 28.410  -5.679  -50.666  1.00 55.15  ? 18  C   E N4    1 
ATOM   3094 C  C5    . C   E 2 15 ? 27.344  -7.655  -49.831  1.00 47.99  ? 18  C   E C5    1 
ATOM   3095 C  C6    . C   E 2 15 ? 27.390  -8.650  -48.938  1.00 42.07  ? 18  C   E C6    1 
ATOM   3096 P  P     . C   E 2 16 ? 27.764  -12.975 -43.692  1.00 30.87  ? 19  C   E P     1 
ATOM   3097 O  OP1   . C   E 2 16 ? 27.368  -13.951 -44.736  1.00 28.65  ? 19  C   E OP1   1 
ATOM   3098 O  OP2   . C   E 2 16 ? 26.911  -12.782 -42.500  1.00 39.50  ? 19  C   E OP2   1 
ATOM   3099 O  "O5'" . C   E 2 16 ? 29.215  -13.361 -43.188  1.00 22.65  ? 19  C   E "O5'" 1 
ATOM   3100 C  "C5'" . C   E 2 16 ? 29.938  -12.440 -42.409  1.00 29.32  ? 19  C   E "C5'" 1 
ATOM   3101 C  "C4'" . C   E 2 16 ? 31.275  -13.002 -42.019  1.00 30.12  ? 19  C   E "C4'" 1 
ATOM   3102 O  "O4'" . C   E 2 16 ? 31.953  -13.539 -43.184  1.00 27.87  ? 19  C   E "O4'" 1 
ATOM   3103 C  "C3'" . C   E 2 16 ? 32.183  -11.916 -41.479  1.00 33.53  ? 19  C   E "C3'" 1 
ATOM   3104 O  "O3'" . C   E 2 16 ? 31.959  -11.751 -40.081  1.00 27.68  ? 19  C   E "O3'" 1 
ATOM   3105 C  "C2'" . C   E 2 16 ? 33.575  -12.424 -41.837  1.00 35.83  ? 19  C   E "C2'" 1 
ATOM   3106 O  "O2'" . C   E 2 16 ? 34.095  -13.309 -40.867  1.00 47.44  ? 19  C   E "O2'" 1 
ATOM   3107 C  "C1'" . C   E 2 16 ? 33.315  -13.149 -43.166  1.00 33.05  ? 19  C   E "C1'" 1 
ATOM   3108 N  N1    . C   E 2 16 ? 33.558  -12.327 -44.363  1.00 31.20  ? 19  C   E N1    1 
ATOM   3109 C  C2    . C   E 2 16 ? 34.759  -12.482 -45.064  1.00 37.00  ? 19  C   E C2    1 
ATOM   3110 O  O2    . C   E 2 16 ? 35.594  -13.302 -44.651  1.00 40.85  ? 19  C   E O2    1 
ATOM   3111 N  N3    . C   E 2 16 ? 34.976  -11.738 -46.175  1.00 33.03  ? 19  C   E N3    1 
ATOM   3112 C  C4    . C   E 2 16 ? 34.048  -10.872 -46.584  1.00 31.40  ? 19  C   E C4    1 
ATOM   3113 N  N4    . C   E 2 16 ? 34.294  -10.165 -47.678  1.00 35.74  ? 19  C   E N4    1 
ATOM   3114 C  C5    . C   E 2 16 ? 32.825  -10.693 -45.886  1.00 30.51  ? 19  C   E C5    1 
ATOM   3115 C  C6    . C   E 2 16 ? 32.622  -11.431 -44.792  1.00 29.14  ? 19  C   E C6    1 
ATOM   3116 P  P     . U   E 2 17 ? 31.065  -10.519 -39.560  1.00 31.91  ? 20  U   E P     1 
ATOM   3117 O  OP1   . U   E 2 17 ? 31.106  -10.504 -38.080  1.00 24.87  ? 20  U   E OP1   1 
ATOM   3118 O  OP2   . U   E 2 17 ? 29.757  -10.570 -40.256  1.00 35.08  ? 20  U   E OP2   1 
ATOM   3119 O  "O5'" . U   E 2 17 ? 31.848  -9.245  -40.090  1.00 25.55  ? 20  U   E "O5'" 1 
ATOM   3120 C  "C5'" . U   E 2 17 ? 33.200  -9.045  -39.722  1.00 32.30  ? 20  U   E "C5'" 1 
ATOM   3121 C  "C4'" . U   E 2 17 ? 33.529  -7.589  -39.774  1.00 34.47  ? 20  U   E "C4'" 1 
ATOM   3122 O  "O4'" . U   E 2 17 ? 33.805  -7.199  -41.136  1.00 35.87  ? 20  U   E "O4'" 1 
ATOM   3123 C  "C3'" . U   E 2 17 ? 32.386  -6.685  -39.364  1.00 40.04  ? 20  U   E "C3'" 1 
ATOM   3124 O  "O3'" . U   E 2 17 ? 32.298  -6.578  -37.956  1.00 47.22  ? 20  U   E "O3'" 1 
ATOM   3125 C  "C2'" . U   E 2 17 ? 32.777  -5.368  -40.015  1.00 37.19  ? 20  U   E "C2'" 1 
ATOM   3126 O  "O2'" . U   E 2 17 ? 33.742  -4.664  -39.260  1.00 31.54  ? 20  U   E "O2'" 1 
ATOM   3127 C  "C1'" . U   E 2 17 ? 33.388  -5.856  -41.331  1.00 40.03  ? 20  U   E "C1'" 1 
ATOM   3128 N  N1    . U   E 2 17 ? 32.445  -5.814  -42.459  1.00 39.22  ? 20  U   E N1    1 
ATOM   3129 C  C2    . U   E 2 17 ? 32.321  -4.621  -43.135  1.00 35.13  ? 20  U   E C2    1 
ATOM   3130 O  O2    . U   E 2 17 ? 32.956  -3.634  -42.836  1.00 36.29  ? 20  U   E O2    1 
ATOM   3131 N  N3    . U   E 2 17 ? 31.427  -4.626  -44.173  1.00 36.23  ? 20  U   E N3    1 
ATOM   3132 C  C4    . U   E 2 17 ? 30.659  -5.683  -44.596  1.00 45.50  ? 20  U   E C4    1 
ATOM   3133 O  O4    . U   E 2 17 ? 29.890  -5.531  -45.549  1.00 50.15  ? 20  U   E O4    1 
ATOM   3134 C  C5    . U   E 2 17 ? 30.846  -6.893  -43.845  1.00 49.38  ? 20  U   E C5    1 
ATOM   3135 C  C6    . U   E 2 17 ? 31.712  -6.915  -42.827  1.00 44.21  ? 20  U   E C6    1 
ATOM   3136 P  P     . C   E 2 18 ? 31.160  -5.659  -37.311  1.00 50.21  ? 21  C   E P     1 
ATOM   3137 O  OP1   . C   E 2 18 ? 31.319  -5.677  -35.834  1.00 48.60  ? 21  C   E OP1   1 
ATOM   3138 O  OP2   . C   E 2 18 ? 29.861  -6.039  -37.916  1.00 47.48  ? 21  C   E OP2   1 
ATOM   3139 O  "O5'" . C   E 2 18 ? 31.539  -4.215  -37.845  1.00 49.13  ? 21  C   E "O5'" 1 
ATOM   3140 C  "C5'" . C   E 2 18 ? 30.545  -3.234  -38.039  1.00 47.20  ? 21  C   E "C5'" 1 
ATOM   3141 C  "C4'" . C   E 2 18 ? 31.177  -1.961  -38.523  1.00 49.41  ? 21  C   E "C4'" 1 
ATOM   3142 O  "O4'" . C   E 2 18 ? 31.819  -2.183  -39.811  1.00 55.29  ? 21  C   E "O4'" 1 
ATOM   3143 C  "C3'" . C   E 2 18 ? 30.166  -0.874  -38.791  1.00 47.67  ? 21  C   E "C3'" 1 
ATOM   3144 O  "O3'" . C   E 2 18 ? 29.870  -0.201  -37.598  1.00 37.37  ? 21  C   E "O3'" 1 
ATOM   3145 C  "C2'" . C   E 2 18 ? 30.865  -0.032  -39.838  1.00 52.38  ? 21  C   E "C2'" 1 
ATOM   3146 O  "O2'" . C   E 2 18 ? 31.877  0.791   -39.291  1.00 49.87  ? 21  C   E "O2'" 1 
ATOM   3147 C  "C1'" . C   E 2 18 ? 31.468  -1.137  -40.707  1.00 55.12  ? 21  C   E "C1'" 1 
ATOM   3148 N  N1    . C   E 2 18 ? 30.480  -1.690  -41.650  1.00 58.30  ? 21  C   E N1    1 
ATOM   3149 C  C2    . C   E 2 18 ? 30.083  -0.932  -42.748  1.00 59.90  ? 21  C   E C2    1 
ATOM   3150 O  O2    . C   E 2 18 ? 30.584  0.185   -42.917  1.00 67.30  ? 21  C   E O2    1 
ATOM   3151 N  N3    . C   E 2 18 ? 29.165  -1.433  -43.598  1.00 58.53  ? 21  C   E N3    1 
ATOM   3152 C  C4    . C   E 2 18 ? 28.650  -2.642  -43.382  1.00 60.29  ? 21  C   E C4    1 
ATOM   3153 N  N4    . C   E 2 18 ? 27.742  -3.097  -44.239  1.00 72.99  ? 21  C   E N4    1 
ATOM   3154 C  C5    . C   E 2 18 ? 29.041  -3.439  -42.277  1.00 60.63  ? 21  C   E C5    1 
ATOM   3155 C  C6    . C   E 2 18 ? 29.949  -2.931  -41.444  1.00 60.18  ? 21  C   E C6    1 
ATOM   3156 P  P     . C   E 2 19 ? 28.348  -0.055  -37.166  1.00 41.77  ? 22  C   E P     1 
ATOM   3157 O  OP1   . C   E 2 19 ? 28.325  0.166   -35.701  1.00 47.58  ? 22  C   E OP1   1 
ATOM   3158 O  OP2   . C   E 2 19 ? 27.615  -1.208  -37.748  1.00 41.33  ? 22  C   E OP2   1 
ATOM   3159 O  "O5'" . C   E 2 19 ? 27.898  1.264   -37.930  1.00 32.40  ? 22  C   E "O5'" 1 
ATOM   3160 C  "C5'" . C   E 2 19 ? 28.721  2.415   -37.886  1.00 32.43  ? 22  C   E "C5'" 1 
ATOM   3161 C  "C4'" . C   E 2 19 ? 28.321  3.386   -38.958  1.00 37.41  ? 22  C   E "C4'" 1 
ATOM   3162 O  "O4'" . C   E 2 19 ? 28.718  2.886   -40.266  1.00 39.05  ? 22  C   E "O4'" 1 
ATOM   3163 C  "C3'" . C   E 2 19 ? 26.833  3.625   -39.117  1.00 35.76  ? 22  C   E "C3'" 1 
ATOM   3164 O  "O3'" . C   E 2 19 ? 26.310  4.500   -38.132  1.00 35.44  ? 22  C   E "O3'" 1 
ATOM   3165 C  "C2'" . C   E 2 19 ? 26.790  4.239   -40.506  1.00 33.66  ? 22  C   E "C2'" 1 
ATOM   3166 O  "O2'" . C   E 2 19 ? 27.213  5.588   -40.484  1.00 24.37  ? 22  C   E "O2'" 1 
ATOM   3167 C  "C1'" . C   E 2 19 ? 27.801  3.355   -41.248  1.00 34.03  ? 22  C   E "C1'" 1 
ATOM   3168 N  N1    . C   E 2 19 ? 27.144  2.184   -41.857  1.00 35.28  ? 22  C   E N1    1 
ATOM   3169 C  C2    . C   E 2 19 ? 26.626  2.285   -43.161  1.00 31.03  ? 22  C   E C2    1 
ATOM   3170 O  O2    . C   E 2 19 ? 26.772  3.345   -43.790  1.00 28.08  ? 22  C   E O2    1 
ATOM   3171 N  N3    . C   E 2 19 ? 25.983  1.220   -43.698  1.00 28.73  ? 22  C   E N3    1 
ATOM   3172 C  C4    . C   E 2 19 ? 25.853  0.089   -42.993  1.00 30.29  ? 22  C   E C4    1 
ATOM   3173 N  N4    . C   E 2 19 ? 25.204  -0.935  -43.555  1.00 21.72  ? 22  C   E N4    1 
ATOM   3174 C  C5    . C   E 2 19 ? 26.381  -0.042  -41.678  1.00 33.51  ? 22  C   E C5    1 
ATOM   3175 C  C6    . C   E 2 19 ? 27.016  1.017   -41.155  1.00 37.11  ? 22  C   E C6    1 
ATOM   3176 P  P     . A   E 2 20 ? 24.740  4.463   -37.803  1.00 41.24  ? 23  A   E P     1 
ATOM   3177 O  OP1   . A   E 2 20 ? 24.437  5.493   -36.772  1.00 37.66  ? 23  A   E OP1   1 
ATOM   3178 O  OP2   . A   E 2 20 ? 24.360  3.045   -37.568  1.00 41.16  ? 23  A   E OP2   1 
ATOM   3179 O  "O5'" . A   E 2 20 ? 24.061  4.901   -39.168  1.00 28.40  ? 23  A   E "O5'" 1 
ATOM   3180 C  "C5'" . A   E 2 20 ? 24.243  6.207   -39.677  1.00 21.42  ? 23  A   E "C5'" 1 
ATOM   3181 C  "C4'" . A   E 2 20 ? 23.471  6.364   -40.956  1.00 26.14  ? 23  A   E "C4'" 1 
ATOM   3182 O  "O4'" . A   E 2 20 ? 24.065  5.518   -41.973  1.00 19.56  ? 23  A   E "O4'" 1 
ATOM   3183 C  "C3'" . A   E 2 20 ? 22.034  5.881   -40.898  1.00 30.57  ? 23  A   E "C3'" 1 
ATOM   3184 O  "O3'" . A   E 2 20 ? 21.150  6.839   -40.348  1.00 40.28  ? 23  A   E "O3'" 1 
ATOM   3185 C  "C2'" . A   E 2 20 ? 21.741  5.647   -42.363  1.00 26.38  ? 23  A   E "C2'" 1 
ATOM   3186 O  "O2'" . A   E 2 20 ? 21.567  6.876   -43.034  1.00 24.26  ? 23  A   E "O2'" 1 
ATOM   3187 C  "C1'" . A   E 2 20 ? 23.047  4.992   -42.807  1.00 26.23  ? 23  A   E "C1'" 1 
ATOM   3188 N  N9    . A   E 2 20 ? 23.024  3.539   -42.642  1.00 23.82  ? 23  A   E N9    1 
ATOM   3189 C  C8    . A   E 2 20 ? 23.712  2.801   -41.722  1.00 24.84  ? 23  A   E C8    1 
ATOM   3190 N  N7    . A   E 2 20 ? 23.500  1.513   -41.811  1.00 31.79  ? 23  A   E N7    1 
ATOM   3191 C  C5    . A   E 2 20 ? 22.606  1.392   -42.864  1.00 28.59  ? 23  A   E C5    1 
ATOM   3192 C  C6    . A   E 2 20 ? 21.987  0.278   -43.457  1.00 25.95  ? 23  A   E C6    1 
ATOM   3193 N  N6    . A   E 2 20 ? 22.188  -0.974  -43.058  1.00 22.20  ? 23  A   E N6    1 
ATOM   3194 N  N1    . A   E 2 20 ? 21.145  0.499   -44.486  1.00 27.31  ? 23  A   E N1    1 
ATOM   3195 C  C2    . A   E 2 20 ? 20.946  1.759   -44.884  1.00 29.83  ? 23  A   E C2    1 
ATOM   3196 N  N3    . A   E 2 20 ? 21.468  2.887   -44.410  1.00 30.70  ? 23  A   E N3    1 
ATOM   3197 C  C4    . A   E 2 20 ? 22.302  2.632   -43.386  1.00 28.51  ? 23  A   E C4    1 
ATOM   3198 P  P     . U   E 2 21 ? 19.893  6.339   -39.482  1.00 49.93  ? 24  U   E P     1 
ATOM   3199 O  OP1   . U   E 2 21 ? 19.218  7.539   -38.930  1.00 53.78  ? 24  U   E OP1   1 
ATOM   3200 O  OP2   . U   E 2 21 ? 20.364  5.269   -38.561  1.00 50.36  ? 24  U   E OP2   1 
ATOM   3201 O  "O5'" . U   E 2 21 ? 18.937  5.650   -40.553  1.00 49.70  ? 24  U   E "O5'" 1 
ATOM   3202 C  "C5'" . U   E 2 21 ? 18.344  6.413   -41.594  1.00 46.82  ? 24  U   E "C5'" 1 
ATOM   3203 C  "C4'" . U   E 2 21 ? 17.543  5.521   -42.509  1.00 41.35  ? 24  U   E "C4'" 1 
ATOM   3204 O  "O4'" . U   E 2 21 ? 18.406  4.449   -42.970  1.00 37.95  ? 24  U   E "O4'" 1 
ATOM   3205 C  "C3'" . U   E 2 21 ? 16.366  4.776   -41.897  1.00 41.00  ? 24  U   E "C3'" 1 
ATOM   3206 O  "O3'" . U   E 2 21 ? 15.195  5.586   -41.814  1.00 42.68  ? 24  U   E "O3'" 1 
ATOM   3207 C  "C2'" . U   E 2 21 ? 16.167  3.643   -42.896  1.00 41.85  ? 24  U   E "C2'" 1 
ATOM   3208 O  "O2'" . U   E 2 21 ? 15.440  4.038   -44.047  1.00 40.24  ? 24  U   E "O2'" 1 
ATOM   3209 C  "C1'" . U   E 2 21 ? 17.614  3.316   -43.275  1.00 39.77  ? 24  U   E "C1'" 1 
ATOM   3210 N  N1    . U   E 2 21 ? 18.141  2.145   -42.563  1.00 32.28  ? 24  U   E N1    1 
ATOM   3211 C  C2    . U   E 2 21 ? 17.702  0.928   -42.994  1.00 32.15  ? 24  U   E C2    1 
ATOM   3212 O  O2    . U   E 2 21 ? 16.928  0.810   -43.922  1.00 35.55  ? 24  U   E O2    1 
ATOM   3213 N  N3    . U   E 2 21 ? 18.194  -0.149  -42.307  1.00 35.26  ? 24  U   E N3    1 
ATOM   3214 C  C4    . U   E 2 21 ? 19.067  -0.130  -41.254  1.00 33.95  ? 24  U   E C4    1 
ATOM   3215 O  O4    . U   E 2 21 ? 19.412  -1.198  -40.731  1.00 32.25  ? 24  U   E O4    1 
ATOM   3216 C  C5    . U   E 2 21 ? 19.485  1.181   -40.863  1.00 33.44  ? 24  U   E C5    1 
ATOM   3217 C  C6    . U   E 2 21 ? 19.018  2.249   -41.518  1.00 33.76  ? 24  U   E C6    1 
ATOM   3218 P  P     . U   E 2 22 ? 14.100  5.290   -40.668  1.00 44.32  ? 25  U   E P     1 
ATOM   3219 O  OP1   . U   E 2 22 ? 13.158  6.437   -40.580  1.00 41.58  ? 25  U   E OP1   1 
ATOM   3220 O  OP2   . U   E 2 22 ? 14.874  4.882   -39.467  1.00 43.04  ? 25  U   E OP2   1 
ATOM   3221 O  "O5'" . U   E 2 22 ? 13.297  4.013   -41.187  1.00 34.57  ? 25  U   E "O5'" 1 
ATOM   3222 C  "C5'" . U   E 2 22 ? 12.204  4.124   -42.103  1.00 31.63  ? 25  U   E "C5'" 1 
ATOM   3223 C  "C4'" . U   E 2 22 ? 11.114  3.183   -41.676  1.00 30.02  ? 25  U   E "C4'" 1 
ATOM   3224 O  "O4'" . U   E 2 22 ? 11.770  1.952   -41.325  1.00 32.25  ? 25  U   E "O4'" 1 
ATOM   3225 C  "C3'" . U   E 2 22 ? 10.400  3.645   -40.411  1.00 36.62  ? 25  U   E "C3'" 1 
ATOM   3226 O  "O3'" . U   E 2 22 ? 9.067   4.105   -40.691  1.00 39.25  ? 25  U   E "O3'" 1 
ATOM   3227 C  "C2'" . U   E 2 22 ? 10.191  2.375   -39.577  1.00 40.33  ? 25  U   E "C2'" 1 
ATOM   3228 O  "O2'" . U   E 2 22 ? 8.850   1.940   -39.573  1.00 55.81  ? 25  U   E "O2'" 1 
ATOM   3229 C  "C1'" . U   E 2 22 ? 11.057  1.334   -40.287  1.00 38.71  ? 25  U   E "C1'" 1 
ATOM   3230 N  N1    . U   E 2 22 ? 11.962  0.503   -39.479  1.00 35.73  ? 25  U   E N1    1 
ATOM   3231 C  C2    . U   E 2 22 ? 11.421  -0.641  -38.916  1.00 34.16  ? 25  U   E C2    1 
ATOM   3232 O  O2    . U   E 2 22 ? 10.235  -0.925  -39.008  1.00 27.94  ? 25  U   E O2    1 
ATOM   3233 N  N3    . U   E 2 22 ? 12.315  -1.439  -38.243  1.00 30.32  ? 25  U   E N3    1 
ATOM   3234 C  C4    . U   E 2 22 ? 13.663  -1.206  -38.065  1.00 30.90  ? 25  U   E C4    1 
ATOM   3235 O  O4    . U   E 2 22 ? 14.345  -2.032  -37.449  1.00 23.81  ? 25  U   E O4    1 
ATOM   3236 C  C5    . U   E 2 22 ? 14.139  0.018   -38.647  1.00 31.38  ? 25  U   E C5    1 
ATOM   3237 C  C6    . U   E 2 22 ? 13.292  0.813   -39.313  1.00 34.18  ? 25  U   E C6    1 
ATOM   3238 P  P     . G   E 2 23 ? 8.767   5.174   -41.865  1.00 38.56  ? 26  G   E P     1 
ATOM   3239 O  OP1   . G   E 2 23 ? 9.628   6.380   -41.711  1.00 34.68  ? 26  G   E OP1   1 
ATOM   3240 O  OP2   . G   E 2 23 ? 7.289   5.325   -41.863  1.00 32.86  ? 26  G   E OP2   1 
ATOM   3241 O  "O5'" . G   E 2 23 ? 9.132   4.437   -43.233  1.00 39.25  ? 26  G   E "O5'" 1 
ATOM   3242 C  "C5'" . G   E 2 23 ? 8.879   5.081   -44.490  1.00 35.54  ? 26  G   E "C5'" 1 
ATOM   3243 C  "C4'" . G   E 2 23 ? 9.647   4.403   -45.605  1.00 27.53  ? 26  G   E "C4'" 1 
ATOM   3244 O  "O4'" . G   E 2 23 ? 10.741  3.651   -45.018  1.00 24.02  ? 26  G   E "O4'" 1 
ATOM   3245 C  "C3'" . G   E 2 23 ? 8.881   3.369   -46.417  1.00 28.03  ? 26  G   E "C3'" 1 
ATOM   3246 O  "O3'" . G   E 2 23 ? 8.155   3.955   -47.489  1.00 27.53  ? 26  G   E "O3'" 1 
ATOM   3247 C  "C2'" . G   E 2 23 ? 10.002  2.491   -46.944  1.00 26.24  ? 26  G   E "C2'" 1 
ATOM   3248 O  "O2'" . G   E 2 23 ? 10.679  3.055   -48.038  1.00 23.31  ? 26  G   E "O2'" 1 
ATOM   3249 C  "C1'" . G   E 2 23 ? 10.931  2.445   -45.735  1.00 29.83  ? 26  G   E "C1'" 1 
ATOM   3250 N  N9    . G   E 2 23 ? 10.600  1.327   -44.856  1.00 31.34  ? 26  G   E N9    1 
ATOM   3251 C  C8    . G   E 2 23 ? 9.350   0.839   -44.566  1.00 30.22  ? 26  G   E C8    1 
ATOM   3252 N  N7    . G   E 2 23 ? 9.374   -0.190  -43.770  1.00 33.11  ? 26  G   E N7    1 
ATOM   3253 C  C5    . G   E 2 23 ? 10.719  -0.387  -43.514  1.00 33.58  ? 26  G   E C5    1 
ATOM   3254 C  C6    . G   E 2 23 ? 11.357  -1.348  -42.713  1.00 36.09  ? 26  G   E C6    1 
ATOM   3255 O  O6    . G   E 2 23 ? 10.844  -2.247  -42.040  1.00 34.70  ? 26  G   E O6    1 
ATOM   3256 N  N1    . G   E 2 23 ? 12.739  -1.191  -42.735  1.00 37.37  ? 26  G   E N1    1 
ATOM   3257 C  C2    . G   E 2 23 ? 13.412  -0.221  -43.436  1.00 35.14  ? 26  G   E C2    1 
ATOM   3258 N  N2    . G   E 2 23 ? 14.741  -0.223  -43.328  1.00 37.63  ? 26  G   E N2    1 
ATOM   3259 N  N3    . G   E 2 23 ? 12.824  0.685   -44.184  1.00 33.29  ? 26  G   E N3    1 
ATOM   3260 C  C4    . G   E 2 23 ? 11.486  0.544   -44.178  1.00 31.97  ? 26  G   E C4    1 
ATOM   3261 P  P     . C   E 2 24 ? 6.565   3.756   -47.576  1.00 33.09  ? 27  C   E P     1 
ATOM   3262 O  OP1   . C   E 2 24 ? 5.929   5.086   -47.425  1.00 23.44  ? 27  C   E OP1   1 
ATOM   3263 O  OP2   . C   E 2 24 ? 6.165   2.630   -46.688  1.00 36.15  ? 27  C   E OP2   1 
ATOM   3264 O  "O5'" . C   E 2 24 ? 6.302   3.225   -49.043  1.00 34.84  ? 27  C   E "O5'" 1 
ATOM   3265 C  "C5'" . C   E 2 24 ? 6.652   1.900   -49.394  1.00 32.79  ? 27  C   E "C5'" 1 
ATOM   3266 C  "C4'" . C   E 2 24 ? 5.639   1.342   -50.352  1.00 33.71  ? 27  C   E "C4'" 1 
ATOM   3267 O  "O4'" . C   E 2 24 ? 4.700   0.503   -49.630  1.00 42.05  ? 27  C   E "O4'" 1 
ATOM   3268 C  "C3'" . C   E 2 24 ? 4.815   2.487   -50.930  1.00 35.03  ? 27  C   E "C3'" 1 
ATOM   3269 O  "O3'" . C   E 2 24 ? 4.687   2.425   -52.333  1.00 39.12  ? 27  C   E "O3'" 1 
ATOM   3270 C  "C2'" . C   E 2 24 ? 3.504   2.517   -50.147  1.00 37.92  ? 27  C   E "C2'" 1 
ATOM   3271 O  "O2'" . C   E 2 24 ? 2.391   2.693   -50.995  1.00 44.29  ? 27  C   E "O2'" 1 
ATOM   3272 C  "C1'" . C   E 2 24 ? 3.416   1.074   -49.669  1.00 42.85  ? 27  C   E "C1'" 1 
ATOM   3273 N  N1    . C   E 2 24 ? 2.651   0.742   -48.459  1.00 45.32  ? 27  C   E N1    1 
ATOM   3274 C  C2    . C   E 2 24 ? 1.551   -0.136  -48.602  1.00 42.26  ? 27  C   E C2    1 
ATOM   3275 O  O2    . C   E 2 24 ? 1.292   -0.595  -49.728  1.00 30.88  ? 27  C   E O2    1 
ATOM   3276 N  N3    . C   E 2 24 ? 0.811   -0.459  -47.516  1.00 40.01  ? 27  C   E N3    1 
ATOM   3277 C  C4    . C   E 2 24 ? 1.128   0.049   -46.323  1.00 45.11  ? 27  C   E C4    1 
ATOM   3278 N  N4    . C   E 2 24 ? 0.379   -0.310  -45.282  1.00 44.51  ? 27  C   E N4    1 
ATOM   3279 C  C5    . C   E 2 24 ? 2.237   0.946   -46.147  1.00 48.42  ? 27  C   E C5    1 
ATOM   3280 C  C6    . C   E 2 24 ? 2.968   1.259   -47.234  1.00 43.90  ? 27  C   E C6    1 
ATOM   3281 P  P     . A   E 2 25 ? 5.578   3.364   -53.259  1.00 39.81  ? 28  A   E P     1 
ATOM   3282 O  OP1   . A   E 2 25 ? 6.635   4.010   -52.445  1.00 28.01  ? 28  A   E OP1   1 
ATOM   3283 O  OP2   . A   E 2 25 ? 4.609   4.199   -54.002  1.00 48.38  ? 28  A   E OP2   1 
ATOM   3284 O  "O5'" . A   E 2 25 ? 6.247   2.336   -54.281  1.00 38.39  ? 28  A   E "O5'" 1 
ATOM   3285 C  "C5'" . A   E 2 25 ? 7.567   1.832   -54.054  1.00 37.38  ? 28  A   E "C5'" 1 
ATOM   3286 C  "C4'" . A   E 2 25 ? 7.636   0.356   -54.377  1.00 24.38  ? 28  A   E "C4'" 1 
ATOM   3287 O  "O4'" . A   E 2 25 ? 6.698   -0.347  -53.531  1.00 23.90  ? 28  A   E "O4'" 1 
ATOM   3288 C  "C3'" . A   E 2 25 ? 7.197   -0.025  -55.775  1.00 30.77  ? 28  A   E "C3'" 1 
ATOM   3289 O  "O3'" . A   E 2 25 ? 8.246   0.181   -56.709  1.00 33.05  ? 28  A   E "O3'" 1 
ATOM   3290 C  "C2'" . A   E 2 25 ? 6.797   -1.491  -55.614  1.00 23.69  ? 28  A   E "C2'" 1 
ATOM   3291 O  "O2'" . A   E 2 25 ? 7.879   -2.392  -55.638  1.00 16.20  ? 28  A   E "O2'" 1 
ATOM   3292 C  "C1'" . A   E 2 25 ? 6.213   -1.493  -54.202  1.00 19.05  ? 28  A   E "C1'" 1 
ATOM   3293 N  N9    . A   E 2 25 ? 4.754   -1.496  -54.114  1.00 11.68  ? 28  A   E N9    1 
ATOM   3294 C  C8    . A   E 2 25 ? 3.932   -0.451  -53.797  1.00 9.69   ? 28  A   E C8    1 
ATOM   3295 N  N7    . A   E 2 25 ? 2.661   -0.772  -53.755  1.00 14.42  ? 28  A   E N7    1 
ATOM   3296 C  C5    . A   E 2 25 ? 2.649   -2.119  -54.079  1.00 7.35   ? 28  A   E C5    1 
ATOM   3297 C  C6    . A   E 2 25 ? 1.613   -3.040  -54.212  1.00 11.22  ? 28  A   E C6    1 
ATOM   3298 N  N6    . A   E 2 25 ? 0.331   -2.735  -54.022  1.00 14.19  ? 28  A   E N6    1 
ATOM   3299 N  N1    . A   E 2 25 ? 1.935   -4.306  -54.550  1.00 16.37  ? 28  A   E N1    1 
ATOM   3300 C  C2    . A   E 2 25 ? 3.218   -4.613  -54.735  1.00 9.58   ? 28  A   E C2    1 
ATOM   3301 N  N3    . A   E 2 25 ? 4.284   -3.834  -54.640  1.00 16.74  ? 28  A   E N3    1 
ATOM   3302 C  C4    . A   E 2 25 ? 3.927   -2.579  -54.307  1.00 12.33  ? 28  A   E C4    1 
ATOM   3303 P  P     . C   E 2 26 ? 7.887   0.696   -58.185  1.00 35.13  ? 29  C   E P     1 
ATOM   3304 O  OP1   . C   E 2 26 ? 9.140   1.163   -58.818  1.00 42.92  ? 29  C   E OP1   1 
ATOM   3305 O  OP2   . C   E 2 26 ? 6.734   1.622   -58.069  1.00 25.46  ? 29  C   E OP2   1 
ATOM   3306 O  "O5'" . C   E 2 26 ? 7.407   -0.624  -58.932  1.00 27.17  ? 29  C   E "O5'" 1 
ATOM   3307 C  "C5'" . C   E 2 26 ? 8.344   -1.631  -59.286  1.00 33.10  ? 29  C   E "C5'" 1 
ATOM   3308 C  "C4'" . C   E 2 26 ? 7.631   -2.850  -59.817  1.00 39.52  ? 29  C   E "C4'" 1 
ATOM   3309 O  "O4'" . C   E 2 26 ? 6.765   -3.389  -58.788  1.00 41.61  ? 29  C   E "O4'" 1 
ATOM   3310 C  "C3'" . C   E 2 26 ? 6.704   -2.608  -60.990  1.00 41.54  ? 29  C   E "C3'" 1 
ATOM   3311 O  "O3'" . C   E 2 26 ? 7.442   -2.618  -62.200  1.00 54.29  ? 29  C   E "O3'" 1 
ATOM   3312 C  "C2'" . C   E 2 26 ? 5.752   -3.791  -60.902  1.00 39.69  ? 29  C   E "C2'" 1 
ATOM   3313 O  "O2'" . C   E 2 26 ? 6.297   -4.962  -61.477  1.00 40.32  ? 29  C   E "O2'" 1 
ATOM   3314 C  "C1'" . C   E 2 26 ? 5.614   -3.957  -59.386  1.00 36.35  ? 29  C   E "C1'" 1 
ATOM   3315 N  N1    . C   E 2 26 ? 4.445   -3.288  -58.807  1.00 32.61  ? 29  C   E N1    1 
ATOM   3316 C  C2    . C   E 2 26 ? 3.261   -4.003  -58.680  1.00 35.72  ? 29  C   E C2    1 
ATOM   3317 O  O2    . C   E 2 26 ? 3.226   -5.178  -59.080  1.00 41.96  ? 29  C   E O2    1 
ATOM   3318 N  N3    . C   E 2 26 ? 2.185   -3.405  -58.122  1.00 34.01  ? 29  C   E N3    1 
ATOM   3319 C  C4    . C   E 2 26 ? 2.268   -2.142  -57.701  1.00 32.42  ? 29  C   E C4    1 
ATOM   3320 N  N4    . C   E 2 26 ? 1.184   -1.597  -57.151  1.00 36.38  ? 29  C   E N4    1 
ATOM   3321 C  C5    . C   E 2 26 ? 3.465   -1.385  -57.826  1.00 28.66  ? 29  C   E C5    1 
ATOM   3322 C  C6    . C   E 2 26 ? 4.519   -1.991  -58.383  1.00 32.03  ? 29  C   E C6    1 
ATOM   3323 P  P     . U   E 2 27 ? 7.145   -1.501  -63.305  1.00 61.49  ? 30  U   E P     1 
ATOM   3324 O  OP1   . U   E 2 27 ? 6.176   -0.541  -62.715  1.00 62.07  ? 30  U   E OP1   1 
ATOM   3325 O  OP2   . U   E 2 27 ? 6.779   -2.248  -64.531  1.00 56.64  ? 30  U   E OP2   1 
ATOM   3326 O  "O5'" . U   E 2 27 ? 8.546   -0.757  -63.538  1.00 71.95  ? 30  U   E "O5'" 1 
ATOM   3327 C  "C5'" . U   E 2 27 ? 9.243   -0.080  -62.475  1.00 81.84  ? 30  U   E "C5'" 1 
ATOM   3328 C  "C4'" . U   E 2 27 ? 9.796   1.254   -62.961  1.00 89.09  ? 30  U   E "C4'" 1 
ATOM   3329 O  "O4'" . U   E 2 27 ? 8.673   2.100   -63.304  1.00 94.28  ? 30  U   E "O4'" 1 
ATOM   3330 C  "C3'" . U   E 2 27 ? 10.596  2.084   -61.951  1.00 93.47  ? 30  U   E "C3'" 1 
ATOM   3331 O  "O3'" . U   E 2 27 ? 12.004  1.885   -62.078  1.00 95.93  ? 30  U   E "O3'" 1 
ATOM   3332 C  "C2'" . U   E 2 27 ? 10.395  3.518   -62.436  1.00 96.11  ? 30  U   E "C2'" 1 
ATOM   3333 O  "O2'" . U   E 2 27 ? 11.390  3.911   -63.359  1.00 95.75  ? 30  U   E "O2'" 1 
ATOM   3334 C  "C1'" . U   E 2 27 ? 9.035   3.455   -63.132  1.00 100.17 ? 30  U   E "C1'" 1 
ATOM   3335 N  N1    . U   E 2 27 ? 7.956   4.155   -62.423  1.00 103.94 ? 30  U   E N1    1 
ATOM   3336 C  C2    . U   E 2 27 ? 7.928   5.537   -62.512  1.00 103.30 ? 30  U   E C2    1 
ATOM   3337 O  O2    . U   E 2 27 ? 8.761   6.181   -63.128  1.00 100.21 ? 30  U   E O2    1 
ATOM   3338 N  N3    . U   E 2 27 ? 6.888   6.136   -61.851  1.00 104.06 ? 30  U   E N3    1 
ATOM   3339 C  C4    . U   E 2 27 ? 5.898   5.509   -61.124  1.00 105.62 ? 30  U   E C4    1 
ATOM   3340 O  O4    . U   E 2 27 ? 5.020   6.187   -60.591  1.00 106.81 ? 30  U   E O4    1 
ATOM   3341 C  C5    . U   E 2 27 ? 6.003   4.082   -61.074  1.00 106.52 ? 30  U   E C5    1 
ATOM   3342 C  C6    . U   E 2 27 ? 7.005   3.469   -61.709  1.00 105.16 ? 30  U   E C6    1 
ATOM   3343 P  P     . C   E 2 28 ? 12.699  0.551   -61.521  1.00 103.74 ? 31  C   E P     1 
ATOM   3344 O  OP1   . C   E 2 28 ? 14.072  0.562   -62.093  1.00 98.56  ? 31  C   E OP1   1 
ATOM   3345 O  OP2   . C   E 2 28 ? 11.789  -0.582  -61.818  1.00 106.38 ? 31  C   E OP2   1 
ATOM   3346 O  "O5'" . C   E 2 28 ? 12.814  0.744   -59.937  1.00 98.53  ? 31  C   E "O5'" 1 
ATOM   3347 C  "C5'" . C   E 2 28 ? 12.249  -0.202  -59.006  1.00 88.28  ? 31  C   E "C5'" 1 
ATOM   3348 C  "C4'" . C   E 2 28 ? 12.886  -1.575  -59.166  1.00 84.19  ? 31  C   E "C4'" 1 
ATOM   3349 O  "O4'" . C   E 2 28 ? 12.187  -2.329  -60.191  1.00 84.14  ? 31  C   E "O4'" 1 
ATOM   3350 C  "C3'" . C   E 2 28 ? 14.362  -1.590  -59.554  1.00 80.76  ? 31  C   E "C3'" 1 
ATOM   3351 O  "O3'" . C   E 2 28 ? 15.206  -1.605  -58.402  1.00 66.19  ? 31  C   E "O3'" 1 
ATOM   3352 C  "C2'" . C   E 2 28 ? 14.499  -2.904  -60.327  1.00 83.56  ? 31  C   E "C2'" 1 
ATOM   3353 O  "O2'" . C   E 2 28 ? 14.747  -4.030  -59.509  1.00 90.49  ? 31  C   E "O2'" 1 
ATOM   3354 C  "C1'" . C   E 2 28 ? 13.122  -3.040  -60.983  1.00 85.33  ? 31  C   E "C1'" 1 
ATOM   3355 P  P     . C   E 2 29 ? 15.549  -0.236  -57.629  1.00 58.21  ? 32  C   E P     1 
ATOM   3356 O  OP1   . C   E 2 29 ? 15.155  -0.446  -56.208  1.00 53.22  ? 32  C   E OP1   1 
ATOM   3357 O  OP2   . C   E 2 29 ? 14.949  0.893   -58.395  1.00 57.03  ? 32  C   E OP2   1 
ATOM   3358 O  "O5'" . C   E 2 29 ? 17.143  -0.131  -57.698  1.00 48.57  ? 32  C   E "O5'" 1 
ATOM   3359 C  "C5'" . C   E 2 29 ? 17.966  -1.194  -57.206  1.00 34.83  ? 32  C   E "C5'" 1 
ATOM   3360 C  "C4'" . C   E 2 29 ? 19.416  -0.754  -57.043  1.00 26.22  ? 32  C   E "C4'" 1 
ATOM   3361 O  "O4'" . C   E 2 29 ? 20.047  -0.521  -58.327  1.00 19.64  ? 32  C   E "O4'" 1 
ATOM   3362 C  "C3'" . C   E 2 29 ? 19.696  0.506   -56.245  1.00 22.57  ? 32  C   E "C3'" 1 
ATOM   3363 O  "O3'" . C   E 2 29 ? 19.757  0.185   -54.870  1.00 14.80  ? 32  C   E "O3'" 1 
ATOM   3364 C  "C2'" . C   E 2 29 ? 21.092  0.881   -56.724  1.00 21.81  ? 32  C   E "C2'" 1 
ATOM   3365 O  "O2'" . C   E 2 29 ? 22.069  0.088   -56.080  1.00 25.71  ? 32  C   E "O2'" 1 
ATOM   3366 C  "C1'" . C   E 2 29 ? 21.026  0.493   -58.201  1.00 15.92  ? 32  C   E "C1'" 1 
ATOM   3367 N  N1    . C   E 2 29 ? 20.656  1.573   -59.125  1.00 21.17  ? 32  C   E N1    1 
ATOM   3368 C  C2    . C   E 2 29 ? 21.606  2.535   -59.483  1.00 22.72  ? 32  C   E C2    1 
ATOM   3369 O  O2    . C   E 2 29 ? 22.718  2.515   -58.948  1.00 29.86  ? 32  C   E O2    1 
ATOM   3370 N  N3    . C   E 2 29 ? 21.283  3.464   -60.404  1.00 26.81  ? 32  C   E N3    1 
ATOM   3371 C  C4    . C   E 2 29 ? 20.062  3.465   -60.950  1.00 28.87  ? 32  C   E C4    1 
ATOM   3372 N  N4    . C   E 2 29 ? 19.790  4.385   -61.878  1.00 39.07  ? 32  C   E N4    1 
ATOM   3373 C  C5    . C   E 2 29 ? 19.066  2.524   -60.574  1.00 23.73  ? 32  C   E C5    1 
ATOM   3374 C  C6    . C   E 2 29 ? 19.400  1.610   -59.663  1.00 24.71  ? 32  C   E C6    1 
ATOM   3375 P  P     . G   E 2 30 ? 19.464  1.313   -53.783  1.00 14.34  ? 33  G   E P     1 
ATOM   3376 O  OP1   . G   E 2 30 ? 19.795  0.740   -52.463  1.00 28.41  ? 33  G   E OP1   1 
ATOM   3377 O  OP2   . G   E 2 30 ? 18.106  1.831   -54.034  1.00 19.84  ? 33  G   E OP2   1 
ATOM   3378 O  "O5'" . G   E 2 30 ? 20.533  2.449   -54.090  1.00 21.29  ? 33  G   E "O5'" 1 
ATOM   3379 C  "C5'" . G   E 2 30 ? 21.912  2.254   -53.784  1.00 26.11  ? 33  G   E "C5'" 1 
ATOM   3380 C  "C4'" . G   E 2 30 ? 22.434  3.419   -52.977  1.00 29.68  ? 33  G   E "C4'" 1 
ATOM   3381 O  "O4'" . G   E 2 30 ? 21.651  3.528   -51.758  1.00 27.64  ? 33  G   E "O4'" 1 
ATOM   3382 C  "C3'" . G   E 2 30 ? 23.880  3.313   -52.503  1.00 32.70  ? 33  G   E "C3'" 1 
ATOM   3383 O  "O3'" . G   E 2 30 ? 24.798  3.826   -53.470  1.00 39.00  ? 33  G   E "O3'" 1 
ATOM   3384 C  "C2'" . G   E 2 30 ? 23.851  4.196   -51.271  1.00 34.45  ? 33  G   E "C2'" 1 
ATOM   3385 O  "O2'" . G   E 2 30 ? 23.828  5.562   -51.631  1.00 32.63  ? 33  G   E "O2'" 1 
ATOM   3386 C  "C1'" . G   E 2 30 ? 22.509  3.791   -50.664  1.00 29.83  ? 33  G   E "C1'" 1 
ATOM   3387 N  N9    . G   E 2 30 ? 22.625  2.553   -49.907  1.00 24.40  ? 33  G   E N9    1 
ATOM   3388 C  C8    . G   E 2 30 ? 22.218  1.310   -50.319  1.00 26.84  ? 33  G   E C8    1 
ATOM   3389 N  N7    . G   E 2 30 ? 22.456  0.375   -49.439  1.00 36.68  ? 33  G   E N7    1 
ATOM   3390 C  C5    . G   E 2 30 ? 23.053  1.044   -48.378  1.00 29.18  ? 33  G   E C5    1 
ATOM   3391 C  C6    . G   E 2 30 ? 23.532  0.556   -47.135  1.00 25.42  ? 33  G   E C6    1 
ATOM   3392 O  O6    . G   E 2 30 ? 23.526  -0.607  -46.703  1.00 28.24  ? 33  G   E O6    1 
ATOM   3393 N  N1    . G   E 2 30 ? 24.065  1.577   -46.362  1.00 19.90  ? 33  G   E N1    1 
ATOM   3394 C  C2    . G   E 2 30 ? 24.137  2.888   -46.731  1.00 17.21  ? 33  G   E C2    1 
ATOM   3395 N  N2    . G   E 2 30 ? 24.708  3.715   -45.849  1.00 24.77  ? 33  G   E N2    1 
ATOM   3396 N  N3    . G   E 2 30 ? 23.690  3.358   -47.879  1.00 17.12  ? 33  G   E N3    1 
ATOM   3397 C  C4    . G   E 2 30 ? 23.165  2.389   -48.651  1.00 22.48  ? 33  G   E C4    1 
ATOM   3398 P  P     . G   E 2 31 ? 26.363  3.463   -53.364  1.00 44.30  ? 34  G   E P     1 
ATOM   3399 O  OP1   . G   E 2 31 ? 27.101  4.204   -54.416  1.00 44.07  ? 34  G   E OP1   1 
ATOM   3400 O  OP2   . G   E 2 31 ? 26.484  1.987   -53.285  1.00 46.13  ? 34  G   E OP2   1 
ATOM   3401 O  "O5'" . G   E 2 31 ? 26.815  4.075   -51.968  1.00 43.96  ? 34  G   E "O5'" 1 
ATOM   3402 C  "C5'" . G   E 2 31 ? 27.102  5.459   -51.853  1.00 44.06  ? 34  G   E "C5'" 1 
ATOM   3403 C  "C4'" . G   E 2 31 ? 27.956  5.707   -50.642  1.00 42.09  ? 34  G   E "C4'" 1 
ATOM   3404 O  "O4'" . G   E 2 31 ? 27.171  5.498   -49.439  1.00 43.96  ? 34  G   E "O4'" 1 
ATOM   3405 C  "C3'" . G   E 2 31 ? 29.124  4.754   -50.489  1.00 38.81  ? 34  G   E "C3'" 1 
ATOM   3406 O  "O3'" . G   E 2 31 ? 30.226  5.172   -51.275  1.00 38.90  ? 34  G   E "O3'" 1 
ATOM   3407 C  "C2'" . G   E 2 31 ? 29.402  4.861   -49.000  1.00 41.63  ? 34  G   E "C2'" 1 
ATOM   3408 O  "O2'" . G   E 2 31 ? 30.046  6.068   -48.657  1.00 50.01  ? 34  G   E "O2'" 1 
ATOM   3409 C  "C1'" . G   E 2 31 ? 27.979  4.886   -48.445  1.00 44.12  ? 34  G   E "C1'" 1 
ATOM   3410 N  N9    . G   E 2 31 ? 27.485  3.533   -48.234  1.00 37.83  ? 34  G   E N9    1 
ATOM   3411 C  C8    . G   E 2 31 ? 26.600  2.851   -49.023  1.00 36.40  ? 34  G   E C8    1 
ATOM   3412 N  N7    . G   E 2 31 ? 26.381  1.635   -48.611  1.00 39.45  ? 34  G   E N7    1 
ATOM   3413 C  C5    . G   E 2 31 ? 27.161  1.511   -47.476  1.00 36.73  ? 34  G   E C5    1 
ATOM   3414 C  C6    . G   E 2 31 ? 27.338  0.412   -46.610  1.00 40.39  ? 34  G   E C6    1 
ATOM   3415 O  O6    . G   E 2 31 ? 26.823  -0.710  -46.681  1.00 46.67  ? 34  G   E O6    1 
ATOM   3416 N  N1    . G   E 2 31 ? 28.221  0.711   -45.577  1.00 38.57  ? 34  G   E N1    1 
ATOM   3417 C  C2    . G   E 2 31 ? 28.854  1.917   -45.408  1.00 43.42  ? 34  G   E C2    1 
ATOM   3418 N  N2    . G   E 2 31 ? 29.666  2.012   -44.356  1.00 42.11  ? 34  G   E N2    1 
ATOM   3419 N  N3    . G   E 2 31 ? 28.698  2.954   -46.215  1.00 44.18  ? 34  G   E N3    1 
ATOM   3420 C  C4    . G   E 2 31 ? 27.842  2.679   -47.223  1.00 40.14  ? 34  G   E C4    1 
ATOM   3421 P  P     . A   E 2 32 ? 31.200  4.071   -51.922  1.00 41.71  ? 35  A   E P     1 
ATOM   3422 O  OP1   . A   E 2 32 ? 32.141  4.776   -52.829  1.00 31.19  ? 35  A   E OP1   1 
ATOM   3423 O  OP2   . A   E 2 32 ? 30.329  2.991   -52.455  1.00 30.17  ? 35  A   E OP2   1 
ATOM   3424 O  "O5'" . A   E 2 32 ? 32.046  3.529   -50.683  1.00 36.03  ? 35  A   E "O5'" 1 
ATOM   3425 C  "C5'" . A   E 2 32 ? 32.907  4.413   -49.971  1.00 28.86  ? 35  A   E "C5'" 1 
ATOM   3426 C  "C4'" . A   E 2 32 ? 33.544  3.726   -48.788  1.00 26.05  ? 35  A   E "C4'" 1 
ATOM   3427 O  "O4'" . A   E 2 32 ? 32.532  3.318   -47.830  1.00 34.56  ? 35  A   E "O4'" 1 
ATOM   3428 C  "C3'" . A   E 2 32 ? 34.279  2.431   -49.054  1.00 29.72  ? 35  A   E "C3'" 1 
ATOM   3429 O  "O3'" . A   E 2 32 ? 35.547  2.685   -49.620  1.00 33.69  ? 35  A   E "O3'" 1 
ATOM   3430 C  "C2'" . A   E 2 32 ? 34.387  1.870   -47.644  1.00 28.78  ? 35  A   E "C2'" 1 
ATOM   3431 O  "O2'" . A   E 2 32 ? 35.322  2.575   -46.857  1.00 27.14  ? 35  A   E "O2'" 1 
ATOM   3432 C  "C1'" . A   E 2 32 ? 32.998  2.187   -47.103  1.00 25.54  ? 35  A   E "C1'" 1 
ATOM   3433 N  N9    . A   E 2 32 ? 32.065  1.081   -47.306  1.00 21.33  ? 35  A   E N9    1 
ATOM   3434 C  C8    . A   E 2 32 ? 31.062  0.962   -48.233  1.00 17.03  ? 35  A   E C8    1 
ATOM   3435 N  N7    . A   E 2 32 ? 30.384  -0.152  -48.137  1.00 14.44  ? 35  A   E N7    1 
ATOM   3436 C  C5    . A   E 2 32 ? 30.985  -0.815  -47.077  1.00 21.52  ? 35  A   E C5    1 
ATOM   3437 C  C6    . A   E 2 32 ? 30.727  -2.057  -46.465  1.00 25.24  ? 35  A   E C6    1 
ATOM   3438 N  N6    . A   E 2 32 ? 29.750  -2.880  -46.840  1.00 30.00  ? 35  A   E N6    1 
ATOM   3439 N  N1    . A   E 2 32 ? 31.518  -2.426  -45.439  1.00 26.51  ? 35  A   E N1    1 
ATOM   3440 C  C2    . A   E 2 32 ? 32.497  -1.597  -45.056  1.00 28.66  ? 35  A   E C2    1 
ATOM   3441 N  N3    . A   E 2 32 ? 32.835  -0.407  -45.546  1.00 28.69  ? 35  A   E N3    1 
ATOM   3442 C  C4    . A   E 2 32 ? 32.028  -0.071  -46.565  1.00 22.75  ? 35  A   E C4    1 
ATOM   3443 P  P     . G   E 2 33 ? 35.921  2.027   -51.031  1.00 33.38  ? 36  G   E P     1 
ATOM   3444 O  OP1   . G   E 2 33 ? 37.076  2.764   -51.603  1.00 35.17  ? 36  G   E OP1   1 
ATOM   3445 O  OP2   . G   E 2 33 ? 34.648  1.953   -51.782  1.00 33.62  ? 36  G   E OP2   1 
ATOM   3446 O  "O5'" . G   E 2 33 ? 36.410  0.563   -50.661  1.00 26.13  ? 36  G   E "O5'" 1 
ATOM   3447 C  "C5'" . G   E 2 33 ? 37.567  0.379   -49.865  1.00 15.00  ? 36  G   E "C5'" 1 
ATOM   3448 C  "C4'" . G   E 2 33 ? 37.367  -0.778  -48.932  1.00 14.48  ? 36  G   E "C4'" 1 
ATOM   3449 O  "O4'" . G   E 2 33 ? 36.125  -0.570  -48.213  1.00 11.70  ? 36  G   E "O4'" 1 
ATOM   3450 C  "C3'" . G   E 2 33 ? 37.131  -2.113  -49.603  1.00 22.36  ? 36  G   E "C3'" 1 
ATOM   3451 O  "O3'" . G   E 2 33 ? 38.334  -2.729  -50.018  1.00 32.56  ? 36  G   E "O3'" 1 
ATOM   3452 C  "C2'" . G   E 2 33 ? 36.463  -2.891  -48.491  1.00 17.63  ? 36  G   E "C2'" 1 
ATOM   3453 O  "O2'" . G   E 2 33 ? 37.402  -3.273  -47.519  1.00 8.03   ? 36  G   E "O2'" 1 
ATOM   3454 C  "C1'" . G   E 2 33 ? 35.523  -1.825  -47.929  1.00 22.33  ? 36  G   E "C1'" 1 
ATOM   3455 N  N9    . G   E 2 33 ? 34.221  -1.872  -48.588  1.00 29.06  ? 36  G   E N9    1 
ATOM   3456 C  C8    . G   E 2 33 ? 33.659  -0.905  -49.386  1.00 33.31  ? 36  G   E C8    1 
ATOM   3457 N  N7    . G   E 2 33 ? 32.502  -1.257  -49.881  1.00 39.03  ? 36  G   E N7    1 
ATOM   3458 C  C5    . G   E 2 33 ? 32.283  -2.531  -49.372  1.00 34.03  ? 36  G   E C5    1 
ATOM   3459 C  C6    . G   E 2 33 ? 31.194  -3.421  -49.561  1.00 33.19  ? 36  G   E C6    1 
ATOM   3460 O  O6    . G   E 2 33 ? 30.173  -3.260  -50.245  1.00 34.17  ? 36  G   E O6    1 
ATOM   3461 N  N1    . G   E 2 33 ? 31.376  -4.603  -48.853  1.00 33.49  ? 36  G   E N1    1 
ATOM   3462 C  C2    . G   E 2 33 ? 32.464  -4.896  -48.067  1.00 30.08  ? 36  G   E C2    1 
ATOM   3463 N  N2    . G   E 2 33 ? 32.459  -6.100  -47.476  1.00 27.28  ? 36  G   E N2    1 
ATOM   3464 N  N3    . G   E 2 33 ? 33.481  -4.074  -47.880  1.00 25.58  ? 36  G   E N3    1 
ATOM   3465 C  C4    . G   E 2 33 ? 33.327  -2.919  -48.559  1.00 29.60  ? 36  G   E C4    1 
ATOM   3466 P  P     . G   E 2 34 ? 38.316  -3.677  -51.310  1.00 35.48  ? 37  G   E P     1 
ATOM   3467 O  OP1   . G   E 2 34 ? 39.702  -4.066  -51.660  1.00 30.43  ? 37  G   E OP1   1 
ATOM   3468 O  OP2   . G   E 2 34 ? 37.463  -2.984  -52.308  1.00 38.59  ? 37  G   E OP2   1 
ATOM   3469 O  "O5'" . G   E 2 34 ? 37.569  -4.982  -50.808  1.00 28.89  ? 37  G   E "O5'" 1 
ATOM   3470 C  "C5'" . G   E 2 34 ? 38.177  -5.814  -49.838  1.00 34.35  ? 37  G   E "C5'" 1 
ATOM   3471 C  "C4'" . G   E 2 34 ? 37.385  -7.080  -49.670  1.00 34.57  ? 37  G   E "C4'" 1 
ATOM   3472 O  "O4'" . G   E 2 34 ? 36.088  -6.765  -49.088  1.00 34.96  ? 37  G   E "O4'" 1 
ATOM   3473 C  "C3'" . G   E 2 34 ? 37.021  -7.797  -50.954  1.00 36.38  ? 37  G   E "C3'" 1 
ATOM   3474 O  "O3'" . G   E 2 34 ? 38.085  -8.567  -51.504  1.00 33.93  ? 37  G   E "O3'" 1 
ATOM   3475 C  "C2'" . G   E 2 34 ? 35.871  -8.658  -50.470  1.00 36.14  ? 37  G   E "C2'" 1 
ATOM   3476 O  "O2'" . G   E 2 34 ? 36.341  -9.707  -49.655  1.00 45.17  ? 37  G   E "O2'" 1 
ATOM   3477 C  "C1'" . G   E 2 34 ? 35.112  -7.657  -49.601  1.00 33.71  ? 37  G   E "C1'" 1 
ATOM   3478 N  N9    . G   E 2 34 ? 34.158  -6.898  -50.403  1.00 30.12  ? 37  G   E N9    1 
ATOM   3479 C  C8    . G   E 2 34 ? 34.297  -5.614  -50.872  1.00 31.74  ? 37  G   E C8    1 
ATOM   3480 N  N7    . G   E 2 34 ? 33.289  -5.224  -51.607  1.00 31.06  ? 37  G   E N7    1 
ATOM   3481 C  C5    . G   E 2 34 ? 32.427  -6.311  -51.613  1.00 34.70  ? 37  G   E C5    1 
ATOM   3482 C  C6    . G   E 2 34 ? 31.161  -6.482  -52.243  1.00 34.92  ? 37  G   E C6    1 
ATOM   3483 O  O6    . G   E 2 34 ? 30.537  -5.676  -52.947  1.00 33.48  ? 37  G   E O6    1 
ATOM   3484 N  N1    . G   E 2 34 ? 30.627  -7.744  -51.982  1.00 30.00  ? 37  G   E N1    1 
ATOM   3485 C  C2    . G   E 2 34 ? 31.235  -8.714  -51.216  1.00 27.69  ? 37  G   E C2    1 
ATOM   3486 N  N2    . G   E 2 34 ? 30.572  -9.855  -51.078  1.00 28.20  ? 37  G   E N2    1 
ATOM   3487 N  N3    . G   E 2 34 ? 32.409  -8.569  -50.629  1.00 26.22  ? 37  G   E N3    1 
ATOM   3488 C  C4    . G   E 2 34 ? 32.946  -7.351  -50.866  1.00 32.80  ? 37  G   E C4    1 
ATOM   3489 P  P     . C   E 2 35 ? 38.062  -8.935  -53.074  1.00 40.97  ? 38  C   E P     1 
ATOM   3490 O  OP1   . C   E 2 35 ? 39.229  -9.793  -53.405  1.00 33.26  ? 38  C   E OP1   1 
ATOM   3491 O  OP2   . C   E 2 35 ? 37.828  -7.674  -53.835  1.00 28.76  ? 38  C   E OP2   1 
ATOM   3492 O  "O5'" . C   E 2 35 ? 36.763  -9.839  -53.226  1.00 31.71  ? 38  C   E "O5'" 1 
ATOM   3493 C  "C5'" . C   E 2 35 ? 36.685  -11.095 -52.577  1.00 20.46  ? 38  C   E "C5'" 1 
ATOM   3494 C  "C4'" . C   E 2 35 ? 35.588  -11.917 -53.186  1.00 20.43  ? 38  C   E "C4'" 1 
ATOM   3495 O  "O4'" . C   E 2 35 ? 34.297  -11.397 -52.794  1.00 30.89  ? 38  C   E "O4'" 1 
ATOM   3496 C  "C3'" . C   E 2 35 ? 35.533  -11.882 -54.695  1.00 17.38  ? 38  C   E "C3'" 1 
ATOM   3497 O  "O3'" . C   E 2 35 ? 36.471  -12.781 -55.245  1.00 21.52  ? 38  C   E "O3'" 1 
ATOM   3498 C  "C2'" . C   E 2 35 ? 34.108  -12.339 -54.951  1.00 23.96  ? 38  C   E "C2'" 1 
ATOM   3499 O  "O2'" . C   E 2 35 ? 33.965  -13.727 -54.754  1.00 32.73  ? 38  C   E "O2'" 1 
ATOM   3500 C  "C1'" . C   E 2 35 ? 33.359  -11.612 -53.838  1.00 24.19  ? 38  C   E "C1'" 1 
ATOM   3501 N  N1    . C   E 2 35 ? 32.858  -10.308 -54.282  1.00 22.81  ? 38  C   E N1    1 
ATOM   3502 C  C2    . C   E 2 35 ? 31.612  -10.241 -54.895  1.00 23.56  ? 38  C   E C2    1 
ATOM   3503 O  O2    . C   E 2 35 ? 30.950  -11.285 -55.021  1.00 22.98  ? 38  C   E O2    1 
ATOM   3504 N  N3    . C   E 2 35 ? 31.159  -9.042  -55.329  1.00 18.16  ? 38  C   E N3    1 
ATOM   3505 C  C4    . C   E 2 35 ? 31.902  -7.949  -55.156  1.00 7.58   ? 38  C   E C4    1 
ATOM   3506 N  N4    . C   E 2 35 ? 31.425  -6.795  -55.588  1.00 11.32  ? 38  C   E N4    1 
ATOM   3507 C  C5    . C   E 2 35 ? 33.167  -7.994  -54.527  1.00 10.84  ? 38  C   E C5    1 
ATOM   3508 C  C6    . C   E 2 35 ? 33.604  -9.179  -54.109  1.00 17.67  ? 38  C   E C6    1 
ATOM   3509 P  P     . U   E 2 36 ? 36.996  -12.546 -56.732  1.00 24.51  ? 39  U   E P     1 
ATOM   3510 O  OP1   . U   E 2 36 ? 38.108  -13.486 -57.016  1.00 20.46  ? 39  U   E OP1   1 
ATOM   3511 O  OP2   . U   E 2 36 ? 37.219  -11.087 -56.857  1.00 28.09  ? 39  U   E OP2   1 
ATOM   3512 O  "O5'" . U   E 2 36 ? 35.735  -12.927 -57.630  1.00 25.88  ? 39  U   E "O5'" 1 
ATOM   3513 C  "C5'" . U   E 2 36 ? 35.257  -14.267 -57.710  1.00 13.96  ? 39  U   E "C5'" 1 
ATOM   3514 C  "C4'" . U   E 2 36 ? 34.037  -14.323 -58.596  1.00 22.54  ? 39  U   E "C4'" 1 
ATOM   3515 O  "O4'" . U   E 2 36 ? 32.952  -13.565 -57.993  1.00 26.22  ? 39  U   E "O4'" 1 
ATOM   3516 C  "C3'" . U   E 2 36 ? 34.200  -13.674 -59.957  1.00 21.92  ? 39  U   E "C3'" 1 
ATOM   3517 O  "O3'" . U   E 2 36 ? 34.846  -14.551 -60.869  1.00 19.83  ? 39  U   E "O3'" 1 
ATOM   3518 C  "C2'" . U   E 2 36 ? 32.755  -13.398 -60.354  1.00 19.62  ? 39  U   E "C2'" 1 
ATOM   3519 O  "O2'" . U   E 2 36 ? 32.101  -14.538 -60.863  1.00 23.11  ? 39  U   E "O2'" 1 
ATOM   3520 C  "C1'" . U   E 2 36 ? 32.134  -13.012 -59.011  1.00 23.14  ? 39  U   E "C1'" 1 
ATOM   3521 N  N1    . U   E 2 36 ? 32.080  -11.555 -58.832  1.00 30.33  ? 39  U   E N1    1 
ATOM   3522 C  C2    . U   E 2 36 ? 30.956  -10.886 -59.305  1.00 28.69  ? 39  U   E C2    1 
ATOM   3523 O  O2    . U   E 2 36 ? 30.012  -11.455 -59.825  1.00 21.17  ? 39  U   E O2    1 
ATOM   3524 N  N3    . U   E 2 36 ? 30.983  -9.524  -59.146  1.00 21.97  ? 39  U   E N3    1 
ATOM   3525 C  C4    . U   E 2 36 ? 31.989  -8.778  -58.573  1.00 17.63  ? 39  U   E C4    1 
ATOM   3526 O  O4    . U   E 2 36 ? 31.873  -7.555  -58.521  1.00 18.06  ? 39  U   E O4    1 
ATOM   3527 C  C5    . U   E 2 36 ? 33.107  -9.539  -58.095  1.00 22.81  ? 39  U   E C5    1 
ATOM   3528 C  C6    . U   E 2 36 ? 33.113  -10.869 -58.235  1.00 27.01  ? 39  U   E C6    1 
ATOM   3529 P  P     . G   E 2 37 ? 35.763  -13.942 -62.038  1.00 26.85  ? 40  G   E P     1 
ATOM   3530 O  OP1   . G   E 2 37 ? 36.362  -15.057 -62.827  1.00 20.23  ? 40  G   E OP1   1 
ATOM   3531 O  OP2   . G   E 2 37 ? 36.646  -12.915 -61.418  1.00 21.19  ? 40  G   E OP2   1 
ATOM   3532 O  "O5'" . G   E 2 37 ? 34.730  -13.195 -62.986  1.00 20.51  ? 40  G   E "O5'" 1 
ATOM   3533 C  "C5'" . G   E 2 37 ? 33.738  -13.925 -63.679  1.00 19.74  ? 40  G   E "C5'" 1 
ATOM   3534 C  "C4'" . G   E 2 37 ? 32.778  -12.984 -64.342  1.00 25.32  ? 40  G   E "C4'" 1 
ATOM   3535 O  "O4'" . G   E 2 37 ? 32.070  -12.210 -63.339  1.00 34.43  ? 40  G   E "O4'" 1 
ATOM   3536 C  "C3'" . G   E 2 37 ? 33.420  -11.920 -65.203  1.00 27.73  ? 40  G   E "C3'" 1 
ATOM   3537 O  "O3'" . G   E 2 37 ? 33.783  -12.451 -66.464  1.00 33.61  ? 40  G   E "O3'" 1 
ATOM   3538 C  "C2'" . G   E 2 37 ? 32.295  -10.898 -65.294  1.00 28.07  ? 40  G   E "C2'" 1 
ATOM   3539 O  "O2'" . G   E 2 37 ? 31.278  -11.270 -66.199  1.00 28.07  ? 40  G   E "O2'" 1 
ATOM   3540 C  "C1'" . G   E 2 37 ? 31.761  -10.927 -63.861  1.00 25.82  ? 40  G   E "C1'" 1 
ATOM   3541 N  N9    . G   E 2 37 ? 32.471  -9.924  -63.082  1.00 24.71  ? 40  G   E N9    1 
ATOM   3542 C  C8    . G   E 2 37 ? 33.789  -9.955  -62.710  1.00 28.02  ? 40  G   E C8    1 
ATOM   3543 N  N7    . G   E 2 37 ? 34.184  -8.851  -62.141  1.00 39.72  ? 40  G   E N7    1 
ATOM   3544 C  C5    . G   E 2 37 ? 33.047  -8.057  -62.109  1.00 32.95  ? 40  G   E C5    1 
ATOM   3545 C  C6    . G   E 2 37 ? 32.857  -6.732  -61.619  1.00 33.48  ? 40  G   E C6    1 
ATOM   3546 O  O6    . G   E 2 37 ? 33.690  -5.962  -61.103  1.00 31.55  ? 40  G   E O6    1 
ATOM   3547 N  N1    . G   E 2 37 ? 31.540  -6.321  -61.782  1.00 29.27  ? 40  G   E N1    1 
ATOM   3548 C  C2    . G   E 2 37 ? 30.537  -7.078  -62.339  1.00 26.33  ? 40  G   E C2    1 
ATOM   3549 N  N2    . G   E 2 37 ? 29.319  -6.510  -62.399  1.00 26.32  ? 40  G   E N2    1 
ATOM   3550 N  N3    . G   E 2 37 ? 30.708  -8.302  -62.802  1.00 26.17  ? 40  G   E N3    1 
ATOM   3551 C  C4    . G   E 2 37 ? 31.975  -8.723  -62.658  1.00 25.29  ? 40  G   E C4    1 
ATOM   3552 P  P     . A   E 2 38 ? 35.002  -11.800 -67.276  1.00 34.49  ? 41  A   E P     1 
ATOM   3553 O  OP1   . A   E 2 38 ? 34.933  -12.320 -68.665  1.00 29.60  ? 41  A   E OP1   1 
ATOM   3554 O  OP2   . A   E 2 38 ? 36.234  -11.995 -66.476  1.00 36.20  ? 41  A   E OP2   1 
ATOM   3555 O  "O5'" . A   E 2 38 ? 34.653  -10.246 -67.297  1.00 29.53  ? 41  A   E "O5'" 1 
ATOM   3556 C  "C5'" . A   E 2 38 ? 35.470  -9.327  -68.005  1.00 19.87  ? 41  A   E "C5'" 1 
ATOM   3557 C  "C4'" . A   E 2 38 ? 34.619  -8.275  -68.666  1.00 15.46  ? 41  A   E "C4'" 1 
ATOM   3558 O  "O4'" . A   E 2 38 ? 33.742  -8.918  -69.613  1.00 13.37  ? 41  A   E "O4'" 1 
ATOM   3559 C  "C3'" . A   E 2 38 ? 33.665  -7.527  -67.752  1.00 19.49  ? 41  A   E "C3'" 1 
ATOM   3560 O  "O3'" . A   E 2 38 ? 34.300  -6.420  -67.134  1.00 20.05  ? 41  A   E "O3'" 1 
ATOM   3561 C  "C2'" . A   E 2 38 ? 32.598  -7.026  -68.712  1.00 18.27  ? 41  A   E "C2'" 1 
ATOM   3562 O  "O2'" . A   E 2 38 ? 32.975  -5.790  -69.279  1.00 4.88   ? 41  A   E "O2'" 1 
ATOM   3563 C  "C1'" . A   E 2 38 ? 32.571  -8.142  -69.760  1.00 18.54  ? 41  A   E "C1'" 1 
ATOM   3564 N  N9    . A   E 2 38 ? 31.412  -9.032  -69.722  1.00 21.22  ? 41  A   E N9    1 
ATOM   3565 C  C8    . A   E 2 38 ? 31.390  -10.405 -69.607  1.00 24.32  ? 41  A   E C8    1 
ATOM   3566 N  N7    . A   E 2 38 ? 30.189  -10.923 -69.700  1.00 20.54  ? 41  A   E N7    1 
ATOM   3567 C  C5    . A   E 2 38 ? 29.364  -9.817  -69.866  1.00 23.62  ? 41  A   E C5    1 
ATOM   3568 C  C6    . A   E 2 38 ? 27.980  -9.690  -70.033  1.00 26.52  ? 41  A   E C6    1 
ATOM   3569 N  N6    . A   E 2 38 ? 27.146  -10.731 -70.064  1.00 30.01  ? 41  A   E N6    1 
ATOM   3570 N  N1    . A   E 2 38 ? 27.474  -8.440  -70.167  1.00 21.19  ? 41  A   E N1    1 
ATOM   3571 C  C2    . A   E 2 38 ? 28.313  -7.403  -70.128  1.00 5.63   ? 41  A   E C2    1 
ATOM   3572 N  N3    . A   E 2 38 ? 29.628  -7.395  -69.980  1.00 10.35  ? 41  A   E N3    1 
ATOM   3573 C  C4    . A   E 2 38 ? 30.100  -8.647  -69.857  1.00 20.28  ? 41  A   E C4    1 
ATOM   3574 P  P     . G   E 2 39 ? 34.092  -6.181  -65.570  1.00 33.19  ? 42  G   E P     1 
ATOM   3575 O  OP1   . G   E 2 39 ? 35.144  -5.268  -65.054  1.00 27.04  ? 42  G   E OP1   1 
ATOM   3576 O  OP2   . G   E 2 39 ? 33.964  -7.549  -65.004  1.00 33.35  ? 42  G   E OP2   1 
ATOM   3577 O  "O5'" . G   E 2 39 ? 32.675  -5.458  -65.476  1.00 28.69  ? 42  G   E "O5'" 1 
ATOM   3578 C  "C5'" . G   E 2 39 ? 32.473  -4.178  -66.056  1.00 25.41  ? 42  G   E "C5'" 1 
ATOM   3579 C  "C4'" . G   E 2 39 ? 31.006  -3.942  -66.286  1.00 29.52  ? 42  G   E "C4'" 1 
ATOM   3580 O  "O4'" . G   E 2 39 ? 30.503  -4.913  -67.235  1.00 32.75  ? 42  G   E "O4'" 1 
ATOM   3581 C  "C3'" . G   E 2 39 ? 30.141  -4.102  -65.051  1.00 27.26  ? 42  G   E "C3'" 1 
ATOM   3582 O  "O3'" . G   E 2 39 ? 30.044  -2.843  -64.400  1.00 31.94  ? 42  G   E "O3'" 1 
ATOM   3583 C  "C2'" . G   E 2 39 ? 28.789  -4.496  -65.637  1.00 28.89  ? 42  G   E "C2'" 1 
ATOM   3584 O  "O2'" . G   E 2 39 ? 28.051  -3.373  -66.063  1.00 29.80  ? 42  G   E "O2'" 1 
ATOM   3585 C  "C1'" . G   E 2 39 ? 29.200  -5.319  -66.859  1.00 30.65  ? 42  G   E "C1'" 1 
ATOM   3586 N  N9    . G   E 2 39 ? 29.230  -6.764  -66.658  1.00 32.20  ? 42  G   E N9    1 
ATOM   3587 C  C8    . G   E 2 39 ? 30.327  -7.514  -66.320  1.00 26.74  ? 42  G   E C8    1 
ATOM   3588 N  N7    . G   E 2 39 ? 30.082  -8.791  -66.285  1.00 29.70  ? 42  G   E N7    1 
ATOM   3589 C  C5    . G   E 2 39 ? 28.735  -8.895  -66.600  1.00 26.59  ? 42  G   E C5    1 
ATOM   3590 C  C6    . G   E 2 39 ? 27.914  -10.040 -66.732  1.00 25.85  ? 42  G   E C6    1 
ATOM   3591 O  O6    . G   E 2 39 ? 28.220  -11.227 -66.585  1.00 25.83  ? 42  G   E O6    1 
ATOM   3592 N  N1    . G   E 2 39 ? 26.609  -9.700  -67.075  1.00 31.56  ? 42  G   E N1    1 
ATOM   3593 C  C2    . G   E 2 39 ? 26.146  -8.421  -67.262  1.00 35.97  ? 42  G   E C2    1 
ATOM   3594 N  N2    . G   E 2 39 ? 24.842  -8.315  -67.578  1.00 29.00  ? 42  G   E N2    1 
ATOM   3595 N  N3    . G   E 2 39 ? 26.907  -7.335  -67.143  1.00 37.00  ? 42  G   E N3    1 
ATOM   3596 C  C4    . G   E 2 39 ? 28.186  -7.650  -66.815  1.00 32.65  ? 42  G   E C4    1 
ATOM   3597 P  P     . A   E 2 40 ? 30.141  -2.759  -62.805  1.00 27.64  ? 43  A   E P     1 
ATOM   3598 O  OP1   . A   E 2 40 ? 29.983  -1.344  -62.392  1.00 30.62  ? 43  A   E OP1   1 
ATOM   3599 O  OP2   . A   E 2 40 ? 31.371  -3.498  -62.438  1.00 37.19  ? 43  A   E OP2   1 
ATOM   3600 O  "O5'" . A   E 2 40 ? 28.875  -3.573  -62.291  1.00 17.26  ? 43  A   E "O5'" 1 
ATOM   3601 C  "C5'" . A   E 2 40 ? 27.588  -2.981  -62.258  1.00 7.49   ? 43  A   E "C5'" 1 
ATOM   3602 C  "C4'" . A   E 2 40 ? 26.811  -3.552  -61.111  1.00 14.56  ? 43  A   E "C4'" 1 
ATOM   3603 O  "O4'" . A   E 2 40 ? 26.898  -4.981  -61.171  1.00 20.50  ? 43  A   E "O4'" 1 
ATOM   3604 C  "C3'" . A   E 2 40 ? 27.343  -3.235  -59.725  1.00 18.81  ? 43  A   E "C3'" 1 
ATOM   3605 O  "O3'" . A   E 2 40 ? 26.617  -2.091  -59.298  1.00 23.76  ? 43  A   E "O3'" 1 
ATOM   3606 C  "C2'" . A   E 2 40 ? 26.946  -4.452  -58.868  1.00 17.98  ? 43  A   E "C2'" 1 
ATOM   3607 O  "O2'" . A   E 2 40 ? 25.865  -4.190  -58.003  1.00 19.96  ? 43  A   E "O2'" 1 
ATOM   3608 C  "C1'" . A   E 2 40 ? 26.532  -5.484  -59.921  1.00 16.31  ? 43  A   E "C1'" 1 
ATOM   3609 N  N9    . A   E 2 40 ? 26.959  -6.877  -59.812  1.00 21.41  ? 43  A   E N9    1 
ATOM   3610 C  C8    . A   E 2 40 ? 28.201  -7.430  -59.618  1.00 24.30  ? 43  A   E C8    1 
ATOM   3611 N  N7    . A   E 2 40 ? 28.188  -8.743  -59.540  1.00 16.45  ? 43  A   E N7    1 
ATOM   3612 C  C5    . A   E 2 40 ? 26.848  -9.071  -59.702  1.00 16.69  ? 43  A   E C5    1 
ATOM   3613 C  C6    . A   E 2 40 ? 26.167  -10.299 -59.716  1.00 16.16  ? 43  A   E C6    1 
ATOM   3614 N  N6    . A   E 2 40 ? 26.766  -11.477 -59.535  1.00 31.71  ? 43  A   E N6    1 
ATOM   3615 N  N1    . A   E 2 40 ? 24.831  -10.278 -59.919  1.00 4.89   ? 43  A   E N1    1 
ATOM   3616 C  C2    . A   E 2 40 ? 24.228  -9.102  -60.083  1.00 14.73  ? 43  A   E C2    1 
ATOM   3617 N  N3    . A   E 2 40 ? 24.754  -7.881  -60.080  1.00 22.34  ? 43  A   E N3    1 
ATOM   3618 C  C4    . A   E 2 40 ? 26.085  -7.936  -59.881  1.00 22.36  ? 43  A   E C4    1 
ATOM   3619 P  P     . A   E 2 41 ? 27.326  -0.969  -58.409  1.00 26.64  ? 44  A   E P     1 
ATOM   3620 O  OP1   . A   E 2 41 ? 28.780  -1.240  -58.375  1.00 22.50  ? 44  A   E OP1   1 
ATOM   3621 O  OP2   . A   E 2 41 ? 26.565  -0.891  -57.141  1.00 30.13  ? 44  A   E OP2   1 
ATOM   3622 O  "O5'" . A   E 2 41 ? 27.075  0.344   -59.262  1.00 17.64  ? 44  A   E "O5'" 1 
ATOM   3623 C  "C5'" . A   E 2 41 ? 27.724  0.490   -60.502  1.00 23.31  ? 44  A   E "C5'" 1 
ATOM   3624 C  "C4'" . A   E 2 41 ? 26.921  1.337   -61.457  1.00 33.52  ? 44  A   E "C4'" 1 
ATOM   3625 O  "O4'" . A   E 2 41 ? 25.657  0.748   -61.823  1.00 35.40  ? 44  A   E "O4'" 1 
ATOM   3626 C  "C3'" . A   E 2 41 ? 26.499  2.745   -61.086  1.00 40.67  ? 44  A   E "C3'" 1 
ATOM   3627 O  "O3'" . A   E 2 41 ? 27.647  3.595   -61.130  1.00 52.65  ? 44  A   E "O3'" 1 
ATOM   3628 C  "C2'" . A   E 2 41 ? 25.531  3.079   -62.227  1.00 44.55  ? 44  A   E "C2'" 1 
ATOM   3629 O  "O2'" . A   E 2 41 ? 26.231  3.582   -63.347  1.00 53.69  ? 44  A   E "O2'" 1 
ATOM   3630 C  "C1'" . A   E 2 41 ? 25.000  1.697   -62.625  1.00 37.62  ? 44  A   E "C1'" 1 
ATOM   3631 N  N9    . A   E 2 41 ? 23.553  1.468   -62.697  1.00 41.50  ? 44  A   E N9    1 
ATOM   3632 C  C8    . A   E 2 41 ? 22.687  2.145   -63.535  1.00 46.83  ? 44  A   E C8    1 
ATOM   3633 N  N7    . A   E 2 41 ? 21.457  1.691   -63.513  1.00 35.01  ? 44  A   E N7    1 
ATOM   3634 C  C5    . A   E 2 41 ? 21.505  0.667   -62.584  1.00 32.37  ? 44  A   E C5    1 
ATOM   3635 C  C6    . A   E 2 41 ? 20.528  -0.199  -62.111  1.00 26.91  ? 44  A   E C6    1 
ATOM   3636 N  N6    . A   E 2 41 ? 19.267  -0.178  -62.529  1.00 28.13  ? 44  A   E N6    1 
ATOM   3637 N  N1    . A   E 2 41 ? 20.887  -1.100  -61.179  1.00 32.98  ? 44  A   E N1    1 
ATOM   3638 C  C2    . A   E 2 41 ? 22.160  -1.116  -60.759  1.00 42.07  ? 44  A   E C2    1 
ATOM   3639 N  N3    . A   E 2 41 ? 23.180  -0.352  -61.131  1.00 39.33  ? 44  A   E N3    1 
ATOM   3640 C  C4    . A   E 2 41 ? 22.784  0.530   -62.057  1.00 36.87  ? 44  A   E C4    1 
ATOM   3641 P  P     . A   E 2 42 ? 27.480  5.168   -61.422  1.00 60.08  ? 45  A   E P     1 
ATOM   3642 O  OP1   . A   E 2 42 ? 28.576  5.894   -60.731  1.00 66.79  ? 45  A   E OP1   1 
ATOM   3643 O  OP2   . A   E 2 42 ? 26.069  5.563   -61.172  1.00 65.89  ? 45  A   E OP2   1 
ATOM   3644 O  "O5'" . A   E 2 42 ? 27.729  5.286   -62.983  1.00 57.02  ? 45  A   E "O5'" 1 
ATOM   3645 C  "C5'" . A   E 2 42 ? 26.882  6.091   -63.787  1.00 72.14  ? 45  A   E "C5'" 1 
ATOM   3646 C  "C4'" . A   E 2 42 ? 27.405  6.121   -65.194  1.00 80.90  ? 45  A   E "C4'" 1 
ATOM   3647 O  "O4'" . A   E 2 42 ? 27.758  4.769   -65.591  1.00 78.96  ? 45  A   E "O4'" 1 
ATOM   3648 C  "C3'" . A   E 2 42 ? 26.431  6.606   -66.255  1.00 84.18  ? 45  A   E "C3'" 1 
ATOM   3649 O  "O3'" . A   E 2 42 ? 26.440  8.027   -66.356  1.00 90.47  ? 45  A   E "O3'" 1 
ATOM   3650 C  "C2'" . A   E 2 42 ? 26.976  5.912   -67.494  1.00 83.14  ? 45  A   E "C2'" 1 
ATOM   3651 O  "O2'" . A   E 2 42 ? 28.149  6.542   -67.992  1.00 81.72  ? 45  A   E "O2'" 1 
ATOM   3652 C  "C1'" . A   E 2 42 ? 27.317  4.534   -66.915  1.00 77.71  ? 45  A   E "C1'" 1 
ATOM   3653 N  N9    . A   E 2 42 ? 26.155  3.646   -66.829  1.00 70.33  ? 45  A   E N9    1 
ATOM   3654 C  C8    . A   E 2 42 ? 24.878  3.866   -67.289  1.00 68.59  ? 45  A   E C8    1 
ATOM   3655 N  N7    . A   E 2 42 ? 24.053  2.876   -67.049  1.00 64.82  ? 45  A   E N7    1 
ATOM   3656 C  C5    . A   E 2 42 ? 24.837  1.942   -66.388  1.00 61.02  ? 45  A   E C5    1 
ATOM   3657 C  C6    . A   E 2 42 ? 24.549  0.675   -65.859  1.00 59.63  ? 45  A   E C6    1 
ATOM   3658 N  N6    . A   E 2 42 ? 23.346  0.105   -65.918  1.00 55.06  ? 45  A   E N6    1 
ATOM   3659 N  N1    . A   E 2 42 ? 25.553  0.004   -65.257  1.00 62.07  ? 45  A   E N1    1 
ATOM   3660 C  C2    . A   E 2 42 ? 26.762  0.578   -65.197  1.00 66.57  ? 45  A   E C2    1 
ATOM   3661 N  N3    . A   E 2 42 ? 27.155  1.762   -65.658  1.00 65.08  ? 45  A   E N3    1 
ATOM   3662 C  C4    . A   E 2 42 ? 26.133  2.401   -66.249  1.00 62.65  ? 45  A   E C4    1 
ATOM   3663 P  P     . U   E 2 43 ? 25.677  8.744   -67.575  1.00 90.58  ? 46  U   E P     1 
ATOM   3664 O  OP1   . U   E 2 43 ? 25.575  10.187  -67.247  1.00 87.23  ? 46  U   E OP1   1 
ATOM   3665 O  OP2   . U   E 2 43 ? 24.439  7.966   -67.849  1.00 86.62  ? 46  U   E OP2   1 
ATOM   3666 O  "O5'" . U   E 2 43 ? 26.688  8.550   -68.796  1.00 87.03  ? 46  U   E "O5'" 1 
ATOM   3667 C  "C5'" . U   E 2 43 ? 26.217  8.450   -70.135  1.00 85.28  ? 46  U   E "C5'" 1 
ATOM   3668 C  "C4'" . U   E 2 43 ? 25.755  7.039   -70.424  1.00 87.69  ? 46  U   E "C4'" 1 
ATOM   3669 O  "O4'" . U   E 2 43 ? 24.313  7.024   -70.589  1.00 88.50  ? 46  U   E "O4'" 1 
ATOM   3670 C  "C3'" . U   E 2 43 ? 26.311  6.432   -71.703  1.00 87.11  ? 46  U   E "C3'" 1 
ATOM   3671 O  "O3'" . U   E 2 43 ? 27.528  5.766   -71.407  1.00 83.80  ? 46  U   E "O3'" 1 
ATOM   3672 C  "C2'" . U   E 2 43 ? 25.234  5.431   -72.103  1.00 88.31  ? 46  U   E "C2'" 1 
ATOM   3673 O  "O2'" . U   E 2 43 ? 25.363  4.183   -71.454  1.00 90.13  ? 46  U   E "O2'" 1 
ATOM   3674 C  "C1'" . U   E 2 43 ? 23.959  6.140   -71.639  1.00 88.98  ? 46  U   E "C1'" 1 
ATOM   3675 P  P     . A   E 2 44 ? 28.628  5.559   -72.553  1.00 81.17  ? 47  A   E P     1 
ATOM   3676 O  OP1   . A   E 2 44 ? 29.456  6.786   -72.586  1.00 84.49  ? 47  A   E OP1   1 
ATOM   3677 O  OP2   . A   E 2 44 ? 27.947  5.090   -73.795  1.00 80.75  ? 47  A   E OP2   1 
ATOM   3678 O  "O5'" . A   E 2 44 ? 29.530  4.377   -71.986  1.00 75.05  ? 47  A   E "O5'" 1 
ATOM   3679 C  "C5'" . A   E 2 44 ? 30.467  4.600   -70.933  1.00 62.45  ? 47  A   E "C5'" 1 
ATOM   3680 C  "C4'" . A   E 2 44 ? 30.694  3.320   -70.157  1.00 59.04  ? 47  A   E "C4'" 1 
ATOM   3681 O  "O4'" . A   E 2 44 ? 29.649  3.135   -69.163  1.00 55.28  ? 47  A   E "O4'" 1 
ATOM   3682 C  "C3'" . A   E 2 44 ? 30.631  2.043   -70.980  1.00 54.00  ? 47  A   E "C3'" 1 
ATOM   3683 O  "O3'" . A   E 2 44 ? 31.818  1.788   -71.712  1.00 47.87  ? 47  A   E "O3'" 1 
ATOM   3684 C  "C2'" . A   E 2 44 ? 30.350  0.987   -69.921  1.00 47.53  ? 47  A   E "C2'" 1 
ATOM   3685 O  "O2'" . A   E 2 44 ? 31.500  0.582   -69.209  1.00 39.56  ? 47  A   E "O2'" 1 
ATOM   3686 C  "C1'" . A   E 2 44 ? 29.389  1.743   -69.001  1.00 50.97  ? 47  A   E "C1'" 1 
ATOM   3687 N  N9    . A   E 2 44 ? 27.987  1.478   -69.333  1.00 46.76  ? 47  A   E N9    1 
ATOM   3688 C  C8    . A   E 2 44 ? 27.152  2.169   -70.180  1.00 44.27  ? 47  A   E C8    1 
ATOM   3689 N  N7    . A   E 2 44 ? 25.950  1.654   -70.277  1.00 38.17  ? 47  A   E N7    1 
ATOM   3690 C  C5    . A   E 2 44 ? 25.992  0.555   -69.431  1.00 37.40  ? 47  A   E C5    1 
ATOM   3691 C  C6    . A   E 2 44 ? 25.037  -0.415  -69.097  1.00 33.38  ? 47  A   E C6    1 
ATOM   3692 N  N6    . A   E 2 44 ? 23.799  -0.434  -69.587  1.00 29.64  ? 47  A   E N6    1 
ATOM   3693 N  N1    . A   E 2 44 ? 25.403  -1.382  -68.233  1.00 34.01  ? 47  A   E N1    1 
ATOM   3694 C  C2    . A   E 2 44 ? 26.647  -1.368  -67.742  1.00 39.68  ? 47  A   E C2    1 
ATOM   3695 N  N3    . A   E 2 44 ? 27.636  -0.511  -67.977  1.00 39.16  ? 47  A   E N3    1 
ATOM   3696 C  C4    . A   E 2 44 ? 27.239  0.437   -68.842  1.00 41.52  ? 47  A   E C4    1 
ATOM   3697 P  P     . C   E 2 45 ? 31.718  1.033   -73.123  1.00 49.00  ? 48  C   E P     1 
ATOM   3698 O  OP1   . C   E 2 45 ? 33.062  1.065   -73.743  1.00 55.65  ? 48  C   E OP1   1 
ATOM   3699 O  OP2   . C   E 2 45 ? 30.558  1.594   -73.863  1.00 45.71  ? 48  C   E OP2   1 
ATOM   3700 O  "O5'" . C   E 2 45 ? 31.381  -0.472  -72.717  1.00 43.57  ? 48  C   E "O5'" 1 
ATOM   3701 C  "C5'" . C   E 2 45 ? 32.277  -1.209  -71.890  1.00 31.47  ? 48  C   E "C5'" 1 
ATOM   3702 C  "C4'" . C   E 2 45 ? 31.602  -2.438  -71.346  1.00 24.09  ? 48  C   E "C4'" 1 
ATOM   3703 O  "O4'" . C   E 2 45 ? 30.511  -2.049  -70.476  1.00 21.74  ? 48  C   E "O4'" 1 
ATOM   3704 C  "C3'" . C   E 2 45 ? 30.939  -3.315  -72.384  1.00 21.81  ? 48  C   E "C3'" 1 
ATOM   3705 O  "O3'" . C   E 2 45 ? 31.860  -4.196  -72.979  1.00 17.03  ? 48  C   E "O3'" 1 
ATOM   3706 C  "C2'" . C   E 2 45 ? 29.920  -4.072  -71.558  1.00 22.52  ? 48  C   E "C2'" 1 
ATOM   3707 O  "O2'" . C   E 2 45 ? 30.506  -5.123  -70.824  1.00 24.11  ? 48  C   E "O2'" 1 
ATOM   3708 C  "C1'" . C   E 2 45 ? 29.442  -2.970  -70.614  1.00 22.68  ? 48  C   E "C1'" 1 
ATOM   3709 N  N1    . C   E 2 45 ? 28.290  -2.248  -71.163  1.00 23.01  ? 48  C   E N1    1 
ATOM   3710 C  C2    . C   E 2 45 ? 27.033  -2.839  -71.100  1.00 19.01  ? 48  C   E C2    1 
ATOM   3711 O  O2    . C   E 2 45 ? 26.927  -3.954  -70.594  1.00 23.65  ? 48  C   E O2    1 
ATOM   3712 N  N3    . C   E 2 45 ? 25.966  -2.181  -71.590  1.00 17.07  ? 48  C   E N3    1 
ATOM   3713 C  C4    . C   E 2 45 ? 26.123  -0.976  -72.128  1.00 17.00  ? 48  C   E C4    1 
ATOM   3714 N  N4    . C   E 2 45 ? 25.045  -0.354  -72.578  1.00 18.80  ? 48  C   E N4    1 
ATOM   3715 C  C5    . C   E 2 45 ? 27.398  -0.352  -72.218  1.00 23.19  ? 48  C   E C5    1 
ATOM   3716 C  C6    . C   E 2 45 ? 28.445  -1.016  -71.726  1.00 23.04  ? 48  C   E C6    1 
ATOM   3717 P  P     . C   E 2 46 ? 31.658  -4.595  -74.510  1.00 29.82  ? 49  C   E P     1 
ATOM   3718 O  OP1   . C   E 2 46 ? 32.926  -5.168  -75.027  1.00 21.60  ? 49  C   E OP1   1 
ATOM   3719 O  OP2   . C   E 2 46 ? 31.057  -3.399  -75.168  1.00 26.87  ? 49  C   E OP2   1 
ATOM   3720 O  "O5'" . C   E 2 46 ? 30.533  -5.716  -74.475  1.00 14.89  ? 49  C   E "O5'" 1 
ATOM   3721 C  "C5'" . C   E 2 46 ? 30.598  -6.780  -73.548  1.00 18.94  ? 49  C   E "C5'" 1 
ATOM   3722 C  "C4'" . C   E 2 46 ? 29.259  -7.460  -73.460  1.00 18.56  ? 49  C   E "C4'" 1 
ATOM   3723 O  "O4'" . C   E 2 46 ? 28.317  -6.607  -72.763  1.00 21.80  ? 49  C   E "O4'" 1 
ATOM   3724 C  "C3'" . C   E 2 46 ? 28.594  -7.701  -74.798  1.00 19.26  ? 49  C   E "C3'" 1 
ATOM   3725 O  "O3'" . C   E 2 46 ? 29.114  -8.865  -75.419  1.00 29.54  ? 49  C   E "O3'" 1 
ATOM   3726 C  "C2'" . C   E 2 46 ? 27.141  -7.868  -74.389  1.00 12.86  ? 49  C   E "C2'" 1 
ATOM   3727 O  "O2'" . C   E 2 46 ? 26.905  -9.146  -73.858  1.00 3.17   ? 49  C   E "O2'" 1 
ATOM   3728 C  "C1'" . C   E 2 46 ? 27.017  -6.805  -73.296  1.00 20.29  ? 49  C   E "C1'" 1 
ATOM   3729 N  N1    . C   E 2 46 ? 26.546  -5.526  -73.840  1.00 18.96  ? 49  C   E N1    1 
ATOM   3730 C  C2    . C   E 2 46 ? 25.190  -5.375  -74.129  1.00 17.88  ? 49  C   E C2    1 
ATOM   3731 O  O2    . C   E 2 46 ? 24.416  -6.299  -73.867  1.00 7.80   ? 49  C   E O2    1 
ATOM   3732 N  N3    . C   E 2 46 ? 24.758  -4.224  -74.688  1.00 25.08  ? 49  C   E N3    1 
ATOM   3733 C  C4    . C   E 2 46 ? 25.627  -3.241  -74.944  1.00 29.48  ? 49  C   E C4    1 
ATOM   3734 N  N4    . C   E 2 46 ? 25.162  -2.124  -75.503  1.00 27.42  ? 49  C   E N4    1 
ATOM   3735 C  C5    . C   E 2 46 ? 27.012  -3.361  -74.637  1.00 26.46  ? 49  C   E C5    1 
ATOM   3736 C  C6    . C   E 2 46 ? 27.423  -4.508  -74.086  1.00 22.93  ? 49  C   E C6    1 
ATOM   3737 P  P     . C   E 2 47 ? 29.098  -8.989  -77.021  1.00 23.97  ? 50  C   E P     1 
ATOM   3738 O  OP1   . C   E 2 47 ? 29.772  -10.251 -77.387  1.00 10.00  ? 50  C   E OP1   1 
ATOM   3739 O  OP2   . C   E 2 47 ? 29.591  -7.705  -77.576  1.00 28.24  ? 50  C   E OP2   1 
ATOM   3740 O  "O5'" . C   E 2 47 ? 27.554  -9.147  -77.364  1.00 13.82  ? 50  C   E "O5'" 1 
ATOM   3741 C  "C5'" . C   E 2 47 ? 26.905  -10.385 -77.151  1.00 14.37  ? 50  C   E "C5'" 1 
ATOM   3742 C  "C4'" . C   E 2 47 ? 25.426  -10.226 -77.329  1.00 17.10  ? 50  C   E "C4'" 1 
ATOM   3743 O  "O4'" . C   E 2 47 ? 25.020  -9.068  -76.561  1.00 23.15  ? 50  C   E "O4'" 1 
ATOM   3744 C  "C3'" . C   E 2 47 ? 24.919  -9.891  -78.719  1.00 19.51  ? 50  C   E "C3'" 1 
ATOM   3745 O  "O3'" . C   E 2 47 ? 24.796  -11.057 -79.530  1.00 32.20  ? 50  C   E "O3'" 1 
ATOM   3746 C  "C2'" . C   E 2 47 ? 23.551  -9.329  -78.382  1.00 24.41  ? 50  C   E "C2'" 1 
ATOM   3747 O  "O2'" . C   E 2 47 ? 22.658  -10.345 -77.972  1.00 29.77  ? 50  C   E "O2'" 1 
ATOM   3748 C  "C1'" . C   E 2 47 ? 23.887  -8.474  -77.166  1.00 22.16  ? 50  C   E "C1'" 1 
ATOM   3749 N  N1    . C   E 2 47 ? 24.214  -7.087  -77.523  1.00 26.09  ? 50  C   E N1    1 
ATOM   3750 C  C2    . C   E 2 47 ? 23.193  -6.271  -78.000  1.00 30.30  ? 50  C   E C2    1 
ATOM   3751 O  O2    . C   E 2 47 ? 22.053  -6.747  -78.113  1.00 35.32  ? 50  C   E O2    1 
ATOM   3752 N  N3    . C   E 2 47 ? 23.466  -4.992  -78.330  1.00 28.33  ? 50  C   E N3    1 
ATOM   3753 C  C4    . C   E 2 47 ? 24.702  -4.521  -78.198  1.00 24.71  ? 50  C   E C4    1 
ATOM   3754 N  N4    . C   E 2 47 ? 24.921  -3.248  -78.542  1.00 22.19  ? 50  C   E N4    1 
ATOM   3755 C  C5    . C   E 2 47 ? 25.768  -5.331  -77.711  1.00 23.03  ? 50  C   E C5    1 
ATOM   3756 C  C6    . C   E 2 47 ? 25.482  -6.598  -77.391  1.00 24.25  ? 50  C   E C6    1 
ATOM   3757 P  P     . G   E 2 48 ? 24.697  -10.916 -81.136  1.00 39.20  ? 51  G   E P     1 
ATOM   3758 O  OP1   . G   E 2 48 ? 24.741  -12.284 -81.718  1.00 30.90  ? 51  G   E OP1   1 
ATOM   3759 O  OP2   . G   E 2 48 ? 25.663  -9.874  -81.592  1.00 18.30  ? 51  G   E OP2   1 
ATOM   3760 O  "O5'" . G   E 2 48 ? 23.241  -10.345 -81.407  1.00 28.80  ? 51  G   E "O5'" 1 
ATOM   3761 C  "C5'" . G   E 2 48 ? 22.111  -11.197 -81.409  1.00 22.87  ? 51  G   E "C5'" 1 
ATOM   3762 C  "C4'" . G   E 2 48 ? 20.940  -10.452 -81.977  1.00 32.24  ? 51  G   E "C4'" 1 
ATOM   3763 O  "O4'" . G   E 2 48 ? 20.736  -9.256  -81.180  1.00 36.09  ? 51  G   E "O4'" 1 
ATOM   3764 C  "C3'" . G   E 2 48 ? 21.184  -9.931  -83.380  1.00 34.56  ? 51  G   E "C3'" 1 
ATOM   3765 O  "O3'" . G   E 2 48 ? 20.801  -10.912 -84.324  1.00 34.44  ? 51  G   E "O3'" 1 
ATOM   3766 C  "C2'" . G   E 2 48 ? 20.281  -8.708  -83.452  1.00 34.56  ? 51  G   E "C2'" 1 
ATOM   3767 O  "O2'" . G   E 2 48 ? 18.943  -9.039  -83.775  1.00 35.78  ? 51  G   E "O2'" 1 
ATOM   3768 C  "C1'" . G   E 2 48 ? 20.391  -8.168  -82.023  1.00 30.53  ? 51  G   E "C1'" 1 
ATOM   3769 N  N9    . G   E 2 48 ? 21.410  -7.140  -81.848  1.00 19.60  ? 51  G   E N9    1 
ATOM   3770 C  C8    . G   E 2 48 ? 22.683  -7.318  -81.356  1.00 14.62  ? 51  G   E C8    1 
ATOM   3771 N  N7    . G   E 2 48 ? 23.368  -6.211  -81.291  1.00 12.67  ? 51  G   E N7    1 
ATOM   3772 C  C5    . G   E 2 48 ? 22.497  -5.241  -81.775  1.00 20.32  ? 51  G   E C5    1 
ATOM   3773 C  C6    . G   E 2 48 ? 22.681  -3.840  -81.949  1.00 23.22  ? 51  G   E C6    1 
ATOM   3774 O  O6    . G   E 2 48 ? 23.683  -3.155  -81.700  1.00 34.81  ? 51  G   E O6    1 
ATOM   3775 N  N1    . G   E 2 48 ? 21.543  -3.236  -82.473  1.00 11.69  ? 51  G   E N1    1 
ATOM   3776 C  C2    . G   E 2 48 ? 20.383  -3.884  -82.789  1.00 12.19  ? 51  G   E C2    1 
ATOM   3777 N  N2    . G   E 2 48 ? 19.419  -3.109  -83.283  1.00 10.37  ? 51  G   E N2    1 
ATOM   3778 N  N3    . G   E 2 48 ? 20.189  -5.191  -82.634  1.00 8.19   ? 51  G   E N3    1 
ATOM   3779 C  C4    . G   E 2 48 ? 21.284  -5.802  -82.127  1.00 17.06  ? 51  G   E C4    1 
ATOM   3780 P  P     . U   E 2 49 ? 21.641  -11.079 -85.674  1.00 37.16  ? 52  U   E P     1 
ATOM   3781 O  OP1   . U   E 2 49 ? 23.094  -11.024 -85.378  1.00 27.36  ? 52  U   E OP1   1 
ATOM   3782 O  OP2   . U   E 2 49 ? 21.051  -10.143 -86.672  1.00 36.81  ? 52  U   E OP2   1 
ATOM   3783 O  "O5'" . U   E 2 49 ? 21.291  -12.561 -86.116  1.00 43.68  ? 52  U   E "O5'" 1 
ATOM   3784 C  "C5'" . U   E 2 49 ? 21.559  -13.658 -85.260  1.00 37.74  ? 52  U   E "C5'" 1 
ATOM   3785 C  "C4'" . U   E 2 49 ? 20.453  -14.671 -85.373  1.00 42.55  ? 52  U   E "C4'" 1 
ATOM   3786 O  "O4'" . U   E 2 49 ? 19.247  -14.168 -84.754  1.00 42.97  ? 52  U   E "O4'" 1 
ATOM   3787 C  "C3'" . U   E 2 49 ? 20.003  -15.006 -86.785  1.00 45.98  ? 52  U   E "C3'" 1 
ATOM   3788 O  "O3'" . U   E 2 49 ? 20.956  -15.838 -87.480  1.00 49.20  ? 52  U   E "O3'" 1 
ATOM   3789 C  "C2'" . U   E 2 49 ? 18.564  -15.514 -86.615  1.00 50.48  ? 52  U   E "C2'" 1 
ATOM   3790 O  "O2'" . U   E 2 49 ? 18.431  -16.915 -86.539  1.00 55.42  ? 52  U   E "O2'" 1 
ATOM   3791 C  "C1'" . U   E 2 49 ? 18.157  -14.897 -85.269  1.00 51.94  ? 52  U   E "C1'" 1 
ATOM   3792 N  N1    . U   E 2 49 ? 16.913  -14.119 -85.137  1.00 57.74  ? 52  U   E N1    1 
ATOM   3793 C  C2    . U   E 2 49 ? 15.712  -14.762 -85.452  1.00 64.37  ? 52  U   E C2    1 
ATOM   3794 O  O2    . U   E 2 49 ? 15.663  -15.887 -85.923  1.00 69.12  ? 52  U   E O2    1 
ATOM   3795 N  N3    . U   E 2 49 ? 14.571  -14.036 -85.193  1.00 65.93  ? 52  U   E N3    1 
ATOM   3796 C  C4    . U   E 2 49 ? 14.499  -12.754 -84.682  1.00 68.99  ? 52  U   E C4    1 
ATOM   3797 O  O4    . U   E 2 49 ? 13.386  -12.238 -84.485  1.00 68.44  ? 52  U   E O4    1 
ATOM   3798 C  C5    . U   E 2 49 ? 15.783  -12.140 -84.424  1.00 63.81  ? 52  U   E C5    1 
ATOM   3799 C  C6    . U   E 2 49 ? 16.916  -12.827 -84.664  1.00 54.65  ? 52  U   E C6    1 
ATOM   3800 P  P     . A   E 2 50 ? 21.212  -17.380 -87.043  1.00 52.34  ? 53  A   E P     1 
ATOM   3801 O  OP1   . A   E 2 50 ? 22.539  -17.759 -87.587  1.00 57.14  ? 53  A   E OP1   1 
ATOM   3802 O  OP2   . A   E 2 50 ? 20.033  -18.226 -87.359  1.00 51.09  ? 53  A   E OP2   1 
ATOM   3803 O  "O5'" . A   E 2 50 ? 21.400  -17.334 -85.469  1.00 52.06  ? 53  A   E "O5'" 1 
ATOM   3804 C  "C5'" . A   E 2 50 ? 21.033  -18.438 -84.660  1.00 54.62  ? 53  A   E "C5'" 1 
ATOM   3805 C  "C4'" . A   E 2 50 ? 21.495  -18.206 -83.248  1.00 60.40  ? 53  A   E "C4'" 1 
ATOM   3806 O  "O4'" . A   E 2 50 ? 21.271  -16.824 -82.897  1.00 58.25  ? 53  A   E "O4'" 1 
ATOM   3807 C  "C3'" . A   E 2 50 ? 20.778  -19.020 -82.187  1.00 66.55  ? 53  A   E "C3'" 1 
ATOM   3808 O  "O3'" . A   E 2 50 ? 21.443  -20.275 -82.043  1.00 78.92  ? 53  A   E "O3'" 1 
ATOM   3809 C  "C2'" . A   E 2 50 ? 20.923  -18.145 -80.938  1.00 65.11  ? 53  A   E "C2'" 1 
ATOM   3810 O  "O2'" . A   E 2 50 ? 22.134  -18.353 -80.233  1.00 61.44  ? 53  A   E "O2'" 1 
ATOM   3811 C  "C1'" . A   E 2 50 ? 20.932  -16.732 -81.532  1.00 58.61  ? 53  A   E "C1'" 1 
ATOM   3812 N  N9    . A   E 2 50 ? 19.694  -15.962 -81.430  1.00 55.57  ? 53  A   E N9    1 
ATOM   3813 C  C8    . A   E 2 50 ? 19.548  -14.700 -80.914  1.00 54.04  ? 53  A   E C8    1 
ATOM   3814 N  N7    . A   E 2 50 ? 18.324  -14.243 -80.976  1.00 48.62  ? 53  A   E N7    1 
ATOM   3815 C  C5    . A   E 2 50 ? 17.616  -15.276 -81.565  1.00 50.28  ? 53  A   E C5    1 
ATOM   3816 C  C6    . A   E 2 50 ? 16.273  -15.410 -81.907  1.00 55.25  ? 53  A   E C6    1 
ATOM   3817 N  N6    . A   E 2 50 ? 15.359  -14.459 -81.695  1.00 61.86  ? 53  A   E N6    1 
ATOM   3818 N  N1    . A   E 2 50 ? 15.885  -16.567 -82.483  1.00 56.96  ? 53  A   E N1    1 
ATOM   3819 C  C2    . A   E 2 50 ? 16.803  -17.515 -82.692  1.00 55.21  ? 53  A   E C2    1 
ATOM   3820 N  N3    . A   E 2 50 ? 18.100  -17.504 -82.413  1.00 51.54  ? 53  A   E N3    1 
ATOM   3821 C  C4    . A   E 2 50 ? 18.446  -16.343 -81.844  1.00 51.38  ? 53  A   E C4    1 
ATOM   3822 P  P     . U   E 2 51 ? 20.605  -21.648 -82.104  1.00 81.12  ? 54  U   E P     1 
ATOM   3823 O  OP1   . U   E 2 51 ? 21.455  -22.634 -82.813  1.00 81.40  ? 54  U   E OP1   1 
ATOM   3824 O  OP2   . U   E 2 51 ? 19.247  -21.342 -82.618  1.00 78.62  ? 54  U   E OP2   1 
ATOM   3825 O  "O5'" . U   E 2 51 ? 20.488  -22.090 -80.578  1.00 81.13  ? 54  U   E "O5'" 1 
ATOM   3826 C  "C5'" . U   E 2 51 ? 21.356  -21.527 -79.606  1.00 79.80  ? 54  U   E "C5'" 1 
ATOM   3827 C  "C4'" . U   E 2 51 ? 22.013  -22.610 -78.796  1.00 76.85  ? 54  U   E "C4'" 1 
ATOM   3828 O  "O4'" . U   E 2 51 ? 21.993  -23.854 -79.512  1.00 73.77  ? 54  U   E "O4'" 1 
ATOM   3829 C  "C3'" . U   E 2 51 ? 23.480  -22.355 -78.482  1.00 79.69  ? 54  U   E "C3'" 1 
ATOM   3830 O  "O3'" . U   E 2 51 ? 23.578  -21.699 -77.213  1.00 81.43  ? 54  U   E "O3'" 1 
ATOM   3831 C  "C2'" . U   E 2 51 ? 24.095  -23.761 -78.379  1.00 80.84  ? 54  U   E "C2'" 1 
ATOM   3832 O  "O2'" . U   E 2 51 ? 24.338  -24.177 -77.053  1.00 88.51  ? 54  U   E "O2'" 1 
ATOM   3833 C  "C1'" . U   E 2 51 ? 23.017  -24.663 -78.996  1.00 81.36  ? 54  U   E "C1'" 1 
ATOM   3834 N  N1    . U   E 2 51 ? 23.409  -25.659 -79.999  1.00 82.99  ? 54  U   E N1    1 
ATOM   3835 C  C2    . U   E 2 51 ? 24.031  -26.811 -79.548  1.00 80.41  ? 54  U   E C2    1 
ATOM   3836 O  O2    . U   E 2 51 ? 24.306  -27.004 -78.379  1.00 76.97  ? 54  U   E O2    1 
ATOM   3837 N  N3    . U   E 2 51 ? 24.315  -27.731 -80.520  1.00 82.17  ? 54  U   E N3    1 
ATOM   3838 C  C4    . U   E 2 51 ? 24.049  -27.618 -81.869  1.00 89.47  ? 54  U   E C4    1 
ATOM   3839 O  O4    . U   E 2 51 ? 24.345  -28.546 -82.624  1.00 95.01  ? 54  U   E O4    1 
ATOM   3840 C  C5    . U   E 2 51 ? 23.423  -26.389 -82.257  1.00 87.36  ? 54  U   E C5    1 
ATOM   3841 C  C6    . U   E 2 51 ? 23.138  -25.473 -81.330  1.00 86.32  ? 54  U   E C6    1 
ATOM   3842 P  P     . C   E 2 52 ? 23.458  -20.095 -77.106  1.00 81.37  ? 55  C   E P     1 
ATOM   3843 O  OP1   . C   E 2 52 ? 23.607  -19.730 -75.678  1.00 81.41  ? 55  C   E OP1   1 
ATOM   3844 O  OP2   . C   E 2 52 ? 22.249  -19.648 -77.845  1.00 78.91  ? 55  C   E OP2   1 
ATOM   3845 O  "O5'" . C   E 2 52 ? 24.746  -19.561 -77.875  1.00 84.78  ? 55  C   E "O5'" 1 
ATOM   3846 C  "C5'" . C   E 2 52 ? 26.014  -19.467 -77.224  1.00 82.16  ? 55  C   E "C5'" 1 
ATOM   3847 C  "C4'" . C   E 2 52 ? 26.734  -18.227 -77.693  1.00 82.09  ? 55  C   E "C4'" 1 
ATOM   3848 O  "O4'" . C   E 2 52 ? 26.966  -18.329 -79.125  1.00 84.41  ? 55  C   E "O4'" 1 
ATOM   3849 C  "C3'" . C   E 2 52 ? 25.912  -16.961 -77.530  1.00 82.98  ? 55  C   E "C3'" 1 
ATOM   3850 O  "O3'" . C   E 2 52 ? 26.083  -16.379 -76.245  1.00 69.20  ? 55  C   E "O3'" 1 
ATOM   3851 C  "C2'" . C   E 2 52 ? 26.428  -16.057 -78.644  1.00 88.69  ? 55  C   E "C2'" 1 
ATOM   3852 O  "O2'" . C   E 2 52 ? 27.571  -15.307 -78.287  1.00 98.82  ? 55  C   E "O2'" 1 
ATOM   3853 C  "C1'" . C   E 2 52 ? 26.750  -17.071 -79.744  1.00 86.97  ? 55  C   E "C1'" 1 
ATOM   3854 P  P     . A   E 2 53 ? 24.949  -15.399 -75.683  1.00 65.52  ? 56  A   E P     1 
ATOM   3855 O  OP1   . A   E 2 53 ? 23.748  -16.212 -75.348  1.00 55.79  ? 56  A   E OP1   1 
ATOM   3856 O  OP2   . A   E 2 53 ? 24.833  -14.282 -76.654  1.00 68.08  ? 56  A   E OP2   1 
ATOM   3857 O  "O5'" . A   E 2 53 ? 25.564  -14.790 -74.350  1.00 60.42  ? 56  A   E "O5'" 1 
ATOM   3858 C  "C5'" . A   E 2 53 ? 24.709  -14.269 -73.334  1.00 51.06  ? 56  A   E "C5'" 1 
ATOM   3859 C  "C4'" . A   E 2 53 ? 24.635  -12.758 -73.412  1.00 41.30  ? 56  A   E "C4'" 1 
ATOM   3860 O  "O4'" . A   E 2 53 ? 24.039  -12.341 -74.670  1.00 38.66  ? 56  A   E "O4'" 1 
ATOM   3861 C  "C3'" . A   E 2 53 ? 23.724  -12.140 -72.368  1.00 38.00  ? 56  A   E "C3'" 1 
ATOM   3862 O  "O3'" . A   E 2 53 ? 24.415  -12.005 -71.143  1.00 37.08  ? 56  A   E "O3'" 1 
ATOM   3863 C  "C2'" . A   E 2 53 ? 23.368  -10.797 -72.992  1.00 36.57  ? 56  A   E "C2'" 1 
ATOM   3864 O  "O2'" . A   E 2 53 ? 24.349  -9.789  -72.839  1.00 28.78  ? 56  A   E "O2'" 1 
ATOM   3865 C  "C1'" . A   E 2 53 ? 23.240  -11.184 -74.462  1.00 38.89  ? 56  A   E "C1'" 1 
ATOM   3866 N  N9    . A   E 2 53 ? 21.864  -11.518 -74.814  1.00 44.77  ? 56  A   E N9    1 
ATOM   3867 C  C8    . A   E 2 53 ? 21.379  -12.748 -75.182  1.00 52.69  ? 56  A   E C8    1 
ATOM   3868 N  N7    . A   E 2 53 ? 20.100  -12.747 -75.464  1.00 52.73  ? 56  A   E N7    1 
ATOM   3869 C  C5    . A   E 2 53 ? 19.717  -11.429 -75.266  1.00 40.94  ? 56  A   E C5    1 
ATOM   3870 C  C6    . A   E 2 53 ? 18.493  -10.780 -75.416  1.00 31.83  ? 56  A   E C6    1 
ATOM   3871 N  N6    . A   E 2 53 ? 17.382  -11.395 -75.813  1.00 28.50  ? 56  A   E N6    1 
ATOM   3872 N  N1    . A   E 2 53 ? 18.445  -9.463  -75.146  1.00 30.79  ? 56  A   E N1    1 
ATOM   3873 C  C2    . A   E 2 53 ? 19.563  -8.851  -74.754  1.00 31.96  ? 56  A   E C2    1 
ATOM   3874 N  N3    . A   E 2 53 ? 20.778  -9.352  -74.580  1.00 36.20  ? 56  A   E N3    1 
ATOM   3875 C  C4    . A   E 2 53 ? 20.790  -10.663 -74.858  1.00 40.47  ? 56  A   E C4    1 
ATOM   3876 P  P     . C   E 2 54 ? 23.887  -12.785 -69.851  1.00 33.34  ? 57  C   E P     1 
ATOM   3877 O  OP1   . C   E 2 54 ? 24.474  -12.073 -68.682  1.00 40.73  ? 57  C   E OP1   1 
ATOM   3878 O  OP2   . C   E 2 54 ? 24.164  -14.225 -70.042  1.00 23.52  ? 57  C   E OP2   1 
ATOM   3879 O  "O5'" . C   E 2 54 ? 22.321  -12.488 -69.855  1.00 22.11  ? 57  C   E "O5'" 1 
ATOM   3880 C  "C5'" . C   E 2 54 ? 21.860  -11.234 -69.362  1.00 22.83  ? 57  C   E "C5'" 1 
ATOM   3881 C  "C4'" . C   E 2 54 ? 20.413  -10.996 -69.706  1.00 15.37  ? 57  C   E "C4'" 1 
ATOM   3882 O  "O4'" . C   E 2 54 ? 20.231  -11.121 -71.140  1.00 22.23  ? 57  C   E "O4'" 1 
ATOM   3883 C  "C3'" . C   E 2 54 ? 19.381  -11.955 -69.147  1.00 17.89  ? 57  C   E "C3'" 1 
ATOM   3884 O  "O3'" . C   E 2 54 ? 19.058  -11.683 -67.789  1.00 21.89  ? 57  C   E "O3'" 1 
ATOM   3885 C  "C2'" . C   E 2 54 ? 18.207  -11.649 -70.059  1.00 14.55  ? 57  C   E "C2'" 1 
ATOM   3886 O  "O2'" . C   E 2 54 ? 17.667  -10.373 -69.781  1.00 4.35   ? 57  C   E "O2'" 1 
ATOM   3887 C  "C1'" . C   E 2 54 ? 18.914  -11.576 -71.406  1.00 18.80  ? 57  C   E "C1'" 1 
ATOM   3888 N  N1    . C   E 2 54 ? 18.990  -12.881 -72.082  1.00 19.23  ? 57  C   E N1    1 
ATOM   3889 C  C2    . C   E 2 54 ? 17.848  -13.365 -72.723  1.00 17.90  ? 57  C   E C2    1 
ATOM   3890 O  O2    . C   E 2 54 ? 16.808  -12.713 -72.668  1.00 13.87  ? 57  C   E O2    1 
ATOM   3891 N  N3    . C   E 2 54 ? 17.905  -14.533 -73.384  1.00 22.53  ? 57  C   E N3    1 
ATOM   3892 C  C4    . C   E 2 54 ? 19.040  -15.224 -73.416  1.00 20.15  ? 57  C   E C4    1 
ATOM   3893 N  N4    . C   E 2 54 ? 19.039  -16.362 -74.098  1.00 19.41  ? 57  C   E N4    1 
ATOM   3894 C  C5    . C   E 2 54 ? 20.222  -14.771 -72.751  1.00 14.21  ? 57  C   E C5    1 
ATOM   3895 C  C6    . C   E 2 54 ? 20.151  -13.605 -72.100  1.00 14.05  ? 57  C   E C6    1 
ATOM   3896 P  P     . C   E 2 55 ? 18.558  -12.882 -66.839  1.00 28.79  ? 58  C   E P     1 
ATOM   3897 O  OP1   . C   E 2 55 ? 18.648  -12.435 -65.430  1.00 25.98  ? 58  C   E OP1   1 
ATOM   3898 O  OP2   . C   E 2 55 ? 19.280  -14.101 -67.274  1.00 26.11  ? 58  C   E OP2   1 
ATOM   3899 O  "O5'" . C   E 2 55 ? 17.019  -13.078 -67.202  1.00 23.95  ? 58  C   E "O5'" 1 
ATOM   3900 C  "C5'" . C   E 2 55 ? 16.086  -12.018 -67.017  1.00 17.87  ? 58  C   E "C5'" 1 
ATOM   3901 C  "C4'" . C   E 2 55 ? 14.806  -12.304 -67.772  1.00 15.19  ? 58  C   E "C4'" 1 
ATOM   3902 O  "O4'" . C   E 2 55 ? 15.133  -12.605 -69.144  1.00 13.45  ? 58  C   E "O4'" 1 
ATOM   3903 C  "C3'" . C   E 2 55 ? 14.007  -13.510 -67.321  1.00 18.23  ? 58  C   E "C3'" 1 
ATOM   3904 O  "O3'" . C   E 2 55 ? 13.151  -13.133 -66.257  1.00 30.78  ? 58  C   E "O3'" 1 
ATOM   3905 C  "C2'" . C   E 2 55 ? 13.205  -13.856 -68.568  1.00 8.85   ? 58  C   E "C2'" 1 
ATOM   3906 O  "O2'" . C   E 2 55 ? 12.074  -13.031 -68.735  1.00 5.87   ? 58  C   E "O2'" 1 
ATOM   3907 C  "C1'" . C   E 2 55 ? 14.208  -13.532 -69.665  1.00 7.05   ? 58  C   E "C1'" 1 
ATOM   3908 N  N1    . C   E 2 55 ? 14.966  -14.676 -70.163  1.00 12.40  ? 58  C   E N1    1 
ATOM   3909 C  C2    . C   E 2 55 ? 14.334  -15.581 -70.997  1.00 17.47  ? 58  C   E C2    1 
ATOM   3910 O  O2    . C   E 2 55 ? 13.127  -15.412 -71.258  1.00 29.24  ? 58  C   E O2    1 
ATOM   3911 N  N3    . C   E 2 55 ? 15.043  -16.614 -71.504  1.00 15.77  ? 58  C   E N3    1 
ATOM   3912 C  C4    . C   E 2 55 ? 16.332  -16.751 -71.193  1.00 18.05  ? 58  C   E C4    1 
ATOM   3913 N  N4    . C   E 2 55 ? 17.001  -17.774 -71.722  1.00 27.16  ? 58  C   E N4    1 
ATOM   3914 C  C5    . C   E 2 55 ? 16.996  -15.845 -70.326  1.00 17.38  ? 58  C   E C5    1 
ATOM   3915 C  C6    . C   E 2 55 ? 16.281  -14.834 -69.834  1.00 14.17  ? 58  C   E C6    1 
ATOM   3916 P  P     . U   E 2 56 ? 13.027  -14.079 -64.974  1.00 41.26  ? 59  U   E P     1 
ATOM   3917 O  OP1   . U   E 2 56 ? 12.511  -13.255 -63.853  1.00 46.31  ? 59  U   E OP1   1 
ATOM   3918 O  OP2   . U   E 2 56 ? 14.312  -14.808 -64.827  1.00 38.09  ? 59  U   E OP2   1 
ATOM   3919 O  "O5'" . U   E 2 56 ? 11.931  -15.146 -65.395  1.00 38.36  ? 59  U   E "O5'" 1 
ATOM   3920 C  "C5'" . U   E 2 56 ? 10.740  -14.743 -66.052  1.00 39.04  ? 59  U   E "C5'" 1 
ATOM   3921 C  "C4'" . U   E 2 56 ? 10.067  -15.946 -66.653  1.00 36.61  ? 59  U   E "C4'" 1 
ATOM   3922 O  "O4'" . U   E 2 56 ? 10.751  -16.367 -67.855  1.00 33.12  ? 59  U   E "O4'" 1 
ATOM   3923 C  "C3'" . U   E 2 56 ? 10.126  -17.154 -65.750  1.00 34.21  ? 59  U   E "C3'" 1 
ATOM   3924 O  "O3'" . U   E 2 56 ? 9.098   -17.035 -64.781  1.00 39.01  ? 59  U   E "O3'" 1 
ATOM   3925 C  "C2'" . U   E 2 56 ? 9.964   -18.314 -66.730  1.00 29.68  ? 59  U   E "C2'" 1 
ATOM   3926 O  "O2'" . U   E 2 56 ? 8.621   -18.582 -67.078  1.00 26.52  ? 59  U   E "O2'" 1 
ATOM   3927 C  "C1'" . U   E 2 56 ? 10.693  -17.775 -67.963  1.00 22.24  ? 59  U   E "C1'" 1 
ATOM   3928 N  N1    . U   E 2 56 ? 12.059  -18.257 -68.182  1.00 14.71  ? 59  U   E N1    1 
ATOM   3929 C  C2    . U   E 2 56 ? 12.218  -19.483 -68.771  1.00 15.34  ? 59  U   E C2    1 
ATOM   3930 O  O2    . U   E 2 56 ? 11.278  -20.201 -69.048  1.00 31.85  ? 59  U   E O2    1 
ATOM   3931 N  N3    . U   E 2 56 ? 13.516  -19.841 -69.032  1.00 10.32  ? 59  U   E N3    1 
ATOM   3932 C  C4    . U   E 2 56 ? 14.645  -19.108 -68.756  1.00 12.36  ? 59  U   E C4    1 
ATOM   3933 O  O4    . U   E 2 56 ? 15.759  -19.556 -69.058  1.00 5.97   ? 59  U   E O4    1 
ATOM   3934 C  C5    . U   E 2 56 ? 14.391  -17.860 -68.114  1.00 15.35  ? 59  U   E C5    1 
ATOM   3935 C  C6    . U   E 2 56 ? 13.136  -17.491 -67.850  1.00 7.07   ? 59  U   E C6    1 
ATOM   3936 P  P     . G   E 2 57 ? 9.276   -17.741 -63.359  1.00 41.49  ? 60  G   E P     1 
ATOM   3937 O  OP1   . G   E 2 57 ? 8.488   -17.006 -62.326  1.00 30.38  ? 60  G   E OP1   1 
ATOM   3938 O  OP2   . G   E 2 57 ? 10.725  -17.986 -63.144  1.00 29.67  ? 60  G   E OP2   1 
ATOM   3939 O  "O5'" . G   E 2 57 ? 8.628   -19.164 -63.616  1.00 31.60  ? 60  G   E "O5'" 1 
ATOM   3940 C  "C5'" . G   E 2 57 ? 9.170   -20.289 -62.994  1.00 27.32  ? 60  G   E "C5'" 1 
ATOM   3941 C  "C4'" . G   E 2 57 ? 9.237   -21.445 -63.949  1.00 32.85  ? 60  G   E "C4'" 1 
ATOM   3942 O  "O4'" . G   E 2 57 ? 9.954   -21.083 -65.153  1.00 24.59  ? 60  G   E "O4'" 1 
ATOM   3943 C  "C3'" . G   E 2 57 ? 10.017  -22.591 -63.341  1.00 41.85  ? 60  G   E "C3'" 1 
ATOM   3944 O  "O3'" . G   E 2 57 ? 9.116   -23.362 -62.536  1.00 52.19  ? 60  G   E "O3'" 1 
ATOM   3945 C  "C2'" . G   E 2 57 ? 10.584  -23.307 -64.564  1.00 32.25  ? 60  G   E "C2'" 1 
ATOM   3946 O  "O2'" . G   E 2 57 ? 9.649   -24.217 -65.107  1.00 24.56  ? 60  G   E "O2'" 1 
ATOM   3947 C  "C1'" . G   E 2 57 ? 10.834  -22.135 -65.529  1.00 29.17  ? 60  G   E "C1'" 1 
ATOM   3948 N  N9    . G   E 2 57 ? 12.180  -21.563 -65.558  1.00 26.22  ? 60  G   E N9    1 
ATOM   3949 C  C8    . G   E 2 57 ? 12.554  -20.421 -64.897  1.00 38.04  ? 60  G   E C8    1 
ATOM   3950 N  N7    . G   E 2 57 ? 13.798  -20.086 -65.106  1.00 39.67  ? 60  G   E N7    1 
ATOM   3951 C  C5    . G   E 2 57 ? 14.285  -21.069 -65.950  1.00 30.10  ? 60  G   E C5    1 
ATOM   3952 C  C6    . G   E 2 57 ? 15.577  -21.221 -66.512  1.00 31.59  ? 60  G   E C6    1 
ATOM   3953 O  O6    . G   E 2 57 ? 16.573  -20.495 -66.368  1.00 35.01  ? 60  G   E O6    1 
ATOM   3954 N  N1    . G   E 2 57 ? 15.652  -22.347 -67.315  1.00 28.33  ? 60  G   E N1    1 
ATOM   3955 C  C2    . G   E 2 57 ? 14.619  -23.213 -67.550  1.00 31.76  ? 60  G   E C2    1 
ATOM   3956 N  N2    . G   E 2 57 ? 14.912  -24.239 -68.363  1.00 34.26  ? 60  G   E N2    1 
ATOM   3957 N  N3    . G   E 2 57 ? 13.397  -23.084 -67.029  1.00 25.05  ? 60  G   E N3    1 
ATOM   3958 C  C4    . G   E 2 57 ? 13.304  -21.996 -66.243  1.00 23.50  ? 60  G   E C4    1 
ATOM   3959 P  P     . A   E 2 58 ? 8.583   -22.752 -61.135  1.00 56.61  ? 61  A   E P     1 
ATOM   3960 O  OP1   . A   E 2 58 ? 8.585   -23.882 -60.166  1.00 52.59  ? 61  A   E OP1   1 
ATOM   3961 O  OP2   . A   E 2 58 ? 7.317   -22.002 -61.400  1.00 41.57  ? 61  A   E OP2   1 
ATOM   3962 O  "O5'" . A   E 2 58 ? 9.710   -21.678 -60.757  1.00 53.20  ? 61  A   E "O5'" 1 
ATOM   3963 C  "C5'" . A   E 2 58 ? 9.860   -21.116 -59.442  1.00 44.66  ? 61  A   E "C5'" 1 
ATOM   3964 C  "C4'" . A   E 2 58 ? 11.272  -20.591 -59.296  1.00 38.63  ? 61  A   E "C4'" 1 
ATOM   3965 O  "O4'" . A   E 2 58 ? 12.138  -21.695 -59.616  1.00 34.86  ? 61  A   E "O4'" 1 
ATOM   3966 C  "C3'" . A   E 2 58 ? 11.600  -19.465 -60.279  1.00 36.27  ? 61  A   E "C3'" 1 
ATOM   3967 O  "O3'" . A   E 2 58 ? 11.749  -18.189 -59.634  1.00 34.11  ? 61  A   E "O3'" 1 
ATOM   3968 C  "C2'" . A   E 2 58 ? 12.984  -19.798 -60.838  1.00 39.25  ? 61  A   E "C2'" 1 
ATOM   3969 O  "O2'" . A   E 2 58 ? 14.021  -18.958 -60.373  1.00 43.69  ? 61  A   E "O2'" 1 
ATOM   3970 C  "C1'" . A   E 2 58 ? 13.218  -21.238 -60.379  1.00 42.92  ? 61  A   E "C1'" 1 
ATOM   3971 N  N9    . A   E 2 58 ? 13.514  -22.218 -61.416  1.00 46.26  ? 61  A   E N9    1 
ATOM   3972 C  C8    . A   E 2 58 ? 12.843  -23.368 -61.739  1.00 45.59  ? 61  A   E C8    1 
ATOM   3973 N  N7    . A   E 2 58 ? 13.420  -24.063 -62.689  1.00 51.12  ? 61  A   E N7    1 
ATOM   3974 C  C5    . A   E 2 58 ? 14.537  -23.308 -63.022  1.00 48.78  ? 61  A   E C5    1 
ATOM   3975 C  C6    . A   E 2 58 ? 15.569  -23.499 -63.956  1.00 49.06  ? 61  A   E C6    1 
ATOM   3976 N  N6    . A   E 2 58 ? 15.654  -24.554 -64.768  1.00 51.35  ? 61  A   E N6    1 
ATOM   3977 N  N1    . A   E 2 58 ? 16.530  -22.555 -64.027  1.00 49.86  ? 61  A   E N1    1 
ATOM   3978 C  C2    . A   E 2 58 ? 16.452  -21.497 -63.212  1.00 47.77  ? 61  A   E C2    1 
ATOM   3979 N  N3    . A   E 2 58 ? 15.539  -21.208 -62.296  1.00 43.32  ? 61  A   E N3    1 
ATOM   3980 C  C4    . A   E 2 58 ? 14.599  -22.165 -62.252  1.00 47.66  ? 61  A   E C4    1 
ATOM   3981 P  P     . U   E 2 59 ? 10.915  -17.825 -58.300  1.00 35.92  ? 62  U   E P     1 
ATOM   3982 O  OP1   . U   E 2 59 ? 9.473   -18.008 -58.598  1.00 41.19  ? 62  U   E OP1   1 
ATOM   3983 O  OP2   . U   E 2 59 ? 11.401  -16.510 -57.797  1.00 33.97  ? 62  U   E OP2   1 
ATOM   3984 O  "O5'" . U   E 2 59 ? 11.349  -18.908 -57.208  1.00 37.89  ? 62  U   E "O5'" 1 
ATOM   3985 C  "C5'" . U   E 2 59 ? 12.502  -18.706 -56.394  1.00 26.83  ? 62  U   E "C5'" 1 
ATOM   3986 C  "C4'" . U   E 2 59 ? 12.412  -19.494 -55.096  1.00 24.36  ? 62  U   E "C4'" 1 
ATOM   3987 O  "O4'" . U   E 2 59 ? 11.476  -18.861 -54.192  1.00 28.34  ? 62  U   E "O4'" 1 
ATOM   3988 C  "C3'" . U   E 2 59 ? 11.894  -20.912 -55.306  1.00 28.75  ? 62  U   E "C3'" 1 
ATOM   3989 O  "O3'" . U   E 2 59 ? 12.665  -21.896 -54.628  1.00 26.65  ? 62  U   E "O3'" 1 
ATOM   3990 C  "C2'" . U   E 2 59 ? 10.408  -20.879 -54.945  1.00 29.23  ? 62  U   E "C2'" 1 
ATOM   3991 O  "O2'" . U   E 2 59 ? 10.022  -22.017 -54.207  1.00 33.07  ? 62  U   E "O2'" 1 
ATOM   3992 C  "C1'" . U   E 2 59 ? 10.360  -19.693 -53.984  1.00 32.22  ? 62  U   E "C1'" 1 
ATOM   3993 N  N1    . U   E 2 59 ? 9.144   -18.879 -53.910  1.00 36.45  ? 62  U   E N1    1 
ATOM   3994 C  C2    . U   E 2 59 ? 8.248   -19.195 -52.919  1.00 41.14  ? 62  U   E C2    1 
ATOM   3995 O  O2    . U   E 2 59 ? 8.444   -20.090 -52.128  1.00 42.51  ? 62  U   E O2    1 
ATOM   3996 N  N3    . U   E 2 59 ? 7.117   -18.422 -52.884  1.00 47.65  ? 62  U   E N3    1 
ATOM   3997 C  C4    . U   E 2 59 ? 6.804   -17.379 -53.729  1.00 58.60  ? 62  U   E C4    1 
ATOM   3998 O  O4    . U   E 2 59 ? 5.734   -16.780 -53.589  1.00 63.71  ? 62  U   E O4    1 
ATOM   3999 C  C5    . U   E 2 59 ? 7.794   -17.107 -54.730  1.00 60.86  ? 62  U   E C5    1 
ATOM   4000 C  C6    . U   E 2 59 ? 8.904   -17.851 -54.782  1.00 52.08  ? 62  U   E C6    1 
ATOM   4001 P  P     . C   E 2 60 ? 14.127  -22.280 -55.156  1.00 29.48  ? 63  C   E P     1 
ATOM   4002 O  OP1   . C   E 2 60 ? 14.737  -23.194 -54.161  1.00 40.11  ? 63  C   E OP1   1 
ATOM   4003 O  OP2   . C   E 2 60 ? 14.844  -21.039 -55.541  1.00 31.12  ? 63  C   E OP2   1 
ATOM   4004 O  "O5'" . C   E 2 60 ? 13.819  -23.139 -56.450  1.00 30.81  ? 63  C   E "O5'" 1 
ATOM   4005 C  "C5'" . C   E 2 60 ? 12.705  -24.010 -56.472  1.00 36.56  ? 63  C   E "C5'" 1 
ATOM   4006 C  "C4'" . C   E 2 60 ? 13.001  -25.193 -57.346  1.00 40.46  ? 63  C   E "C4'" 1 
ATOM   4007 O  "O4'" . C   E 2 60 ? 13.277  -24.721 -58.688  1.00 47.27  ? 63  C   E "O4'" 1 
ATOM   4008 C  "C3'" . C   E 2 60 ? 14.257  -25.957 -56.988  1.00 40.86  ? 63  C   E "C3'" 1 
ATOM   4009 O  "O3'" . C   E 2 60 ? 14.014  -26.865 -55.929  1.00 41.93  ? 63  C   E "O3'" 1 
ATOM   4010 C  "C2'" . C   E 2 60 ? 14.564  -26.673 -58.296  1.00 42.36  ? 63  C   E "C2'" 1 
ATOM   4011 O  "O2'" . C   E 2 60 ? 13.791  -27.830 -58.510  1.00 42.26  ? 63  C   E "O2'" 1 
ATOM   4012 C  "C1'" . C   E 2 60 ? 14.179  -25.607 -59.321  1.00 45.06  ? 63  C   E "C1'" 1 
ATOM   4013 N  N1    . C   E 2 60 ? 15.367  -24.862 -59.720  1.00 45.89  ? 63  C   E N1    1 
ATOM   4014 C  C2    . C   E 2 60 ? 15.995  -25.221 -60.896  1.00 49.77  ? 63  C   E C2    1 
ATOM   4015 O  O2    . C   E 2 60 ? 15.474  -26.099 -61.603  1.00 51.52  ? 63  C   E O2    1 
ATOM   4016 N  N3    . C   E 2 60 ? 17.147  -24.609 -61.241  1.00 52.46  ? 63  C   E N3    1 
ATOM   4017 C  C4    . C   E 2 60 ? 17.656  -23.661 -60.456  1.00 46.95  ? 63  C   E C4    1 
ATOM   4018 N  N4    . C   E 2 60 ? 18.803  -23.097 -60.823  1.00 51.28  ? 63  C   E N4    1 
ATOM   4019 C  C5    . C   E 2 60 ? 17.012  -23.253 -59.260  1.00 46.19  ? 63  C   E C5    1 
ATOM   4020 C  C6    . C   E 2 60 ? 15.875  -23.869 -58.935  1.00 42.60  ? 63  C   E C6    1 
ATOM   4021 P  P     . U   E 2 61 ? 15.188  -27.199 -54.890  1.00 43.80  ? 64  U   E P     1 
ATOM   4022 O  OP1   . U   E 2 61 ? 14.584  -27.945 -53.762  1.00 40.76  ? 64  U   E OP1   1 
ATOM   4023 O  OP2   . U   E 2 61 ? 15.906  -25.921 -54.631  1.00 36.40  ? 64  U   E OP2   1 
ATOM   4024 O  "O5'" . U   E 2 61 ? 16.147  -28.193 -55.688  1.00 35.45  ? 64  U   E "O5'" 1 
ATOM   4025 C  "C5'" . U   E 2 61 ? 15.691  -29.487 -56.075  1.00 27.57  ? 64  U   E "C5'" 1 
ATOM   4026 C  "C4'" . U   E 2 61 ? 16.700  -30.159 -56.976  1.00 26.05  ? 64  U   E "C4'" 1 
ATOM   4027 O  "O4'" . U   E 2 61 ? 16.845  -29.394 -58.197  1.00 32.70  ? 64  U   E "O4'" 1 
ATOM   4028 C  "C3'" . U   E 2 61 ? 18.115  -30.239 -56.441  1.00 26.71  ? 64  U   E "C3'" 1 
ATOM   4029 O  "O3'" . U   E 2 61 ? 18.289  -31.358 -55.594  1.00 27.47  ? 64  U   E "O3'" 1 
ATOM   4030 C  "C2'" . U   E 2 61 ? 18.923  -30.420 -57.712  1.00 26.76  ? 64  U   E "C2'" 1 
ATOM   4031 O  "O2'" . U   E 2 61 ? 18.868  -31.750 -58.180  1.00 24.15  ? 64  U   E "O2'" 1 
ATOM   4032 C  "C1'" . U   E 2 61 ? 18.180  -29.490 -58.667  1.00 31.61  ? 64  U   E "C1'" 1 
ATOM   4033 N  N1    . U   E 2 61 ? 18.753  -28.139 -58.699  1.00 37.83  ? 64  U   E N1    1 
ATOM   4034 C  C2    . U   E 2 61 ? 19.837  -27.913 -59.529  1.00 36.25  ? 64  U   E C2    1 
ATOM   4035 O  O2    . U   E 2 61 ? 20.331  -28.782 -60.226  1.00 35.65  ? 64  U   E O2    1 
ATOM   4036 N  N3    . U   E 2 61 ? 20.317  -26.629 -59.516  1.00 30.78  ? 64  U   E N3    1 
ATOM   4037 C  C4    . U   E 2 61 ? 19.836  -25.575 -58.778  1.00 31.22  ? 64  U   E C4    1 
ATOM   4038 O  O4    . U   E 2 61 ? 20.365  -24.476 -58.886  1.00 35.55  ? 64  U   E O4    1 
ATOM   4039 C  C5    . U   E 2 61 ? 18.721  -25.887 -57.944  1.00 38.51  ? 64  U   E C5    1 
ATOM   4040 C  C6    . U   E 2 61 ? 18.230  -27.129 -57.932  1.00 39.32  ? 64  U   E C6    1 
ATOM   4041 P  P     . G   E 2 62 ? 19.320  -31.263 -54.376  1.00 30.68  ? 65  G   E P     1 
ATOM   4042 O  OP1   . G   E 2 62 ? 19.123  -32.472 -53.546  1.00 37.55  ? 65  G   E OP1   1 
ATOM   4043 O  OP2   . G   E 2 62 ? 19.149  -29.918 -53.771  1.00 28.28  ? 65  G   E OP2   1 
ATOM   4044 O  "O5'" . G   E 2 62 ? 20.757  -31.331 -55.061  1.00 27.04  ? 65  G   E "O5'" 1 
ATOM   4045 C  "C5'" . G   E 2 62 ? 21.286  -32.574 -55.506  1.00 33.56  ? 65  G   E "C5'" 1 
ATOM   4046 C  "C4'" . G   E 2 62 ? 22.670  -32.392 -56.090  1.00 30.48  ? 65  G   E "C4'" 1 
ATOM   4047 O  "O4'" . G   E 2 62 ? 22.564  -31.619 -57.311  1.00 33.45  ? 65  G   E "O4'" 1 
ATOM   4048 C  "C3'" . G   E 2 62 ? 23.691  -31.627 -55.260  1.00 31.51  ? 65  G   E "C3'" 1 
ATOM   4049 O  "O3'" . G   E 2 62 ? 24.338  -32.444 -54.296  1.00 27.78  ? 65  G   E "O3'" 1 
ATOM   4050 C  "C2'" . G   E 2 62 ? 24.675  -31.200 -56.334  1.00 38.04  ? 65  G   E "C2'" 1 
ATOM   4051 O  "O2'" . G   E 2 62 ? 25.501  -32.267 -56.755  1.00 42.75  ? 65  G   E "O2'" 1 
ATOM   4052 C  "C1'" . G   E 2 62 ? 23.718  -30.808 -57.458  1.00 37.37  ? 65  G   E "C1'" 1 
ATOM   4053 N  N9    . G   E 2 62 ? 23.324  -29.410 -57.327  1.00 39.57  ? 65  G   E N9    1 
ATOM   4054 C  C8    . G   E 2 62 ? 22.157  -28.902 -56.796  1.00 43.21  ? 65  G   E C8    1 
ATOM   4055 N  N7    . G   E 2 62 ? 22.127  -27.596 -56.777  1.00 42.94  ? 65  G   E N7    1 
ATOM   4056 C  C5    . G   E 2 62 ? 23.343  -27.221 -57.338  1.00 41.23  ? 65  G   E C5    1 
ATOM   4057 C  C6    . G   E 2 62 ? 23.890  -25.934 -57.580  1.00 33.32  ? 65  G   E C6    1 
ATOM   4058 O  O6    . G   E 2 62 ? 23.399  -24.826 -57.324  1.00 27.04  ? 65  G   E O6    1 
ATOM   4059 N  N1    . G   E 2 62 ? 25.146  -26.021 -58.174  1.00 29.09  ? 65  G   E N1    1 
ATOM   4060 C  C2    . G   E 2 62 ? 25.798  -27.192 -58.489  1.00 28.81  ? 65  G   E C2    1 
ATOM   4061 N  N2    . G   E 2 62 ? 26.999  -27.069 -59.057  1.00 27.00  ? 65  G   E N2    1 
ATOM   4062 N  N3    . G   E 2 62 ? 25.306  -28.393 -58.263  1.00 30.61  ? 65  G   E N3    1 
ATOM   4063 C  C4    . G   E 2 62 ? 24.085  -28.335 -57.691  1.00 39.35  ? 65  G   E C4    1 
ATOM   4064 P  P     . G   E 2 63 ? 24.907  -31.784 -52.944  1.00 35.20  ? 66  G   E P     1 
ATOM   4065 O  OP1   . G   E 2 63 ? 25.270  -32.863 -51.991  1.00 36.84  ? 66  G   E OP1   1 
ATOM   4066 O  OP2   . G   E 2 63 ? 23.944  -30.731 -52.526  1.00 28.89  ? 66  G   E OP2   1 
ATOM   4067 O  "O5'" . G   E 2 63 ? 26.259  -31.074 -53.390  1.00 35.38  ? 66  G   E "O5'" 1 
ATOM   4068 C  "C5'" . G   E 2 63 ? 27.367  -31.832 -53.859  1.00 34.24  ? 66  G   E "C5'" 1 
ATOM   4069 C  "C4'" . G   E 2 63 ? 28.383  -30.917 -54.508  1.00 39.82  ? 66  G   E "C4'" 1 
ATOM   4070 O  "O4'" . G   E 2 63 ? 27.738  -30.177 -55.589  1.00 39.69  ? 66  G   E "O4'" 1 
ATOM   4071 C  "C3'" . G   E 2 63 ? 28.947  -29.819 -53.623  1.00 39.30  ? 66  G   E "C3'" 1 
ATOM   4072 O  "O3'" . G   E 2 63 ? 30.010  -30.270 -52.796  1.00 36.28  ? 66  G   E "O3'" 1 
ATOM   4073 C  "C2'" . G   E 2 63 ? 29.437  -28.815 -54.653  1.00 42.19  ? 66  G   E "C2'" 1 
ATOM   4074 O  "O2'" . G   E 2 63 ? 30.667  -29.215 -55.219  1.00 41.47  ? 66  G   E "O2'" 1 
ATOM   4075 C  "C1'" . G   E 2 63 ? 28.314  -28.882 -55.695  1.00 40.44  ? 66  G   E "C1'" 1 
ATOM   4076 N  N9    . G   E 2 63 ? 27.266  -27.892 -55.449  1.00 33.54  ? 66  G   E N9    1 
ATOM   4077 C  C8    . G   E 2 63 ? 26.002  -28.139 -54.982  1.00 23.05  ? 66  G   E C8    1 
ATOM   4078 N  N7    . G   E 2 63 ? 25.299  -27.054 -54.809  1.00 25.78  ? 66  G   E N7    1 
ATOM   4079 C  C5    . G   E 2 63 ? 26.144  -26.023 -55.197  1.00 26.89  ? 66  G   E C5    1 
ATOM   4080 C  C6    . G   E 2 63 ? 25.931  -24.610 -55.227  1.00 29.00  ? 66  G   E C6    1 
ATOM   4081 O  O6    . G   E 2 63 ? 24.923  -23.970 -54.897  1.00 24.83  ? 66  G   E O6    1 
ATOM   4082 N  N1    . G   E 2 63 ? 27.050  -23.936 -55.700  1.00 31.65  ? 66  G   E N1    1 
ATOM   4083 C  C2    . G   E 2 63 ? 28.223  -24.528 -56.095  1.00 30.23  ? 66  G   E C2    1 
ATOM   4084 N  N2    . G   E 2 63 ? 29.186  -23.693 -56.528  1.00 21.00  ? 66  G   E N2    1 
ATOM   4085 N  N3    . G   E 2 63 ? 28.437  -25.839 -56.069  1.00 28.35  ? 66  G   E N3    1 
ATOM   4086 C  C4    . G   E 2 63 ? 27.360  -26.520 -55.610  1.00 28.98  ? 66  G   E C4    1 
ATOM   4087 P  P     . A   E 2 64 ? 30.170  -29.655 -51.320  1.00 38.92  ? 67  A   E P     1 
ATOM   4088 O  OP1   . A   E 2 64 ? 31.107  -30.489 -50.534  1.00 23.22  ? 67  A   E OP1   1 
ATOM   4089 O  OP2   . A   E 2 64 ? 28.793  -29.422 -50.821  1.00 40.01  ? 67  A   E OP2   1 
ATOM   4090 O  "O5'" . A   E 2 64 ? 30.856  -28.242 -51.560  1.00 28.28  ? 67  A   E "O5'" 1 
ATOM   4091 C  "C5'" . A   E 2 64 ? 32.148  -28.178 -52.127  1.00 28.78  ? 67  A   E "C5'" 1 
ATOM   4092 C  "C4'" . A   E 2 64 ? 32.427  -26.797 -52.646  1.00 27.84  ? 67  A   E "C4'" 1 
ATOM   4093 O  "O4'" . A   E 2 64 ? 31.318  -26.377 -53.477  1.00 27.60  ? 67  A   E "O4'" 1 
ATOM   4094 C  "C3'" . A   E 2 64 ? 32.526  -25.683 -51.619  1.00 29.31  ? 67  A   E "C3'" 1 
ATOM   4095 O  "O3'" . A   E 2 64 ? 33.823  -25.657 -51.032  1.00 34.71  ? 67  A   E "O3'" 1 
ATOM   4096 C  "C2'" . A   E 2 64 ? 32.303  -24.447 -52.485  1.00 29.01  ? 67  A   E "C2'" 1 
ATOM   4097 O  "O2'" . A   E 2 64 ? 33.467  -24.051 -53.183  1.00 16.51  ? 67  A   E "O2'" 1 
ATOM   4098 C  "C1'" . A   E 2 64 ? 31.264  -24.959 -53.487  1.00 33.48  ? 67  A   E "C1'" 1 
ATOM   4099 N  N9    . A   E 2 64 ? 29.897  -24.528 -53.195  1.00 39.00  ? 67  A   E N9    1 
ATOM   4100 C  C8    . A   E 2 64 ? 28.818  -25.286 -52.818  1.00 38.49  ? 67  A   E C8    1 
ATOM   4101 N  N7    . A   E 2 64 ? 27.719  -24.591 -52.653  1.00 40.34  ? 67  A   E N7    1 
ATOM   4102 C  C5    . A   E 2 64 ? 28.103  -23.289 -52.936  1.00 36.51  ? 67  A   E C5    1 
ATOM   4103 C  C6    . A   E 2 64 ? 27.400  -22.084 -52.944  1.00 34.12  ? 67  A   E C6    1 
ATOM   4104 N  N6    . A   E 2 64 ? 26.107  -21.988 -52.653  1.00 46.16  ? 67  A   E N6    1 
ATOM   4105 N  N1    . A   E 2 64 ? 28.073  -20.963 -53.265  1.00 29.68  ? 67  A   E N1    1 
ATOM   4106 C  C2    . A   E 2 64 ? 29.367  -21.061 -53.558  1.00 35.23  ? 67  A   E C2    1 
ATOM   4107 N  N3    . A   E 2 64 ? 30.143  -22.139 -53.591  1.00 38.46  ? 67  A   E N3    1 
ATOM   4108 C  C4    . A   E 2 64 ? 29.440  -23.234 -53.265  1.00 38.52  ? 67  A   E C4    1 
ATOM   4109 P  P     . U   E 2 65 ? 34.026  -25.026 -49.564  1.00 32.66  ? 68  U   E P     1 
ATOM   4110 O  OP1   . U   E 2 65 ? 35.473  -24.982 -49.217  1.00 27.36  ? 68  U   E OP1   1 
ATOM   4111 O  OP2   . U   E 2 65 ? 33.066  -25.723 -48.665  1.00 32.53  ? 68  U   E OP2   1 
ATOM   4112 O  "O5'" . U   E 2 65 ? 33.580  -23.514 -49.738  1.00 27.84  ? 68  U   E "O5'" 1 
ATOM   4113 C  "C5'" . U   E 2 65 ? 34.470  -22.559 -50.289  1.00 15.74  ? 68  U   E "C5'" 1 
ATOM   4114 C  "C4'" . U   E 2 65 ? 33.805  -21.225 -50.321  1.00 8.10   ? 68  U   E "C4'" 1 
ATOM   4115 O  "O4'" . U   E 2 65 ? 32.565  -21.365 -51.054  1.00 12.42  ? 68  U   E "O4'" 1 
ATOM   4116 C  "C3'" . U   E 2 65 ? 33.351  -20.734 -48.966  1.00 11.21  ? 68  U   E "C3'" 1 
ATOM   4117 O  "O3'" . U   E 2 65 ? 34.434  -20.112 -48.294  1.00 23.02  ? 68  U   E "O3'" 1 
ATOM   4118 C  "C2'" . U   E 2 65 ? 32.243  -19.756 -49.336  1.00 15.76  ? 68  U   E "C2'" 1 
ATOM   4119 O  "O2'" . U   E 2 65 ? 32.713  -18.477 -49.707  1.00 24.32  ? 68  U   E "O2'" 1 
ATOM   4120 C  "C1'" . U   E 2 65 ? 31.617  -20.443 -50.554  1.00 18.03  ? 68  U   E "C1'" 1 
ATOM   4121 N  N1    . U   E 2 65 ? 30.389  -21.169 -50.215  1.00 21.38  ? 68  U   E N1    1 
ATOM   4122 C  C2    . U   E 2 65 ? 29.231  -20.436 -50.115  1.00 25.15  ? 68  U   E C2    1 
ATOM   4123 O  O2    . U   E 2 65 ? 29.185  -19.241 -50.359  1.00 20.23  ? 68  U   E O2    1 
ATOM   4124 N  N3    . U   E 2 65 ? 28.128  -21.152 -49.725  1.00 30.27  ? 68  U   E N3    1 
ATOM   4125 C  C4    . U   E 2 65 ? 28.071  -22.497 -49.451  1.00 22.65  ? 68  U   E C4    1 
ATOM   4126 O  O4    . U   E 2 65 ? 27.006  -23.000 -49.098  1.00 27.17  ? 68  U   E O4    1 
ATOM   4127 C  C5    . U   E 2 65 ? 29.305  -23.185 -49.611  1.00 21.34  ? 68  U   E C5    1 
ATOM   4128 C  C6    . U   E 2 65 ? 30.394  -22.516 -49.982  1.00 16.32  ? 68  U   E C6    1 
ATOM   4129 P  P     . A   E 2 66 ? 34.516  -20.165 -46.692  1.00 31.07  ? 69  A   E P     1 
ATOM   4130 O  OP1   . A   E 2 66 ? 35.845  -19.637 -46.291  1.00 28.03  ? 69  A   E OP1   1 
ATOM   4131 O  OP2   . A   E 2 66 ? 34.101  -21.524 -46.264  1.00 23.12  ? 69  A   E OP2   1 
ATOM   4132 O  "O5'" . A   E 2 66 ? 33.409  -19.130 -46.209  1.00 29.10  ? 69  A   E "O5'" 1 
ATOM   4133 C  "C5'" . A   E 2 66 ? 32.856  -19.221 -44.906  1.00 31.18  ? 69  A   E "C5'" 1 
ATOM   4134 C  "C4'" . A   E 2 66 ? 31.888  -18.094 -44.675  1.00 30.46  ? 69  A   E "C4'" 1 
ATOM   4135 O  "O4'" . A   E 2 66 ? 32.615  -16.843 -44.746  1.00 30.98  ? 69  A   E "O4'" 1 
ATOM   4136 C  "C3'" . A   E 2 66 ? 30.777  -17.960 -45.705  1.00 24.72  ? 69  A   E "C3'" 1 
ATOM   4137 O  "O3'" . A   E 2 66 ? 29.665  -18.788 -45.366  1.00 23.76  ? 69  A   E "O3'" 1 
ATOM   4138 C  "C2'" . A   E 2 66 ? 30.418  -16.486 -45.589  1.00 28.97  ? 69  A   E "C2'" 1 
ATOM   4139 O  "O2'" . A   E 2 66 ? 29.556  -16.215 -44.504  1.00 25.91  ? 69  A   E "O2'" 1 
ATOM   4140 C  "C1'" . A   E 2 66 ? 31.791  -15.855 -45.335  1.00 34.15  ? 69  A   E "C1'" 1 
ATOM   4141 N  N9    . A   E 2 66 ? 32.450  -15.388 -46.552  1.00 32.05  ? 69  A   E N9    1 
ATOM   4142 C  C8    . A   E 2 66 ? 33.556  -15.914 -47.156  1.00 31.70  ? 69  A   E C8    1 
ATOM   4143 N  N7    . A   E 2 66 ? 33.915  -15.277 -48.241  1.00 38.51  ? 69  A   E N7    1 
ATOM   4144 C  C5    . A   E 2 66 ? 32.976  -14.262 -48.359  1.00 30.96  ? 69  A   E C5    1 
ATOM   4145 C  C6    . A   E 2 66 ? 32.799  -13.233 -49.307  1.00 29.48  ? 69  A   E C6    1 
ATOM   4146 N  N6    . A   E 2 66 ? 33.586  -13.051 -50.369  1.00 24.08  ? 69  A   E N6    1 
ATOM   4147 N  N1    . A   E 2 66 ? 31.768  -12.387 -49.126  1.00 28.07  ? 69  A   E N1    1 
ATOM   4148 C  C2    . A   E 2 66 ? 30.975  -12.568 -48.071  1.00 30.62  ? 69  A   E C2    1 
ATOM   4149 N  N3    . A   E 2 66 ? 31.036  -13.493 -47.121  1.00 31.82  ? 69  A   E N3    1 
ATOM   4150 C  C4    . A   E 2 66 ? 32.072  -14.318 -47.325  1.00 28.20  ? 69  A   E C4    1 
ATOM   4151 P  P     . A   E 2 67 ? 29.047  -19.788 -46.465  1.00 28.37  ? 70  A   E P     1 
ATOM   4152 O  OP1   . A   E 2 67 ? 28.163  -20.764 -45.798  1.00 27.75  ? 70  A   E OP1   1 
ATOM   4153 O  OP2   . A   E 2 67 ? 30.160  -20.268 -47.312  1.00 32.02  ? 70  A   E OP2   1 
ATOM   4154 O  "O5'" . A   E 2 67 ? 28.129  -18.861 -47.362  1.00 27.45  ? 70  A   E "O5'" 1 
ATOM   4155 C  "C5'" . A   E 2 67 ? 27.031  -18.180 -46.788  1.00 31.95  ? 70  A   E "C5'" 1 
ATOM   4156 C  "C4'" . A   E 2 67 ? 26.646  -17.016 -47.651  1.00 33.27  ? 70  A   E "C4'" 1 
ATOM   4157 O  "O4'" . A   E 2 67 ? 27.769  -16.108 -47.748  1.00 37.66  ? 70  A   E "O4'" 1 
ATOM   4158 C  "C3'" . A   E 2 67 ? 26.342  -17.361 -49.094  1.00 33.49  ? 70  A   E "C3'" 1 
ATOM   4159 O  "O3'" . A   E 2 67 ? 24.999  -17.796 -49.194  1.00 27.39  ? 70  A   E "O3'" 1 
ATOM   4160 C  "C2'" . A   E 2 67 ? 26.543  -16.018 -49.778  1.00 35.79  ? 70  A   E "C2'" 1 
ATOM   4161 O  "O2'" . A   E 2 67 ? 25.442  -15.160 -49.546  1.00 37.17  ? 70  A   E "O2'" 1 
ATOM   4162 C  "C1'" . A   E 2 67 ? 27.747  -15.469 -49.010  1.00 36.77  ? 70  A   E "C1'" 1 
ATOM   4163 N  N9    . A   E 2 67 ? 29.058  -15.647 -49.635  1.00 35.41  ? 70  A   E N9    1 
ATOM   4164 C  C8    . A   E 2 67 ? 30.020  -16.563 -49.302  1.00 38.57  ? 70  A   E C8    1 
ATOM   4165 N  N7    . A   E 2 67 ? 31.126  -16.440 -49.991  1.00 36.67  ? 70  A   E N7    1 
ATOM   4166 C  C5    . A   E 2 67 ? 30.868  -15.384 -50.849  1.00 34.70  ? 70  A   E C5    1 
ATOM   4167 C  C6    . A   E 2 67 ? 31.642  -14.760 -51.826  1.00 34.54  ? 70  A   E C6    1 
ATOM   4168 N  N6    . A   E 2 67 ? 32.884  -15.128 -52.120  1.00 44.97  ? 70  A   E N6    1 
ATOM   4169 N  N1    . A   E 2 67 ? 31.096  -13.731 -52.503  1.00 32.17  ? 70  A   E N1    1 
ATOM   4170 C  C2    . A   E 2 67 ? 29.854  -13.366 -52.208  1.00 30.04  ? 70  A   E C2    1 
ATOM   4171 N  N3    . A   E 2 67 ? 29.021  -13.874 -51.309  1.00 33.29  ? 70  A   E N3    1 
ATOM   4172 C  C4    . A   E 2 67 ? 29.596  -14.894 -50.652  1.00 34.50  ? 70  A   E C4    1 
ATOM   4173 P  P     . U   E 2 68 ? 24.608  -18.930 -50.250  1.00 32.72  ? 71  U   E P     1 
ATOM   4174 O  OP1   . U   E 2 68 ? 23.327  -19.509 -49.789  1.00 41.63  ? 71  U   E OP1   1 
ATOM   4175 O  OP2   . U   E 2 68 ? 25.766  -19.817 -50.489  1.00 27.82  ? 71  U   E OP2   1 
ATOM   4176 O  "O5'" . U   E 2 68 ? 24.345  -18.117 -51.588  1.00 31.99  ? 71  U   E "O5'" 1 
ATOM   4177 C  "C5'" . U   E 2 68 ? 23.267  -17.205 -51.671  1.00 28.17  ? 71  U   E "C5'" 1 
ATOM   4178 C  "C4'" . U   E 2 68 ? 23.527  -16.194 -52.750  1.00 30.87  ? 71  U   E "C4'" 1 
ATOM   4179 O  "O4'" . U   E 2 68 ? 24.811  -15.559 -52.511  1.00 39.28  ? 71  U   E "O4'" 1 
ATOM   4180 C  "C3'" . U   E 2 68 ? 23.708  -16.743 -54.148  1.00 26.60  ? 71  U   E "C3'" 1 
ATOM   4181 O  "O3'" . U   E 2 68 ? 22.458  -17.029 -54.732  1.00 28.84  ? 71  U   E "O3'" 1 
ATOM   4182 C  "C2'" . U   E 2 68 ? 24.389  -15.572 -54.841  1.00 28.88  ? 71  U   E "C2'" 1 
ATOM   4183 O  "O2'" . U   E 2 68 ? 23.486  -14.529 -55.146  1.00 30.68  ? 71  U   E "O2'" 1 
ATOM   4184 C  "C1'" . U   E 2 68 ? 25.334  -15.087 -53.742  1.00 31.21  ? 71  U   E "C1'" 1 
ATOM   4185 N  N1    . U   E 2 68 ? 26.712  -15.568 -53.905  1.00 31.75  ? 71  U   E N1    1 
ATOM   4186 C  C2    . U   E 2 68 ? 27.578  -14.749 -54.605  1.00 33.39  ? 71  U   E C2    1 
ATOM   4187 O  O2    . U   E 2 68 ? 27.241  -13.670 -55.059  1.00 37.87  ? 71  U   E O2    1 
ATOM   4188 N  N3    . U   E 2 68 ? 28.850  -15.231 -54.751  1.00 30.14  ? 71  U   E N3    1 
ATOM   4189 C  C4    . U   E 2 68 ? 29.337  -16.418 -54.279  1.00 30.03  ? 71  U   E C4    1 
ATOM   4190 O  O4    . U   E 2 68 ? 30.513  -16.701 -54.490  1.00 33.39  ? 71  U   E O4    1 
ATOM   4191 C  C5    . U   E 2 68 ? 28.386  -17.217 -53.557  1.00 29.94  ? 71  U   E C5    1 
ATOM   4192 C  C6    . U   E 2 68 ? 27.135  -16.773 -53.399  1.00 29.62  ? 71  U   E C6    1 
ATOM   4193 P  P     . G   E 2 69 ? 22.284  -18.359 -55.607  1.00 33.81  ? 72  G   E P     1 
ATOM   4194 O  OP1   . G   E 2 69 ? 20.954  -18.308 -56.266  1.00 23.39  ? 72  G   E OP1   1 
ATOM   4195 O  OP2   . G   E 2 69 ? 22.644  -19.520 -54.750  1.00 22.85  ? 72  G   E OP2   1 
ATOM   4196 O  "O5'" . G   E 2 69 ? 23.417  -18.247 -56.718  1.00 35.34  ? 72  G   E "O5'" 1 
ATOM   4197 C  "C5'" . G   E 2 69 ? 23.444  -17.185 -57.670  1.00 36.99  ? 72  G   E "C5'" 1 
ATOM   4198 C  "C4'" . G   E 2 69 ? 23.848  -17.732 -59.016  1.00 40.02  ? 72  G   E "C4'" 1 
ATOM   4199 O  "O4'" . G   E 2 69 ? 22.762  -18.566 -59.493  1.00 42.16  ? 72  G   E "O4'" 1 
ATOM   4200 C  "C3'" . G   E 2 69 ? 24.086  -16.726 -60.134  1.00 41.65  ? 72  G   E "C3'" 1 
ATOM   4201 O  "O3'" . G   E 2 69 ? 25.459  -16.346 -60.195  1.00 32.59  ? 72  G   E "O3'" 1 
ATOM   4202 C  "C2'" . G   E 2 69 ? 23.822  -17.577 -61.370  1.00 48.79  ? 72  G   E "C2'" 1 
ATOM   4203 O  "O2'" . G   E 2 69 ? 24.938  -18.392 -61.671  1.00 57.09  ? 72  G   E "O2'" 1 
ATOM   4204 C  "C1'" . G   E 2 69 ? 22.681  -18.478 -60.899  1.00 49.44  ? 72  G   E "C1'" 1 
ATOM   4205 N  N9    . G   E 2 69 ? 21.342  -18.026 -61.273  1.00 53.61  ? 72  G   E N9    1 
ATOM   4206 C  C8    . G   E 2 69 ? 20.474  -18.667 -62.126  1.00 53.84  ? 72  G   E C8    1 
ATOM   4207 N  N7    . G   E 2 69 ? 19.353  -18.023 -62.299  1.00 56.58  ? 72  G   E N7    1 
ATOM   4208 C  C5    . G   E 2 69 ? 19.482  -16.887 -61.509  1.00 56.49  ? 72  G   E C5    1 
ATOM   4209 C  C6    . G   E 2 69 ? 18.580  -15.816 -61.291  1.00 53.72  ? 72  G   E C6    1 
ATOM   4210 O  O6    . G   E 2 69 ? 17.456  -15.651 -61.769  1.00 48.16  ? 72  G   E O6    1 
ATOM   4211 N  N1    . G   E 2 69 ? 19.105  -14.876 -60.412  1.00 55.84  ? 72  G   E N1    1 
ATOM   4212 C  C2    . G   E 2 69 ? 20.339  -14.956 -59.816  1.00 55.97  ? 72  G   E C2    1 
ATOM   4213 N  N2    . G   E 2 69 ? 20.661  -13.951 -58.996  1.00 55.89  ? 72  G   E N2    1 
ATOM   4214 N  N3    . G   E 2 69 ? 21.192  -15.948 -60.011  1.00 55.36  ? 72  G   E N3    1 
ATOM   4215 C  C4    . G   E 2 69 ? 20.702  -16.874 -60.865  1.00 55.99  ? 72  G   E C4    1 
ATOM   4216 P  P     . C   E 2 70 ? 25.992  -15.066 -59.385  1.00 23.65  ? 73  C   E P     1 
ATOM   4217 O  OP1   . C   E 2 70 ? 24.951  -14.644 -58.425  1.00 16.21  ? 73  C   E OP1   1 
ATOM   4218 O  OP2   . C   E 2 70 ? 26.512  -14.091 -60.365  1.00 20.98  ? 73  C   E OP2   1 
ATOM   4219 O  "O5'" . C   E 2 70 ? 27.262  -15.658 -58.622  1.00 21.76  ? 73  C   E "O5'" 1 
ATOM   4220 C  "C5'" . C   E 2 70 ? 28.579  -15.183 -58.911  1.00 23.26  ? 73  C   E "C5'" 1 
ATOM   4221 C  "C4'" . C   E 2 70 ? 29.602  -16.296 -58.780  1.00 24.53  ? 73  C   E "C4'" 1 
ATOM   4222 O  "O4'" . C   E 2 70 ? 29.605  -16.817 -57.426  1.00 25.64  ? 73  C   E "O4'" 1 
ATOM   4223 C  "C3'" . C   E 2 70 ? 29.386  -17.509 -59.670  1.00 25.63  ? 73  C   E "C3'" 1 
ATOM   4224 O  "O3'" . C   E 2 70 ? 29.967  -17.291 -60.952  1.00 33.45  ? 73  C   E "O3'" 1 
ATOM   4225 C  "C2'" . C   E 2 70 ? 30.099  -18.611 -58.895  1.00 21.25  ? 73  C   E "C2'" 1 
ATOM   4226 O  "O2'" . C   E 2 70 ? 31.495  -18.623 -59.084  1.00 9.08   ? 73  C   E "O2'" 1 
ATOM   4227 C  "C1'" . C   E 2 70 ? 29.769  -18.226 -57.453  1.00 22.00  ? 73  C   E "C1'" 1 
ATOM   4228 N  N1    . C   E 2 70 ? 28.510  -18.824 -56.998  1.00 25.90  ? 73  C   E N1    1 
ATOM   4229 C  C2    . C   E 2 70 ? 28.435  -20.206 -56.829  1.00 27.44  ? 73  C   E C2    1 
ATOM   4230 O  O2    . C   E 2 70 ? 29.439  -20.890 -57.052  1.00 36.20  ? 73  C   E O2    1 
ATOM   4231 N  N3    . C   E 2 70 ? 27.271  -20.763 -56.427  1.00 30.36  ? 73  C   E N3    1 
ATOM   4232 C  C4    . C   E 2 70 ? 26.210  -19.988 -56.193  1.00 32.69  ? 73  C   E C4    1 
ATOM   4233 N  N4    . C   E 2 70 ? 25.077  -20.578 -55.793  1.00 29.53  ? 73  C   E N4    1 
ATOM   4234 C  C5    . C   E 2 70 ? 26.262  -18.574 -56.356  1.00 31.69  ? 73  C   E C5    1 
ATOM   4235 C  C6    . C   E 2 70 ? 27.419  -18.040 -56.753  1.00 27.24  ? 73  C   E C6    1 
ATOM   4236 P  P     . C   E 2 71 ? 29.344  -18.012 -62.248  1.00 36.97  ? 74  C   E P     1 
ATOM   4237 O  OP1   . C   E 2 71 ? 30.027  -17.472 -63.443  1.00 36.81  ? 74  C   E OP1   1 
ATOM   4238 O  OP2   . C   E 2 71 ? 27.867  -17.939 -62.152  1.00 39.80  ? 74  C   E OP2   1 
ATOM   4239 O  "O5'" . C   E 2 71 ? 29.770  -19.534 -62.080  1.00 46.66  ? 74  C   E "O5'" 1 
ATOM   4240 C  "C5'" . C   E 2 71 ? 31.145  -19.903 -62.014  1.00 49.12  ? 74  C   E "C5'" 1 
ATOM   4241 C  "C4'" . C   E 2 71 ? 31.281  -21.401 -61.866  1.00 49.85  ? 74  C   E "C4'" 1 
ATOM   4242 O  "O4'" . C   E 2 71 ? 30.880  -21.806 -60.532  1.00 47.57  ? 74  C   E "O4'" 1 
ATOM   4243 C  "C3'" . C   E 2 71 ? 30.392  -22.227 -62.781  1.00 50.30  ? 74  C   E "C3'" 1 
ATOM   4244 O  "O3'" . C   E 2 71 ? 30.937  -22.347 -64.090  1.00 46.96  ? 74  C   E "O3'" 1 
ATOM   4245 C  "C2'" . C   E 2 71 ? 30.316  -23.557 -62.040  1.00 49.00  ? 74  C   E "C2'" 1 
ATOM   4246 O  "O2'" . C   E 2 71 ? 31.447  -24.389 -62.214  1.00 50.92  ? 74  C   E "O2'" 1 
ATOM   4247 C  "C1'" . C   E 2 71 ? 30.247  -23.078 -60.592  1.00 47.89  ? 74  C   E "C1'" 1 
ATOM   4248 N  N1    . C   E 2 71 ? 28.862  -22.928 -60.132  1.00 44.42  ? 74  C   E N1    1 
ATOM   4249 C  C2    . C   E 2 71 ? 28.229  -24.029 -59.564  1.00 41.20  ? 74  C   E C2    1 
ATOM   4250 O  O2    . C   E 2 71 ? 28.846  -25.094 -59.485  1.00 39.72  ? 74  C   E O2    1 
ATOM   4251 N  N3    . C   E 2 71 ? 26.965  -23.910 -59.119  1.00 40.58  ? 74  C   E N3    1 
ATOM   4252 C  C4    . C   E 2 71 ? 26.328  -22.746 -59.233  1.00 42.77  ? 74  C   E C4    1 
ATOM   4253 N  N4    . C   E 2 71 ? 25.074  -22.675 -58.777  1.00 43.51  ? 74  C   E N4    1 
ATOM   4254 C  C5    . C   E 2 71 ? 26.948  -21.602 -59.820  1.00 43.80  ? 74  C   E C5    1 
ATOM   4255 C  C6    . C   E 2 71 ? 28.204  -21.738 -60.252  1.00 40.31  ? 74  C   E C6    1 
ATOM   4256 P  P     . A   E 2 72 ? 30.001  -22.857 -65.290  1.00 38.58  ? 75  A   E P     1 
ATOM   4257 O  OP1   . A   E 2 72 ? 30.753  -22.722 -66.559  1.00 38.58  ? 75  A   E OP1   1 
ATOM   4258 O  OP2   . A   E 2 72 ? 28.682  -22.190 -65.151  1.00 36.91  ? 75  A   E OP2   1 
ATOM   4259 O  "O5'" . A   E 2 72 ? 29.806  -24.405 -64.968  1.00 36.39  ? 75  A   E "O5'" 1 
ATOM   4260 C  "C5'" . A   E 2 72 ? 28.736  -25.122 -65.554  1.00 40.16  ? 75  A   E "C5'" 1 
ATOM   4261 C  "C4'" . A   E 2 72 ? 28.514  -26.443 -64.853  1.00 41.91  ? 75  A   E "C4'" 1 
ATOM   4262 O  "O4'" . A   E 2 72 ? 28.397  -26.270 -63.412  1.00 46.66  ? 75  A   E "O4'" 1 
ATOM   4263 C  "C3'" . A   E 2 72 ? 27.193  -27.062 -65.262  1.00 38.35  ? 75  A   E "C3'" 1 
ATOM   4264 O  "O3'" . A   E 2 72 ? 27.355  -27.743 -66.478  1.00 40.14  ? 75  A   E "O3'" 1 
ATOM   4265 C  "C2'" . A   E 2 72 ? 26.855  -27.943 -64.078  1.00 36.67  ? 75  A   E "C2'" 1 
ATOM   4266 O  "O2'" . A   E 2 72 ? 27.605  -29.139 -64.097  1.00 33.06  ? 75  A   E "O2'" 1 
ATOM   4267 C  "C1'" . A   E 2 72 ? 27.302  -27.041 -62.923  1.00 43.22  ? 75  A   E "C1'" 1 
ATOM   4268 N  N9    . A   E 2 72 ? 26.265  -26.101 -62.483  1.00 43.67  ? 75  A   E N9    1 
ATOM   4269 C  C8    . A   E 2 72 ? 26.253  -24.738 -62.677  1.00 46.48  ? 75  A   E C8    1 
ATOM   4270 N  N7    . A   E 2 72 ? 25.199  -24.139 -62.180  1.00 43.34  ? 75  A   E N7    1 
ATOM   4271 C  C5    . A   E 2 72 ? 24.466  -25.172 -61.620  1.00 42.27  ? 75  A   E C5    1 
ATOM   4272 C  C6    . A   E 2 72 ? 23.242  -25.191 -60.943  1.00 39.36  ? 75  A   E C6    1 
ATOM   4273 N  N6    . A   E 2 72 ? 22.513  -24.101 -60.713  1.00 36.19  ? 75  A   E N6    1 
ATOM   4274 N  N1    . A   E 2 72 ? 22.783  -26.383 -60.510  1.00 39.55  ? 75  A   E N1    1 
ATOM   4275 C  C2    . A   E 2 72 ? 23.517  -27.479 -60.752  1.00 39.82  ? 75  A   E C2    1 
ATOM   4276 N  N3    . A   E 2 72 ? 24.686  -27.591 -61.380  1.00 36.53  ? 75  A   E N3    1 
ATOM   4277 C  C4    . A   E 2 72 ? 25.111  -26.388 -61.796  1.00 41.62  ? 75  A   E C4    1 
ATOM   4278 P  P     . G   E 2 73 ? 26.436  -27.332 -67.717  1.00 47.93  ? 76  G   E P     1 
ATOM   4279 O  OP1   . G   E 2 73 ? 27.059  -27.835 -68.966  1.00 45.24  ? 76  G   E OP1   1 
ATOM   4280 O  OP2   . G   E 2 73 ? 26.141  -25.881 -67.580  1.00 51.37  ? 76  G   E OP2   1 
ATOM   4281 O  "O5'" . G   E 2 73 ? 25.110  -28.162 -67.434  1.00 45.67  ? 76  G   E "O5'" 1 
ATOM   4282 C  "C5'" . G   E 2 73 ? 25.200  -29.558 -67.183  1.00 44.58  ? 76  G   E "C5'" 1 
ATOM   4283 C  "C4'" . G   E 2 73 ? 24.072  -30.009 -66.306  1.00 36.50  ? 76  G   E "C4'" 1 
ATOM   4284 O  "O4'" . G   E 2 73 ? 24.099  -29.239 -65.086  1.00 39.73  ? 76  G   E "O4'" 1 
ATOM   4285 C  "C3'" . G   E 2 73 ? 22.685  -29.751 -66.853  1.00 38.64  ? 76  G   E "C3'" 1 
ATOM   4286 O  "O3'" . G   E 2 73 ? 22.323  -30.785 -67.751  1.00 40.38  ? 76  G   E "O3'" 1 
ATOM   4287 C  "C2'" . G   E 2 73 ? 21.854  -29.797 -65.585  1.00 39.08  ? 76  G   E "C2'" 1 
ATOM   4288 O  "O2'" . G   E 2 73 ? 21.697  -31.125 -65.133  1.00 40.28  ? 76  G   E "O2'" 1 
ATOM   4289 C  "C1'" . G   E 2 73 ? 22.777  -29.069 -64.612  1.00 41.17  ? 76  G   E "C1'" 1 
ATOM   4290 N  N9    . G   E 2 73 ? 22.515  -27.639 -64.458  1.00 42.25  ? 76  G   E N9    1 
ATOM   4291 C  C8    . G   E 2 73 ? 23.314  -26.588 -64.851  1.00 38.59  ? 76  G   E C8    1 
ATOM   4292 N  N7    . G   E 2 73 ? 22.831  -25.423 -64.508  1.00 34.37  ? 76  G   E N7    1 
ATOM   4293 C  C5    . G   E 2 73 ? 21.636  -25.723 -63.863  1.00 36.18  ? 76  G   E C5    1 
ATOM   4294 C  C6    . G   E 2 73 ? 20.670  -24.870 -63.262  1.00 36.51  ? 76  G   E C6    1 
ATOM   4295 O  O6    . G   E 2 73 ? 20.681  -23.639 -63.170  1.00 41.95  ? 76  G   E O6    1 
ATOM   4296 N  N1    . G   E 2 73 ? 19.610  -25.593 -62.729  1.00 32.42  ? 76  G   E N1    1 
ATOM   4297 C  C2    . G   E 2 73 ? 19.492  -26.961 -62.761  1.00 35.40  ? 76  G   E C2    1 
ATOM   4298 N  N2    . G   E 2 73 ? 18.399  -27.480 -62.186  1.00 35.36  ? 76  G   E N2    1 
ATOM   4299 N  N3    . G   E 2 73 ? 20.380  -27.765 -63.313  1.00 35.25  ? 76  G   E N3    1 
ATOM   4300 C  C4    . G   E 2 73 ? 21.419  -27.084 -63.840  1.00 37.47  ? 76  G   E C4    1 
ATOM   4301 P  P     . C   E 2 74 ? 21.797  -30.409 -69.216  1.00 39.64  ? 77  C   E P     1 
ATOM   4302 O  OP1   . C   E 2 74 ? 21.790  -31.657 -70.017  1.00 41.20  ? 77  C   E OP1   1 
ATOM   4303 O  OP2   . C   E 2 74 ? 22.586  -29.241 -69.693  1.00 35.10  ? 77  C   E OP2   1 
ATOM   4304 O  "O5'" . C   E 2 74 ? 20.298  -29.940 -68.949  1.00 30.30  ? 77  C   E "O5'" 1 
ATOM   4305 C  "C5'" . C   E 2 74 ? 19.386  -30.783 -68.265  1.00 30.97  ? 77  C   E "C5'" 1 
ATOM   4306 C  "C4'" . C   E 2 74 ? 18.197  -29.989 -67.792  1.00 36.75  ? 77  C   E "C4'" 1 
ATOM   4307 O  "O4'" . C   E 2 74 ? 18.556  -29.202 -66.628  1.00 41.43  ? 77  C   E "O4'" 1 
ATOM   4308 C  "C3'" . C   E 2 74 ? 17.652  -29.002 -68.804  1.00 37.92  ? 77  C   E "C3'" 1 
ATOM   4309 O  "O3'" . C   E 2 74 ? 16.707  -29.645 -69.650  1.00 35.81  ? 77  C   E "O3'" 1 
ATOM   4310 C  "C2'" . C   E 2 74 ? 17.029  -27.932 -67.909  1.00 39.02  ? 77  C   E "C2'" 1 
ATOM   4311 O  "O2'" . C   E 2 74 ? 15.752  -28.288 -67.427  1.00 32.05  ? 77  C   E "O2'" 1 
ATOM   4312 C  "C1'" . C   E 2 74 ? 18.025  -27.893 -66.747  1.00 41.05  ? 77  C   E "C1'" 1 
ATOM   4313 N  N1    . C   E 2 74 ? 19.174  -27.016 -66.981  1.00 43.83  ? 77  C   E N1    1 
ATOM   4314 C  C2    . C   E 2 74 ? 19.222  -25.741 -66.405  1.00 43.13  ? 77  C   E C2    1 
ATOM   4315 O  O2    . C   E 2 74 ? 18.254  -25.338 -65.735  1.00 36.96  ? 77  C   E O2    1 
ATOM   4316 N  N3    . C   E 2 74 ? 20.334  -24.987 -66.594  1.00 43.33  ? 77  C   E N3    1 
ATOM   4317 C  C4    . C   E 2 74 ? 21.353  -25.468 -67.322  1.00 45.77  ? 77  C   E C4    1 
ATOM   4318 N  N4    . C   E 2 74 ? 22.448  -24.732 -67.462  1.00 40.96  ? 77  C   E N4    1 
ATOM   4319 C  C5    . C   E 2 74 ? 21.302  -26.740 -67.935  1.00 51.76  ? 77  C   E C5    1 
ATOM   4320 C  C6    . C   E 2 74 ? 20.209  -27.469 -67.744  1.00 50.39  ? 77  C   E C6    1 
ATOM   4321 P  P     . G   E 2 75 ? 16.669  -29.295 -71.215  1.00 34.73  ? 78  G   E P     1 
ATOM   4322 O  OP1   . G   E 2 75 ? 15.976  -27.988 -71.373  1.00 29.28  ? 78  G   E OP1   1 
ATOM   4323 O  OP2   . G   E 2 75 ? 16.095  -30.504 -71.855  1.00 28.29  ? 78  G   E OP2   1 
ATOM   4324 O  "O5'" . G   E 2 75 ? 18.216  -29.126 -71.608  1.00 39.80  ? 78  G   E "O5'" 1 
ATOM   4325 C  "C5'" . G   E 2 75 ? 18.641  -28.910 -72.969  1.00 46.39  ? 78  G   E "C5'" 1 
ATOM   4326 C  "C4'" . G   E 2 75 ? 19.679  -27.803 -73.028  1.00 54.71  ? 78  G   E "C4'" 1 
ATOM   4327 O  "O4'" . G   E 2 75 ? 19.056  -26.627 -72.486  1.00 61.11  ? 78  G   E "O4'" 1 
ATOM   4328 C  "C3'" . G   E 2 75 ? 20.953  -28.034 -72.212  1.00 62.51  ? 78  G   E "C3'" 1 
ATOM   4329 O  "O3'" . G   E 2 75 ? 22.117  -28.386 -73.003  1.00 68.25  ? 78  G   E "O3'" 1 
ATOM   4330 C  "C2'" . G   E 2 75 ? 21.300  -26.656 -71.621  1.00 64.42  ? 78  G   E "C2'" 1 
ATOM   4331 O  "O2'" . G   E 2 75 ? 22.405  -26.032 -72.254  1.00 65.98  ? 78  G   E "O2'" 1 
ATOM   4332 C  "C1'" . G   E 2 75 ? 20.026  -25.835 -71.850  1.00 67.55  ? 78  G   E "C1'" 1 
ATOM   4333 N  N9    . G   E 2 75 ? 19.410  -25.151 -70.717  1.00 67.02  ? 78  G   E N9    1 
ATOM   4334 C  C8    . G   E 2 75 ? 18.347  -25.581 -69.963  1.00 69.91  ? 78  G   E C8    1 
ATOM   4335 N  N7    . G   E 2 75 ? 17.980  -24.717 -69.054  1.00 71.53  ? 78  G   E N7    1 
ATOM   4336 C  C5    . G   E 2 75 ? 18.864  -23.659 -69.207  1.00 64.71  ? 78  G   E C5    1 
ATOM   4337 C  C6    . G   E 2 75 ? 18.961  -22.433 -68.499  1.00 61.81  ? 78  G   E C6    1 
ATOM   4338 O  O6    . G   E 2 75 ? 18.265  -22.024 -67.559  1.00 55.99  ? 78  G   E O6    1 
ATOM   4339 N  N1    . G   E 2 75 ? 20.003  -21.650 -68.985  1.00 60.32  ? 78  G   E N1    1 
ATOM   4340 C  C2    . G   E 2 75 ? 20.845  -22.004 -70.014  1.00 55.52  ? 78  G   E C2    1 
ATOM   4341 N  N2    . G   E 2 75 ? 21.793  -21.121 -70.328  1.00 59.63  ? 78  G   E N2    1 
ATOM   4342 N  N3    . G   E 2 75 ? 20.766  -23.139 -70.677  1.00 55.07  ? 78  G   E N3    1 
ATOM   4343 C  C4    . G   E 2 75 ? 19.760  -23.915 -70.225  1.00 63.84  ? 78  G   E C4    1 
ATOM   4344 P  P     . U   E 2 76 ? 22.020  -29.399 -74.268  1.00 64.78  ? 79  U   E P     1 
ATOM   4345 O  OP1   . U   E 2 76 ? 20.860  -30.325 -74.141  1.00 61.15  ? 79  U   E OP1   1 
ATOM   4346 O  OP2   . U   E 2 76 ? 23.380  -29.957 -74.498  1.00 60.25  ? 79  U   E OP2   1 
ATOM   4347 O  "O5'" . U   E 2 76 ? 21.748  -28.443 -75.503  1.00 61.19  ? 79  U   E "O5'" 1 
ATOM   4348 C  "C5'" . U   E 2 76 ? 20.424  -28.189 -75.912  1.00 66.08  ? 79  U   E "C5'" 1 
ATOM   4349 C  "C4'" . U   E 2 76 ? 20.420  -27.323 -77.124  1.00 62.64  ? 79  U   E "C4'" 1 
ATOM   4350 O  "O4'" . U   E 2 76 ? 21.090  -28.050 -78.178  1.00 59.20  ? 79  U   E "O4'" 1 
ATOM   4351 C  "C3'" . U   E 2 76 ? 19.003  -27.102 -77.602  1.00 59.67  ? 79  U   E "C3'" 1 
ATOM   4352 O  "O3'" . U   E 2 76 ? 18.481  -25.790 -77.631  1.00 55.87  ? 79  U   E "O3'" 1 
ATOM   4353 C  "C2'" . U   E 2 76 ? 18.749  -28.085 -78.726  1.00 60.76  ? 79  U   E "C2'" 1 
ATOM   4354 O  "O2'" . U   E 2 76 ? 18.112  -27.472 -79.822  1.00 71.88  ? 79  U   E "O2'" 1 
ATOM   4355 C  "C1'" . U   E 2 76 ? 20.165  -28.453 -79.163  1.00 64.77  ? 79  U   E "C1'" 1 
ATOM   4356 N  N1    . U   E 2 76 ? 20.286  -29.897 -79.371  1.00 69.43  ? 79  U   E N1    1 
ATOM   4357 C  C2    . U   E 2 76 ? 21.301  -30.349 -80.196  1.00 71.68  ? 79  U   E C2    1 
ATOM   4358 O  O2    . U   E 2 76 ? 22.147  -29.614 -80.676  1.00 67.03  ? 79  U   E O2    1 
ATOM   4359 N  N3    . U   E 2 76 ? 21.290  -31.697 -80.434  1.00 76.55  ? 79  U   E N3    1 
ATOM   4360 C  C4    . U   E 2 76 ? 20.396  -32.619 -79.930  1.00 81.44  ? 79  U   E C4    1 
ATOM   4361 O  O4    . U   E 2 76 ? 20.505  -33.793 -80.257  1.00 85.33  ? 79  U   E O4    1 
ATOM   4362 C  C5    . U   E 2 76 ? 19.397  -32.079 -79.057  1.00 79.90  ? 79  U   E C5    1 
ATOM   4363 C  C6    . U   E 2 76 ? 19.382  -30.769 -78.806  1.00 73.39  ? 79  U   E C6    1 
ATOM   4364 P  P     . A   E 2 77 ? 16.916  -25.579 -77.879  1.00 59.42  ? 80  A   E P     1 
ATOM   4365 O  OP1   . A   E 2 77 ? 16.688  -25.437 -79.340  1.00 60.17  ? 80  A   E OP1   1 
ATOM   4366 O  OP2   . A   E 2 77 ? 16.475  -24.495 -76.965  1.00 64.40  ? 80  A   E OP2   1 
ATOM   4367 O  "O5'" . A   E 2 77 ? 16.268  -26.956 -77.402  1.00 50.52  ? 80  A   E "O5'" 1 
ATOM   4368 C  "C5'" . A   E 2 77 ? 16.273  -27.326 -76.030  1.00 44.88  ? 80  A   E "C5'" 1 
ATOM   4369 C  "C4'" . A   E 2 77 ? 14.860  -27.393 -75.494  1.00 40.14  ? 80  A   E "C4'" 1 
ATOM   4370 O  "O4'" . A   E 2 77 ? 14.928  -27.423 -74.044  1.00 44.12  ? 80  A   E "O4'" 1 
ATOM   4371 C  "C3'" . A   E 2 77 ? 14.014  -26.179 -75.845  1.00 36.56  ? 80  A   E "C3'" 1 
ATOM   4372 O  "O3'" . A   E 2 77 ? 13.221  -26.483 -76.983  1.00 32.57  ? 80  A   E "O3'" 1 
ATOM   4373 C  "C2'" . A   E 2 77 ? 13.164  -25.958 -74.601  1.00 35.20  ? 80  A   E "C2'" 1 
ATOM   4374 O  "O2'" . A   E 2 77 ? 12.012  -26.766 -74.560  1.00 35.04  ? 80  A   E "O2'" 1 
ATOM   4375 C  "C1'" . A   E 2 77 ? 14.121  -26.400 -73.500  1.00 36.64  ? 80  A   E "C1'" 1 
ATOM   4376 N  N9    . A   E 2 77 ? 15.023  -25.357 -73.029  1.00 31.43  ? 80  A   E N9    1 
ATOM   4377 C  C8    . A   E 2 77 ? 16.384  -25.329 -73.173  1.00 34.38  ? 80  A   E C8    1 
ATOM   4378 N  N7    . A   E 2 77 ? 16.954  -24.292 -72.616  1.00 41.00  ? 80  A   E N7    1 
ATOM   4379 C  C5    . A   E 2 77 ? 15.894  -23.584 -72.076  1.00 40.47  ? 80  A   E C5    1 
ATOM   4380 C  C6    . A   E 2 77 ? 15.834  -22.389 -71.346  1.00 45.81  ? 80  A   E C6    1 
ATOM   4381 N  N6    . A   E 2 77 ? 16.907  -21.664 -71.021  1.00 46.93  ? 80  A   E N6    1 
ATOM   4382 N  N1    . A   E 2 77 ? 14.617  -21.957 -70.954  1.00 49.03  ? 80  A   E N1    1 
ATOM   4383 C  C2    . A   E 2 77 ? 13.542  -22.689 -71.278  1.00 42.43  ? 80  A   E C2    1 
ATOM   4384 N  N3    . A   E 2 77 ? 13.474  -23.828 -71.962  1.00 34.24  ? 80  A   E N3    1 
ATOM   4385 C  C4    . A   E 2 77 ? 14.697  -24.226 -72.334  1.00 32.83  ? 80  A   E C4    1 
ATOM   4386 P  P     . G   E 2 78 ? 12.487  -25.303 -77.771  1.00 42.85  ? 81  G   E P     1 
ATOM   4387 O  OP1   . G   E 2 78 ? 11.551  -25.862 -78.779  1.00 30.98  ? 81  G   E OP1   1 
ATOM   4388 O  OP2   . G   E 2 78 ? 13.556  -24.364 -78.202  1.00 44.26  ? 81  G   E OP2   1 
ATOM   4389 O  "O5'" . G   E 2 78 ? 11.624  -24.601 -76.636  1.00 40.14  ? 81  G   E "O5'" 1 
ATOM   4390 C  "C5'" . G   E 2 78 ? 10.328  -25.072 -76.304  1.00 36.56  ? 81  G   E "C5'" 1 
ATOM   4391 C  "C4'" . G   E 2 78 ? 9.560   -23.978 -75.620  1.00 35.30  ? 81  G   E "C4'" 1 
ATOM   4392 O  "O4'" . G   E 2 78 ? 10.149  -23.712 -74.316  1.00 29.80  ? 81  G   E "O4'" 1 
ATOM   4393 C  "C3'" . G   E 2 78 ? 9.675   -22.652 -76.342  1.00 38.93  ? 81  G   E "C3'" 1 
ATOM   4394 O  "O3'" . G   E 2 78 ? 8.785   -22.532 -77.440  1.00 39.04  ? 81  G   E "O3'" 1 
ATOM   4395 C  "C2'" . G   E 2 78 ? 9.440   -21.649 -75.221  1.00 33.38  ? 81  G   E "C2'" 1 
ATOM   4396 O  "O2'" . G   E 2 78 ? 8.086   -21.503 -74.852  1.00 32.40  ? 81  G   E "O2'" 1 
ATOM   4397 C  "C1'" . G   E 2 78 ? 10.223  -22.311 -74.094  1.00 26.38  ? 81  G   E "C1'" 1 
ATOM   4398 N  N9    . G   E 2 78 ? 11.628  -21.929 -74.140  1.00 24.99  ? 81  G   E N9    1 
ATOM   4399 C  C8    . G   E 2 78 ? 12.656  -22.614 -74.748  1.00 29.37  ? 81  G   E C8    1 
ATOM   4400 N  N7    . G   E 2 78 ? 13.814  -22.027 -74.614  1.00 26.54  ? 81  G   E N7    1 
ATOM   4401 C  C5    . G   E 2 78 ? 13.529  -20.886 -73.874  1.00 26.68  ? 81  G   E C5    1 
ATOM   4402 C  C6    . G   E 2 78 ? 14.385  -19.857 -73.409  1.00 22.78  ? 81  G   E C6    1 
ATOM   4403 O  O6    . G   E 2 78 ? 15.606  -19.746 -73.562  1.00 19.97  ? 81  G   E O6    1 
ATOM   4404 N  N1    . G   E 2 78 ? 13.681  -18.887 -72.702  1.00 19.75  ? 81  G   E N1    1 
ATOM   4405 C  C2    . G   E 2 78 ? 12.327  -18.909 -72.467  1.00 26.67  ? 81  G   E C2    1 
ATOM   4406 N  N2    . G   E 2 78 ? 11.823  -17.879 -71.767  1.00 19.45  ? 81  G   E N2    1 
ATOM   4407 N  N3    . G   E 2 78 ? 11.520  -19.870 -72.889  1.00 26.18  ? 81  G   E N3    1 
ATOM   4408 C  C4    . G   E 2 78 ? 12.182  -20.814 -73.580  1.00 23.51  ? 81  G   E C4    1 
ATOM   4409 P  P     . G   E 2 79 ? 9.052   -21.387 -78.526  1.00 43.09  ? 82  G   E P     1 
ATOM   4410 O  OP1   . G   E 2 79 ? 7.932   -21.336 -79.495  1.00 50.70  ? 82  G   E OP1   1 
ATOM   4411 O  OP2   . G   E 2 79 ? 10.447  -21.574 -79.011  1.00 35.28  ? 82  G   E OP2   1 
ATOM   4412 O  "O5'" . G   E 2 79 ? 8.977   -20.065 -77.649  1.00 40.43  ? 82  G   E "O5'" 1 
ATOM   4413 C  "C5'" . G   E 2 79 ? 9.483   -18.834 -78.130  1.00 39.44  ? 82  G   E "C5'" 1 
ATOM   4414 C  "C4'" . G   E 2 79 ? 9.415   -17.796 -77.041  1.00 38.67  ? 82  G   E "C4'" 1 
ATOM   4415 O  "O4'" . G   E 2 79 ? 10.181  -18.253 -75.899  1.00 34.09  ? 82  G   E "O4'" 1 
ATOM   4416 C  "C3'" . G   E 2 79 ? 10.042  -16.466 -77.399  1.00 37.42  ? 82  G   E "C3'" 1 
ATOM   4417 O  "O3'" . G   E 2 79 ? 9.142   -15.645 -78.114  1.00 35.53  ? 82  G   E "O3'" 1 
ATOM   4418 C  "C2'" . G   E 2 79 ? 10.395  -15.898 -76.037  1.00 34.74  ? 82  G   E "C2'" 1 
ATOM   4419 O  "O2'" . G   E 2 79 ? 9.272   -15.365 -75.367  1.00 24.53  ? 82  G   E "O2'" 1 
ATOM   4420 C  "C1'" . G   E 2 79 ? 10.877  -17.160 -75.326  1.00 34.62  ? 82  G   E "C1'" 1 
ATOM   4421 N  N9    . G   E 2 79 ? 12.304  -17.419 -75.480  1.00 30.18  ? 82  G   E N9    1 
ATOM   4422 C  C8    . G   E 2 79 ? 12.870  -18.533 -76.047  1.00 25.33  ? 82  G   E C8    1 
ATOM   4423 N  N7    . G   E 2 79 ? 14.173  -18.530 -75.991  1.00 24.93  ? 82  G   E N7    1 
ATOM   4424 C  C5    . G   E 2 79 ? 14.490  -17.334 -75.363  1.00 22.74  ? 82  G   E C5    1 
ATOM   4425 C  C6    . G   E 2 79 ? 15.752  -16.783 -75.021  1.00 22.21  ? 82  G   E C6    1 
ATOM   4426 O  O6    . G   E 2 79 ? 16.879  -17.258 -75.197  1.00 13.28  ? 82  G   E O6    1 
ATOM   4427 N  N1    . G   E 2 79 ? 15.616  -15.544 -74.410  1.00 20.02  ? 82  G   E N1    1 
ATOM   4428 C  C2    . G   E 2 79 ? 14.431  -14.915 -74.161  1.00 11.62  ? 82  G   E C2    1 
ATOM   4429 N  N2    . G   E 2 79 ? 14.535  -13.731 -73.592  1.00 3.17   ? 82  G   E N2    1 
ATOM   4430 N  N3    . G   E 2 79 ? 13.244  -15.416 -74.458  1.00 17.51  ? 82  G   E N3    1 
ATOM   4431 C  C4    . G   E 2 79 ? 13.348  -16.625 -75.055  1.00 25.75  ? 82  G   E C4    1 
ATOM   4432 P  P     . G   E 2 80 ? 9.714   -14.708 -79.274  1.00 40.13  ? 83  G   E P     1 
ATOM   4433 O  OP1   . G   E 2 80 ? 8.695   -13.683 -79.613  1.00 44.19  ? 83  G   E OP1   1 
ATOM   4434 O  OP2   . G   E 2 80 ? 10.266  -15.585 -80.336  1.00 33.59  ? 83  G   E OP2   1 
ATOM   4435 O  "O5'" . G   E 2 80 ? 10.932  -13.969 -78.572  1.00 36.27  ? 83  G   E "O5'" 1 
ATOM   4436 C  "C5'" . G   E 2 80 ? 10.705  -12.903 -77.663  1.00 35.71  ? 83  G   E "C5'" 1 
ATOM   4437 C  "C4'" . G   E 2 80 ? 12.011  -12.245 -77.337  1.00 37.72  ? 83  G   E "C4'" 1 
ATOM   4438 O  "O4'" . G   E 2 80 ? 12.862  -13.219 -76.694  1.00 37.78  ? 83  G   E "O4'" 1 
ATOM   4439 C  "C3'" . G   E 2 80 ? 12.769  -11.808 -78.572  1.00 38.73  ? 83  G   E "C3'" 1 
ATOM   4440 O  "O3'" . G   E 2 80 ? 12.418  -10.475 -78.862  1.00 43.54  ? 83  G   E "O3'" 1 
ATOM   4441 C  "C2'" . G   E 2 80 ? 14.219  -11.916 -78.139  1.00 37.64  ? 83  G   E "C2'" 1 
ATOM   4442 O  "O2'" . G   E 2 80 ? 14.647  -10.775 -77.424  1.00 37.64  ? 83  G   E "O2'" 1 
ATOM   4443 C  "C1'" . G   E 2 80 ? 14.166  -13.137 -77.221  1.00 35.67  ? 83  G   E "C1'" 1 
ATOM   4444 N  N9    . G   E 2 80 ? 14.438  -14.411 -77.870  1.00 35.68  ? 83  G   E N9    1 
ATOM   4445 C  C8    . G   E 2 80 ? 13.534  -15.230 -78.501  1.00 36.29  ? 83  G   E C8    1 
ATOM   4446 N  N7    . G   E 2 80 ? 14.067  -16.341 -78.931  1.00 43.06  ? 83  G   E N7    1 
ATOM   4447 C  C5    . G   E 2 80 ? 15.406  -16.239 -78.574  1.00 37.96  ? 83  G   E C5    1 
ATOM   4448 C  C6    . G   E 2 80 ? 16.484  -17.140 -78.770  1.00 40.09  ? 83  G   E C6    1 
ATOM   4449 O  O6    . G   E 2 80 ? 16.473  -18.255 -79.315  1.00 46.18  ? 83  G   E O6    1 
ATOM   4450 N  N1    . G   E 2 80 ? 17.671  -16.632 -78.251  1.00 39.30  ? 83  G   E N1    1 
ATOM   4451 C  C2    . G   E 2 80 ? 17.803  -15.417 -77.623  1.00 35.78  ? 83  G   E C2    1 
ATOM   4452 N  N2    . G   E 2 80 ? 19.029  -15.092 -77.185  1.00 33.85  ? 83  G   E N2    1 
ATOM   4453 N  N3    . G   E 2 80 ? 16.808  -14.577 -77.434  1.00 35.27  ? 83  G   E N3    1 
ATOM   4454 C  C4    . G   E 2 80 ? 15.649  -15.047 -77.930  1.00 34.57  ? 83  G   E C4    1 
ATOM   4455 P  P     . A   E 2 81 ? 11.747  -10.136 -80.263  1.00 50.28  ? 84  A   E P     1 
ATOM   4456 O  OP1   . A   E 2 81 ? 10.436  -9.490  -79.992  1.00 39.37  ? 84  A   E OP1   1 
ATOM   4457 O  OP2   . A   E 2 81 ? 11.817  -11.368 -81.091  1.00 55.14  ? 84  A   E OP2   1 
ATOM   4458 O  "O5'" . A   E 2 81 ? 12.743  -9.077  -80.902  1.00 51.00  ? 84  A   E "O5'" 1 
ATOM   4459 C  "C5'" . A   E 2 81 ? 12.530  -7.689  -80.723  1.00 55.78  ? 84  A   E "C5'" 1 
ATOM   4460 C  "C4'" . A   E 2 81 ? 13.777  -6.928  -81.085  1.00 55.34  ? 84  A   E "C4'" 1 
ATOM   4461 O  "O4'" . A   E 2 81 ? 14.813  -7.195  -80.107  1.00 57.68  ? 84  A   E "O4'" 1 
ATOM   4462 C  "C3'" . A   E 2 81 ? 14.407  -7.324  -82.406  1.00 50.90  ? 84  A   E "C3'" 1 
ATOM   4463 O  "O3'" . A   E 2 81 ? 13.757  -6.673  -83.491  1.00 41.21  ? 84  A   E "O3'" 1 
ATOM   4464 C  "C2'" . A   E 2 81 ? 15.853  -6.867  -82.224  1.00 51.94  ? 84  A   E "C2'" 1 
ATOM   4465 O  "O2'" . A   E 2 81 ? 16.067  -5.495  -82.497  1.00 45.36  ? 84  A   E "O2'" 1 
ATOM   4466 C  "C1'" . A   E 2 81 ? 16.081  -7.144  -80.735  1.00 51.01  ? 84  A   E "C1'" 1 
ATOM   4467 N  N9    . A   E 2 81 ? 16.763  -8.408  -80.480  1.00 43.69  ? 84  A   E N9    1 
ATOM   4468 C  C8    . A   E 2 81 ? 16.509  -9.629  -81.038  1.00 40.62  ? 84  A   E C8    1 
ATOM   4469 N  N7    . A   E 2 81 ? 17.317  -10.575 -80.626  1.00 47.95  ? 84  A   E N7    1 
ATOM   4470 C  C5    . A   E 2 81 ? 18.158  -9.932  -79.726  1.00 46.07  ? 84  A   E C5    1 
ATOM   4471 C  C6    . A   E 2 81 ? 19.247  -10.384 -78.935  1.00 40.50  ? 84  A   E C6    1 
ATOM   4472 N  N6    . A   E 2 81 ? 19.696  -11.642 -78.923  1.00 33.94  ? 84  A   E N6    1 
ATOM   4473 N  N1    . A   E 2 81 ? 19.865  -9.480  -78.147  1.00 37.09  ? 84  A   E N1    1 
ATOM   4474 C  C2    . A   E 2 81 ? 19.422  -8.219  -78.152  1.00 43.15  ? 84  A   E C2    1 
ATOM   4475 N  N3    . A   E 2 81 ? 18.418  -7.675  -78.843  1.00 49.00  ? 84  A   E N3    1 
ATOM   4476 C  C4    . A   E 2 81 ? 17.822  -8.597  -79.622  1.00 48.03  ? 84  A   E C4    1 
ATOM   4477 P  P     . A   E 2 82 ? 13.898  -7.272  -84.964  1.00 43.16  ? 85  A   E P     1 
ATOM   4478 O  OP1   . A   E 2 82 ? 13.487  -6.223  -85.921  1.00 45.25  ? 85  A   E OP1   1 
ATOM   4479 O  OP2   . A   E 2 82 ? 13.197  -8.578  -84.966  1.00 49.23  ? 85  A   E OP2   1 
ATOM   4480 O  "O5'" . A   E 2 82 ? 15.469  -7.523  -85.101  1.00 45.78  ? 85  A   E "O5'" 1 
ATOM   4481 C  "C5'" . A   E 2 82 ? 16.042  -8.058  -86.290  1.00 39.93  ? 85  A   E "C5'" 1 
ATOM   4482 C  "C4'" . A   E 2 82 ? 16.191  -6.963  -87.308  1.00 41.46  ? 85  A   E "C4'" 1 
ATOM   4483 O  "O4'" . A   E 2 82 ? 17.199  -6.022  -86.853  1.00 39.73  ? 85  A   E "O4'" 1 
ATOM   4484 C  "C3'" . A   E 2 82 ? 16.705  -7.499  -88.637  1.00 42.25  ? 85  A   E "C3'" 1 
ATOM   4485 O  "O3'" . A   E 2 82 ? 15.887  -7.112  -89.729  1.00 44.99  ? 85  A   E "O3'" 1 
ATOM   4486 C  "C2'" . A   E 2 82 ? 18.201  -7.209  -88.687  1.00 39.52  ? 85  A   E "C2'" 1 
ATOM   4487 O  "O2'" . A   E 2 82 ? 18.590  -6.684  -89.932  1.00 39.55  ? 85  A   E "O2'" 1 
ATOM   4488 C  "C1'" . A   E 2 82 ? 18.311  -6.042  -87.719  1.00 41.07  ? 85  A   E "C1'" 1 
ATOM   4489 N  N9    . A   E 2 82 ? 19.557  -5.868  -86.977  1.00 39.18  ? 85  A   E N9    1 
ATOM   4490 C  C8    . A   E 2 82 ? 20.379  -6.803  -86.401  1.00 41.54  ? 85  A   E C8    1 
ATOM   4491 N  N7    . A   E 2 82 ? 21.453  -6.287  -85.843  1.00 38.50  ? 85  A   E N7    1 
ATOM   4492 C  C5    . A   E 2 82 ? 21.319  -4.921  -86.060  1.00 32.77  ? 85  A   E C5    1 
ATOM   4493 C  C6    . A   E 2 82 ? 22.126  -3.822  -85.715  1.00 27.79  ? 85  A   E C6    1 
ATOM   4494 N  N6    . A   E 2 82 ? 23.275  -3.926  -85.053  1.00 30.82  ? 85  A   E N6    1 
ATOM   4495 N  N1    . A   E 2 82 ? 21.705  -2.596  -86.081  1.00 24.79  ? 85  A   E N1    1 
ATOM   4496 C  C2    . A   E 2 82 ? 20.550  -2.489  -86.752  1.00 24.46  ? 85  A   E C2    1 
ATOM   4497 N  N3    . A   E 2 82 ? 19.708  -3.441  -87.137  1.00 20.66  ? 85  A   E N3    1 
ATOM   4498 C  C4    . A   E 2 82 ? 20.155  -4.650  -86.754  1.00 31.95  ? 85  A   E C4    1 
ATOM   4499 P  P     . G   E 2 83 ? 16.174  -7.682  -91.193  1.00 44.98  ? 86  G   E P     1 
ATOM   4500 O  OP1   . G   E 2 83 ? 14.900  -8.287  -91.642  1.00 39.46  ? 86  G   E OP1   1 
ATOM   4501 O  OP2   . G   E 2 83 ? 17.400  -8.518  -91.129  1.00 47.14  ? 86  G   E OP2   1 
ATOM   4502 O  "O5'" . G   E 2 83 ? 16.452  -6.356  -92.043  1.00 42.43  ? 86  G   E "O5'" 1 
ATOM   4503 C  "C5'" . G   E 2 83 ? 17.697  -6.148  -92.711  1.00 34.23  ? 86  G   E "C5'" 1 
ATOM   4504 C  "C4'" . G   E 2 83 ? 17.995  -4.668  -92.814  1.00 37.32  ? 86  G   E "C4'" 1 
ATOM   4505 O  "O4'" . G   E 2 83 ? 18.214  -4.114  -91.486  1.00 38.85  ? 86  G   E "O4'" 1 
ATOM   4506 C  "C3'" . G   E 2 83 ? 19.278  -4.312  -93.545  1.00 42.03  ? 86  G   E "C3'" 1 
ATOM   4507 O  "O3'" . G   E 2 83 ? 19.102  -4.325  -94.953  1.00 47.15  ? 86  G   E "O3'" 1 
ATOM   4508 C  "C2'" . G   E 2 83 ? 19.566  -2.913  -93.017  1.00 36.03  ? 86  G   E "C2'" 1 
ATOM   4509 O  "O2'" . G   E 2 83 ? 18.746  -1.919  -93.593  1.00 36.05  ? 86  G   E "O2'" 1 
ATOM   4510 C  "C1'" . G   E 2 83 ? 19.194  -3.079  -91.548  1.00 32.63  ? 86  G   E "C1'" 1 
ATOM   4511 N  N9    . G   E 2 83 ? 20.343  -3.481  -90.744  1.00 29.01  ? 86  G   E N9    1 
ATOM   4512 C  C8    . G   E 2 83 ? 20.592  -4.732  -90.237  1.00 23.92  ? 86  G   E C8    1 
ATOM   4513 N  N7    . G   E 2 83 ? 21.703  -4.797  -89.556  1.00 27.01  ? 86  G   E N7    1 
ATOM   4514 C  C5    . G   E 2 83 ? 22.222  -3.508  -89.613  1.00 29.81  ? 86  G   E C5    1 
ATOM   4515 C  C6    . G   E 2 83 ? 23.423  -2.961  -89.052  1.00 30.47  ? 86  G   E C6    1 
ATOM   4516 O  O6    . G   E 2 83 ? 24.288  -3.526  -88.365  1.00 27.49  ? 86  G   E O6    1 
ATOM   4517 N  N1    . G   E 2 83 ? 23.564  -1.614  -89.363  1.00 26.98  ? 86  G   E N1    1 
ATOM   4518 C  C2    . G   E 2 83 ? 22.677  -0.880  -90.104  1.00 26.92  ? 86  G   E C2    1 
ATOM   4519 N  N2    . G   E 2 83 ? 23.000  0.408   -90.289  1.00 21.14  ? 86  G   E N2    1 
ATOM   4520 N  N3    . G   E 2 83 ? 21.557  -1.370  -90.625  1.00 29.00  ? 86  G   E N3    1 
ATOM   4521 C  C4    . G   E 2 83 ? 21.396  -2.683  -90.343  1.00 27.39  ? 86  G   E C4    1 
ATOM   4522 P  P     . U   E 2 84 ? 20.379  -4.514  -95.906  1.00 51.68  ? 87  U   E P     1 
ATOM   4523 O  OP1   . U   E 2 84 ? 19.888  -4.398  -97.298  1.00 54.07  ? 87  U   E OP1   1 
ATOM   4524 O  OP2   . U   E 2 84 ? 21.119  -5.736  -95.482  1.00 50.64  ? 87  U   E OP2   1 
ATOM   4525 O  "O5'" . U   E 2 84 ? 21.285  -3.245  -95.595  1.00 43.94  ? 87  U   E "O5'" 1 
ATOM   4526 C  "C5'" . U   E 2 84 ? 20.872  -1.955  -96.012  1.00 47.87  ? 87  U   E "C5'" 1 
ATOM   4527 C  "C4'" . U   E 2 84 ? 21.885  -0.929  -95.593  1.00 50.34  ? 87  U   E "C4'" 1 
ATOM   4528 O  "O4'" . U   E 2 84 ? 21.978  -0.929  -94.145  1.00 51.39  ? 87  U   E "O4'" 1 
ATOM   4529 C  "C3'" . U   E 2 84 ? 23.306  -1.197  -96.056  1.00 54.28  ? 87  U   E "C3'" 1 
ATOM   4530 O  "O3'" . U   E 2 84 ? 23.521  -0.715  -97.377  1.00 49.76  ? 87  U   E "O3'" 1 
ATOM   4531 C  "C2'" . U   E 2 84 ? 24.109  -0.412  -95.029  1.00 57.90  ? 87  U   E "C2'" 1 
ATOM   4532 O  "O2'" . U   E 2 84 ? 24.088  0.981   -95.271  1.00 65.56  ? 87  U   E "O2'" 1 
ATOM   4533 C  "C1'" . U   E 2 84 ? 23.323  -0.716  -93.755  1.00 54.68  ? 87  U   E "C1'" 1 
ATOM   4534 N  N1    . U   E 2 84 ? 23.807  -1.933  -93.090  1.00 57.09  ? 87  U   E N1    1 
ATOM   4535 C  C2    . U   E 2 84 ? 25.017  -1.857  -92.427  1.00 57.33  ? 87  U   E C2    1 
ATOM   4536 O  O2    . U   E 2 84 ? 25.677  -0.836  -92.386  1.00 61.99  ? 87  U   E O2    1 
ATOM   4537 N  N3    . U   E 2 84 ? 25.427  -3.021  -91.820  1.00 50.87  ? 87  U   E N3    1 
ATOM   4538 C  C4    . U   E 2 84 ? 24.764  -4.228  -91.814  1.00 51.28  ? 87  U   E C4    1 
ATOM   4539 O  O4    . U   E 2 84 ? 25.261  -5.190  -91.227  1.00 48.21  ? 87  U   E O4    1 
ATOM   4540 C  C5    . U   E 2 84 ? 23.518  -4.226  -92.524  1.00 56.12  ? 87  U   E C5    1 
ATOM   4541 C  C6    . U   E 2 84 ? 23.092  -3.105  -93.123  1.00 55.66  ? 87  U   E C6    1 
ATOM   4542 P  P     . C   E 2 85 ? 24.664  -1.376  -98.296  1.00 47.65  ? 88  C   E P     1 
ATOM   4543 O  OP1   . C   E 2 85 ? 24.645  -0.679  -99.600  1.00 53.62  ? 88  C   E OP1   1 
ATOM   4544 O  OP2   . C   E 2 85 ? 24.496  -2.849  -98.245  1.00 48.77  ? 88  C   E OP2   1 
ATOM   4545 O  "O5'" . C   E 2 85 ? 26.036  -0.979  -97.595  1.00 42.87  ? 88  C   E "O5'" 1 
ATOM   4546 C  "C5'" . C   E 2 85 ? 26.576  0.322   -97.765  1.00 41.55  ? 88  C   E "C5'" 1 
ATOM   4547 C  "C4'" . C   E 2 85 ? 27.867  0.462   -96.998  1.00 49.65  ? 88  C   E "C4'" 1 
ATOM   4548 O  "O4'" . C   E 2 85 ? 27.635  0.100   -95.610  1.00 50.74  ? 88  C   E "O4'" 1 
ATOM   4549 C  "C3'" . C   E 2 85 ? 29.010  -0.461  -97.387  1.00 55.57  ? 88  C   E "C3'" 1 
ATOM   4550 O  "O3'" . C   E 2 85 ? 29.703  -0.013  -98.547  1.00 54.74  ? 88  C   E "O3'" 1 
ATOM   4551 C  "C2'" . C   E 2 85 ? 29.897  -0.382  -96.150  1.00 56.33  ? 88  C   E "C2'" 1 
ATOM   4552 O  "O2'" . C   E 2 85 ? 30.680  0.797   -96.092  1.00 53.51  ? 88  C   E "O2'" 1 
ATOM   4553 C  "C1'" . C   E 2 85 ? 28.851  -0.355  -95.037  1.00 51.62  ? 88  C   E "C1'" 1 
ATOM   4554 N  N1    . C   E 2 85 ? 28.631  -1.675  -94.431  1.00 49.90  ? 88  C   E N1    1 
ATOM   4555 C  C2    . C   E 2 85 ? 29.573  -2.151  -93.511  1.00 54.03  ? 88  C   E C2    1 
ATOM   4556 O  O2    . C   E 2 85 ? 30.567  -1.452  -93.254  1.00 60.81  ? 88  C   E O2    1 
ATOM   4557 N  N3    . C   E 2 85 ? 29.380  -3.353  -92.926  1.00 47.90  ? 88  C   E N3    1 
ATOM   4558 C  C4    . C   E 2 85 ? 28.302  -4.072  -93.231  1.00 48.60  ? 88  C   E C4    1 
ATOM   4559 N  N4    . C   E 2 85 ? 28.148  -5.247  -92.624  1.00 51.02  ? 88  C   E N4    1 
ATOM   4560 C  C5    . C   E 2 85 ? 27.332  -3.618  -94.173  1.00 49.80  ? 88  C   E C5    1 
ATOM   4561 C  C6    . C   E 2 85 ? 27.535  -2.423  -94.744  1.00 46.87  ? 88  C   E C6    1 
ATOM   4562 P  P     . G   E 2 86 ? 30.541  -1.066  -99.430  1.00 57.68  ? 89  G   E P     1 
ATOM   4563 O  OP1   . G   E 2 86 ? 30.944  -0.318  -100.646 1.00 58.68  ? 89  G   E OP1   1 
ATOM   4564 O  OP2   . G   E 2 86 ? 29.766  -2.329  -99.565  1.00 50.18  ? 89  G   E OP2   1 
ATOM   4565 O  "O5'" . G   E 2 86 ? 31.836  -1.390  -98.553  1.00 52.94  ? 89  G   E "O5'" 1 
ATOM   4566 C  "C5'" . G   E 2 86 ? 32.706  -0.341  -98.133  1.00 53.52  ? 89  G   E "C5'" 1 
ATOM   4567 C  "C4'" . G   E 2 86 ? 33.672  -0.832  -97.073  1.00 55.91  ? 89  G   E "C4'" 1 
ATOM   4568 O  "O4'" . G   E 2 86 ? 32.951  -1.244  -95.887  1.00 57.55  ? 89  G   E "O4'" 1 
ATOM   4569 C  "C3'" . G   E 2 86 ? 34.531  -2.036  -97.417  1.00 57.98  ? 89  G   E "C3'" 1 
ATOM   4570 O  "O3'" . G   E 2 86 ? 35.671  -1.614  -98.158  1.00 64.98  ? 89  G   E "O3'" 1 
ATOM   4571 C  "C2'" . G   E 2 86 ? 34.942  -2.545  -96.035  1.00 56.26  ? 89  G   E "C2'" 1 
ATOM   4572 O  "O2'" . G   E 2 86 ? 36.052  -1.869  -95.483  1.00 51.90  ? 89  G   E "O2'" 1 
ATOM   4573 C  "C1'" . G   E 2 86 ? 33.702  -2.229  -95.199  1.00 54.86  ? 89  G   E "C1'" 1 
ATOM   4574 N  N9    . G   E 2 86 ? 32.844  -3.383  -94.959  1.00 53.25  ? 89  G   E N9    1 
ATOM   4575 C  C8    . G   E 2 86 ? 31.628  -3.648  -95.540  1.00 58.15  ? 89  G   E C8    1 
ATOM   4576 N  N7    . G   E 2 86 ? 31.079  -4.749  -95.101  1.00 58.15  ? 89  G   E N7    1 
ATOM   4577 C  C5    . G   E 2 86 ? 31.994  -5.244  -94.181  1.00 51.89  ? 89  G   E C5    1 
ATOM   4578 C  C6    . G   E 2 86 ? 31.947  -6.410  -93.379  1.00 48.87  ? 89  G   E C6    1 
ATOM   4579 O  O6    . G   E 2 86 ? 31.057  -7.266  -93.314  1.00 42.83  ? 89  G   E O6    1 
ATOM   4580 N  N1    . G   E 2 86 ? 33.085  -6.530  -92.587  1.00 49.01  ? 89  G   E N1    1 
ATOM   4581 C  C2    . G   E 2 86 ? 34.132  -5.640  -92.567  1.00 46.21  ? 89  G   E C2    1 
ATOM   4582 N  N2    . G   E 2 86 ? 35.135  -5.925  -91.728  1.00 42.72  ? 89  G   E N2    1 
ATOM   4583 N  N3    . G   E 2 86 ? 34.188  -4.551  -93.314  1.00 46.53  ? 89  G   E N3    1 
ATOM   4584 C  C4    . G   E 2 86 ? 33.092  -4.415  -94.089  1.00 50.50  ? 89  G   E C4    1 
ATOM   4585 P  P     . C   E 2 87 ? 36.309  -2.578  -99.276  1.00 66.43  ? 90  C   E P     1 
ATOM   4586 O  OP1   . C   E 2 87 ? 36.745  -1.693  -100.388 1.00 64.89  ? 90  C   E OP1   1 
ATOM   4587 O  OP2   . C   E 2 87 ? 35.362  -3.696  -99.547  1.00 62.96  ? 90  C   E OP2   1 
ATOM   4588 O  "O5'" . C   E 2 87 ? 37.604  -3.189  -98.573  1.00 59.48  ? 90  C   E "O5'" 1 
ATOM   4589 C  "C5'" . C   E 2 87 ? 38.086  -4.481  -98.928  1.00 53.13  ? 90  C   E "C5'" 1 
ATOM   4590 C  "C4'" . C   E 2 87 ? 38.878  -5.067  -97.789  1.00 49.95  ? 90  C   E "C4'" 1 
ATOM   4591 O  "O4'" . C   E 2 87 ? 38.165  -4.812  -96.551  1.00 45.55  ? 90  C   E "O4'" 1 
ATOM   4592 C  "C3'" . C   E 2 87 ? 39.064  -6.579  -97.848  1.00 51.31  ? 90  C   E "C3'" 1 
ATOM   4593 O  "O3'" . C   E 2 87 ? 40.120  -7.079  -98.677  1.00 41.94  ? 90  C   E "O3'" 1 
ATOM   4594 C  "C2'" . C   E 2 87 ? 39.169  -6.945  -96.377  1.00 55.40  ? 90  C   E "C2'" 1 
ATOM   4595 O  "O2'" . C   E 2 87 ? 40.450  -6.692  -95.819  1.00 51.65  ? 90  C   E "O2'" 1 
ATOM   4596 C  "C1'" . C   E 2 87 ? 38.124  -5.997  -95.779  1.00 56.30  ? 90  C   E "C1'" 1 
ATOM   4597 N  N1    . C   E 2 87 ? 36.749  -6.510  -95.868  1.00 57.87  ? 90  C   E N1    1 
ATOM   4598 C  C2    . C   E 2 87 ? 36.421  -7.722  -95.250  1.00 62.18  ? 90  C   E C2    1 
ATOM   4599 O  O2    . C   E 2 87 ? 37.305  -8.357  -94.652  1.00 71.74  ? 90  C   E O2    1 
ATOM   4600 N  N3    . C   E 2 87 ? 35.151  -8.171  -95.322  1.00 56.38  ? 90  C   E N3    1 
ATOM   4601 C  C4    . C   E 2 87 ? 34.231  -7.468  -95.981  1.00 53.62  ? 90  C   E C4    1 
ATOM   4602 N  N4    . C   E 2 87 ? 32.992  -7.952  -96.028  1.00 53.37  ? 90  C   E N4    1 
ATOM   4603 C  C5    . C   E 2 87 ? 34.540  -6.240  -96.623  1.00 55.77  ? 90  C   E C5    1 
ATOM   4604 C  C6    . C   E 2 87 ? 35.798  -5.803  -96.543  1.00 55.56  ? 90  C   E C6    1 
ATOM   4605 O  "O5'" . G   F 2 1  ? 22.609  -12.154 29.883   1.00 75.96  ? 104 G   F "O5'" 1 
ATOM   4606 C  "C5'" . G   F 2 1  ? 23.069  -10.832 29.627   1.00 80.87  ? 104 G   F "C5'" 1 
ATOM   4607 C  "C4'" . G   F 2 1  ? 24.492  -10.645 30.093   1.00 86.97  ? 104 G   F "C4'" 1 
ATOM   4608 O  "O4'" . G   F 2 1  ? 24.560  -10.797 31.535   1.00 94.00  ? 104 G   F "O4'" 1 
ATOM   4609 C  "C3'" . G   F 2 1  ? 25.472  -11.676 29.571   1.00 89.14  ? 104 G   F "C3'" 1 
ATOM   4610 O  "O3'" . G   F 2 1  ? 25.902  -11.336 28.265   1.00 92.17  ? 104 G   F "O3'" 1 
ATOM   4611 C  "C2'" . G   F 2 1  ? 26.584  -11.620 30.612   1.00 90.29  ? 104 G   F "C2'" 1 
ATOM   4612 O  "O2'" . G   F 2 1  ? 27.467  -10.523 30.456   1.00 83.68  ? 104 G   F "O2'" 1 
ATOM   4613 C  "C1'" . G   F 2 1  ? 25.768  -11.454 31.895   1.00 92.06  ? 104 G   F "C1'" 1 
ATOM   4614 N  N9    . G   F 2 1  ? 25.413  -12.719 32.535   1.00 92.60  ? 104 G   F N9    1 
ATOM   4615 C  C8    . G   F 2 1  ? 24.235  -13.413 32.390   1.00 90.59  ? 104 G   F C8    1 
ATOM   4616 N  N7    . G   F 2 1  ? 24.192  -14.504 33.104   1.00 91.02  ? 104 G   F N7    1 
ATOM   4617 C  C5    . G   F 2 1  ? 25.417  -14.537 33.756   1.00 93.17  ? 104 G   F C5    1 
ATOM   4618 C  C6    . G   F 2 1  ? 25.948  -15.490 34.670   1.00 98.28  ? 104 G   F C6    1 
ATOM   4619 O  O6    . G   F 2 1  ? 25.423  -16.529 35.101   1.00 101.36 ? 104 G   F O6    1 
ATOM   4620 N  N1    . G   F 2 1  ? 27.229  -15.138 35.086   1.00 100.41 ? 104 G   F N1    1 
ATOM   4621 C  C2    . G   F 2 1  ? 27.912  -14.017 34.679   1.00 98.53  ? 104 G   F C2    1 
ATOM   4622 N  N2    . G   F 2 1  ? 29.141  -13.855 35.198   1.00 99.50  ? 104 G   F N2    1 
ATOM   4623 N  N3    . G   F 2 1  ? 27.428  -13.123 33.828   1.00 94.09  ? 104 G   F N3    1 
ATOM   4624 C  C4    . G   F 2 1  ? 26.185  -13.445 33.411   1.00 91.45  ? 104 G   F C4    1 
ATOM   4625 P  P     . C   F 2 2  ? 26.077  -12.492 27.171   1.00 92.46  ? 105 C   F P     1 
ATOM   4626 O  OP1   . C   F 2 2  ? 26.170  -11.854 25.833   1.00 93.93  ? 105 C   F OP1   1 
ATOM   4627 O  OP2   . C   F 2 2  ? 25.014  -13.498 27.434   1.00 85.68  ? 105 C   F OP2   1 
ATOM   4628 O  "O5'" . C   F 2 2  ? 27.501  -13.107 27.526   1.00 91.43  ? 105 C   F "O5'" 1 
ATOM   4629 C  "C5'" . C   F 2 2  ? 28.656  -12.274 27.540   1.00 91.50  ? 105 C   F "C5'" 1 
ATOM   4630 C  "C4'" . C   F 2 2  ? 29.712  -12.845 28.455   1.00 90.79  ? 105 C   F "C4'" 1 
ATOM   4631 O  "O4'" . C   F 2 2  ? 29.242  -12.817 29.832   1.00 89.99  ? 105 C   F "O4'" 1 
ATOM   4632 C  "C3'" . C   F 2 2  ? 30.063  -14.306 28.235   1.00 89.84  ? 105 C   F "C3'" 1 
ATOM   4633 O  "O3'" . C   F 2 2  ? 30.964  -14.500 27.152   1.00 92.14  ? 105 C   F "O3'" 1 
ATOM   4634 C  "C2'" . C   F 2 2  ? 30.702  -14.661 29.567   1.00 88.15  ? 105 C   F "C2'" 1 
ATOM   4635 O  "O2'" . C   F 2 2  ? 32.014  -14.153 29.680   1.00 84.55  ? 105 C   F "O2'" 1 
ATOM   4636 C  "C1'" . C   F 2 2  ? 29.771  -13.934 30.537   1.00 88.08  ? 105 C   F "C1'" 1 
ATOM   4637 N  N1    . C   F 2 2  ? 28.658  -14.810 30.944   1.00 87.26  ? 105 C   F N1    1 
ATOM   4638 C  C2    . C   F 2 2  ? 28.846  -15.678 32.023   1.00 86.00  ? 105 C   F C2    1 
ATOM   4639 O  O2    . C   F 2 2  ? 29.929  -15.660 32.623   1.00 82.74  ? 105 C   F O2    1 
ATOM   4640 N  N3    . C   F 2 2  ? 27.844  -16.514 32.383   1.00 87.04  ? 105 C   F N3    1 
ATOM   4641 C  C4    . C   F 2 2  ? 26.690  -16.499 31.713   1.00 89.56  ? 105 C   F C4    1 
ATOM   4642 N  N4    . C   F 2 2  ? 25.727  -17.346 32.097   1.00 88.65  ? 105 C   F N4    1 
ATOM   4643 C  C5    . C   F 2 2  ? 26.467  -15.615 30.619   1.00 90.71  ? 105 C   F C5    1 
ATOM   4644 C  C6    . C   F 2 2  ? 27.468  -14.794 30.273   1.00 89.10  ? 105 C   F C6    1 
ATOM   4645 P  P     . G   F 2 3  ? 31.000  -15.922 26.404   1.00 92.19  ? 106 G   F P     1 
ATOM   4646 O  OP1   . G   F 2 3  ? 32.138  -15.947 25.445   1.00 90.53  ? 106 G   F OP1   1 
ATOM   4647 O  OP2   . G   F 2 3  ? 29.620  -16.205 25.923   1.00 90.60  ? 106 G   F OP2   1 
ATOM   4648 O  "O5'" . G   F 2 3  ? 31.337  -16.937 27.578   1.00 88.06  ? 106 G   F "O5'" 1 
ATOM   4649 C  "C5'" . G   F 2 3  ? 32.592  -16.879 28.240   1.00 83.60  ? 106 G   F "C5'" 1 
ATOM   4650 C  "C4'" . G   F 2 3  ? 32.755  -18.080 29.125   1.00 80.82  ? 106 G   F "C4'" 1 
ATOM   4651 O  "O4'" . G   F 2 3  ? 31.875  -17.977 30.274   1.00 83.22  ? 106 G   F "O4'" 1 
ATOM   4652 C  "C3'" . G   F 2 3  ? 32.313  -19.379 28.488   1.00 79.81  ? 106 G   F "C3'" 1 
ATOM   4653 O  "O3'" . G   F 2 3  ? 33.282  -19.868 27.586   1.00 78.28  ? 106 G   F "O3'" 1 
ATOM   4654 C  "C2'" . G   F 2 3  ? 32.114  -20.269 29.705   1.00 80.38  ? 106 G   F "C2'" 1 
ATOM   4655 O  "O2'" . G   F 2 3  ? 33.328  -20.758 30.241   1.00 74.71  ? 106 G   F "O2'" 1 
ATOM   4656 C  "C1'" . G   F 2 3  ? 31.475  -19.280 30.681   1.00 79.51  ? 106 G   F "C1'" 1 
ATOM   4657 N  N9    . G   F 2 3  ? 30.017  -19.350 30.658   1.00 72.15  ? 106 G   F N9    1 
ATOM   4658 C  C8    . G   F 2 3  ? 29.150  -18.583 29.918   1.00 68.88  ? 106 G   F C8    1 
ATOM   4659 N  N7    . G   F 2 3  ? 27.897  -18.902 30.105   1.00 66.73  ? 106 G   F N7    1 
ATOM   4660 C  C5    . G   F 2 3  ? 27.942  -19.940 31.027   1.00 63.88  ? 106 G   F C5    1 
ATOM   4661 C  C6    . G   F 2 3  ? 26.892  -20.699 31.619   1.00 60.19  ? 106 G   F C6    1 
ATOM   4662 O  O6    . G   F 2 3  ? 25.669  -20.605 31.443   1.00 54.72  ? 106 G   F O6    1 
ATOM   4663 N  N1    . G   F 2 3  ? 27.390  -21.650 32.499   1.00 59.27  ? 106 G   F N1    1 
ATOM   4664 C  C2    . G   F 2 3  ? 28.720  -21.848 32.779   1.00 59.85  ? 106 G   F C2    1 
ATOM   4665 N  N2    . G   F 2 3  ? 28.998  -22.812 33.659   1.00 61.70  ? 106 G   F N2    1 
ATOM   4666 N  N3    . G   F 2 3  ? 29.702  -21.153 32.238   1.00 59.53  ? 106 G   F N3    1 
ATOM   4667 C  C4    . G   F 2 3  ? 29.245  -20.224 31.379   1.00 65.53  ? 106 G   F C4    1 
ATOM   4668 P  P     . A   F 2 4  ? 32.830  -20.876 26.431   1.00 70.79  ? 107 A   F P     1 
ATOM   4669 O  OP1   . A   F 2 4  ? 33.799  -20.759 25.318   1.00 75.09  ? 107 A   F OP1   1 
ATOM   4670 O  OP2   . A   F 2 4  ? 31.380  -20.675 26.178   1.00 64.82  ? 107 A   F OP2   1 
ATOM   4671 O  "O5'" . A   F 2 4  ? 33.020  -22.290 27.120   1.00 76.84  ? 107 A   F "O5'" 1 
ATOM   4672 C  "C5'" . A   F 2 4  ? 34.041  -22.483 28.094   1.00 79.02  ? 107 A   F "C5'" 1 
ATOM   4673 C  "C4'" . A   F 2 4  ? 33.669  -23.631 28.988   1.00 80.04  ? 107 A   F "C4'" 1 
ATOM   4674 O  "O4'" . A   F 2 4  ? 32.595  -23.250 29.884   1.00 77.76  ? 107 A   F "O4'" 1 
ATOM   4675 C  "C3'" . A   F 2 4  ? 33.121  -24.807 28.206   1.00 79.83  ? 107 A   F "C3'" 1 
ATOM   4676 O  "O3'" . A   F 2 4  ? 34.206  -25.593 27.739   1.00 77.65  ? 107 A   F "O3'" 1 
ATOM   4677 C  "C2'" . A   F 2 4  ? 32.244  -25.527 29.226   1.00 80.14  ? 107 A   F "C2'" 1 
ATOM   4678 O  "O2'" . A   F 2 4  ? 32.957  -26.472 29.997   1.00 82.82  ? 107 A   F "O2'" 1 
ATOM   4679 C  "C1'" . A   F 2 4  ? 31.750  -24.365 30.102   1.00 78.09  ? 107 A   F "C1'" 1 
ATOM   4680 N  N9    . A   F 2 4  ? 30.368  -23.953 29.853   1.00 72.53  ? 107 A   F N9    1 
ATOM   4681 C  C8    . A   F 2 4  ? 29.916  -22.896 29.105   1.00 66.97  ? 107 A   F C8    1 
ATOM   4682 N  N7    . A   F 2 4  ? 28.610  -22.789 29.078   1.00 64.89  ? 107 A   F N7    1 
ATOM   4683 C  C5    . A   F 2 4  ? 28.172  -23.848 29.863   1.00 63.75  ? 107 A   F C5    1 
ATOM   4684 C  C6    . A   F 2 4  ? 26.886  -24.292 30.232   1.00 58.85  ? 107 A   F C6    1 
ATOM   4685 N  N6    . A   F 2 4  ? 25.752  -23.704 29.845   1.00 56.66  ? 107 A   F N6    1 
ATOM   4686 N  N1    . A   F 2 4  ? 26.803  -25.381 31.024   1.00 57.14  ? 107 A   F N1    1 
ATOM   4687 C  C2    . A   F 2 4  ? 27.933  -25.977 31.414   1.00 60.46  ? 107 A   F C2    1 
ATOM   4688 N  N3    . A   F 2 4  ? 29.193  -25.659 31.136   1.00 65.53  ? 107 A   F N3    1 
ATOM   4689 C  C4    . A   F 2 4  ? 29.244  -24.572 30.346   1.00 68.07  ? 107 A   F C4    1 
ATOM   4690 P  P     . C   F 2 5  ? 33.943  -26.732 26.651   1.00 81.60  ? 108 C   F P     1 
ATOM   4691 O  OP1   . C   F 2 5  ? 35.234  -27.405 26.361   1.00 81.96  ? 108 C   F OP1   1 
ATOM   4692 O  OP2   . C   F 2 5  ? 33.136  -26.166 25.541   1.00 78.27  ? 108 C   F OP2   1 
ATOM   4693 O  "O5'" . C   F 2 5  ? 33.018  -27.754 27.425   1.00 73.93  ? 108 C   F "O5'" 1 
ATOM   4694 C  "C5'" . C   F 2 5  ? 32.135  -28.589 26.725   1.00 63.39  ? 108 C   F "C5'" 1 
ATOM   4695 C  "C4'" . C   F 2 5  ? 31.325  -29.372 27.705   1.00 65.78  ? 108 C   F "C4'" 1 
ATOM   4696 O  "O4'" . C   F 2 5  ? 30.670  -28.456 28.617   1.00 58.26  ? 108 C   F "O4'" 1 
ATOM   4697 C  "C3'" . C   F 2 5  ? 30.207  -30.179 27.082   1.00 69.29  ? 108 C   F "C3'" 1 
ATOM   4698 O  "O3'" . C   F 2 5  ? 30.717  -31.432 26.649   1.00 71.28  ? 108 C   F "O3'" 1 
ATOM   4699 C  "C2'" . C   F 2 5  ? 29.229  -30.312 28.239   1.00 65.77  ? 108 C   F "C2'" 1 
ATOM   4700 O  "O2'" . C   F 2 5  ? 29.584  -31.348 29.129   1.00 71.58  ? 108 C   F "O2'" 1 
ATOM   4701 C  "C1'" . C   F 2 5  ? 29.377  -28.946 28.918   1.00 61.93  ? 108 C   F "C1'" 1 
ATOM   4702 N  N1    . C   F 2 5  ? 28.402  -27.970 28.422   1.00 59.72  ? 108 C   F N1    1 
ATOM   4703 C  C2    . C   F 2 5  ? 27.053  -28.154 28.737   1.00 56.92  ? 108 C   F C2    1 
ATOM   4704 O  O2    . C   F 2 5  ? 26.724  -29.142 29.424   1.00 48.82  ? 108 C   F O2    1 
ATOM   4705 N  N3    . C   F 2 5  ? 26.144  -27.257 28.289   1.00 54.79  ? 108 C   F N3    1 
ATOM   4706 C  C4    . C   F 2 5  ? 26.541  -26.213 27.557   1.00 57.27  ? 108 C   F C4    1 
ATOM   4707 N  N4    . C   F 2 5  ? 25.608  -25.351 27.148   1.00 57.07  ? 108 C   F N4    1 
ATOM   4708 C  C5    . C   F 2 5  ? 27.912  -26.005 27.216   1.00 54.69  ? 108 C   F C5    1 
ATOM   4709 C  C6    . C   F 2 5  ? 28.799  -26.899 27.667   1.00 58.25  ? 108 C   F C6    1 
ATOM   4710 P  P     . U   F 2 6  ? 30.490  -31.894 25.135   1.00 70.76  ? 109 U   F P     1 
ATOM   4711 O  OP1   . U   F 2 6  ? 31.269  -33.136 24.931   1.00 71.69  ? 109 U   F OP1   1 
ATOM   4712 O  OP2   . U   F 2 6  ? 30.738  -30.718 24.265   1.00 72.81  ? 109 U   F OP2   1 
ATOM   4713 O  "O5'" . U   F 2 6  ? 28.941  -32.247 25.097   1.00 66.30  ? 109 U   F "O5'" 1 
ATOM   4714 C  "C5'" . U   F 2 6  ? 28.389  -33.112 26.076   1.00 60.36  ? 109 U   F "C5'" 1 
ATOM   4715 C  "C4'" . U   F 2 6  ? 26.911  -32.872 26.211   1.00 60.75  ? 109 U   F "C4'" 1 
ATOM   4716 O  "O4'" . U   F 2 6  ? 26.669  -31.561 26.781   1.00 60.39  ? 109 U   F "O4'" 1 
ATOM   4717 C  "C3'" . U   F 2 6  ? 26.140  -32.830 24.908   1.00 63.60  ? 109 U   F "C3'" 1 
ATOM   4718 O  "O3'" . U   F 2 6  ? 25.902  -34.137 24.399   1.00 68.66  ? 109 U   F "O3'" 1 
ATOM   4719 C  "C2'" . U   F 2 6  ? 24.870  -32.099 25.330   1.00 57.81  ? 109 U   F "C2'" 1 
ATOM   4720 O  "O2'" . U   F 2 6  ? 23.948  -32.908 26.027   1.00 57.66  ? 109 U   F "O2'" 1 
ATOM   4721 C  "C1'" . U   F 2 6  ? 25.439  -31.055 26.288   1.00 53.43  ? 109 U   F "C1'" 1 
ATOM   4722 N  N1    . U   F 2 6  ? 25.690  -29.776 25.614   1.00 47.01  ? 109 U   F N1    1 
ATOM   4723 C  C2    . U   F 2 6  ? 24.583  -29.011 25.304   1.00 43.46  ? 109 U   F C2    1 
ATOM   4724 O  O2    . U   F 2 6  ? 23.444  -29.366 25.567   1.00 39.40  ? 109 U   F O2    1 
ATOM   4725 N  N3    . U   F 2 6  ? 24.855  -27.821 24.675   1.00 39.58  ? 109 U   F N3    1 
ATOM   4726 C  C4    . U   F 2 6  ? 26.099  -27.331 24.332   1.00 42.28  ? 109 U   F C4    1 
ATOM   4727 O  O4    . U   F 2 6  ? 26.178  -26.240 23.761   1.00 38.01  ? 109 U   F O4    1 
ATOM   4728 C  C5    . U   F 2 6  ? 27.202  -28.187 24.687   1.00 39.44  ? 109 U   F C5    1 
ATOM   4729 C  C6    . U   F 2 6  ? 26.964  -29.351 25.300   1.00 38.81  ? 109 U   F C6    1 
ATOM   4730 P  P     . C   F 2 7  ? 26.030  -34.405 22.819   1.00 70.22  ? 110 C   F P     1 
ATOM   4731 O  OP1   . C   F 2 7  ? 26.115  -35.866 22.582   1.00 68.90  ? 110 C   F OP1   1 
ATOM   4732 O  OP2   . C   F 2 7  ? 27.106  -33.510 22.304   1.00 67.86  ? 110 C   F OP2   1 
ATOM   4733 O  "O5'" . C   F 2 7  ? 24.628  -33.909 22.254   1.00 73.11  ? 110 C   F "O5'" 1 
ATOM   4734 C  "C5'" . C   F 2 7  ? 23.419  -34.489 22.733   1.00 70.85  ? 110 C   F "C5'" 1 
ATOM   4735 C  "C4'" . C   F 2 7  ? 22.296  -33.487 22.663   1.00 65.75  ? 110 C   F "C4'" 1 
ATOM   4736 O  "O4'" . C   F 2 7  ? 22.669  -32.310 23.432   1.00 63.54  ? 110 C   F "O4'" 1 
ATOM   4737 C  "C3'" . C   F 2 7  ? 22.026  -32.903 21.293   1.00 67.49  ? 110 C   F "C3'" 1 
ATOM   4738 O  "O3'" . C   F 2 7  ? 21.272  -33.756 20.455   1.00 70.06  ? 110 C   F "O3'" 1 
ATOM   4739 C  "C2'" . C   F 2 7  ? 21.272  -31.641 21.660   1.00 65.48  ? 110 C   F "C2'" 1 
ATOM   4740 O  "O2'" . C   F 2 7  ? 19.957  -31.917 22.109   1.00 64.50  ? 110 C   F "O2'" 1 
ATOM   4741 C  "C1'" . C   F 2 7  ? 22.130  -31.147 22.818   1.00 59.12  ? 110 C   F "C1'" 1 
ATOM   4742 N  N1    . C   F 2 7  ? 23.246  -30.316 22.338   1.00 50.22  ? 110 C   F N1    1 
ATOM   4743 C  C2    . C   F 2 7  ? 23.005  -28.967 22.054   1.00 48.29  ? 110 C   F C2    1 
ATOM   4744 O  O2    . C   F 2 7  ? 21.865  -28.516 22.210   1.00 47.07  ? 110 C   F O2    1 
ATOM   4745 N  N3    . C   F 2 7  ? 24.019  -28.191 21.621   1.00 48.36  ? 110 C   F N3    1 
ATOM   4746 C  C4    . C   F 2 7  ? 25.235  -28.712 21.467   1.00 49.72  ? 110 C   F C4    1 
ATOM   4747 N  N4    . C   F 2 7  ? 26.209  -27.902 21.042   1.00 52.85  ? 110 C   F N4    1 
ATOM   4748 C  C5    . C   F 2 7  ? 25.509  -30.085 21.744   1.00 48.60  ? 110 C   F C5    1 
ATOM   4749 C  C6    . C   F 2 7  ? 24.494  -30.844 22.171   1.00 46.04  ? 110 C   F C6    1 
ATOM   4750 P  P     . G   F 2 8  ? 21.514  -33.698 18.869   1.00 75.20  ? 111 G   F P     1 
ATOM   4751 O  OP1   . G   F 2 8  ? 20.588  -34.692 18.262   1.00 72.95  ? 111 G   F OP1   1 
ATOM   4752 O  OP2   . G   F 2 8  ? 22.976  -33.817 18.640   1.00 71.02  ? 111 G   F OP2   1 
ATOM   4753 O  "O5'" . G   F 2 8  ? 21.086  -32.207 18.462   1.00 74.92  ? 111 G   F "O5'" 1 
ATOM   4754 C  "C5'" . G   F 2 8  ? 19.785  -31.713 18.798   1.00 69.00  ? 111 G   F "C5'" 1 
ATOM   4755 C  "C4'" . G   F 2 8  ? 19.658  -30.203 18.597   1.00 59.41  ? 111 G   F "C4'" 1 
ATOM   4756 O  "O4'" . G   F 2 8  ? 20.706  -29.462 19.281   1.00 49.86  ? 111 G   F "O4'" 1 
ATOM   4757 C  "C3'" . G   F 2 8  ? 19.722  -29.582 17.211   1.00 57.33  ? 111 G   F "C3'" 1 
ATOM   4758 O  "O3'" . G   F 2 8  ? 18.556  -29.863 16.433   1.00 59.90  ? 111 G   F "O3'" 1 
ATOM   4759 C  "C2'" . G   F 2 8  ? 19.778  -28.099 17.580   1.00 52.56  ? 111 G   F "C2'" 1 
ATOM   4760 O  "O2'" . G   F 2 8  ? 18.527  -27.602 18.012   1.00 50.96  ? 111 G   F "O2'" 1 
ATOM   4761 C  "C1'" . G   F 2 8  ? 20.686  -28.122 18.807   1.00 46.33  ? 111 G   F "C1'" 1 
ATOM   4762 N  N9    . G   F 2 8  ? 22.041  -27.652 18.533   1.00 41.70  ? 111 G   F N9    1 
ATOM   4763 C  C8    . G   F 2 8  ? 23.208  -28.372 18.557   1.00 41.09  ? 111 G   F C8    1 
ATOM   4764 N  N7    . G   F 2 8  ? 24.262  -27.648 18.279   1.00 38.27  ? 111 G   F N7    1 
ATOM   4765 C  C5    . G   F 2 8  ? 23.759  -26.374 18.053   1.00 33.44  ? 111 G   F C5    1 
ATOM   4766 C  C6    . G   F 2 8  ? 24.427  -25.159 17.708   1.00 32.94  ? 111 G   F C6    1 
ATOM   4767 O  O6    . G   F 2 8  ? 25.637  -24.962 17.523   1.00 33.78  ? 111 G   F O6    1 
ATOM   4768 N  N1    . G   F 2 8  ? 23.532  -24.106 17.579   1.00 25.95  ? 111 G   F N1    1 
ATOM   4769 C  C2    . G   F 2 8  ? 22.177  -24.200 17.752   1.00 31.27  ? 111 G   F C2    1 
ATOM   4770 N  N2    . G   F 2 8  ? 21.488  -23.073 17.586   1.00 32.71  ? 111 G   F N2    1 
ATOM   4771 N  N3    . G   F 2 8  ? 21.542  -25.319 18.068   1.00 36.18  ? 111 G   F N3    1 
ATOM   4772 C  C4    . G   F 2 8  ? 22.390  -26.359 18.203   1.00 37.57  ? 111 G   F C4    1 
ATOM   4773 P  P     . G   F 2 9  ? 18.636  -29.815 14.820   1.00 54.29  ? 112 G   F P     1 
ATOM   4774 O  OP1   . G   F 2 9  ? 17.421  -30.463 14.263   1.00 46.97  ? 112 G   F OP1   1 
ATOM   4775 O  OP2   . G   F 2 9  ? 19.975  -30.302 14.420   1.00 56.43  ? 112 G   F OP2   1 
ATOM   4776 O  "O5'" . G   F 2 9  ? 18.600  -28.263 14.468   1.00 50.96  ? 112 G   F "O5'" 1 
ATOM   4777 C  "C5'" . G   F 2 9  ? 17.539  -27.438 14.926   1.00 43.80  ? 112 G   F "C5'" 1 
ATOM   4778 C  "C4'" . G   F 2 9  ? 17.841  -25.985 14.644   1.00 45.63  ? 112 G   F "C4'" 1 
ATOM   4779 O  "O4'" . G   F 2 9  ? 19.066  -25.591 15.314   1.00 46.59  ? 112 G   F "O4'" 1 
ATOM   4780 C  "C3'" . G   F 2 9  ? 18.138  -25.599 13.208   1.00 47.78  ? 112 G   F "C3'" 1 
ATOM   4781 O  "O3'" . G   F 2 9  ? 16.940  -25.530 12.438   1.00 50.21  ? 112 G   F "O3'" 1 
ATOM   4782 C  "C2'" . G   F 2 9  ? 18.781  -24.228 13.395   1.00 45.39  ? 112 G   F "C2'" 1 
ATOM   4783 O  "O2'" . G   F 2 9  ? 17.820  -23.237 13.692   1.00 46.38  ? 112 G   F "O2'" 1 
ATOM   4784 C  "C1'" . G   F 2 9  ? 19.599  -24.450 14.665   1.00 43.73  ? 112 G   F "C1'" 1 
ATOM   4785 N  N9    . G   F 2 9  ? 21.033  -24.634 14.473   1.00 45.71  ? 112 G   F N9    1 
ATOM   4786 C  C8    . G   F 2 9  ? 21.750  -25.800 14.605   1.00 49.11  ? 112 G   F C8    1 
ATOM   4787 N  N7    . G   F 2 9  ? 23.036  -25.631 14.440   1.00 53.22  ? 112 G   F N7    1 
ATOM   4788 C  C5    . G   F 2 9  ? 23.176  -24.272 14.167   1.00 48.60  ? 112 G   F C5    1 
ATOM   4789 C  C6    . G   F 2 9  ? 24.346  -23.485 13.907   1.00 44.38  ? 112 G   F C6    1 
ATOM   4790 O  O6    . G   F 2 9  ? 25.532  -23.839 13.881   1.00 40.43  ? 112 G   F O6    1 
ATOM   4791 N  N1    . G   F 2 9  ? 24.023  -22.157 13.668   1.00 37.74  ? 112 G   F N1    1 
ATOM   4792 C  C2    . G   F 2 9  ? 22.757  -21.639 13.683   1.00 38.89  ? 112 G   F C2    1 
ATOM   4793 N  N2    . G   F 2 9  ? 22.661  -20.331 13.425   1.00 37.25  ? 112 G   F N2    1 
ATOM   4794 N  N3    . G   F 2 9  ? 21.667  -22.348 13.933   1.00 39.97  ? 112 G   F N3    1 
ATOM   4795 C  C4    . G   F 2 9  ? 21.947  -23.647 14.164   1.00 45.74  ? 112 G   F C4    1 
ATOM   4796 P  P     . G   F 2 10 ? 16.994  -25.807 10.851   1.00 45.60  ? 113 G   F P     1 
ATOM   4797 O  OP1   . G   F 2 10 ? 15.706  -26.418 10.436   1.00 36.40  ? 113 G   F OP1   1 
ATOM   4798 O  OP2   . G   F 2 10 ? 18.275  -26.511 10.555   1.00 33.05  ? 113 G   F OP2   1 
ATOM   4799 O  "O5'" . G   F 2 10 ? 17.066  -24.345 10.230   1.00 42.15  ? 113 G   F "O5'" 1 
ATOM   4800 C  "C5'" . G   F 2 10 ? 17.796  -24.091 9.042    1.00 37.02  ? 113 G   F "C5'" 1 
ATOM   4801 C  "C4'" . G   F 2 10 ? 18.574  -22.817 9.191    1.00 33.03  ? 113 G   F "C4'" 1 
ATOM   4802 O  "O4'" . G   F 2 10 ? 19.486  -22.948 10.303   1.00 33.36  ? 113 G   F "O4'" 1 
ATOM   4803 C  "C3'" . G   F 2 10 ? 19.473  -22.471 8.020    1.00 37.55  ? 113 G   F "C3'" 1 
ATOM   4804 O  "O3'" . G   F 2 10 ? 18.719  -21.779 7.045    1.00 40.60  ? 113 G   F "O3'" 1 
ATOM   4805 C  "C2'" . G   F 2 10 ? 20.505  -21.547 8.653    1.00 41.28  ? 113 G   F "C2'" 1 
ATOM   4806 O  "O2'" . G   F 2 10 ? 20.090  -20.190 8.676    1.00 36.15  ? 113 G   F "O2'" 1 
ATOM   4807 C  "C1'" . G   F 2 10 ? 20.620  -22.134 10.068   1.00 40.80  ? 113 G   F "C1'" 1 
ATOM   4808 N  N9    . G   F 2 10 ? 21.820  -22.937 10.266   1.00 36.73  ? 113 G   F N9    1 
ATOM   4809 C  C8    . G   F 2 10 ? 21.897  -24.264 10.615   1.00 30.85  ? 113 G   F C8    1 
ATOM   4810 N  N7    . G   F 2 10 ? 23.123  -24.695 10.707   1.00 30.18  ? 113 G   F N7    1 
ATOM   4811 C  C5    . G   F 2 10 ? 23.901  -23.584 10.404   1.00 36.64  ? 113 G   F C5    1 
ATOM   4812 C  C6    . G   F 2 10 ? 25.316  -23.432 10.342   1.00 41.37  ? 113 G   F C6    1 
ATOM   4813 O  O6    . G   F 2 10 ? 26.195  -24.283 10.544   1.00 48.27  ? 113 G   F O6    1 
ATOM   4814 N  N1    . G   F 2 10 ? 25.676  -22.130 10.001   1.00 37.77  ? 113 G   F N1    1 
ATOM   4815 C  C2    . G   F 2 10 ? 24.796  -21.109 9.743    1.00 35.81  ? 113 G   F C2    1 
ATOM   4816 N  N2    . G   F 2 10 ? 25.342  -19.928 9.423    1.00 38.04  ? 113 G   F N2    1 
ATOM   4817 N  N3    . G   F 2 10 ? 23.482  -21.236 9.794    1.00 33.32  ? 113 G   F N3    1 
ATOM   4818 C  C4    . G   F 2 10 ? 23.109  -22.493 10.130   1.00 35.20  ? 113 G   F C4    1 
ATOM   4819 P  P     . G   F 2 11 ? 18.332  -22.518 5.685    1.00 38.93  ? 114 G   F P     1 
ATOM   4820 O  OP1   . G   F 2 11 ? 16.881  -22.314 5.437    1.00 33.83  ? 114 G   F OP1   1 
ATOM   4821 O  OP2   . G   F 2 11 ? 18.882  -23.896 5.773    1.00 33.64  ? 114 G   F OP2   1 
ATOM   4822 O  "O5'" . G   F 2 11 ? 19.164  -21.718 4.597    1.00 37.49  ? 114 G   F "O5'" 1 
ATOM   4823 C  "C5'" . G   F 2 11 ? 18.882  -20.355 4.334    1.00 44.26  ? 114 G   F "C5'" 1 
ATOM   4824 C  "C4'" . G   F 2 11 ? 20.157  -19.623 4.023    1.00 48.64  ? 114 G   F "C4'" 1 
ATOM   4825 O  "O4'" . G   F 2 11 ? 21.006  -19.648 5.200    1.00 51.91  ? 114 G   F "O4'" 1 
ATOM   4826 C  "C3'" . G   F 2 11 ? 21.014  -20.260 2.947    1.00 50.84  ? 114 G   F "C3'" 1 
ATOM   4827 O  "O3'" . G   F 2 11 ? 20.551  -19.911 1.647    1.00 51.70  ? 114 G   F "O3'" 1 
ATOM   4828 C  "C2'" . G   F 2 11 ? 22.386  -19.695 3.284    1.00 50.06  ? 114 G   F "C2'" 1 
ATOM   4829 O  "O2'" . G   F 2 11 ? 22.506  -18.337 2.898    1.00 43.20  ? 114 G   F "O2'" 1 
ATOM   4830 C  "C1'" . G   F 2 11 ? 22.362  -19.784 4.812    1.00 50.74  ? 114 G   F "C1'" 1 
ATOM   4831 N  N9    . G   F 2 11 ? 22.841  -21.052 5.352    1.00 51.34  ? 114 G   F N9    1 
ATOM   4832 C  C8    . G   F 2 11 ? 22.115  -22.208 5.495    1.00 53.65  ? 114 G   F C8    1 
ATOM   4833 N  N7    . G   F 2 11 ? 22.800  -23.186 6.024    1.00 52.31  ? 114 G   F N7    1 
ATOM   4834 C  C5    . G   F 2 11 ? 24.058  -22.646 6.240    1.00 51.91  ? 114 G   F C5    1 
ATOM   4835 C  C6    . G   F 2 11 ? 25.230  -23.237 6.789    1.00 51.66  ? 114 G   F C6    1 
ATOM   4836 O  O6    . G   F 2 11 ? 25.389  -24.399 7.208    1.00 43.30  ? 114 G   F O6    1 
ATOM   4837 N  N1    . G   F 2 11 ? 26.289  -22.327 6.824    1.00 46.31  ? 114 G   F N1    1 
ATOM   4838 C  C2    . G   F 2 11 ? 26.224  -21.020 6.390    1.00 41.30  ? 114 G   F C2    1 
ATOM   4839 N  N2    . G   F 2 11 ? 27.341  -20.299 6.509    1.00 36.49  ? 114 G   F N2    1 
ATOM   4840 N  N3    . G   F 2 11 ? 25.138  -20.462 5.878    1.00 44.87  ? 114 G   F N3    1 
ATOM   4841 C  C4    . G   F 2 11 ? 24.101  -21.326 5.831    1.00 51.88  ? 114 G   F C4    1 
ATOM   4842 P  P     . U   F 2 12 ? 20.442  -21.048 0.515    1.00 53.91  ? 115 U   F P     1 
ATOM   4843 O  OP1   . U   F 2 12 ? 19.480  -20.603 -0.528   1.00 52.65  ? 115 U   F OP1   1 
ATOM   4844 O  OP2   . U   F 2 12 ? 20.231  -22.355 1.196    1.00 49.36  ? 115 U   F OP2   1 
ATOM   4845 O  "O5'" . U   F 2 12 ? 21.902  -21.074 -0.118   1.00 56.94  ? 115 U   F "O5'" 1 
ATOM   4846 C  "C5'" . U   F 2 12 ? 22.466  -19.903 -0.700   1.00 58.83  ? 115 U   F "C5'" 1 
ATOM   4847 C  "C4'" . U   F 2 12 ? 23.966  -20.001 -0.697   1.00 59.46  ? 115 U   F "C4'" 1 
ATOM   4848 O  "O4'" . U   F 2 12 ? 24.403  -20.118 0.678    1.00 58.90  ? 115 U   F "O4'" 1 
ATOM   4849 C  "C3'" . U   F 2 12 ? 24.528  -21.243 -1.373   1.00 63.54  ? 115 U   F "C3'" 1 
ATOM   4850 O  "O3'" . U   F 2 12 ? 24.721  -21.027 -2.772   1.00 56.55  ? 115 U   F "O3'" 1 
ATOM   4851 C  "C2'" . U   F 2 12 ? 25.880  -21.403 -0.685   1.00 67.72  ? 115 U   F "C2'" 1 
ATOM   4852 O  "O2'" . U   F 2 12 ? 26.885  -20.615 -1.287   1.00 78.45  ? 115 U   F "O2'" 1 
ATOM   4853 C  "C1'" . U   F 2 12 ? 25.587  -20.892 0.732    1.00 65.57  ? 115 U   F "C1'" 1 
ATOM   4854 N  N1    . U   F 2 12 ? 25.416  -21.970 1.719    1.00 62.80  ? 115 U   F N1    1 
ATOM   4855 C  C2    . U   F 2 12 ? 26.548  -22.400 2.395    1.00 59.24  ? 115 U   F C2    1 
ATOM   4856 O  O2    . U   F 2 12 ? 27.647  -21.888 2.235    1.00 54.13  ? 115 U   F O2    1 
ATOM   4857 N  N3    . U   F 2 12 ? 26.345  -23.448 3.260    1.00 56.88  ? 115 U   F N3    1 
ATOM   4858 C  C4    . U   F 2 12 ? 25.151  -24.095 3.520    1.00 60.37  ? 115 U   F C4    1 
ATOM   4859 O  O4    . U   F 2 12 ? 25.135  -25.051 4.304    1.00 60.65  ? 115 U   F O4    1 
ATOM   4860 C  C5    . U   F 2 12 ? 24.023  -23.575 2.803    1.00 61.24  ? 115 U   F C5    1 
ATOM   4861 C  C6    . U   F 2 12 ? 24.189  -22.554 1.951    1.00 62.86  ? 115 U   F C6    1 
ATOM   4862 P  P     . G   F 2 13 ? 23.619  -21.539 -3.824   1.00 53.21  ? 116 G   F P     1 
ATOM   4863 O  OP1   . G   F 2 13 ? 22.892  -22.712 -3.275   1.00 55.58  ? 116 G   F OP1   1 
ATOM   4864 O  OP2   . G   F 2 13 ? 24.300  -21.657 -5.128   1.00 49.59  ? 116 G   F OP2   1 
ATOM   4865 O  "O5'" . G   F 2 13 ? 22.605  -20.317 -3.921   1.00 51.12  ? 116 G   F "O5'" 1 
ATOM   4866 C  "C5'" . G   F 2 13 ? 22.568  -19.520 -5.093   1.00 50.90  ? 116 G   F "C5'" 1 
ATOM   4867 C  "C4'" . G   F 2 13 ? 22.426  -18.056 -4.749   1.00 46.00  ? 116 G   F "C4'" 1 
ATOM   4868 O  "O4'" . G   F 2 13 ? 23.358  -17.690 -3.701   1.00 41.51  ? 116 G   F "O4'" 1 
ATOM   4869 C  "C3'" . G   F 2 13 ? 22.789  -17.162 -5.918   1.00 44.45  ? 116 G   F "C3'" 1 
ATOM   4870 O  "O3'" . G   F 2 13 ? 21.673  -17.025 -6.786   1.00 41.66  ? 116 G   F "O3'" 1 
ATOM   4871 C  "C2'" . G   F 2 13 ? 23.249  -15.871 -5.244   1.00 41.49  ? 116 G   F "C2'" 1 
ATOM   4872 O  "O2'" . G   F 2 13 ? 22.232  -14.954 -4.911   1.00 44.53  ? 116 G   F "O2'" 1 
ATOM   4873 C  "C1'" . G   F 2 13 ? 23.894  -16.404 -3.965   1.00 37.46  ? 116 G   F "C1'" 1 
ATOM   4874 N  N9    . G   F 2 13 ? 25.344  -16.532 -4.028   1.00 36.32  ? 116 G   F N9    1 
ATOM   4875 C  C8    . G   F 2 13 ? 26.069  -17.689 -3.879   1.00 38.51  ? 116 G   F C8    1 
ATOM   4876 N  N7    . G   F 2 13 ? 27.359  -17.497 -3.943   1.00 35.43  ? 116 G   F N7    1 
ATOM   4877 C  C5    . G   F 2 13 ? 27.495  -16.133 -4.159   1.00 33.72  ? 116 G   F C5    1 
ATOM   4878 C  C6    . G   F 2 13 ? 28.655  -15.347 -4.310   1.00 31.35  ? 116 G   F C6    1 
ATOM   4879 O  O6    . G   F 2 13 ? 29.829  -15.705 -4.276   1.00 38.35  ? 116 G   F O6    1 
ATOM   4880 N  N1    . G   F 2 13 ? 28.347  -14.012 -4.514   1.00 30.98  ? 116 G   F N1    1 
ATOM   4881 C  C2    . G   F 2 13 ? 27.083  -13.492 -4.558   1.00 35.94  ? 116 G   F C2    1 
ATOM   4882 N  N2    . G   F 2 13 ? 26.999  -12.164 -4.756   1.00 33.40  ? 116 G   F N2    1 
ATOM   4883 N  N3    . G   F 2 13 ? 25.981  -14.216 -4.415   1.00 38.98  ? 116 G   F N3    1 
ATOM   4884 C  C4    . G   F 2 13 ? 26.262  -15.522 -4.221   1.00 36.01  ? 116 G   F C4    1 
ATOM   4885 P  P     . C   F 2 14 ? 21.809  -17.460 -8.330   1.00 44.46  ? 117 C   F P     1 
ATOM   4886 O  OP1   . C   F 2 14 ? 20.619  -18.242 -8.773   1.00 33.37  ? 117 C   F OP1   1 
ATOM   4887 O  OP2   . C   F 2 14 ? 23.170  -18.023 -8.506   1.00 28.46  ? 117 C   F OP2   1 
ATOM   4888 O  "O5'" . C   F 2 14 ? 21.757  -16.068 -9.088   1.00 50.37  ? 117 C   F "O5'" 1 
ATOM   4889 C  "C5'" . C   F 2 14 ? 22.851  -15.636 -9.872   1.00 51.99  ? 117 C   F "C5'" 1 
ATOM   4890 C  "C4'" . C   F 2 14 ? 23.183  -14.199 -9.560   1.00 47.27  ? 117 C   F "C4'" 1 
ATOM   4891 O  "O4'" . C   F 2 14 ? 23.708  -14.090 -8.213   1.00 44.25  ? 117 C   F "O4'" 1 
ATOM   4892 C  "C3'" . C   F 2 14 ? 24.286  -13.665 -10.450  1.00 46.84  ? 117 C   F "C3'" 1 
ATOM   4893 O  "O3'" . C   F 2 14 ? 23.689  -13.137 -11.608  1.00 48.58  ? 117 C   F "O3'" 1 
ATOM   4894 C  "C2'" . C   F 2 14 ? 24.915  -12.593 -9.587   1.00 40.08  ? 117 C   F "C2'" 1 
ATOM   4895 O  "O2'" . C   F 2 14 ? 24.154  -11.410 -9.576   1.00 41.00  ? 117 C   F "O2'" 1 
ATOM   4896 C  "C1'" . C   F 2 14 ? 24.866  -13.272 -8.222   1.00 41.14  ? 117 C   F "C1'" 1 
ATOM   4897 N  N1    . C   F 2 14 ? 26.038  -14.136 -8.002   1.00 36.10  ? 117 C   F N1    1 
ATOM   4898 C  C2    . C   F 2 14 ? 27.285  -13.545 -7.968   1.00 31.47  ? 117 C   F C2    1 
ATOM   4899 O  O2    . C   F 2 14 ? 27.362  -12.330 -8.154   1.00 34.79  ? 117 C   F O2    1 
ATOM   4900 N  N3    . C   F 2 14 ? 28.375  -14.304 -7.737   1.00 32.49  ? 117 C   F N3    1 
ATOM   4901 C  C4    . C   F 2 14 ? 28.245  -15.616 -7.556   1.00 32.68  ? 117 C   F C4    1 
ATOM   4902 N  N4    . C   F 2 14 ? 29.353  -16.326 -7.332   1.00 30.36  ? 117 C   F N4    1 
ATOM   4903 C  C5    . C   F 2 14 ? 26.975  -16.256 -7.599   1.00 29.32  ? 117 C   F C5    1 
ATOM   4904 C  C6    . C   F 2 14 ? 25.907  -15.486 -7.825   1.00 32.98  ? 117 C   F C6    1 
ATOM   4905 P  P     . C   F 2 15 ? 23.514  -14.070 -12.891  1.00 49.28  ? 118 C   F P     1 
ATOM   4906 O  OP1   . C   F 2 15 ? 22.161  -13.771 -13.411  1.00 50.51  ? 118 C   F OP1   1 
ATOM   4907 O  OP2   . C   F 2 15 ? 23.865  -15.467 -12.508  1.00 34.02  ? 118 C   F OP2   1 
ATOM   4908 O  "O5'" . C   F 2 15 ? 24.628  -13.507 -13.890  1.00 56.70  ? 118 C   F "O5'" 1 
ATOM   4909 C  "C5'" . C   F 2 15 ? 25.036  -12.132 -13.834  1.00 50.34  ? 118 C   F "C5'" 1 
ATOM   4910 C  "C4'" . C   F 2 15 ? 26.550  -12.018 -13.811  1.00 42.46  ? 118 C   F "C4'" 1 
ATOM   4911 O  "O4'" . C   F 2 15 ? 27.081  -12.861 -12.778  1.00 33.45  ? 118 C   F "O4'" 1 
ATOM   4912 C  "C3'" . C   F 2 15 ? 27.305  -12.424 -15.070  1.00 44.50  ? 118 C   F "C3'" 1 
ATOM   4913 O  "O3'" . C   F 2 15 ? 27.612  -11.224 -15.785  1.00 52.74  ? 118 C   F "O3'" 1 
ATOM   4914 C  "C2'" . C   F 2 15 ? 28.658  -12.935 -14.551  1.00 42.76  ? 118 C   F "C2'" 1 
ATOM   4915 O  "O2'" . C   F 2 15 ? 29.706  -12.020 -14.761  1.00 58.13  ? 118 C   F "O2'" 1 
ATOM   4916 C  "C1'" . C   F 2 15 ? 28.436  -13.062 -13.043  1.00 40.09  ? 118 C   F "C1'" 1 
ATOM   4917 N  N1    . C   F 2 15 ? 28.902  -14.286 -12.383  1.00 49.53  ? 118 C   F N1    1 
ATOM   4918 C  C2    . C   F 2 15 ? 30.233  -14.334 -11.960  1.00 49.71  ? 118 C   F C2    1 
ATOM   4919 O  O2    . C   F 2 15 ? 30.959  -13.349 -12.176  1.00 45.98  ? 118 C   F O2    1 
ATOM   4920 N  N3    . C   F 2 15 ? 30.694  -15.441 -11.329  1.00 47.47  ? 118 C   F N3    1 
ATOM   4921 C  C4    . C   F 2 15 ? 29.876  -16.475 -11.118  1.00 50.15  ? 118 C   F C4    1 
ATOM   4922 N  N4    . C   F 2 15 ? 30.370  -17.547 -10.488  1.00 46.27  ? 118 C   F N4    1 
ATOM   4923 C  C5    . C   F 2 15 ? 28.511  -16.457 -11.545  1.00 54.67  ? 118 C   F C5    1 
ATOM   4924 C  C6    . C   F 2 15 ? 28.071  -15.351 -12.170  1.00 53.55  ? 118 C   F C6    1 
ATOM   4925 P  P     . C   F 2 16 ? 26.847  -10.841 -17.142  1.00 53.88  ? 119 C   F P     1 
ATOM   4926 O  OP1   . C   F 2 16 ? 25.774  -9.859  -16.829  1.00 46.77  ? 119 C   F OP1   1 
ATOM   4927 O  OP2   . C   F 2 16 ? 26.520  -12.089 -17.875  1.00 54.61  ? 119 C   F OP2   1 
ATOM   4928 O  "O5'" . C   F 2 16 ? 27.965  -10.056 -17.956  1.00 50.56  ? 119 C   F "O5'" 1 
ATOM   4929 C  "C5'" . C   F 2 16 ? 27.849  -8.660  -18.198  1.00 54.76  ? 119 C   F "C5'" 1 
ATOM   4930 C  "C4'" . C   F 2 16 ? 29.208  -8.004  -18.131  1.00 58.16  ? 119 C   F "C4'" 1 
ATOM   4931 O  "O4'" . C   F 2 16 ? 29.570  -7.714  -16.765  1.00 65.47  ? 119 C   F "O4'" 1 
ATOM   4932 C  "C3'" . C   F 2 16 ? 30.370  -8.843  -18.623  1.00 60.36  ? 119 C   F "C3'" 1 
ATOM   4933 O  "O3'" . C   F 2 16 ? 30.450  -8.802  -20.037  1.00 59.63  ? 119 C   F "O3'" 1 
ATOM   4934 C  "C2'" . C   F 2 16 ? 31.581  -8.180  -17.967  1.00 62.18  ? 119 C   F "C2'" 1 
ATOM   4935 O  "O2'" . C   F 2 16 ? 32.173  -7.176  -18.764  1.00 61.68  ? 119 C   F "O2'" 1 
ATOM   4936 C  "C1'" . C   F 2 16 ? 30.978  -7.590  -16.681  1.00 65.18  ? 119 C   F "C1'" 1 
ATOM   4937 N  N1    . C   F 2 16 ? 31.443  -8.232  -15.442  1.00 69.02  ? 119 C   F N1    1 
ATOM   4938 C  C2    . C   F 2 16 ? 31.935  -7.416  -14.412  1.00 72.75  ? 119 C   F C2    1 
ATOM   4939 O  O2    . C   F 2 16 ? 31.914  -6.180  -14.560  1.00 73.94  ? 119 C   F O2    1 
ATOM   4940 N  N3    . C   F 2 16 ? 32.416  -7.992  -13.285  1.00 73.28  ? 119 C   F N3    1 
ATOM   4941 C  C4    . C   F 2 16 ? 32.413  -9.322  -13.163  1.00 72.81  ? 119 C   F C4    1 
ATOM   4942 N  N4    . C   F 2 16 ? 32.908  -9.846  -12.038  1.00 78.21  ? 119 C   F N4    1 
ATOM   4943 C  C5    . C   F 2 16 ? 31.904  -10.173 -14.188  1.00 69.77  ? 119 C   F C5    1 
ATOM   4944 C  C6    . C   F 2 16 ? 31.428  -9.591  -15.297  1.00 68.26  ? 119 C   F C6    1 
ATOM   4945 P  P     . U   F 2 17 ? 30.535  -10.175 -20.853  1.00 62.83  ? 120 U   F P     1 
ATOM   4946 O  OP1   . U   F 2 17 ? 30.674  -9.879  -22.303  1.00 61.29  ? 120 U   F OP1   1 
ATOM   4947 O  OP2   . U   F 2 17 ? 29.421  -11.041 -20.390  1.00 60.79  ? 120 U   F OP2   1 
ATOM   4948 O  "O5'" . U   F 2 17 ? 31.895  -10.799 -20.321  1.00 63.10  ? 120 U   F "O5'" 1 
ATOM   4949 C  "C5'" . U   F 2 17 ? 32.261  -12.118 -20.664  1.00 61.99  ? 120 U   F "C5'" 1 
ATOM   4950 C  "C4'" . U   F 2 17 ? 33.747  -12.292 -20.532  1.00 62.55  ? 120 U   F "C4'" 1 
ATOM   4951 O  "O4'" . U   F 2 17 ? 34.157  -12.015 -19.166  1.00 63.98  ? 120 U   F "O4'" 1 
ATOM   4952 C  "C3'" . U   F 2 17 ? 34.183  -13.717 -20.797  1.00 64.62  ? 120 U   F "C3'" 1 
ATOM   4953 O  "O3'" . U   F 2 17 ? 34.412  -13.893 -22.183  1.00 65.82  ? 120 U   F "O3'" 1 
ATOM   4954 C  "C2'" . U   F 2 17 ? 35.443  -13.828 -19.962  1.00 66.89  ? 120 U   F "C2'" 1 
ATOM   4955 O  "O2'" . U   F 2 17 ? 36.547  -13.207 -20.589  1.00 71.53  ? 120 U   F "O2'" 1 
ATOM   4956 C  "C1'" . U   F 2 17 ? 35.029  -13.039 -18.716  1.00 68.28  ? 120 U   F "C1'" 1 
ATOM   4957 N  N1    . U   F 2 17 ? 34.310  -13.811 -17.687  1.00 69.78  ? 120 U   F N1    1 
ATOM   4958 C  C2    . U   F 2 17 ? 34.616  -15.158 -17.518  1.00 67.42  ? 120 U   F C2    1 
ATOM   4959 O  O2    . U   F 2 17 ? 35.467  -15.736 -18.166  1.00 63.60  ? 120 U   F O2    1 
ATOM   4960 N  N3    . U   F 2 17 ? 33.881  -15.802 -16.551  1.00 66.69  ? 120 U   F N3    1 
ATOM   4961 C  C4    . U   F 2 17 ? 32.901  -15.256 -15.745  1.00 65.93  ? 120 U   F C4    1 
ATOM   4962 O  O4    . U   F 2 17 ? 32.321  -15.973 -14.930  1.00 60.47  ? 120 U   F O4    1 
ATOM   4963 C  C5    . U   F 2 17 ? 32.652  -13.862 -15.967  1.00 66.00  ? 120 U   F C5    1 
ATOM   4964 C  C6    . U   F 2 17 ? 33.345  -13.204 -16.905  1.00 68.25  ? 120 U   F C6    1 
ATOM   4965 P  P     . C   F 2 18 ? 33.542  -14.969 -22.989  1.00 69.28  ? 121 C   F P     1 
ATOM   4966 O  OP1   . C   F 2 18 ? 34.128  -15.157 -24.338  1.00 70.93  ? 121 C   F OP1   1 
ATOM   4967 O  OP2   . C   F 2 18 ? 32.119  -14.569 -22.861  1.00 74.07  ? 121 C   F OP2   1 
ATOM   4968 O  "O5'" . C   F 2 18 ? 33.757  -16.298 -22.144  1.00 61.96  ? 121 C   F "O5'" 1 
ATOM   4969 C  "C5'" . C   F 2 18 ? 33.919  -17.552 -22.779  1.00 56.30  ? 121 C   F "C5'" 1 
ATOM   4970 C  "C4'" . C   F 2 18 ? 35.309  -18.067 -22.528  1.00 58.27  ? 121 C   F "C4'" 1 
ATOM   4971 O  "O4'" . C   F 2 18 ? 35.852  -17.447 -21.333  1.00 61.54  ? 121 C   F "O4'" 1 
ATOM   4972 C  "C3'" . C   F 2 18 ? 35.364  -19.557 -22.269  1.00 57.11  ? 121 C   F "C3'" 1 
ATOM   4973 O  "O3'" . C   F 2 18 ? 35.452  -20.271 -23.486  1.00 62.04  ? 121 C   F "O3'" 1 
ATOM   4974 C  "C2'" . C   F 2 18 ? 36.584  -19.682 -21.371  1.00 57.92  ? 121 C   F "C2'" 1 
ATOM   4975 O  "O2'" . C   F 2 18 ? 37.801  -19.604 -22.086  1.00 51.38  ? 121 C   F "O2'" 1 
ATOM   4976 C  "C1'" . C   F 2 18 ? 36.410  -18.440 -20.493  1.00 63.23  ? 121 C   F "C1'" 1 
ATOM   4977 N  N1    . C   F 2 18 ? 35.461  -18.636 -19.385  1.00 70.56  ? 121 C   F N1    1 
ATOM   4978 C  C2    . C   F 2 18 ? 35.821  -19.446 -18.309  1.00 73.71  ? 121 C   F C2    1 
ATOM   4979 O  O2    . C   F 2 18 ? 36.937  -19.982 -18.311  1.00 78.39  ? 121 C   F O2    1 
ATOM   4980 N  N3    . C   F 2 18 ? 34.940  -19.622 -17.293  1.00 76.87  ? 121 C   F N3    1 
ATOM   4981 C  C4    . C   F 2 18 ? 33.744  -19.022 -17.333  1.00 75.25  ? 121 C   F C4    1 
ATOM   4982 N  N4    . C   F 2 18 ? 32.902  -19.224 -16.316  1.00 73.22  ? 121 C   F N4    1 
ATOM   4983 C  C5    . C   F 2 18 ? 33.356  -18.191 -18.418  1.00 72.18  ? 121 C   F C5    1 
ATOM   4984 C  C6    . C   F 2 18 ? 34.235  -18.027 -19.412  1.00 71.61  ? 121 C   F C6    1 
ATOM   4985 P  P     . C   F 2 19 ? 34.343  -21.381 -23.819  1.00 71.94  ? 122 C   F P     1 
ATOM   4986 O  OP1   . C   F 2 19 ? 34.687  -22.059 -25.097  1.00 69.73  ? 122 C   F OP1   1 
ATOM   4987 O  OP2   . C   F 2 19 ? 33.022  -20.717 -23.675  1.00 69.76  ? 122 C   F OP2   1 
ATOM   4988 O  "O5'" . C   F 2 19 ? 34.531  -22.421 -22.630  1.00 64.68  ? 122 C   F "O5'" 1 
ATOM   4989 C  "C5'" . C   F 2 19 ? 35.836  -22.844 -22.261  1.00 62.30  ? 122 C   F "C5'" 1 
ATOM   4990 C  "C4'" . C   F 2 19 ? 35.768  -23.804 -21.110  1.00 59.52  ? 122 C   F "C4'" 1 
ATOM   4991 O  "O4'" . C   F 2 19 ? 35.592  -23.097 -19.852  1.00 62.02  ? 122 C   F "O4'" 1 
ATOM   4992 C  "C3'" . C   F 2 19 ? 34.585  -24.742 -21.158  1.00 56.28  ? 122 C   F "C3'" 1 
ATOM   4993 O  "O3'" . C   F 2 19 ? 34.783  -25.792 -22.082  1.00 53.49  ? 122 C   F "O3'" 1 
ATOM   4994 C  "C2'" . C   F 2 19 ? 34.506  -25.206 -19.713  1.00 58.48  ? 122 C   F "C2'" 1 
ATOM   4995 O  "O2'" . C   F 2 19 ? 35.461  -26.209 -19.429  1.00 49.12  ? 122 C   F "O2'" 1 
ATOM   4996 C  "C1'" . C   F 2 19 ? 34.817  -23.899 -18.965  1.00 61.84  ? 122 C   F "C1'" 1 
ATOM   4997 N  N1    . C   F 2 19 ? 33.600  -23.142 -18.608  1.00 59.58  ? 122 C   F N1    1 
ATOM   4998 C  C2    . C   F 2 19 ? 32.954  -23.412 -17.394  1.00 53.03  ? 122 C   F C2    1 
ATOM   4999 O  O2    . C   F 2 19 ? 33.430  -24.260 -16.637  1.00 47.46  ? 122 C   F O2    1 
ATOM   5000 N  N3    . C   F 2 19 ? 31.826  -22.740 -17.083  1.00 53.34  ? 122 C   F N3    1 
ATOM   5001 C  C4    . C   F 2 19 ? 31.341  -21.827 -17.928  1.00 57.93  ? 122 C   F C4    1 
ATOM   5002 N  N4    . C   F 2 19 ? 30.222  -21.188 -17.587  1.00 61.60  ? 122 C   F N4    1 
ATOM   5003 C  C5    . C   F 2 19 ? 31.980  -21.527 -19.164  1.00 56.39  ? 122 C   F C5    1 
ATOM   5004 C  C6    . C   F 2 19 ? 33.097  -22.197 -19.459  1.00 59.44  ? 122 C   F C6    1 
ATOM   5005 P  P     . A   F 2 20 ? 33.519  -26.373 -22.883  1.00 57.58  ? 123 A   F P     1 
ATOM   5006 O  OP1   . A   F 2 20 ? 33.978  -27.188 -24.040  1.00 59.00  ? 123 A   F OP1   1 
ATOM   5007 O  OP2   . A   F 2 20 ? 32.611  -25.216 -23.112  1.00 44.47  ? 123 A   F OP2   1 
ATOM   5008 O  "O5'" . A   F 2 20 ? 32.859  -27.368 -21.829  1.00 50.41  ? 123 A   F "O5'" 1 
ATOM   5009 C  "C5'" . A   F 2 20 ? 33.653  -28.346 -21.163  1.00 37.86  ? 123 A   F "C5'" 1 
ATOM   5010 C  "C4'" . A   F 2 20 ? 32.981  -28.778 -19.886  1.00 35.47  ? 123 A   F "C4'" 1 
ATOM   5011 O  "O4'" . A   F 2 20 ? 32.958  -27.673 -18.942  1.00 38.44  ? 123 A   F "O4'" 1 
ATOM   5012 C  "C3'" . A   F 2 20 ? 31.520  -29.143 -20.033  1.00 35.51  ? 123 A   F "C3'" 1 
ATOM   5013 O  "O3'" . A   F 2 20 ? 31.349  -30.459 -20.534  1.00 37.15  ? 123 A   F "O3'" 1 
ATOM   5014 C  "C2'" . A   F 2 20 ? 31.006  -28.988 -18.610  1.00 37.46  ? 123 A   F "C2'" 1 
ATOM   5015 O  "O2'" . A   F 2 20 ? 31.284  -30.111 -17.797  1.00 34.40  ? 123 A   F "O2'" 1 
ATOM   5016 C  "C1'" . A   F 2 20 ? 31.783  -27.751 -18.143  1.00 40.50  ? 123 A   F "C1'" 1 
ATOM   5017 N  N9    . A   F 2 20 ? 31.010  -26.518 -18.327  1.00 43.28  ? 123 A   F N9    1 
ATOM   5018 C  C8    . A   F 2 20 ? 31.350  -25.395 -19.038  1.00 39.01  ? 123 A   F C8    1 
ATOM   5019 N  N7    . A   F 2 20 ? 30.412  -24.480 -19.065  1.00 39.36  ? 123 A   F N7    1 
ATOM   5020 C  C5    . A   F 2 20 ? 29.386  -25.033 -18.309  1.00 45.22  ? 123 A   F C5    1 
ATOM   5021 C  C6    . A   F 2 20 ? 28.093  -24.569 -17.965  1.00 46.07  ? 123 A   F C6    1 
ATOM   5022 N  N6    . A   F 2 20 ? 27.590  -23.394 -18.353  1.00 43.65  ? 123 A   F N6    1 
ATOM   5023 N  N1    . A   F 2 20 ? 27.325  -25.371 -17.200  1.00 46.26  ? 123 A   F N1    1 
ATOM   5024 C  C2    . A   F 2 20 ? 27.820  -26.552 -16.812  1.00 45.83  ? 123 A   F C2    1 
ATOM   5025 N  N3    . A   F 2 20 ? 29.006  -27.098 -17.071  1.00 43.37  ? 123 A   F N3    1 
ATOM   5026 C  C4    . A   F 2 20 ? 29.749  -26.280 -17.834  1.00 43.20  ? 123 A   F C4    1 
ATOM   5027 P  P     . U   F 2 21 ? 30.160  -30.756 -21.572  1.00 37.93  ? 124 U   F P     1 
ATOM   5028 O  OP1   . U   F 2 21 ? 30.271  -32.157 -22.056  1.00 34.32  ? 124 U   F OP1   1 
ATOM   5029 O  OP2   . U   F 2 21 ? 30.159  -29.634 -22.550  1.00 29.01  ? 124 U   F OP2   1 
ATOM   5030 O  "O5'" . U   F 2 21 ? 28.850  -30.646 -20.673  1.00 37.44  ? 124 U   F "O5'" 1 
ATOM   5031 C  "C5'" . U   F 2 21 ? 28.651  -31.542 -19.594  1.00 37.97  ? 124 U   F "C5'" 1 
ATOM   5032 C  "C4'" . U   F 2 21 ? 27.403  -31.188 -18.831  1.00 38.36  ? 124 U   F "C4'" 1 
ATOM   5033 O  "O4'" . U   F 2 21 ? 27.509  -29.827 -18.344  1.00 34.11  ? 124 U   F "O4'" 1 
ATOM   5034 C  "C3'" . U   F 2 21 ? 26.086  -31.182 -19.591  1.00 38.44  ? 124 U   F "C3'" 1 
ATOM   5035 O  "O3'" . U   F 2 21 ? 25.563  -32.505 -19.740  1.00 37.22  ? 124 U   F "O3'" 1 
ATOM   5036 C  "C2'" . U   F 2 21 ? 25.218  -30.358 -18.650  1.00 39.27  ? 124 U   F "C2'" 1 
ATOM   5037 O  "O2'" . U   F 2 21 ? 24.812  -31.113 -17.531  1.00 33.64  ? 124 U   F "O2'" 1 
ATOM   5038 C  "C1'" . U   F 2 21 ? 26.209  -29.291 -18.178  1.00 41.36  ? 124 U   F "C1'" 1 
ATOM   5039 N  N1    . U   F 2 21 ? 26.107  -28.042 -18.945  1.00 51.45  ? 124 U   F N1    1 
ATOM   5040 C  C2    . U   F 2 21 ? 25.001  -27.249 -18.719  1.00 55.43  ? 124 U   F C2    1 
ATOM   5041 O  O2    . U   F 2 21 ? 24.135  -27.541 -17.909  1.00 54.75  ? 124 U   F O2    1 
ATOM   5042 N  N3    . U   F 2 21 ? 24.943  -26.104 -19.477  1.00 56.79  ? 124 U   F N3    1 
ATOM   5043 C  C4    . U   F 2 21 ? 25.859  -25.680 -20.414  1.00 56.38  ? 124 U   F C4    1 
ATOM   5044 O  O4    . U   F 2 21 ? 25.658  -24.631 -21.031  1.00 61.45  ? 124 U   F O4    1 
ATOM   5045 C  C5    . U   F 2 21 ? 26.978  -26.550 -20.582  1.00 57.13  ? 124 U   F C5    1 
ATOM   5046 C  C6    . U   F 2 21 ? 27.063  -27.674 -19.859  1.00 53.73  ? 124 U   F C6    1 
ATOM   5047 P  P     . U   F 2 22 ? 24.526  -32.830 -20.932  1.00 38.74  ? 125 U   F P     1 
ATOM   5048 O  OP1   . U   F 2 22 ? 24.400  -34.305 -21.075  1.00 37.11  ? 125 U   F OP1   1 
ATOM   5049 O  OP2   . U   F 2 22 ? 24.933  -32.018 -22.100  1.00 40.38  ? 125 U   F OP2   1 
ATOM   5050 O  "O5'" . U   F 2 22 ? 23.132  -32.244 -20.425  1.00 34.50  ? 125 U   F "O5'" 1 
ATOM   5051 C  "C5'" . U   F 2 22 ? 22.133  -33.081 -19.846  1.00 30.65  ? 125 U   F "C5'" 1 
ATOM   5052 C  "C4'" . U   F 2 22 ? 20.774  -32.623 -20.301  1.00 33.67  ? 125 U   F "C4'" 1 
ATOM   5053 O  "O4'" . U   F 2 22 ? 20.897  -31.216 -20.568  1.00 37.67  ? 125 U   F "O4'" 1 
ATOM   5054 C  "C3'" . U   F 2 22 ? 20.268  -33.234 -21.607  1.00 36.12  ? 125 U   F "C3'" 1 
ATOM   5055 O  "O3'" . U   F 2 22 ? 19.306  -34.277 -21.346  1.00 35.52  ? 125 U   F "O3'" 1 
ATOM   5056 C  "C2'" . U   F 2 22 ? 19.479  -32.100 -22.282  1.00 40.43  ? 125 U   F "C2'" 1 
ATOM   5057 O  "O2'" . U   F 2 22 ? 18.080  -32.227 -22.123  1.00 53.48  ? 125 U   F "O2'" 1 
ATOM   5058 C  "C1'" . U   F 2 22 ? 19.937  -30.855 -21.522  1.00 39.62  ? 125 U   F "C1'" 1 
ATOM   5059 N  N1    . U   F 2 22 ? 20.379  -29.656 -22.245  1.00 36.52  ? 125 U   F N1    1 
ATOM   5060 C  C2    . U   F 2 22 ? 19.440  -28.992 -22.999  1.00 34.91  ? 125 U   F C2    1 
ATOM   5061 O  O2    . U   F 2 22 ? 18.308  -29.412 -23.152  1.00 32.37  ? 125 U   F O2    1 
ATOM   5062 N  N3    . U   F 2 22 ? 19.873  -27.815 -23.563  1.00 37.58  ? 125 U   F N3    1 
ATOM   5063 C  C4    . U   F 2 22 ? 21.129  -27.254 -23.454  1.00 40.59  ? 125 U   F C4    1 
ATOM   5064 O  O4    . U   F 2 22 ? 21.360  -26.162 -23.983  1.00 40.16  ? 125 U   F O4    1 
ATOM   5065 C  C5    . U   F 2 22 ? 22.055  -28.025 -22.686  1.00 43.84  ? 125 U   F C5    1 
ATOM   5066 C  C6    . U   F 2 22 ? 21.659  -29.177 -22.129  1.00 42.26  ? 125 U   F C6    1 
ATOM   5067 P  P     . G   F 2 23 ? 19.663  -35.519 -20.374  1.00 36.56  ? 126 G   F P     1 
ATOM   5068 O  OP1   . G   F 2 23 ? 21.070  -35.936 -20.629  1.00 35.87  ? 126 G   F OP1   1 
ATOM   5069 O  OP2   . G   F 2 23 ? 18.561  -36.503 -20.516  1.00 22.49  ? 126 G   F OP2   1 
ATOM   5070 O  "O5'" . G   F 2 23 ? 19.549  -34.947 -18.888  1.00 36.54  ? 126 G   F "O5'" 1 
ATOM   5071 C  "C5'" . G   F 2 23 ? 20.156  -35.624 -17.785  1.00 32.42  ? 126 G   F "C5'" 1 
ATOM   5072 C  "C4'" . G   F 2 23 ? 20.136  -34.745 -16.556  1.00 39.16  ? 126 G   F "C4'" 1 
ATOM   5073 O  "O4'" . G   F 2 23 ? 20.539  -33.408 -16.949  1.00 46.48  ? 126 G   F "O4'" 1 
ATOM   5074 C  "C3'" . G   F 2 23 ? 18.786  -34.576 -15.871  1.00 41.06  ? 126 G   F "C3'" 1 
ATOM   5075 O  "O3'" . G   F 2 23 ? 18.679  -35.557 -14.842  1.00 39.03  ? 126 G   F "O3'" 1 
ATOM   5076 C  "C2'" . G   F 2 23 ? 18.907  -33.192 -15.235  1.00 45.92  ? 126 G   F "C2'" 1 
ATOM   5077 O  "O2'" . G   F 2 23 ? 19.584  -33.223 -13.999  1.00 51.21  ? 126 G   F "O2'" 1 
ATOM   5078 C  "C1'" . G   F 2 23 ? 19.774  -32.444 -16.250  1.00 46.86  ? 126 G   F "C1'" 1 
ATOM   5079 N  N9    . G   F 2 23 ? 18.999  -31.683 -17.225  1.00 49.38  ? 126 G   F N9    1 
ATOM   5080 C  C8    . G   F 2 23 ? 17.762  -32.008 -17.724  1.00 50.77  ? 126 G   F C8    1 
ATOM   5081 N  N7    . G   F 2 23 ? 17.307  -31.130 -18.576  1.00 53.64  ? 126 G   F N7    1 
ATOM   5082 C  C5    . G   F 2 23 ? 18.303  -30.167 -18.645  1.00 48.02  ? 126 G   F C5    1 
ATOM   5083 C  C6    . G   F 2 23 ? 18.366  -28.979 -19.400  1.00 47.21  ? 126 G   F C6    1 
ATOM   5084 O  O6    . G   F 2 23 ? 17.530  -28.522 -20.185  1.00 53.38  ? 126 G   F O6    1 
ATOM   5085 N  N1    . G   F 2 23 ? 19.553  -28.295 -19.175  1.00 42.56  ? 126 G   F N1    1 
ATOM   5086 C  C2    . G   F 2 23 ? 20.551  -28.706 -18.335  1.00 40.37  ? 126 G   F C2    1 
ATOM   5087 N  N2    . G   F 2 23 ? 21.621  -27.908 -18.262  1.00 37.43  ? 126 G   F N2    1 
ATOM   5088 N  N3    . G   F 2 23 ? 20.504  -29.816 -17.620  1.00 42.93  ? 126 G   F N3    1 
ATOM   5089 C  C4    . G   F 2 23 ? 19.357  -30.493 -17.822  1.00 46.45  ? 126 G   F C4    1 
ATOM   5090 P  P     . C   F 2 24 ? 17.345  -36.441 -14.689  1.00 45.01  ? 127 C   F P     1 
ATOM   5091 O  OP1   . C   F 2 24 ? 17.552  -37.319 -13.514  1.00 43.80  ? 127 C   F OP1   1 
ATOM   5092 O  OP2   . C   F 2 24 ? 17.039  -37.048 -16.008  1.00 42.20  ? 127 C   F OP2   1 
ATOM   5093 O  "O5'" . C   F 2 24 ? 16.189  -35.408 -14.307  1.00 44.20  ? 127 C   F "O5'" 1 
ATOM   5094 C  "C5'" . C   F 2 24 ? 16.420  -34.352 -13.378  1.00 39.54  ? 127 C   F "C5'" 1 
ATOM   5095 C  "C4'" . C   F 2 24 ? 15.461  -34.437 -12.206  1.00 42.05  ? 127 C   F "C4'" 1 
ATOM   5096 O  "O4'" . C   F 2 24 ? 14.101  -34.166 -12.658  1.00 46.76  ? 127 C   F "O4'" 1 
ATOM   5097 C  "C3'" . C   F 2 24 ? 15.413  -35.839 -11.604  1.00 47.03  ? 127 C   F "C3'" 1 
ATOM   5098 O  "O3'" . C   F 2 24 ? 15.963  -36.039 -10.286  1.00 50.35  ? 127 C   F "O3'" 1 
ATOM   5099 C  "C2'" . C   F 2 24 ? 14.176  -36.530 -12.186  1.00 47.41  ? 127 C   F "C2'" 1 
ATOM   5100 O  "O2'" . C   F 2 24 ? 13.459  -37.377 -11.313  1.00 48.40  ? 127 C   F "O2'" 1 
ATOM   5101 C  "C1'" . C   F 2 24 ? 13.297  -35.330 -12.542  1.00 47.17  ? 127 C   F "C1'" 1 
ATOM   5102 N  N1    . C   F 2 24 ? 12.391  -35.468 -13.700  1.00 46.58  ? 127 C   F N1    1 
ATOM   5103 C  C2    . C   F 2 24 ? 11.010  -35.470 -13.456  1.00 42.00  ? 127 C   F C2    1 
ATOM   5104 O  O2    . C   F 2 24 ? 10.612  -35.309 -12.302  1.00 43.71  ? 127 C   F O2    1 
ATOM   5105 N  N3    . C   F 2 24 ? 10.149  -35.645 -14.481  1.00 38.68  ? 127 C   F N3    1 
ATOM   5106 C  C4    . C   F 2 24 ? 10.614  -35.810 -15.717  1.00 42.11  ? 127 C   F C4    1 
ATOM   5107 N  N4    . C   F 2 24 ? 9.723   -35.996 -16.692  1.00 35.18  ? 127 C   F N4    1 
ATOM   5108 C  C5    . C   F 2 24 ? 12.016  -35.795 -16.006  1.00 46.50  ? 127 C   F C5    1 
ATOM   5109 C  C6    . C   F 2 24 ? 12.863  -35.619 -14.975  1.00 47.93  ? 127 C   F C6    1 
ATOM   5110 P  P     . A   F 2 25 ? 15.012  -36.447 -9.035   1.00 50.43  ? 128 A   F P     1 
ATOM   5111 O  OP1   . A   F 2 25 ? 15.564  -37.686 -8.438   1.00 58.26  ? 128 A   F OP1   1 
ATOM   5112 O  OP2   . A   F 2 25 ? 13.578  -36.400 -9.403   1.00 49.64  ? 128 A   F OP2   1 
ATOM   5113 O  "O5'" . A   F 2 25 ? 15.235  -35.269 -7.984   1.00 44.91  ? 128 A   F "O5'" 1 
ATOM   5114 C  "C5'" . A   F 2 25 ? 16.116  -34.191 -8.272   1.00 32.48  ? 128 A   F "C5'" 1 
ATOM   5115 C  "C4'" . A   F 2 25 ? 15.443  -32.874 -7.976   1.00 33.55  ? 128 A   F "C4'" 1 
ATOM   5116 O  "O4'" . A   F 2 25 ? 14.351  -32.647 -8.898   1.00 34.88  ? 128 A   F "O4'" 1 
ATOM   5117 C  "C3'" . A   F 2 25 ? 14.761  -32.771 -6.631   1.00 37.65  ? 128 A   F "C3'" 1 
ATOM   5118 O  "O3'" . A   F 2 25 ? 15.701  -32.524 -5.606   1.00 52.13  ? 128 A   F "O3'" 1 
ATOM   5119 C  "C2'" . A   F 2 25 ? 13.829  -31.588 -6.847   1.00 31.96  ? 128 A   F "C2'" 1 
ATOM   5120 O  "O2'" . A   F 2 25 ? 14.499  -30.343 -6.812   1.00 24.53  ? 128 A   F "O2'" 1 
ATOM   5121 C  "C1'" . A   F 2 25 ? 13.357  -31.850 -8.271   1.00 33.57  ? 128 A   F "C1'" 1 
ATOM   5122 N  N9    . A   F 2 25 ? 12.083  -32.561 -8.335   1.00 40.14  ? 128 A   F N9    1 
ATOM   5123 C  C8    . A   F 2 25 ? 11.867  -33.889 -8.612   1.00 43.69  ? 128 A   F C8    1 
ATOM   5124 N  N7    . A   F 2 25 ? 10.599  -34.227 -8.636   1.00 40.11  ? 128 A   F N7    1 
ATOM   5125 C  C5    . A   F 2 25 ? 9.934   -33.043 -8.348   1.00 40.96  ? 128 A   F C5    1 
ATOM   5126 C  C6    . A   F 2 25 ? 8.568   -32.731 -8.232   1.00 37.38  ? 128 A   F C6    1 
ATOM   5127 N  N6    . A   F 2 25 ? 7.592   -33.620 -8.408   1.00 35.99  ? 128 A   F N6    1 
ATOM   5128 N  N1    . A   F 2 25 ? 8.239   -31.460 -7.928   1.00 30.24  ? 128 A   F N1    1 
ATOM   5129 C  C2    . A   F 2 25 ? 9.225   -30.567 -7.757   1.00 35.59  ? 128 A   F C2    1 
ATOM   5130 N  N3    . A   F 2 25 ? 10.546  -30.735 -7.845   1.00 33.25  ? 128 A   F N3    1 
ATOM   5131 C  C4    . A   F 2 25 ? 10.838  -32.011 -8.148   1.00 41.33  ? 128 A   F C4    1 
ATOM   5132 P  P     . C   F 2 26 ? 15.436  -33.121 -4.147   1.00 58.00  ? 129 C   F P     1 
ATOM   5133 O  OP1   . C   F 2 26 ? 16.613  -32.799 -3.301   1.00 51.50  ? 129 C   F OP1   1 
ATOM   5134 O  OP2   . C   F 2 26 ? 15.017  -34.541 -4.339   1.00 47.99  ? 129 C   F OP2   1 
ATOM   5135 O  "O5'" . C   F 2 26 ? 14.193  -32.275 -3.624   1.00 51.19  ? 129 C   F "O5'" 1 
ATOM   5136 C  "C5'" . C   F 2 26 ? 14.282  -30.859 -3.514   1.00 49.70  ? 129 C   F "C5'" 1 
ATOM   5137 C  "C4'" . C   F 2 26 ? 12.967  -30.289 -3.039   1.00 52.85  ? 129 C   F "C4'" 1 
ATOM   5138 O  "O4'" . C   F 2 26 ? 11.960  -30.403 -4.074   1.00 53.12  ? 129 C   F "O4'" 1 
ATOM   5139 C  "C3'" . C   F 2 26 ? 12.355  -30.997 -1.850   1.00 53.69  ? 129 C   F "C3'" 1 
ATOM   5140 O  "O3'" . C   F 2 26 ? 12.936  -30.506 -0.654   1.00 61.73  ? 129 C   F "O3'" 1 
ATOM   5141 C  "C2'" . C   F 2 26 ? 10.882  -30.626 -1.967   1.00 50.57  ? 129 C   F "C2'" 1 
ATOM   5142 O  "O2'" . C   F 2 26 ? 10.597  -29.346 -1.444   1.00 46.84  ? 129 C   F "O2'" 1 
ATOM   5143 C  "C1'" . C   F 2 26 ? 10.688  -30.607 -3.485   1.00 43.77  ? 129 C   F "C1'" 1 
ATOM   5144 N  N1    . C   F 2 26 ? 10.125  -31.842 -4.047   1.00 36.99  ? 129 C   F N1    1 
ATOM   5145 C  C2    . C   F 2 26 ? 8.761   -31.882 -4.354   1.00 36.77  ? 129 C   F C2    1 
ATOM   5146 O  O2    . C   F 2 26 ? 8.054   -30.896 -4.091   1.00 38.64  ? 129 C   F O2    1 
ATOM   5147 N  N3    . C   F 2 26 ? 8.247   -32.988 -4.927   1.00 30.52  ? 129 C   F N3    1 
ATOM   5148 C  C4    . C   F 2 26 ? 9.036   -34.025 -5.189   1.00 25.86  ? 129 C   F C4    1 
ATOM   5149 N  N4    . C   F 2 26 ? 8.487   -35.082 -5.776   1.00 33.09  ? 129 C   F N4    1 
ATOM   5150 C  C5    . C   F 2 26 ? 10.421  -34.023 -4.865   1.00 24.90  ? 129 C   F C5    1 
ATOM   5151 C  C6    . C   F 2 26 ? 10.919  -32.924 -4.293   1.00 27.12  ? 129 C   F C6    1 
ATOM   5152 P  P     . U   F 2 27 ? 12.729  -31.312 0.710    1.00 66.60  ? 130 U   F P     1 
ATOM   5153 O  OP1   . U   F 2 27 ? 12.276  -32.689 0.381    1.00 69.73  ? 130 U   F OP1   1 
ATOM   5154 O  OP2   . U   F 2 27 ? 11.872  -30.436 1.550    1.00 65.64  ? 130 U   F OP2   1 
ATOM   5155 O  "O5'" . U   F 2 27 ? 14.187  -31.400 1.349    1.00 69.60  ? 130 U   F "O5'" 1 
ATOM   5156 C  "C5'" . U   F 2 27 ? 15.341  -31.595 0.535    1.00 76.02  ? 130 U   F "C5'" 1 
ATOM   5157 C  "C4'" . U   F 2 27 ? 15.963  -32.946 0.817    1.00 81.86  ? 130 U   F "C4'" 1 
ATOM   5158 O  "O4'" . U   F 2 27 ? 15.030  -33.982 0.411    1.00 80.21  ? 130 U   F "O4'" 1 
ATOM   5159 C  "C3'" . U   F 2 27 ? 17.233  -33.242 0.032    1.00 85.24  ? 130 U   F "C3'" 1 
ATOM   5160 O  "O3'" . U   F 2 27 ? 18.385  -32.763 0.728    1.00 95.38  ? 130 U   F "O3'" 1 
ATOM   5161 C  "C2'" . U   F 2 27 ? 17.228  -34.766 -0.022   1.00 83.92  ? 130 U   F "C2'" 1 
ATOM   5162 O  "O2'" . U   F 2 27 ? 17.696  -35.359 1.170    1.00 82.82  ? 130 U   F "O2'" 1 
ATOM   5163 C  "C1'" . U   F 2 27 ? 15.736  -35.063 -0.171   1.00 81.77  ? 130 U   F "C1'" 1 
ATOM   5164 P  P     . C   F 2 28 ? 18.675  -31.179 0.811    1.00 102.05 ? 131 C   F P     1 
ATOM   5165 O  OP1   . C   F 2 28 ? 18.399  -30.742 2.209    1.00 99.60  ? 131 C   F OP1   1 
ATOM   5166 O  OP2   . C   F 2 28 ? 17.955  -30.528 -0.317   1.00 107.26 ? 131 C   F OP2   1 
ATOM   5167 O  "O5'" . C   F 2 28 ? 20.243  -31.029 0.556    1.00 97.97  ? 131 C   F "O5'" 1 
ATOM   5168 C  "C5'" . C   F 2 28 ? 20.753  -30.323 -0.583   1.00 93.71  ? 131 C   F "C5'" 1 
ATOM   5169 C  "C4'" . C   F 2 28 ? 20.483  -28.836 -0.452   1.00 91.53  ? 131 C   F "C4'" 1 
ATOM   5170 O  "O4'" . C   F 2 28 ? 20.740  -28.405 0.910    1.00 94.27  ? 131 C   F "O4'" 1 
ATOM   5171 C  "C3'" . C   F 2 28 ? 21.347  -27.907 -1.296   1.00 87.60  ? 131 C   F "C3'" 1 
ATOM   5172 O  "O3'" . C   F 2 28 ? 20.858  -27.778 -2.621   1.00 78.52  ? 131 C   F "O3'" 1 
ATOM   5173 C  "C2'" . C   F 2 28 ? 21.207  -26.585 -0.553   1.00 87.84  ? 131 C   F "C2'" 1 
ATOM   5174 O  "O2'" . C   F 2 28 ? 19.995  -25.919 -0.863   1.00 80.26  ? 131 C   F "O2'" 1 
ATOM   5175 C  "C1'" . C   F 2 28 ? 21.194  -27.060 0.903    1.00 92.12  ? 131 C   F "C1'" 1 
ATOM   5176 P  P     . C   F 2 29 ? 21.855  -27.982 -3.866   1.00 70.83  ? 132 C   F P     1 
ATOM   5177 O  OP1   . C   F 2 29 ? 21.219  -27.276 -5.010   1.00 70.31  ? 132 C   F OP1   1 
ATOM   5178 O  OP2   . C   F 2 29 ? 22.153  -29.435 -3.964   1.00 65.50  ? 132 C   F OP2   1 
ATOM   5179 O  "O5'" . C   F 2 29 ? 23.201  -27.209 -3.483   1.00 60.22  ? 132 C   F "O5'" 1 
ATOM   5180 C  "C5'" . C   F 2 29 ? 23.430  -25.880 -3.952   1.00 53.07  ? 132 C   F "C5'" 1 
ATOM   5181 C  "C4'" . C   F 2 29 ? 24.915  -25.562 -4.029   1.00 45.83  ? 132 C   F "C4'" 1 
ATOM   5182 O  "O4'" . C   F 2 29 ? 25.516  -25.702 -2.719   1.00 48.06  ? 132 C   F "O4'" 1 
ATOM   5183 C  "C3'" . C   F 2 29 ? 25.832  -26.396 -4.912   1.00 43.20  ? 132 C   F "C3'" 1 
ATOM   5184 O  "O3'" . C   F 2 29 ? 25.760  -25.989 -6.276   1.00 50.35  ? 132 C   F "O3'" 1 
ATOM   5185 C  "C2'" . C   F 2 29 ? 27.190  -25.997 -4.354   1.00 40.09  ? 132 C   F "C2'" 1 
ATOM   5186 O  "O2'" . C   F 2 29 ? 27.516  -24.681 -4.737   1.00 42.49  ? 132 C   F "O2'" 1 
ATOM   5187 C  "C1'" . C   F 2 29 ? 26.902  -25.963 -2.858   1.00 43.98  ? 132 C   F "C1'" 1 
ATOM   5188 N  N1    . C   F 2 29 ? 27.222  -27.228 -2.176   1.00 48.73  ? 132 C   F N1    1 
ATOM   5189 C  C2    . C   F 2 29 ? 28.546  -27.472 -1.798   1.00 49.80  ? 132 C   F C2    1 
ATOM   5190 O  O2    . C   F 2 29 ? 29.410  -26.619 -2.052   1.00 54.67  ? 132 C   F O2    1 
ATOM   5191 N  N3    . C   F 2 29 ? 28.850  -28.630 -1.163   1.00 52.14  ? 132 C   F N3    1 
ATOM   5192 C  C4    . C   F 2 29 ? 27.887  -29.521 -0.906   1.00 55.28  ? 132 C   F C4    1 
ATOM   5193 N  N4    . C   F 2 29 ? 28.224  -30.647 -0.270   1.00 58.72  ? 132 C   F N4    1 
ATOM   5194 C  C5    . C   F 2 29 ? 26.534  -29.299 -1.285   1.00 53.18  ? 132 C   F C5    1 
ATOM   5195 C  C6    . C   F 2 29 ? 26.248  -28.150 -1.913   1.00 52.30  ? 132 C   F C6    1 
ATOM   5196 P  P     . G   F 2 30 ? 26.221  -26.996 -7.450   1.00 50.83  ? 133 G   F P     1 
ATOM   5197 O  OP1   . G   F 2 30 ? 26.205  -26.235 -8.724   1.00 51.38  ? 133 G   F OP1   1 
ATOM   5198 O  OP2   . G   F 2 30 ? 25.445  -28.255 -7.331   1.00 48.11  ? 133 G   F OP2   1 
ATOM   5199 O  "O5'" . G   F 2 30 ? 27.739  -27.342 -7.135   1.00 49.64  ? 133 G   F "O5'" 1 
ATOM   5200 C  "C5'" . G   F 2 30 ? 28.792  -26.545 -7.660   1.00 54.41  ? 133 G   F "C5'" 1 
ATOM   5201 C  "C4'" . G   F 2 30 ? 29.832  -27.422 -8.319   1.00 60.11  ? 133 G   F "C4'" 1 
ATOM   5202 O  "O4'" . G   F 2 30 ? 29.276  -28.020 -9.525   1.00 59.30  ? 133 G   F "O4'" 1 
ATOM   5203 C  "C3'" . G   F 2 30 ? 31.068  -26.672 -8.785   1.00 62.08  ? 133 G   F "C3'" 1 
ATOM   5204 O  "O3'" . G   F 2 30 ? 32.024  -26.598 -7.731   1.00 61.84  ? 133 G   F "O3'" 1 
ATOM   5205 C  "C2'" . G   F 2 30 ? 31.550  -27.539 -9.936   1.00 64.05  ? 133 G   F "C2'" 1 
ATOM   5206 O  "O2'" . G   F 2 30 ? 32.234  -28.683 -9.472   1.00 68.97  ? 133 G   F "O2'" 1 
ATOM   5207 C  "C1'" . G   F 2 30 ? 30.220  -27.940 -10.583  1.00 63.10  ? 133 G   F "C1'" 1 
ATOM   5208 N  N9    . G   F 2 30 ? 29.729  -26.944 -11.534  1.00 60.84  ? 133 G   F N9    1 
ATOM   5209 C  C8    . G   F 2 30 ? 28.468  -26.404 -11.571  1.00 61.39  ? 133 G   F C8    1 
ATOM   5210 N  N7    . G   F 2 30 ? 28.330  -25.480 -12.481  1.00 63.92  ? 133 G   F N7    1 
ATOM   5211 C  C5    . G   F 2 30 ? 29.571  -25.415 -13.098  1.00 64.57  ? 133 G   F C5    1 
ATOM   5212 C  C6    . G   F 2 30 ? 30.030  -24.585 -14.163  1.00 66.80  ? 133 G   F C6    1 
ATOM   5213 O  O6    . G   F 2 30 ? 29.411  -23.709 -14.787  1.00 60.15  ? 133 G   F O6    1 
ATOM   5214 N  N1    . G   F 2 30 ? 31.356  -24.856 -14.482  1.00 71.37  ? 133 G   F N1    1 
ATOM   5215 C  C2    . G   F 2 30 ? 32.143  -25.799 -13.861  1.00 72.30  ? 133 G   F C2    1 
ATOM   5216 N  N2    . G   F 2 30 ? 33.402  -25.911 -14.318  1.00 74.19  ? 133 G   F N2    1 
ATOM   5217 N  N3    . G   F 2 30 ? 31.728  -26.573 -12.867  1.00 67.33  ? 133 G   F N3    1 
ATOM   5218 C  C4    . G   F 2 30 ? 30.442  -26.328 -12.539  1.00 63.32  ? 133 G   F C4    1 
ATOM   5219 P  P     . G   F 2 31 ? 32.865  -25.250 -7.518   1.00 61.46  ? 134 G   F P     1 
ATOM   5220 O  OP1   . G   F 2 31 ? 33.532  -25.295 -6.198   1.00 66.28  ? 134 G   F OP1   1 
ATOM   5221 O  OP2   . G   F 2 31 ? 31.967  -24.122 -7.846   1.00 61.62  ? 134 G   F OP2   1 
ATOM   5222 O  "O5'" . G   F 2 31 ? 33.985  -25.329 -8.640   1.00 62.70  ? 134 G   F "O5'" 1 
ATOM   5223 C  "C5'" . G   F 2 31 ? 34.919  -26.397 -8.654   1.00 57.35  ? 134 G   F "C5'" 1 
ATOM   5224 C  "C4'" . G   F 2 31 ? 35.926  -26.178 -9.748   1.00 58.20  ? 134 G   F "C4'" 1 
ATOM   5225 O  "O4'" . G   F 2 31 ? 35.279  -26.348 -11.039  1.00 52.90  ? 134 G   F "O4'" 1 
ATOM   5226 C  "C3'" . G   F 2 31 ? 36.505  -24.771 -9.813   1.00 59.71  ? 134 G   F "C3'" 1 
ATOM   5227 O  "O3'" . G   F 2 31 ? 37.577  -24.568 -8.894   1.00 65.29  ? 134 G   F "O3'" 1 
ATOM   5228 C  "C2'" . G   F 2 31 ? 36.967  -24.710 -11.259  1.00 55.17  ? 134 G   F "C2'" 1 
ATOM   5229 O  "O2'" . G   F 2 31 ? 38.139  -25.469 -11.469  1.00 53.82  ? 134 G   F "O2'" 1 
ATOM   5230 C  "C1'" . G   F 2 31 ? 35.791  -25.389 -11.957  1.00 53.86  ? 134 G   F "C1'" 1 
ATOM   5231 N  N9    . G   F 2 31 ? 34.734  -24.427 -12.245  1.00 49.45  ? 134 G   F N9    1 
ATOM   5232 C  C8    . G   F 2 31 ? 33.609  -24.199 -11.496  1.00 50.85  ? 134 G   F C8    1 
ATOM   5233 N  N7    . G   F 2 31 ? 32.844  -23.267 -11.991  1.00 53.58  ? 134 G   F N7    1 
ATOM   5234 C  C5    . G   F 2 31 ? 33.504  -22.854 -13.139  1.00 52.87  ? 134 G   F C5    1 
ATOM   5235 C  C6    . G   F 2 31 ? 33.156  -21.862 -14.089  1.00 54.40  ? 134 G   F C6    1 
ATOM   5236 O  O6    . G   F 2 31 ? 32.162  -21.131 -14.105  1.00 60.11  ? 134 G   F O6    1 
ATOM   5237 N  N1    . G   F 2 31 ? 34.106  -21.759 -15.096  1.00 51.58  ? 134 G   F N1    1 
ATOM   5238 C  C2    . G   F 2 31 ? 35.247  -22.513 -15.181  1.00 56.71  ? 134 G   F C2    1 
ATOM   5239 N  N2    . G   F 2 31 ? 36.046  -22.257 -16.233  1.00 54.36  ? 134 G   F N2    1 
ATOM   5240 N  N3    . G   F 2 31 ? 35.582  -23.448 -14.301  1.00 56.48  ? 134 G   F N3    1 
ATOM   5241 C  C4    . G   F 2 31 ? 34.671  -23.562 -13.312  1.00 50.73  ? 134 G   F C4    1 
ATOM   5242 P  P     . A   F 2 32 ? 37.993  -23.069 -8.476   1.00 64.33  ? 135 A   F P     1 
ATOM   5243 O  OP1   . A   F 2 32 ? 39.164  -23.120 -7.565   1.00 64.07  ? 135 A   F OP1   1 
ATOM   5244 O  OP2   . A   F 2 32 ? 36.751  -22.378 -8.045   1.00 64.95  ? 135 A   F OP2   1 
ATOM   5245 O  "O5'" . A   F 2 32 ? 38.486  -22.413 -9.839   1.00 63.27  ? 135 A   F "O5'" 1 
ATOM   5246 C  "C5'" . A   F 2 32 ? 39.720  -22.806 -10.433  1.00 59.14  ? 135 A   F "C5'" 1 
ATOM   5247 C  "C4'" . A   F 2 32 ? 40.133  -21.796 -11.469  1.00 54.25  ? 135 A   F "C4'" 1 
ATOM   5248 O  "O4'" . A   F 2 32 ? 39.299  -21.918 -12.653  1.00 53.00  ? 135 A   F "O4'" 1 
ATOM   5249 C  "C3'" . A   F 2 32 ? 39.910  -20.369 -11.019  1.00 53.91  ? 135 A   F "C3'" 1 
ATOM   5250 O  "O3'" . A   F 2 32 ? 40.950  -19.909 -10.185  1.00 49.35  ? 135 A   F "O3'" 1 
ATOM   5251 C  "C2'" . A   F 2 32 ? 39.815  -19.625 -12.339  1.00 53.74  ? 135 A   F "C2'" 1 
ATOM   5252 O  "O2'" . A   F 2 32 ? 41.073  -19.374 -12.925  1.00 47.73  ? 135 A   F "O2'" 1 
ATOM   5253 C  "C1'" . A   F 2 32 ? 39.012  -20.624 -13.172  1.00 56.38  ? 135 A   F "C1'" 1 
ATOM   5254 N  N9    . A   F 2 32 ? 37.573  -20.390 -13.044  1.00 60.71  ? 135 A   F N9    1 
ATOM   5255 C  C8    . A   F 2 32 ? 36.671  -21.106 -12.297  1.00 63.98  ? 135 A   F C8    1 
ATOM   5256 N  N7    . A   F 2 32 ? 35.445  -20.649 -12.368  1.00 64.56  ? 135 A   F N7    1 
ATOM   5257 C  C5    . A   F 2 32 ? 35.545  -19.562 -13.223  1.00 62.62  ? 135 A   F C5    1 
ATOM   5258 C  C6    . A   F 2 32 ? 34.595  -18.650 -13.701  1.00 63.39  ? 135 A   F C6    1 
ATOM   5259 N  N6    . A   F 2 32 ? 33.300  -18.695 -13.383  1.00 67.89  ? 135 A   F N6    1 
ATOM   5260 N  N1    . A   F 2 32 ? 35.022  -17.676 -14.530  1.00 62.74  ? 135 A   F N1    1 
ATOM   5261 C  C2    . A   F 2 32 ? 36.317  -17.635 -14.851  1.00 59.06  ? 135 A   F C2    1 
ATOM   5262 N  N3    . A   F 2 32 ? 37.305  -18.434 -14.468  1.00 57.47  ? 135 A   F N3    1 
ATOM   5263 C  C4    . A   F 2 32 ? 36.848  -19.390 -13.645  1.00 59.91  ? 135 A   F C4    1 
ATOM   5264 P  P     . G   F 2 33 ? 40.594  -18.928 -8.977   1.00 46.54  ? 136 G   F P     1 
ATOM   5265 O  OP1   . G   F 2 33 ? 41.798  -18.707 -8.153   1.00 50.52  ? 136 G   F OP1   1 
ATOM   5266 O  OP2   . G   F 2 33 ? 39.352  -19.461 -8.354   1.00 45.80  ? 136 G   F OP2   1 
ATOM   5267 O  "O5'" . G   F 2 33 ? 40.277  -17.555 -9.700   1.00 36.06  ? 136 G   F "O5'" 1 
ATOM   5268 C  "C5'" . G   F 2 33 ? 41.218  -16.975 -10.581  1.00 34.34  ? 136 G   F "C5'" 1 
ATOM   5269 C  "C4'" . G   F 2 33 ? 40.540  -15.920 -11.397  1.00 42.21  ? 136 G   F "C4'" 1 
ATOM   5270 O  "O4'" . G   F 2 33 ? 39.581  -16.556 -12.286  1.00 47.62  ? 136 G   F "O4'" 1 
ATOM   5271 C  "C3'" . G   F 2 33 ? 39.685  -14.996 -10.553  1.00 43.31  ? 136 G   F "C3'" 1 
ATOM   5272 O  "O3'" . G   F 2 33 ? 40.448  -13.984 -9.921   1.00 43.98  ? 136 G   F "O3'" 1 
ATOM   5273 C  "C2'" . G   F 2 33 ? 38.669  -14.487 -11.564  1.00 44.91  ? 136 G   F "C2'" 1 
ATOM   5274 O  "O2'" . G   F 2 33 ? 39.144  -13.463 -12.418  1.00 33.07  ? 136 G   F "O2'" 1 
ATOM   5275 C  "C1'" . G   F 2 33 ? 38.395  -15.770 -12.354  1.00 49.94  ? 136 G   F "C1'" 1 
ATOM   5276 N  N9    . G   F 2 33 ? 37.298  -16.520 -11.744  1.00 48.86  ? 136 G   F N9    1 
ATOM   5277 C  C8    . G   F 2 33 ? 37.369  -17.702 -11.046  1.00 47.18  ? 136 G   F C8    1 
ATOM   5278 N  N7    . G   F 2 33 ? 36.216  -18.083 -10.567  1.00 47.94  ? 136 G   F N7    1 
ATOM   5279 C  C5    . G   F 2 33 ? 35.329  -17.097 -10.982  1.00 45.66  ? 136 G   F C5    1 
ATOM   5280 C  C6    . G   F 2 33 ? 33.937  -16.955 -10.755  1.00 42.97  ? 136 G   F C6    1 
ATOM   5281 O  O6    . G   F 2 33 ? 33.182  -17.691 -10.108  1.00 45.73  ? 136 G   F O6    1 
ATOM   5282 N  N1    . G   F 2 33 ? 33.435  -15.810 -11.368  1.00 37.69  ? 136 G   F N1    1 
ATOM   5283 C  C2    . G   F 2 33 ? 34.178  -14.914 -12.099  1.00 36.16  ? 136 G   F C2    1 
ATOM   5284 N  N2    . G   F 2 33 ? 33.522  -13.867 -12.621  1.00 30.32  ? 136 G   F N2    1 
ATOM   5285 N  N3    . G   F 2 33 ? 35.471  -15.033 -12.307  1.00 40.33  ? 136 G   F N3    1 
ATOM   5286 C  C4    . G   F 2 33 ? 35.979  -16.138 -11.725  1.00 44.90  ? 136 G   F C4    1 
ATOM   5287 P  P     . G   F 2 34 ? 39.965  -13.410 -8.505   1.00 47.90  ? 137 G   F P     1 
ATOM   5288 O  OP1   . G   F 2 34 ? 41.017  -12.529 -7.954   1.00 52.10  ? 137 G   F OP1   1 
ATOM   5289 O  OP2   . G   F 2 34 ? 39.505  -14.584 -7.719   1.00 52.61  ? 137 G   F OP2   1 
ATOM   5290 O  "O5'" . G   F 2 34 ? 38.718  -12.492 -8.885   1.00 46.69  ? 137 G   F "O5'" 1 
ATOM   5291 C  "C5'" . G   F 2 34 ? 38.866  -11.454 -9.847   1.00 50.77  ? 137 G   F "C5'" 1 
ATOM   5292 C  "C4'" . G   F 2 34 ? 37.525  -10.879 -10.228  1.00 54.17  ? 137 G   F "C4'" 1 
ATOM   5293 O  "O4'" . G   F 2 34 ? 36.712  -11.907 -10.851  1.00 53.98  ? 137 G   F "O4'" 1 
ATOM   5294 C  "C3'" . G   F 2 34 ? 36.652  -10.389 -9.087   1.00 55.00  ? 137 G   F "C3'" 1 
ATOM   5295 O  "O3'" . G   F 2 34 ? 36.998  -9.091  -8.651   1.00 61.59  ? 137 G   F "O3'" 1 
ATOM   5296 C  "C2'" . G   F 2 34 ? 35.285  -10.377 -9.739   1.00 52.62  ? 137 G   F "C2'" 1 
ATOM   5297 O  "O2'" . G   F 2 34 ? 35.129  -9.263  -10.600  1.00 44.47  ? 137 G   F "O2'" 1 
ATOM   5298 C  "C1'" . G   F 2 34 ? 35.346  -11.686 -10.524  1.00 52.55  ? 137 G   F "C1'" 1 
ATOM   5299 N  N9    . G   F 2 34 ? 34.887  -12.811 -9.716   1.00 49.48  ? 137 G   F N9    1 
ATOM   5300 C  C8    . G   F 2 34 ? 35.636  -13.863 -9.249   1.00 48.08  ? 137 G   F C8    1 
ATOM   5301 N  N7    . G   F 2 34 ? 34.931  -14.734 -8.579   1.00 44.82  ? 137 G   F N7    1 
ATOM   5302 C  C5    . G   F 2 34 ? 33.643  -14.221 -8.601   1.00 39.22  ? 137 G   F C5    1 
ATOM   5303 C  C6    . G   F 2 34 ? 32.448  -14.731 -8.051   1.00 38.71  ? 137 G   F C6    1 
ATOM   5304 O  O6    . G   F 2 34 ? 32.275  -15.779 -7.425   1.00 44.97  ? 137 G   F O6    1 
ATOM   5305 N  N1    . G   F 2 34 ? 31.373  -13.888 -8.298   1.00 36.48  ? 137 G   F N1    1 
ATOM   5306 C  C2    . G   F 2 34 ? 31.439  -12.709 -8.995   1.00 37.73  ? 137 G   F C2    1 
ATOM   5307 N  N2    . G   F 2 34 ? 30.293  -12.033 -9.133   1.00 33.84  ? 137 G   F N2    1 
ATOM   5308 N  N3    . G   F 2 34 ? 32.547  -12.226 -9.520   1.00 39.38  ? 137 G   F N3    1 
ATOM   5309 C  C4    . G   F 2 34 ? 33.603  -13.029 -9.287   1.00 43.18  ? 137 G   F C4    1 
ATOM   5310 P  P     . C   F 2 35 ? 36.682  -8.670  -7.140   1.00 68.64  ? 138 C   F P     1 
ATOM   5311 O  OP1   . C   F 2 35 ? 37.598  -7.580  -6.704   1.00 67.34  ? 138 C   F OP1   1 
ATOM   5312 O  OP2   . C   F 2 35 ? 36.615  -9.935  -6.355   1.00 62.50  ? 138 C   F OP2   1 
ATOM   5313 O  "O5'" . C   F 2 35 ? 35.214  -8.065  -7.208   1.00 68.53  ? 138 C   F "O5'" 1 
ATOM   5314 C  "C5'" . C   F 2 35 ? 34.561  -7.696  -6.010   1.00 69.29  ? 138 C   F "C5'" 1 
ATOM   5315 C  "C4'" . C   F 2 35 ? 33.073  -7.599  -6.211   1.00 64.26  ? 138 C   F "C4'" 1 
ATOM   5316 O  "O4'" . C   F 2 35 ? 32.560  -8.755  -6.917   1.00 60.52  ? 138 C   F "O4'" 1 
ATOM   5317 C  "C3'" . C   F 2 35 ? 32.350  -7.613  -4.886   1.00 65.35  ? 138 C   F "C3'" 1 
ATOM   5318 O  "O3'" . C   F 2 35 ? 32.367  -6.306  -4.344   1.00 67.77  ? 138 C   F "O3'" 1 
ATOM   5319 C  "C2'" . C   F 2 35 ? 30.973  -8.139  -5.258   1.00 63.86  ? 138 C   F "C2'" 1 
ATOM   5320 O  "O2'" . C   F 2 35 ? 30.134  -7.141  -5.800   1.00 66.31  ? 138 C   F "O2'" 1 
ATOM   5321 C  "C1'" . C   F 2 35 ? 31.329  -9.159  -6.341   1.00 57.60  ? 138 C   F "C1'" 1 
ATOM   5322 N  N1    . C   F 2 35 ? 31.489  -10.545 -5.876   1.00 48.29  ? 138 C   F N1    1 
ATOM   5323 C  C2    . C   F 2 35 ? 30.402  -11.211 -5.305   1.00 44.69  ? 138 C   F C2    1 
ATOM   5324 O  O2    . C   F 2 35 ? 29.329  -10.602 -5.155   1.00 37.46  ? 138 C   F O2    1 
ATOM   5325 N  N3    . C   F 2 35 ? 30.550  -12.505 -4.929   1.00 43.06  ? 138 C   F N3    1 
ATOM   5326 C  C4    . C   F 2 35 ? 31.724  -13.120 -5.095   1.00 40.50  ? 138 C   F C4    1 
ATOM   5327 N  N4    . C   F 2 35 ? 31.829  -14.388 -4.714   1.00 40.37  ? 138 C   F N4    1 
ATOM   5328 C  C5    . C   F 2 35 ? 32.843  -12.460 -5.658   1.00 42.46  ? 138 C   F C5    1 
ATOM   5329 C  C6    . C   F 2 35 ? 32.686  -11.185 -6.026   1.00 47.74  ? 138 C   F C6    1 
ATOM   5330 P  P     . U   F 2 36 ? 33.128  -6.049  -2.960   1.00 68.82  ? 139 U   F P     1 
ATOM   5331 O  OP1   . U   F 2 36 ? 33.487  -4.611  -2.876   1.00 64.04  ? 139 U   F OP1   1 
ATOM   5332 O  OP2   . U   F 2 36 ? 34.188  -7.089  -2.831   1.00 59.53  ? 139 U   F OP2   1 
ATOM   5333 O  "O5'" . U   F 2 36 ? 32.003  -6.361  -1.883   1.00 72.72  ? 139 U   F "O5'" 1 
ATOM   5334 C  "C5'" . U   F 2 36 ? 30.745  -5.701  -1.942   1.00 69.32  ? 139 U   F "C5'" 1 
ATOM   5335 C  "C4'" . U   F 2 36 ? 29.708  -6.496  -1.195   1.00 67.46  ? 139 U   F "C4'" 1 
ATOM   5336 O  "O4'" . U   F 2 36 ? 29.330  -7.673  -1.952   1.00 63.77  ? 139 U   F "O4'" 1 
ATOM   5337 C  "C3'" . U   F 2 36 ? 30.170  -7.082  0.126    1.00 68.44  ? 139 U   F "C3'" 1 
ATOM   5338 O  "O3'" . U   F 2 36 ? 30.201  -6.101  1.153    1.00 70.51  ? 139 U   F "O3'" 1 
ATOM   5339 C  "C2'" . U   F 2 36 ? 29.114  -8.152  0.368    1.00 65.79  ? 139 U   F "C2'" 1 
ATOM   5340 O  "O2'" . U   F 2 36 ? 27.902  -7.630  0.871    1.00 67.64  ? 139 U   F "O2'" 1 
ATOM   5341 C  "C1'" . U   F 2 36 ? 28.889  -8.676  -1.052   1.00 62.30  ? 139 U   F "C1'" 1 
ATOM   5342 N  N1    . U   F 2 36 ? 29.636  -9.914  -1.305   1.00 56.07  ? 139 U   F N1    1 
ATOM   5343 C  C2    . U   F 2 36 ? 28.971  -11.107 -1.062   1.00 53.11  ? 139 U   F C2    1 
ATOM   5344 O  O2    . U   F 2 36 ? 27.821  -11.150 -0.665   1.00 49.53  ? 139 U   F O2    1 
ATOM   5345 N  N3    . U   F 2 36 ? 29.702  -12.242 -1.297   1.00 47.27  ? 139 U   F N3    1 
ATOM   5346 C  C4    . U   F 2 36 ? 31.004  -12.309 -1.740   1.00 46.84  ? 139 U   F C4    1 
ATOM   5347 O  O4    . U   F 2 36 ? 31.525  -13.415 -1.906   1.00 31.22  ? 139 U   F O4    1 
ATOM   5348 C  C5    . U   F 2 36 ? 31.629  -11.029 -1.970   1.00 48.53  ? 139 U   F C5    1 
ATOM   5349 C  C6    . U   F 2 36 ? 30.937  -9.902  -1.751   1.00 48.26  ? 139 U   F C6    1 
ATOM   5350 P  P     . G   F 2 37 ? 31.332  -6.177  2.292    1.00 69.11  ? 140 G   F P     1 
ATOM   5351 O  OP1   . G   F 2 37 ? 31.176  -4.956  3.117    1.00 70.00  ? 140 G   F OP1   1 
ATOM   5352 O  OP2   . G   F 2 37 ? 32.637  -6.464  1.641    1.00 62.50  ? 140 G   F OP2   1 
ATOM   5353 O  "O5'" . G   F 2 37 ? 30.891  -7.427  3.175    1.00 62.85  ? 140 G   F "O5'" 1 
ATOM   5354 C  "C5'" . G   F 2 37 ? 29.631  -7.413  3.838    1.00 68.06  ? 140 G   F "C5'" 1 
ATOM   5355 C  "C4'" . G   F 2 37 ? 29.228  -8.806  4.257    1.00 66.21  ? 140 G   F "C4'" 1 
ATOM   5356 O  "O4'" . G   F 2 37 ? 29.112  -9.659  3.088    1.00 65.10  ? 140 G   F "O4'" 1 
ATOM   5357 C  "C3'" . G   F 2 37 ? 30.208  -9.539  5.152    1.00 64.73  ? 140 G   F "C3'" 1 
ATOM   5358 O  "O3'" . G   F 2 37 ? 30.041  -9.126  6.508    1.00 64.69  ? 140 G   F "O3'" 1 
ATOM   5359 C  "C2'" . G   F 2 37 ? 29.798  -10.989 4.925    1.00 61.85  ? 140 G   F "C2'" 1 
ATOM   5360 O  "O2'" . G   F 2 37 ? 28.632  -11.334 5.643    1.00 61.07  ? 140 G   F "O2'" 1 
ATOM   5361 C  "C1'" . G   F 2 37 ? 29.485  -10.984 3.426    1.00 61.13  ? 140 G   F "C1'" 1 
ATOM   5362 N  N9    . G   F 2 37 ? 30.642  -11.345 2.615    1.00 60.94  ? 140 G   F N9    1 
ATOM   5363 C  C8    . G   F 2 37 ? 31.572  -10.487 2.081    1.00 60.68  ? 140 G   F C8    1 
ATOM   5364 N  N7    . G   F 2 37 ? 32.538  -11.103 1.454    1.00 62.18  ? 140 G   F N7    1 
ATOM   5365 C  C5    . G   F 2 37 ? 32.219  -12.451 1.566    1.00 63.57  ? 140 G   F C5    1 
ATOM   5366 C  C6    . G   F 2 37 ? 32.907  -13.613 1.090    1.00 65.00  ? 140 G   F C6    1 
ATOM   5367 O  O6    . G   F 2 37 ? 33.972  -13.680 0.458    1.00 70.05  ? 140 G   F O6    1 
ATOM   5368 N  N1    . G   F 2 37 ? 32.229  -14.779 1.424    1.00 60.28  ? 140 G   F N1    1 
ATOM   5369 C  C2    . G   F 2 37 ? 31.046  -14.833 2.118    1.00 60.32  ? 140 G   F C2    1 
ATOM   5370 N  N2    . G   F 2 37 ? 30.549  -16.054 2.331    1.00 56.85  ? 140 G   F N2    1 
ATOM   5371 N  N3    . G   F 2 37 ? 30.398  -13.766 2.571    1.00 62.36  ? 140 G   F N3    1 
ATOM   5372 C  C4    . G   F 2 37 ? 31.039  -12.617 2.263    1.00 62.79  ? 140 G   F C4    1 
ATOM   5373 P  P     . A   F 2 38 ? 31.335  -8.761  7.393    1.00 62.65  ? 141 A   F P     1 
ATOM   5374 O  OP1   . A   F 2 38 ? 30.952  -8.745  8.823    1.00 61.44  ? 141 A   F OP1   1 
ATOM   5375 O  OP2   . A   F 2 38 ? 31.956  -7.555  6.794    1.00 59.27  ? 141 A   F OP2   1 
ATOM   5376 O  "O5'" . A   F 2 38 ? 32.299  -10.007 7.158    1.00 54.38  ? 141 A   F "O5'" 1 
ATOM   5377 C  "C5'" . A   F 2 38 ? 33.269  -10.368 8.123    1.00 46.54  ? 141 A   F "C5'" 1 
ATOM   5378 C  "C4'" . A   F 2 38 ? 32.973  -11.744 8.668    1.00 48.52  ? 141 A   F "C4'" 1 
ATOM   5379 O  "O4'" . A   F 2 38 ? 31.787  -11.710 9.496    1.00 47.77  ? 141 A   F "O4'" 1 
ATOM   5380 C  "C3'" . A   F 2 38 ? 32.630  -12.817 7.653    1.00 52.39  ? 141 A   F "C3'" 1 
ATOM   5381 O  "O3'" . A   F 2 38 ? 33.787  -13.329 7.020    1.00 58.08  ? 141 A   F "O3'" 1 
ATOM   5382 C  "C2'" . A   F 2 38 ? 31.949  -13.874 8.515    1.00 52.47  ? 141 A   F "C2'" 1 
ATOM   5383 O  "O2'" . A   F 2 38 ? 32.855  -14.709 9.207    1.00 49.76  ? 141 A   F "O2'" 1 
ATOM   5384 C  "C1'" . A   F 2 38 ? 31.201  -13.005 9.524    1.00 50.60  ? 141 A   F "C1'" 1 
ATOM   5385 N  N9    . A   F 2 38 ? 29.760  -12.887 9.288    1.00 52.91  ? 141 A   F N9    1 
ATOM   5386 C  C8    . A   F 2 38 ? 29.031  -11.742 9.056    1.00 55.05  ? 141 A   F C8    1 
ATOM   5387 N  N7    . A   F 2 38 ? 27.737  -11.946 8.973    1.00 51.73  ? 141 A   F N7    1 
ATOM   5388 C  C5    . A   F 2 38 ? 27.605  -13.318 9.141    1.00 43.84  ? 141 A   F C5    1 
ATOM   5389 C  C6    . A   F 2 38 ? 26.484  -14.157 9.169    1.00 41.52  ? 141 A   F C6    1 
ATOM   5390 N  N6    . A   F 2 38 ? 25.231  -13.714 9.032    1.00 40.40  ? 141 A   F N6    1 
ATOM   5391 N  N1    . A   F 2 38 ? 26.693  -15.482 9.345    1.00 37.63  ? 141 A   F N1    1 
ATOM   5392 C  C2    . A   F 2 38 ? 27.954  -15.916 9.482    1.00 36.46  ? 141 A   F C2    1 
ATOM   5393 N  N3    . A   F 2 38 ? 29.090  -15.223 9.481    1.00 32.91  ? 141 A   F N3    1 
ATOM   5394 C  C4    . A   F 2 38 ? 28.844  -13.914 9.309    1.00 43.32  ? 141 A   F C4    1 
ATOM   5395 P  P     . G   F 2 39 ? 33.774  -13.551 5.437    1.00 56.74  ? 142 G   F P     1 
ATOM   5396 O  OP1   . G   F 2 39 ? 35.167  -13.752 4.964    1.00 59.46  ? 142 G   F OP1   1 
ATOM   5397 O  OP2   . G   F 2 39 ? 32.974  -12.421 4.905    1.00 60.93  ? 142 G   F OP2   1 
ATOM   5398 O  "O5'" . G   F 2 39 ? 32.980  -14.921 5.255    1.00 55.55  ? 142 G   F "O5'" 1 
ATOM   5399 C  "C5'" . G   F 2 39 ? 33.609  -16.162 5.561    1.00 59.29  ? 142 G   F "C5'" 1 
ATOM   5400 C  "C4'" . G   F 2 39 ? 32.583  -17.261 5.677    1.00 60.11  ? 142 G   F "C4'" 1 
ATOM   5401 O  "O4'" . G   F 2 39 ? 31.593  -16.863 6.654    1.00 57.89  ? 142 G   F "O4'" 1 
ATOM   5402 C  "C3'" . G   F 2 39 ? 31.792  -17.571 4.416    1.00 64.36  ? 142 G   F "C3'" 1 
ATOM   5403 O  "O3'" . G   F 2 39 ? 32.481  -18.552 3.639    1.00 66.64  ? 142 G   F "O3'" 1 
ATOM   5404 C  "C2'" . G   F 2 39 ? 30.493  -18.135 4.982    1.00 61.15  ? 142 G   F "C2'" 1 
ATOM   5405 O  "O2'" . G   F 2 39 ? 30.600  -19.490 5.371    1.00 67.32  ? 142 G   F "O2'" 1 
ATOM   5406 C  "C1'" . G   F 2 39 ? 30.311  -17.281 6.233    1.00 54.12  ? 142 G   F "C1'" 1 
ATOM   5407 N  N9    . G   F 2 39 ? 29.528  -16.082 6.003    1.00 51.85  ? 142 G   F N9    1 
ATOM   5408 C  C8    . G   F 2 39 ? 30.008  -14.834 5.688    1.00 50.25  ? 142 G   F C8    1 
ATOM   5409 N  N7    . G   F 2 39 ? 29.070  -13.934 5.596    1.00 46.23  ? 142 G   F N7    1 
ATOM   5410 C  C5    . G   F 2 39 ? 27.903  -14.634 5.854    1.00 44.94  ? 142 G   F C5    1 
ATOM   5411 C  C6    . G   F 2 39 ? 26.580  -14.188 5.908    1.00 42.39  ? 142 G   F C6    1 
ATOM   5412 O  O6    . G   F 2 39 ? 26.155  -13.048 5.733    1.00 48.89  ? 142 G   F O6    1 
ATOM   5413 N  N1    . G   F 2 39 ? 25.698  -15.225 6.204    1.00 44.72  ? 142 G   F N1    1 
ATOM   5414 C  C2    . G   F 2 39 ? 26.056  -16.535 6.419    1.00 47.36  ? 142 G   F C2    1 
ATOM   5415 N  N2    . G   F 2 39 ? 25.050  -17.389 6.681    1.00 38.93  ? 142 G   F N2    1 
ATOM   5416 N  N3    . G   F 2 39 ? 27.306  -16.968 6.375    1.00 50.61  ? 142 G   F N3    1 
ATOM   5417 C  C4    . G   F 2 39 ? 28.171  -15.967 6.092    1.00 51.23  ? 142 G   F C4    1 
ATOM   5418 P  P     . A   F 2 40 ? 32.685  -18.332 2.059    1.00 63.92  ? 143 A   F P     1 
ATOM   5419 O  OP1   . A   F 2 40 ? 33.443  -19.502 1.536    1.00 59.08  ? 143 A   F OP1   1 
ATOM   5420 O  OP2   . A   F 2 40 ? 33.226  -16.952 1.866    1.00 52.45  ? 143 A   F OP2   1 
ATOM   5421 O  "O5'" . A   F 2 40 ? 31.209  -18.401 1.458    1.00 60.28  ? 143 A   F "O5'" 1 
ATOM   5422 C  "C5'" . A   F 2 40 ? 30.526  -19.645 1.313    1.00 53.68  ? 143 A   F "C5'" 1 
ATOM   5423 C  "C4'" . A   F 2 40 ? 29.638  -19.608 0.090    1.00 52.43  ? 143 A   F "C4'" 1 
ATOM   5424 O  "O4'" . A   F 2 40 ? 28.750  -18.484 0.192    1.00 45.41  ? 143 A   F "O4'" 1 
ATOM   5425 C  "C3'" . A   F 2 40 ? 30.341  -19.414 -1.247   1.00 55.74  ? 143 A   F "C3'" 1 
ATOM   5426 O  "O3'" . A   F 2 40 ? 30.631  -20.718 -1.759   1.00 63.42  ? 143 A   F "O3'" 1 
ATOM   5427 C  "C2'" . A   F 2 40 ? 29.296  -18.710 -2.128   1.00 51.90  ? 143 A   F "C2'" 1 
ATOM   5428 O  "O2'" . A   F 2 40 ? 28.591  -19.591 -2.987   1.00 52.58  ? 143 A   F "O2'" 1 
ATOM   5429 C  "C1'" . A   F 2 40 ? 28.332  -18.107 -1.098   1.00 45.81  ? 143 A   F "C1'" 1 
ATOM   5430 N  N9    . A   F 2 40 ? 28.074  -16.665 -1.110   1.00 40.75  ? 143 A   F N9    1 
ATOM   5431 C  C8    . A   F 2 40 ? 28.950  -15.609 -1.154   1.00 44.65  ? 143 A   F C8    1 
ATOM   5432 N  N7    . A   F 2 40 ? 28.363  -14.432 -1.112   1.00 36.32  ? 143 A   F N7    1 
ATOM   5433 C  C5    . A   F 2 40 ? 27.010  -14.737 -1.043   1.00 32.91  ? 143 A   F C5    1 
ATOM   5434 C  C6    . A   F 2 40 ? 25.858  -13.932 -0.963   1.00 30.69  ? 143 A   F C6    1 
ATOM   5435 N  N6    . A   F 2 40 ? 25.886  -12.600 -0.933   1.00 29.63  ? 143 A   F N6    1 
ATOM   5436 N  N1    . A   F 2 40 ? 24.659  -14.551 -0.905   1.00 27.27  ? 143 A   F N1    1 
ATOM   5437 C  C2    . A   F 2 40 ? 24.630  -15.886 -0.915   1.00 25.20  ? 143 A   F C2    1 
ATOM   5438 N  N3    . A   F 2 40 ? 25.638  -16.752 -0.982   1.00 28.51  ? 143 A   F N3    1 
ATOM   5439 C  C4    . A   F 2 40 ? 26.816  -16.105 -1.048   1.00 35.18  ? 143 A   F C4    1 
ATOM   5440 P  P     . A   F 2 41 ? 31.830  -20.934 -2.803   1.00 66.25  ? 144 A   F P     1 
ATOM   5441 O  OP1   . A   F 2 41 ? 33.095  -20.987 -2.022   1.00 68.63  ? 144 A   F OP1   1 
ATOM   5442 O  OP2   . A   F 2 41 ? 31.679  -19.925 -3.882   1.00 68.93  ? 144 A   F OP2   1 
ATOM   5443 O  "O5'" . A   F 2 41 ? 31.521  -22.376 -3.417   1.00 67.31  ? 144 A   F "O5'" 1 
ATOM   5444 C  "C5'" . A   F 2 41 ? 32.258  -23.531 -3.012   1.00 74.20  ? 144 A   F "C5'" 1 
ATOM   5445 C  "C4'" . A   F 2 41 ? 32.383  -23.548 -1.512   1.00 77.97  ? 144 A   F "C4'" 1 
ATOM   5446 O  "O4'" . A   F 2 41 ? 31.091  -23.263 -0.942   1.00 76.00  ? 144 A   F "O4'" 1 
ATOM   5447 C  "C3'" . A   F 2 41 ? 32.850  -24.830 -0.838   1.00 79.34  ? 144 A   F "C3'" 1 
ATOM   5448 O  "O3'" . A   F 2 41 ? 34.284  -24.853 -0.831   1.00 82.27  ? 144 A   F "O3'" 1 
ATOM   5449 C  "C2'" . A   F 2 41 ? 32.292  -24.661 0.572    1.00 78.65  ? 144 A   F "C2'" 1 
ATOM   5450 O  "O2'" . A   F 2 41 ? 33.133  -23.829 1.342    1.00 82.48  ? 144 A   F "O2'" 1 
ATOM   5451 C  "C1'" . A   F 2 41 ? 31.001  -23.877 0.316    1.00 77.29  ? 144 A   F "C1'" 1 
ATOM   5452 N  N9    . A   F 2 41 ? 29.706  -24.551 0.415    1.00 78.31  ? 144 A   F N9    1 
ATOM   5453 C  C8    . A   F 2 41 ? 28.534  -24.073 -0.116   1.00 80.22  ? 144 A   F C8    1 
ATOM   5454 N  N7    . A   F 2 41 ? 27.479  -24.784 0.196    1.00 77.40  ? 144 A   F N7    1 
ATOM   5455 C  C5    . A   F 2 41 ? 27.989  -25.816 0.964    1.00 75.75  ? 144 A   F C5    1 
ATOM   5456 C  C6    . A   F 2 41 ? 27.373  -26.897 1.606    1.00 74.74  ? 144 A   F C6    1 
ATOM   5457 N  N6    . A   F 2 41 ? 26.054  -27.115 1.584    1.00 68.44  ? 144 A   F N6    1 
ATOM   5458 N  N1    . A   F 2 41 ? 28.163  -27.755 2.284    1.00 78.16  ? 144 A   F N1    1 
ATOM   5459 C  C2    . A   F 2 41 ? 29.485  -27.524 2.313    1.00 81.13  ? 144 A   F C2    1 
ATOM   5460 N  N3    . A   F 2 41 ? 30.182  -26.535 1.755    1.00 80.68  ? 144 A   F N3    1 
ATOM   5461 C  C4    . A   F 2 41 ? 29.366  -25.703 1.087    1.00 78.61  ? 144 A   F C4    1 
ATOM   5462 P  P     . A   F 2 42 ? 35.081  -25.987 -0.003   1.00 81.62  ? 145 A   F P     1 
ATOM   5463 O  OP1   . A   F 2 42 ? 36.407  -26.158 -0.643   1.00 81.15  ? 145 A   F OP1   1 
ATOM   5464 O  OP2   . A   F 2 42 ? 34.191  -27.167 0.169    1.00 81.43  ? 145 A   F OP2   1 
ATOM   5465 O  "O5'" . A   F 2 42 ? 35.331  -25.323 1.426    1.00 86.50  ? 145 A   F "O5'" 1 
ATOM   5466 C  "C5'" . A   F 2 42 ? 35.786  -26.100 2.538    1.00 90.59  ? 145 A   F "C5'" 1 
ATOM   5467 C  "C4'" . A   F 2 42 ? 35.963  -25.218 3.758    1.00 91.20  ? 145 A   F "C4'" 1 
ATOM   5468 O  "O4'" . A   F 2 42 ? 34.748  -24.461 3.988    1.00 93.56  ? 145 A   F "O4'" 1 
ATOM   5469 C  "C3'" . A   F 2 42 ? 36.235  -25.936 5.072    1.00 90.29  ? 145 A   F "C3'" 1 
ATOM   5470 O  "O3'" . A   F 2 42 ? 37.633  -26.147 5.200    1.00 93.58  ? 145 A   F "O3'" 1 
ATOM   5471 C  "C2'" . A   F 2 42 ? 35.717  -24.935 6.101    1.00 90.71  ? 145 A   F "C2'" 1 
ATOM   5472 O  "O2'" . A   F 2 42 ? 36.625  -23.882 6.358    1.00 81.43  ? 145 A   F "O2'" 1 
ATOM   5473 C  "C1'" . A   F 2 42 ? 34.497  -24.363 5.378    1.00 92.68  ? 145 A   F "C1'" 1 
ATOM   5474 N  N9    . A   F 2 42 ? 33.231  -25.048 5.648    1.00 96.69  ? 145 A   F N9    1 
ATOM   5475 C  C8    . A   F 2 42 ? 32.985  -26.209 6.354    1.00 96.19  ? 145 A   F C8    1 
ATOM   5476 N  N7    . A   F 2 42 ? 31.715  -26.543 6.394    1.00 93.75  ? 145 A   F N7    1 
ATOM   5477 C  C5    . A   F 2 42 ? 31.082  -25.537 5.667    1.00 93.62  ? 145 A   F C5    1 
ATOM   5478 C  C6    . A   F 2 42 ? 29.730  -25.306 5.334    1.00 89.51  ? 145 A   F C6    1 
ATOM   5479 N  N6    . A   F 2 42 ? 28.725  -26.099 5.706    1.00 86.46  ? 145 A   F N6    1 
ATOM   5480 N  N1    . A   F 2 42 ? 29.444  -24.210 4.595    1.00 86.76  ? 145 A   F N1    1 
ATOM   5481 C  C2    . A   F 2 42 ? 30.447  -23.404 4.223    1.00 84.57  ? 145 A   F C2    1 
ATOM   5482 N  N3    . A   F 2 42 ? 31.747  -23.510 4.473    1.00 87.95  ? 145 A   F N3    1 
ATOM   5483 C  C4    . A   F 2 42 ? 32.003  -24.610 5.207    1.00 94.24  ? 145 A   F C4    1 
ATOM   5484 P  P     . U   F 2 43 ? 38.212  -27.018 6.420    1.00 96.84  ? 146 U   F P     1 
ATOM   5485 O  OP1   . U   F 2 43 ? 39.234  -26.177 7.097    1.00 97.79  ? 146 U   F OP1   1 
ATOM   5486 O  OP2   . U   F 2 43 ? 38.598  -28.348 5.885    1.00 92.63  ? 146 U   F OP2   1 
ATOM   5487 O  "O5'" . U   F 2 43 ? 36.990  -27.214 7.427    1.00 97.20  ? 146 U   F "O5'" 1 
ATOM   5488 C  "C5'" . U   F 2 43 ? 36.906  -28.386 8.245    1.00 102.15 ? 146 U   F "C5'" 1 
ATOM   5489 C  "C4'" . U   F 2 43 ? 37.883  -28.295 9.404    1.00 103.49 ? 146 U   F "C4'" 1 
ATOM   5490 O  "O4'" . U   F 2 43 ? 39.217  -28.048 8.876    1.00 106.15 ? 146 U   F "O4'" 1 
ATOM   5491 C  "C3'" . U   F 2 43 ? 37.632  -27.158 10.385   1.00 101.42 ? 146 U   F "C3'" 1 
ATOM   5492 O  "O3'" . U   F 2 43 ? 36.770  -27.567 11.450   1.00 97.81  ? 146 U   F "O3'" 1 
ATOM   5493 C  "C2'" . U   F 2 43 ? 39.028  -26.863 10.926   1.00 99.23  ? 146 U   F "C2'" 1 
ATOM   5494 O  "O2'" . U   F 2 43 ? 39.415  -27.734 11.966   1.00 95.00  ? 146 U   F "O2'" 1 
ATOM   5495 C  "C1'" . U   F 2 43 ? 39.897  -27.111 9.694    1.00 101.99 ? 146 U   F "C1'" 1 
ATOM   5496 P  P     . A   F 2 44 ? 35.243  -27.054 11.501   1.00 96.98  ? 147 A   F P     1 
ATOM   5497 O  OP1   . A   F 2 44 ? 34.630  -27.620 12.731   1.00 91.46  ? 147 A   F OP1   1 
ATOM   5498 O  OP2   . A   F 2 44 ? 34.634  -27.348 10.171   1.00 97.23  ? 147 A   F OP2   1 
ATOM   5499 O  "O5'" . A   F 2 44 ? 35.333  -25.470 11.694   1.00 91.26  ? 147 A   F "O5'" 1 
ATOM   5500 C  "C5'" . A   F 2 44 ? 36.477  -24.735 11.262   1.00 86.65  ? 147 A   F "C5'" 1 
ATOM   5501 C  "C4'" . A   F 2 44 ? 36.066  -23.581 10.382   1.00 78.51  ? 147 A   F "C4'" 1 
ATOM   5502 O  "O4'" . A   F 2 44 ? 35.377  -24.073 9.201    1.00 76.68  ? 147 A   F "O4'" 1 
ATOM   5503 C  "C3'" . A   F 2 44 ? 35.074  -22.627 11.012   1.00 75.80  ? 147 A   F "C3'" 1 
ATOM   5504 O  "O3'" . A   F 2 44 ? 35.754  -21.699 11.842   1.00 75.87  ? 147 A   F "O3'" 1 
ATOM   5505 C  "C2'" . A   F 2 44 ? 34.452  -21.974 9.788    1.00 71.10  ? 147 A   F "C2'" 1 
ATOM   5506 O  "O2'" . A   F 2 44 ? 35.303  -21.011 9.207    1.00 71.22  ? 147 A   F "O2'" 1 
ATOM   5507 C  "C1'" . A   F 2 44 ? 34.344  -23.168 8.842    1.00 69.80  ? 147 A   F "C1'" 1 
ATOM   5508 N  N9    . A   F 2 44 ? 33.060  -23.864 8.943    1.00 62.74  ? 147 A   F N9    1 
ATOM   5509 C  C8    . A   F 2 44 ? 32.786  -25.074 9.535    1.00 60.91  ? 147 A   F C8    1 
ATOM   5510 N  N7    . A   F 2 44 ? 31.527  -25.431 9.451    1.00 57.62  ? 147 A   F N7    1 
ATOM   5511 C  C5    . A   F 2 44 ? 30.931  -24.386 8.761    1.00 56.74  ? 147 A   F C5    1 
ATOM   5512 C  C6    . A   F 2 44 ? 29.607  -24.156 8.351    1.00 54.08  ? 147 A   F C6    1 
ATOM   5513 N  N6    . A   F 2 44 ? 28.601  -24.999 8.583    1.00 55.86  ? 147 A   F N6    1 
ATOM   5514 N  N1    . A   F 2 44 ? 29.349  -23.014 7.683    1.00 48.95  ? 147 A   F N1    1 
ATOM   5515 C  C2    . A   F 2 44 ? 30.358  -22.168 7.444    1.00 48.03  ? 147 A   F C2    1 
ATOM   5516 N  N3    . A   F 2 44 ? 31.638  -22.270 7.776    1.00 50.78  ? 147 A   F N3    1 
ATOM   5517 C  C4    . A   F 2 44 ? 31.863  -23.414 8.442    1.00 57.14  ? 147 A   F C4    1 
ATOM   5518 P  P     . C   F 2 45 ? 35.005  -21.087 13.122   1.00 75.31  ? 148 C   F P     1 
ATOM   5519 O  OP1   . C   F 2 45 ? 35.983  -20.248 13.863   1.00 70.36  ? 148 C   F OP1   1 
ATOM   5520 O  OP2   . C   F 2 45 ? 34.326  -22.218 13.810   1.00 70.62  ? 148 C   F OP2   1 
ATOM   5521 O  "O5'" . C   F 2 45 ? 33.901  -20.135 12.479   1.00 73.54  ? 148 C   F "O5'" 1 
ATOM   5522 C  "C5'" . C   F 2 45 ? 34.283  -19.115 11.557   1.00 69.02  ? 148 C   F "C5'" 1 
ATOM   5523 C  "C4'" . C   F 2 45 ? 33.081  -18.598 10.800   1.00 65.85  ? 148 C   F "C4'" 1 
ATOM   5524 O  "O4'" . C   F 2 45 ? 32.523  -19.647 9.966    1.00 63.26  ? 148 C   F "O4'" 1 
ATOM   5525 C  "C3'" . C   F 2 45 ? 31.898  -18.169 11.643   1.00 64.31  ? 148 C   F "C3'" 1 
ATOM   5526 O  "O3'" . C   F 2 45 ? 32.097  -16.885 12.206   1.00 64.97  ? 148 C   F "O3'" 1 
ATOM   5527 C  "C2'" . C   F 2 45 ? 30.770  -18.194 10.625   1.00 58.28  ? 148 C   F "C2'" 1 
ATOM   5528 O  "O2'" . C   F 2 45 ? 30.811  -17.083 9.751    1.00 50.35  ? 148 C   F "O2'" 1 
ATOM   5529 C  "C1'" . C   F 2 45 ? 31.119  -19.462 9.848    1.00 56.14  ? 148 C   F "C1'" 1 
ATOM   5530 N  N1    . C   F 2 45 ? 30.456  -20.664 10.370   1.00 49.63  ? 148 C   F N1    1 
ATOM   5531 C  C2    . C   F 2 45 ? 29.092  -20.862 10.105   1.00 43.42  ? 148 C   F C2    1 
ATOM   5532 O  O2    . C   F 2 45 ? 28.467  -19.996 9.477    1.00 37.71  ? 148 C   F O2    1 
ATOM   5533 N  N3    . C   F 2 45 ? 28.494  -21.990 10.546   1.00 41.12  ? 148 C   F N3    1 
ATOM   5534 C  C4    . C   F 2 45 ? 29.196  -22.890 11.238   1.00 45.26  ? 148 C   F C4    1 
ATOM   5535 N  N4    . C   F 2 45 ? 28.567  -23.987 11.649   1.00 45.73  ? 148 C   F N4    1 
ATOM   5536 C  C5    . C   F 2 45 ? 30.577  -22.703 11.540   1.00 48.27  ? 148 C   F C5    1 
ATOM   5537 C  C6    . C   F 2 45 ? 31.161  -21.587 11.091   1.00 50.11  ? 148 C   F C6    1 
ATOM   5538 P  P     . C   F 2 46 ? 31.670  -16.631 13.728   1.00 64.70  ? 149 C   F P     1 
ATOM   5539 O  OP1   . C   F 2 46 ? 32.203  -15.311 14.166   1.00 63.71  ? 149 C   F OP1   1 
ATOM   5540 O  OP2   . C   F 2 46 ? 32.003  -17.864 14.492   1.00 60.91  ? 149 C   F OP2   1 
ATOM   5541 O  "O5'" . C   F 2 46 ? 30.087  -16.545 13.658   1.00 60.90  ? 149 C   F "O5'" 1 
ATOM   5542 C  "C5'" . C   F 2 46 ? 29.456  -15.464 12.998   1.00 55.27  ? 149 C   F "C5'" 1 
ATOM   5543 C  "C4'" . C   F 2 46 ? 27.982  -15.721 12.904   1.00 53.22  ? 149 C   F "C4'" 1 
ATOM   5544 O  "O4'" . C   F 2 46 ? 27.759  -16.898 12.086   1.00 52.76  ? 149 C   F "O4'" 1 
ATOM   5545 C  "C3'" . C   F 2 46 ? 27.314  -16.098 14.209   1.00 54.76  ? 149 C   F "C3'" 1 
ATOM   5546 O  "O3'" . C   F 2 46 ? 27.054  -14.964 15.015   1.00 59.61  ? 149 C   F "O3'" 1 
ATOM   5547 C  "C2'" . C   F 2 46 ? 26.046  -16.765 13.707   1.00 54.01  ? 149 C   F "C2'" 1 
ATOM   5548 O  "O2'" . C   F 2 46 ? 25.112  -15.822 13.214   1.00 52.60  ? 149 C   F "O2'" 1 
ATOM   5549 C  "C1'" . C   F 2 46 ? 26.602  -17.579 12.540   1.00 49.82  ? 149 C   F "C1'" 1 
ATOM   5550 N  N1    . C   F 2 46 ? 27.000  -18.934 12.932   1.00 41.63  ? 149 C   F N1    1 
ATOM   5551 C  C2    . C   F 2 46 ? 26.029  -19.939 12.960   1.00 42.42  ? 149 C   F C2    1 
ATOM   5552 O  O2    . C   F 2 46 ? 24.861  -19.650 12.660   1.00 36.54  ? 149 C   F O2    1 
ATOM   5553 N  N3    . C   F 2 46 ? 26.385  -21.197 13.312   1.00 43.02  ? 149 C   F N3    1 
ATOM   5554 C  C4    . C   F 2 46 ? 27.655  -21.464 13.630   1.00 46.44  ? 149 C   F C4    1 
ATOM   5555 N  N4    . C   F 2 46 ? 27.967  -22.719 13.970   1.00 40.02  ? 149 C   F N4    1 
ATOM   5556 C  C5    . C   F 2 46 ? 28.665  -20.453 13.613   1.00 49.16  ? 149 C   F C5    1 
ATOM   5557 C  C6    . C   F 2 46 ? 28.295  -19.214 13.263   1.00 44.07  ? 149 C   F C6    1 
ATOM   5558 P  P     . C   F 2 47 ? 26.961  -15.142 16.605   1.00 60.57  ? 150 C   F P     1 
ATOM   5559 O  OP1   . C   F 2 47 ? 26.973  -13.795 17.228   1.00 57.74  ? 150 C   F OP1   1 
ATOM   5560 O  OP2   . C   F 2 47 ? 27.999  -16.133 16.977   1.00 61.40  ? 150 C   F OP2   1 
ATOM   5561 O  "O5'" . C   F 2 47 ? 25.538  -15.835 16.823   1.00 62.35  ? 150 C   F "O5'" 1 
ATOM   5562 C  "C5'" . C   F 2 47 ? 24.337  -15.215 16.356   1.00 58.62  ? 150 C   F "C5'" 1 
ATOM   5563 C  "C4'" . C   F 2 47 ? 23.190  -16.202 16.366   1.00 53.63  ? 150 C   F "C4'" 1 
ATOM   5564 O  "O4'" . C   F 2 47 ? 23.520  -17.318 15.503   1.00 52.87  ? 150 C   F "O4'" 1 
ATOM   5565 C  "C3'" . C   F 2 47 ? 22.880  -16.862 17.698   1.00 56.41  ? 150 C   F "C3'" 1 
ATOM   5566 O  "O3'" . C   F 2 47 ? 22.048  -16.041 18.505   1.00 63.02  ? 150 C   F "O3'" 1 
ATOM   5567 C  "C2'" . C   F 2 47 ? 22.155  -18.124 17.261   1.00 54.71  ? 150 C   F "C2'" 1 
ATOM   5568 O  "O2'" . C   F 2 47 ? 20.819  -17.885 16.869   1.00 49.95  ? 150 C   F "O2'" 1 
ATOM   5569 C  "C1'" . C   F 2 47 ? 22.978  -18.514 16.038   1.00 55.57  ? 150 C   F "C1'" 1 
ATOM   5570 N  N1    . C   F 2 47 ? 24.087  -19.425 16.365   1.00 58.56  ? 150 C   F N1    1 
ATOM   5571 C  C2    . C   F 2 47 ? 23.785  -20.754 16.673   1.00 59.93  ? 150 C   F C2    1 
ATOM   5572 O  O2    . C   F 2 47 ? 22.600  -21.106 16.684   1.00 59.88  ? 150 C   F O2    1 
ATOM   5573 N  N3    . C   F 2 47 ? 24.787  -21.619 16.950   1.00 63.79  ? 150 C   F N3    1 
ATOM   5574 C  C4    . C   F 2 47 ? 26.054  -21.196 16.933   1.00 68.89  ? 150 C   F C4    1 
ATOM   5575 N  N4    . C   F 2 47 ? 27.016  -22.093 17.209   1.00 69.88  ? 150 C   F N4    1 
ATOM   5576 C  C5    . C   F 2 47 ? 26.393  -19.838 16.632   1.00 65.57  ? 150 C   F C5    1 
ATOM   5577 C  C6    . C   F 2 47 ? 25.386  -18.995 16.359   1.00 59.15  ? 150 C   F C6    1 
ATOM   5578 P  P     . G   F 2 48 ? 21.981  -16.295 20.091   1.00 56.74  ? 151 G   F P     1 
ATOM   5579 O  OP1   . G   F 2 48 ? 21.274  -15.152 20.721   1.00 58.91  ? 151 G   F OP1   1 
ATOM   5580 O  OP2   . G   F 2 48 ? 23.349  -16.656 20.544   1.00 59.75  ? 151 G   F OP2   1 
ATOM   5581 O  "O5'" . G   F 2 48 ? 21.057  -17.579 20.229   1.00 50.44  ? 151 G   F "O5'" 1 
ATOM   5582 C  "C5'" . G   F 2 48 ? 19.702  -17.530 19.829   1.00 46.34  ? 151 G   F "C5'" 1 
ATOM   5583 C  "C4'" . G   F 2 48 ? 19.027  -18.816 20.190   1.00 48.52  ? 151 G   F "C4'" 1 
ATOM   5584 O  "O4'" . G   F 2 48 ? 19.746  -19.895 19.549   1.00 48.21  ? 151 G   F "O4'" 1 
ATOM   5585 C  "C3'" . G   F 2 48 ? 19.096  -19.176 21.661   1.00 53.06  ? 151 G   F "C3'" 1 
ATOM   5586 O  "O3'" . G   F 2 48 ? 18.078  -18.491 22.387   1.00 56.20  ? 151 G   F "O3'" 1 
ATOM   5587 C  "C2'" . G   F 2 48 ? 18.899  -20.689 21.629   1.00 53.15  ? 151 G   F "C2'" 1 
ATOM   5588 O  "O2'" . G   F 2 48 ? 17.541  -21.087 21.558   1.00 50.69  ? 151 G   F "O2'" 1 
ATOM   5589 C  "C1'" . G   F 2 48 ? 19.628  -21.064 20.333   1.00 49.03  ? 151 G   F "C1'" 1 
ATOM   5590 N  N9    . G   F 2 48 ? 20.957  -21.648 20.502   1.00 44.38  ? 151 G   F N9    1 
ATOM   5591 C  C8    . G   F 2 48 ? 22.177  -21.012 20.458   1.00 41.68  ? 151 G   F C8    1 
ATOM   5592 N  N7    . G   F 2 48 ? 23.185  -21.828 20.628   1.00 38.80  ? 151 G   F N7    1 
ATOM   5593 C  C5    . G   F 2 48 ? 22.592  -23.074 20.799   1.00 38.60  ? 151 G   F C5    1 
ATOM   5594 C  C6    . G   F 2 48 ? 23.170  -24.354 21.025   1.00 36.59  ? 151 G   F C6    1 
ATOM   5595 O  O6    . G   F 2 48 ? 24.363  -24.658 21.114   1.00 44.35  ? 151 G   F O6    1 
ATOM   5596 N  N1    . G   F 2 48 ? 22.199  -25.339 21.151   1.00 29.28  ? 151 G   F N1    1 
ATOM   5597 C  C2    . G   F 2 48 ? 20.848  -25.126 21.064   1.00 34.99  ? 151 G   F C2    1 
ATOM   5598 N  N2    . G   F 2 48 ? 20.066  -26.197 21.214   1.00 40.38  ? 151 G   F N2    1 
ATOM   5599 N  N3    . G   F 2 48 ? 20.298  -23.950 20.846   1.00 38.01  ? 151 G   F N3    1 
ATOM   5600 C  C4    . G   F 2 48 ? 21.220  -22.975 20.727   1.00 40.53  ? 151 G   F C4    1 
ATOM   5601 P  P     . U   F 2 49 ? 18.399  -17.885 23.845   1.00 54.97  ? 152 U   F P     1 
ATOM   5602 O  OP1   . U   F 2 49 ? 19.476  -16.854 23.798   1.00 42.18  ? 152 U   F OP1   1 
ATOM   5603 O  OP2   . U   F 2 49 ? 18.552  -19.070 24.723   1.00 51.92  ? 152 U   F OP2   1 
ATOM   5604 O  "O5'" . U   F 2 49 ? 17.048  -17.142 24.233   1.00 55.75  ? 152 U   F "O5'" 1 
ATOM   5605 C  "C5'" . U   F 2 49 ? 16.595  -16.019 23.490   1.00 58.28  ? 152 U   F "C5'" 1 
ATOM   5606 C  "C4'" . U   F 2 49 ? 15.107  -16.117 23.283   1.00 64.74  ? 152 U   F "C4'" 1 
ATOM   5607 O  "O4'" . U   F 2 49 ? 14.836  -17.225 22.397   1.00 63.23  ? 152 U   F "O4'" 1 
ATOM   5608 C  "C3'" . U   F 2 49 ? 14.305  -16.441 24.538   1.00 68.77  ? 152 U   F "C3'" 1 
ATOM   5609 O  "O3'" . U   F 2 49 ? 13.836  -15.274 25.247   1.00 77.63  ? 152 U   F "O3'" 1 
ATOM   5610 C  "C2'" . U   F 2 49 ? 13.057  -17.147 23.988   1.00 68.21  ? 152 U   F "C2'" 1 
ATOM   5611 O  "O2'" . U   F 2 49 ? 11.983  -16.251 23.790   1.00 65.35  ? 152 U   F "O2'" 1 
ATOM   5612 C  "C1'" . U   F 2 49 ? 13.516  -17.651 22.617   1.00 68.83  ? 152 U   F "C1'" 1 
ATOM   5613 N  N1    . U   F 2 49 ? 13.377  -19.079 22.292   1.00 73.18  ? 152 U   F N1    1 
ATOM   5614 C  C2    . U   F 2 49 ? 12.115  -19.643 22.409   1.00 77.50  ? 152 U   F C2    1 
ATOM   5615 O  O2    . U   F 2 49 ? 11.154  -19.029 22.825   1.00 83.23  ? 152 U   F O2    1 
ATOM   5616 N  N3    . U   F 2 49 ? 12.019  -20.954 22.019   1.00 81.10  ? 152 U   F N3    1 
ATOM   5617 C  C4    . U   F 2 49 ? 13.032  -21.754 21.543   1.00 84.29  ? 152 U   F C4    1 
ATOM   5618 O  O4    . U   F 2 49 ? 12.783  -22.924 21.226   1.00 81.23  ? 152 U   F O4    1 
ATOM   5619 C  C5    . U   F 2 49 ? 14.315  -21.111 21.474   1.00 85.77  ? 152 U   F C5    1 
ATOM   5620 C  C6    . U   F 2 49 ? 14.440  -19.826 21.848   1.00 78.85  ? 152 U   F C6    1 
ATOM   5621 P  P     . A   F 2 50 ? 14.695  -13.899 25.274   1.00 75.51  ? 153 A   F P     1 
ATOM   5622 O  OP1   . A   F 2 50 ? 16.149  -14.167 25.435   1.00 73.96  ? 153 A   F OP1   1 
ATOM   5623 O  OP2   . A   F 2 50 ? 14.010  -12.990 26.225   1.00 71.97  ? 153 A   F OP2   1 
ATOM   5624 O  "O5'" . A   F 2 50 ? 14.462  -13.255 23.839   1.00 76.66  ? 153 A   F "O5'" 1 
ATOM   5625 C  "C5'" . A   F 2 50 ? 15.273  -12.177 23.399   1.00 80.56  ? 153 A   F "C5'" 1 
ATOM   5626 C  "C4'" . A   F 2 50 ? 15.229  -12.071 21.896   1.00 80.28  ? 153 A   F "C4'" 1 
ATOM   5627 O  "O4'" . A   F 2 50 ? 15.618  -13.334 21.313   1.00 76.69  ? 153 A   F "O4'" 1 
ATOM   5628 C  "C3'" . A   F 2 50 ? 13.872  -11.767 21.276   1.00 79.93  ? 153 A   F "C3'" 1 
ATOM   5629 O  "O3'" . A   F 2 50 ? 13.711  -10.342 21.309   1.00 81.67  ? 153 A   F "O3'" 1 
ATOM   5630 C  "C2'" . A   F 2 50 ? 14.002  -12.336 19.854   1.00 78.88  ? 153 A   F "C2'" 1 
ATOM   5631 O  "O2'" . A   F 2 50 ? 14.450  -11.415 18.885   1.00 82.17  ? 153 A   F "O2'" 1 
ATOM   5632 C  "C1'" . A   F 2 50 ? 15.080  -13.414 20.017   1.00 72.33  ? 153 A   F "C1'" 1 
ATOM   5633 N  N9    . A   F 2 50 ? 14.707  -14.795 19.728   1.00 65.27  ? 153 A   F N9    1 
ATOM   5634 C  C8    . A   F 2 50 ? 15.552  -15.779 19.284   1.00 64.17  ? 153 A   F C8    1 
ATOM   5635 N  N7    . A   F 2 50 ? 14.956  -16.913 19.027   1.00 59.11  ? 153 A   F N7    1 
ATOM   5636 C  C5    . A   F 2 50 ? 13.631  -16.666 19.337   1.00 57.42  ? 153 A   F C5    1 
ATOM   5637 C  C6    . A   F 2 50 ? 12.497  -17.468 19.273   1.00 58.43  ? 153 A   F C6    1 
ATOM   5638 N  N6    . A   F 2 50 ? 12.518  -18.733 18.848   1.00 57.33  ? 153 A   F N6    1 
ATOM   5639 N  N1    . A   F 2 50 ? 11.322  -16.925 19.662   1.00 60.80  ? 153 A   F N1    1 
ATOM   5640 C  C2    . A   F 2 50 ? 11.312  -15.655 20.083   1.00 58.89  ? 153 A   F C2    1 
ATOM   5641 N  N3    . A   F 2 50 ? 12.318  -14.796 20.183   1.00 58.19  ? 153 A   F N3    1 
ATOM   5642 C  C4    . A   F 2 50 ? 13.464  -15.370 19.788   1.00 59.92  ? 153 A   F C4    1 
ATOM   5643 P  P     . U   F 2 51 ? 12.391  -9.643  20.702   1.00 84.71  ? 154 U   F P     1 
ATOM   5644 O  OP1   . U   F 2 51 ? 11.893  -8.698  21.727   1.00 86.71  ? 154 U   F OP1   1 
ATOM   5645 O  OP2   . U   F 2 51 ? 11.471  -10.675 20.151   1.00 86.25  ? 154 U   F OP2   1 
ATOM   5646 O  "O5'" . U   F 2 51 ? 12.966  -8.763  19.504   1.00 80.52  ? 154 U   F "O5'" 1 
ATOM   5647 C  "C5'" . U   F 2 51 ? 12.142  -7.860  18.774   1.00 75.69  ? 154 U   F "C5'" 1 
ATOM   5648 C  "C4'" . U   F 2 51 ? 12.963  -6.676  18.327   1.00 79.13  ? 154 U   F "C4'" 1 
ATOM   5649 O  "O4'" . U   F 2 51 ? 13.065  -5.702  19.396   1.00 81.56  ? 154 U   F "O4'" 1 
ATOM   5650 C  "C3'" . U   F 2 51 ? 14.404  -7.019  17.996   1.00 83.28  ? 154 U   F "C3'" 1 
ATOM   5651 O  "O3'" . U   F 2 51 ? 14.503  -7.540  16.676   1.00 92.30  ? 154 U   F "O3'" 1 
ATOM   5652 C  "C2'" . U   F 2 51 ? 15.103  -5.678  18.178   1.00 81.57  ? 154 U   F "C2'" 1 
ATOM   5653 O  "O2'" . U   F 2 51 ? 14.921  -4.797  17.089   1.00 83.40  ? 154 U   F "O2'" 1 
ATOM   5654 C  "C1'" . U   F 2 51 ? 14.357  -5.119  19.390   1.00 81.95  ? 154 U   F "C1'" 1 
ATOM   5655 P  P     . C   F 2 52 ? 15.352  -8.879  16.413   1.00 89.03  ? 155 C   F P     1 
ATOM   5656 O  OP1   . C   F 2 52 ? 14.981  -9.460  15.099   1.00 84.03  ? 155 C   F OP1   1 
ATOM   5657 O  OP2   . C   F 2 52 ? 15.237  -9.706  17.630   1.00 91.98  ? 155 C   F OP2   1 
ATOM   5658 O  "O5'" . C   F 2 52 ? 16.846  -8.347  16.334   1.00 88.37  ? 155 C   F "O5'" 1 
ATOM   5659 C  "C5'" . C   F 2 52 ? 17.478  -8.157  15.081   1.00 87.28  ? 155 C   F "C5'" 1 
ATOM   5660 C  "C4'" . C   F 2 52 ? 18.960  -8.353  15.229   1.00 85.86  ? 155 C   F "C4'" 1 
ATOM   5661 O  "O4'" . C   F 2 52 ? 19.584  -7.169  15.795   1.00 87.30  ? 155 C   F "O4'" 1 
ATOM   5662 C  "C3'" . C   F 2 52 ? 19.333  -9.469  16.182   1.00 81.48  ? 155 C   F "C3'" 1 
ATOM   5663 O  "O3'" . C   F 2 52 ? 19.121  -10.734 15.558   1.00 77.65  ? 155 C   F "O3'" 1 
ATOM   5664 C  "C2'" . C   F 2 52 ? 20.752  -9.079  16.588   1.00 82.07  ? 155 C   F "C2'" 1 
ATOM   5665 O  "O2'" . C   F 2 52 ? 21.745  -9.363  15.627   1.00 81.08  ? 155 C   F "O2'" 1 
ATOM   5666 C  "C1'" . C   F 2 52 ? 20.620  -7.557  16.684   1.00 83.89  ? 155 C   F "C1'" 1 
ATOM   5667 P  P     . A   F 2 53 ? 20.347  -11.520 14.882   1.00 84.80  ? 156 A   F P     1 
ATOM   5668 O  OP1   . A   F 2 53 ? 21.403  -11.815 15.890   1.00 84.07  ? 156 A   F OP1   1 
ATOM   5669 O  OP2   . A   F 2 53 ? 20.694  -10.763 13.653   1.00 83.15  ? 156 A   F OP2   1 
ATOM   5670 O  "O5'" . A   F 2 53 ? 19.714  -12.904 14.423   1.00 74.14  ? 156 A   F "O5'" 1 
ATOM   5671 C  "C5'" . A   F 2 53 ? 19.799  -13.314 13.070   1.00 63.94  ? 156 A   F "C5'" 1 
ATOM   5672 C  "C4'" . A   F 2 53 ? 20.988  -14.220 12.877   1.00 53.86  ? 156 A   F "C4'" 1 
ATOM   5673 O  "O4'" . A   F 2 53 ? 20.999  -15.220 13.924   1.00 49.51  ? 156 A   F "O4'" 1 
ATOM   5674 C  "C3'" . A   F 2 53 ? 20.972  -14.979 11.558   1.00 50.04  ? 156 A   F "C3'" 1 
ATOM   5675 O  "O3'" . A   F 2 53 ? 21.717  -14.269 10.572   1.00 50.05  ? 156 A   F "O3'" 1 
ATOM   5676 C  "C2'" . A   F 2 53 ? 21.642  -16.293 11.927   1.00 47.00  ? 156 A   F "C2'" 1 
ATOM   5677 O  "O2'" . A   F 2 53 ? 23.052  -16.185 11.935   1.00 49.69  ? 156 A   F "O2'" 1 
ATOM   5678 C  "C1'" . A   F 2 53 ? 21.122  -16.503 13.350   1.00 41.60  ? 156 A   F "C1'" 1 
ATOM   5679 N  N9    . A   F 2 53 ? 19.802  -17.122 13.439   1.00 33.65  ? 156 A   F N9    1 
ATOM   5680 C  C8    . A   F 2 53 ? 18.627  -16.479 13.713   1.00 34.38  ? 156 A   F C8    1 
ATOM   5681 N  N7    . A   F 2 53 ? 17.595  -17.276 13.800   1.00 24.83  ? 156 A   F N7    1 
ATOM   5682 C  C5    . A   F 2 53 ? 18.124  -18.527 13.552   1.00 23.72  ? 156 A   F C5    1 
ATOM   5683 C  C6    . A   F 2 53 ? 17.544  -19.797 13.512   1.00 27.62  ? 156 A   F C6    1 
ATOM   5684 N  N6    . A   F 2 53 ? 16.251  -20.032 13.740   1.00 26.03  ? 156 A   F N6    1 
ATOM   5685 N  N1    . A   F 2 53 ? 18.346  -20.840 13.231   1.00 33.85  ? 156 A   F N1    1 
ATOM   5686 C  C2    . A   F 2 53 ? 19.642  -20.609 13.014   1.00 37.36  ? 156 A   F C2    1 
ATOM   5687 N  N3    . A   F 2 53 ? 20.307  -19.460 13.033   1.00 38.61  ? 156 A   F N3    1 
ATOM   5688 C  C4    . A   F 2 53 ? 19.479  -18.446 13.312   1.00 29.53  ? 156 A   F C4    1 
ATOM   5689 P  P     . C   F 2 54 ? 21.001  -13.793 9.214    1.00 52.46  ? 157 C   F P     1 
ATOM   5690 O  OP1   . C   F 2 54 ? 22.056  -13.692 8.173    1.00 48.53  ? 157 C   F OP1   1 
ATOM   5691 O  OP2   . C   F 2 54 ? 20.151  -12.607 9.512    1.00 49.69  ? 157 C   F OP2   1 
ATOM   5692 O  "O5'" . C   F 2 54 ? 20.041  -15.011 8.852    1.00 45.92  ? 157 C   F "O5'" 1 
ATOM   5693 C  "C5'" . C   F 2 54 ? 20.576  -16.238 8.379    1.00 45.00  ? 157 C   F "C5'" 1 
ATOM   5694 C  "C4'" . C   F 2 54 ? 19.527  -17.318 8.435    1.00 46.93  ? 157 C   F "C4'" 1 
ATOM   5695 O  "O4'" . C   F 2 54 ? 19.114  -17.506 9.813    1.00 50.20  ? 157 C   F "O4'" 1 
ATOM   5696 C  "C3'" . C   F 2 54 ? 18.225  -17.024 7.712    1.00 44.88  ? 157 C   F "C3'" 1 
ATOM   5697 O  "O3'" . C   F 2 54 ? 18.339  -17.302 6.324    1.00 49.07  ? 157 C   F "O3'" 1 
ATOM   5698 C  "C2'" . C   F 2 54 ? 17.270  -17.977 8.415    1.00 43.37  ? 157 C   F "C2'" 1 
ATOM   5699 O  "O2'" . C   F 2 54 ? 17.447  -19.324 8.025    1.00 34.72  ? 157 C   F "O2'" 1 
ATOM   5700 C  "C1'" . C   F 2 54 ? 17.732  -17.824 9.862    1.00 45.66  ? 157 C   F "C1'" 1 
ATOM   5701 N  N1    . C   F 2 54 ? 17.033  -16.729 10.551   1.00 47.42  ? 157 C   F N1    1 
ATOM   5702 C  C2    . C   F 2 54 ? 15.739  -16.952 11.034   1.00 41.37  ? 157 C   F C2    1 
ATOM   5703 O  O2    . C   F 2 54 ? 15.230  -18.068 10.886   1.00 31.81  ? 157 C   F O2    1 
ATOM   5704 N  N3    . C   F 2 54 ? 15.080  -15.943 11.645   1.00 43.74  ? 157 C   F N3    1 
ATOM   5705 C  C4    . C   F 2 54 ? 15.664  -14.748 11.779   1.00 50.03  ? 157 C   F C4    1 
ATOM   5706 N  N4    . C   F 2 54 ? 14.970  -13.773 12.371   1.00 52.19  ? 157 C   F N4    1 
ATOM   5707 C  C5    . C   F 2 54 ? 16.986  -14.498 11.307   1.00 50.02  ? 157 C   F C5    1 
ATOM   5708 C  C6    . C   F 2 54 ? 17.629  -15.507 10.707   1.00 49.03  ? 157 C   F C6    1 
ATOM   5709 P  P     . C   F 2 55 ? 17.478  -16.453 5.271    1.00 43.25  ? 158 C   F P     1 
ATOM   5710 O  OP1   . C   F 2 55 ? 18.051  -16.666 3.920    1.00 43.05  ? 158 C   F OP1   1 
ATOM   5711 O  OP2   . C   F 2 55 ? 17.366  -15.078 5.813    1.00 47.29  ? 158 C   F OP2   1 
ATOM   5712 O  "O5'" . C   F 2 55 ? 16.028  -17.106 5.345    1.00 40.01  ? 158 C   F "O5'" 1 
ATOM   5713 C  "C5'" . C   F 2 55 ? 15.846  -18.516 5.265    1.00 23.57  ? 158 C   F "C5'" 1 
ATOM   5714 C  "C4'" . C   F 2 55 ? 14.462  -18.887 5.738    1.00 21.62  ? 158 C   F "C4'" 1 
ATOM   5715 O  "O4'" . C   F 2 55 ? 14.306  -18.435 7.105    1.00 26.43  ? 158 C   F "O4'" 1 
ATOM   5716 C  "C3'" . C   F 2 55 ? 13.299  -18.209 5.033    1.00 23.49  ? 158 C   F "C3'" 1 
ATOM   5717 O  "O3'" . C   F 2 55 ? 12.955  -18.871 3.830    1.00 33.05  ? 158 C   F "O3'" 1 
ATOM   5718 C  "C2'" . C   F 2 55 ? 12.174  -18.351 6.050    1.00 25.33  ? 158 C   F "C2'" 1 
ATOM   5719 O  "O2'" . C   F 2 55 ? 11.549  -19.619 6.022    1.00 19.85  ? 158 C   F "O2'" 1 
ATOM   5720 C  "C1'" . C   F 2 55 ? 12.934  -18.183 7.363    1.00 28.23  ? 158 C   F "C1'" 1 
ATOM   5721 N  N1    . C   F 2 55 ? 12.785  -16.852 7.975    1.00 32.01  ? 158 C   F N1    1 
ATOM   5722 C  C2    . C   F 2 55 ? 11.604  -16.581 8.693    1.00 34.85  ? 158 C   F C2    1 
ATOM   5723 O  O2    . C   F 2 55 ? 10.724  -17.460 8.752    1.00 31.12  ? 158 C   F O2    1 
ATOM   5724 N  N3    . C   F 2 55 ? 11.455  -15.376 9.297    1.00 34.14  ? 158 C   F N3    1 
ATOM   5725 C  C4    . C   F 2 55 ? 12.422  -14.459 9.199    1.00 36.67  ? 158 C   F C4    1 
ATOM   5726 N  N4    . C   F 2 55 ? 12.232  -13.289 9.816    1.00 35.64  ? 158 C   F N4    1 
ATOM   5727 C  C5    . C   F 2 55 ? 13.629  -14.703 8.462    1.00 33.88  ? 158 C   F C5    1 
ATOM   5728 C  C6    . C   F 2 55 ? 13.765  -15.900 7.870    1.00 26.93  ? 158 C   F C6    1 
ATOM   5729 P  P     . U   F 2 56 ? 12.145  -18.078 2.689    1.00 40.61  ? 159 U   F P     1 
ATOM   5730 O  OP1   . U   F 2 56 ? 11.948  -19.029 1.573    1.00 35.51  ? 159 U   F OP1   1 
ATOM   5731 O  OP2   . U   F 2 56 ? 12.849  -16.787 2.444    1.00 32.95  ? 159 U   F OP2   1 
ATOM   5732 O  "O5'" . U   F 2 56 ? 10.715  -17.771 3.338    1.00 36.75  ? 159 U   F "O5'" 1 
ATOM   5733 C  "C5'" . U   F 2 56 ? 9.732   -18.799 3.498    1.00 22.82  ? 159 U   F "C5'" 1 
ATOM   5734 C  "C4'" . U   F 2 56 ? 8.470   -18.231 4.113    1.00 25.02  ? 159 U   F "C4'" 1 
ATOM   5735 O  "O4'" . U   F 2 56 ? 8.798   -17.645 5.401    1.00 31.66  ? 159 U   F "O4'" 1 
ATOM   5736 C  "C3'" . U   F 2 56 ? 7.803   -17.102 3.342    1.00 24.47  ? 159 U   F "C3'" 1 
ATOM   5737 O  "O3'" . U   F 2 56 ? 6.930   -17.618 2.334    1.00 17.19  ? 159 U   F "O3'" 1 
ATOM   5738 C  "C2'" . U   F 2 56 ? 7.054   -16.344 4.441    1.00 23.10  ? 159 U   F "C2'" 1 
ATOM   5739 O  "O2'" . U   F 2 56 ? 5.834   -16.945 4.816    1.00 24.91  ? 159 U   F "O2'" 1 
ATOM   5740 C  "C1'" . U   F 2 56 ? 8.011   -16.483 5.621    1.00 25.37  ? 159 U   F "C1'" 1 
ATOM   5741 N  N1    . U   F 2 56 ? 8.914   -15.348 5.872    1.00 25.56  ? 159 U   F N1    1 
ATOM   5742 C  C2    . U   F 2 56 ? 8.398   -14.221 6.501    1.00 24.05  ? 159 U   F C2    1 
ATOM   5743 O  O2    . U   F 2 56 ? 7.229   -14.108 6.806    1.00 29.71  ? 159 U   F O2    1 
ATOM   5744 N  N3    . U   F 2 56 ? 9.312   -13.233 6.765    1.00 20.97  ? 159 U   F N3    1 
ATOM   5745 C  C4    . U   F 2 56 ? 10.661  -13.248 6.465    1.00 26.17  ? 159 U   F C4    1 
ATOM   5746 O  O4    . U   F 2 56 ? 11.370  -12.279 6.778    1.00 23.30  ? 159 U   F O4    1 
ATOM   5747 C  C5    . U   F 2 56 ? 11.110  -14.435 5.796    1.00 27.18  ? 159 U   F C5    1 
ATOM   5748 C  C6    . U   F 2 56 ? 10.242  -15.415 5.525    1.00 22.23  ? 159 U   F C6    1 
ATOM   5749 P  P     . G   F 2 57 ? 6.907   -16.938 0.869    1.00 29.43  ? 160 G   F P     1 
ATOM   5750 O  OP1   . G   F 2 57 ? 6.012   -17.744 -0.002   1.00 29.83  ? 160 G   F OP1   1 
ATOM   5751 O  OP2   . G   F 2 57 ? 8.303   -16.657 0.436    1.00 18.39  ? 160 G   F OP2   1 
ATOM   5752 O  "O5'" . G   F 2 57 ? 6.221   -15.520 1.086    1.00 29.40  ? 160 G   F "O5'" 1 
ATOM   5753 C  "C5'" . G   F 2 57 ? 4.827   -15.412 1.348    1.00 29.37  ? 160 G   F "C5'" 1 
ATOM   5754 C  "C4'" . G   F 2 57 ? 4.509   -14.031 1.855    1.00 29.16  ? 160 G   F "C4'" 1 
ATOM   5755 O  "O4'" . G   F 2 57 ? 5.248   -13.803 3.083    1.00 28.31  ? 160 G   F "O4'" 1 
ATOM   5756 C  "C3'" . G   F 2 57 ? 4.945   -12.904 0.934    1.00 29.28  ? 160 G   F "C3'" 1 
ATOM   5757 O  "O3'" . G   F 2 57 ? 3.906   -12.590 0.013    1.00 30.64  ? 160 G   F "O3'" 1 
ATOM   5758 C  "C2'" . G   F 2 57 ? 5.088   -11.747 1.908    1.00 29.05  ? 160 G   F "C2'" 1 
ATOM   5759 O  "O2'" . G   F 2 57 ? 3.819   -11.181 2.159    1.00 25.37  ? 160 G   F "O2'" 1 
ATOM   5760 C  "C1'" . G   F 2 57 ? 5.642   -12.448 3.155    1.00 27.71  ? 160 G   F "C1'" 1 
ATOM   5761 N  N9    . G   F 2 57 ? 7.097   -12.404 3.236    1.00 26.75  ? 160 G   F N9    1 
ATOM   5762 C  C8    . G   F 2 57 ? 7.987   -13.242 2.610    1.00 31.22  ? 160 G   F C8    1 
ATOM   5763 N  N7    . G   F 2 57 ? 9.235   -12.925 2.830    1.00 28.61  ? 160 G   F N7    1 
ATOM   5764 C  C5    . G   F 2 57 ? 9.164   -11.818 3.661    1.00 28.14  ? 160 G   F C5    1 
ATOM   5765 C  C6    . G   F 2 57 ? 10.201  -11.021 4.226    1.00 29.33  ? 160 G   F C6    1 
ATOM   5766 O  O6    . G   F 2 57 ? 11.432  -11.138 4.091    1.00 30.46  ? 160 G   F O6    1 
ATOM   5767 N  N1    . G   F 2 57 ? 9.680   -9.997  5.015    1.00 24.65  ? 160 G   F N1    1 
ATOM   5768 C  C2    . G   F 2 57 ? 8.339   -9.764  5.223    1.00 21.87  ? 160 G   F C2    1 
ATOM   5769 N  N2    . G   F 2 57 ? 8.036   -8.732  6.017    1.00 20.40  ? 160 G   F N2    1 
ATOM   5770 N  N3    . G   F 2 57 ? 7.368   -10.491 4.692    1.00 20.75  ? 160 G   F N3    1 
ATOM   5771 C  C4    . G   F 2 57 ? 7.848   -11.493 3.931    1.00 27.14  ? 160 G   F C4    1 
ATOM   5772 P  P     . A   F 2 58 ? 3.892   -13.258 -1.448   1.00 35.38  ? 161 A   F P     1 
ATOM   5773 O  OP1   . A   F 2 58 ? 3.133   -12.318 -2.301   1.00 27.18  ? 161 A   F OP1   1 
ATOM   5774 O  OP2   . A   F 2 58 ? 3.404   -14.656 -1.290   1.00 24.50  ? 161 A   F OP2   1 
ATOM   5775 O  "O5'" . A   F 2 58 ? 5.427   -13.279 -1.911   1.00 32.03  ? 161 A   F "O5'" 1 
ATOM   5776 C  "C5'" . A   F 2 58 ? 5.801   -13.766 -3.212   1.00 25.45  ? 161 A   F "C5'" 1 
ATOM   5777 C  "C4'" . A   F 2 58 ? 7.313   -13.747 -3.394   1.00 27.37  ? 161 A   F "C4'" 1 
ATOM   5778 O  "O4'" . A   F 2 58 ? 7.812   -12.448 -3.027   1.00 35.16  ? 161 A   F "O4'" 1 
ATOM   5779 C  "C3'" . A   F 2 58 ? 8.064   -14.742 -2.518   1.00 28.73  ? 161 A   F "C3'" 1 
ATOM   5780 O  "O3'" . A   F 2 58 ? 9.134   -15.421 -3.176   1.00 30.13  ? 161 A   F "O3'" 1 
ATOM   5781 C  "C2'" . A   F 2 58 ? 8.533   -13.956 -1.301   1.00 31.83  ? 161 A   F "C2'" 1 
ATOM   5782 O  "O2'" . A   F 2 58 ? 9.868   -14.248 -0.940   1.00 41.35  ? 161 A   F "O2'" 1 
ATOM   5783 C  "C1'" . A   F 2 58 ? 8.564   -12.537 -1.849   1.00 34.13  ? 161 A   F "C1'" 1 
ATOM   5784 N  N9    . A   F 2 58 ? 8.133   -11.496 -0.940   1.00 35.08  ? 161 A   F N9    1 
ATOM   5785 C  C8    . A   F 2 58 ? 6.900   -10.928 -0.764   1.00 28.91  ? 161 A   F C8    1 
ATOM   5786 N  N7    . A   F 2 58 ? 6.892   -9.967  0.121    1.00 35.94  ? 161 A   F N7    1 
ATOM   5787 C  C5    . A   F 2 58 ? 8.208   -9.912  0.562    1.00 32.93  ? 161 A   F C5    1 
ATOM   5788 C  C6    . A   F 2 58 ? 8.855   -9.102  1.491    1.00 33.66  ? 161 A   F C6    1 
ATOM   5789 N  N6    . A   F 2 58 ? 8.234   -8.153  2.189    1.00 39.62  ? 161 A   F N6    1 
ATOM   5790 N  N1    . A   F 2 58 ? 10.179  -9.301  1.688    1.00 32.40  ? 161 A   F N1    1 
ATOM   5791 C  C2    . A   F 2 58 ? 10.794  -10.264 0.990    1.00 23.54  ? 161 A   F C2    1 
ATOM   5792 N  N3    . A   F 2 58 ? 10.290  -11.092 0.091    1.00 23.63  ? 161 A   F N3    1 
ATOM   5793 C  C4    . A   F 2 58 ? 8.976   -10.856 -0.077   1.00 33.04  ? 161 A   F C4    1 
ATOM   5794 P  P     . U   F 2 59 ? 8.912   -16.103 -4.607   1.00 29.01  ? 162 U   F P     1 
ATOM   5795 O  OP1   . U   F 2 59 ? 7.862   -17.147 -4.500   1.00 22.86  ? 162 U   F OP1   1 
ATOM   5796 O  OP2   . U   F 2 59 ? 10.266  -16.471 -5.078   1.00 31.45  ? 162 U   F OP2   1 
ATOM   5797 O  "O5'" . U   F 2 59 ? 8.363   -14.922 -5.524   1.00 28.51  ? 162 U   F "O5'" 1 
ATOM   5798 C  "C5'" . U   F 2 59 ? 9.212   -14.185 -6.410   1.00 26.10  ? 162 U   F "C5'" 1 
ATOM   5799 C  "C4'" . U   F 2 59 ? 8.413   -13.733 -7.615   1.00 23.80  ? 162 U   F "C4'" 1 
ATOM   5800 O  "O4'" . U   F 2 59 ? 8.063   -14.899 -8.375   1.00 25.21  ? 162 U   F "O4'" 1 
ATOM   5801 C  "C3'" . U   F 2 59 ? 7.100   -13.056 -7.240   1.00 26.31  ? 162 U   F "C3'" 1 
ATOM   5802 O  "O3'" . U   F 2 59 ? 7.144   -11.640 -7.390   1.00 31.63  ? 162 U   F "O3'" 1 
ATOM   5803 C  "C2'" . U   F 2 59 ? 6.095   -13.522 -8.292   1.00 28.93  ? 162 U   F "C2'" 1 
ATOM   5804 O  "O2'" . U   F 2 59 ? 5.784   -12.517 -9.234   1.00 31.94  ? 162 U   F "O2'" 1 
ATOM   5805 C  "C1'" . U   F 2 59 ? 6.799   -14.710 -8.952   1.00 30.10  ? 162 U   F "C1'" 1 
ATOM   5806 N  N1    . U   F 2 59 ? 6.090   -15.991 -8.950   1.00 29.32  ? 162 U   F N1    1 
ATOM   5807 C  C2    . U   F 2 59 ? 4.967   -16.089 -9.733   1.00 28.94  ? 162 U   F C2    1 
ATOM   5808 O  O2    . U   F 2 59 ? 4.518   -15.144 -10.351  1.00 29.16  ? 162 U   F O2    1 
ATOM   5809 N  N3    . U   F 2 59 ? 4.387   -17.331 -9.765   1.00 33.21  ? 162 U   F N3    1 
ATOM   5810 C  C4    . U   F 2 59 ? 4.808   -18.459 -9.090   1.00 40.13  ? 162 U   F C4    1 
ATOM   5811 O  O4    . U   F 2 59 ? 4.189   -19.514 -9.226   1.00 50.63  ? 162 U   F O4    1 
ATOM   5812 C  C5    . U   F 2 59 ? 5.966   -18.266 -8.272   1.00 42.34  ? 162 U   F C5    1 
ATOM   5813 C  C6    . U   F 2 59 ? 6.550   -17.062 -8.228   1.00 37.94  ? 162 U   F C6    1 
ATOM   5814 P  P     . C   F 2 60 ? 8.530   -10.828 -7.240   1.00 48.17  ? 163 C   F P     1 
ATOM   5815 O  OP1   . C   F 2 60 ? 8.469   -9.694  -8.202   1.00 47.37  ? 163 C   F OP1   1 
ATOM   5816 O  OP2   . C   F 2 60 ? 9.732   -11.700 -7.218   1.00 40.59  ? 163 C   F OP2   1 
ATOM   5817 O  "O5'" . C   F 2 60 ? 8.397   -10.146 -5.819   1.00 46.47  ? 163 C   F "O5'" 1 
ATOM   5818 C  "C5'" . C   F 2 60 ? 8.305   -8.748  -5.738   1.00 47.41  ? 163 C   F "C5'" 1 
ATOM   5819 C  "C4'" . C   F 2 60 ? 7.049   -8.354  -5.028   1.00 49.95  ? 163 C   F "C4'" 1 
ATOM   5820 O  "O4'" . C   F 2 60 ? 6.992   -9.038  -3.750   1.00 50.12  ? 163 C   F "O4'" 1 
ATOM   5821 C  "C3'" . C   F 2 60 ? 7.059   -6.868  -4.714   1.00 54.74  ? 163 C   F "C3'" 1 
ATOM   5822 O  "O3'" . C   F 2 60 ? 6.389   -6.155  -5.747   1.00 60.49  ? 163 C   F "O3'" 1 
ATOM   5823 C  "C2'" . C   F 2 60 ? 6.360   -6.820  -3.368   1.00 53.35  ? 163 C   F "C2'" 1 
ATOM   5824 O  "O2'" . C   F 2 60 ? 4.958   -6.947  -3.488   1.00 47.85  ? 163 C   F "O2'" 1 
ATOM   5825 C  "C1'" . C   F 2 60 ? 6.936   -8.078  -2.715   1.00 54.47  ? 163 C   F "C1'" 1 
ATOM   5826 N  N1    . C   F 2 60 ? 8.316   -7.915  -2.217   1.00 53.85  ? 163 C   F N1    1 
ATOM   5827 C  C2    . C   F 2 60 ? 8.632   -6.825  -1.394   1.00 53.05  ? 163 C   F C2    1 
ATOM   5828 O  O2    . C   F 2 60 ? 7.750   -5.999  -1.113   1.00 52.28  ? 163 C   F O2    1 
ATOM   5829 N  N3    . C   F 2 60 ? 9.897   -6.697  -0.931   1.00 52.51  ? 163 C   F N3    1 
ATOM   5830 C  C4    . C   F 2 60 ? 10.828  -7.593  -1.266   1.00 45.21  ? 163 C   F C4    1 
ATOM   5831 N  N4    . C   F 2 60 ? 12.063  -7.416  -0.785   1.00 37.97  ? 163 C   F N4    1 
ATOM   5832 C  C5    . C   F 2 60 ? 10.535  -8.705  -2.108   1.00 40.80  ? 163 C   F C5    1 
ATOM   5833 C  C6    . C   F 2 60 ? 9.281   -8.827  -2.555   1.00 46.76  ? 163 C   F C6    1 
ATOM   5834 P  P     . U   F 2 61 ? 7.236   -5.497  -6.949   1.00 58.29  ? 164 U   F P     1 
ATOM   5835 O  OP1   . U   F 2 61 ? 6.381   -5.516  -8.162   1.00 55.25  ? 164 U   F OP1   1 
ATOM   5836 O  OP2   . U   F 2 61 ? 8.576   -6.137  -6.990   1.00 59.92  ? 164 U   F OP2   1 
ATOM   5837 O  "O5'" . U   F 2 61 ? 7.419   -3.988  -6.488   1.00 45.00  ? 164 U   F "O5'" 1 
ATOM   5838 C  "C5'" . U   F 2 61 ? 6.290   -3.191  -6.195   1.00 43.73  ? 164 U   F "C5'" 1 
ATOM   5839 C  "C4'" . U   F 2 61 ? 6.666   -2.148  -5.197   1.00 46.83  ? 164 U   F "C4'" 1 
ATOM   5840 O  "O4'" . U   F 2 61 ? 7.023   -2.794  -3.954   1.00 47.89  ? 164 U   F "O4'" 1 
ATOM   5841 C  "C3'" . U   F 2 61 ? 7.926   -1.398  -5.568   1.00 55.62  ? 164 U   F "C3'" 1 
ATOM   5842 O  "O3'" . U   F 2 61 ? 7.647   -0.349  -6.472   1.00 65.15  ? 164 U   F "O3'" 1 
ATOM   5843 C  "C2'" . U   F 2 61 ? 8.394   -0.870  -4.226   1.00 57.03  ? 164 U   F "C2'" 1 
ATOM   5844 O  "O2'" . U   F 2 61 ? 7.727   0.315   -3.836   1.00 64.37  ? 164 U   F "O2'" 1 
ATOM   5845 C  "C1'" . U   F 2 61 ? 8.045   -2.047  -3.312   1.00 54.78  ? 164 U   F "C1'" 1 
ATOM   5846 N  N1    . U   F 2 61 ? 9.201   -2.928  -3.107   1.00 52.03  ? 164 U   F N1    1 
ATOM   5847 C  C2    . U   F 2 61 ? 10.249  -2.436  -2.344   1.00 47.60  ? 164 U   F C2    1 
ATOM   5848 O  O2    . U   F 2 61 ? 10.238  -1.321  -1.830   1.00 31.87  ? 164 U   F O2    1 
ATOM   5849 N  N3    . U   F 2 61 ? 11.312  -3.290  -2.210   1.00 47.93  ? 164 U   F N3    1 
ATOM   5850 C  C4    . U   F 2 61 ? 11.433  -4.553  -2.745   1.00 50.45  ? 164 U   F C4    1 
ATOM   5851 O  O4    . U   F 2 61 ? 12.461  -5.200  -2.537   1.00 51.13  ? 164 U   F O4    1 
ATOM   5852 C  C5    . U   F 2 61 ? 10.302  -4.990  -3.512   1.00 50.35  ? 164 U   F C5    1 
ATOM   5853 C  C6    . U   F 2 61 ? 9.250   -4.184  -3.660   1.00 48.18  ? 164 U   F C6    1 
ATOM   5854 P  P     . G   F 2 62 ? 8.703   -0.009  -7.620   1.00 64.45  ? 165 G   F P     1 
ATOM   5855 O  OP1   . G   F 2 62 ? 7.977   0.089   -8.907   1.00 69.74  ? 165 G   F OP1   1 
ATOM   5856 O  OP2   . G   F 2 62 ? 9.835   -0.957  -7.484   1.00 64.50  ? 165 G   F OP2   1 
ATOM   5857 O  "O5'" . G   F 2 62 ? 9.249   1.418   -7.207   1.00 59.76  ? 165 G   F "O5'" 1 
ATOM   5858 C  "C5'" . G   F 2 62 ? 10.626  1.692   -7.302   1.00 57.72  ? 165 G   F "C5'" 1 
ATOM   5859 C  "C4'" . G   F 2 62 ? 11.076  2.486   -6.112   1.00 59.51  ? 165 G   F "C4'" 1 
ATOM   5860 O  "O4'" . G   F 2 62 ? 10.769  1.772   -4.885   1.00 57.04  ? 165 G   F "O4'" 1 
ATOM   5861 C  "C3'" . G   F 2 62 ? 12.576  2.670   -6.072   1.00 62.60  ? 165 G   F "C3'" 1 
ATOM   5862 O  "O3'" . G   F 2 62 ? 12.942  3.746   -6.906   1.00 61.65  ? 165 G   F "O3'" 1 
ATOM   5863 C  "C2'" . G   F 2 62 ? 12.819  2.920   -4.598   1.00 63.39  ? 165 G   F "C2'" 1 
ATOM   5864 O  "O2'" . G   F 2 62 ? 12.479  4.236   -4.216   1.00 67.55  ? 165 G   F "O2'" 1 
ATOM   5865 C  "C1'" . G   F 2 62 ? 11.859  1.898   -3.981   1.00 63.76  ? 165 G   F "C1'" 1 
ATOM   5866 N  N9    . G   F 2 62 ? 12.488  0.584   -3.851   1.00 64.18  ? 165 G   F N9    1 
ATOM   5867 C  C8    . G   F 2 62 ? 11.941  -0.633  -4.183   1.00 63.40  ? 165 G   F C8    1 
ATOM   5868 N  N7    . G   F 2 62 ? 12.755  -1.635  -3.983   1.00 60.72  ? 165 G   F N7    1 
ATOM   5869 C  C5    . G   F 2 62 ? 13.910  -1.046  -3.483   1.00 59.42  ? 165 G   F C5    1 
ATOM   5870 C  C6    . G   F 2 62 ? 15.147  -1.631  -3.086   1.00 55.97  ? 165 G   F C6    1 
ATOM   5871 O  O6    . G   F 2 62 ? 15.477  -2.826  -3.100   1.00 46.22  ? 165 G   F O6    1 
ATOM   5872 N  N1    . G   F 2 62 ? 16.047  -0.664  -2.640   1.00 55.96  ? 165 G   F N1    1 
ATOM   5873 C  C2    . G   F 2 62 ? 15.794  0.692   -2.587   1.00 54.40  ? 165 G   F C2    1 
ATOM   5874 N  N2    . G   F 2 62 ? 16.788  1.470   -2.132   1.00 47.74  ? 165 G   F N2    1 
ATOM   5875 N  N3    . G   F 2 62 ? 14.651  1.244   -2.954   1.00 52.27  ? 165 G   F N3    1 
ATOM   5876 C  C4    . G   F 2 62 ? 13.760  0.324   -3.388   1.00 60.23  ? 165 G   F C4    1 
ATOM   5877 P  P     . G   F 2 63 ? 13.345  3.448   -8.427   1.00 65.98  ? 166 G   F P     1 
ATOM   5878 O  OP1   . G   F 2 63 ? 12.305  4.017   -9.325   1.00 64.51  ? 166 G   F OP1   1 
ATOM   5879 O  OP2   . G   F 2 63 ? 13.674  2.002   -8.517   1.00 53.81  ? 166 G   F OP2   1 
ATOM   5880 O  "O5'" . G   F 2 63 ? 14.684  4.286   -8.595   1.00 70.91  ? 166 G   F "O5'" 1 
ATOM   5881 C  "C5'" . G   F 2 63 ? 15.944  3.637   -8.631   1.00 75.54  ? 166 G   F "C5'" 1 
ATOM   5882 C  "C4'" . G   F 2 63 ? 16.646  3.766   -7.300   1.00 75.47  ? 166 G   F "C4'" 1 
ATOM   5883 O  "O4'" . G   F 2 63 ? 15.935  2.998   -6.290   1.00 75.20  ? 166 G   F "O4'" 1 
ATOM   5884 C  "C3'" . G   F 2 63 ? 18.036  3.158   -7.315   1.00 77.77  ? 166 G   F "C3'" 1 
ATOM   5885 O  "O3'" . G   F 2 63 ? 18.966  4.091   -7.839   1.00 79.94  ? 166 G   F "O3'" 1 
ATOM   5886 C  "C2'" . G   F 2 63 ? 18.262  2.808   -5.852   1.00 74.08  ? 166 G   F "C2'" 1 
ATOM   5887 O  "O2'" . G   F 2 63 ? 18.642  3.908   -5.053   1.00 69.90  ? 166 G   F "O2'" 1 
ATOM   5888 C  "C1'" . G   F 2 63 ? 16.869  2.316   -5.459   1.00 74.64  ? 166 G   F "C1'" 1 
ATOM   5889 N  N9    . G   F 2 63 ? 16.689  0.877   -5.654   1.00 70.40  ? 166 G   F N9    1 
ATOM   5890 C  C8    . G   F 2 63 ? 15.562  0.243   -6.120   1.00 67.45  ? 166 G   F C8    1 
ATOM   5891 N  N7    . G   F 2 63 ? 15.681  -1.057  -6.157   1.00 65.50  ? 166 G   F N7    1 
ATOM   5892 C  C5    . G   F 2 63 ? 16.967  -1.300  -5.697   1.00 65.18  ? 166 G   F C5    1 
ATOM   5893 C  C6    . G   F 2 63 ? 17.658  -2.527  -5.506   1.00 63.74  ? 166 G   F C6    1 
ATOM   5894 O  O6    . G   F 2 63 ? 17.255  -3.679  -5.708   1.00 60.33  ? 166 G   F O6    1 
ATOM   5895 N  N1    . G   F 2 63 ? 18.947  -2.319  -5.023   1.00 66.37  ? 166 G   F N1    1 
ATOM   5896 C  C2    . G   F 2 63 ? 19.502  -1.089  -4.751   1.00 68.61  ? 166 G   F C2    1 
ATOM   5897 N  N2    . G   F 2 63 ? 20.765  -1.095  -4.291   1.00 59.68  ? 166 G   F N2    1 
ATOM   5898 N  N3    . G   F 2 63 ? 18.866  0.063   -4.917   1.00 70.46  ? 166 G   F N3    1 
ATOM   5899 C  C4    . G   F 2 63 ? 17.610  -0.117  -5.389   1.00 69.48  ? 166 G   F C4    1 
ATOM   5900 P  P     . A   F 2 64 ? 19.477  3.928   -9.354   1.00 78.34  ? 167 A   F P     1 
ATOM   5901 O  OP1   . A   F 2 64 ? 19.442  5.279   -9.976   1.00 79.34  ? 167 A   F OP1   1 
ATOM   5902 O  OP2   . A   F 2 64 ? 18.735  2.801   -9.984   1.00 71.34  ? 167 A   F OP2   1 
ATOM   5903 O  "O5'" . A   F 2 64 ? 20.990  3.486   -9.181   1.00 72.92  ? 167 A   F "O5'" 1 
ATOM   5904 C  "C5'" . A   F 2 64 ? 21.837  4.194   -8.291   1.00 76.23  ? 167 A   F "C5'" 1 
ATOM   5905 C  "C4'" . A   F 2 64 ? 22.811  3.248   -7.648   1.00 73.84  ? 167 A   F "C4'" 1 
ATOM   5906 O  "O4'" . A   F 2 64 ? 22.132  2.397   -6.681   1.00 73.14  ? 167 A   F "O4'" 1 
ATOM   5907 C  "C3'" . A   F 2 64 ? 23.433  2.255   -8.605   1.00 72.17  ? 167 A   F "C3'" 1 
ATOM   5908 O  "O3'" . A   F 2 64 ? 24.435  2.849   -9.422   1.00 69.67  ? 167 A   F "O3'" 1 
ATOM   5909 C  "C2'" . A   F 2 64 ? 23.923  1.198   -7.630   1.00 73.34  ? 167 A   F "C2'" 1 
ATOM   5910 O  "O2'" . A   F 2 64 ? 25.041  1.628   -6.878   1.00 68.71  ? 167 A   F "O2'" 1 
ATOM   5911 C  "C1'" . A   F 2 64 ? 22.700  1.092   -6.716   1.00 74.16  ? 167 A   F "C1'" 1 
ATOM   5912 N  N9    . A   F 2 64 ? 21.704  0.175   -7.277   1.00 75.24  ? 167 A   F N9    1 
ATOM   5913 C  C8    . A   F 2 64 ? 20.487  0.487   -7.842   1.00 76.20  ? 167 A   F C8    1 
ATOM   5914 N  N7    . A   F 2 64 ? 19.829  -0.556  -8.294   1.00 73.91  ? 167 A   F N7    1 
ATOM   5915 C  C5    . A   F 2 64 ? 20.662  -1.629  -7.999   1.00 75.78  ? 167 A   F C5    1 
ATOM   5916 C  C6    . A   F 2 64 ? 20.540  -3.018  -8.222   1.00 74.04  ? 167 A   F C6    1 
ATOM   5917 N  N6    . A   F 2 64 ? 19.489  -3.585  -8.820   1.00 72.65  ? 167 A   F N6    1 
ATOM   5918 N  N1    . A   F 2 64 ? 21.551  -3.812  -7.806   1.00 71.51  ? 167 A   F N1    1 
ATOM   5919 C  C2    . A   F 2 64 ? 22.606  -3.245  -7.209   1.00 72.61  ? 167 A   F C2    1 
ATOM   5920 N  N3    . A   F 2 64 ? 22.837  -1.958  -6.943   1.00 73.84  ? 167 A   F N3    1 
ATOM   5921 C  C4    . A   F 2 64 ? 21.816  -1.194  -7.367   1.00 74.85  ? 167 A   F C4    1 
ATOM   5922 P  P     . U   F 2 65 ? 24.352  2.678   -11.023  1.00 66.70  ? 168 U   F P     1 
ATOM   5923 O  OP1   . U   F 2 65 ? 24.895  3.903   -11.670  1.00 66.36  ? 168 U   F OP1   1 
ATOM   5924 O  OP2   . U   F 2 65 ? 22.975  2.226   -11.352  1.00 61.62  ? 168 U   F OP2   1 
ATOM   5925 O  "O5'" . U   F 2 65 ? 25.339  1.462   -11.307  1.00 62.84  ? 168 U   F "O5'" 1 
ATOM   5926 C  "C5'" . U   F 2 65 ? 26.346  1.113   -10.365  1.00 56.16  ? 168 U   F "C5'" 1 
ATOM   5927 C  "C4'" . U   F 2 65 ? 26.380  -0.382  -10.169  1.00 57.56  ? 168 U   F "C4'" 1 
ATOM   5928 O  "O4'" . U   F 2 65 ? 25.164  -0.838  -9.520   1.00 58.57  ? 168 U   F "O4'" 1 
ATOM   5929 C  "C3'" . U   F 2 65 ? 26.412  -1.191  -11.449  1.00 60.98  ? 168 U   F "C3'" 1 
ATOM   5930 O  "O3'" . U   F 2 65 ? 27.728  -1.225  -11.983  1.00 67.15  ? 168 U   F "O3'" 1 
ATOM   5931 C  "C2'" . U   F 2 65 ? 25.924  -2.556  -10.973  1.00 58.17  ? 168 U   F "C2'" 1 
ATOM   5932 O  "O2'" . U   F 2 65 ? 26.914  -3.323  -10.321  1.00 56.77  ? 168 U   F "O2'" 1 
ATOM   5933 C  "C1'" . U   F 2 65 ? 24.854  -2.154  -9.958   1.00 55.15  ? 168 U   F "C1'" 1 
ATOM   5934 N  N1    . U   F 2 65 ? 23.502  -2.158  -10.536  1.00 54.23  ? 168 U   F N1    1 
ATOM   5935 C  C2    . U   F 2 65 ? 22.885  -3.382  -10.698  1.00 53.39  ? 168 U   F C2    1 
ATOM   5936 O  O2    . U   F 2 65 ? 23.420  -4.436  -10.393  1.00 54.09  ? 168 U   F O2    1 
ATOM   5937 N  N3    . U   F 2 65 ? 21.622  -3.327  -11.234  1.00 51.73  ? 168 U   F N3    1 
ATOM   5938 C  C4    . U   F 2 65 ? 20.930  -2.196  -11.619  1.00 52.31  ? 168 U   F C4    1 
ATOM   5939 O  O4    . U   F 2 65 ? 19.796  -2.309  -12.081  1.00 51.31  ? 168 U   F O4    1 
ATOM   5940 C  C5    . U   F 2 65 ? 21.639  -0.971  -11.427  1.00 55.54  ? 168 U   F C5    1 
ATOM   5941 C  C6    . U   F 2 65 ? 22.871  -0.992  -10.904  1.00 56.82  ? 168 U   F C6    1 
ATOM   5942 P  P     . A   F 2 66 ? 27.941  -1.210  -13.575  1.00 63.23  ? 169 A   F P     1 
ATOM   5943 O  OP1   . A   F 2 66 ? 29.402  -1.296  -13.839  1.00 62.95  ? 169 A   F OP1   1 
ATOM   5944 O  OP2   . A   F 2 66 ? 27.157  -0.079  -14.130  1.00 56.61  ? 169 A   F OP2   1 
ATOM   5945 O  "O5'" . A   F 2 66 ? 27.264  -2.564  -14.056  1.00 61.19  ? 169 A   F "O5'" 1 
ATOM   5946 C  "C5'" . A   F 2 66 ? 27.045  -2.807  -15.431  1.00 62.93  ? 169 A   F "C5'" 1 
ATOM   5947 C  "C4'" . A   F 2 66 ? 26.917  -4.283  -15.668  1.00 61.51  ? 169 A   F "C4'" 1 
ATOM   5948 O  "O4'" . A   F 2 66 ? 28.175  -4.928  -15.372  1.00 61.52  ? 169 A   F "O4'" 1 
ATOM   5949 C  "C3'" . A   F 2 66 ? 25.925  -4.969  -14.754  1.00 58.22  ? 169 A   F "C3'" 1 
ATOM   5950 O  "O3'" . A   F 2 66 ? 24.631  -4.817  -15.302  1.00 54.58  ? 169 A   F "O3'" 1 
ATOM   5951 C  "C2'" . A   F 2 66 ? 26.412  -6.415  -14.765  1.00 59.11  ? 169 A   F "C2'" 1 
ATOM   5952 O  "O2'" . A   F 2 66 ? 25.974  -7.144  -15.904  1.00 55.23  ? 169 A   F "O2'" 1 
ATOM   5953 C  "C1'" . A   F 2 66 ? 27.927  -6.213  -14.842  1.00 56.45  ? 169 A   F "C1'" 1 
ATOM   5954 N  N9    . A   F 2 66 ? 28.672  -6.326  -13.596  1.00 46.70  ? 169 A   F N9    1 
ATOM   5955 C  C8    . A   F 2 66 ? 29.382  -5.348  -12.954  1.00 43.40  ? 169 A   F C8    1 
ATOM   5956 N  N7    . A   F 2 66 ? 30.045  -5.778  -11.911  1.00 46.83  ? 169 A   F N7    1 
ATOM   5957 C  C5    . A   F 2 66 ? 29.727  -7.127  -11.849  1.00 44.30  ? 169 A   F C5    1 
ATOM   5958 C  C6    . A   F 2 66 ? 30.118  -8.157  -10.973  1.00 44.49  ? 169 A   F C6    1 
ATOM   5959 N  N6    . A   F 2 66 ? 30.960  -7.990  -9.951   1.00 41.21  ? 169 A   F N6    1 
ATOM   5960 N  N1    . A   F 2 66 ? 29.609  -9.389  -11.190  1.00 46.74  ? 169 A   F N1    1 
ATOM   5961 C  C2    . A   F 2 66 ? 28.771  -9.565  -12.220  1.00 48.99  ? 169 A   F C2    1 
ATOM   5962 N  N3    . A   F 2 66 ? 28.336  -8.678  -13.113  1.00 50.28  ? 169 A   F N3    1 
ATOM   5963 C  C4    . A   F 2 66 ? 28.860  -7.468  -12.867  1.00 45.92  ? 169 A   F C4    1 
ATOM   5964 P  P     . A   F 2 67 ? 23.460  -4.235  -14.388  1.00 48.20  ? 170 A   F P     1 
ATOM   5965 O  OP1   . A   F 2 67 ? 22.302  -3.924  -15.262  1.00 50.89  ? 170 A   F OP1   1 
ATOM   5966 O  OP2   . A   F 2 67 ? 24.058  -3.177  -13.546  1.00 45.98  ? 170 A   F OP2   1 
ATOM   5967 O  "O5'" . A   F 2 67 ? 23.071  -5.475  -13.471  1.00 58.09  ? 170 A   F "O5'" 1 
ATOM   5968 C  "C5'" . A   F 2 67 ? 22.582  -6.671  -14.068  1.00 59.05  ? 170 A   F "C5'" 1 
ATOM   5969 C  "C4'" . A   F 2 67 ? 22.777  -7.845  -13.143  1.00 57.49  ? 170 A   F "C4'" 1 
ATOM   5970 O  "O4'" . A   F 2 67 ? 24.184  -8.104  -12.935  1.00 57.28  ? 170 A   F "O4'" 1 
ATOM   5971 C  "C3'" . A   F 2 67 ? 22.212  -7.679  -11.748  1.00 56.04  ? 170 A   F "C3'" 1 
ATOM   5972 O  "O3'" . A   F 2 67 ? 20.836  -8.008  -11.795  1.00 55.25  ? 170 A   F "O3'" 1 
ATOM   5973 C  "C2'" . A   F 2 67 ? 23.005  -8.711  -10.954  1.00 57.91  ? 170 A   F "C2'" 1 
ATOM   5974 O  "O2'" . A   F 2 67 ? 22.471  -10.014 -11.076  1.00 58.78  ? 170 A   F "O2'" 1 
ATOM   5975 C  "C1'" . A   F 2 67 ? 24.370  -8.656  -11.648  1.00 58.72  ? 170 A   F "C1'" 1 
ATOM   5976 N  N9    . A   F 2 67 ? 25.369  -7.851  -10.954  1.00 63.91  ? 170 A   F N9    1 
ATOM   5977 C  C8    . A   F 2 67 ? 25.743  -6.554  -11.212  1.00 62.15  ? 170 A   F C8    1 
ATOM   5978 N  N7    . A   F 2 67 ? 26.708  -6.121  -10.437  1.00 62.15  ? 170 A   F N7    1 
ATOM   5979 C  C5    . A   F 2 67 ? 26.978  -7.201  -9.605   1.00 61.19  ? 170 A   F C5    1 
ATOM   5980 C  C6    . A   F 2 67 ? 27.901  -7.387  -8.559   1.00 57.31  ? 170 A   F C6    1 
ATOM   5981 N  N6    . A   F 2 67 ? 28.759  -6.452  -8.157   1.00 54.21  ? 170 A   F N6    1 
ATOM   5982 N  N1    . A   F 2 67 ? 27.912  -8.585  -7.932   1.00 55.56  ? 170 A   F N1    1 
ATOM   5983 C  C2    . A   F 2 67 ? 27.050  -9.525  -8.335   1.00 57.90  ? 170 A   F C2    1 
ATOM   5984 N  N3    . A   F 2 67 ? 26.138  -9.473  -9.303   1.00 62.85  ? 170 A   F N3    1 
ATOM   5985 C  C4    . A   F 2 67 ? 26.154  -8.269  -9.907   1.00 64.22  ? 170 A   F C4    1 
ATOM   5986 P  P     . U   F 2 68 ? 19.873  -7.567  -10.604  1.00 54.73  ? 171 U   F P     1 
ATOM   5987 O  OP1   . U   F 2 68 ? 18.487  -7.873  -11.041  1.00 57.88  ? 171 U   F OP1   1 
ATOM   5988 O  OP2   . U   F 2 68 ? 20.237  -6.170  -10.265  1.00 53.73  ? 171 U   F OP2   1 
ATOM   5989 O  "O5'" . U   F 2 68 ? 20.286  -8.547  -9.410   1.00 50.07  ? 171 U   F "O5'" 1 
ATOM   5990 C  "C5'" . U   F 2 68 ? 19.914  -9.930  -9.431   1.00 46.27  ? 171 U   F "C5'" 1 
ATOM   5991 C  "C4'" . U   F 2 68 ? 20.473  -10.666 -8.225   1.00 47.75  ? 171 U   F "C4'" 1 
ATOM   5992 O  "O4'" . U   F 2 68 ? 21.921  -10.610 -8.255   1.00 55.66  ? 171 U   F "O4'" 1 
ATOM   5993 C  "C3'" . U   F 2 68 ? 20.111  -10.141 -6.841   1.00 50.31  ? 171 U   F "C3'" 1 
ATOM   5994 O  "O3'" . U   F 2 68 ? 18.839  -10.625 -6.420   1.00 49.82  ? 171 U   F "O3'" 1 
ATOM   5995 C  "C2'" . U   F 2 68 ? 21.240  -10.699 -5.970   1.00 52.41  ? 171 U   F "C2'" 1 
ATOM   5996 O  "O2'" . U   F 2 68 ? 21.058  -12.026 -5.517   1.00 49.85  ? 171 U   F "O2'" 1 
ATOM   5997 C  "C1'" . U   F 2 68 ? 22.432  -10.646 -6.929   1.00 54.71  ? 171 U   F "C1'" 1 
ATOM   5998 N  N1    . U   F 2 68 ? 23.274  -9.460  -6.705   1.00 52.36  ? 171 U   F N1    1 
ATOM   5999 C  C2    . U   F 2 68 ? 24.384  -9.616  -5.902   1.00 51.06  ? 171 U   F C2    1 
ATOM   6000 O  O2    . U   F 2 68 ? 24.703  -10.687 -5.415   1.00 50.33  ? 171 U   F O2    1 
ATOM   6001 N  N3    . U   F 2 68 ? 25.108  -8.471  -5.690   1.00 52.35  ? 171 U   F N3    1 
ATOM   6002 C  C4    . U   F 2 68 ? 24.844  -7.213  -6.194   1.00 51.41  ? 171 U   F C4    1 
ATOM   6003 O  O4    . U   F 2 68 ? 25.589  -6.277  -5.901   1.00 48.21  ? 171 U   F O4    1 
ATOM   6004 C  C5    . U   F 2 68 ? 23.687  -7.136  -7.030   1.00 48.95  ? 171 U   F C5    1 
ATOM   6005 C  C6    . U   F 2 68 ? 22.961  -8.236  -7.254   1.00 49.87  ? 171 U   F C6    1 
ATOM   6006 P  P     . G   F 2 69 ? 18.021  -9.850  -5.269   1.00 48.73  ? 172 G   F P     1 
ATOM   6007 O  OP1   . G   F 2 69 ? 16.720  -10.542 -5.133   1.00 52.21  ? 172 G   F OP1   1 
ATOM   6008 O  OP2   . G   F 2 69 ? 18.046  -8.394  -5.560   1.00 39.16  ? 172 G   F OP2   1 
ATOM   6009 O  "O5'" . G   F 2 69 ? 18.855  -10.125 -3.939   1.00 52.62  ? 172 G   F "O5'" 1 
ATOM   6010 C  "C5'" . G   F 2 69 ? 18.359  -9.724  -2.657   1.00 58.55  ? 172 G   F "C5'" 1 
ATOM   6011 C  "C4'" . G   F 2 69 ? 18.944  -10.600 -1.571   1.00 60.64  ? 172 G   F "C4'" 1 
ATOM   6012 O  "O4'" . G   F 2 69 ? 18.261  -11.882 -1.496   1.00 66.23  ? 172 G   F "O4'" 1 
ATOM   6013 C  "C3'" . G   F 2 69 ? 20.392  -10.970 -1.801   1.00 62.06  ? 172 G   F "C3'" 1 
ATOM   6014 O  "O3'" . G   F 2 69 ? 21.250  -9.933  -1.368   1.00 55.32  ? 172 G   F "O3'" 1 
ATOM   6015 C  "C2'" . G   F 2 69 ? 20.567  -12.244 -0.974   1.00 66.65  ? 172 G   F "C2'" 1 
ATOM   6016 O  "O2'" . G   F 2 69 ? 20.913  -11.988 0.375    1.00 70.31  ? 172 G   F "O2'" 1 
ATOM   6017 C  "C1'" . G   F 2 69 ? 19.177  -12.886 -1.072   1.00 64.93  ? 172 G   F "C1'" 1 
ATOM   6018 N  N9    . G   F 2 69 ? 19.080  -14.031 -1.979   1.00 60.33  ? 172 G   F N9    1 
ATOM   6019 C  C8    . G   F 2 69 ? 18.904  -13.998 -3.342   1.00 63.65  ? 172 G   F C8    1 
ATOM   6020 N  N7    . G   F 2 69 ? 18.828  -15.186 -3.881   1.00 61.77  ? 172 G   F N7    1 
ATOM   6021 C  C5    . G   F 2 69 ? 18.969  -16.060 -2.811   1.00 60.01  ? 172 G   F C5    1 
ATOM   6022 C  C6    . G   F 2 69 ? 18.966  -17.488 -2.773   1.00 60.21  ? 172 G   F C6    1 
ATOM   6023 O  O6    . G   F 2 69 ? 18.843  -18.292 -3.712   1.00 62.67  ? 172 G   F O6    1 
ATOM   6024 N  N1    . G   F 2 69 ? 19.132  -17.962 -1.476   1.00 52.45  ? 172 G   F N1    1 
ATOM   6025 C  C2    . G   F 2 69 ? 19.287  -17.177 -0.364   1.00 44.47  ? 172 G   F C2    1 
ATOM   6026 N  N2    . G   F 2 69 ? 19.438  -17.825 0.796    1.00 38.99  ? 172 G   F N2    1 
ATOM   6027 N  N3    . G   F 2 69 ? 19.295  -15.856 -0.386   1.00 48.42  ? 172 G   F N3    1 
ATOM   6028 C  C4    . G   F 2 69 ? 19.131  -15.366 -1.631   1.00 56.08  ? 172 G   F C4    1 
ATOM   6029 P  P     . C   F 2 70 ? 22.828  -10.156 -1.440   1.00 59.69  ? 173 C   F P     1 
ATOM   6030 O  OP1   . C   F 2 70 ? 23.051  -11.216 -2.457   1.00 65.83  ? 173 C   F OP1   1 
ATOM   6031 O  OP2   . C   F 2 70 ? 23.322  -10.350 -0.050   1.00 62.21  ? 173 C   F OP2   1 
ATOM   6032 O  "O5'" . C   F 2 70 ? 23.396  -8.788  -2.011   1.00 55.02  ? 173 C   F "O5'" 1 
ATOM   6033 C  "C5'" . C   F 2 70 ? 24.772  -8.462  -1.883   1.00 47.00  ? 173 C   F "C5'" 1 
ATOM   6034 C  "C4'" . C   F 2 70 ? 24.942  -6.973  -1.956   1.00 46.87  ? 173 C   F "C4'" 1 
ATOM   6035 O  "O4'" . C   F 2 70 ? 24.514  -6.517  -3.266   1.00 46.46  ? 173 C   F "O4'" 1 
ATOM   6036 C  "C3'" . C   F 2 70 ? 24.035  -6.214  -1.012   1.00 51.72  ? 173 C   F "C3'" 1 
ATOM   6037 O  "O3'" . C   F 2 70 ? 24.573  -6.145  0.294    1.00 57.10  ? 173 C   F "O3'" 1 
ATOM   6038 C  "C2'" . C   F 2 70 ? 23.957  -4.857  -1.683   1.00 52.96  ? 173 C   F "C2'" 1 
ATOM   6039 O  "O2'" . C   F 2 70 ? 25.130  -4.097  -1.481   1.00 54.10  ? 173 C   F "O2'" 1 
ATOM   6040 C  "C1'" . C   F 2 70 ? 23.838  -5.276  -3.147   1.00 52.41  ? 173 C   F "C1'" 1 
ATOM   6041 N  N1    . C   F 2 70 ? 22.436  -5.480  -3.544   1.00 58.32  ? 173 C   F N1    1 
ATOM   6042 C  C2    . C   F 2 70 ? 21.654  -4.361  -3.882   1.00 62.80  ? 173 C   F C2    1 
ATOM   6043 O  O2    . C   F 2 70 ? 22.173  -3.233  -3.859   1.00 58.33  ? 173 C   F O2    1 
ATOM   6044 N  N3    . C   F 2 70 ? 20.354  -4.541  -4.222   1.00 67.29  ? 173 C   F N3    1 
ATOM   6045 C  C4    . C   F 2 70 ? 19.830  -5.771  -4.232   1.00 70.56  ? 173 C   F C4    1 
ATOM   6046 N  N4    . C   F 2 70 ? 18.536  -5.900  -4.564   1.00 68.92  ? 173 C   F N4    1 
ATOM   6047 C  C5    . C   F 2 70 ? 20.607  -6.926  -3.901   1.00 69.06  ? 173 C   F C5    1 
ATOM   6048 C  C6    . C   F 2 70 ? 21.893  -6.735  -3.570   1.00 61.84  ? 173 C   F C6    1 
ATOM   6049 P  P     . C   F 2 71 ? 23.578  -6.023  1.543    1.00 59.77  ? 174 C   F P     1 
ATOM   6050 O  OP1   . C   F 2 71 ? 24.348  -6.251  2.789    1.00 59.34  ? 174 C   F OP1   1 
ATOM   6051 O  OP2   . C   F 2 71 ? 22.368  -6.843  1.246    1.00 55.35  ? 174 C   F OP2   1 
ATOM   6052 O  "O5'" . C   F 2 71 ? 23.136  -4.504  1.508    1.00 53.49  ? 174 C   F "O5'" 1 
ATOM   6053 C  "C5'" . C   F 2 71 ? 24.100  -3.478  1.487    1.00 45.58  ? 174 C   F "C5'" 1 
ATOM   6054 C  "C4'" . C   F 2 71 ? 23.410  -2.164  1.301    1.00 49.29  ? 174 C   F "C4'" 1 
ATOM   6055 O  "O4'" . C   F 2 71 ? 22.860  -2.091  -0.036   1.00 46.02  ? 174 C   F "O4'" 1 
ATOM   6056 C  "C3'" . C   F 2 71 ? 22.184  -1.998  2.169    1.00 52.05  ? 174 C   F "C3'" 1 
ATOM   6057 O  "O3'" . C   F 2 71 ? 22.541  -1.650  3.491    1.00 63.01  ? 174 C   F "O3'" 1 
ATOM   6058 C  "C2'" . C   F 2 71 ? 21.425  -0.904  1.437    1.00 47.22  ? 174 C   F "C2'" 1 
ATOM   6059 O  "O2'" . C   F 2 71 ? 21.938  0.390   1.687    1.00 43.41  ? 174 C   F "O2'" 1 
ATOM   6060 C  "C1'" . C   F 2 71 ? 21.684  -1.297  -0.018   1.00 46.81  ? 174 C   F "C1'" 1 
ATOM   6061 N  N1    . C   F 2 71 ? 20.595  -2.083  -0.608   1.00 47.87  ? 174 C   F N1    1 
ATOM   6062 C  C2    . C   F 2 71 ? 19.545  -1.405  -1.239   1.00 50.12  ? 174 C   F C2    1 
ATOM   6063 O  O2    . C   F 2 71 ? 19.561  -0.163  -1.263   1.00 45.39  ? 174 C   F O2    1 
ATOM   6064 N  N3    . C   F 2 71 ? 18.545  -2.117  -1.805   1.00 51.84  ? 174 C   F N3    1 
ATOM   6065 C  C4    . C   F 2 71 ? 18.566  -3.452  -1.754   1.00 55.93  ? 174 C   F C4    1 
ATOM   6066 N  N4    . C   F 2 71 ? 17.563  -4.115  -2.337   1.00 62.26  ? 174 C   F N4    1 
ATOM   6067 C  C5    . C   F 2 71 ? 19.619  -4.167  -1.106   1.00 52.09  ? 174 C   F C5    1 
ATOM   6068 C  C6    . C   F 2 71 ? 20.603  -3.448  -0.552   1.00 47.47  ? 174 C   F C6    1 
ATOM   6069 P  P     . A   F 2 72 ? 21.554  -2.029  4.692    1.00 67.99  ? 175 A   F P     1 
ATOM   6070 O  OP1   . A   F 2 72 ? 22.343  -2.070  5.950    1.00 68.56  ? 175 A   F OP1   1 
ATOM   6071 O  OP2   . A   F 2 72 ? 20.772  -3.227  4.274    1.00 65.22  ? 175 A   F OP2   1 
ATOM   6072 O  "O5'" . A   F 2 72 ? 20.571  -0.783  4.740    1.00 58.22  ? 175 A   F "O5'" 1 
ATOM   6073 C  "C5'" . A   F 2 72 ? 19.185  -0.969  4.926    1.00 56.70  ? 175 A   F "C5'" 1 
ATOM   6074 C  "C4'" . A   F 2 72 ? 18.425  0.007   4.081    1.00 60.69  ? 175 A   F "C4'" 1 
ATOM   6075 O  "O4'" . A   F 2 72 ? 18.606  -0.314  2.678    1.00 64.38  ? 175 A   F "O4'" 1 
ATOM   6076 C  "C3'" . A   F 2 72 ? 16.928  -0.062  4.263    1.00 65.99  ? 175 A   F "C3'" 1 
ATOM   6077 O  "O3'" . A   F 2 72 ? 16.572  0.658   5.423    1.00 68.03  ? 175 A   F "O3'" 1 
ATOM   6078 C  "C2'" . A   F 2 72 ? 16.437  0.572   2.974    1.00 66.58  ? 175 A   F "C2'" 1 
ATOM   6079 O  "O2'" . A   F 2 72 ? 16.628  1.971   2.966    1.00 71.58  ? 175 A   F "O2'" 1 
ATOM   6080 C  "C1'" . A   F 2 72 ? 17.397  -0.062  1.974    1.00 67.08  ? 175 A   F "C1'" 1 
ATOM   6081 N  N9    . A   F 2 72 ? 16.896  -1.333  1.451    1.00 69.89  ? 175 A   F N9    1 
ATOM   6082 C  C8    . A   F 2 72 ? 17.490  -2.573  1.502    1.00 71.03  ? 175 A   F C8    1 
ATOM   6083 N  N7    . A   F 2 72 ? 16.794  -3.518  0.915    1.00 68.02  ? 175 A   F N7    1 
ATOM   6084 C  C5    . A   F 2 72 ? 15.662  -2.858  0.452    1.00 70.31  ? 175 A   F C5    1 
ATOM   6085 C  C6    . A   F 2 72 ? 14.532  -3.300  -0.259   1.00 69.62  ? 175 A   F C6    1 
ATOM   6086 N  N6    . A   F 2 72 ? 14.347  -4.564  -0.651   1.00 68.60  ? 175 A   F N6    1 
ATOM   6087 N  N1    . A   F 2 72 ? 13.584  -2.386  -0.558   1.00 69.99  ? 175 A   F N1    1 
ATOM   6088 C  C2    . A   F 2 72 ? 13.767  -1.118  -0.165   1.00 69.59  ? 175 A   F C2    1 
ATOM   6089 N  N3    . A   F 2 72 ? 14.784  -0.582  0.503    1.00 70.10  ? 175 A   F N3    1 
ATOM   6090 C  C4    . A   F 2 72 ? 15.709  -1.515  0.783    1.00 70.48  ? 175 A   F C4    1 
ATOM   6091 P  P     . G   F 2 73 ? 15.809  -0.101  6.606    1.00 69.68  ? 176 G   F P     1 
ATOM   6092 O  OP1   . G   F 2 73 ? 15.982  0.695   7.846    1.00 72.06  ? 176 G   F OP1   1 
ATOM   6093 O  OP2   . G   F 2 73 ? 16.238  -1.522  6.583    1.00 63.40  ? 176 G   F OP2   1 
ATOM   6094 O  "O5'" . G   F 2 73 ? 14.288  -0.026  6.148    1.00 65.94  ? 176 G   F "O5'" 1 
ATOM   6095 C  "C5'" . G   F 2 73 ? 13.697  1.223   5.810    1.00 64.22  ? 176 G   F "C5'" 1 
ATOM   6096 C  "C4'" . G   F 2 73 ? 12.416  0.999   5.053    1.00 64.80  ? 176 G   F "C4'" 1 
ATOM   6097 O  "O4'" . G   F 2 73 ? 12.710  0.441   3.745    1.00 65.62  ? 176 G   F "O4'" 1 
ATOM   6098 C  "C3'" . G   F 2 73 ? 11.484  -0.018  5.684    1.00 66.44  ? 176 G   F "C3'" 1 
ATOM   6099 O  "O3'" . G   F 2 73 ? 10.719  0.577   6.725    1.00 63.94  ? 176 G   F "O3'" 1 
ATOM   6100 C  "C2'" . G   F 2 73 ? 10.638  -0.456  4.491    1.00 67.58  ? 176 G   F "C2'" 1 
ATOM   6101 O  "O2'" . G   F 2 73 ? 9.611   0.456   4.154    1.00 69.12  ? 176 G   F "O2'" 1 
ATOM   6102 C  "C1'" . G   F 2 73 ? 11.680  -0.463  3.371    1.00 64.54  ? 176 G   F "C1'" 1 
ATOM   6103 N  N9    . G   F 2 73 ? 12.278  -1.775  3.138    1.00 57.46  ? 176 G   F N9    1 
ATOM   6104 C  C8    . G   F 2 73 ? 13.506  -2.212  3.566    1.00 53.69  ? 176 G   F C8    1 
ATOM   6105 N  N7    . G   F 2 73 ? 13.776  -3.429  3.186    1.00 49.88  ? 176 G   F N7    1 
ATOM   6106 C  C5    . G   F 2 73 ? 12.655  -3.823  2.467    1.00 49.69  ? 176 G   F C5    1 
ATOM   6107 C  C6    . G   F 2 73 ? 12.367  -5.048  1.803    1.00 50.09  ? 176 G   F C6    1 
ATOM   6108 O  O6    . G   F 2 73 ? 13.065  -6.062  1.715    1.00 52.39  ? 176 G   F O6    1 
ATOM   6109 N  N1    . G   F 2 73 ? 11.120  -5.019  1.197    1.00 50.05  ? 176 G   F N1    1 
ATOM   6110 C  C2    . G   F 2 73 ? 10.255  -3.959  1.222    1.00 53.19  ? 176 G   F C2    1 
ATOM   6111 N  N2    . G   F 2 73 ? 9.092   -4.136  0.571    1.00 50.04  ? 176 G   F N2    1 
ATOM   6112 N  N3    . G   F 2 73 ? 10.508  -2.812  1.835    1.00 54.78  ? 176 G   F N3    1 
ATOM   6113 C  C4    . G   F 2 73 ? 11.719  -2.815  2.432    1.00 52.09  ? 176 G   F C4    1 
ATOM   6114 P  P     . C   F 2 74 ? 10.282  -0.305  7.992    1.00 64.76  ? 177 C   F P     1 
ATOM   6115 O  OP1   . C   F 2 74 ? 9.454   0.566   8.851    1.00 68.34  ? 177 C   F OP1   1 
ATOM   6116 O  OP2   . C   F 2 74 ? 11.491  -0.958  8.560    1.00 65.11  ? 177 C   F OP2   1 
ATOM   6117 O  "O5'" . C   F 2 74 ? 9.346   -1.443  7.378    1.00 62.84  ? 177 C   F "O5'" 1 
ATOM   6118 C  "C5'" . C   F 2 74 ? 8.037   -1.147  6.891    1.00 56.72  ? 177 C   F "C5'" 1 
ATOM   6119 C  "C4'" . C   F 2 74 ? 7.434   -2.368  6.228    1.00 58.18  ? 177 C   F "C4'" 1 
ATOM   6120 O  "O4'" . C   F 2 74 ? 8.224   -2.722  5.061    1.00 55.79  ? 177 C   F "O4'" 1 
ATOM   6121 C  "C3'" . C   F 2 74 ? 7.412   -3.631  7.078    1.00 57.84  ? 177 C   F "C3'" 1 
ATOM   6122 O  "O3'" . C   F 2 74 ? 6.261   -3.670  7.914    1.00 58.14  ? 177 C   F "O3'" 1 
ATOM   6123 C  "C2'" . C   F 2 74 ? 7.419   -4.743  6.029    1.00 53.42  ? 177 C   F "C2'" 1 
ATOM   6124 O  "O2'" . C   F 2 74 ? 6.151   -5.072  5.484    1.00 44.77  ? 177 C   F "O2'" 1 
ATOM   6125 C  "C1'" . C   F 2 74 ? 8.331   -4.136  4.960    1.00 48.79  ? 177 C   F "C1'" 1 
ATOM   6126 N  N1    . C   F 2 74 ? 9.738   -4.498  5.176    1.00 38.25  ? 177 C   F N1    1 
ATOM   6127 C  C2    . C   F 2 74 ? 10.186  -5.733  4.728    1.00 32.99  ? 177 C   F C2    1 
ATOM   6128 O  O2    . C   F 2 74 ? 9.400   -6.470  4.133    1.00 31.77  ? 177 C   F O2    1 
ATOM   6129 N  N3    . C   F 2 74 ? 11.463  -6.096  4.956    1.00 30.53  ? 177 C   F N3    1 
ATOM   6130 C  C4    . C   F 2 74 ? 12.281  -5.269  5.604    1.00 22.46  ? 177 C   F C4    1 
ATOM   6131 N  N4    . C   F 2 74 ? 13.520  -5.679  5.828    1.00 17.72  ? 177 C   F N4    1 
ATOM   6132 C  C5    . C   F 2 74 ? 11.857  -3.990  6.054    1.00 23.82  ? 177 C   F C5    1 
ATOM   6133 C  C6    . C   F 2 74 ? 10.590  -3.648  5.821    1.00 33.03  ? 177 C   F C6    1 
ATOM   6134 P  P     . G   F 2 75 ? 6.326   -4.449  9.312    1.00 51.53  ? 178 G   F P     1 
ATOM   6135 O  OP1   . G   F 2 75 ? 6.512   -5.884  9.002    1.00 48.54  ? 178 G   F OP1   1 
ATOM   6136 O  OP2   . G   F 2 75 ? 5.128   -4.014  10.062   1.00 54.14  ? 178 G   F OP2   1 
ATOM   6137 O  "O5'" . G   F 2 75 ? 7.652   -3.871  9.999    1.00 59.11  ? 178 G   F "O5'" 1 
ATOM   6138 C  "C5'" . G   F 2 75 ? 7.960   -4.101  11.386   1.00 59.41  ? 178 G   F "C5'" 1 
ATOM   6139 C  "C4'" . G   F 2 75 ? 9.410   -4.516  11.533   1.00 62.35  ? 178 G   F "C4'" 1 
ATOM   6140 O  "O4'" . G   F 2 75 ? 9.582   -5.736  10.791   1.00 62.70  ? 178 G   F "O4'" 1 
ATOM   6141 C  "C3'" . G   F 2 75 ? 10.447  -3.526  10.996   1.00 64.82  ? 178 G   F "C3'" 1 
ATOM   6142 O  "O3'" . G   F 2 75 ? 11.158  -2.880  12.077   1.00 73.68  ? 178 G   F "O3'" 1 
ATOM   6143 C  "C2'" . G   F 2 75 ? 11.513  -4.400  10.304   1.00 65.50  ? 178 G   F "C2'" 1 
ATOM   6144 O  "O2'" . G   F 2 75 ? 12.760  -4.412  10.973   1.00 69.23  ? 178 G   F "O2'" 1 
ATOM   6145 C  "C1'" . G   F 2 75 ? 10.903  -5.811  10.333   1.00 64.81  ? 178 G   F "C1'" 1 
ATOM   6146 N  N9    . G   F 2 75 ? 10.941  -6.641  9.133    1.00 57.34  ? 178 G   F N9    1 
ATOM   6147 C  C8    . G   F 2 75 ? 9.874   -7.009  8.354    1.00 51.99  ? 178 G   F C8    1 
ATOM   6148 N  N7    . G   F 2 75 ? 10.205  -7.796  7.368    1.00 54.71  ? 178 G   F N7    1 
ATOM   6149 C  C5    . G   F 2 75 ? 11.579  -7.949  7.493    1.00 59.51  ? 178 G   F C5    1 
ATOM   6150 C  C6    . G   F 2 75 ? 12.505  -8.687  6.693    1.00 63.64  ? 178 G   F C6    1 
ATOM   6151 O  O6    . G   F 2 75 ? 12.284  -9.373  5.682    1.00 63.50  ? 178 G   F O6    1 
ATOM   6152 N  N1    . G   F 2 75 ? 13.806  -8.565  7.177    1.00 64.34  ? 178 G   F N1    1 
ATOM   6153 C  C2    . G   F 2 75 ? 14.177  -7.828  8.280    1.00 59.32  ? 178 G   F C2    1 
ATOM   6154 N  N2    . G   F 2 75 ? 15.490  -7.838  8.580    1.00 53.36  ? 178 G   F N2    1 
ATOM   6155 N  N3    . G   F 2 75 ? 13.325  -7.133  9.029    1.00 55.14  ? 178 G   F N3    1 
ATOM   6156 C  C4    . G   F 2 75 ? 12.052  -7.238  8.579    1.00 57.75  ? 178 G   F C4    1 
ATOM   6157 P  P     . U   F 2 76 ? 10.409  -1.901  13.131   1.00 74.52  ? 179 U   F P     1 
ATOM   6158 O  OP1   . U   F 2 76 ? 9.350   -1.137  12.421   1.00 70.55  ? 179 U   F OP1   1 
ATOM   6159 O  OP2   . U   F 2 76 ? 11.504  -1.166  13.819   1.00 64.45  ? 179 U   F OP2   1 
ATOM   6160 O  "O5'" . U   F 2 76 ? 9.732   -2.858  14.226   1.00 74.28  ? 179 U   F "O5'" 1 
ATOM   6161 C  "C5'" . U   F 2 76 ? 10.471  -3.920  14.855   1.00 80.43  ? 179 U   F "C5'" 1 
ATOM   6162 C  "C4'" . U   F 2 76 ? 9.965   -4.185  16.269   1.00 79.54  ? 179 U   F "C4'" 1 
ATOM   6163 O  "O4'" . U   F 2 76 ? 10.204  -3.027  17.099   1.00 85.86  ? 179 U   F "O4'" 1 
ATOM   6164 C  "C3'" . U   F 2 76 ? 8.481   -4.518  16.455   1.00 79.21  ? 179 U   F "C3'" 1 
ATOM   6165 O  "O3'" . U   F 2 76 ? 8.266   -5.929  16.612   1.00 66.79  ? 179 U   F "O3'" 1 
ATOM   6166 C  "C2'" . U   F 2 76 ? 8.145   -3.983  17.858   1.00 86.89  ? 179 U   F "C2'" 1 
ATOM   6167 O  "O2'" . U   F 2 76 ? 8.045   -5.005  18.832   1.00 93.90  ? 179 U   F "O2'" 1 
ATOM   6168 C  "C1'" . U   F 2 76 ? 9.351   -3.111  18.213   1.00 89.85  ? 179 U   F "C1'" 1 
ATOM   6169 N  N1    . U   F 2 76 ? 9.132   -1.786  18.815   1.00 92.54  ? 179 U   F N1    1 
ATOM   6170 C  C2    . U   F 2 76 ? 8.072   -1.640  19.708   1.00 94.22  ? 179 U   F C2    1 
ATOM   6171 O  O2    . U   F 2 76 ? 7.281   -2.539  19.968   1.00 87.29  ? 179 U   F O2    1 
ATOM   6172 N  N3    . U   F 2 76 ? 7.973   -0.399  20.290   1.00 98.42  ? 179 U   F N3    1 
ATOM   6173 C  C4    . U   F 2 76 ? 8.796   0.692   20.076   1.00 99.30  ? 179 U   F C4    1 
ATOM   6174 O  O4    . U   F 2 76 ? 8.577   1.744   20.684   1.00 97.00  ? 179 U   F O4    1 
ATOM   6175 C  C5    . U   F 2 76 ? 9.850   0.468   19.128   1.00 97.65  ? 179 U   F C5    1 
ATOM   6176 C  C6    . U   F 2 76 ? 9.974   -0.730  18.541   1.00 95.09  ? 179 U   F C6    1 
ATOM   6177 P  P     . A   F 2 77 ? 8.306   -6.931  15.359   1.00 59.75  ? 180 A   F P     1 
ATOM   6178 O  OP1   . A   F 2 77 ? 7.608   -8.178  15.772   1.00 54.84  ? 180 A   F OP1   1 
ATOM   6179 O  OP2   . A   F 2 77 ? 9.713   -7.007  14.894   1.00 57.00  ? 180 A   F OP2   1 
ATOM   6180 O  "O5'" . A   F 2 77 ? 7.414   -6.228  14.246   1.00 58.85  ? 180 A   F "O5'" 1 
ATOM   6181 C  "C5'" . A   F 2 77 ? 6.011   -6.073  14.423   1.00 52.63  ? 180 A   F "C5'" 1 
ATOM   6182 C  "C4'" . A   F 2 77 ? 5.252   -7.002  13.498   1.00 49.63  ? 180 A   F "C4'" 1 
ATOM   6183 O  "O4'" . A   F 2 77 ? 5.771   -6.870  12.151   1.00 48.19  ? 180 A   F "O4'" 1 
ATOM   6184 C  "C3'" . A   F 2 77 ? 5.364   -8.488  13.780   1.00 46.67  ? 180 A   F "C3'" 1 
ATOM   6185 O  "O3'" . A   F 2 77 ? 4.401   -8.869  14.750   1.00 56.18  ? 180 A   F "O3'" 1 
ATOM   6186 C  "C2'" . A   F 2 77 ? 4.991   -9.088  12.437   1.00 43.18  ? 180 A   F "C2'" 1 
ATOM   6187 O  "O2'" . A   F 2 77 ? 3.594   -9.095  12.253   1.00 31.66  ? 180 A   F "O2'" 1 
ATOM   6188 C  "C1'" . A   F 2 77 ? 5.643   -8.103  11.468   1.00 47.48  ? 180 A   F "C1'" 1 
ATOM   6189 N  N9    . A   F 2 77 ? 6.972   -8.505  11.001   1.00 55.82  ? 180 A   F N9    1 
ATOM   6190 C  C8    . A   F 2 77 ? 8.178   -7.993  11.410   1.00 60.26  ? 180 A   F C8    1 
ATOM   6191 N  N7    . A   F 2 77 ? 9.216   -8.540  10.821   1.00 65.12  ? 180 A   F N7    1 
ATOM   6192 C  C5    . A   F 2 77 ? 8.658   -9.481  9.964    1.00 62.62  ? 180 A   F C5    1 
ATOM   6193 C  C6    . A   F 2 77 ? 9.231   -10.399 9.055    1.00 60.29  ? 180 A   F C6    1 
ATOM   6194 N  N6    . A   F 2 77 ? 10.547  -10.524 8.855    1.00 62.01  ? 180 A   F N6    1 
ATOM   6195 N  N1    . A   F 2 77 ? 8.395   -11.193 8.353    1.00 52.62  ? 180 A   F N1    1 
ATOM   6196 C  C2    . A   F 2 77 ? 7.079   -11.068 8.552    1.00 53.36  ? 180 A   F C2    1 
ATOM   6197 N  N3    . A   F 2 77 ? 6.419   -10.247 9.374    1.00 56.97  ? 180 A   F N3    1 
ATOM   6198 C  C4    . A   F 2 77 ? 7.275   -9.470  10.062   1.00 59.49  ? 180 A   F C4    1 
ATOM   6199 P  P     . G   F 2 78 ? 4.552   -10.271 15.513   1.00 67.92  ? 181 G   F P     1 
ATOM   6200 O  OP1   . G   F 2 78 ? 3.518   -10.329 16.579   1.00 69.02  ? 181 G   F OP1   1 
ATOM   6201 O  OP2   . G   F 2 78 ? 5.989   -10.419 15.871   1.00 68.13  ? 181 G   F OP2   1 
ATOM   6202 O  "O5'" . G   F 2 78 ? 4.182   -11.358 14.412   1.00 57.84  ? 181 G   F "O5'" 1 
ATOM   6203 C  "C5'" . G   F 2 78 ? 2.857   -11.468 13.917   1.00 53.42  ? 181 G   F "C5'" 1 
ATOM   6204 C  "C4'" . G   F 2 78 ? 2.785   -12.567 12.885   1.00 56.77  ? 181 G   F "C4'" 1 
ATOM   6205 O  "O4'" . G   F 2 78 ? 3.545   -12.190 11.706   1.00 56.02  ? 181 G   F "O4'" 1 
ATOM   6206 C  "C3'" . G   F 2 78 ? 3.362   -13.902 13.326   1.00 53.35  ? 181 G   F "C3'" 1 
ATOM   6207 O  "O3'" . G   F 2 78 ? 2.334   -14.674 13.931   1.00 54.31  ? 181 G   F "O3'" 1 
ATOM   6208 C  "C2'" . G   F 2 78 ? 3.794   -14.515 12.003   1.00 52.23  ? 181 G   F "C2'" 1 
ATOM   6209 O  "O2'" . G   F 2 78 ? 2.671   -15.030 11.310   1.00 38.83  ? 181 G   F "O2'" 1 
ATOM   6210 C  "C1'" . G   F 2 78 ? 4.327   -13.285 11.264   1.00 48.78  ? 181 G   F "C1'" 1 
ATOM   6211 N  N9    . G   F 2 78 ? 5.716   -12.919 11.523   1.00 43.67  ? 181 G   F N9    1 
ATOM   6212 C  C8    . G   F 2 78 ? 6.117   -11.878 12.321   1.00 47.66  ? 181 G   F C8    1 
ATOM   6213 N  N7    . G   F 2 78 ? 7.409   -11.700 12.334   1.00 50.54  ? 181 G   F N7    1 
ATOM   6214 C  C5    . G   F 2 78 ? 7.902   -12.697 11.508   1.00 50.04  ? 181 G   F C5    1 
ATOM   6215 C  C6    . G   F 2 78 ? 9.242   -12.998 11.137   1.00 47.65  ? 181 G   F C6    1 
ATOM   6216 O  O6    . G   F 2 78 ? 10.286  -12.411 11.475   1.00 41.45  ? 181 G   F O6    1 
ATOM   6217 N  N1    . G   F 2 78 ? 9.299   -14.100 10.287   1.00 40.92  ? 181 G   F N1    1 
ATOM   6218 C  C2    . G   F 2 78 ? 8.208   -14.816 9.851    1.00 39.45  ? 181 G   F C2    1 
ATOM   6219 N  N2    . G   F 2 78 ? 8.473   -15.845 9.050    1.00 33.18  ? 181 G   F N2    1 
ATOM   6220 N  N3    . G   F 2 78 ? 6.950   -14.541 10.182   1.00 42.65  ? 181 G   F N3    1 
ATOM   6221 C  C4    . G   F 2 78 ? 6.870   -13.476 11.008   1.00 47.00  ? 181 G   F C4    1 
ATOM   6222 P  P     . G   F 2 79 ? 2.697   -15.706 15.100   1.00 55.10  ? 182 G   F P     1 
ATOM   6223 O  OP1   . G   F 2 79 ? 1.428   -16.281 15.622   1.00 45.62  ? 182 G   F OP1   1 
ATOM   6224 O  OP2   . G   F 2 79 ? 3.641   -15.021 16.024   1.00 53.40  ? 182 G   F OP2   1 
ATOM   6225 O  "O5'" . G   F 2 79 ? 3.497   -16.852 14.347   1.00 51.46  ? 182 G   F "O5'" 1 
ATOM   6226 C  "C5'" . G   F 2 79 ? 4.594   -17.501 14.969   1.00 51.35  ? 182 G   F "C5'" 1 
ATOM   6227 C  "C4'" . G   F 2 79 ? 5.431   -18.192 13.927   1.00 53.96  ? 182 G   F "C4'" 1 
ATOM   6228 O  "O4'" . G   F 2 79 ? 5.941   -17.200 12.996   1.00 49.49  ? 182 G   F "O4'" 1 
ATOM   6229 C  "C3'" . G   F 2 79 ? 6.680   -18.896 14.433   1.00 57.31  ? 182 G   F "C3'" 1 
ATOM   6230 O  "O3'" . G   F 2 79 ? 6.357   -20.195 14.931   1.00 64.02  ? 182 G   F "O3'" 1 
ATOM   6231 C  "C2'" . G   F 2 79 ? 7.524   -18.963 13.165   1.00 52.21  ? 182 G   F "C2'" 1 
ATOM   6232 O  "O2'" . G   F 2 79 ? 7.105   -19.982 12.281   1.00 50.51  ? 182 G   F "O2'" 1 
ATOM   6233 C  "C1'" . G   F 2 79 ? 7.214   -17.609 12.526   1.00 46.25  ? 182 G   F "C1'" 1 
ATOM   6234 N  N9    . G   F 2 79 ? 8.188   -16.588 12.885   1.00 36.99  ? 182 G   F N9    1 
ATOM   6235 C  C8    . G   F 2 79 ? 7.953   -15.388 13.510   1.00 33.68  ? 182 G   F C8    1 
ATOM   6236 N  N7    . G   F 2 79 ? 9.035   -14.677 13.675   1.00 30.94  ? 182 G   F N7    1 
ATOM   6237 C  C5    . G   F 2 79 ? 10.044  -15.460 13.129   1.00 29.58  ? 182 G   F C5    1 
ATOM   6238 C  C6    . G   F 2 79 ? 11.437  -15.214 13.009   1.00 26.09  ? 182 G   F C6    1 
ATOM   6239 O  O6    . G   F 2 79 ? 12.079  -14.214 13.369   1.00 16.89  ? 182 G   F O6    1 
ATOM   6240 N  N1    . G   F 2 79 ? 12.090  -16.281 12.397   1.00 21.87  ? 182 G   F N1    1 
ATOM   6241 C  C2    . G   F 2 79 ? 11.478  -17.435 11.953   1.00 25.47  ? 182 G   F C2    1 
ATOM   6242 N  N2    . G   F 2 79 ? 12.269  -18.362 11.391   1.00 16.69  ? 182 G   F N2    1 
ATOM   6243 N  N3    . G   F 2 79 ? 10.182  -17.666 12.053   1.00 27.20  ? 182 G   F N3    1 
ATOM   6244 C  C4    . G   F 2 79 ? 9.533   -16.646 12.646   1.00 31.51  ? 182 G   F C4    1 
ATOM   6245 P  P     . G   F 2 80 ? 7.112   -20.768 16.236   1.00 66.84  ? 183 G   F P     1 
ATOM   6246 O  OP1   . G   F 2 80 ? 6.757   -22.208 16.372   1.00 65.34  ? 183 G   F OP1   1 
ATOM   6247 O  OP2   . G   F 2 80 ? 6.873   -19.843 17.374   1.00 66.59  ? 183 G   F OP2   1 
ATOM   6248 O  "O5'" . G   F 2 80 ? 8.657   -20.652 15.874   1.00 61.19  ? 183 G   F "O5'" 1 
ATOM   6249 C  "C5'" . G   F 2 80 ? 9.231   -21.458 14.857   1.00 50.78  ? 183 G   F "C5'" 1 
ATOM   6250 C  "C4'" . G   F 2 80 ? 10.672  -21.073 14.649   1.00 46.31  ? 183 G   F "C4'" 1 
ATOM   6251 O  "O4'" . G   F 2 80 ? 10.739  -19.692 14.225   1.00 38.53  ? 183 G   F "O4'" 1 
ATOM   6252 C  "C3'" . G   F 2 80 ? 11.525  -21.115 15.901   1.00 48.48  ? 183 G   F "C3'" 1 
ATOM   6253 O  "O3'" . G   F 2 80 ? 11.983  -22.451 16.122   1.00 56.33  ? 183 G   F "O3'" 1 
ATOM   6254 C  "C2'" . G   F 2 80 ? 12.660  -20.151 15.553   1.00 41.85  ? 183 G   F "C2'" 1 
ATOM   6255 O  "O2'" . G   F 2 80 ? 13.684  -20.737 14.780   1.00 39.09  ? 183 G   F "O2'" 1 
ATOM   6256 C  "C1'" . G   F 2 80 ? 11.942  -19.117 14.685   1.00 38.40  ? 183 G   F "C1'" 1 
ATOM   6257 N  N9    . G   F 2 80 ? 11.629  -17.855 15.345   1.00 42.12  ? 183 G   F N9    1 
ATOM   6258 C  C8    . G   F 2 80 ? 10.411  -17.449 15.834   1.00 42.98  ? 183 G   F C8    1 
ATOM   6259 N  N7    . G   F 2 80 ? 10.444  -16.251 16.355   1.00 43.61  ? 183 G   F N7    1 
ATOM   6260 C  C5    . G   F 2 80 ? 11.763  -15.847 16.206   1.00 37.32  ? 183 G   F C5    1 
ATOM   6261 C  C6    . G   F 2 80 ? 12.403  -14.637 16.582   1.00 39.38  ? 183 G   F C6    1 
ATOM   6262 O  O6    . G   F 2 80 ? 11.921  -13.641 17.136   1.00 34.37  ? 183 G   F O6    1 
ATOM   6263 N  N1    . G   F 2 80 ? 13.750  -14.652 16.246   1.00 45.45  ? 183 G   F N1    1 
ATOM   6264 C  C2    . G   F 2 80 ? 14.400  -15.692 15.625   1.00 43.57  ? 183 G   F C2    1 
ATOM   6265 N  N2    . G   F 2 80 ? 15.709  -15.518 15.392   1.00 44.93  ? 183 G   F N2    1 
ATOM   6266 N  N3    . G   F 2 80 ? 13.813  -16.817 15.263   1.00 37.84  ? 183 G   F N3    1 
ATOM   6267 C  C4    . G   F 2 80 ? 12.507  -16.827 15.586   1.00 38.87  ? 183 G   F C4    1 
ATOM   6268 P  P     . A   F 2 81 ? 11.545  -23.238 17.456   1.00 58.43  ? 184 A   F P     1 
ATOM   6269 O  OP1   . A   F 2 81 ? 10.589  -24.322 17.107   1.00 46.84  ? 184 A   F OP1   1 
ATOM   6270 O  OP2   . A   F 2 81 ? 11.161  -22.214 18.457   1.00 65.07  ? 184 A   F OP2   1 
ATOM   6271 O  "O5'" . A   F 2 81 ? 12.900  -23.890 17.979   1.00 57.64  ? 184 A   F "O5'" 1 
ATOM   6272 C  "C5'" . A   F 2 81 ? 13.281  -25.209 17.609   1.00 54.86  ? 184 A   F "C5'" 1 
ATOM   6273 C  "C4'" . A   F 2 81 ? 14.724  -25.440 17.979   1.00 54.23  ? 184 A   F "C4'" 1 
ATOM   6274 O  "O4'" . A   F 2 81 ? 15.568  -24.611 17.152   1.00 45.96  ? 184 A   F "O4'" 1 
ATOM   6275 C  "C3'" . A   F 2 81 ? 15.058  -25.057 19.408   1.00 58.28  ? 184 A   F "C3'" 1 
ATOM   6276 O  "O3'" . A   F 2 81 ? 14.848  -26.189 20.234   1.00 66.77  ? 184 A   F "O3'" 1 
ATOM   6277 C  "C2'" . A   F 2 81 ? 16.527  -24.663 19.329   1.00 54.20  ? 184 A   F "C2'" 1 
ATOM   6278 O  "O2'" . A   F 2 81 ? 17.401  -25.769 19.444   1.00 53.45  ? 184 A   F "O2'" 1 
ATOM   6279 C  "C1'" . A   F 2 81 ? 16.605  -24.056 17.927   1.00 46.99  ? 184 A   F "C1'" 1 
ATOM   6280 N  N9    . A   F 2 81 ? 16.440  -22.612 17.866   1.00 42.74  ? 184 A   F N9    1 
ATOM   6281 C  C8    . A   F 2 81 ? 15.319  -21.885 18.155   1.00 46.67  ? 184 A   F C8    1 
ATOM   6282 N  N7    . A   F 2 81 ? 15.462  -20.595 17.962   1.00 54.22  ? 184 A   F N7    1 
ATOM   6283 C  C5    . A   F 2 81 ? 16.773  -20.467 17.525   1.00 47.27  ? 184 A   F C5    1 
ATOM   6284 C  C6    . A   F 2 81 ? 17.548  -19.348 17.149   1.00 45.28  ? 184 A   F C6    1 
ATOM   6285 N  N6    . A   F 2 81 ? 17.099  -18.092 17.148   1.00 39.83  ? 184 A   F N6    1 
ATOM   6286 N  N1    . A   F 2 81 ? 18.821  -19.570 16.768   1.00 47.66  ? 184 A   F N1    1 
ATOM   6287 C  C2    . A   F 2 81 ? 19.277  -20.831 16.763   1.00 52.75  ? 184 A   F C2    1 
ATOM   6288 N  N3    . A   F 2 81 ? 18.647  -21.961 17.091   1.00 47.92  ? 184 A   F N3    1 
ATOM   6289 C  C4    . A   F 2 81 ? 17.387  -21.704 17.469   1.00 45.66  ? 184 A   F C4    1 
ATOM   6290 P  P     . A   F 2 82 ? 14.927  -26.041 21.823   1.00 73.66  ? 185 A   F P     1 
ATOM   6291 O  OP1   . A   F 2 82 ? 16.292  -26.470 22.223   1.00 69.04  ? 185 A   F OP1   1 
ATOM   6292 O  OP2   . A   F 2 82 ? 13.737  -26.724 22.393   1.00 74.67  ? 185 A   F OP2   1 
ATOM   6293 O  "O5'" . A   F 2 82 ? 14.772  -24.481 22.105   1.00 72.91  ? 185 A   F "O5'" 1 
ATOM   6294 C  "C5'" . A   F 2 82 ? 14.536  -24.014 23.430   1.00 77.37  ? 185 A   F "C5'" 1 
ATOM   6295 C  "C4'" . A   F 2 82 ? 15.384  -24.802 24.398   1.00 80.86  ? 185 A   F "C4'" 1 
ATOM   6296 O  "O4'" . A   F 2 82 ? 16.754  -24.767 23.963   1.00 83.16  ? 185 A   F "O4'" 1 
ATOM   6297 C  "C3'" . A   F 2 82 ? 15.427  -24.346 25.846   1.00 83.50  ? 185 A   F "C3'" 1 
ATOM   6298 O  "O3'" . A   F 2 82 ? 14.330  -24.961 26.520   1.00 88.52  ? 185 A   F "O3'" 1 
ATOM   6299 C  "C2'" . A   F 2 82 ? 16.763  -24.901 26.353   1.00 81.47  ? 185 A   F "C2'" 1 
ATOM   6300 O  "O2'" . A   F 2 82 ? 16.652  -26.188 26.914   1.00 90.06  ? 185 A   F "O2'" 1 
ATOM   6301 C  "C1'" . A   F 2 82 ? 17.581  -25.034 25.067   1.00 77.55  ? 185 A   F "C1'" 1 
ATOM   6302 N  N9    . A   F 2 82 ? 18.799  -24.246 24.945   1.00 67.86  ? 185 A   F N9    1 
ATOM   6303 C  C8    . A   F 2 82 ? 18.980  -22.891 24.831   1.00 62.90  ? 185 A   F C8    1 
ATOM   6304 N  N7    . A   F 2 82 ? 20.234  -22.544 24.675   1.00 60.88  ? 185 A   F N7    1 
ATOM   6305 C  C5    . A   F 2 82 ? 20.920  -23.752 24.702   1.00 61.29  ? 185 A   F C5    1 
ATOM   6306 C  C6    . A   F 2 82 ? 22.278  -24.074 24.578   1.00 60.12  ? 185 A   F C6    1 
ATOM   6307 N  N6    . A   F 2 82 ? 23.235  -23.167 24.393   1.00 61.42  ? 185 A   F N6    1 
ATOM   6308 N  N1    . A   F 2 82 ? 22.626  -25.381 24.649   1.00 59.95  ? 185 A   F N1    1 
ATOM   6309 C  C2    . A   F 2 82 ? 21.664  -26.291 24.831   1.00 55.87  ? 185 A   F C2    1 
ATOM   6310 N  N3    . A   F 2 82 ? 20.356  -26.111 24.959   1.00 55.92  ? 185 A   F N3    1 
ATOM   6311 C  C4    . A   F 2 82 ? 20.048  -24.803 24.882   1.00 62.61  ? 185 A   F C4    1 
ATOM   6312 P  P     . G   F 2 83 ? 14.213  -24.880 28.118   1.00 86.26  ? 186 G   F P     1 
ATOM   6313 O  OP1   . G   F 2 83 ? 12.785  -25.075 28.475   1.00 84.46  ? 186 G   F OP1   1 
ATOM   6314 O  OP2   . G   F 2 83 ? 14.918  -23.635 28.525   1.00 89.28  ? 186 G   F OP2   1 
ATOM   6315 O  "O5'" . G   F 2 83 ? 15.029  -26.144 28.652   1.00 83.86  ? 186 G   F "O5'" 1 
ATOM   6316 C  "C5'" . G   F 2 83 ? 15.825  -26.056 29.838   1.00 79.58  ? 186 G   F "C5'" 1 
ATOM   6317 C  "C4'" . G   F 2 83 ? 16.559  -27.360 30.094   1.00 73.85  ? 186 G   F "C4'" 1 
ATOM   6318 O  "O4'" . G   F 2 83 ? 17.286  -27.749 28.896   1.00 69.42  ? 186 G   F "O4'" 1 
ATOM   6319 C  "C3'" . G   F 2 83 ? 17.617  -27.287 31.192   1.00 69.57  ? 186 G   F "C3'" 1 
ATOM   6320 O  "O3'" . G   F 2 83 ? 17.071  -27.561 32.480   1.00 67.77  ? 186 G   F "O3'" 1 
ATOM   6321 C  "C2'" . G   F 2 83 ? 18.606  -28.352 30.749   1.00 61.84  ? 186 G   F "C2'" 1 
ATOM   6322 O  "O2'" . G   F 2 83 ? 18.147  -29.654 31.058   1.00 45.35  ? 186 G   F "O2'" 1 
ATOM   6323 C  "C1'" . G   F 2 83 ? 18.608  -28.119 29.237   1.00 58.72  ? 186 G   F "C1'" 1 
ATOM   6324 N  N9    . G   F 2 83 ? 19.478  -27.019 28.829   1.00 53.47  ? 186 G   F N9    1 
ATOM   6325 C  C8    . G   F 2 83 ? 19.091  -25.752 28.452   1.00 50.84  ? 186 G   F C8    1 
ATOM   6326 N  N7    . G   F 2 83 ? 20.095  -24.982 28.127   1.00 44.75  ? 186 G   F N7    1 
ATOM   6327 C  C5    . G   F 2 83 ? 21.211  -25.785 28.304   1.00 45.61  ? 186 G   F C5    1 
ATOM   6328 C  C6    . G   F 2 83 ? 22.580  -25.498 28.115   1.00 44.98  ? 186 G   F C6    1 
ATOM   6329 O  O6    . G   F 2 83 ? 23.096  -24.440 27.747   1.00 39.00  ? 186 G   F O6    1 
ATOM   6330 N  N1    . G   F 2 83 ? 23.381  -26.601 28.411   1.00 47.71  ? 186 G   F N1    1 
ATOM   6331 C  C2    . G   F 2 83 ? 22.916  -27.827 28.844   1.00 48.06  ? 186 G   F C2    1 
ATOM   6332 N  N2    . G   F 2 83 ? 23.841  -28.774 29.087   1.00 43.13  ? 186 G   F N2    1 
ATOM   6333 N  N3    . G   F 2 83 ? 21.636  -28.104 29.026   1.00 47.77  ? 186 G   F N3    1 
ATOM   6334 C  C4    . G   F 2 83 ? 20.846  -27.047 28.739   1.00 49.97  ? 186 G   F C4    1 
ATOM   6335 P  P     . U   F 2 84 ? 17.455  -26.621 33.729   1.00 64.47  ? 187 U   F P     1 
ATOM   6336 O  OP1   . U   F 2 84 ? 16.498  -26.956 34.813   1.00 61.92  ? 187 U   F OP1   1 
ATOM   6337 O  OP2   . U   F 2 84 ? 17.578  -25.215 33.263   1.00 62.45  ? 187 U   F OP2   1 
ATOM   6338 O  "O5'" . U   F 2 84 ? 18.909  -27.107 34.157   1.00 62.73  ? 187 U   F "O5'" 1 
ATOM   6339 C  "C5'" . U   F 2 84 ? 19.110  -28.426 34.636   1.00 60.08  ? 187 U   F "C5'" 1 
ATOM   6340 C  "C4'" . U   F 2 84 ? 20.567  -28.802 34.559   1.00 58.89  ? 187 U   F "C4'" 1 
ATOM   6341 O  "O4'" . U   F 2 84 ? 21.031  -28.634 33.194   1.00 55.05  ? 187 U   F "O4'" 1 
ATOM   6342 C  "C3'" . U   F 2 84 ? 21.540  -27.960 35.367   1.00 58.66  ? 187 U   F "C3'" 1 
ATOM   6343 O  "O3'" . U   F 2 84 ? 21.562  -28.366 36.732   1.00 60.65  ? 187 U   F "O3'" 1 
ATOM   6344 C  "C2'" . U   F 2 84 ? 22.860  -28.266 34.667   1.00 57.41  ? 187 U   F "C2'" 1 
ATOM   6345 O  "O2'" . U   F 2 84 ? 23.427  -29.506 35.051   1.00 53.26  ? 187 U   F "O2'" 1 
ATOM   6346 C  "C1'" . U   F 2 84 ? 22.415  -28.326 33.203   1.00 54.95  ? 187 U   F "C1'" 1 
ATOM   6347 N  N1    . U   F 2 84 ? 22.608  -27.049 32.506   1.00 53.19  ? 187 U   F N1    1 
ATOM   6348 C  C2    . U   F 2 84 ? 23.899  -26.715 32.132   1.00 52.16  ? 187 U   F C2    1 
ATOM   6349 O  O2    . U   F 2 84 ? 24.863  -27.440 32.354   1.00 43.37  ? 187 U   F O2    1 
ATOM   6350 N  N3    . U   F 2 84 ? 24.020  -25.503 31.493   1.00 54.51  ? 187 U   F N3    1 
ATOM   6351 C  C4    . U   F 2 84 ? 23.004  -24.610 31.199   1.00 55.83  ? 187 U   F C4    1 
ATOM   6352 O  O4    . U   F 2 84 ? 23.273  -23.555 30.615   1.00 53.59  ? 187 U   F O4    1 
ATOM   6353 C  C5    . U   F 2 84 ? 21.697  -25.033 31.619   1.00 56.47  ? 187 U   F C5    1 
ATOM   6354 C  C6    . U   F 2 84 ? 21.548  -26.209 32.240   1.00 54.30  ? 187 U   F C6    1 
ATOM   6355 P  P     . C   F 2 85 ? 22.034  -27.330 37.870   1.00 59.98  ? 188 C   F P     1 
ATOM   6356 O  OP1   . C   F 2 85 ? 21.827  -27.980 39.191   1.00 62.52  ? 188 C   F OP1   1 
ATOM   6357 O  OP2   . C   F 2 85 ? 21.424  -26.001 37.597   1.00 60.44  ? 188 C   F OP2   1 
ATOM   6358 O  "O5'" . C   F 2 85 ? 23.602  -27.202 37.650   1.00 56.74  ? 188 C   F "O5'" 1 
ATOM   6359 C  "C5'" . C   F 2 85 ? 24.460  -28.282 37.967   1.00 55.59  ? 188 C   F "C5'" 1 
ATOM   6360 C  "C4'" . C   F 2 85 ? 25.846  -27.985 37.484   1.00 55.98  ? 188 C   F "C4'" 1 
ATOM   6361 O  "O4'" . C   F 2 85 ? 25.796  -27.762 36.053   1.00 58.69  ? 188 C   F "O4'" 1 
ATOM   6362 C  "C3'" . C   F 2 85 ? 26.441  -26.700 38.021   1.00 55.54  ? 188 C   F "C3'" 1 
ATOM   6363 O  "O3'" . C   F 2 85 ? 27.012  -26.914 39.300   1.00 64.32  ? 188 C   F "O3'" 1 
ATOM   6364 C  "C2'" . C   F 2 85 ? 27.492  -26.398 36.969   1.00 54.42  ? 188 C   F "C2'" 1 
ATOM   6365 O  "O2'" . C   F 2 85 ? 28.615  -27.248 37.083   1.00 53.86  ? 188 C   F "O2'" 1 
ATOM   6366 C  "C1'" . C   F 2 85 ? 26.729  -26.757 35.696   1.00 56.64  ? 188 C   F "C1'" 1 
ATOM   6367 N  N1    . C   F 2 85 ? 25.993  -25.612 35.141   1.00 58.51  ? 188 C   F N1    1 
ATOM   6368 C  C2    . C   F 2 85 ? 26.688  -24.704 34.355   1.00 60.29  ? 188 C   F C2    1 
ATOM   6369 O  O2    . C   F 2 85 ? 27.887  -24.907 34.141   1.00 63.58  ? 188 C   F O2    1 
ATOM   6370 N  N3    . C   F 2 85 ? 26.041  -23.630 33.845   1.00 62.38  ? 188 C   F N3    1 
ATOM   6371 C  C4    . C   F 2 85 ? 24.743  -23.453 34.094   1.00 61.14  ? 188 C   F C4    1 
ATOM   6372 N  N4    . C   F 2 85 ? 24.146  -22.375 33.572   1.00 55.58  ? 188 C   F N4    1 
ATOM   6373 C  C5    . C   F 2 85 ? 24.000  -24.373 34.891   1.00 61.14  ? 188 C   F C5    1 
ATOM   6374 C  C6    . C   F 2 85 ? 24.661  -25.430 35.391   1.00 62.88  ? 188 C   F C6    1 
ATOM   6375 P  P     . G   F 2 86 ? 27.051  -25.711 40.362   1.00 69.87  ? 189 G   F P     1 
ATOM   6376 O  OP1   . G   F 2 86 ? 26.840  -26.268 41.723   1.00 67.18  ? 189 G   F OP1   1 
ATOM   6377 O  OP2   . G   F 2 86 ? 26.154  -24.634 39.862   1.00 71.57  ? 189 G   F OP2   1 
ATOM   6378 O  "O5'" . G   F 2 86 ? 28.544  -25.178 40.261   1.00 67.94  ? 189 G   F "O5'" 1 
ATOM   6379 C  "C5'" . G   F 2 86 ? 28.845  -23.820 40.523   1.00 67.38  ? 189 G   F "C5'" 1 
ATOM   6380 C  "C4'" . G   F 2 86 ? 29.803  -23.305 39.491   1.00 70.09  ? 189 G   F "C4'" 1 
ATOM   6381 O  "O4'" . G   F 2 86 ? 29.231  -23.499 38.181   1.00 69.42  ? 189 G   F "O4'" 1 
ATOM   6382 C  "C3'" . G   F 2 86 ? 30.077  -21.821 39.584   1.00 76.38  ? 189 G   F "C3'" 1 
ATOM   6383 O  "O3'" . G   F 2 86 ? 31.170  -21.631 40.466   1.00 85.93  ? 189 G   F "O3'" 1 
ATOM   6384 C  "C2'" . G   F 2 86 ? 30.471  -21.465 38.159   1.00 76.19  ? 189 G   F "C2'" 1 
ATOM   6385 O  "O2'" . G   F 2 86 ? 31.839  -21.730 37.919   1.00 76.28  ? 189 G   F "O2'" 1 
ATOM   6386 C  "C1'" . G   F 2 86 ? 29.596  -22.423 37.343   1.00 72.65  ? 189 G   F "C1'" 1 
ATOM   6387 N  N9    . G   F 2 86 ? 28.371  -21.856 36.785   1.00 70.28  ? 189 G   F N9    1 
ATOM   6388 C  C8    . G   F 2 86 ? 27.106  -22.378 36.903   1.00 69.40  ? 189 G   F C8    1 
ATOM   6389 N  N7    . G   F 2 86 ? 26.200  -21.678 36.273   1.00 72.18  ? 189 G   F N7    1 
ATOM   6390 C  C5    . G   F 2 86 ? 26.906  -20.622 35.711   1.00 72.83  ? 189 G   F C5    1 
ATOM   6391 C  C6    . G   F 2 86 ? 26.455  -19.527 34.911   1.00 70.38  ? 189 G   F C6    1 
ATOM   6392 O  O6    . G   F 2 86 ? 25.306  -19.268 34.527   1.00 72.96  ? 189 G   F O6    1 
ATOM   6393 N  N1    . G   F 2 86 ? 27.505  -18.688 34.557   1.00 64.28  ? 189 G   F N1    1 
ATOM   6394 C  C2    . G   F 2 86 ? 28.815  -18.870 34.917   1.00 65.45  ? 189 G   F C2    1 
ATOM   6395 N  N2    . G   F 2 86 ? 29.673  -17.952 34.472   1.00 69.00  ? 189 G   F N2    1 
ATOM   6396 N  N3    . G   F 2 86 ? 29.251  -19.879 35.659   1.00 68.20  ? 189 G   F N3    1 
ATOM   6397 C  C4    . G   F 2 86 ? 28.249  -20.711 36.019   1.00 72.35  ? 189 G   F C4    1 
ATOM   6398 P  P     . C   F 2 87 ? 30.967  -20.779 41.804   1.00 92.35  ? 190 C   F P     1 
ATOM   6399 O  OP1   . C   F 2 87 ? 31.847  -21.351 42.857   1.00 91.75  ? 190 C   F OP1   1 
ATOM   6400 O  OP2   . C   F 2 87 ? 29.499  -20.682 42.040   1.00 88.55  ? 190 C   F OP2   1 
ATOM   6401 O  "O5'" . C   F 2 87 ? 31.521  -19.341 41.405   1.00 93.70  ? 190 C   F "O5'" 1 
ATOM   6402 C  "C5'" . C   F 2 87 ? 32.874  -19.166 40.990   1.00 89.36  ? 190 C   F "C5'" 1 
ATOM   6403 C  "C4'" . C   F 2 87 ? 32.977  -17.994 40.044   1.00 88.22  ? 190 C   F "C4'" 1 
ATOM   6404 O  "O4'" . C   F 2 87 ? 32.173  -18.276 38.867   1.00 89.53  ? 190 C   F "O4'" 1 
ATOM   6405 C  "C3'" . C   F 2 87 ? 32.416  -16.678 40.561   1.00 86.93  ? 190 C   F "C3'" 1 
ATOM   6406 O  "O3'" . C   F 2 87 ? 33.294  -15.982 41.458   1.00 82.37  ? 190 C   F "O3'" 1 
ATOM   6407 C  "C2'" . C   F 2 87 ? 32.120  -15.939 39.265   1.00 86.96  ? 190 C   F "C2'" 1 
ATOM   6408 O  "O2'" . C   F 2 87 ? 33.307  -15.455 38.670   1.00 85.87  ? 190 C   F "O2'" 1 
ATOM   6409 C  "C1'" . C   F 2 87 ? 31.579  -17.077 38.395   1.00 88.84  ? 190 C   F "C1'" 1 
ATOM   6410 N  N1    . C   F 2 87 ? 30.111  -17.246 38.418   1.00 89.44  ? 190 C   F N1    1 
ATOM   6411 C  C2    . C   F 2 87 ? 29.332  -16.552 37.475   1.00 88.52  ? 190 C   F C2    1 
ATOM   6412 O  O2    . C   F 2 87 ? 29.896  -15.786 36.674   1.00 86.08  ? 190 C   F O2    1 
ATOM   6413 N  N3    . C   F 2 87 ? 27.987  -16.735 37.464   1.00 83.44  ? 190 C   F N3    1 
ATOM   6414 C  C4    . C   F 2 87 ? 27.418  -17.561 38.346   1.00 80.89  ? 190 C   F C4    1 
ATOM   6415 N  N4    . C   F 2 87 ? 26.091  -17.720 38.291   1.00 71.53  ? 190 C   F N4    1 
ATOM   6416 C  C5    . C   F 2 87 ? 28.184  -18.265 39.325   1.00 81.11  ? 190 C   F C5    1 
ATOM   6417 C  C6    . C   F 2 87 ? 29.513  -18.078 39.326   1.00 84.76  ? 190 C   F C6    1 
HETATM 6418 N  "N1'" . TPP G 3 .  ? 24.466  -8.015  -64.084  1.00 72.49  ? 601 TPP E "N1'" 1 
HETATM 6419 C  "C2'" . TPP G 3 .  ? 25.337  -7.573  -63.218  1.00 74.46  ? 601 TPP E "C2'" 1 
HETATM 6420 C  CM2   . TPP G 3 .  ? 25.184  -6.179  -62.762  1.00 79.54  ? 601 TPP E CM2   1 
HETATM 6421 N  "N3'" . TPP G 3 .  ? 26.344  -8.350  -62.760  1.00 72.52  ? 601 TPP E "N3'" 1 
HETATM 6422 C  "C4'" . TPP G 3 .  ? 26.478  -9.623  -63.198  1.00 67.08  ? 601 TPP E "C4'" 1 
HETATM 6423 N  "N4'" . TPP G 3 .  ? 27.509  -10.445 -62.759  1.00 60.52  ? 601 TPP E "N4'" 1 
HETATM 6424 C  "C5'" . TPP G 3 .  ? 25.551  -10.082 -64.123  1.00 70.02  ? 601 TPP E "C5'" 1 
HETATM 6425 C  "C6'" . TPP G 3 .  ? 24.541  -9.232  -64.546  1.00 70.37  ? 601 TPP E "C6'" 1 
HETATM 6426 C  "C7'" . TPP G 3 .  ? 25.587  -11.412 -64.724  1.00 77.41  ? 601 TPP E "C7'" 1 
HETATM 6427 N  N3    . TPP G 3 .  ? 24.671  -12.460 -64.291  1.00 78.13  ? 601 TPP E N3    1 
HETATM 6428 C  C2    . TPP G 3 .  ? 23.783  -12.346 -63.311  1.00 79.55  ? 601 TPP E C2    1 
HETATM 6429 S  S1    . TPP G 3 .  ? 23.024  -13.908 -63.359  1.00 82.97  ? 601 TPP E S1    1 
HETATM 6430 C  C5    . TPP G 3 .  ? 23.991  -14.551 -64.713  1.00 78.02  ? 601 TPP E C5    1 
HETATM 6431 C  C4    . TPP G 3 .  ? 24.782  -13.548 -64.982  1.00 78.30  ? 601 TPP E C4    1 
HETATM 6432 C  CM4   . TPP G 3 .  ? 25.802  -13.688 -66.133  1.00 83.94  ? 601 TPP E CM4   1 
HETATM 6433 C  C6    . TPP G 3 .  ? 24.003  -15.811 -65.451  1.00 74.84  ? 601 TPP E C6    1 
HETATM 6434 C  C7    . TPP G 3 .  ? 23.156  -16.896 -64.967  1.00 61.04  ? 601 TPP E C7    1 
HETATM 6435 O  O7    . TPP G 3 .  ? 23.265  -17.948 -65.847  1.00 61.30  ? 601 TPP E O7    1 
HETATM 6436 P  PA    . TPP G 3 .  ? 22.411  -19.137 -65.418  1.00 66.69  ? 601 TPP E PA    1 
HETATM 6437 O  O1A   . TPP G 3 .  ? 20.987  -18.760 -65.348  1.00 70.18  ? 601 TPP E O1A   1 
HETATM 6438 O  O2A   . TPP G 3 .  ? 22.895  -19.676 -63.989  1.00 72.67  ? 601 TPP E O2A   1 
HETATM 6439 O  O3A   . TPP G 3 .  ? 22.636  -20.204 -66.570  1.00 75.92  ? 601 TPP E O3A   1 
HETATM 6440 P  PB    . TPP G 3 .  ? 21.794  -21.490 -66.237  1.00 95.77  ? 601 TPP E PB    1 
HETATM 6441 O  O1B   . TPP G 3 .  ? 20.292  -21.138 -66.141  1.00 95.97  ? 601 TPP E O1B   1 
HETATM 6442 O  O2B   . TPP G 3 .  ? 22.035  -22.533 -67.404  1.00 104.54 ? 601 TPP E O2B   1 
HETATM 6443 O  O3B   . TPP G 3 .  ? 22.276  -22.091 -64.893  1.00 98.18  ? 601 TPP E O3B   1 
HETATM 6444 MG MG    . MG  H 4 .  ? 24.600  -21.084 -64.755  1.00 22.16  ? 701 MG  E MG    1 
HETATM 6445 MG MG    . MG  I 4 .  ? 18.666  -20.376 -66.421  1.00 32.14  ? 702 MG  E MG    1 
HETATM 6446 MG MG    . MG  J 4 .  ? 33.922  -23.185 -58.945  1.00 28.25  ? 704 MG  E MG    1 
HETATM 6447 MG MG    . MG  K 4 .  ? 31.256  -1.562  -52.216  1.00 26.93  ? 705 MG  E MG    1 
HETATM 6448 MG MG    . MG  L 4 .  ? 18.345  -21.476 -74.470  1.00 39.18  ? 706 MG  E MG    1 
HETATM 6449 MG MG    . MG  M 4 .  ? 21.896  -23.524 -56.613  1.00 43.17  ? 707 MG  E MG    1 
HETATM 6450 N  "N1'" . TPP N 3 .  ? 25.466  -16.554 3.195    1.00 45.43  ? 602 TPP F "N1'" 1 
HETATM 6451 C  "C2'" . TPP N 3 .  ? 26.406  -15.988 2.477    1.00 47.42  ? 602 TPP F "C2'" 1 
HETATM 6452 C  CM2   . TPP N 3 .  ? 27.529  -16.839 2.012    1.00 51.40  ? 602 TPP F CM2   1 
HETATM 6453 N  "N3'" . TPP N 3 .  ? 26.376  -14.679 2.174    1.00 51.83  ? 602 TPP F "N3'" 1 
HETATM 6454 C  "C4'" . TPP N 3 .  ? 25.366  -13.883 2.612    1.00 56.95  ? 602 TPP F "C4'" 1 
HETATM 6455 N  "N4'" . TPP N 3 .  ? 25.345  -12.525 2.304    1.00 56.11  ? 602 TPP F "N4'" 1 
HETATM 6456 C  "C5'" . TPP N 3 .  ? 24.352  -14.475 3.401    1.00 57.94  ? 602 TPP F "C5'" 1 
HETATM 6457 C  "C6'" . TPP N 3 .  ? 24.449  -15.849 3.664    1.00 53.99  ? 602 TPP F "C6'" 1 
HETATM 6458 C  "C7'" . TPP N 3 .  ? 23.193  -13.722 4.003    1.00 66.00  ? 602 TPP F "C7'" 1 
HETATM 6459 N  N3    . TPP N 3 .  ? 21.883  -13.818 3.339    1.00 76.30  ? 602 TPP F N3    1 
HETATM 6460 C  C2    . TPP N 3 .  ? 21.724  -14.503 2.224    1.00 81.13  ? 602 TPP F C2    1 
HETATM 6461 S  S1    . TPP N 3 .  ? 20.045  -14.305 1.907    1.00 88.55  ? 602 TPP F S1    1 
HETATM 6462 C  C5    . TPP N 3 .  ? 19.642  -13.308 3.311    1.00 78.42  ? 602 TPP F C5    1 
HETATM 6463 C  C4    . TPP N 3 .  ? 20.854  -13.200 3.913    1.00 78.08  ? 602 TPP F C4    1 
HETATM 6464 C  CM4   . TPP N 3 .  ? 21.011  -12.408 5.211    1.00 78.53  ? 602 TPP F CM4   1 
HETATM 6465 C  C6    . TPP N 3 .  ? 18.313  -12.763 3.689    1.00 74.12  ? 602 TPP F C6    1 
HETATM 6466 C  C7    . TPP N 3 .  ? 18.333  -11.296 3.438    1.00 64.81  ? 602 TPP F C7    1 
HETATM 6467 O  O7    . TPP N 3 .  ? 17.094  -10.752 3.768    1.00 64.07  ? 602 TPP F O7    1 
HETATM 6468 P  PA    . TPP N 3 .  ? 17.292  -9.225  3.462    1.00 72.96  ? 602 TPP F PA    1 
HETATM 6469 O  O1A   . TPP N 3 .  ? 17.632  -9.053  2.021    1.00 68.07  ? 602 TPP F O1A   1 
HETATM 6470 O  O2A   . TPP N 3 .  ? 18.482  -8.654  4.385    1.00 68.34  ? 602 TPP F O2A   1 
HETATM 6471 O  O3A   . TPP N 3 .  ? 15.927  -8.448  3.787    1.00 77.96  ? 602 TPP F O3A   1 
HETATM 6472 P  PB    . TPP N 3 .  ? 16.165  -6.886  3.467    1.00 87.46  ? 602 TPP F PB    1 
HETATM 6473 O  O1B   . TPP N 3 .  ? 16.542  -6.695  1.976    1.00 88.67  ? 602 TPP F O1B   1 
HETATM 6474 O  O2B   . TPP N 3 .  ? 14.816  -6.087  3.776    1.00 91.18  ? 602 TPP F O2B   1 
HETATM 6475 O  O3B   . TPP N 3 .  ? 17.310  -6.324  4.357    1.00 79.47  ? 602 TPP F O3B   1 
HETATM 6476 MG MG    . MG  O 4 .  ? 13.341  -10.272 4.507    1.00 21.25  ? 703 MG  F MG    1 
HETATM 6477 MG MG    . MG  P 4 .  ? 15.848  -9.097  5.541    1.00 11.44  ? 708 MG  F MG    1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1  ALA 1  202 ?   ?   ?   A . n 
A 1 2  VAL 2  203 ?   ?   ?   A . n 
A 1 3  PRO 3  204 ?   ?   ?   A . n 
A 1 4  GLU 4  205 ?   ?   ?   A . n 
A 1 5  THR 5  206 206 THR THR A . n 
A 1 6  ARG 6  207 207 ARG ALA A . n 
A 1 7  PRO 7  208 208 PRO PRO A . n 
A 1 8  ASN 8  209 209 ASN ASN A . n 
A 1 9  HIS 9  210 210 HIS HIS A . n 
A 1 10 THR 10 211 211 THR THR A . n 
A 1 11 ILE 11 212 212 ILE ILE A . n 
A 1 12 TYR 12 213 213 TYR TYR A . n 
A 1 13 ILE 13 214 214 ILE ILE A . n 
A 1 14 ASN 14 215 215 ASN ASN A . n 
A 1 15 ASN 15 216 216 ASN ASN A . n 
A 1 16 LEU 16 217 217 LEU LEU A . n 
A 1 17 ASN 17 218 218 ASN ASN A . n 
A 1 18 GLU 18 219 219 GLU GLU A . n 
A 1 19 LYS 19 220 220 LYS LYS A . n 
A 1 20 ILE 20 221 221 ILE ILE A . n 
A 1 21 LYS 21 222 222 LYS LYS A . n 
A 1 22 LYS 22 223 223 LYS ALA A . n 
A 1 23 ASP 23 224 224 ASP ASP A . n 
A 1 24 GLU 24 225 225 GLU GLU A . n 
A 1 25 LEU 25 226 226 LEU LEU A . n 
A 1 26 LYS 26 227 227 LYS LYS A . n 
A 1 27 LYS 27 228 228 LYS LYS A . n 
A 1 28 SER 28 229 229 SER SER A . n 
A 1 29 LEU 29 230 230 LEU LEU A . n 
A 1 30 HIS 30 231 231 HIS HIS A . n 
A 1 31 ALA 31 232 232 ALA ALA A . n 
A 1 32 ILE 32 233 233 ILE ILE A . n 
A 1 33 PHE 33 234 234 PHE PHE A . n 
A 1 34 SER 34 235 235 SER SER A . n 
A 1 35 ARG 35 236 236 ARG ARG A . n 
A 1 36 PHE 36 237 237 PHE PHE A . n 
A 1 37 GLY 37 238 238 GLY GLY A . n 
A 1 38 GLN 38 239 239 GLN GLN A . n 
A 1 39 ILE 39 240 240 ILE ILE A . n 
A 1 40 LEU 40 241 241 LEU LEU A . n 
A 1 41 ASP 41 242 242 ASP ASP A . n 
A 1 42 ILE 42 243 243 ILE ILE A . n 
A 1 43 LEU 43 244 244 LEU LEU A . n 
A 1 44 VAL 44 245 245 VAL VAL A . n 
A 1 45 SER 45 246 246 SER SER A . n 
A 1 46 ARG 46 247 247 ARG ARG A . n 
A 1 47 SER 47 248 248 SER SER A . n 
A 1 48 LEU 48 249 249 LEU LEU A . n 
A 1 49 LYS 49 250 250 LYS LYS A . n 
A 1 50 MET 50 251 251 MET MET A . n 
A 1 51 ARG 51 252 252 ARG ARG A . n 
A 1 52 GLY 52 253 253 GLY GLY A . n 
A 1 53 GLN 53 254 254 GLN GLN A . n 
A 1 54 ALA 54 255 255 ALA ALA A . n 
A 1 55 PHE 55 256 256 PHE PHE A . n 
A 1 56 VAL 56 257 257 VAL VAL A . n 
A 1 57 ILE 57 258 258 ILE ILE A . n 
A 1 58 PHE 58 259 259 PHE PHE A . n 
A 1 59 LYS 59 260 260 LYS LYS A . n 
A 1 60 GLU 60 261 261 GLU GLU A . n 
A 1 61 VAL 61 262 262 VAL VAL A . n 
A 1 62 SER 62 263 263 SER SER A . n 
A 1 63 SER 63 264 264 SER SER A . n 
A 1 64 ALA 64 265 265 ALA ALA A . n 
A 1 65 THR 65 266 266 THR THR A . n 
A 1 66 ASN 66 267 267 ASN ASN A . n 
A 1 67 ALA 67 268 268 ALA ALA A . n 
A 1 68 LEU 68 269 269 LEU LEU A . n 
A 1 69 ARG 69 270 270 ARG ARG A . n 
A 1 70 SER 70 271 271 SER SER A . n 
A 1 71 MET 71 272 272 MET MET A . n 
A 1 72 GLN 72 273 273 GLN GLN A . n 
A 1 73 GLY 73 274 274 GLY GLY A . n 
A 1 74 PHE 74 275 275 PHE PHE A . n 
A 1 75 PRO 75 276 276 PRO PRO A . n 
A 1 76 PHE 76 277 277 PHE PHE A . n 
A 1 77 TYR 77 278 278 TYR TYR A . n 
A 1 78 ASP 78 279 279 ASP ASP A . n 
A 1 79 LYS 79 280 280 LYS LYS A . n 
A 1 80 PRO 80 281 281 PRO PRO A . n 
A 1 81 MET 81 282 282 MET MET A . n 
A 1 82 ARG 82 283 283 ARG ARG A . n 
A 1 83 ILE 83 284 284 ILE ILE A . n 
A 1 84 GLN 84 285 285 GLN GLN A . n 
A 1 85 TYR 85 286 286 TYR TYR A . n 
A 1 86 ALA 86 287 287 ALA ALA A . n 
A 1 87 LYS 87 288 288 LYS LYS A . n 
A 1 88 THR 88 289 289 THR THR A . n 
A 1 89 ASP 89 290 290 ASP ASP A . n 
A 1 90 SER 90 291 291 SER SER A . n 
A 1 91 ASP 91 292 292 ASP ASP A . n 
A 1 92 ILE 92 293 293 ILE ILE A . n 
A 1 93 ILE 93 294 294 ILE ILE A . n 
A 1 94 ALA 94 295 295 ALA ALA A . n 
A 1 95 LYS 95 296 296 LYS LYS A . n 
A 1 96 MET 96 297 297 MET MET A . n 
B 1 1  ALA 1  302 ?   ?   ?   B . n 
B 1 2  VAL 2  303 ?   ?   ?   B . n 
B 1 3  PRO 3  304 ?   ?   ?   B . n 
B 1 4  GLU 4  305 ?   ?   ?   B . n 
B 1 5  THR 5  306 306 THR THR B . n 
B 1 6  ARG 6  307 307 ARG ALA B . n 
B 1 7  PRO 7  308 308 PRO PRO B . n 
B 1 8  ASN 8  309 309 ASN ASN B . n 
B 1 9  HIS 9  310 310 HIS HIS B . n 
B 1 10 THR 10 311 311 THR THR B . n 
B 1 11 ILE 11 312 312 ILE ILE B . n 
B 1 12 TYR 12 313 313 TYR TYR B . n 
B 1 13 ILE 13 314 314 ILE ILE B . n 
B 1 14 ASN 14 315 315 ASN ASN B . n 
B 1 15 ASN 15 316 316 ASN ASN B . n 
B 1 16 LEU 16 317 317 LEU LEU B . n 
B 1 17 ASN 17 318 318 ASN ASN B . n 
B 1 18 GLU 18 319 319 GLU GLU B . n 
B 1 19 LYS 19 320 320 LYS ALA B . n 
B 1 20 ILE 20 321 321 ILE ILE B . n 
B 1 21 LYS 21 322 322 LYS LYS B . n 
B 1 22 LYS 22 323 323 LYS ALA B . n 
B 1 23 ASP 23 324 324 ASP ASP B . n 
B 1 24 GLU 24 325 325 GLU GLU B . n 
B 1 25 LEU 25 326 326 LEU LEU B . n 
B 1 26 LYS 26 327 327 LYS LYS B . n 
B 1 27 LYS 27 328 328 LYS LYS B . n 
B 1 28 SER 28 329 329 SER SER B . n 
B 1 29 LEU 29 330 330 LEU LEU B . n 
B 1 30 HIS 30 331 331 HIS HIS B . n 
B 1 31 ALA 31 332 332 ALA ALA B . n 
B 1 32 ILE 32 333 333 ILE ILE B . n 
B 1 33 PHE 33 334 334 PHE PHE B . n 
B 1 34 SER 34 335 335 SER SER B . n 
B 1 35 ARG 35 336 336 ARG ARG B . n 
B 1 36 PHE 36 337 337 PHE PHE B . n 
B 1 37 GLY 37 338 338 GLY GLY B . n 
B 1 38 GLN 38 339 339 GLN GLN B . n 
B 1 39 ILE 39 340 340 ILE ILE B . n 
B 1 40 LEU 40 341 341 LEU LEU B . n 
B 1 41 ASP 41 342 342 ASP ASP B . n 
B 1 42 ILE 42 343 343 ILE ILE B . n 
B 1 43 LEU 43 344 344 LEU LEU B . n 
B 1 44 VAL 44 345 345 VAL VAL B . n 
B 1 45 SER 45 346 346 SER SER B . n 
B 1 46 ARG 46 347 347 ARG ARG B . n 
B 1 47 SER 47 348 348 SER SER B . n 
B 1 48 LEU 48 349 349 LEU LEU B . n 
B 1 49 LYS 49 350 350 LYS ALA B . n 
B 1 50 MET 50 351 351 MET MET B . n 
B 1 51 ARG 51 352 352 ARG ARG B . n 
B 1 52 GLY 52 353 353 GLY GLY B . n 
B 1 53 GLN 53 354 354 GLN GLN B . n 
B 1 54 ALA 54 355 355 ALA ALA B . n 
B 1 55 PHE 55 356 356 PHE PHE B . n 
B 1 56 VAL 56 357 357 VAL VAL B . n 
B 1 57 ILE 57 358 358 ILE ILE B . n 
B 1 58 PHE 58 359 359 PHE PHE B . n 
B 1 59 LYS 59 360 360 LYS LYS B . n 
B 1 60 GLU 60 361 361 GLU GLU B . n 
B 1 61 VAL 61 362 362 VAL VAL B . n 
B 1 62 SER 62 363 363 SER SER B . n 
B 1 63 SER 63 364 364 SER SER B . n 
B 1 64 ALA 64 365 365 ALA ALA B . n 
B 1 65 THR 65 366 366 THR THR B . n 
B 1 66 ASN 66 367 367 ASN ASN B . n 
B 1 67 ALA 67 368 368 ALA ALA B . n 
B 1 68 LEU 68 369 369 LEU LEU B . n 
B 1 69 ARG 69 370 370 ARG ALA B . n 
B 1 70 SER 70 371 371 SER SER B . n 
B 1 71 MET 71 372 372 MET MET B . n 
B 1 72 GLN 72 373 373 GLN GLN B . n 
B 1 73 GLY 73 374 374 GLY GLY B . n 
B 1 74 PHE 74 375 375 PHE PHE B . n 
B 1 75 PRO 75 376 376 PRO PRO B . n 
B 1 76 PHE 76 377 377 PHE PHE B . n 
B 1 77 TYR 77 378 378 TYR TYR B . n 
B 1 78 ASP 78 379 379 ASP ASP B . n 
B 1 79 LYS 79 380 380 LYS LYS B . n 
B 1 80 PRO 80 381 381 PRO PRO B . n 
B 1 81 MET 81 382 382 MET MET B . n 
B 1 82 ARG 82 383 383 ARG ARG B . n 
B 1 83 ILE 83 384 384 ILE ILE B . n 
B 1 84 GLN 84 385 385 GLN GLN B . n 
B 1 85 TYR 85 386 386 TYR TYR B . n 
B 1 86 ALA 86 387 387 ALA ALA B . n 
B 1 87 LYS 87 388 388 LYS LYS B . n 
B 1 88 THR 88 389 389 THR THR B . n 
B 1 89 ASP 89 390 390 ASP ASP B . n 
B 1 90 SER 90 391 391 SER SER B . n 
B 1 91 ASP 91 392 392 ASP ASP B . n 
B 1 92 ILE 92 393 393 ILE ILE B . n 
B 1 93 ILE 93 394 394 ILE ILE B . n 
B 1 94 ALA 94 395 395 ALA ALA B . n 
B 1 95 LYS 95 396 396 LYS LYS B . n 
B 1 96 MET 96 397 397 MET MET B . n 
C 1 1  ALA 1  402 ?   ?   ?   C . n 
C 1 2  VAL 2  403 ?   ?   ?   C . n 
C 1 3  PRO 3  404 404 PRO PRO C . n 
C 1 4  GLU 4  405 405 GLU ALA C . n 
C 1 5  THR 5  406 406 THR THR C . n 
C 1 6  ARG 6  407 407 ARG ALA C . n 
C 1 7  PRO 7  408 408 PRO PRO C . n 
C 1 8  ASN 8  409 409 ASN ASN C . n 
C 1 9  HIS 9  410 410 HIS HIS C . n 
C 1 10 THR 10 411 411 THR THR C . n 
C 1 11 ILE 11 412 412 ILE ILE C . n 
C 1 12 TYR 12 413 413 TYR TYR C . n 
C 1 13 ILE 13 414 414 ILE ILE C . n 
C 1 14 ASN 14 415 415 ASN ASN C . n 
C 1 15 ASN 15 416 416 ASN ASN C . n 
C 1 16 LEU 16 417 417 LEU LEU C . n 
C 1 17 ASN 17 418 418 ASN ASN C . n 
C 1 18 GLU 18 419 419 GLU ALA C . n 
C 1 19 LYS 19 420 420 LYS ALA C . n 
C 1 20 ILE 20 421 421 ILE ILE C . n 
C 1 21 LYS 21 422 422 LYS LYS C . n 
C 1 22 LYS 22 423 423 LYS LYS C . n 
C 1 23 ASP 23 424 424 ASP ASP C . n 
C 1 24 GLU 24 425 425 GLU GLU C . n 
C 1 25 LEU 25 426 426 LEU LEU C . n 
C 1 26 LYS 26 427 427 LYS LYS C . n 
C 1 27 LYS 27 428 428 LYS LYS C . n 
C 1 28 SER 28 429 429 SER SER C . n 
C 1 29 LEU 29 430 430 LEU LEU C . n 
C 1 30 HIS 30 431 431 HIS HIS C . n 
C 1 31 ALA 31 432 432 ALA ALA C . n 
C 1 32 ILE 32 433 433 ILE ILE C . n 
C 1 33 PHE 33 434 434 PHE PHE C . n 
C 1 34 SER 34 435 435 SER SER C . n 
C 1 35 ARG 35 436 436 ARG ARG C . n 
C 1 36 PHE 36 437 437 PHE PHE C . n 
C 1 37 GLY 37 438 438 GLY GLY C . n 
C 1 38 GLN 38 439 439 GLN GLN C . n 
C 1 39 ILE 39 440 440 ILE ILE C . n 
C 1 40 LEU 40 441 441 LEU LEU C . n 
C 1 41 ASP 41 442 442 ASP ASP C . n 
C 1 42 ILE 42 443 443 ILE ILE C . n 
C 1 43 LEU 43 444 444 LEU LEU C . n 
C 1 44 VAL 44 445 445 VAL VAL C . n 
C 1 45 SER 45 446 446 SER SER C . n 
C 1 46 ARG 46 447 447 ARG ALA C . n 
C 1 47 SER 47 448 448 SER SER C . n 
C 1 48 LEU 48 449 449 LEU LEU C . n 
C 1 49 LYS 49 450 450 LYS LYS C . n 
C 1 50 MET 50 451 451 MET ALA C . n 
C 1 51 ARG 51 452 452 ARG ALA C . n 
C 1 52 GLY 52 453 453 GLY GLY C . n 
C 1 53 GLN 53 454 454 GLN GLN C . n 
C 1 54 ALA 54 455 455 ALA ALA C . n 
C 1 55 PHE 55 456 456 PHE PHE C . n 
C 1 56 VAL 56 457 457 VAL VAL C . n 
C 1 57 ILE 57 458 458 ILE ILE C . n 
C 1 58 PHE 58 459 459 PHE PHE C . n 
C 1 59 LYS 59 460 460 LYS LYS C . n 
C 1 60 GLU 60 461 461 GLU GLU C . n 
C 1 61 VAL 61 462 462 VAL VAL C . n 
C 1 62 SER 62 463 463 SER SER C . n 
C 1 63 SER 63 464 464 SER SER C . n 
C 1 64 ALA 64 465 465 ALA ALA C . n 
C 1 65 THR 65 466 466 THR THR C . n 
C 1 66 ASN 66 467 467 ASN ASN C . n 
C 1 67 ALA 67 468 468 ALA ALA C . n 
C 1 68 LEU 68 469 469 LEU LEU C . n 
C 1 69 ARG 69 470 470 ARG ARG C . n 
C 1 70 SER 70 471 471 SER SER C . n 
C 1 71 MET 71 472 472 MET MET C . n 
C 1 72 GLN 72 473 473 GLN GLN C . n 
C 1 73 GLY 73 474 474 GLY GLY C . n 
C 1 74 PHE 74 475 475 PHE PHE C . n 
C 1 75 PRO 75 476 476 PRO PRO C . n 
C 1 76 PHE 76 477 477 PHE PHE C . n 
C 1 77 TYR 77 478 478 TYR TYR C . n 
C 1 78 ASP 78 479 479 ASP ASP C . n 
C 1 79 LYS 79 480 480 LYS LYS C . n 
C 1 80 PRO 80 481 481 PRO PRO C . n 
C 1 81 MET 81 482 482 MET MET C . n 
C 1 82 ARG 82 483 483 ARG ARG C . n 
C 1 83 ILE 83 484 484 ILE ILE C . n 
C 1 84 GLN 84 485 485 GLN GLN C . n 
C 1 85 TYR 85 486 486 TYR TYR C . n 
C 1 86 ALA 86 487 487 ALA ALA C . n 
C 1 87 LYS 87 488 488 LYS LYS C . n 
C 1 88 THR 88 489 489 THR THR C . n 
C 1 89 ASP 89 490 ?   ?   ?   C . n 
C 1 90 SER 90 491 ?   ?   ?   C . n 
C 1 91 ASP 91 492 ?   ?   ?   C . n 
C 1 92 ILE 92 493 ?   ?   ?   C . n 
C 1 93 ILE 93 494 ?   ?   ?   C . n 
C 1 94 ALA 94 495 ?   ?   ?   C . n 
C 1 95 LYS 95 496 ?   ?   ?   C . n 
C 1 96 MET 96 497 ?   ?   ?   C . n 
D 1 1  ALA 1  502 ?   ?   ?   D . n 
D 1 2  VAL 2  503 ?   ?   ?   D . n 
D 1 3  PRO 3  504 ?   ?   ?   D . n 
D 1 4  GLU 4  505 ?   ?   ?   D . n 
D 1 5  THR 5  506 506 THR THR D . n 
D 1 6  ARG 6  507 507 ARG ALA D . n 
D 1 7  PRO 7  508 508 PRO PRO D . n 
D 1 8  ASN 8  509 509 ASN ASN D . n 
D 1 9  HIS 9  510 510 HIS HIS D . n 
D 1 10 THR 10 511 511 THR THR D . n 
D 1 11 ILE 11 512 512 ILE ILE D . n 
D 1 12 TYR 12 513 513 TYR TYR D . n 
D 1 13 ILE 13 514 514 ILE ILE D . n 
D 1 14 ASN 14 515 515 ASN ASN D . n 
D 1 15 ASN 15 516 516 ASN ASN D . n 
D 1 16 LEU 16 517 517 LEU LEU D . n 
D 1 17 ASN 17 518 518 ASN ASN D . n 
D 1 18 GLU 18 519 519 GLU GLU D . n 
D 1 19 LYS 19 520 520 LYS ALA D . n 
D 1 20 ILE 20 521 521 ILE ILE D . n 
D 1 21 LYS 21 522 522 LYS ALA D . n 
D 1 22 LYS 22 523 523 LYS LYS D . n 
D 1 23 ASP 23 524 524 ASP ASP D . n 
D 1 24 GLU 24 525 525 GLU GLU D . n 
D 1 25 LEU 25 526 526 LEU LEU D . n 
D 1 26 LYS 26 527 527 LYS LYS D . n 
D 1 27 LYS 27 528 528 LYS LYS D . n 
D 1 28 SER 28 529 529 SER SER D . n 
D 1 29 LEU 29 530 530 LEU LEU D . n 
D 1 30 HIS 30 531 531 HIS HIS D . n 
D 1 31 ALA 31 532 532 ALA ALA D . n 
D 1 32 ILE 32 533 533 ILE ILE D . n 
D 1 33 PHE 33 534 534 PHE PHE D . n 
D 1 34 SER 34 535 535 SER SER D . n 
D 1 35 ARG 35 536 536 ARG ARG D . n 
D 1 36 PHE 36 537 537 PHE PHE D . n 
D 1 37 GLY 37 538 538 GLY GLY D . n 
D 1 38 GLN 38 539 539 GLN GLN D . n 
D 1 39 ILE 39 540 540 ILE ILE D . n 
D 1 40 LEU 40 541 541 LEU LEU D . n 
D 1 41 ASP 41 542 542 ASP ASP D . n 
D 1 42 ILE 42 543 543 ILE ILE D . n 
D 1 43 LEU 43 544 544 LEU LEU D . n 
D 1 44 VAL 44 545 545 VAL VAL D . n 
D 1 45 SER 45 546 546 SER SER D . n 
D 1 46 ARG 46 547 547 ARG ALA D . n 
D 1 47 SER 47 548 548 SER SER D . n 
D 1 48 LEU 48 549 ?   ?   ?   D . n 
D 1 49 LYS 49 550 ?   ?   ?   D . n 
D 1 50 MET 50 551 551 MET MET D . n 
D 1 51 ARG 51 552 552 ARG ARG D . n 
D 1 52 GLY 52 553 553 GLY GLY D . n 
D 1 53 GLN 53 554 554 GLN GLN D . n 
D 1 54 ALA 54 555 555 ALA ALA D . n 
D 1 55 PHE 55 556 556 PHE PHE D . n 
D 1 56 VAL 56 557 557 VAL VAL D . n 
D 1 57 ILE 57 558 558 ILE ILE D . n 
D 1 58 PHE 58 559 559 PHE PHE D . n 
D 1 59 LYS 59 560 560 LYS ALA D . n 
D 1 60 GLU 60 561 561 GLU GLU D . n 
D 1 61 VAL 61 562 562 VAL VAL D . n 
D 1 62 SER 62 563 563 SER SER D . n 
D 1 63 SER 63 564 564 SER SER D . n 
D 1 64 ALA 64 565 565 ALA ALA D . n 
D 1 65 THR 65 566 566 THR THR D . n 
D 1 66 ASN 66 567 567 ASN ASN D . n 
D 1 67 ALA 67 568 568 ALA ALA D . n 
D 1 68 LEU 68 569 569 LEU LEU D . n 
D 1 69 ARG 69 570 570 ARG ALA D . n 
D 1 70 SER 70 571 571 SER SER D . n 
D 1 71 MET 71 572 572 MET MET D . n 
D 1 72 GLN 72 573 573 GLN GLN D . n 
D 1 73 GLY 73 574 574 GLY GLY D . n 
D 1 74 PHE 74 575 575 PHE PHE D . n 
D 1 75 PRO 75 576 576 PRO PRO D . n 
D 1 76 PHE 76 577 577 PHE PHE D . n 
D 1 77 TYR 77 578 578 TYR TYR D . n 
D 1 78 ASP 78 579 579 ASP ASP D . n 
D 1 79 LYS 79 580 580 LYS LYS D . n 
D 1 80 PRO 80 581 581 PRO PRO D . n 
D 1 81 MET 81 582 582 MET MET D . n 
D 1 82 ARG 82 583 583 ARG ARG D . n 
D 1 83 ILE 83 584 584 ILE ILE D . n 
D 1 84 GLN 84 585 585 GLN GLN D . n 
D 1 85 TYR 85 586 586 TYR TYR D . n 
D 1 86 ALA 86 587 587 ALA ALA D . n 
D 1 87 LYS 87 588 588 LYS ALA D . n 
D 1 88 THR 88 589 589 THR THR D . n 
D 1 89 ASP 89 590 ?   ?   ?   D . n 
D 1 90 SER 90 591 ?   ?   ?   D . n 
D 1 91 ASP 91 592 ?   ?   ?   D . n 
D 1 92 ILE 92 593 ?   ?   ?   D . n 
D 1 93 ILE 93 594 ?   ?   ?   D . n 
D 1 94 ALA 94 595 ?   ?   ?   D . n 
D 1 95 LYS 95 596 ?   ?   ?   D . n 
D 1 96 MET 96 597 ?   ?   ?   D . n 
E 2 1  G   1  4   4   G   G   E . n 
E 2 2  C   2  5   5   C   C   E . n 
E 2 3  G   3  6   6   G   G   E . n 
E 2 4  A   4  7   7   A   A   E . n 
E 2 5  C   5  8   8   C   C   E . n 
E 2 6  U   6  9   9   U   U   E . n 
E 2 7  C   7  10  10  C   C   E . n 
E 2 8  G   8  11  11  G   G   E . n 
E 2 9  G   9  12  12  G   G   E . n 
E 2 10 G   10 13  13  G   G   E . n 
E 2 11 G   11 14  14  G   G   E . n 
E 2 12 U   12 15  15  U   U   E . n 
E 2 13 G   13 16  16  G   G   E . n 
E 2 14 C   14 17  17  C   C   E . n 
E 2 15 C   15 18  18  C   C   E . n 
E 2 16 C   16 19  19  C   C   E . n 
E 2 17 U   17 20  20  U   U   E . n 
E 2 18 C   18 21  21  C   C   E . n 
E 2 19 C   19 22  22  C   C   E . n 
E 2 20 A   20 23  23  A   A   E . n 
E 2 21 U   21 24  24  U   U   E . n 
E 2 22 U   22 25  25  U   U   E . n 
E 2 23 G   23 26  26  G   G   E . n 
E 2 24 C   24 27  27  C   C   E . n 
E 2 25 A   25 28  28  A   A   E . n 
E 2 26 C   26 29  29  C   C   E . n 
E 2 27 U   27 30  30  U   U   E . n 
E 2 28 C   28 31  31  C   C   E . n 
E 2 29 C   29 32  32  C   C   E . n 
E 2 30 G   30 33  33  G   G   E . n 
E 2 31 G   31 34  34  G   G   E . n 
E 2 32 A   32 35  35  A   A   E . n 
E 2 33 G   33 36  36  G   G   E . n 
E 2 34 G   34 37  37  G   G   E . n 
E 2 35 C   35 38  38  C   C   E . n 
E 2 36 U   36 39  39  U   U   E . n 
E 2 37 G   37 40  40  G   G   E . n 
E 2 38 A   38 41  41  A   A   E . n 
E 2 39 G   39 42  42  G   G   E . n 
E 2 40 A   40 43  43  A   A   E . n 
E 2 41 A   41 44  44  A   A   E . n 
E 2 42 A   42 45  45  A   A   E . n 
E 2 43 U   43 46  46  U   U   E . n 
E 2 44 A   44 47  47  A   A   E . n 
E 2 45 C   45 48  48  C   C   E . n 
E 2 46 C   46 49  49  C   C   E . n 
E 2 47 C   47 50  50  C   C   E . n 
E 2 48 G   48 51  51  G   G   E . n 
E 2 49 U   49 52  52  U   U   E . n 
E 2 50 A   50 53  53  A   A   E . n 
E 2 51 U   51 54  54  U   U   E . n 
E 2 52 C   52 55  55  C   C   E . n 
E 2 53 A   53 56  56  A   A   E . n 
E 2 54 C   54 57  57  C   C   E . n 
E 2 55 C   55 58  58  C   C   E . n 
E 2 56 U   56 59  59  U   U   E . n 
E 2 57 G   57 60  60  G   G   E . n 
E 2 58 A   58 61  61  A   A   E . n 
E 2 59 U   59 62  62  U   U   E . n 
E 2 60 C   60 63  63  C   C   E . n 
E 2 61 U   61 64  64  U   U   E . n 
E 2 62 G   62 65  65  G   G   E . n 
E 2 63 G   63 66  66  G   G   E . n 
E 2 64 A   64 67  67  A   A   E . n 
E 2 65 U   65 68  68  U   U   E . n 
E 2 66 A   66 69  69  A   A   E . n 
E 2 67 A   67 70  70  A   A   E . n 
E 2 68 U   68 71  71  U   U   E . n 
E 2 69 G   69 72  72  G   G   E . n 
E 2 70 C   70 73  73  C   C   E . n 
E 2 71 C   71 74  74  C   C   E . n 
E 2 72 A   72 75  75  A   A   E . n 
E 2 73 G   73 76  76  G   G   E . n 
E 2 74 C   74 77  77  C   C   E . n 
E 2 75 G   75 78  78  G   G   E . n 
E 2 76 U   76 79  79  U   U   E . n 
E 2 77 A   77 80  80  A   A   E . n 
E 2 78 G   78 81  81  G   G   E . n 
E 2 79 G   79 82  82  G   G   E . n 
E 2 80 G   80 83  83  G   G   E . n 
E 2 81 A   81 84  84  A   A   E . n 
E 2 82 A   82 85  85  A   A   E . n 
E 2 83 G   83 86  86  G   G   E . n 
E 2 84 U   84 87  87  U   U   E . n 
E 2 85 C   85 88  88  C   C   E . n 
E 2 86 G   86 89  89  G   G   E . n 
E 2 87 C   87 90  90  C   C   E . n 
F 2 1  G   1  104 104 G   G   F . n 
F 2 2  C   2  105 105 C   C   F . n 
F 2 3  G   3  106 106 G   G   F . n 
F 2 4  A   4  107 107 A   A   F . n 
F 2 5  C   5  108 108 C   C   F . n 
F 2 6  U   6  109 109 U   U   F . n 
F 2 7  C   7  110 110 C   C   F . n 
F 2 8  G   8  111 111 G   G   F . n 
F 2 9  G   9  112 112 G   G   F . n 
F 2 10 G   10 113 113 G   G   F . n 
F 2 11 G   11 114 114 G   G   F . n 
F 2 12 U   12 115 115 U   U   F . n 
F 2 13 G   13 116 116 G   G   F . n 
F 2 14 C   14 117 117 C   C   F . n 
F 2 15 C   15 118 118 C   C   F . n 
F 2 16 C   16 119 119 C   C   F . n 
F 2 17 U   17 120 120 U   U   F . n 
F 2 18 C   18 121 121 C   C   F . n 
F 2 19 C   19 122 122 C   C   F . n 
F 2 20 A   20 123 123 A   A   F . n 
F 2 21 U   21 124 124 U   U   F . n 
F 2 22 U   22 125 125 U   U   F . n 
F 2 23 G   23 126 126 G   G   F . n 
F 2 24 C   24 127 127 C   C   F . n 
F 2 25 A   25 128 128 A   A   F . n 
F 2 26 C   26 129 129 C   C   F . n 
F 2 27 U   27 130 130 U   U   F . n 
F 2 28 C   28 131 131 C   C   F . n 
F 2 29 C   29 132 132 C   C   F . n 
F 2 30 G   30 133 133 G   G   F . n 
F 2 31 G   31 134 134 G   G   F . n 
F 2 32 A   32 135 135 A   A   F . n 
F 2 33 G   33 136 136 G   G   F . n 
F 2 34 G   34 137 137 G   G   F . n 
F 2 35 C   35 138 138 C   C   F . n 
F 2 36 U   36 139 139 U   U   F . n 
F 2 37 G   37 140 140 G   G   F . n 
F 2 38 A   38 141 141 A   A   F . n 
F 2 39 G   39 142 142 G   G   F . n 
F 2 40 A   40 143 143 A   A   F . n 
F 2 41 A   41 144 144 A   A   F . n 
F 2 42 A   42 145 145 A   A   F . n 
F 2 43 U   43 146 146 U   U   F . n 
F 2 44 A   44 147 147 A   A   F . n 
F 2 45 C   45 148 148 C   C   F . n 
F 2 46 C   46 149 149 C   C   F . n 
F 2 47 C   47 150 150 C   C   F . n 
F 2 48 G   48 151 151 G   G   F . n 
F 2 49 U   49 152 152 U   U   F . n 
F 2 50 A   50 153 153 A   A   F . n 
F 2 51 U   51 154 154 U   U   F . n 
F 2 52 C   52 155 155 C   C   F . n 
F 2 53 A   53 156 156 A   A   F . n 
F 2 54 C   54 157 157 C   C   F . n 
F 2 55 C   55 158 158 C   C   F . n 
F 2 56 U   56 159 159 U   U   F . n 
F 2 57 G   57 160 160 G   G   F . n 
F 2 58 A   58 161 161 A   A   F . n 
F 2 59 U   59 162 162 U   U   F . n 
F 2 60 C   60 163 163 C   C   F . n 
F 2 61 U   61 164 164 U   U   F . n 
F 2 62 G   62 165 165 G   G   F . n 
F 2 63 G   63 166 166 G   G   F . n 
F 2 64 A   64 167 167 A   A   F . n 
F 2 65 U   65 168 168 U   U   F . n 
F 2 66 A   66 169 169 A   A   F . n 
F 2 67 A   67 170 170 A   A   F . n 
F 2 68 U   68 171 171 U   U   F . n 
F 2 69 G   69 172 172 G   G   F . n 
F 2 70 C   70 173 173 C   C   F . n 
F 2 71 C   71 174 174 C   C   F . n 
F 2 72 A   72 175 175 A   A   F . n 
F 2 73 G   73 176 176 G   G   F . n 
F 2 74 C   74 177 177 C   C   F . n 
F 2 75 G   75 178 178 G   G   F . n 
F 2 76 U   76 179 179 U   U   F . n 
F 2 77 A   77 180 180 A   A   F . n 
F 2 78 G   78 181 181 G   G   F . n 
F 2 79 G   79 182 182 G   G   F . n 
F 2 80 G   80 183 183 G   G   F . n 
F 2 81 A   81 184 184 A   A   F . n 
F 2 82 A   82 185 185 A   A   F . n 
F 2 83 G   83 186 186 G   G   F . n 
F 2 84 U   84 187 187 U   U   F . n 
F 2 85 C   85 188 188 C   C   F . n 
F 2 86 G   86 189 189 G   G   F . n 
F 2 87 C   87 190 190 C   C   F . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_defined_assembly ? trimeric 3 
2 author_defined_assembly ? trimeric 3 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1 A,C,E,G,H,I,J,K,L,M 
2 1 B,D,F,N,O,P         
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  O6  ? E G   57 ? E G   60  ? 1_555 MG ? I MG . ? E MG 702 ? 1_555 O6  ? E G   75 ? E G   78  ? 1_555 76.8  ? 
2  O6  ? E G   57 ? E G   60  ? 1_555 MG ? I MG . ? E MG 702 ? 1_555 O1B ? G TPP .  ? E TPP 601 ? 1_555 149.9 ? 
3  O6  ? E G   75 ? E G   78  ? 1_555 MG ? I MG . ? E MG 702 ? 1_555 O1B ? G TPP .  ? E TPP 601 ? 1_555 85.6  ? 
4  O6  ? E G   62 ? E G   65  ? 1_555 MG ? M MG . ? E MG 707 ? 1_555 O4  ? E U   61 ? E U   64  ? 1_555 84.8  ? 
5  O6  ? F G   57 ? F G   160 ? 1_555 MG ? O MG . ? F MG 703 ? 1_555 O6  ? F G   75 ? F G   178 ? 1_555 78.9  ? 
6  O2A ? G TPP .  ? E TPP 601 ? 1_555 MG ? H MG . ? E MG 701 ? 1_555 O3B ? G TPP .  ? E TPP 601 ? 1_555 65.7  ? 
7  O2A ? G TPP .  ? E TPP 601 ? 1_555 MG ? H MG . ? E MG 701 ? 1_555 O3A ? G TPP .  ? E TPP 601 ? 1_555 61.0  ? 
8  O3B ? G TPP .  ? E TPP 601 ? 1_555 MG ? H MG . ? E MG 701 ? 1_555 O3A ? G TPP .  ? E TPP 601 ? 1_555 56.6  ? 
9  O3A ? N TPP .  ? F TPP 602 ? 1_555 MG ? P MG . ? F MG 708 ? 1_555 O7  ? N TPP .  ? F TPP 602 ? 1_555 65.3  ? 
10 O3A ? N TPP .  ? F TPP 602 ? 1_555 MG ? P MG . ? F MG 708 ? 1_555 O2A ? N TPP .  ? F TPP 602 ? 1_555 62.4  ? 
11 O7  ? N TPP .  ? F TPP 602 ? 1_555 MG ? P MG . ? F MG 708 ? 1_555 O2A ? N TPP .  ? F TPP 602 ? 1_555 54.6  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-12-22 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' .   ? 1 
PHASER   phasing           .   ? 2 
CNS      refinement        1.2 ? 3 
HKL-2000 'data reduction'  .   ? 4 
# 
_pdbx_validate_close_contact.id               1 
_pdbx_validate_close_contact.PDB_model_num    1 
_pdbx_validate_close_contact.auth_atom_id_1   OE1 
_pdbx_validate_close_contact.auth_asym_id_1   A 
_pdbx_validate_close_contact.auth_comp_id_1   GLU 
_pdbx_validate_close_contact.auth_seq_id_1    225 
_pdbx_validate_close_contact.PDB_ins_code_1   ? 
_pdbx_validate_close_contact.label_alt_id_1   ? 
_pdbx_validate_close_contact.auth_atom_id_2   NH2 
_pdbx_validate_close_contact.auth_asym_id_2   C 
_pdbx_validate_close_contact.auth_comp_id_2   ARG 
_pdbx_validate_close_contact.auth_seq_id_2    483 
_pdbx_validate_close_contact.PDB_ins_code_2   ? 
_pdbx_validate_close_contact.label_alt_id_2   ? 
_pdbx_validate_close_contact.dist             2.17 
# 
_pdbx_validate_rmsd_angle.id                         1 
_pdbx_validate_rmsd_angle.PDB_model_num              1 
_pdbx_validate_rmsd_angle.auth_atom_id_1             "C2'" 
_pdbx_validate_rmsd_angle.auth_asym_id_1             F 
_pdbx_validate_rmsd_angle.auth_comp_id_1             C 
_pdbx_validate_rmsd_angle.auth_seq_id_1              127 
_pdbx_validate_rmsd_angle.PDB_ins_code_1             ? 
_pdbx_validate_rmsd_angle.label_alt_id_1             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_2             "C3'" 
_pdbx_validate_rmsd_angle.auth_asym_id_2             F 
_pdbx_validate_rmsd_angle.auth_comp_id_2             C 
_pdbx_validate_rmsd_angle.auth_seq_id_2              127 
_pdbx_validate_rmsd_angle.PDB_ins_code_2             ? 
_pdbx_validate_rmsd_angle.label_alt_id_2             ? 
_pdbx_validate_rmsd_angle.auth_atom_id_3             "O3'" 
_pdbx_validate_rmsd_angle.auth_asym_id_3             F 
_pdbx_validate_rmsd_angle.auth_comp_id_3             C 
_pdbx_validate_rmsd_angle.auth_seq_id_3              127 
_pdbx_validate_rmsd_angle.PDB_ins_code_3             ? 
_pdbx_validate_rmsd_angle.label_alt_id_3             ? 
_pdbx_validate_rmsd_angle.angle_value                126.35 
_pdbx_validate_rmsd_angle.angle_target_value         113.70 
_pdbx_validate_rmsd_angle.angle_deviation            12.65 
_pdbx_validate_rmsd_angle.angle_standard_deviation   1.60 
_pdbx_validate_rmsd_angle.linker_flag                N 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ARG A 236 ? ? -18.98  -54.35 
2  1 ASP A 242 ? ? 171.32  158.45 
3  1 LEU A 249 ? ? -25.51  -57.68 
4  1 TYR A 278 ? ? 31.98   55.04  
5  1 ASP A 279 ? ? 87.06   -3.08  
6  1 ALA A 295 ? ? -27.34  -59.50 
7  1 PRO B 308 ? ? -45.35  153.28 
8  1 ASN B 316 ? ? 70.80   33.68  
9  1 ASN B 318 ? ? -40.05  98.85  
10 1 LEU B 349 ? ? -26.51  -55.66 
11 1 ARG B 352 ? ? -31.53  149.81 
12 1 PHE B 375 ? ? -30.67  141.44 
13 1 ASP B 379 ? ? 89.95   7.98   
14 1 ASP B 390 ? ? -43.19  158.53 
15 1 SER C 435 ? ? -66.83  3.22   
16 1 ASP C 442 ? ? 164.11  149.08 
17 1 LEU C 449 ? ? -61.81  18.93  
18 1 GLN C 473 ? ? -52.01  108.54 
19 1 LYS C 480 ? ? -167.63 112.83 
20 1 ARG D 507 ? ? -57.36  102.50 
21 1 PRO D 508 ? ? -44.42  100.28 
22 1 ASN D 516 ? ? 90.90   10.69  
23 1 LYS D 520 ? ? -62.72  22.37  
24 1 ASP D 542 ? ? 165.45  159.03 
25 1 ARG D 547 ? ? -54.09  18.96  
26 1 MET D 572 ? ? -69.19  7.92   
27 1 PRO D 576 ? ? -57.14  92.11  
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1   1 Y 1 A ARG 207 ? CG  ? A ARG 6  CG  
2   1 Y 1 A ARG 207 ? CD  ? A ARG 6  CD  
3   1 Y 1 A ARG 207 ? NE  ? A ARG 6  NE  
4   1 Y 1 A ARG 207 ? CZ  ? A ARG 6  CZ  
5   1 Y 1 A ARG 207 ? NH1 ? A ARG 6  NH1 
6   1 Y 1 A ARG 207 ? NH2 ? A ARG 6  NH2 
7   1 Y 1 A LYS 223 ? CG  ? A LYS 22 CG  
8   1 Y 1 A LYS 223 ? CD  ? A LYS 22 CD  
9   1 Y 1 A LYS 223 ? CE  ? A LYS 22 CE  
10  1 Y 1 A LYS 223 ? NZ  ? A LYS 22 NZ  
11  1 Y 1 B ARG 307 ? CG  ? B ARG 6  CG  
12  1 Y 1 B ARG 307 ? CD  ? B ARG 6  CD  
13  1 Y 1 B ARG 307 ? NE  ? B ARG 6  NE  
14  1 Y 1 B ARG 307 ? CZ  ? B ARG 6  CZ  
15  1 Y 1 B ARG 307 ? NH1 ? B ARG 6  NH1 
16  1 Y 1 B ARG 307 ? NH2 ? B ARG 6  NH2 
17  1 Y 1 B LYS 320 ? CG  ? B LYS 19 CG  
18  1 Y 1 B LYS 320 ? CD  ? B LYS 19 CD  
19  1 Y 1 B LYS 320 ? CE  ? B LYS 19 CE  
20  1 Y 1 B LYS 320 ? NZ  ? B LYS 19 NZ  
21  1 Y 1 B LYS 323 ? CG  ? B LYS 22 CG  
22  1 Y 1 B LYS 323 ? CD  ? B LYS 22 CD  
23  1 Y 1 B LYS 323 ? CE  ? B LYS 22 CE  
24  1 Y 1 B LYS 323 ? NZ  ? B LYS 22 NZ  
25  1 Y 1 B LYS 350 ? CG  ? B LYS 49 CG  
26  1 Y 1 B LYS 350 ? CD  ? B LYS 49 CD  
27  1 Y 1 B LYS 350 ? CE  ? B LYS 49 CE  
28  1 Y 1 B LYS 350 ? NZ  ? B LYS 49 NZ  
29  1 Y 1 B ARG 370 ? CG  ? B ARG 69 CG  
30  1 Y 1 B ARG 370 ? CD  ? B ARG 69 CD  
31  1 Y 1 B ARG 370 ? NE  ? B ARG 69 NE  
32  1 Y 1 B ARG 370 ? CZ  ? B ARG 69 CZ  
33  1 Y 1 B ARG 370 ? NH1 ? B ARG 69 NH1 
34  1 Y 1 B ARG 370 ? NH2 ? B ARG 69 NH2 
35  1 Y 1 C GLU 405 ? CG  ? C GLU 4  CG  
36  1 Y 1 C GLU 405 ? CD  ? C GLU 4  CD  
37  1 Y 1 C GLU 405 ? OE1 ? C GLU 4  OE1 
38  1 Y 1 C GLU 405 ? OE2 ? C GLU 4  OE2 
39  1 Y 1 C ARG 407 ? CG  ? C ARG 6  CG  
40  1 Y 1 C ARG 407 ? CD  ? C ARG 6  CD  
41  1 Y 1 C ARG 407 ? NE  ? C ARG 6  NE  
42  1 Y 1 C ARG 407 ? CZ  ? C ARG 6  CZ  
43  1 Y 1 C ARG 407 ? NH1 ? C ARG 6  NH1 
44  1 Y 1 C ARG 407 ? NH2 ? C ARG 6  NH2 
45  1 Y 1 C GLU 419 ? CG  ? C GLU 18 CG  
46  1 Y 1 C GLU 419 ? CD  ? C GLU 18 CD  
47  1 Y 1 C GLU 419 ? OE1 ? C GLU 18 OE1 
48  1 Y 1 C GLU 419 ? OE2 ? C GLU 18 OE2 
49  1 Y 1 C LYS 420 ? CG  ? C LYS 19 CG  
50  1 Y 1 C LYS 420 ? CD  ? C LYS 19 CD  
51  1 Y 1 C LYS 420 ? CE  ? C LYS 19 CE  
52  1 Y 1 C LYS 420 ? NZ  ? C LYS 19 NZ  
53  1 Y 1 C ARG 447 ? CG  ? C ARG 46 CG  
54  1 Y 1 C ARG 447 ? CD  ? C ARG 46 CD  
55  1 Y 1 C ARG 447 ? NE  ? C ARG 46 NE  
56  1 Y 1 C ARG 447 ? CZ  ? C ARG 46 CZ  
57  1 Y 1 C ARG 447 ? NH1 ? C ARG 46 NH1 
58  1 Y 1 C ARG 447 ? NH2 ? C ARG 46 NH2 
59  1 Y 1 C MET 451 ? CG  ? C MET 50 CG  
60  1 Y 1 C MET 451 ? SD  ? C MET 50 SD  
61  1 Y 1 C MET 451 ? CE  ? C MET 50 CE  
62  1 Y 1 C ARG 452 ? CG  ? C ARG 51 CG  
63  1 Y 1 C ARG 452 ? CD  ? C ARG 51 CD  
64  1 Y 1 C ARG 452 ? NE  ? C ARG 51 NE  
65  1 Y 1 C ARG 452 ? CZ  ? C ARG 51 CZ  
66  1 Y 1 C ARG 452 ? NH1 ? C ARG 51 NH1 
67  1 Y 1 C ARG 452 ? NH2 ? C ARG 51 NH2 
68  1 Y 1 D ARG 507 ? CG  ? D ARG 6  CG  
69  1 Y 1 D ARG 507 ? CD  ? D ARG 6  CD  
70  1 Y 1 D ARG 507 ? NE  ? D ARG 6  NE  
71  1 Y 1 D ARG 507 ? CZ  ? D ARG 6  CZ  
72  1 Y 1 D ARG 507 ? NH1 ? D ARG 6  NH1 
73  1 Y 1 D ARG 507 ? NH2 ? D ARG 6  NH2 
74  1 Y 1 D LYS 520 ? CG  ? D LYS 19 CG  
75  1 Y 1 D LYS 520 ? CD  ? D LYS 19 CD  
76  1 Y 1 D LYS 520 ? CE  ? D LYS 19 CE  
77  1 Y 1 D LYS 520 ? NZ  ? D LYS 19 NZ  
78  1 Y 1 D LYS 522 ? CG  ? D LYS 21 CG  
79  1 Y 1 D LYS 522 ? CD  ? D LYS 21 CD  
80  1 Y 1 D LYS 522 ? CE  ? D LYS 21 CE  
81  1 Y 1 D LYS 522 ? NZ  ? D LYS 21 NZ  
82  1 Y 1 D ARG 547 ? CG  ? D ARG 46 CG  
83  1 Y 1 D ARG 547 ? CD  ? D ARG 46 CD  
84  1 Y 1 D ARG 547 ? NE  ? D ARG 46 NE  
85  1 Y 1 D ARG 547 ? CZ  ? D ARG 46 CZ  
86  1 Y 1 D ARG 547 ? NH1 ? D ARG 46 NH1 
87  1 Y 1 D ARG 547 ? NH2 ? D ARG 46 NH2 
88  1 Y 1 D LYS 560 ? CG  ? D LYS 59 CG  
89  1 Y 1 D LYS 560 ? CD  ? D LYS 59 CD  
90  1 Y 1 D LYS 560 ? CE  ? D LYS 59 CE  
91  1 Y 1 D LYS 560 ? NZ  ? D LYS 59 NZ  
92  1 Y 1 D ARG 570 ? CG  ? D ARG 69 CG  
93  1 Y 1 D ARG 570 ? CD  ? D ARG 69 CD  
94  1 Y 1 D ARG 570 ? NE  ? D ARG 69 NE  
95  1 Y 1 D ARG 570 ? CZ  ? D ARG 69 CZ  
96  1 Y 1 D ARG 570 ? NH1 ? D ARG 69 NH1 
97  1 Y 1 D ARG 570 ? NH2 ? D ARG 69 NH2 
98  1 Y 1 D LYS 588 ? CG  ? D LYS 87 CG  
99  1 Y 1 D LYS 588 ? CD  ? D LYS 87 CD  
100 1 Y 1 D LYS 588 ? CE  ? D LYS 87 CE  
101 1 Y 1 D LYS 588 ? NZ  ? D LYS 87 NZ  
102 1 Y 1 E C   31  ? N1  ? E C   28 N1  
103 1 Y 1 E C   31  ? C2  ? E C   28 C2  
104 1 Y 1 E C   31  ? O2  ? E C   28 O2  
105 1 Y 1 E C   31  ? N3  ? E C   28 N3  
106 1 Y 1 E C   31  ? C4  ? E C   28 C4  
107 1 Y 1 E C   31  ? N4  ? E C   28 N4  
108 1 Y 1 E C   31  ? C5  ? E C   28 C5  
109 1 Y 1 E C   31  ? C6  ? E C   28 C6  
110 1 Y 1 E U   46  ? N1  ? E U   43 N1  
111 1 Y 1 E U   46  ? C2  ? E U   43 C2  
112 1 Y 1 E U   46  ? O2  ? E U   43 O2  
113 1 Y 1 E U   46  ? N3  ? E U   43 N3  
114 1 Y 1 E U   46  ? C4  ? E U   43 C4  
115 1 Y 1 E U   46  ? O4  ? E U   43 O4  
116 1 Y 1 E U   46  ? C5  ? E U   43 C5  
117 1 Y 1 E U   46  ? C6  ? E U   43 C6  
118 1 Y 1 E C   55  ? N1  ? E C   52 N1  
119 1 Y 1 E C   55  ? C2  ? E C   52 C2  
120 1 Y 1 E C   55  ? O2  ? E C   52 O2  
121 1 Y 1 E C   55  ? N3  ? E C   52 N3  
122 1 Y 1 E C   55  ? C4  ? E C   52 C4  
123 1 Y 1 E C   55  ? N4  ? E C   52 N4  
124 1 Y 1 E C   55  ? C5  ? E C   52 C5  
125 1 Y 1 E C   55  ? C6  ? E C   52 C6  
126 1 Y 1 F U   130 ? N1  ? F U   27 N1  
127 1 Y 1 F U   130 ? C2  ? F U   27 C2  
128 1 Y 1 F U   130 ? O2  ? F U   27 O2  
129 1 Y 1 F U   130 ? N3  ? F U   27 N3  
130 1 Y 1 F U   130 ? C4  ? F U   27 C4  
131 1 Y 1 F U   130 ? O4  ? F U   27 O4  
132 1 Y 1 F U   130 ? C5  ? F U   27 C5  
133 1 Y 1 F U   130 ? C6  ? F U   27 C6  
134 1 Y 1 F C   131 ? N1  ? F C   28 N1  
135 1 Y 1 F C   131 ? C2  ? F C   28 C2  
136 1 Y 1 F C   131 ? O2  ? F C   28 O2  
137 1 Y 1 F C   131 ? N3  ? F C   28 N3  
138 1 Y 1 F C   131 ? C4  ? F C   28 C4  
139 1 Y 1 F C   131 ? N4  ? F C   28 N4  
140 1 Y 1 F C   131 ? C5  ? F C   28 C5  
141 1 Y 1 F C   131 ? C6  ? F C   28 C6  
142 1 Y 1 F U   146 ? N1  ? F U   43 N1  
143 1 Y 1 F U   146 ? C2  ? F U   43 C2  
144 1 Y 1 F U   146 ? O2  ? F U   43 O2  
145 1 Y 1 F U   146 ? N3  ? F U   43 N3  
146 1 Y 1 F U   146 ? C4  ? F U   43 C4  
147 1 Y 1 F U   146 ? O4  ? F U   43 O4  
148 1 Y 1 F U   146 ? C5  ? F U   43 C5  
149 1 Y 1 F U   146 ? C6  ? F U   43 C6  
150 1 Y 1 F U   154 ? N1  ? F U   51 N1  
151 1 Y 1 F U   154 ? C2  ? F U   51 C2  
152 1 Y 1 F U   154 ? O2  ? F U   51 O2  
153 1 Y 1 F U   154 ? N3  ? F U   51 N3  
154 1 Y 1 F U   154 ? C4  ? F U   51 C4  
155 1 Y 1 F U   154 ? O4  ? F U   51 O4  
156 1 Y 1 F U   154 ? C5  ? F U   51 C5  
157 1 Y 1 F U   154 ? C6  ? F U   51 C6  
158 1 Y 1 F C   155 ? N1  ? F C   52 N1  
159 1 Y 1 F C   155 ? C2  ? F C   52 C2  
160 1 Y 1 F C   155 ? O2  ? F C   52 O2  
161 1 Y 1 F C   155 ? N3  ? F C   52 N3  
162 1 Y 1 F C   155 ? C4  ? F C   52 C4  
163 1 Y 1 F C   155 ? N4  ? F C   52 N4  
164 1 Y 1 F C   155 ? C5  ? F C   52 C5  
165 1 Y 1 F C   155 ? C6  ? F C   52 C6  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A ALA 202 ? A ALA 1  
2  1 Y 1 A VAL 203 ? A VAL 2  
3  1 Y 1 A PRO 204 ? A PRO 3  
4  1 Y 1 A GLU 205 ? A GLU 4  
5  1 Y 1 B ALA 302 ? B ALA 1  
6  1 Y 1 B VAL 303 ? B VAL 2  
7  1 Y 1 B PRO 304 ? B PRO 3  
8  1 Y 1 B GLU 305 ? B GLU 4  
9  1 Y 1 C ALA 402 ? C ALA 1  
10 1 Y 1 C VAL 403 ? C VAL 2  
11 1 Y 1 C ASP 490 ? C ASP 89 
12 1 Y 1 C SER 491 ? C SER 90 
13 1 Y 1 C ASP 492 ? C ASP 91 
14 1 Y 1 C ILE 493 ? C ILE 92 
15 1 Y 1 C ILE 494 ? C ILE 93 
16 1 Y 1 C ALA 495 ? C ALA 94 
17 1 Y 1 C LYS 496 ? C LYS 95 
18 1 Y 1 C MET 497 ? C MET 96 
19 1 Y 1 D ALA 502 ? D ALA 1  
20 1 Y 1 D VAL 503 ? D VAL 2  
21 1 Y 1 D PRO 504 ? D PRO 3  
22 1 Y 1 D GLU 505 ? D GLU 4  
23 1 Y 1 D LEU 549 ? D LEU 48 
24 1 Y 1 D LYS 550 ? D LYS 49 
25 1 Y 1 D ASP 590 ? D ASP 89 
26 1 Y 1 D SER 591 ? D SER 90 
27 1 Y 1 D ASP 592 ? D ASP 91 
28 1 Y 1 D ILE 593 ? D ILE 92 
29 1 Y 1 D ILE 594 ? D ILE 93 
30 1 Y 1 D ALA 595 ? D ALA 94 
31 1 Y 1 D LYS 596 ? D LYS 95 
32 1 Y 1 D MET 597 ? D MET 96 
# 
loop_
_ndb_struct_conf_na.entry_id 
_ndb_struct_conf_na.feature 
3K0J 'double helix'         
3K0J 'a-form double helix'  
3K0J 'hairpin loop'         
3K0J 'bulge loop'           
3K0J 'mismatched base pair' 
3K0J 'internal loop'        
3K0J 'three-way junction'   
# 
loop_
_ndb_struct_na_base_pair.model_number 
_ndb_struct_na_base_pair.i_label_asym_id 
_ndb_struct_na_base_pair.i_label_comp_id 
_ndb_struct_na_base_pair.i_label_seq_id 
_ndb_struct_na_base_pair.i_symmetry 
_ndb_struct_na_base_pair.j_label_asym_id 
_ndb_struct_na_base_pair.j_label_comp_id 
_ndb_struct_na_base_pair.j_label_seq_id 
_ndb_struct_na_base_pair.j_symmetry 
_ndb_struct_na_base_pair.shear 
_ndb_struct_na_base_pair.stretch 
_ndb_struct_na_base_pair.stagger 
_ndb_struct_na_base_pair.buckle 
_ndb_struct_na_base_pair.propeller 
_ndb_struct_na_base_pair.opening 
_ndb_struct_na_base_pair.pair_number 
_ndb_struct_na_base_pair.pair_name 
_ndb_struct_na_base_pair.i_auth_asym_id 
_ndb_struct_na_base_pair.i_auth_seq_id 
_ndb_struct_na_base_pair.i_PDB_ins_code 
_ndb_struct_na_base_pair.j_auth_asym_id 
_ndb_struct_na_base_pair.j_auth_seq_id 
_ndb_struct_na_base_pair.j_PDB_ins_code 
_ndb_struct_na_base_pair.hbond_type_28 
_ndb_struct_na_base_pair.hbond_type_12 
1 E G 1  1_555 E C 87 1_555 -0.083 -0.012 0.694  2.496   0.262   0.057    1  E_G4:C90_E    E 4   ? E 90  ? 19 1  
1 E C 2  1_555 E G 86 1_555 -1.287 -0.114 0.346  -2.389  -7.347  -14.873  2  E_C5:G89_E    E 5   ? E 89  ? 19 1  
1 E G 3  1_555 E C 85 1_555 0.559  -0.352 0.098  5.602   -5.180  2.679    3  E_G6:C88_E    E 6   ? E 88  ? 19 1  
1 E A 4  1_555 E U 84 1_555 -1.186 -0.309 0.509  8.499   -10.221 -4.758   4  E_A7:U87_E    E 7   ? E 87  ? 20 1  
1 E C 5  1_555 E G 83 1_555 -0.264 -0.256 0.331  -1.737  -11.190 -6.407   5  E_C8:G86_E    E 8   ? E 86  ? 19 1  
1 E U 6  1_555 E A 82 1_555 -0.803 -0.163 0.095  -11.170 -9.550  1.816    6  E_U9:A85_E    E 9   ? E 85  ? 20 1  
1 E C 7  1_555 E G 48 1_555 -0.466 -0.126 0.156  1.446   -3.363  0.984    7  E_C10:G51_E   E 10  ? E 51  ? 19 1  
1 E G 8  1_555 E C 47 1_555 -0.267 -0.339 0.228  0.319   -7.779  -2.261   8  E_G11:C50_E   E 11  ? E 50  ? 19 1  
1 E G 9  1_555 E C 46 1_555 -0.498 -0.334 0.379  -8.683  -13.053 2.595    9  E_G12:C49_E   E 12  ? E 49  ? 19 1  
1 E G 10 1_555 E C 45 1_555 -0.136 -0.291 0.537  -5.143  -13.888 -3.112   10 E_G13:C48_E   E 13  ? E 48  ? 19 1  
1 E G 11 1_555 E A 44 1_555 0.444  1.158  -0.271 3.039   -24.879 -17.356  11 E_G14:A47_E   E 14  ? E 47  ? 8  1  
1 E U 12 1_555 E A 42 1_555 1.898  -0.056 -0.099 16.981  2.151   -27.417  12 E_U15:A45_E   E 15  ? E 45  ? ?  ?  
1 E G 30 1_555 E C 19 1_555 0.023  0.309  -0.644 -2.459  -9.117  9.108    13 E_G33:C22_E   E 33  ? E 22  ? ?  1  
1 E G 31 1_555 E C 18 1_555 -0.412 0.156  -0.407 -2.758  -3.592  12.619   14 E_G34:C21_E   E 34  ? E 21  ? ?  1  
1 E A 32 1_555 E U 17 1_555 -0.158 -0.303 0.071  6.346   8.054   10.170   15 E_A35:U20_E   E 35  ? E 20  ? 20 1  
1 E G 33 1_555 E C 15 1_555 0.236  -0.065 -0.377 -8.182  7.119   1.670    16 E_G36:C18_E   E 36  ? E 18  ? 19 1  
1 E G 34 1_555 E C 14 1_555 -0.281 0.081  -0.111 -10.641 -15.648 10.568   17 E_G37:C17_E   E 37  ? E 17  ? 19 1  
1 E C 35 1_555 E G 13 1_555 0.170  -0.104 0.289  -15.219 5.348   1.045    18 E_C38:G16_E   E 38  ? E 16  ? 19 1  
1 E U 36 1_555 E A 40 1_555 4.514  -2.719 1.212  8.097   20.556  -92.649  19 E_U39:A43_E   E 39  ? E 43  ? 24 4  
1 E A 53 1_555 E G 80 1_555 -7.095 -4.518 0.556  8.307   -11.959 -12.405  20 E_A56:G83_E   E 56  ? E 83  ? ?  10 
1 E C 54 1_555 E G 79 1_555 0.009  -0.291 -0.047 12.800  -4.988  -2.527   21 E_C57:G82_E   E 57  ? E 82  ? 19 1  
1 E C 55 1_555 E G 78 1_555 -0.100 -0.044 -0.293 12.761  -19.532 3.436    22 E_C58:G81_E   E 58  ? E 81  ? 19 1  
1 E U 56 1_555 E A 77 1_555 -0.851 -0.009 0.706  -7.302  -0.109  0.536    23 E_U59:A80_E   E 59  ? E 80  ? 20 1  
1 E G 57 1_555 E G 75 1_555 0.779  3.326  -0.415 -21.006 8.804   -101.671 24 E_G60:G78_E   E 60  ? E 78  ? 6  3  
1 E A 58 1_555 E C 74 1_555 -2.373 3.360  0.676  0.074   -11.879 98.413   25 E_A61:C77_E   E 61  ? E 77  ? ?  ?  
1 E C 60 1_555 E G 73 1_555 -0.369 0.025  -0.546 26.275  -32.754 2.691    26 E_C63:G76_E   E 63  ? E 76  ? 19 1  
1 E U 61 1_555 E A 72 1_555 0.008  -0.273 -0.396 4.387   -22.486 1.845    27 E_U64:A75_E   E 64  ? E 75  ? 20 1  
1 E G 62 1_555 E C 71 1_555 0.332  0.008  -0.283 -11.171 -13.492 2.377    28 E_G65:C74_E   E 65  ? E 74  ? 19 1  
1 E G 63 1_555 E C 70 1_555 0.146  0.352  0.420  0.111   -4.120  6.352    29 E_G66:C73_E   E 66  ? E 73  ? ?  1  
1 F G 1  1_555 F C 87 1_555 -1.014 -0.092 0.750  -4.979  -23.161 8.414    30 F_G104:C190_F F 104 ? F 190 ? ?  1  
1 F C 2  1_555 F G 86 1_555 -0.320 0.257  0.392  10.973  -11.772 4.314    31 F_C105:G189_F F 105 ? F 189 ? 19 1  
1 F G 3  1_555 F C 85 1_555 0.331  -0.142 0.096  2.373   -16.783 10.991   32 F_G106:C188_F F 106 ? F 188 ? 19 1  
1 F A 4  1_555 F U 84 1_555 -0.796 -0.477 0.221  -0.104  -8.892  -7.401   33 F_A107:U187_F F 107 ? F 187 ? 20 1  
1 F C 5  1_555 F G 83 1_555 -0.951 -0.222 0.195  3.828   -14.065 -4.239   34 F_C108:G186_F F 108 ? F 186 ? 19 1  
1 F U 6  1_555 F A 82 1_555 -0.472 0.561  0.862  -14.952 -17.114 20.418   35 F_U109:A185_F F 109 ? F 185 ? ?  ?  
1 F C 7  1_555 F G 48 1_555 1.394  0.131  0.194  -3.949  -15.340 8.134    36 F_C110:G151_F F 110 ? F 151 ? ?  1  
1 F G 8  1_555 F C 47 1_555 -0.653 -0.104 0.204  0.629   -10.422 8.788    37 F_G111:C150_F F 111 ? F 150 ? 19 1  
1 F G 9  1_555 F C 46 1_555 -0.896 -0.642 -0.344 -9.937  -15.602 4.068    38 F_G112:C149_F F 112 ? F 149 ? 19 1  
1 F G 10 1_555 F C 45 1_555 -0.346 -0.270 0.242  -11.023 -17.967 -9.208   39 F_G113:C148_F F 113 ? F 148 ? 19 1  
1 F G 11 1_555 F A 44 1_555 0.099  1.938  -0.092 0.904   -11.380 -12.148  40 F_G114:A147_F F 114 ? F 147 ? 8  1  
1 F G 30 1_555 F C 19 1_555 -1.437 0.166  -0.516 -17.623 6.196   12.688   41 F_G133:C122_F F 133 ? F 122 ? ?  1  
1 F G 31 1_555 F C 18 1_555 1.115  -0.085 -0.915 -7.598  -7.295  -3.690   42 F_G134:C121_F F 134 ? F 121 ? 19 1  
1 F A 32 1_555 F U 17 1_555 0.359  -0.121 1.515  26.708  23.058  11.208   43 F_A135:U120_F F 135 ? F 120 ? 20 1  
1 F G 33 1_555 F C 15 1_555 -0.241 -0.200 -0.453 -23.071 -16.571 2.749    44 F_G136:C118_F F 136 ? F 118 ? 19 1  
1 F G 34 1_555 F C 14 1_555 0.526  0.051  -0.475 -21.436 -16.987 -4.275   45 F_G137:C117_F F 137 ? F 117 ? 19 1  
1 F C 35 1_555 F G 13 1_555 -0.079 -0.385 0.536  -15.609 4.099   -6.770   46 F_C138:G116_F F 138 ? F 116 ? 19 1  
1 F U 36 1_555 F A 40 1_555 4.042  -2.490 0.731  3.471   14.930  -90.229  47 F_U139:A143_F F 139 ? F 143 ? 24 4  
1 F U 21 1_555 F G 23 1_555 0.982  4.800  -2.205 49.293  18.647  103.063  48 F_U124:G126_F F 124 ? F 126 ? ?  ?  
1 F A 50 1_555 F A 81 1_555 6.210  -5.301 0.771  -15.334 18.614  163.587  49 F_A153:A184_F F 153 ? F 184 ? ?  ?  
1 F A 53 1_555 F G 80 1_555 -7.206 -5.207 0.382  13.534  -10.021 -25.713  50 F_A156:G183_F F 156 ? F 183 ? ?  10 
1 F C 54 1_555 F G 79 1_555 0.097  0.148  -0.075 13.187  -9.875  0.038    51 F_C157:G182_F F 157 ? F 182 ? 19 1  
1 F C 55 1_555 F G 78 1_555 -0.318 -0.299 -0.295 10.621  -22.410 -1.539   52 F_C158:G181_F F 158 ? F 181 ? 19 1  
1 F U 56 1_555 F A 77 1_555 -0.185 -0.189 0.348  -16.402 -14.078 -2.480   53 F_U159:A180_F F 159 ? F 180 ? 20 1  
1 F G 57 1_555 F G 75 1_555 0.800  3.591  0.161  -12.294 14.204  -92.562  54 F_G160:G178_F F 160 ? F 178 ? 6  3  
1 F A 58 1_555 F C 74 1_555 -2.355 2.707  -0.920 5.861   -16.422 104.230  55 F_A161:C177_F F 161 ? F 177 ? ?  ?  
1 F C 60 1_555 F G 73 1_555 -0.593 -0.170 0.692  2.965   -13.575 -1.582   56 F_C163:G176_F F 163 ? F 176 ? 19 1  
1 F U 61 1_555 F A 72 1_555 -0.209 0.052  0.141  1.733   -11.134 -7.340   57 F_U164:A175_F F 164 ? F 175 ? 20 1  
1 F G 62 1_555 F C 71 1_555 -0.217 -0.121 -0.485 -13.203 -6.063  -10.336  58 F_G165:C174_F F 165 ? F 174 ? 19 1  
1 F G 63 1_555 F C 70 1_555 -0.201 -0.273 0.362  -0.850  -10.066 1.402    59 F_G166:C173_F F 166 ? F 173 ? 19 1  
# 
loop_
_ndb_struct_na_base_pair_step.model_number 
_ndb_struct_na_base_pair_step.i_label_asym_id_1 
_ndb_struct_na_base_pair_step.i_label_comp_id_1 
_ndb_struct_na_base_pair_step.i_label_seq_id_1 
_ndb_struct_na_base_pair_step.i_symmetry_1 
_ndb_struct_na_base_pair_step.j_label_asym_id_1 
_ndb_struct_na_base_pair_step.j_label_comp_id_1 
_ndb_struct_na_base_pair_step.j_label_seq_id_1 
_ndb_struct_na_base_pair_step.j_symmetry_1 
_ndb_struct_na_base_pair_step.i_label_asym_id_2 
_ndb_struct_na_base_pair_step.i_label_comp_id_2 
_ndb_struct_na_base_pair_step.i_label_seq_id_2 
_ndb_struct_na_base_pair_step.i_symmetry_2 
_ndb_struct_na_base_pair_step.j_label_asym_id_2 
_ndb_struct_na_base_pair_step.j_label_comp_id_2 
_ndb_struct_na_base_pair_step.j_label_seq_id_2 
_ndb_struct_na_base_pair_step.j_symmetry_2 
_ndb_struct_na_base_pair_step.shift 
_ndb_struct_na_base_pair_step.slide 
_ndb_struct_na_base_pair_step.rise 
_ndb_struct_na_base_pair_step.tilt 
_ndb_struct_na_base_pair_step.roll 
_ndb_struct_na_base_pair_step.twist 
_ndb_struct_na_base_pair_step.x_displacement 
_ndb_struct_na_base_pair_step.y_displacement 
_ndb_struct_na_base_pair_step.helical_rise 
_ndb_struct_na_base_pair_step.inclination 
_ndb_struct_na_base_pair_step.tip 
_ndb_struct_na_base_pair_step.helical_twist 
_ndb_struct_na_base_pair_step.step_number 
_ndb_struct_na_base_pair_step.step_name 
_ndb_struct_na_base_pair_step.i_auth_asym_id_1 
_ndb_struct_na_base_pair_step.i_auth_seq_id_1 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.j_auth_asym_id_1 
_ndb_struct_na_base_pair_step.j_auth_seq_id_1 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_1 
_ndb_struct_na_base_pair_step.i_auth_asym_id_2 
_ndb_struct_na_base_pair_step.i_auth_seq_id_2 
_ndb_struct_na_base_pair_step.i_PDB_ins_code_2 
_ndb_struct_na_base_pair_step.j_auth_asym_id_2 
_ndb_struct_na_base_pair_step.j_auth_seq_id_2 
_ndb_struct_na_base_pair_step.j_PDB_ins_code_2 
1 E G 1  1_555 E C 87 1_555 E C 2  1_555 E G 86 1_555 -0.064 -1.244 3.443  -0.517  10.745   28.145  -4.565  0.019  2.791  21.144  
1.017   30.092   1  EE_G4C5:G89C90_EE       E 4   ? E 90  ? E 5   ? E 89  ? 
1 E C 2  1_555 E G 86 1_555 E G 3  1_555 E C 85 1_555 0.941  -1.991 2.841  3.353   7.118    37.857  -3.734  -1.080 2.511  10.828  
-5.101  38.637   2  EE_C5G6:C88G89_EE       E 5   ? E 89  ? E 6   ? E 88  ? 
1 E G 3  1_555 E C 85 1_555 E A 4  1_555 E U 84 1_555 -0.315 -2.167 2.907  -5.168  4.731    23.895  -6.217  -0.566 2.451  11.125  
12.151  24.887   3  EE_G6A7:U87C88_EE       E 6   ? E 88  ? E 7   ? E 87  ? 
1 E A 4  1_555 E U 84 1_555 E C 5  1_555 E G 83 1_555 -0.252 -1.779 3.513  2.105   4.604    38.673  -3.245  0.642  3.270  6.916   
-3.163  38.990   4  EE_A7C8:G86U87_EE       E 7   ? E 87  ? E 8   ? E 86  ? 
1 E C 5  1_555 E G 83 1_555 E U 6  1_555 E A 82 1_555 0.775  -1.134 3.390  4.288   9.005    31.218  -3.576  -0.630 3.032  16.222  
-7.724  32.735   5  EE_C8U9:A85G86_EE       E 8   ? E 86  ? E 9   ? E 85  ? 
1 E U 6  1_555 E A 82 1_555 E C 7  1_555 E G 48 1_555 1.234  -0.629 3.096  -0.394  6.349    37.854  -1.694  -1.923 2.943  9.702   
0.602   38.366   6  EE_U9C10:G51A85_EE      E 9   ? E 85  ? E 10  ? E 51  ? 
1 E C 7  1_555 E G 48 1_555 E G 8  1_555 E C 47 1_555 0.738  -1.850 2.978  -0.614  9.042    33.760  -4.229  -1.308 2.405  15.232  
1.034   34.921   7  EE_C10G11:C50G51_EE     E 10  ? E 51  ? E 11  ? E 50  ? 
1 E G 8  1_555 E C 47 1_555 E G 9  1_555 E C 46 1_555 -0.270 -1.836 3.436  -1.919  2.395    34.096  -3.509  0.146  3.313  4.075   
3.265   34.230   8  EE_G11G12:C49C50_EE     E 11  ? E 50  ? E 12  ? E 49  ? 
1 E G 9  1_555 E C 46 1_555 E G 10 1_555 E C 45 1_555 -0.084 -1.770 3.260  3.455   0.443    32.322  -3.240  0.750  3.210  0.793   
-6.184  32.504   9  EE_G12G13:C48C49_EE     E 12  ? E 49  ? E 13  ? E 48  ? 
1 E G 10 1_555 E C 45 1_555 E G 11 1_555 E A 44 1_555 -1.110 -0.335 3.068  9.100   7.104    35.669  -1.352  2.793  2.606  11.241  
-14.398 37.433   10 EE_G13G14:A47C48_EE     E 13  ? E 48  ? E 14  ? E 47  ? 
1 E G 11 1_555 E A 44 1_555 E U 12 1_555 E A 42 1_555 -0.505 -0.068 3.225  3.158   8.147    25.916  -2.120  1.835  2.985  17.542  
-6.799  27.326   11 EE_G14U15:A45A47_EE     E 14  ? E 47  ? E 15  ? E 45  ? 
1 E G 30 1_555 E C 19 1_555 E G 31 1_555 E C 18 1_555 -0.352 -1.996 3.070  -9.496  10.956   29.563  -5.132  -0.767 2.219  20.025  
17.357  32.856   12 EE_G33G34:C21C22_EE     E 33  ? E 22  ? E 34  ? E 21  ? 
1 E G 31 1_555 E C 18 1_555 E A 32 1_555 E U 17 1_555 -0.312 -2.247 3.040  -3.912  4.187    25.420  -5.997  -0.252 2.659  9.364   
8.748   26.047   13 EE_G34A35:U20C21_EE     E 34  ? E 21  ? E 35  ? E 20  ? 
1 E A 32 1_555 E U 17 1_555 E G 33 1_555 E C 15 1_555 2.450  -0.515 3.355  7.377   12.613   52.345  -1.385  -2.209 3.447  13.990  
-8.183  54.207   14 EE_A35G36:C18U20_EE     E 35  ? E 20  ? E 36  ? E 18  ? 
1 E G 33 1_555 E C 15 1_555 E G 34 1_555 E C 14 1_555 0.509  -2.451 3.246  0.544   16.998   30.373  -6.212  -0.786 1.687  29.700  
-0.950  34.712   15 EE_G36G37:C17C18_EE     E 36  ? E 18  ? E 37  ? E 17  ? 
1 E G 34 1_555 E C 14 1_555 E C 35 1_555 E G 13 1_555 -0.147 -1.845 3.363  0.897   6.522    35.295  -3.907  0.364  2.982  10.641  
-1.464  35.885   16 EE_G37C38:G16C17_EE     E 37  ? E 17  ? E 38  ? E 16  ? 
1 E C 35 1_555 E G 13 1_555 E U 36 1_555 E A 40 1_555 -2.854 -1.272 2.825  9.127   5.472    70.118  -1.250  2.717  2.394  4.735   
-7.899  70.819   17 EE_C38U39:A43G16_EE     E 38  ? E 16  ? E 39  ? E 43  ? 
1 E A 53 1_555 E G 80 1_555 E C 54 1_555 E G 79 1_555 1.095  -0.917 3.304  -2.054  8.407    67.606  -1.134  -1.055 3.154  7.524   
1.838   68.092   18 EE_A56C57:G82G83_EE     E 56  ? E 83  ? E 57  ? E 82  ? 
1 E C 54 1_555 E G 79 1_555 E C 55 1_555 E G 78 1_555 -0.339 -2.068 3.031  0.626   8.646    28.115  -5.621  0.780  2.299  17.285  
-1.251  29.395   19 EE_C57C58:G81G82_EE     E 57  ? E 82  ? E 58  ? E 81  ? 
1 E C 55 1_555 E G 78 1_555 E U 56 1_555 E A 77 1_555 0.211  -1.382 3.769  -5.509  6.247    35.969  -3.126  -1.164 3.422  9.952   
8.777   36.889   20 EE_C58U59:A80G81_EE     E 58  ? E 81  ? E 59  ? E 80  ? 
1 E U 56 1_555 E A 77 1_555 E G 57 1_555 E G 75 1_555 2.433  -1.615 2.953  23.087  5.775    95.998  -1.160  -1.242 3.262  3.842   
-15.358 98.196   21 EE_U59G60:G78A80_EE     E 59  ? E 80  ? E 60  ? E 78  ? 
1 E G 57 1_555 E G 75 1_555 E A 58 1_555 E C 74 1_555 2.735  1.199  -0.217 20.036  -174.358 -64.894 -0.488  1.381  0.625  88.213  
10.137  -176.207 22 EE_G60A61:C77G78_EE     E 60  ? E 78  ? E 61  ? E 77  ? 
1 E A 58 1_555 E C 74 1_555 E C 60 1_555 E G 73 1_555 -2.269 -1.604 -1.229 101.756 -143.301 136.407 -0.988  1.002  -1.144 -71.774 
-50.966 178.424  23 EE_A61C63:G76C77_EE     E 61  ? E 77  ? E 63  ? E 76  ? 
1 E C 60 1_555 E G 73 1_555 E U 61 1_555 E A 72 1_555 -0.207 -1.318 3.758  -2.619  20.325   35.643  -4.237  -0.007 2.668  30.317  
3.906   40.947   24 EE_C63U64:A75G76_EE     E 63  ? E 76  ? E 64  ? E 75  ? 
1 E U 61 1_555 E A 72 1_555 E G 62 1_555 E C 71 1_555 -0.408 -1.502 3.670  -2.575  14.794   33.934  -4.431  0.283  2.818  23.947  
4.168   37.018   25 EE_U64G65:C74A75_EE     E 64  ? E 75  ? E 65  ? E 74  ? 
1 E G 62 1_555 E C 71 1_555 E G 63 1_555 E C 70 1_555 0.523  -1.796 2.783  -5.303  2.771    30.849  -3.741  -1.777 2.494  5.148   
9.853   31.410   26 EE_G65G66:C73C74_EE     E 65  ? E 74  ? E 66  ? E 73  ? 
1 F G 1  1_555 F C 87 1_555 F C 2  1_555 F G 86 1_555 0.492  -0.414 2.920  -2.782  -1.233   38.659  -0.490  -1.043 2.890  -1.858  
4.194   38.774   27 FF_G104C105:G189C190_FF F 104 ? F 190 ? F 105 ? F 189 ? 
1 F C 2  1_555 F G 86 1_555 F G 3  1_555 F C 85 1_555 0.188  -1.840 3.151  0.728   17.833   31.219  -5.098  -0.219 1.866  30.241  
-1.234  35.850   28 FF_C105G106:C188G189_FF F 105 ? F 189 ? F 106 ? F 188 ? 
1 F G 3  1_555 F C 85 1_555 F A 4  1_555 F U 84 1_555 -0.795 -1.411 3.192  -3.670  4.058    27.528  -3.830  0.808  3.035  8.421   
7.618   28.056   29 FF_G106A107:U187C188_FF F 106 ? F 188 ? F 107 ? F 187 ? 
1 F A 4  1_555 F U 84 1_555 F C 5  1_555 F G 83 1_555 0.251  -1.727 3.164  -0.441  4.995    29.765  -4.257  -0.566 2.839  9.638   
0.850   30.175   30 FF_A107C108:G186U187_FF F 107 ? F 187 ? F 108 ? F 186 ? 
1 F C 5  1_555 F G 83 1_555 F U 6  1_555 F A 82 1_555 2.075  -0.821 3.533  2.905   9.964    37.256  -2.560  -2.753 3.359  15.237  
-4.442  38.625   31 FF_C108U109:A185G186_FF F 108 ? F 186 ? F 109 ? F 185 ? 
1 F U 6  1_555 F A 82 1_555 F C 7  1_555 F G 48 1_555 0.686  -0.098 3.067  3.283   2.120    48.448  -0.273  -0.596 3.097  2.578   
-3.993  48.595   32 FF_U109C110:G151A185_FF F 109 ? F 185 ? F 110 ? F 151 ? 
1 F C 7  1_555 F G 48 1_555 F G 8  1_555 F C 47 1_555 1.039  -2.861 2.969  -2.162  4.373    14.898  -13.024 -5.061 1.886  16.305  
8.063   15.673   33 FF_C110G111:C150G151_FF F 110 ? F 151 ? F 111 ? F 150 ? 
1 F G 8  1_555 F C 47 1_555 F G 9  1_555 F C 46 1_555 -0.454 -1.876 3.661  4.258   3.413    30.139  -4.280  1.767  3.339  6.496   
-8.105  30.618   34 FF_G111G112:C149C150_FF F 111 ? F 150 ? F 112 ? F 149 ? 
1 F G 9  1_555 F C 46 1_555 F G 10 1_555 F C 45 1_555 -0.246 -1.349 3.282  -3.508  10.197   34.366  -3.567  -0.077 2.792  16.755  
5.763   35.969   35 FF_G112G113:C148C149_FF F 112 ? F 149 ? F 113 ? F 148 ? 
1 F G 10 1_555 F C 45 1_555 F G 11 1_555 F A 44 1_555 -0.749 -0.765 2.919  6.875   -0.041   36.169  -1.207  2.003  2.737  -0.065  
-10.952 36.796   36 FF_G113G114:A147C148_FF F 113 ? F 148 ? F 114 ? F 147 ? 
1 F G 30 1_555 F C 19 1_555 F G 31 1_555 F C 18 1_555 -1.759 -2.194 3.242  4.569   2.098    40.562  -3.360  2.995  2.923  3.012   
-6.560  40.860   37 FF_G133G134:C121C122_FF F 133 ? F 122 ? F 134 ? F 121 ? 
1 F G 31 1_555 F C 18 1_555 F A 32 1_555 F U 17 1_555 0.527  -2.471 1.935  -23.795 4.028    28.178  -4.168  -2.423 0.890  6.891   
40.709  36.941   38 FF_G134A135:U120C121_FF F 134 ? F 121 ? F 135 ? F 120 ? 
1 F A 32 1_555 F U 17 1_555 F G 33 1_555 F C 15 1_555 2.145  -1.229 4.317  20.909  21.325   52.965  -2.684  -0.705 4.122  22.051  
-21.621 60.271   39 FF_A135G136:C118U120_FF F 135 ? F 120 ? F 136 ? F 118 ? 
1 F G 33 1_555 F C 15 1_555 F G 34 1_555 F C 14 1_555 -0.608 -1.842 3.560  -5.234  7.864    31.773  -4.608  0.151  3.087  13.982  
9.307   33.113   40 FF_G136G137:C117C118_FF F 136 ? F 118 ? F 137 ? F 117 ? 
1 F G 34 1_555 F C 14 1_555 F C 35 1_555 F G 13 1_555 -0.236 -2.070 3.155  -2.614  8.312    30.512  -5.146  0.006  2.528  15.404  
4.843   31.703   41 FF_G137C138:G116C117_FF F 137 ? F 117 ? F 138 ? F 116 ? 
1 F C 35 1_555 F G 13 1_555 F U 36 1_555 F A 40 1_555 -2.772 -1.053 2.838  12.771  4.827    68.459  -1.060  2.791  2.286  4.247   
-11.238 69.644   42 FF_C138U139:A143G116_FF F 138 ? F 116 ? F 139 ? F 143 ? 
1 F A 50 1_555 F A 81 1_555 F A 53 1_555 F G 80 1_555 -2.630 -1.938 0.410  150.067 -81.706  -23.458 1.333   -0.657 1.438  42.591  
78.227  -171.060 43 FF_A153A156:G183A184_FF F 153 ? F 184 ? F 156 ? F 183 ? 
1 F A 53 1_555 F G 80 1_555 F C 54 1_555 F G 79 1_555 1.867  -1.249 3.408  0.314   7.360    67.414  -1.408  -1.662 3.280  6.611   
-0.282  67.768   44 FF_A156C157:G182G183_FF F 156 ? F 183 ? F 157 ? F 182 ? 
1 F C 54 1_555 F G 79 1_555 F C 55 1_555 F G 78 1_555 -0.351 -2.149 3.267  2.119   8.910    24.109  -7.015  1.308  2.300  20.415  
-4.854  25.766   45 FF_C157C158:G181G182_FF F 157 ? F 182 ? F 158 ? F 181 ? 
1 F C 55 1_555 F G 78 1_555 F U 56 1_555 F A 77 1_555 0.346  -1.029 3.746  -1.353  9.400    42.531  -2.397  -0.612 3.442  12.768  
1.837   43.530   46 FF_C158U159:A180G181_FF F 158 ? F 181 ? F 159 ? F 180 ? 
1 F U 56 1_555 F A 77 1_555 F G 57 1_555 F G 75 1_555 2.837  -1.755 2.761  14.418  2.636    91.472  -1.261  -1.721 3.045  1.831   
-10.015 92.381   47 FF_U159G160:G178A180_FF F 159 ? F 180 ? F 160 ? F 178 ? 
1 F G 57 1_555 F G 75 1_555 F A 58 1_555 F C 74 1_555 2.253  1.575  0.222  23.792  -161.938 -73.189 -0.459  1.183  1.118  84.209  
12.372  -166.910 48 FF_G160A161:C177G178_FF F 160 ? F 178 ? F 161 ? F 177 ? 
1 F A 58 1_555 F C 74 1_555 F C 60 1_555 F G 73 1_555 -2.915 -2.038 -1.675 103.952 -138.755 45.847  -1.667  0.975  -0.761 -70.995 
-53.188 173.899  49 FF_A161C163:G176C177_FF F 161 ? F 177 ? F 163 ? F 176 ? 
1 F C 60 1_555 F G 73 1_555 F U 61 1_555 F A 72 1_555 -0.593 -1.836 3.026  -0.794  12.532   41.292  -3.551  0.741  2.406  17.295  
1.095   43.080   50 FF_C163U164:A175G176_FF F 163 ? F 176 ? F 164 ? F 175 ? 
1 F U 61 1_555 F A 72 1_555 F G 62 1_555 F C 71 1_555 -1.053 -2.027 3.357  -1.545  14.594   28.498  -6.035  1.662  2.143  27.465  
2.907   31.985   51 FF_U164G165:C174A175_FF F 164 ? F 175 ? F 165 ? F 174 ? 
1 F G 62 1_555 F C 71 1_555 F G 63 1_555 F C 70 1_555 0.916  -1.849 2.742  -6.046  7.301    27.757  -4.821  -2.778 1.964  14.686  
12.162  29.301   52 FF_G165G166:C173C174_FF F 165 ? F 174 ? F 166 ? F 173 ? 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
3 'THIAMINE DIPHOSPHATE' TPP 
4 'MAGNESIUM ION'        MG  
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
G 3 TPP 1 601 601 TPP TPP E . 
H 4 MG  1 701 701 MG  MG  E . 
I 4 MG  1 702 702 MG  MG  E . 
J 4 MG  1 704 704 MG  MG  E . 
K 4 MG  1 705 705 MG  MG  E . 
L 4 MG  1 706 706 MG  MG  E . 
M 4 MG  1 707 707 MG  MG  E . 
N 3 TPP 1 602 602 TPP TPP F . 
O 4 MG  1 703 703 MG  MG  F . 
P 4 MG  1 708 708 MG  MG  F . 
#