data_3K0N
# 
_entry.id   3K0N 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3K0N         
RCSB  RCSB055396   
WWPDB D_1000055396 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3K0M . unspecified 
PDB 3K0O . unspecified 
PDB 3K0P . unspecified 
PDB 3K0Q . unspecified 
PDB 3K0R . unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3K0N 
_pdbx_database_status.recvd_initial_deposition_date   2009-09-24 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Fraser, J.S.' 1 
'Alber, T.'    2 
# 
_citation.id                        primary 
_citation.title                     'Hidden alternative structures of proline isomerase essential for catalysis.' 
_citation.journal_abbrev            Nature 
_citation.journal_volume            462 
_citation.page_first                669 
_citation.page_last                 673 
_citation.year                      2009 
_citation.journal_id_ASTM           NATUAS 
_citation.country                   UK 
_citation.journal_id_ISSN           0028-0836 
_citation.journal_id_CSD            0006 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19956261 
_citation.pdbx_database_id_DOI      10.1038/nature08615 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Fraser, J.S.'   1 
primary 'Clarkson, M.W.' 2 
primary 'Degnan, S.C.'   3 
primary 'Erion, R.'      4 
primary 'Kern, D.'       5 
primary 'Alber, T.'      6 
# 
_cell.entry_id           3K0N 
_cell.length_a           43.096 
_cell.length_b           52.592 
_cell.length_c           89.249 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3K0N 
_symmetry.space_group_name_H-M             'P 21 21 21' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                19 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer man 'Cyclophilin A' 18036.504 1   5.2.1.8 ? ? ? 
2 water   nat water           18.015    132 ?       ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'Peptidyl-prolyl cis-trans isomerase A, PPIase A, Rotamase A, Cyclosporin A-binding protein' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYG
EKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIAD
CGQLE
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYG
EKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIAD
CGQLE
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   VAL n 
1 3   ASN n 
1 4   PRO n 
1 5   THR n 
1 6   VAL n 
1 7   PHE n 
1 8   PHE n 
1 9   ASP n 
1 10  ILE n 
1 11  ALA n 
1 12  VAL n 
1 13  ASP n 
1 14  GLY n 
1 15  GLU n 
1 16  PRO n 
1 17  LEU n 
1 18  GLY n 
1 19  ARG n 
1 20  VAL n 
1 21  SER n 
1 22  PHE n 
1 23  GLU n 
1 24  LEU n 
1 25  PHE n 
1 26  ALA n 
1 27  ASP n 
1 28  LYS n 
1 29  VAL n 
1 30  PRO n 
1 31  LYS n 
1 32  THR n 
1 33  ALA n 
1 34  GLU n 
1 35  ASN n 
1 36  PHE n 
1 37  ARG n 
1 38  ALA n 
1 39  LEU n 
1 40  SER n 
1 41  THR n 
1 42  GLY n 
1 43  GLU n 
1 44  LYS n 
1 45  GLY n 
1 46  PHE n 
1 47  GLY n 
1 48  TYR n 
1 49  LYS n 
1 50  GLY n 
1 51  SER n 
1 52  CYS n 
1 53  PHE n 
1 54  HIS n 
1 55  ARG n 
1 56  ILE n 
1 57  ILE n 
1 58  PRO n 
1 59  GLY n 
1 60  PHE n 
1 61  MET n 
1 62  CYS n 
1 63  GLN n 
1 64  GLY n 
1 65  GLY n 
1 66  ASP n 
1 67  PHE n 
1 68  THR n 
1 69  ARG n 
1 70  HIS n 
1 71  ASN n 
1 72  GLY n 
1 73  THR n 
1 74  GLY n 
1 75  GLY n 
1 76  LYS n 
1 77  SER n 
1 78  ILE n 
1 79  TYR n 
1 80  GLY n 
1 81  GLU n 
1 82  LYS n 
1 83  PHE n 
1 84  GLU n 
1 85  ASP n 
1 86  GLU n 
1 87  ASN n 
1 88  PHE n 
1 89  ILE n 
1 90  LEU n 
1 91  LYS n 
1 92  HIS n 
1 93  THR n 
1 94  GLY n 
1 95  PRO n 
1 96  GLY n 
1 97  ILE n 
1 98  LEU n 
1 99  SER n 
1 100 MET n 
1 101 ALA n 
1 102 ASN n 
1 103 ALA n 
1 104 GLY n 
1 105 PRO n 
1 106 ASN n 
1 107 THR n 
1 108 ASN n 
1 109 GLY n 
1 110 SER n 
1 111 GLN n 
1 112 PHE n 
1 113 PHE n 
1 114 ILE n 
1 115 CYS n 
1 116 THR n 
1 117 ALA n 
1 118 LYS n 
1 119 THR n 
1 120 GLU n 
1 121 TRP n 
1 122 LEU n 
1 123 ASP n 
1 124 GLY n 
1 125 LYS n 
1 126 HIS n 
1 127 VAL n 
1 128 VAL n 
1 129 PHE n 
1 130 GLY n 
1 131 LYS n 
1 132 VAL n 
1 133 LYS n 
1 134 GLU n 
1 135 GLY n 
1 136 MET n 
1 137 ASN n 
1 138 ILE n 
1 139 VAL n 
1 140 GLU n 
1 141 ALA n 
1 142 MET n 
1 143 GLU n 
1 144 ARG n 
1 145 PHE n 
1 146 GLY n 
1 147 SER n 
1 148 ARG n 
1 149 ASN n 
1 150 GLY n 
1 151 LYS n 
1 152 THR n 
1 153 SER n 
1 154 LYS n 
1 155 LYS n 
1 156 ILE n 
1 157 THR n 
1 158 ILE n 
1 159 ALA n 
1 160 ASP n 
1 161 CYS n 
1 162 GLY n 
1 163 GLN n 
1 164 LEU n 
1 165 GLU n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'PPIA, CYPA' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               ? 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          ? 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       ? 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    PPIA_HUMAN 
_struct_ref.pdbx_db_accession          P62937 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MVNPTVFFDIAVDGEPLGRVSFELFADKVPKTAENFRALSTGEKGFGYKGSCFHRIIPGFMCQGGDFTRHNGTGGKSIYG
EKFEDENFILKHTGPGILSMANAGPNTNGSQFFICTAKTEWLDGKHVVFGKVKEGMNIVEAMERFGSRNGKTSKKITIAD
CGQLE
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              3K0N 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 1 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 165 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             P62937 
_struct_ref_seq.db_align_beg                  1 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  165 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       1 
_struct_ref_seq.pdbx_auth_seq_align_end       165 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3K0N 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.80 
_exptl_crystal.density_percent_sol   56.13 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              7.5 
_exptl_crystal_grow.pdbx_details    '100 mM HEPES pH 7.5, 22% PEG 3350, 5 mM TCEP, VAPOR DIFFUSION, HANGING DROP, temperature 291K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           288 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315' 
_diffrn_detector.pdbx_collection_date   2008-03-31 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'Kohzu Dual Double Crystal Monochromator (DDCM)' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.115831 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ALS BEAMLINE 12.3.1' 
_diffrn_source.pdbx_synchrotron_site       ALS 
_diffrn_source.pdbx_synchrotron_beamline   12.3.1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.115831 
# 
_reflns.entry_id                     3K0N 
_reflns.observed_criterion_sigma_I   0 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             50 
_reflns.d_resolution_high            1.39 
_reflns.number_obs                   39216 
_reflns.number_all                   41498 
_reflns.percent_possible_obs         94.5 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              .101 
_reflns.pdbx_netI_over_sigmaI        21 
_reflns.B_iso_Wilson_estimate        ? 
_reflns.pdbx_redundancy              7.4 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.39 
_reflns_shell.d_res_low              1.44 
_reflns_shell.percent_possible_all   87 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        .507 
_reflns_shell.meanI_over_sigI_obs    1.9 
_reflns_shell.pdbx_redundancy        2.8 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      3743 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3K0N 
_refine.ls_number_reflns_obs                     39216 
_refine.ls_number_reflns_all                     41498 
_refine.pdbx_ls_sigma_I                          0 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             33.334 
_refine.ls_d_res_high                            1.391 
_refine.ls_percent_reflns_obs                    94.50 
_refine.ls_R_factor_obs                          0.1240 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1222 
_refine.ls_R_factor_R_free                       0.1596 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.84 
_refine.ls_number_reflns_R_free                  1900 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               ? 
_refine.aniso_B[1][1]                            -0.7840 
_refine.aniso_B[2][2]                            1.7250 
_refine.aniso_B[3][3]                            -0.9409 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            -0.0000 
_refine.aniso_B[2][3]                            -0.0000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.360 
_refine.solvent_model_param_bsol                 34.954 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB entry 2CPL' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            phenix.refine 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.14 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 14.71 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1248 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         0 
_refine_hist.number_atoms_solvent             132 
_refine_hist.number_atoms_total               1380 
_refine_hist.d_res_high                       1.391 
_refine_hist.d_res_low                        33.334 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.011  ? ? 1564 'X-RAY DIFFRACTION' ? 
f_angle_d          1.264  ? ? 2118 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 15.948 ? ? 576  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.076  ? ? 223  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.008  ? ? 281  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
. 1.3909 1.4257  2073 0.1783 76.00 0.2775 . . 111 . . . . 'X-RAY DIFFRACTION' 
. 1.4257 1.4642  2394 0.1478 86.00 0.2256 . . 125 . . . . 'X-RAY DIFFRACTION' 
. 1.4642 1.5073  2476 0.1262 89.00 0.1931 . . 130 . . . . 'X-RAY DIFFRACTION' 
. 1.5073 1.5560  2586 0.1100 92.00 0.1945 . . 126 . . . . 'X-RAY DIFFRACTION' 
. 1.5560 1.6116  2607 0.1063 95.00 0.1540 . . 133 . . . . 'X-RAY DIFFRACTION' 
. 1.6116 1.6761  2682 0.0991 95.00 0.1791 . . 132 . . . . 'X-RAY DIFFRACTION' 
. 1.6761 1.7524  2714 0.1051 97.00 0.1492 . . 138 . . . . 'X-RAY DIFFRACTION' 
. 1.7524 1.8448  2734 0.1018 98.00 0.1561 . . 137 . . . . 'X-RAY DIFFRACTION' 
. 1.8448 1.9603  2772 0.1008 99.00 0.1510 . . 143 . . . . 'X-RAY DIFFRACTION' 
. 1.9603 2.1117  2784 0.1034 99.00 0.1335 . . 142 . . . . 'X-RAY DIFFRACTION' 
. 2.1117 2.3241  2810 0.1090 99.00 0.1478 . . 141 . . . . 'X-RAY DIFFRACTION' 
. 2.3241 2.6603  2828 0.1253 99.00 0.1717 . . 144 . . . . 'X-RAY DIFFRACTION' 
. 2.6603 3.3512  2866 0.1338 99.00 0.1563 . . 145 . . . . 'X-RAY DIFFRACTION' 
. 3.3512 33.3435 2990 0.1196 99.00 0.1347 . . 153 . . . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3K0N 
_struct.title                     'Room temperature structure of CypA' 
_struct.pdbx_descriptor           'Cyclophilin A (E.C.5.2.1.8)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3K0N 
_struct_keywords.pdbx_keywords   ISOMERASE 
_struct_keywords.text            
'proline isomerase, Cyclosporin, Host-virus interaction, Isomerase, Isopeptide bond, Phosphoprotein, Rotamase' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 VAL A 29  ? GLY A 42  ? VAL A 29  GLY A 42  1 ? 14 
HELX_P HELX_P2 2 THR A 119 ? ASP A 123 ? THR A 119 ASP A 123 5 ? 5  
HELX_P HELX_P3 3 GLY A 135 ? ARG A 144 ? GLY A 135 ARG A 144 1 ? 10 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
_struct_sheet.id               A 
_struct_sheet.type             ? 
_struct_sheet.number_strands   8 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
A 7 8 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 53  ? ILE A 57  ? PHE A 53  ILE A 57  
A 2 MET A 61  ? GLY A 64  ? MET A 61  GLY A 64  
A 3 PHE A 112 ? CYS A 115 ? PHE A 112 CYS A 115 
A 4 ILE A 97  ? MET A 100 ? ILE A 97  MET A 100 
A 5 VAL A 128 ? GLU A 134 ? VAL A 128 GLU A 134 
A 6 GLU A 15  ? LEU A 24  ? GLU A 15  LEU A 24  
A 7 THR A 5   ? VAL A 12  ? THR A 5   VAL A 12  
A 8 ILE A 156 ? GLN A 163 ? ILE A 156 GLN A 163 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 57  ? N ILE A 57  O MET A 61  ? O MET A 61  
A 2 3 N CYS A 62  ? N CYS A 62  O ILE A 114 ? O ILE A 114 
A 3 4 O PHE A 113 ? O PHE A 113 N SER A 99  ? N SER A 99  
A 4 5 N LEU A 98  ? N LEU A 98  O PHE A 129 ? O PHE A 129 
A 5 6 O GLU A 134 ? O GLU A 134 N SER A 21  ? N SER A 21  
A 6 7 O GLY A 18  ? O GLY A 18  N ILE A 10  ? N ILE A 10  
A 7 8 N ASP A 9   ? N ASP A 9   O ASP A 160 ? O ASP A 160 
# 
_database_PDB_matrix.entry_id          3K0N 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3K0N 
_atom_sites.fract_transf_matrix[1][1]   0.023204 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.019014 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.011205 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C 
H 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N    . VAL A 1 2   ? 19.469  -3.307 18.420 1.00 63.50  ? 2   VAL A N    1 
ATOM   2    C CA   . VAL A 1 2   ? 20.173  -2.031 18.348 1.00 61.53  ? 2   VAL A CA   1 
ATOM   3    C C    . VAL A 1 2   ? 19.189  -0.878 18.097 1.00 49.17  ? 2   VAL A C    1 
ATOM   4    O O    . VAL A 1 2   ? 19.349  0.202  18.666 1.00 59.49  ? 2   VAL A O    1 
ATOM   5    C CB   . VAL A 1 2   ? 21.307  -2.056 17.263 1.00 79.12  ? 2   VAL A CB   1 
ATOM   6    C CG1  . VAL A 1 2   ? 22.345  -0.969 17.531 1.00 87.97  ? 2   VAL A CG1  1 
ATOM   7    C CG2  . VAL A 1 2   ? 21.980  -3.417 17.247 1.00 89.15  ? 2   VAL A CG2  1 
ATOM   8    H HA   . VAL A 1 2   ? 20.601  -1.867 19.214 1.00 73.72  ? 2   VAL A HA   1 
ATOM   9    H HB   . VAL A 1 2   ? 20.915  -1.897 16.379 1.00 94.82  ? 2   VAL A HB   1 
ATOM   10   H HG11 . VAL A 1 2   ? 23.023  -1.010 16.853 1.00 105.45 ? 2   VAL A HG11 1 
ATOM   11   H HG12 . VAL A 1 2   ? 21.912  -0.112 17.510 1.00 105.45 ? 2   VAL A HG12 1 
ATOM   12   H HG13 . VAL A 1 2   ? 22.736  -1.117 18.396 1.00 105.45 ? 2   VAL A HG13 1 
ATOM   13   H HG21 . VAL A 1 2   ? 22.670  -3.417 16.580 1.00 106.87 ? 2   VAL A HG21 1 
ATOM   14   H HG22 . VAL A 1 2   ? 22.360  -3.587 18.112 1.00 106.87 ? 2   VAL A HG22 1 
ATOM   15   H HG23 . VAL A 1 2   ? 21.324  -4.087 17.040 1.00 106.87 ? 2   VAL A HG23 1 
ATOM   16   N N    . ASN A 1 3   ? 18.164  -1.088 17.264 1.00 34.21  ? 3   ASN A N    1 
ATOM   17   C CA   . ASN A 1 3   ? 17.222  -0.008 16.941 1.00 32.95  ? 3   ASN A CA   1 
ATOM   18   C C    . ASN A 1 3   ? 16.416  0.412  18.158 1.00 25.25  ? 3   ASN A C    1 
ATOM   19   O O    . ASN A 1 3   ? 15.973  -0.429 18.958 1.00 29.66  ? 3   ASN A O    1 
ATOM   20   C CB   . ASN A 1 3   ? 16.237  -0.428 15.855 1.00 24.51  ? 3   ASN A CB   1 
ATOM   21   C CG   . ASN A 1 3   ? 16.799  -0.321 14.441 1.00 34.04  ? 3   ASN A CG   1 
ATOM   22   O OD1  . ASN A 1 3   ? 17.809  0.342  14.178 1.00 29.41  ? 3   ASN A OD1  1 
ATOM   23   N ND2  . ASN A 1 3   ? 16.125  -0.985 13.516 1.00 35.03  ? 3   ASN A ND2  1 
ATOM   24   H H    . ASN A 1 3   ? 17.992  -1.837 16.878 1.00 40.94  ? 3   ASN A H    1 
ATOM   25   H HA   . ASN A 1 3   ? 17.722  0.771  16.619 1.00 39.42  ? 3   ASN A HA   1 
ATOM   26   H HB2  . ASN A 1 3   ? 15.983  -1.352 16.004 1.00 29.29  ? 3   ASN A HB2  1 
ATOM   27   H HB3  . ASN A 1 3   ? 15.453  0.142  15.906 1.00 29.29  ? 3   ASN A HB3  1 
ATOM   28   H HD21 . ASN A 1 3   ? 16.424  -0.965 12.583 1.00 41.91  ? 3   ASN A HD21 1 
ATOM   29   H HD22 . ASN A 1 3   ? 15.327  -1.496 13.765 1.00 41.91  ? 3   ASN A HD22 1 
ATOM   30   N N    . PRO A 1 4   ? 16.185  1.712  18.314 1.00 34.54  ? 4   PRO A N    1 
ATOM   31   C CA   . PRO A 1 4   ? 15.467  2.190  19.496 1.00 24.90  ? 4   PRO A CA   1 
ATOM   32   C C    . PRO A 1 4   ? 13.965  1.918  19.423 1.00 21.76  ? 4   PRO A C    1 
ATOM   33   O O    . PRO A 1 4   ? 13.361  1.915  18.352 1.00 25.07  ? 4   PRO A O    1 
ATOM   34   C CB   . PRO A 1 4   ? 15.742  3.697  19.477 1.00 29.97  ? 4   PRO A CB   1 
ATOM   35   C CG   . PRO A 1 4   ? 15.964  4.025  17.976 1.00 45.01  ? 4   PRO A CG   1 
ATOM   36   C CD   . PRO A 1 4   ? 16.062  2.682  17.218 1.00 55.21  ? 4   PRO A CD   1 
ATOM   37   H HA   . PRO A 1 4   ? 15.838  1.795  20.313 1.00 29.76  ? 4   PRO A HA   1 
ATOM   38   H HB2  . PRO A 1 4   ? 14.974  4.177  19.826 1.00 35.85  ? 4   PRO A HB2  1 
ATOM   39   H HB3  . PRO A 1 4   ? 16.538  3.893  19.995 1.00 35.85  ? 4   PRO A HB3  1 
ATOM   40   H HG2  . PRO A 1 4   ? 15.212  4.543  17.647 1.00 53.90  ? 4   PRO A HG2  1 
ATOM   41   H HG3  . PRO A 1 4   ? 16.788  4.528  17.877 1.00 53.90  ? 4   PRO A HG3  1 
ATOM   42   H HD2  . PRO A 1 4   ? 15.254  2.519  16.707 1.00 66.14  ? 4   PRO A HD2  1 
ATOM   43   H HD3  . PRO A 1 4   ? 16.853  2.664  16.656 1.00 66.14  ? 4   PRO A HD3  1 
ATOM   44   N N    A THR A 1 5   ? 13.364  1.745  20.596 0.58 28.63  ? 5   THR A N    1 
ATOM   45   N N    B THR A 1 5   ? 13.368  1.755  20.597 0.42 20.42  ? 5   THR A N    1 
ATOM   46   C CA   A THR A 1 5   ? 11.920  1.628  20.738 0.58 18.36  ? 5   THR A CA   1 
ATOM   47   C CA   B THR A 1 5   ? 11.921  1.672  20.736 0.42 22.98  ? 5   THR A CA   1 
ATOM   48   C C    A THR A 1 5   ? 11.405  2.749  21.629 0.58 25.90  ? 5   THR A C    1 
ATOM   49   C C    B THR A 1 5   ? 11.427  2.939  21.418 0.42 25.08  ? 5   THR A C    1 
ATOM   50   O O    A THR A 1 5   ? 11.892  2.944  22.755 0.58 19.38  ? 5   THR A O    1 
ATOM   51   O O    B THR A 1 5   ? 12.096  3.462  22.316 0.42 25.08  ? 5   THR A O    1 
ATOM   52   C CB   A THR A 1 5   ? 11.524  0.286  21.360 0.58 27.86  ? 5   THR A CB   1 
ATOM   53   C CB   B THR A 1 5   ? 11.521  0.478  21.600 0.42 22.89  ? 5   THR A CB   1 
ATOM   54   O OG1  A THR A 1 5   ? 11.963  -0.779 20.512 0.58 32.32  ? 5   THR A OG1  1 
ATOM   55   O OG1  B THR A 1 5   ? 12.080  -0.722 21.052 0.42 29.32  ? 5   THR A OG1  1 
ATOM   56   C CG2  A THR A 1 5   ? 9.998   0.192  21.545 0.58 28.99  ? 5   THR A CG2  1 
ATOM   57   C CG2  B THR A 1 5   ? 9.997   0.358  21.669 0.42 34.13  ? 5   THR A CG2  1 
ATOM   58   H H    A THR A 1 5   ? 13.785  1.691  21.343 0.58 34.24  ? 5   THR A H    1 
ATOM   59   H H    B THR A 1 5   ? 13.789  1.689  21.344 0.42 24.39  ? 5   THR A H    1 
ATOM   60   H HA   A THR A 1 5   ? 11.494  1.705  19.858 0.58 21.92  ? 5   THR A HA   1 
ATOM   61   H HA   B THR A 1 5   ? 11.499  1.591  19.856 0.42 27.46  ? 5   THR A HA   1 
ATOM   62   H HB   A THR A 1 5   ? 11.943  0.198  22.230 0.58 33.31  ? 5   THR A HB   1 
ATOM   63   H HB   B THR A 1 5   ? 11.858  0.607  22.501 0.42 27.35  ? 5   THR A HB   1 
ATOM   64   H HG1  A THR A 1 5   ? 11.755  -1.502 20.838 0.58 38.66  ? 5   THR A HG1  1 
ATOM   65   H HG1  B THR A 1 5   ? 11.868  -1.366 21.513 0.42 35.07  ? 5   THR A HG1  1 
ATOM   66   H HG21 A THR A 1 5   ? 9.767   -0.654 21.936 0.58 34.68  ? 5   THR A HG21 1 
ATOM   67   H HG21 B THR A 1 5   ? 9.752   -0.394 22.214 0.42 40.84  ? 5   THR A HG21 1 
ATOM   68   H HG22 A THR A 1 5   ? 9.694   0.896  22.123 0.58 34.68  ? 5   THR A HG22 1 
ATOM   69   H HG22 B THR A 1 5   ? 9.623   1.155  22.051 0.42 40.84  ? 5   THR A HG22 1 
ATOM   70   H HG23 A THR A 1 5   ? 9.559   0.274  20.696 0.58 34.68  ? 5   THR A HG23 1 
ATOM   71   H HG23 B THR A 1 5   ? 9.638   0.236  20.788 0.42 40.84  ? 5   THR A HG23 1 
ATOM   72   N N    A VAL A 1 6   ? 10.421  3.492  21.126 0.58 18.15  ? 6   VAL A N    1 
ATOM   73   N N    B VAL A 1 6   ? 10.266  3.431  20.992 0.42 20.07  ? 6   VAL A N    1 
ATOM   74   C CA   A VAL A 1 6   ? 9.815   4.545  21.913 0.58 17.36  ? 6   VAL A CA   1 
ATOM   75   C CA   B VAL A 1 6   ? 9.666   4.610  21.602 0.42 21.19  ? 6   VAL A CA   1 
ATOM   76   C C    A VAL A 1 6   ? 8.326   4.287  22.046 0.58 15.62  ? 6   VAL A C    1 
ATOM   77   C C    B VAL A 1 6   ? 8.225   4.300  21.971 0.42 27.26  ? 6   VAL A C    1 
ATOM   78   O O    A VAL A 1 6   ? 7.749   3.551  21.256 0.58 17.70  ? 6   VAL A O    1 
ATOM   79   O O    B VAL A 1 6   ? 7.585   3.482  21.321 0.42 22.60  ? 6   VAL A O    1 
ATOM   80   C CB   A VAL A 1 6   ? 10.045  5.939  21.297 0.58 19.59  ? 6   VAL A CB   1 
ATOM   81   C CB   B VAL A 1 6   ? 9.688   5.825  20.644 0.42 13.20  ? 6   VAL A CB   1 
ATOM   82   C CG1  A VAL A 1 6   ? 11.537  6.201  21.167 0.58 19.93  ? 6   VAL A CG1  1 
ATOM   83   C CG1  B VAL A 1 6   ? 8.683   6.880  21.090 0.42 24.54  ? 6   VAL A CG1  1 
ATOM   84   C CG2  A VAL A 1 6   ? 9.318   6.070  19.949 0.58 21.20  ? 6   VAL A CG2  1 
ATOM   85   C CG2  B VAL A 1 6   ? 11.102  6.421  20.553 0.42 20.34  ? 6   VAL A CG2  1 
ATOM   86   H H    A VAL A 1 6   ? 10.093  3.403  20.336 0.58 21.66  ? 6   VAL A H    1 
ATOM   87   H H    B VAL A 1 6   ? 9.805   3.098  20.347 0.42 23.96  ? 6   VAL A H    1 
ATOM   88   H HA   A VAL A 1 6   ? 10.207  4.540  22.812 0.58 20.72  ? 6   VAL A HA   1 
ATOM   89   H HA   B VAL A 1 6   ? 10.155  4.845  22.418 0.42 25.31  ? 6   VAL A HA   1 
ATOM   90   H HB   A VAL A 1 6   ? 9.675   6.615  21.902 0.58 23.39  ? 6   VAL A HB   1 
ATOM   91   H HB   B VAL A 1 6   ? 9.430   5.525  19.747 0.42 15.72  ? 6   VAL A HB   1 
ATOM   92   H HG11 A VAL A 1 6   ? 11.668  7.071  20.782 0.58 23.80  ? 6   VAL A HG11 1 
ATOM   93   H HG11 B VAL A 1 6   ? 8.718   7.621  20.480 0.42 29.34  ? 6   VAL A HG11 1 
ATOM   94   H HG12 A VAL A 1 6   ? 11.938  6.164  22.038 0.58 23.80  ? 6   VAL A HG12 1 
ATOM   95   H HG12 B VAL A 1 6   ? 7.804   6.495  21.088 0.42 29.34  ? 6   VAL A HG12 1 
ATOM   96   H HG13 A VAL A 1 6   ? 11.923  5.530  20.599 0.58 23.80  ? 6   VAL A HG13 1 
ATOM   97   H HG13 B VAL A 1 6   ? 8.911   7.174  21.975 0.42 29.34  ? 6   VAL A HG13 1 
ATOM   98   H HG21 A VAL A 1 6   ? 9.480   6.945  19.590 0.58 25.33  ? 6   VAL A HG21 1 
ATOM   99   H HG21 B VAL A 1 6   ? 11.086  7.171  19.953 0.42 24.29  ? 6   VAL A HG21 1 
ATOM   100  H HG22 A VAL A 1 6   ? 9.655   5.402  19.346 0.58 25.33  ? 6   VAL A HG22 1 
ATOM   101  H HG22 B VAL A 1 6   ? 11.378  6.706  21.427 0.42 24.29  ? 6   VAL A HG22 1 
ATOM   102  H HG23 A VAL A 1 6   ? 8.377   5.941  20.088 0.58 25.33  ? 6   VAL A HG23 1 
ATOM   103  H HG23 B VAL A 1 6   ? 11.703  5.750  20.222 0.42 24.29  ? 6   VAL A HG23 1 
ATOM   104  N N    A PHE A 1 7   ? 7.711   4.871  23.073 0.58 16.43  ? 7   PHE A N    1 
ATOM   105  N N    B PHE A 1 7   ? 7.714   4.928  23.028 0.42 26.83  ? 7   PHE A N    1 
ATOM   106  C CA   A PHE A 1 7   ? 6.281   4.681  23.285 0.58 18.48  ? 7   PHE A CA   1 
ATOM   107  C CA   B PHE A 1 7   ? 6.320   4.729  23.409 0.42 18.48  ? 7   PHE A CA   1 
ATOM   108  C C    A PHE A 1 7   ? 5.543   6.006  23.375 0.58 17.85  ? 7   PHE A C    1 
ATOM   109  C C    B PHE A 1 7   ? 5.540   6.035  23.401 0.42 15.68  ? 7   PHE A C    1 
ATOM   110  O O    A PHE A 1 7   ? 6.123   7.043  23.725 0.58 15.18  ? 7   PHE A O    1 
ATOM   111  O O    B PHE A 1 7   ? 6.092   7.095  23.706 0.42 24.81  ? 7   PHE A O    1 
ATOM   112  C CB   A PHE A 1 7   ? 6.024   3.857  24.554 0.58 19.85  ? 7   PHE A CB   1 
ATOM   113  C CB   B PHE A 1 7   ? 6.215   4.047  24.783 0.42 24.14  ? 7   PHE A CB   1 
ATOM   114  C CG   A PHE A 1 7   ? 6.184   4.635  25.818 0.58 16.31  ? 7   PHE A CG   1 
ATOM   115  C CG   B PHE A 1 7   ? 6.644   4.914  25.941 0.42 29.95  ? 7   PHE A CG   1 
ATOM   116  C CD1  A PHE A 1 7   ? 7.413   4.730  26.435 0.58 21.76  ? 7   PHE A CD1  1 
ATOM   117  C CD1  B PHE A 1 7   ? 5.720   5.708  26.607 0.42 19.88  ? 7   PHE A CD1  1 
ATOM   118  C CD2  A PHE A 1 7   ? 5.096   5.284  26.381 0.58 18.74  ? 7   PHE A CD2  1 
ATOM   119  C CD2  B PHE A 1 7   ? 7.959   4.908  26.386 0.42 24.96  ? 7   PHE A CD2  1 
ATOM   120  C CE1  A PHE A 1 7   ? 7.559   5.459  27.602 0.58 22.81  ? 7   PHE A CE1  1 
ATOM   121  C CE1  B PHE A 1 7   ? 6.097   6.495  27.675 0.42 16.12  ? 7   PHE A CE1  1 
ATOM   122  C CE2  A PHE A 1 7   ? 5.232   6.014  27.531 0.58 19.60  ? 7   PHE A CE2  1 
ATOM   123  C CE2  B PHE A 1 7   ? 8.348   5.701  27.465 0.42 33.89  ? 7   PHE A CE2  1 
ATOM   124  C CZ   A PHE A 1 7   ? 6.464   6.099  28.149 0.58 23.61  ? 7   PHE A CZ   1 
ATOM   125  C CZ   B PHE A 1 7   ? 7.414   6.494  28.110 0.42 28.09  ? 7   PHE A CZ   1 
ATOM   126  H H    A PHE A 1 7   ? 8.095   5.375  23.654 0.58 19.59  ? 7   PHE A H    1 
ATOM   127  H H    B PHE A 1 7   ? 8.150   5.468  23.536 0.42 32.08  ? 7   PHE A H    1 
ATOM   128  H HA   A PHE A 1 7   ? 5.912   4.184  22.525 0.58 22.05  ? 7   PHE A HA   1 
ATOM   129  H HA   B PHE A 1 7   ? 5.902   4.133  22.753 0.42 22.06  ? 7   PHE A HA   1 
ATOM   130  H HB2  A PHE A 1 7   ? 5.115   3.518  24.527 0.58 23.71  ? 7   PHE A HB2  1 
ATOM   131  H HB2  B PHE A 1 7   ? 5.292   3.791  24.933 0.42 28.85  ? 7   PHE A HB2  1 
ATOM   132  H HB3  A PHE A 1 7   ? 6.651   3.118  24.578 0.58 23.71  ? 7   PHE A HB3  1 
ATOM   133  H HB3  B PHE A 1 7   ? 6.778   3.257  24.782 0.42 28.85  ? 7   PHE A HB3  1 
ATOM   134  H HD1  A PHE A 1 7   ? 8.150   4.299  26.065 0.58 25.99  ? 7   PHE A HD1  1 
ATOM   135  H HD1  B PHE A 1 7   ? 4.835   5.716  26.322 0.42 23.74  ? 7   PHE A HD1  1 
ATOM   136  H HD2  A PHE A 1 7   ? 4.265   5.230  25.967 0.58 22.37  ? 7   PHE A HD2  1 
ATOM   137  H HD2  B PHE A 1 7   ? 8.589   4.377  25.955 0.42 29.83  ? 7   PHE A HD2  1 
ATOM   138  H HE1  A PHE A 1 7   ? 8.390   5.518  28.016 0.58 27.25  ? 7   PHE A HE1  1 
ATOM   139  H HE1  B PHE A 1 7   ? 5.466   7.027  28.104 0.42 19.23  ? 7   PHE A HE1  1 
ATOM   140  H HE2  A PHE A 1 7   ? 4.493   6.441  27.902 0.58 23.41  ? 7   PHE A HE2  1 
ATOM   141  H HE2  B PHE A 1 7   ? 9.233   5.697  27.751 0.42 40.55  ? 7   PHE A HE2  1 
ATOM   142  H HZ   A PHE A 1 7   ? 6.557   6.590  28.934 0.58 28.21  ? 7   PHE A HZ   1 
ATOM   143  H HZ   B PHE A 1 7   ? 7.669   7.025  28.829 0.42 33.59  ? 7   PHE A HZ   1 
ATOM   144  N N    . PHE A 1 8   ? 4.258   5.937  23.028 1.00 15.22  ? 8   PHE A N    1 
ATOM   145  C CA   . PHE A 1 8   ? 3.286   6.999  23.242 1.00 16.10  ? 8   PHE A CA   1 
ATOM   146  C C    . PHE A 1 8   ? 2.194   6.384  24.096 1.00 15.19  ? 8   PHE A C    1 
ATOM   147  O O    . PHE A 1 8   ? 1.664   5.312  23.779 1.00 17.65  ? 8   PHE A O    1 
ATOM   148  C CB   . PHE A 1 8   ? 2.562   7.422  21.960 1.00 15.88  ? 8   PHE A CB   1 
ATOM   149  C CG   . PHE A 1 8   ? 3.373   8.230  20.980 1.00 15.51  ? 8   PHE A CG   1 
ATOM   150  C CD1  . PHE A 1 8   ? 4.676   8.643  21.242 1.00 15.27  ? 8   PHE A CD1  1 
ATOM   151  C CD2  . PHE A 1 8   ? 2.814   8.558  19.764 1.00 17.27  ? 8   PHE A CD2  1 
ATOM   152  C CE1  . PHE A 1 8   ? 5.373   9.398  20.288 1.00 16.26  ? 8   PHE A CE1  1 
ATOM   153  C CE2  . PHE A 1 8   ? 3.509   9.304  18.825 1.00 17.41  ? 8   PHE A CE2  1 
ATOM   154  C CZ   . PHE A 1 8   ? 4.796   9.710  19.104 1.00 18.30  ? 8   PHE A CZ   1 
ATOM   155  H H    A PHE A 1 8   ? 3.914   5.247  22.647 0.57 18.15  ? 8   PHE A H    1 
ATOM   156  H H    B PHE A 1 8   ? 3.927   5.245  22.640 0.43 18.15  ? 8   PHE A H    1 
ATOM   157  H HA   . PHE A 1 8   ? 3.682   7.775  23.691 1.00 19.20  ? 8   PHE A HA   1 
ATOM   158  H HB2  . PHE A 1 8   ? 2.266   6.622  21.499 1.00 18.94  ? 8   PHE A HB2  1 
ATOM   159  H HB3  . PHE A 1 8   ? 1.791   7.956  22.206 1.00 18.94  ? 8   PHE A HB3  1 
ATOM   160  H HD1  . PHE A 1 8   ? 5.076   8.435  22.055 1.00 18.20  ? 8   PHE A HD1  1 
ATOM   161  H HD2  . PHE A 1 8   ? 1.945   8.287  19.576 1.00 20.61  ? 8   PHE A HD2  1 
ATOM   162  H HE1  . PHE A 1 8   ? 6.242   9.677  20.465 1.00 19.39  ? 8   PHE A HE1  1 
ATOM   163  H HE2  . PHE A 1 8   ? 3.115   9.519  18.011 1.00 20.77  ? 8   PHE A HE2  1 
ATOM   164  H HZ   . PHE A 1 8   ? 5.269   10.207 18.476 1.00 21.84  ? 8   PHE A HZ   1 
ATOM   165  N N    . ASP A 1 9   ? 1.848   7.056  25.184 1.00 14.39  ? 9   ASP A N    1 
ATOM   166  C CA   . ASP A 1 9   ? 0.621   6.770  25.931 1.00 14.37  ? 9   ASP A CA   1 
ATOM   167  C C    . ASP A 1 9   ? -0.460  7.740  25.454 1.00 15.08  ? 9   ASP A C    1 
ATOM   168  O O    . ASP A 1 9   ? -0.297  8.950  25.544 1.00 16.81  ? 9   ASP A O    1 
ATOM   169  C CB   . ASP A 1 9   ? 0.844   6.983  27.420 1.00 16.12  ? 9   ASP A CB   1 
ATOM   170  C CG   . ASP A 1 9   ? 1.589   5.831  28.073 1.00 19.70  ? 9   ASP A CG   1 
ATOM   171  O OD1  . ASP A 1 9   ? 1.636   4.757  27.480 1.00 23.31  ? 9   ASP A OD1  1 
ATOM   172  O OD2  . ASP A 1 9   ? 2.108   6.010  29.170 1.00 26.60  ? 9   ASP A OD2  1 
ATOM   173  H H    . ASP A 1 9   ? 2.313   7.697  25.520 1.00 17.15  ? 9   ASP A H    1 
ATOM   174  H HA   . ASP A 1 9   ? 0.328   5.848  25.772 1.00 17.12  ? 9   ASP A HA   1 
ATOM   175  H HB2  . ASP A 1 9   ? 1.366   7.790  27.550 1.00 19.23  ? 9   ASP A HB2  1 
ATOM   176  H HB3  . ASP A 1 9   ? -0.017  7.070  27.859 1.00 19.23  ? 9   ASP A HB3  1 
ATOM   177  N N    . ILE A 1 10  ? -1.538  7.188  24.920 1.00 15.37  ? 10  ILE A N    1 
ATOM   178  C CA   . ILE A 1 10  ? -2.589  7.962  24.246 1.00 15.71  ? 10  ILE A CA   1 
ATOM   179  C C    . ILE A 1 10  ? -3.776  8.179  25.187 1.00 15.86  ? 10  ILE A C    1 
ATOM   180  O O    . ILE A 1 10  ? -4.169  7.277  25.952 1.00 18.23  ? 10  ILE A O    1 
ATOM   181  C CB   . ILE A 1 10  ? -3.075  7.217  22.979 1.00 16.60  ? 10  ILE A CB   1 
ATOM   182  C CG1  . ILE A 1 10  ? -1.892  6.905  22.049 1.00 19.36  ? 10  ILE A CG1  1 
ATOM   183  C CG2  . ILE A 1 10  ? -4.176  7.986  22.246 1.00 19.06  ? 10  ILE A CG2  1 
ATOM   184  C CD1  . ILE A 1 10  ? -1.197  8.115  21.457 1.00 21.33  ? 10  ILE A CD1  1 
ATOM   185  H H    . ILE A 1 10  ? -1.694  6.343  24.933 1.00 18.33  ? 10  ILE A H    1 
ATOM   186  H HA   . ILE A 1 10  ? -2.236  8.836  23.980 1.00 18.74  ? 10  ILE A HA   1 
ATOM   187  H HB   . ILE A 1 10  ? -3.452  6.370  23.265 1.00 19.81  ? 10  ILE A HB   1 
ATOM   188  H HG12 . ILE A 1 10  ? -1.229  6.406  22.552 1.00 23.11  ? 10  ILE A HG12 1 
ATOM   189  H HG13 . ILE A 1 10  ? -2.215  6.364  21.312 1.00 23.11  ? 10  ILE A HG13 1 
ATOM   190  H HG21 . ILE A 1 10  ? -4.443  7.486  21.471 1.00 22.76  ? 10  ILE A HG21 1 
ATOM   191  H HG22 . ILE A 1 10  ? -4.925  8.099  22.836 1.00 22.76  ? 10  ILE A HG22 1 
ATOM   192  H HG23 . ILE A 1 10  ? -3.835  8.843  21.981 1.00 22.76  ? 10  ILE A HG23 1 
ATOM   193  H HD11 . ILE A 1 10  ? -0.478  7.818  20.895 1.00 25.48  ? 10  ILE A HD11 1 
ATOM   194  H HD12 . ILE A 1 10  ? -1.832  8.617  20.939 1.00 25.48  ? 10  ILE A HD12 1 
ATOM   195  H HD13 . ILE A 1 10  ? -0.854  8.658  22.170 1.00 25.48  ? 10  ILE A HD13 1 
ATOM   196  N N    . ALA A 1 11  ? -4.324  9.384  25.141 1.00 17.79  ? 11  ALA A N    1 
ATOM   197  C CA   . ALA A 1 11  ? -5.517  9.722  25.897 1.00 16.69  ? 11  ALA A CA   1 
ATOM   198  C C    . ALA A 1 11  ? -6.558  10.301 24.938 1.00 15.37  ? 11  ALA A C    1 
ATOM   199  O O    . ALA A 1 11  ? -6.223  10.913 23.901 1.00 18.52  ? 11  ALA A O    1 
ATOM   200  C CB   . ALA A 1 11  ? -5.207  10.721 27.001 1.00 19.17  ? 11  ALA A CB   1 
ATOM   201  H H    . ALA A 1 11  ? -4.016  10.035 24.671 1.00 21.23  ? 11  ALA A H    1 
ATOM   202  H HA   . ALA A 1 11  ? -5.886  8.911  26.306 1.00 19.91  ? 11  ALA A HA   1 
ATOM   203  H HB1  . ALA A 1 11  ? -6.015  10.920 27.478 1.00 22.89  ? 11  ALA A HB1  1 
ATOM   204  H HB2  . ALA A 1 11  ? -4.560  10.336 27.597 1.00 22.89  ? 11  ALA A HB2  1 
ATOM   205  H HB3  . ALA A 1 11  ? -4.853  11.522 26.606 1.00 22.89  ? 11  ALA A HB3  1 
ATOM   206  N N    . VAL A 1 12  ? -7.818  10.113 25.312 1.00 17.19  ? 12  VAL A N    1 
ATOM   207  C CA   . VAL A 1 12  ? -8.971  10.588 24.559 1.00 20.52  ? 12  VAL A CA   1 
ATOM   208  C C    . VAL A 1 12  ? -9.780  11.456 25.523 1.00 22.95  ? 12  VAL A C    1 
ATOM   209  O O    . VAL A 1 12  ? -10.331 10.952 26.505 1.00 23.37  ? 12  VAL A O    1 
ATOM   210  C CB   . VAL A 1 12  ? -9.842  9.421  24.078 1.00 26.05  ? 12  VAL A CB   1 
ATOM   211  C CG1  . VAL A 1 12  ? -11.094 9.927  23.354 1.00 28.94  ? 12  VAL A CG1  1 
ATOM   212  C CG2  . VAL A 1 12  ? -9.044  8.498  23.212 1.00 23.69  ? 12  VAL A CG2  1 
ATOM   213  H H    . VAL A 1 12  ? -8.038  9.694  26.031 1.00 20.51  ? 12  VAL A H    1 
ATOM   214  H HA   . VAL A 1 12  ? -8.686  11.126 23.791 1.00 24.51  ? 12  VAL A HA   1 
ATOM   215  H HB   . VAL A 1 12  ? -10.139 8.910  24.860 1.00 31.14  ? 12  VAL A HB   1 
ATOM   216  H HG11 . VAL A 1 12  ? -11.615 9.173  23.067 1.00 34.61  ? 12  VAL A HG11 1 
ATOM   217  H HG12 . VAL A 1 12  ? -11.606 10.469 23.958 1.00 34.61  ? 12  VAL A HG12 1 
ATOM   218  H HG13 . VAL A 1 12  ? -10.825 10.448 22.594 1.00 34.61  ? 12  VAL A HG13 1 
ATOM   219  H HG21 . VAL A 1 12  ? -9.607  7.776  22.923 1.00 28.31  ? 12  VAL A HG21 1 
ATOM   220  H HG22 . VAL A 1 12  ? -8.720  8.986  22.452 1.00 28.31  ? 12  VAL A HG22 1 
ATOM   221  H HG23 . VAL A 1 12  ? -8.305  8.154  23.721 1.00 28.31  ? 12  VAL A HG23 1 
ATOM   222  N N    . ASP A 1 13  ? -9.850  12.754 25.239 1.00 21.16  ? 13  ASP A N    1 
ATOM   223  C CA   . ASP A 1 13  ? -10.450 13.731 26.142 1.00 26.04  ? 13  ASP A CA   1 
ATOM   224  C C    . ASP A 1 13  ? -9.921  13.530 27.581 1.00 23.02  ? 13  ASP A C    1 
ATOM   225  O O    . ASP A 1 13  ? -10.676 13.634 28.564 1.00 30.45  ? 13  ASP A O    1 
ATOM   226  C CB   . ASP A 1 13  ? -11.985 13.658 26.101 1.00 27.96  ? 13  ASP A CB   1 
ATOM   227  C CG   . ASP A 1 13  ? -12.592 14.395 24.910 1.00 30.52  ? 13  ASP A CG   1 
ATOM   228  O OD1  . ASP A 1 13  ? -11.861 15.067 24.148 1.00 29.55  ? 13  ASP A OD1  1 
ATOM   229  O OD2  . ASP A 1 13  ? -13.828 14.317 24.743 1.00 41.10  ? 13  ASP A OD2  1 
ATOM   230  H H    . ASP A 1 13  ? -9.550  13.101 24.511 1.00 25.28  ? 13  ASP A H    1 
ATOM   231  H HA   . ASP A 1 13  ? -10.187 14.629 25.852 1.00 31.13  ? 13  ASP A HA   1 
ATOM   232  H HB2  . ASP A 1 13  ? -12.254 12.728 26.045 1.00 33.43  ? 13  ASP A HB2  1 
ATOM   233  H HB3  . ASP A 1 13  ? -12.341 14.056 26.911 1.00 33.43  ? 13  ASP A HB3  1 
ATOM   234  N N    A GLY A 1 14  ? -8.638  13.197 27.701 0.58 28.79  ? 14  GLY A N    1 
ATOM   235  N N    B GLY A 1 14  ? -8.616  13.273 27.676 0.42 22.71  ? 14  GLY A N    1 
ATOM   236  C CA   A GLY A 1 14  ? -8.012  13.007 29.002 0.58 33.89  ? 14  GLY A CA   1 
ATOM   237  C CA   B GLY A 1 14  ? -7.904  13.251 28.944 0.42 24.89  ? 14  GLY A CA   1 
ATOM   238  C C    A GLY A 1 14  ? -8.279  11.662 29.668 0.58 27.22  ? 14  GLY A C    1 
ATOM   239  C C    B GLY A 1 14  ? -7.797  11.870 29.556 0.42 23.69  ? 14  GLY A C    1 
ATOM   240  O O    A GLY A 1 14  ? -7.812  11.413 30.782 0.58 30.45  ? 14  GLY A O    1 
ATOM   241  O O    B GLY A 1 14  ? -6.961  11.636 30.429 0.42 23.41  ? 14  GLY A O    1 
ATOM   242  H H    A GLY A 1 14  ? -8.106  13.074 27.036 0.58 34.43  ? 14  GLY A H    1 
ATOM   243  H H    B GLY A 1 14  ? -8.113  13.103 26.999 0.42 27.14  ? 14  GLY A H    1 
ATOM   244  H HA2  A GLY A 1 14  ? -7.051  13.104 28.903 0.58 40.55  ? 14  GLY A HA2  1 
ATOM   245  H HA2  B GLY A 1 14  ? -7.006  13.594 28.812 0.42 29.75  ? 14  GLY A HA2  1 
ATOM   246  H HA3  A GLY A 1 14  ? -8.322  13.703 29.602 0.58 40.55  ? 14  GLY A HA3  1 
ATOM   247  H HA3  B GLY A 1 14  ? -8.360  13.828 29.576 0.42 29.75  ? 14  GLY A HA3  1 
ATOM   248  N N    A GLU A 1 15  ? -9.049  10.803 29.005 0.58 27.65  ? 15  GLU A N    1 
ATOM   249  N N    B GLU A 1 15  ? -8.641  10.952 29.098 0.42 25.48  ? 15  GLU A N    1 
ATOM   250  C CA   A GLU A 1 15  ? -9.223  9.426  29.446 0.58 29.77  ? 15  GLU A CA   1 
ATOM   251  C CA   B GLU A 1 15  ? -8.749  9.640  29.713 0.42 35.01  ? 15  GLU A CA   1 
ATOM   252  C C    A GLU A 1 15  ? -8.111  8.560  28.832 0.58 19.74  ? 15  GLU A C    1 
ATOM   253  C C    B GLU A 1 15  ? -7.942  8.591  28.939 0.42 24.93  ? 15  GLU A C    1 
ATOM   254  O O    A GLU A 1 15  ? -7.851  8.619  27.616 0.58 17.90  ? 15  GLU A O    1 
ATOM   255  O O    B GLU A 1 15  ? -8.145  8.399  27.739 0.42 34.54  ? 15  GLU A O    1 
ATOM   256  C CB   A GLU A 1 15  ? -10.607 8.889  29.047 0.58 31.64  ? 15  GLU A CB   1 
ATOM   257  C CB   B GLU A 1 15  ? -10.220 9.238  29.811 0.42 27.06  ? 15  GLU A CB   1 
ATOM   258  C CG   A GLU A 1 15  ? -11.792 9.577  29.722 0.58 55.68  ? 15  GLU A CG   1 
ATOM   259  C CG   B GLU A 1 15  ? -11.038 10.135 30.743 0.42 44.99  ? 15  GLU A CG   1 
ATOM   260  C CD   A GLU A 1 15  ? -12.019 9.108  31.150 0.58 68.39  ? 15  GLU A CD   1 
ATOM   261  C CD   B GLU A 1 15  ? -10.524 10.118 32.176 0.42 49.02  ? 15  GLU A CD   1 
ATOM   262  O OE1  A GLU A 1 15  ? -11.745 7.922  31.445 0.58 69.30  ? 15  GLU A OE1  1 
ATOM   263  O OE1  B GLU A 1 15  ? -10.651 9.070  32.835 0.42 56.78  ? 15  GLU A OE1  1 
ATOM   264  O OE2  A GLU A 1 15  ? -12.482 9.926  31.975 0.58 64.93  ? 15  GLU A OE2  1 
ATOM   265  O OE2  B GLU A 1 15  ? -9.998  11.151 32.641 0.42 52.48  ? 15  GLU A OE2  1 
ATOM   266  H H    A GLU A 1 15  ? -9.485  10.998 28.290 0.58 33.06  ? 15  GLU A H    1 
ATOM   267  H HA   A GLU A 1 15  ? -9.145  9.384  30.422 0.58 35.61  ? 15  GLU A HA   1 
ATOM   268  H HA   B GLU A 1 15  ? -8.387  9.685  30.623 0.42 41.90  ? 15  GLU A HA   1 
ATOM   269  H HB2  A GLU A 1 15  ? -10.714 8.997  28.089 0.58 37.85  ? 15  GLU A HB2  1 
ATOM   270  H HB2  B GLU A 1 15  ? -10.617 9.285  28.928 0.42 32.35  ? 15  GLU A HB2  1 
ATOM   271  H HB3  A GLU A 1 15  ? -10.649 7.947  29.274 0.58 37.85  ? 15  GLU A HB3  1 
ATOM   272  H HB3  B GLU A 1 15  ? -10.274 8.330  30.149 0.42 32.35  ? 15  GLU A HB3  1 
ATOM   273  H HG2  A GLU A 1 15  ? -11.630 10.534 29.744 0.58 66.70  ? 15  GLU A HG2  1 
ATOM   274  H HG2  B GLU A 1 15  ? -10.995 11.049 30.420 0.42 53.87  ? 15  GLU A HG2  1 
ATOM   275  H HG3  A GLU A 1 15  ? -12.596 9.390  29.214 0.58 66.70  ? 15  GLU A HG3  1 
ATOM   276  H HG3  B GLU A 1 15  ? -11.958 9.828  30.751 0.42 53.87  ? 15  GLU A HG3  1 
ATOM   277  N N    A PRO A 1 16  ? -7.447  7.750  29.670 0.58 21.78  ? 16  PRO A N    1 
ATOM   278  N N    B PRO A 1 16  ? -7.026  7.901  29.635 0.42 31.34  ? 16  PRO A N    1 
ATOM   279  C CA   A PRO A 1 16  ? -6.399  6.872  29.139 0.58 28.56  ? 16  PRO A CA   1 
ATOM   280  C CA   B PRO A 1 16  ? -6.079  6.925  29.070 0.42 29.24  ? 16  PRO A CA   1 
ATOM   281  C C    A PRO A 1 16  ? -6.994  5.940  28.107 0.58 23.80  ? 16  PRO A C    1 
ATOM   282  C C    B PRO A 1 16  ? -6.732  5.805  28.265 0.42 24.02  ? 16  PRO A C    1 
ATOM   283  O O    A PRO A 1 16  ? -8.114  5.464  28.305 0.58 23.11  ? 16  PRO A O    1 
ATOM   284  O O    B PRO A 1 16  ? -7.610  5.090  28.755 0.42 25.18  ? 16  PRO A O    1 
ATOM   285  C CB   A PRO A 1 16  ? -5.943  6.074  30.368 0.58 31.81  ? 16  PRO A CB   1 
ATOM   286  C CB   B PRO A 1 16  ? -5.387  6.353  30.311 0.42 31.19  ? 16  PRO A CB   1 
ATOM   287  C CG   A PRO A 1 16  ? -6.480  6.796  31.557 0.58 30.56  ? 16  PRO A CG   1 
ATOM   288  C CG   B PRO A 1 16  ? -5.519  7.411  31.333 0.42 36.80  ? 16  PRO A CG   1 
ATOM   289  C CD   A PRO A 1 16  ? -7.715  7.494  31.095 0.58 24.13  ? 16  PRO A CD   1 
ATOM   290  C CD   B PRO A 1 16  ? -6.842  8.055  31.088 0.42 27.72  ? 16  PRO A CD   1 
ATOM   291  H HA   A PRO A 1 16  ? -5.654  7.384  28.760 0.58 34.15  ? 16  PRO A HA   1 
ATOM   292  H HA   B PRO A 1 16  ? -5.415  7.381  28.512 0.42 34.98  ? 16  PRO A HA   1 
ATOM   293  H HB2  A PRO A 1 16  ? -6.306  5.175  30.323 0.58 38.05  ? 16  PRO A HB2  1 
ATOM   294  H HB2  B PRO A 1 16  ? -5.838  5.542  30.594 0.42 37.31  ? 16  PRO A HB2  1 
ATOM   295  H HB3  A PRO A 1 16  ? -4.974  6.048  30.395 0.58 38.05  ? 16  PRO A HB3  1 
ATOM   296  H HB3  B PRO A 1 16  ? -4.453  6.178  30.115 0.42 37.31  ? 16  PRO A HB3  1 
ATOM   297  H HG2  A PRO A 1 16  ? -6.692  6.157  32.255 0.58 36.55  ? 16  PRO A HG2  1 
ATOM   298  H HG2  B PRO A 1 16  ? -5.493  7.013  32.218 0.42 44.04  ? 16  PRO A HG2  1 
ATOM   299  H HG3  A PRO A 1 16  ? -5.823  7.437  31.871 0.58 36.55  ? 16  PRO A HG3  1 
ATOM   300  H HG3  B PRO A 1 16  ? -4.802  8.055  31.228 0.42 44.04  ? 16  PRO A HG3  1 
ATOM   301  H HD2  A PRO A 1 16  ? -8.488  6.918  31.196 0.58 28.84  ? 16  PRO A HD2  1 
ATOM   302  H HD2  B PRO A 1 16  ? -7.542  7.587  31.570 0.42 33.15  ? 16  PRO A HD2  1 
ATOM   303  H HD3  A PRO A 1 16  ? -7.829  8.331  31.573 0.58 28.84  ? 16  PRO A HD3  1 
ATOM   304  H HD3  B PRO A 1 16  ? -6.811  8.995  31.328 0.42 33.15  ? 16  PRO A HD3  1 
ATOM   305  N N    . LEU A 1 17  ? -6.272  5.680  27.023 1.00 20.55  ? 17  LEU A N    1 
ATOM   306  C CA   . LEU A 1 17  ? -6.744  4.706  26.049 1.00 18.58  ? 17  LEU A CA   1 
ATOM   307  C C    . LEU A 1 17  ? -5.804  3.506  26.057 1.00 20.70  ? 17  LEU A C    1 
ATOM   308  O O    . LEU A 1 17  ? -6.204  2.374  26.325 1.00 24.74  ? 17  LEU A O    1 
ATOM   309  C CB   . LEU A 1 17  ? -6.796  5.360  24.659 1.00 19.67  ? 17  LEU A CB   1 
ATOM   310  C CG   . LEU A 1 17  ? -7.211  4.447  23.503 1.00 20.20  ? 17  LEU A CG   1 
ATOM   311  C CD1  . LEU A 1 17  ? -8.623  3.972  23.677 1.00 28.99  ? 17  LEU A CD1  1 
ATOM   312  C CD2  . LEU A 1 17  ? -7.052  5.159  22.177 1.00 25.47  ? 17  LEU A CD2  1 
ATOM   313  H H    A LEU A 1 17  ? -5.518  6.047  26.831 0.57 24.54  ? 17  LEU A H    1 
ATOM   314  H H    B LEU A 1 17  ? -5.648  6.181  26.708 0.43 24.54  ? 17  LEU A H    1 
ATOM   315  H HA   . LEU A 1 17  ? -7.644  4.403  26.291 1.00 22.17  ? 17  LEU A HA   1 
ATOM   316  H HB2  . LEU A 1 17  ? -7.431  6.093  24.690 1.00 23.49  ? 17  LEU A HB2  1 
ATOM   317  H HB3  . LEU A 1 17  ? -5.915  5.707  24.451 1.00 23.49  ? 17  LEU A HB3  1 
ATOM   318  H HG   . LEU A 1 17  ? -6.633  3.668  23.495 1.00 24.12  ? 17  LEU A HG   1 
ATOM   319  H HD11 . LEU A 1 17  ? -8.854  3.403  22.940 1.00 34.67  ? 17  LEU A HD11 1 
ATOM   320  H HD12 . LEU A 1 17  ? -8.688  3.484  24.501 1.00 34.67  ? 17  LEU A HD12 1 
ATOM   321  H HD13 . LEU A 1 17  ? -9.207  4.734  23.700 1.00 34.67  ? 17  LEU A HD13 1 
ATOM   322  H HD21 . LEU A 1 17  ? -7.318  4.566  21.470 1.00 30.45  ? 17  LEU A HD21 1 
ATOM   323  H HD22 . LEU A 1 17  ? -7.607  5.942  22.174 1.00 30.45  ? 17  LEU A HD22 1 
ATOM   324  H HD23 . LEU A 1 17  ? -6.132  5.409  22.066 1.00 30.45  ? 17  LEU A HD23 1 
ATOM   325  N N    . GLY A 1 18  ? -4.529  3.767  25.849 1.00 17.32  ? 18  GLY A N    1 
ATOM   326  C CA   . GLY A 1 18  ? -3.531  2.725  25.867 1.00 17.30  ? 18  GLY A CA   1 
ATOM   327  C C    . GLY A 1 18  ? -2.200  3.208  25.341 1.00 14.69  ? 18  GLY A C    1 
ATOM   328  O O    . GLY A 1 18  ? -2.020  4.387  25.034 1.00 18.67  ? 18  GLY A O    1 
ATOM   329  H H    . GLY A 1 18  ? -4.214  4.552  25.693 1.00 20.66  ? 18  GLY A H    1 
ATOM   330  H HA2  . GLY A 1 18  ? -3.408  2.409  26.776 1.00 20.65  ? 18  GLY A HA2  1 
ATOM   331  H HA3  . GLY A 1 18  ? -3.828  1.981  25.319 1.00 20.65  ? 18  GLY A HA3  1 
ATOM   332  N N    A ARG A 1 19  ? -1.285  2.267  25.183 0.67 24.87  ? 19  ARG A N    1 
ATOM   333  N N    B ARG A 1 19  ? -1.244  2.293  25.270 0.33 10.14  ? 19  ARG A N    1 
ATOM   334  C CA   A ARG A 1 19  ? 0.083   2.541  24.789 0.67 21.25  ? 19  ARG A CA   1 
ATOM   335  C CA   B ARG A 1 19  ? 0.109   2.591  24.823 0.33 17.26  ? 19  ARG A CA   1 
ATOM   336  C C    A ARG A 1 19  ? 0.381   1.962  23.410 0.67 15.31  ? 19  ARG A C    1 
ATOM   337  C C    B ARG A 1 19  ? 0.424   1.928  23.487 0.33 18.31  ? 19  ARG A C    1 
ATOM   338  O O    A ARG A 1 19  ? 0.074   0.786  23.104 0.67 17.08  ? 19  ARG A O    1 
ATOM   339  O O    B ARG A 1 19  ? -0.068  0.832  23.183 0.33 20.62  ? 19  ARG A O    1 
ATOM   340  C CB   A ARG A 1 19  ? 1.031   1.925  25.825 0.67 18.01  ? 19  ARG A CB   1 
ATOM   341  C CB   B ARG A 1 19  ? 1.101   2.101  25.873 0.33 20.85  ? 19  ARG A CB   1 
ATOM   342  C CG   A ARG A 1 19  ? 2.512   2.029  25.443 0.67 17.31  ? 19  ARG A CG   1 
ATOM   343  C CG   B ARG A 1 19  ? 2.560   2.160  25.432 0.33 18.08  ? 19  ARG A CG   1 
ATOM   344  C CD   A ARG A 1 19  ? 3.427   1.649  26.609 0.67 18.23  ? 19  ARG A CD   1 
ATOM   345  C CD   B ARG A 1 19  ? 3.495   1.720  26.551 0.33 23.10  ? 19  ARG A CD   1 
ATOM   346  N NE   A ARG A 1 19  ? 3.562   2.723  27.594 0.67 21.52  ? 19  ARG A NE   1 
ATOM   347  N NE   B ARG A 1 19  ? 3.357   2.561  27.735 0.33 12.44  ? 19  ARG A NE   1 
ATOM   348  C CZ   A ARG A 1 19  ? 4.386   2.712  28.640 0.67 25.68  ? 19  ARG A CZ   1 
ATOM   349  C CZ   B ARG A 1 19  ? 4.107   2.459  28.825 0.33 22.83  ? 19  ARG A CZ   1 
ATOM   350  N NH1  A ARG A 1 19  ? 5.159   1.656  28.888 0.67 23.73  ? 19  ARG A NH1  1 
ATOM   351  N NH1  B ARG A 1 19  ? 5.053   1.536  28.899 0.33 29.85  ? 19  ARG A NH1  1 
ATOM   352  N NH2  A ARG A 1 19  ? 4.410   3.758  29.463 0.67 20.68  ? 19  ARG A NH2  1 
ATOM   353  N NH2  B ARG A 1 19  ? 3.901   3.276  29.850 0.33 27.02  ? 19  ARG A NH2  1 
ATOM   354  H H    A ARG A 1 19  ? -1.441  1.430  25.304 0.67 29.73  ? 19  ARG A H    1 
ATOM   355  H H    B ARG A 1 19  ? -1.358  1.467  25.481 0.33 12.05  ? 19  ARG A H    1 
ATOM   356  H HA   A ARG A 1 19  ? 0.232   3.509  24.762 0.67 25.39  ? 19  ARG A HA   1 
ATOM   357  H HA   B ARG A 1 19  ? 0.215   3.561  24.723 0.33 20.60  ? 19  ARG A HA   1 
ATOM   358  H HB2  A ARG A 1 19  ? 0.909   2.382  26.671 0.67 21.49  ? 19  ARG A HB2  1 
ATOM   359  H HB2  B ARG A 1 19  ? 1.010   2.650  26.667 0.33 24.90  ? 19  ARG A HB2  1 
ATOM   360  H HB3  A ARG A 1 19  ? 0.816   0.984  25.925 0.67 21.49  ? 19  ARG A HB3  1 
ATOM   361  H HB3  B ARG A 1 19  ? 0.895   1.178  26.088 0.33 24.90  ? 19  ARG A HB3  1 
ATOM   362  H HG2  A ARG A 1 19  ? 2.695   1.426  24.705 0.67 20.66  ? 19  ARG A HG2  1 
ATOM   363  H HG2  B ARG A 1 19  ? 2.691   1.567  24.675 0.33 21.58  ? 19  ARG A HG2  1 
ATOM   364  H HG3  A ARG A 1 19  ? 2.712   2.943  25.186 0.67 20.66  ? 19  ARG A HG3  1 
ATOM   365  H HG3  B ARG A 1 19  ? 2.785   3.071  25.188 0.33 21.58  ? 19  ARG A HG3  1 
ATOM   366  H HD2  A ARG A 1 19  ? 3.058   0.873  27.060 0.67 21.76  ? 19  ARG A HD2  1 
ATOM   367  H HD2  B ARG A 1 19  ? 3.285   0.806  26.802 0.33 27.61  ? 19  ARG A HD2  1 
ATOM   368  H HD3  A ARG A 1 19  ? 4.310   1.444  26.265 0.67 21.76  ? 19  ARG A HD3  1 
ATOM   369  H HD3  B ARG A 1 19  ? 4.413   1.779  26.242 0.33 27.61  ? 19  ARG A HD3  1 
ATOM   370  H HE   A ARG A 1 19  ? 3.006   3.508  27.475 0.67 25.71  ? 19  ARG A HE   1 
ATOM   371  H HE   B ARG A 1 19  ? 2.667   3.243  27.725 0.33 14.82  ? 19  ARG A HE   1 
ATOM   372  H HH11 A ARG A 1 19  ? 5.144   0.977  28.360 0.67 28.35  ? 19  ARG A HH11 1 
ATOM   373  H HH11 B ARG A 1 19  ? 5.189   1.005  28.237 0.33 35.71  ? 19  ARG A HH11 1 
ATOM   374  H HH12 A ARG A 1 19  ? 5.684   1.658  29.570 0.67 28.35  ? 19  ARG A HH12 1 
ATOM   375  H HH12 B ARG A 1 19  ? 5.537   1.471  29.608 0.33 35.71  ? 19  ARG A HH12 1 
ATOM   376  H HH21 A ARG A 1 19  ? 3.907   4.439  29.308 0.67 24.70  ? 19  ARG A HH21 1 
ATOM   377  H HH21 B ARG A 1 19  ? 3.285   3.875  29.805 0.33 32.31  ? 19  ARG A HH21 1 
ATOM   378  H HH22 A ARG A 1 19  ? 4.934   3.757  30.145 0.67 24.70  ? 19  ARG A HH22 1 
ATOM   379  H HH22 B ARG A 1 19  ? 4.384   3.209  30.558 0.33 32.31  ? 19  ARG A HH22 1 
ATOM   380  N N    A VAL A 1 20  ? 0.983   2.790  22.568 0.67 13.36  ? 20  VAL A N    1 
ATOM   381  N N    B VAL A 1 20  ? 1.244   2.613  22.694 0.33 22.40  ? 20  VAL A N    1 
ATOM   382  C CA   A VAL A 1 20  ? 1.531   2.331  21.298 0.67 13.63  ? 20  VAL A CA   1 
ATOM   383  C CA   B VAL A 1 20  ? 1.747   2.096  21.428 0.33 24.56  ? 20  VAL A CA   1 
ATOM   384  C C    A VAL A 1 20  ? 3.049   2.427  21.372 0.67 16.16  ? 20  VAL A C    1 
ATOM   385  C C    B VAL A 1 20  ? 3.251   2.329  21.393 0.33 21.23  ? 20  VAL A C    1 
ATOM   386  O O    A VAL A 1 20  ? 3.580   3.452  21.811 0.67 18.78  ? 20  VAL A O    1 
ATOM   387  O O    B VAL A 1 20  ? 3.730   3.352  21.872 0.33 18.87  ? 20  VAL A O    1 
ATOM   388  C CB   A VAL A 1 20  ? 1.073   3.191  20.112 0.67 14.98  ? 20  VAL A CB   1 
ATOM   389  C CB   B VAL A 1 20  ? 1.090   2.791  20.213 0.33 22.86  ? 20  VAL A CB   1 
ATOM   390  C CG1  A VAL A 1 20  ? 1.551   2.579  18.791 0.67 15.85  ? 20  VAL A CG1  1 
ATOM   391  C CG1  B VAL A 1 20  ? -0.330  2.340  20.073 0.33 37.53  ? 20  VAL A CG1  1 
ATOM   392  C CG2  A VAL A 1 20  ? -0.411  3.349  20.090 0.67 19.14  ? 20  VAL A CG2  1 
ATOM   393  C CG2  B VAL A 1 20  ? 1.149   4.306  20.344 0.33 19.75  ? 20  VAL A CG2  1 
ATOM   394  H H    A VAL A 1 20  ? 1.090   3.631  22.710 0.67 15.92  ? 20  VAL A H    1 
ATOM   395  H H    B VAL A 1 20  ? 1.530   3.403  22.876 0.33 26.77  ? 20  VAL A H    1 
ATOM   396  H HA   A VAL A 1 20  ? 1.275   1.399  21.137 0.67 16.24  ? 20  VAL A HA   1 
ATOM   397  H HA   B VAL A 1 20  ? 1.575   1.133  21.372 0.33 29.35  ? 20  VAL A HA   1 
ATOM   398  H HB   A VAL A 1 20  ? 1.471   4.083  20.193 0.67 17.86  ? 20  VAL A HB   1 
ATOM   399  H HB   B VAL A 1 20  ? 1.572   2.536  19.398 0.33 27.31  ? 20  VAL A HB   1 
ATOM   400  H HG11 A VAL A 1 20  ? 1.254   3.132  18.065 0.67 18.91  ? 20  VAL A HG11 1 
ATOM   401  H HG11 B VAL A 1 20  ? -0.724  2.779  19.315 0.33 44.92  ? 20  VAL A HG11 1 
ATOM   402  H HG12 A VAL A 1 20  ? 2.510   2.533  18.797 0.67 18.91  ? 20  VAL A HG12 1 
ATOM   403  H HG12 B VAL A 1 20  ? -0.343  1.388  19.944 0.33 44.92  ? 20  VAL A HG12 1 
ATOM   404  H HG13 A VAL A 1 20  ? 1.182   1.697  18.703 0.67 18.91  ? 20  VAL A HG13 1 
ATOM   405  H HG13 B VAL A 1 20  ? -0.810  2.569  20.871 0.33 44.92  ? 20  VAL A HG13 1 
ATOM   406  H HG21 A VAL A 1 20  ? -0.656  3.891  19.337 0.67 22.85  ? 20  VAL A HG21 1 
ATOM   407  H HG21 B VAL A 1 20  ? 0.734   4.703  19.574 0.33 23.58  ? 20  VAL A HG21 1 
ATOM   408  H HG22 A VAL A 1 20  ? -0.816  2.482  20.016 0.67 22.85  ? 20  VAL A HG22 1 
ATOM   409  H HG22 B VAL A 1 20  ? 0.683   4.569  21.140 0.33 23.58  ? 20  VAL A HG22 1 
ATOM   410  H HG23 A VAL A 1 20  ? -0.691  3.773  20.905 0.67 22.85  ? 20  VAL A HG23 1 
ATOM   411  H HG23 B VAL A 1 20  ? 2.068   4.579  20.397 0.33 23.58  ? 20  VAL A HG23 1 
ATOM   412  N N    A SER A 1 21  ? 3.751   1.369  20.980 0.67 15.49  ? 21  SER A N    1 
ATOM   413  N N    B SER A 1 21  ? 3.999   1.374  20.850 0.33 19.67  ? 21  SER A N    1 
ATOM   414  C CA   A SER A 1 21  ? 5.199   1.460  20.890 0.67 17.10  ? 21  SER A CA   1 
ATOM   415  C CA   B SER A 1 21  ? 5.448   1.479  20.822 0.33 22.88  ? 21  SER A CA   1 
ATOM   416  C C    A SER A 1 21  ? 5.653   1.319  19.438 0.67 19.79  ? 21  SER A C    1 
ATOM   417  C C    B SER A 1 21  ? 5.952   1.296  19.388 0.33 16.00  ? 21  SER A C    1 
ATOM   418  O O    A SER A 1 21  ? 4.913   0.813  18.588 0.67 14.47  ? 21  SER A O    1 
ATOM   419  O O    B SER A 1 21  ? 5.522   0.381  18.698 0.33 13.17  ? 21  SER A O    1 
ATOM   420  C CB   A SER A 1 21  ? 5.876   0.436  21.792 0.67 21.00  ? 21  SER A CB   1 
ATOM   421  C CB   B SER A 1 21  ? 6.060   0.427  21.752 0.33 20.42  ? 21  SER A CB   1 
ATOM   422  O OG   A SER A 1 21  ? 5.828   -0.848 21.225 0.67 23.81  ? 21  SER A OG   1 
ATOM   423  O OG   B SER A 1 21  ? 5.530   0.519  23.072 0.33 23.76  ? 21  SER A OG   1 
ATOM   424  H H    A SER A 1 21  ? 3.421   0.604  20.766 0.67 18.47  ? 21  SER A H    1 
ATOM   425  H H    B SER A 1 21  ? 3.689   0.656  20.492 0.33 23.48  ? 21  SER A H    1 
ATOM   426  H HA   A SER A 1 21  ? 5.473   2.349  21.199 0.67 20.41  ? 21  SER A HA   1 
ATOM   427  H HA   B SER A 1 21  ? 5.718   2.367  21.135 0.33 27.34  ? 21  SER A HA   1 
ATOM   428  H HB2  A SER A 1 21  ? 6.804   0.690  21.916 0.67 25.08  ? 21  SER A HB2  1 
ATOM   429  H HB2  B SER A 1 21  ? 5.868   -0.455 21.398 0.33 24.39  ? 21  SER A HB2  1 
ATOM   430  H HB3  A SER A 1 21  ? 5.420   0.419  22.648 0.67 25.08  ? 21  SER A HB3  1 
ATOM   431  H HB3  B SER A 1 21  ? 7.020   0.564  21.790 0.33 24.39  ? 21  SER A HB3  1 
ATOM   432  H HG   A SER A 1 21  ? 6.196   -1.388 21.721 0.67 28.46  ? 21  SER A HG   1 
ATOM   433  H HG   B SER A 1 21  ? 5.872   -0.052 23.552 0.33 28.39  ? 21  SER A HG   1 
ATOM   434  N N    A PHE A 1 22  ? 6.873   1.780  19.169 0.67 14.18  ? 22  PHE A N    1 
ATOM   435  N N    B PHE A 1 22  ? 6.843   2.174  18.931 0.33 15.68  ? 22  PHE A N    1 
ATOM   436  C CA   A PHE A 1 22  ? 7.399   1.916  17.814 0.67 16.90  ? 22  PHE A CA   1 
ATOM   437  C CA   B PHE A 1 22  ? 7.361   2.096  17.564 0.33 14.57  ? 22  PHE A CA   1 
ATOM   438  C C    A PHE A 1 22  ? 8.827   1.458  17.796 0.67 14.98  ? 22  PHE A C    1 
ATOM   439  C C    B PHE A 1 22  ? 8.836   1.737  17.547 0.33 16.96  ? 22  PHE A C    1 
ATOM   440  O O    A PHE A 1 22  ? 9.589   1.749  18.730 0.67 16.25  ? 22  PHE A O    1 
ATOM   441  O O    B PHE A 1 22  ? 9.641   2.355  18.250 0.33 13.03  ? 22  PHE A O    1 
ATOM   442  C CB   A PHE A 1 22  ? 7.431   3.378  17.361 0.67 14.74  ? 22  PHE A CB   1 
ATOM   443  C CB   B PHE A 1 22  ? 7.207   3.433  16.830 0.33 17.47  ? 22  PHE A CB   1 
ATOM   444  C CG   A PHE A 1 22  ? 6.106   4.078  17.421 0.67 17.95  ? 22  PHE A CG   1 
ATOM   445  C CG   B PHE A 1 22  ? 5.920   4.152  17.115 0.33 15.11  ? 22  PHE A CG   1 
ATOM   446  C CD1  A PHE A 1 22  ? 5.181   3.933  16.404 0.67 21.02  ? 22  PHE A CD1  1 
ATOM   447  C CD1  B PHE A 1 22  ? 4.794   3.915  16.347 0.33 22.72  ? 22  PHE A CD1  1 
ATOM   448  C CD2  A PHE A 1 22  ? 5.807   4.909  18.486 0.67 20.95  ? 22  PHE A CD2  1 
ATOM   449  C CD2  B PHE A 1 22  ? 5.844   5.080  18.138 0.33 19.13  ? 22  PHE A CD2  1 
ATOM   450  C CE1  A PHE A 1 22  ? 3.974   4.598  16.450 0.67 20.27  ? 22  PHE A CE1  1 
ATOM   451  C CE1  B PHE A 1 22  ? 3.607   4.581  16.600 0.33 16.31  ? 22  PHE A CE1  1 
ATOM   452  C CE2  A PHE A 1 22  ? 4.602   5.563  18.545 0.67 23.91  ? 22  PHE A CE2  1 
ATOM   453  C CE2  B PHE A 1 22  ? 4.661   5.746  18.396 0.33 20.56  ? 22  PHE A CE2  1 
ATOM   454  C CZ   A PHE A 1 22  ? 3.683   5.410  17.522 0.67 20.67  ? 22  PHE A CZ   1 
ATOM   455  C CZ   B PHE A 1 22  ? 3.542   5.499  17.619 0.33 20.21  ? 22  PHE A CZ   1 
ATOM   456  H H    A PHE A 1 22  ? 7.432   2.027  19.774 0.67 16.90  ? 22  PHE A H    1 
ATOM   457  H H    B PHE A 1 22  ? 7.163   2.826  19.391 0.33 18.70  ? 22  PHE A H    1 
ATOM   458  H HA   A PHE A 1 22  ? 6.872   1.384  17.181 0.67 20.16  ? 22  PHE A HA   1 
ATOM   459  H HA   B PHE A 1 22  ? 6.869   1.410  17.067 0.33 17.37  ? 22  PHE A HA   1 
ATOM   460  H HB2  A PHE A 1 22  ? 8.047   3.865  17.931 0.67 17.57  ? 22  PHE A HB2  1 
ATOM   461  H HB2  B PHE A 1 22  ? 7.935   4.017  17.093 0.33 20.84  ? 22  PHE A HB2  1 
ATOM   462  H HB3  A PHE A 1 22  ? 7.740   3.411  16.443 0.67 17.57  ? 22  PHE A HB3  1 
ATOM   463  H HB3  B PHE A 1 22  ? 7.247   3.269  15.875 0.33 20.84  ? 22  PHE A HB3  1 
ATOM   464  H HD1  A PHE A 1 22  ? 5.378   3.386  15.678 0.67 25.11  ? 22  PHE A HD1  1 
ATOM   465  H HD1  B PHE A 1 22  ? 4.834   3.297  15.654 0.33 27.14  ? 22  PHE A HD1  1 
ATOM   466  H HD2  A PHE A 1 22  ? 6.423   5.015  19.175 0.67 25.02  ? 22  PHE A HD2  1 
ATOM   467  H HD2  B PHE A 1 22  ? 6.593   5.252  18.661 0.33 22.83  ? 22  PHE A HD2  1 
ATOM   468  H HE1  A PHE A 1 22  ? 3.354   4.488  15.766 0.67 24.20  ? 22  PHE A HE1  1 
ATOM   469  H HE1  B PHE A 1 22  ? 2.857   4.410  16.078 0.33 19.45  ? 22  PHE A HE1  1 
ATOM   470  H HE2  A PHE A 1 22  ? 4.407   6.115  19.268 0.67 28.57  ? 22  PHE A HE2  1 
ATOM   471  H HE2  B PHE A 1 22  ? 4.618   6.366  19.088 0.33 24.55  ? 22  PHE A HE2  1 
ATOM   472  H HZ   A PHE A 1 22  ? 2.867   5.853  17.561 0.67 24.69  ? 22  PHE A HZ   1 
ATOM   473  H HZ   B PHE A 1 22  ? 2.745   5.945  17.794 0.33 24.13  ? 22  PHE A HZ   1 
ATOM   474  N N    . GLU A 1 23  ? 9.197   0.738  16.744 1.00 16.88  ? 23  GLU A N    1 
ATOM   475  C CA   . GLU A 1 23  ? 10.590  0.503  16.450 1.00 17.08  ? 23  GLU A CA   1 
ATOM   476  C C    . GLU A 1 23  ? 11.000  1.595  15.449 1.00 16.24  ? 23  GLU A C    1 
ATOM   477  O O    . GLU A 1 23  ? 10.301  1.841  14.468 1.00 18.14  ? 23  GLU A O    1 
ATOM   478  C CB   . GLU A 1 23  ? 10.797  -0.867 15.807 1.00 20.29  ? 23  GLU A CB   1 
ATOM   479  C CG   . GLU A 1 23  ? 12.217  -1.093 15.372 1.00 25.28  ? 23  GLU A CG   1 
ATOM   480  C CD   . GLU A 1 23  ? 12.460  -2.451 14.744 1.00 27.73  ? 23  GLU A CD   1 
ATOM   481  O OE1  . GLU A 1 23  ? 11.550  -3.305 14.721 1.00 40.40  ? 23  GLU A OE1  1 
ATOM   482  O OE2  . GLU A 1 23  ? 13.602  -2.661 14.279 1.00 29.96  ? 23  GLU A OE2  1 
ATOM   483  H H    A GLU A 1 23  ? 8.653   0.374  16.186 0.68 20.14  ? 23  GLU A H    1 
ATOM   484  H H    B GLU A 1 23  ? 8.653   0.190  16.364 0.32 20.14  ? 23  GLU A H    1 
ATOM   485  H HA   . GLU A 1 23  ? 11.135  0.575  17.262 1.00 20.38  ? 23  GLU A HA   1 
ATOM   486  H HB2  . GLU A 1 23  ? 10.567  -1.556 16.450 1.00 24.22  ? 23  GLU A HB2  1 
ATOM   487  H HB3  . GLU A 1 23  ? 10.228  -0.939 15.025 1.00 24.22  ? 23  GLU A HB3  1 
ATOM   488  H HG2  . GLU A 1 23  ? 12.454  -0.418 14.717 1.00 30.21  ? 23  GLU A HG2  1 
ATOM   489  H HG3  . GLU A 1 23  ? 12.797  -1.017 16.146 1.00 30.21  ? 23  GLU A HG3  1 
ATOM   490  N N    . LEU A 1 24  ? 12.140  2.230  15.681 1.00 17.47  ? 24  LEU A N    1 
ATOM   491  C CA   . LEU A 1 24  ? 12.649  3.256  14.781 1.00 16.32  ? 24  LEU A CA   1 
ATOM   492  C C    . LEU A 1 24  ? 13.851  2.685  14.033 1.00 18.80  ? 24  LEU A C    1 
ATOM   493  O O    . LEU A 1 24  ? 14.745  2.088  14.664 1.00 20.62  ? 24  LEU A O    1 
ATOM   494  C CB   . LEU A 1 24  ? 13.071  4.481  15.581 1.00 18.07  ? 24  LEU A CB   1 
ATOM   495  C CG   . LEU A 1 24  ? 12.030  5.088  16.502 1.00 17.51  ? 24  LEU A CG   1 
ATOM   496  C CD1  . LEU A 1 24  ? 12.616  6.319  17.214 1.00 22.48  ? 24  LEU A CD1  1 
ATOM   497  C CD2  . LEU A 1 24  ? 10.761  5.440  15.718 1.00 20.02  ? 24  LEU A CD2  1 
ATOM   498  H H    . LEU A 1 24  ? 12.645  2.083  16.362 1.00 20.85  ? 24  LEU A H    1 
ATOM   499  H HA   . LEU A 1 24  ? 11.959  3.514  14.135 1.00 19.46  ? 24  LEU A HA   1 
ATOM   500  H HB2  . LEU A 1 24  ? 13.831  4.235  16.131 1.00 21.57  ? 24  LEU A HB2  1 
ATOM   501  H HB3  . LEU A 1 24  ? 13.338  5.173  14.956 1.00 21.57  ? 24  LEU A HB3  1 
ATOM   502  H HG   . LEU A 1 24  ? 11.792  4.436  17.180 1.00 20.90  ? 24  LEU A HG   1 
ATOM   503  H HD11 . LEU A 1 24  ? 11.948  6.693  17.793 1.00 26.86  ? 24  LEU A HD11 1 
ATOM   504  H HD12 . LEU A 1 24  ? 13.381  6.048  17.728 1.00 26.86  ? 24  LEU A HD12 1 
ATOM   505  H HD13 . LEU A 1 24  ? 12.877  6.966  16.554 1.00 26.86  ? 24  LEU A HD13 1 
ATOM   506  H HD21 . LEU A 1 24  ? 10.118  5.822  16.321 1.00 23.90  ? 24  LEU A HD21 1 
ATOM   507  H HD22 . LEU A 1 24  ? 10.984  6.073  15.032 1.00 23.90  ? 24  LEU A HD22 1 
ATOM   508  H HD23 . LEU A 1 24  ? 10.406  4.640  15.324 1.00 23.90  ? 24  LEU A HD23 1 
ATOM   509  N N    . PHE A 1 25  ? 13.881  2.859  12.709 1.00 17.88  ? 25  PHE A N    1 
ATOM   510  C CA   . PHE A 1 25  ? 14.881  2.200  11.862 1.00 20.13  ? 25  PHE A CA   1 
ATOM   511  C C    . PHE A 1 25  ? 16.161  3.016  11.756 1.00 23.52  ? 25  PHE A C    1 
ATOM   512  O O    . PHE A 1 25  ? 16.496  3.529  10.688 1.00 23.21  ? 25  PHE A O    1 
ATOM   513  C CB   . PHE A 1 25  ? 14.307  1.911  10.469 1.00 22.53  ? 25  PHE A CB   1 
ATOM   514  C CG   . PHE A 1 25  ? 13.096  1.052  10.493 1.00 23.35  ? 25  PHE A CG   1 
ATOM   515  C CD1  . PHE A 1 25  ? 13.039  -0.056 11.322 1.00 29.81  ? 25  PHE A CD1  1 
ATOM   516  C CD2  . PHE A 1 25  ? 11.991  1.371  9.722  1.00 26.21  ? 25  PHE A CD2  1 
ATOM   517  C CE1  . PHE A 1 25  ? 11.894  -0.852 11.362 1.00 32.85  ? 25  PHE A CE1  1 
ATOM   518  C CE2  . PHE A 1 25  ? 10.858  0.580  9.744  1.00 29.96  ? 25  PHE A CE2  1 
ATOM   519  C CZ   . PHE A 1 25  ? 10.810  -0.534 10.570 1.00 31.00  ? 25  PHE A CZ   1 
ATOM   520  H H    . PHE A 1 25  ? 13.330  3.356  12.275 1.00 21.34  ? 25  PHE A H    1 
ATOM   521  H HA   . PHE A 1 25  ? 15.114  1.339  12.268 1.00 24.03  ? 25  PHE A HA   1 
ATOM   522  H HB2  . PHE A 1 25  ? 14.067  2.752  10.049 1.00 26.92  ? 25  PHE A HB2  1 
ATOM   523  H HB3  . PHE A 1 25  ? 14.982  1.458  9.939  1.00 26.92  ? 25  PHE A HB3  1 
ATOM   524  H HD1  . PHE A 1 25  ? 13.770  -0.272 11.855 1.00 35.66  ? 25  PHE A HD1  1 
ATOM   525  H HD2  . PHE A 1 25  ? 12.020  2.114  9.163  1.00 31.34  ? 25  PHE A HD2  1 
ATOM   526  H HE1  . PHE A 1 25  ? 11.866  -1.601 11.912 1.00 39.30  ? 25  PHE A HE1  1 
ATOM   527  H HE2  . PHE A 1 25  ? 10.126  0.799  9.214  1.00 35.83  ? 25  PHE A HE2  1 
ATOM   528  H HZ   . PHE A 1 25  ? 10.047  -1.064 10.591 1.00 37.08  ? 25  PHE A HZ   1 
ATOM   529  N N    . ALA A 1 26  ? 16.849  3.147  12.885 1.00 22.52  ? 26  ALA A N    1 
ATOM   530  C CA   . ALA A 1 26  ? 18.041  3.961  12.980 1.00 24.82  ? 26  ALA A CA   1 
ATOM   531  C C    . ALA A 1 26  ? 19.161  3.344  12.149 1.00 26.07  ? 26  ALA A C    1 
ATOM   532  O O    . ALA A 1 26  ? 20.107  4.023  11.785 1.00 27.84  ? 26  ALA A O    1 
ATOM   533  C CB   . ALA A 1 26  ? 18.462  4.066  14.430 1.00 27.59  ? 26  ALA A CB   1 
ATOM   534  H H    . ALA A 1 26  ? 16.635  2.763  13.624 1.00 26.91  ? 26  ALA A H    1 
ATOM   535  H HA   . ALA A 1 26  ? 17.855  4.861  12.640 1.00 29.66  ? 26  ALA A HA   1 
ATOM   536  H HB1  . ALA A 1 26  ? 19.254  4.607  14.487 1.00 32.99  ? 26  ALA A HB1  1 
ATOM   537  H HB2  . ALA A 1 26  ? 17.752  4.471  14.933 1.00 32.99  ? 26  ALA A HB2  1 
ATOM   538  H HB3  . ALA A 1 26  ? 18.643  3.186  14.767 1.00 32.99  ? 26  ALA A HB3  1 
ATOM   539  N N    . ASP A 1 27  ? 19.040  2.055  11.849 1.00 24.93  ? 27  ASP A N    1 
ATOM   540  C CA   . ASP A 1 27  ? 20.025  1.373  11.005 1.00 27.36  ? 27  ASP A CA   1 
ATOM   541  C C    . ASP A 1 27  ? 19.966  1.812  9.529  1.00 31.54  ? 27  ASP A C    1 
ATOM   542  O O    . ASP A 1 27  ? 20.974  1.788  8.832  1.00 40.48  ? 27  ASP A O    1 
ATOM   543  C CB   . ASP A 1 27  ? 19.912  -0.161 11.132 1.00 45.14  ? 27  ASP A CB   1 
ATOM   544  C CG   . ASP A 1 27  ? 18.566  -0.722 10.653 1.00 44.30  ? 27  ASP A CG   1 
ATOM   545  O OD1  . ASP A 1 27  ? 17.508  -0.071 10.798 1.00 28.92  ? 27  ASP A OD1  1 
ATOM   546  O OD2  . ASP A 1 27  ? 18.569  -1.859 10.144 1.00 58.75  ? 27  ASP A OD2  1 
ATOM   547  H H    . ASP A 1 27  ? 18.399  1.551  12.119 1.00 29.79  ? 27  ASP A H    1 
ATOM   548  H HA   . ASP A 1 27  ? 20.916  1.616  11.334 1.00 32.71  ? 27  ASP A HA   1 
ATOM   549  H HB2  . ASP A 1 27  ? 20.611  -0.572 10.599 1.00 54.05  ? 27  ASP A HB2  1 
ATOM   550  H HB3  . ASP A 1 27  ? 20.022  -0.407 12.064 1.00 54.05  ? 27  ASP A HB3  1 
ATOM   551  N N    A LYS A 1 28  ? 18.794  2.262  9.084  0.70 23.25  ? 28  LYS A N    1 
ATOM   552  N N    B LYS A 1 28  ? 18.781  2.182  9.058  0.30 25.60  ? 28  LYS A N    1 
ATOM   553  C CA   A LYS A 1 28  ? 18.586  2.606  7.685  0.70 25.05  ? 28  LYS A CA   1 
ATOM   554  C CA   B LYS A 1 28  ? 18.618  2.603  7.675  0.30 27.93  ? 28  LYS A CA   1 
ATOM   555  C C    A LYS A 1 28  ? 18.325  4.107  7.466  0.70 25.45  ? 28  LYS A C    1 
ATOM   556  C C    B LYS A 1 28  ? 18.490  4.113  7.598  0.30 26.66  ? 28  LYS A C    1 
ATOM   557  O O    A LYS A 1 28  ? 18.655  4.632  6.405  0.70 23.51  ? 28  LYS A O    1 
ATOM   558  O O    B LYS A 1 28  ? 18.978  4.742  6.659  0.30 27.20  ? 28  LYS A O    1 
ATOM   559  C CB   A LYS A 1 28  ? 17.461  1.745  7.098  0.70 32.27  ? 28  LYS A CB   1 
ATOM   560  C CB   B LYS A 1 28  ? 17.389  1.935  7.053  0.30 30.70  ? 28  LYS A CB   1 
ATOM   561  C CG   A LYS A 1 28  ? 17.902  0.290  6.884  0.70 36.59  ? 28  LYS A CG   1 
ATOM   562  C CG   B LYS A 1 28  ? 17.683  0.560  6.471  0.30 44.59  ? 28  LYS A CG   1 
ATOM   563  C CD   A LYS A 1 28  ? 16.753  -0.654 6.640  0.70 58.89  ? 28  LYS A CD   1 
ATOM   564  C CD   B LYS A 1 28  ? 16.493  -0.369 6.573  0.30 58.76  ? 28  LYS A CD   1 
ATOM   565  C CE   A LYS A 1 28  ? 17.243  -2.096 6.610  0.70 58.46  ? 28  LYS A CE   1 
ATOM   566  C CE   B LYS A 1 28  ? 16.822  -1.741 6.006  0.30 67.18  ? 28  LYS A CE   1 
ATOM   567  N NZ   A LYS A 1 28  ? 16.118  -3.071 6.633  0.70 92.94  ? 28  LYS A NZ   1 
ATOM   568  N NZ   B LYS A 1 28  ? 15.707  -2.710 6.198  0.30 94.65  ? 28  LYS A NZ   1 
ATOM   569  H H    A LYS A 1 28  ? 18.100  2.376  9.578  0.70 27.78  ? 28  LYS A H    1 
ATOM   570  H H    B LYS A 1 28  ? 18.056  2.197  9.520  0.30 30.60  ? 28  LYS A H    1 
ATOM   571  H HA   A LYS A 1 28  ? 19.404  2.384  7.194  0.70 29.94  ? 28  LYS A HA   1 
ATOM   572  H HA   B LYS A 1 28  ? 19.407  2.334  7.160  0.30 33.40  ? 28  LYS A HA   1 
ATOM   573  H HB2  A LYS A 1 28  ? 16.707  1.746  7.708  0.70 38.60  ? 28  LYS A HB2  1 
ATOM   574  H HB2  B LYS A 1 28  ? 16.708  1.830  7.736  0.30 36.72  ? 28  LYS A HB2  1 
ATOM   575  H HB3  A LYS A 1 28  ? 17.196  2.109  6.239  0.70 38.60  ? 28  LYS A HB3  1 
ATOM   576  H HB3  B LYS A 1 28  ? 17.054  2.497  6.337  0.30 36.72  ? 28  LYS A HB3  1 
ATOM   577  H HG2  A LYS A 1 28  ? 18.490  0.250  6.113  0.70 43.79  ? 28  LYS A HG2  1 
ATOM   578  H HG2  B LYS A 1 28  ? 17.913  0.655  5.533  0.30 53.40  ? 28  LYS A HG2  1 
ATOM   579  H HG3  A LYS A 1 28  ? 18.374  -0.013 7.675  0.70 43.79  ? 28  LYS A HG3  1 
ATOM   580  H HG3  B LYS A 1 28  ? 18.421  0.160  6.957  0.30 53.40  ? 28  LYS A HG3  1 
ATOM   581  H HD2  A LYS A 1 28  ? 16.104  -0.565 7.355  0.70 70.55  ? 28  LYS A HD2  1 
ATOM   582  H HD2  B LYS A 1 28  ? 16.247  -0.475 7.506  0.30 70.40  ? 28  LYS A HD2  1 
ATOM   583  H HD3  A LYS A 1 28  ? 16.344  -0.450 5.784  0.70 70.55  ? 28  LYS A HD3  1 
ATOM   584  H HD3  B LYS A 1 28  ? 15.752  0.001  6.068  0.30 70.40  ? 28  LYS A HD3  1 
ATOM   585  H HE2  A LYS A 1 28  ? 17.753  -2.242 5.798  0.70 70.03  ? 28  LYS A HE2  1 
ATOM   586  H HE2  B LYS A 1 28  ? 16.991  -1.660 5.055  0.30 80.49  ? 28  LYS A HE2  1 
ATOM   587  H HE3  A LYS A 1 28  ? 17.800  -2.259 7.388  0.70 70.03  ? 28  LYS A HE3  1 
ATOM   588  H HE3  B LYS A 1 28  ? 17.607  -2.091 6.456  0.30 80.49  ? 28  LYS A HE3  1 
ATOM   589  H HZ1  A LYS A 1 28  ? 16.460  -3.968 6.613  0.70 111.41 ? 28  LYS A HZ1  1 
ATOM   590  H HZ1  B LYS A 1 28  ? 15.947  -3.563 5.830  0.30 113.46 ? 28  LYS A HZ1  1 
ATOM   591  H HZ2  A LYS A 1 28  ? 15.598  -2.953 7.431  0.70 111.41 ? 28  LYS A HZ2  1 
ATOM   592  H HZ2  B LYS A 1 28  ? 15.521  -2.815 7.134  0.30 113.46 ? 28  LYS A HZ2  1 
ATOM   593  H HZ3  A LYS A 1 28  ? 15.552  -2.936 5.869  0.70 111.41 ? 28  LYS A HZ3  1 
ATOM   594  H HZ3  B LYS A 1 28  ? 14.916  -2.391 5.757  0.30 113.46 ? 28  LYS A HZ3  1 
ATOM   595  N N    A VAL A 1 29  ? 17.746  4.795  8.453  0.70 20.91  ? 29  VAL A N    1 
ATOM   596  N N    B VAL A 1 29  ? 17.841  4.693  8.602  0.30 20.36  ? 29  VAL A N    1 
ATOM   597  C CA   A VAL A 1 29  ? 17.529  6.254  8.359  0.70 18.66  ? 29  VAL A CA   1 
ATOM   598  C CA   B VAL A 1 29  ? 17.494  6.106  8.565  0.30 18.07  ? 29  VAL A CA   1 
ATOM   599  C C    A VAL A 1 29  ? 17.880  6.907  9.701  0.70 21.54  ? 29  VAL A C    1 
ATOM   600  C C    B VAL A 1 29  ? 17.867  6.778  9.897  0.30 21.28  ? 29  VAL A C    1 
ATOM   601  O O    A VAL A 1 29  ? 17.011  7.403  10.412 0.70 19.87  ? 29  VAL A O    1 
ATOM   602  O O    B VAL A 1 29  ? 17.007  7.154  10.703 0.30 17.78  ? 29  VAL A O    1 
ATOM   603  C CB   A VAL A 1 29  ? 16.059  6.672  7.946  0.70 20.00  ? 29  VAL A CB   1 
ATOM   604  C CB   B VAL A 1 29  ? 16.001  6.299  8.174  0.30 23.24  ? 29  VAL A CB   1 
ATOM   605  C CG1  A VAL A 1 29  ? 15.876  6.640  6.435  0.70 19.65  ? 29  VAL A CG1  1 
ATOM   606  C CG1  B VAL A 1 29  ? 15.078  5.564  9.129  0.30 30.55  ? 29  VAL A CG1  1 
ATOM   607  C CG2  A VAL A 1 29  ? 15.051  5.791  8.596  0.70 22.65  ? 29  VAL A CG2  1 
ATOM   608  C CG2  B VAL A 1 29  ? 15.658  7.759  8.109  0.30 32.02  ? 29  VAL A CG2  1 
ATOM   609  H HA   A VAL A 1 29  ? 18.140  6.617  7.684  0.70 22.28  ? 29  VAL A HA   1 
ATOM   610  H HA   B VAL A 1 29  ? 18.032  6.534  7.867  0.30 21.56  ? 29  VAL A HA   1 
ATOM   611  H HB   A VAL A 1 29  ? 15.894  7.590  8.249  0.70 23.89  ? 29  VAL A HB   1 
ATOM   612  H HB   B VAL A 1 29  ? 15.862  5.923  7.280  0.30 27.76  ? 29  VAL A HB   1 
ATOM   613  H HG11 A VAL A 1 29  ? 14.976  6.899  6.224  0.70 23.46  ? 29  VAL A HG11 1 
ATOM   614  H HG11 B VAL A 1 29  ? 14.169  5.707  8.856  0.30 36.54  ? 29  VAL A HG11 1 
ATOM   615  H HG12 A VAL A 1 29  ? 16.496  7.253  6.033  0.70 23.46  ? 29  VAL A HG12 1 
ATOM   616  H HG12 B VAL A 1 29  ? 15.285  4.627  9.104  0.30 36.54  ? 29  VAL A HG12 1 
ATOM   617  H HG13 A VAL A 1 29  ? 16.045  5.750  6.120  0.70 23.46  ? 29  VAL A HG13 1 
ATOM   618  H HG13 B VAL A 1 29  ? 15.211  5.905  10.017 0.30 36.54  ? 29  VAL A HG13 1 
ATOM   619  H HG21 A VAL A 1 29  ? 14.173  6.069  8.327  0.70 27.06  ? 29  VAL A HG21 1 
ATOM   620  H HG21 B VAL A 1 29  ? 14.733  7.851  7.866  0.30 38.31  ? 29  VAL A HG21 1 
ATOM   621  H HG22 A VAL A 1 29  ? 15.207  4.884  8.322  0.70 27.06  ? 29  VAL A HG22 1 
ATOM   622  H HG22 B VAL A 1 29  ? 15.812  8.155  8.970  0.30 38.31  ? 29  VAL A HG22 1 
ATOM   623  H HG23 A VAL A 1 29  ? 15.141  5.864  9.549  0.70 27.06  ? 29  VAL A HG23 1 
ATOM   624  H HG23 B VAL A 1 29  ? 16.213  8.181  7.449  0.30 38.31  ? 29  VAL A HG23 1 
ATOM   625  N N    A PRO A 1 30  ? 19.167  6.908  10.058 0.70 18.74  ? 30  PRO A N    1 
ATOM   626  N N    B PRO A 1 30  ? 19.178  6.938  10.120 0.30 20.70  ? 30  PRO A N    1 
ATOM   627  C CA   A PRO A 1 30  ? 19.567  7.335  11.409 0.70 19.32  ? 30  PRO A CA   1 
ATOM   628  C CA   B PRO A 1 30  ? 19.735  7.389  11.400 0.30 26.35  ? 30  PRO A CA   1 
ATOM   629  C C    A PRO A 1 30  ? 19.209  8.788  11.752 0.70 18.41  ? 30  PRO A C    1 
ATOM   630  C C    B PRO A 1 30  ? 19.317  8.800  11.776 0.30 24.75  ? 30  PRO A C    1 
ATOM   631  O O    A PRO A 1 30  ? 18.816  9.054  12.882 0.70 20.31  ? 30  PRO A O    1 
ATOM   632  O O    B PRO A 1 30  ? 18.965  9.042  12.928 0.30 20.60  ? 30  PRO A O    1 
ATOM   633  C CB   A PRO A 1 30  ? 21.100  7.152  11.409 0.70 23.13  ? 30  PRO A CB   1 
ATOM   634  C CB   B PRO A 1 30  ? 21.248  7.343  11.165 0.30 27.32  ? 30  PRO A CB   1 
ATOM   635  C CG   A PRO A 1 30  ? 21.490  6.946  9.964  0.70 27.86  ? 30  PRO A CG   1 
ATOM   636  C CG   B PRO A 1 30  ? 21.423  7.391  9.685  0.30 24.07  ? 30  PRO A CG   1 
ATOM   637  C CD   A PRO A 1 30  ? 20.293  6.373  9.278  0.70 22.02  ? 30  PRO A CD   1 
ATOM   638  C CD   B PRO A 1 30  ? 20.223  6.703  9.108  0.30 22.51  ? 30  PRO A CD   1 
ATOM   639  H HA   A PRO A 1 30  ? 19.173  6.740  12.080 0.70 23.07  ? 30  PRO A HA   1 
ATOM   640  H HA   B PRO A 1 30  ? 19.494  6.769  12.120 0.30 31.50  ? 30  PRO A HA   1 
ATOM   641  H HB2  A PRO A 1 30  ? 21.522  7.949  11.766 0.70 27.64  ? 30  PRO A HB2  1 
ATOM   642  H HB2  B PRO A 1 30  ? 21.666  8.112  11.583 0.30 32.67  ? 30  PRO A HB2  1 
ATOM   643  H HB3  A PRO A 1 30  ? 21.334  6.375  11.940 0.70 27.64  ? 30  PRO A HB3  1 
ATOM   644  H HB3  B PRO A 1 30  ? 21.610  6.519  11.525 0.30 32.67  ? 30  PRO A HB3  1 
ATOM   645  H HG2  A PRO A 1 30  ? 21.731  7.799  9.570  0.70 33.32  ? 30  PRO A HG2  1 
ATOM   646  H HG2  B PRO A 1 30  ? 21.460  8.315  9.392  0.30 28.77  ? 30  PRO A HG2  1 
ATOM   647  H HG3  A PRO A 1 30  ? 22.236  6.328  9.917  0.70 33.32  ? 30  PRO A HG3  1 
ATOM   648  H HG3  B PRO A 1 30  ? 22.236  6.922  9.439  0.30 28.77  ? 30  PRO A HG3  1 
ATOM   649  H HD2  A PRO A 1 30  ? 20.247  6.684  8.361  0.70 26.31  ? 30  PRO A HD2  1 
ATOM   650  H HD2  B PRO A 1 30  ? 19.973  7.110  8.264  0.30 26.89  ? 30  PRO A HD2  1 
ATOM   651  H HD3  A PRO A 1 30  ? 20.307  5.404  9.326  0.70 26.31  ? 30  PRO A HD3  1 
ATOM   652  H HD3  B PRO A 1 30  ? 20.392  5.753  9.010  0.30 26.89  ? 30  PRO A HD3  1 
ATOM   653  N N    . LYS A 1 31  ? 19.374  9.723  10.824 1.00 19.86  ? 31  LYS A N    1 
ATOM   654  C CA   . LYS A 1 31  ? 19.055  11.126 11.122 1.00 20.67  ? 31  LYS A CA   1 
ATOM   655  C C    . LYS A 1 31  ? 17.542  11.332 11.422 1.00 17.28  ? 31  LYS A C    1 
ATOM   656  O O    . LYS A 1 31  ? 17.156  12.055 12.365 1.00 19.98  ? 31  LYS A O    1 
ATOM   657  C CB   . LYS A 1 31  ? 19.531  12.021 9.983  1.00 22.48  ? 31  LYS A CB   1 
ATOM   658  C CG   . LYS A 1 31  ? 19.359  13.490 10.252 1.00 22.91  ? 31  LYS A CG   1 
ATOM   659  C CD   . LYS A 1 31  ? 20.093  14.317 9.210  1.00 25.76  ? 31  LYS A CD   1 
ATOM   660  C CE   . LYS A 1 31  ? 19.946  15.799 9.495  1.00 28.48  ? 31  LYS A CE   1 
ATOM   661  N NZ   . LYS A 1 31  ? 20.824  16.590 8.591  1.00 28.46  ? 31  LYS A NZ   1 
ATOM   662  H H    A LYS A 1 31  ? 19.663  9.581  10.027 0.50 23.71  ? 31  LYS A H    1 
ATOM   663  H H    B LYS A 1 31  ? 19.591  9.572  10.006 0.50 23.71  ? 31  LYS A H    1 
ATOM   664  H HA   . LYS A 1 31  ? 19.549  11.390 11.927 1.00 24.69  ? 31  LYS A HA   1 
ATOM   665  H HB2  . LYS A 1 31  ? 20.475  11.856 9.830  1.00 26.86  ? 31  LYS A HB2  1 
ATOM   666  H HB3  . LYS A 1 31  ? 19.026  11.805 9.184  1.00 26.86  ? 31  LYS A HB3  1 
ATOM   667  H HG2  . LYS A 1 31  ? 18.417  13.716 10.216 1.00 27.38  ? 31  LYS A HG2  1 
ATOM   668  H HG3  . LYS A 1 31  ? 19.725  13.703 11.126 1.00 27.38  ? 31  LYS A HG3  1 
ATOM   669  H HD2  . LYS A 1 31  ? 21.037  14.094 9.228  1.00 30.79  ? 31  LYS A HD2  1 
ATOM   670  H HD3  . LYS A 1 31  ? 19.720  14.136 8.334  1.00 30.79  ? 31  LYS A HD3  1 
ATOM   671  H HE2  . LYS A 1 31  ? 19.027  16.068 9.345  1.00 34.06  ? 31  LYS A HE2  1 
ATOM   672  H HE3  . LYS A 1 31  ? 20.207  15.979 10.412 1.00 34.06  ? 31  LYS A HE3  1 
ATOM   673  H HZ1  . LYS A 1 31  ? 20.726  17.527 8.776  1.00 34.04  ? 31  LYS A HZ1  1 
ATOM   674  H HZ2  . LYS A 1 31  ? 21.741  16.340 8.723  1.00 34.04  ? 31  LYS A HZ2  1 
ATOM   675  H HZ3  . LYS A 1 31  ? 20.584  16.426 7.676  1.00 34.04  ? 31  LYS A HZ3  1 
ATOM   676  N N    . THR A 1 32  ? 16.688  10.696 10.620 1.00 15.79  ? 32  THR A N    1 
ATOM   677  C CA   . THR A 1 32  ? 15.246  10.838 10.758 1.00 15.24  ? 32  THR A CA   1 
ATOM   678  C C    . THR A 1 32  ? 14.772  10.103 12.030 1.00 15.14  ? 32  THR A C    1 
ATOM   679  O O    . THR A 1 32  ? 13.954  10.619 12.802 1.00 16.28  ? 32  THR A O    1 
ATOM   680  C CB   . THR A 1 32  ? 14.547  10.259 9.530  1.00 16.47  ? 32  THR A CB   1 
ATOM   681  O OG1  . THR A 1 32  ? 15.103  10.874 8.371  1.00 16.53  ? 32  THR A OG1  1 
ATOM   682  C CG2  . THR A 1 32  ? 13.039  10.525 9.568  1.00 17.84  ? 32  THR A CG2  1 
ATOM   683  H H    . THR A 1 32  ? 16.926  10.171 9.981  1.00 18.83  ? 32  THR A H    1 
ATOM   684  H HA   . THR A 1 32  ? 15.012  11.787 10.836 1.00 18.18  ? 32  THR A HA   1 
ATOM   685  H HB   . THR A 1 32  ? 14.693  9.301  9.493  1.00 19.64  ? 32  THR A HB   1 
ATOM   686  H HG1  . THR A 1 32  ? 15.907  10.722 8.331  1.00 19.72  ? 32  THR A HG1  1 
ATOM   687  H HG21 . THR A 1 32  ? 12.621  10.153 8.787  1.00 21.30  ? 32  THR A HG21 1 
ATOM   688  H HG22 . THR A 1 32  ? 12.654  10.122 10.350 1.00 21.30  ? 32  THR A HG22 1 
ATOM   689  H HG23 . THR A 1 32  ? 12.873  11.470 9.590  1.00 21.30  ? 32  THR A HG23 1 
ATOM   690  N N    . ALA A 1 33  ? 15.347  8.927  12.288 1.00 16.06  ? 33  ALA A N    1 
ATOM   691  C CA   . ALA A 1 33  ? 15.042  8.175  13.502 1.00 16.19  ? 33  ALA A CA   1 
ATOM   692  C C    . ALA A 1 33  ? 15.416  8.981  14.745 1.00 16.52  ? 33  ALA A C    1 
ATOM   693  O O    . ALA A 1 33  ? 14.648  9.039  15.704 1.00 17.60  ? 33  ALA A O    1 
ATOM   694  C CB   . ALA A 1 33  ? 15.771  6.818  13.502 1.00 19.58  ? 33  ALA A CB   1 
ATOM   695  H H    . ALA A 1 33  ? 15.918  8.544  11.772 1.00 19.15  ? 33  ALA A H    1 
ATOM   696  H HA   . ALA A 1 33  ? 14.078  8.000  13.534 1.00 19.31  ? 33  ALA A HA   1 
ATOM   697  H HB1  . ALA A 1 33  ? 15.553  6.346  14.309 1.00 23.38  ? 33  ALA A HB1  1 
ATOM   698  H HB2  . ALA A 1 33  ? 15.486  6.310  12.739 1.00 23.38  ? 33  ALA A HB2  1 
ATOM   699  H HB3  . ALA A 1 33  ? 16.717  6.972  13.458 1.00 23.38  ? 33  ALA A HB3  1 
ATOM   700  N N    . GLU A 1 34  ? 16.600  9.590  14.731 1.00 16.98  ? 34  GLU A N    1 
ATOM   701  C CA   . GLU A 1 34  ? 17.078  10.333 15.885 1.00 16.85  ? 34  GLU A CA   1 
ATOM   702  C C    . GLU A 1 34  ? 16.175  11.533 16.212 1.00 16.88  ? 34  GLU A C    1 
ATOM   703  O O    . GLU A 1 34  ? 15.943  11.831 17.368 1.00 18.92  ? 34  GLU A O    1 
ATOM   704  C CB   . GLU A 1 34  ? 18.524  10.788 15.671 1.00 20.19  ? 34  GLU A CB   1 
ATOM   705  C CG   . GLU A 1 34  ? 19.063  11.656 16.818 1.00 23.41  ? 34  GLU A CG   1 
ATOM   706  C CD   . GLU A 1 34  ? 19.162  10.957 18.177 1.00 23.94  ? 34  GLU A CD   1 
ATOM   707  O OE1  . GLU A 1 34  ? 18.952  9.720  18.300 1.00 25.03  ? 34  GLU A OE1  1 
ATOM   708  O OE2  . GLU A 1 34  ? 19.474  11.670 19.147 1.00 35.81  ? 34  GLU A OE2  1 
ATOM   709  H H    . GLU A 1 34  ? 17.142  9.586  14.063 1.00 20.25  ? 34  GLU A H    1 
ATOM   710  H HA   . GLU A 1 34  ? 17.069  9.738  16.663 1.00 20.11  ? 34  GLU A HA   1 
ATOM   711  H HB2  . GLU A 1 34  ? 19.092  10.005 15.598 1.00 24.12  ? 34  GLU A HB2  1 
ATOM   712  H HB3  . GLU A 1 34  ? 18.573  11.309 14.855 1.00 24.12  ? 34  GLU A HB3  1 
ATOM   713  H HG2  . GLU A 1 34  ? 19.954  11.960 16.581 1.00 27.98  ? 34  GLU A HG2  1 
ATOM   714  H HG3  . GLU A 1 34  ? 18.478  12.421 16.926 1.00 27.98  ? 34  GLU A HG3  1 
ATOM   715  N N    . ASN A 1 35  ? 15.694  12.241 15.182 1.00 16.62  ? 35  ASN A N    1 
ATOM   716  C CA   . ASN A 1 35  ? 14.751  13.343 15.391 1.00 16.57  ? 35  ASN A CA   1 
ATOM   717  C C    . ASN A 1 35  ? 13.506  12.885 16.174 1.00 16.61  ? 35  ASN A C    1 
ATOM   718  O O    . ASN A 1 35  ? 13.138  13.452 17.205 1.00 17.50  ? 35  ASN A O    1 
ATOM   719  C CB   . ASN A 1 35  ? 14.379  13.922 14.022 1.00 16.08  ? 35  ASN A CB   1 
ATOM   720  C CG   . ASN A 1 35  ? 13.438  15.101 14.105 1.00 14.20  ? 35  ASN A CG   1 
ATOM   721  O OD1  . ASN A 1 35  ? 13.745  16.119 14.719 1.00 18.73  ? 35  ASN A OD1  1 
ATOM   722  N ND2  . ASN A 1 35  ? 12.268  14.951 13.492 1.00 17.38  ? 35  ASN A ND2  1 
ATOM   723  H H    . ASN A 1 35  ? 15.898  12.103 14.358 1.00 19.83  ? 35  ASN A H    1 
ATOM   724  H HA   . ASN A 1 35  ? 15.193  14.048 15.909 1.00 19.77  ? 35  ASN A HA   1 
ATOM   725  H HB2  . ASN A 1 35  ? 15.188  14.218 13.576 1.00 19.18  ? 35  ASN A HB2  1 
ATOM   726  H HB3  . ASN A 1 35  ? 13.946  13.232 13.496 1.00 19.18  ? 35  ASN A HB3  1 
ATOM   727  H HD21 . ASN A 1 35  ? 11.610  15.677 13.507 1.00 20.73  ? 35  ASN A HD21 1 
ATOM   728  H HD22 . ASN A 1 35  ? 12.063  14.113 13.026 1.00 20.73  ? 35  ASN A HD22 1 
ATOM   729  N N    . PHE A 1 36  ? 12.876  11.822 15.701 1.00 16.06  ? 36  PHE A N    1 
ATOM   730  C CA   . PHE A 1 36  ? 11.694  11.311 16.365 1.00 14.63  ? 36  PHE A CA   1 
ATOM   731  C C    . PHE A 1 36  ? 12.012  10.809 17.778 1.00 15.77  ? 36  PHE A C    1 
ATOM   732  O O    . PHE A 1 36  ? 11.231  11.033 18.706 1.00 16.28  ? 36  PHE A O    1 
ATOM   733  C CB   . PHE A 1 36  ? 11.099  10.194 15.523 1.00 17.22  ? 36  PHE A CB   1 
ATOM   734  C CG   . PHE A 1 36  ? 9.702   9.777  15.931 1.00 13.07  ? 36  PHE A CG   1 
ATOM   735  C CD1  . PHE A 1 36  ? 8.609   10.380 15.351 1.00 16.55  ? 36  PHE A CD1  1 
ATOM   736  C CD2  . PHE A 1 36  ? 9.486   8.749  16.832 1.00 15.96  ? 36  PHE A CD2  1 
ATOM   737  C CE1  . PHE A 1 36  ? 7.337   9.987  15.677 1.00 17.55  ? 36  PHE A CE1  1 
ATOM   738  C CE2  . PHE A 1 36  ? 8.209   8.373  17.172 1.00 21.74  ? 36  PHE A CE2  1 
ATOM   739  C CZ   . PHE A 1 36  ? 7.136   8.978  16.584 1.00 21.70  ? 36  PHE A CZ   1 
ATOM   740  H H    . PHE A 1 36  ? 13.111  11.382 15.000 1.00 19.16  ? 36  PHE A H    1 
ATOM   741  H HA   . PHE A 1 36  ? 11.029  12.028 16.437 1.00 17.43  ? 36  PHE A HA   1 
ATOM   742  H HB2  . PHE A 1 36  ? 11.061  10.488 14.600 1.00 20.54  ? 36  PHE A HB2  1 
ATOM   743  H HB3  . PHE A 1 36  ? 11.672  9.414  15.594 1.00 20.54  ? 36  PHE A HB3  1 
ATOM   744  H HD1  . PHE A 1 36  ? 8.735   11.057 14.727 1.00 19.74  ? 36  PHE A HD1  1 
ATOM   745  H HD2  . PHE A 1 36  ? 10.212  8.326  17.231 1.00 19.04  ? 36  PHE A HD2  1 
ATOM   746  H HE1  . PHE A 1 36  ? 6.607   10.411 15.287 1.00 20.95  ? 36  PHE A HE1  1 
ATOM   747  H HE2  . PHE A 1 36  ? 8.075   7.687  17.785 1.00 25.98  ? 36  PHE A HE2  1 
ATOM   748  H HZ   . PHE A 1 36  ? 6.272   8.726  16.817 1.00 25.93  ? 36  PHE A HZ   1 
ATOM   749  N N    . ARG A 1 37  ? 13.129  10.113 17.944 1.00 16.12  ? 37  ARG A N    1 
ATOM   750  C CA   . ARG A 1 37  ? 13.536  9.592  19.252 1.00 16.77  ? 37  ARG A CA   1 
ATOM   751  C C    . ARG A 1 37  ? 13.692  10.746 20.236 1.00 18.52  ? 37  ARG A C    1 
ATOM   752  O O    . ARG A 1 37  ? 13.155  10.708 21.344 1.00 18.00  ? 37  ARG A O    1 
ATOM   753  C CB   . ARG A 1 37  ? 14.860  8.821  19.162 1.00 16.68  ? 37  ARG A CB   1 
ATOM   754  C CG   . ARG A 1 37  ? 15.183  8.069  20.450 1.00 18.71  ? 37  ARG A CG   1 
ATOM   755  C CD   . ARG A 1 37  ? 16.635  7.695  20.575 1.00 22.35  ? 37  ARG A CD   1 
ATOM   756  N NE   . ARG A 1 37  ? 17.424  8.918  20.608 1.00 22.73  ? 37  ARG A NE   1 
ATOM   757  C CZ   . ARG A 1 37  ? 17.584  9.681  21.683 1.00 27.71  ? 37  ARG A CZ   1 
ATOM   758  N NH1  . ARG A 1 37  ? 17.054  9.323  22.857 1.00 28.52  ? 37  ARG A NH1  1 
ATOM   759  N NH2  . ARG A 1 37  ? 18.283  10.797 21.575 1.00 26.68  ? 37  ARG A NH2  1 
ATOM   760  H H    . ARG A 1 37  ? 13.679  9.926  17.310 1.00 19.22  ? 37  ARG A H    1 
ATOM   761  H HA   . ARG A 1 37  ? 12.845  8.985  19.591 1.00 20.00  ? 37  ARG A HA   1 
ATOM   762  H HB2  . ARG A 1 37  ? 14.803  8.174  18.442 1.00 19.90  ? 37  ARG A HB2  1 
ATOM   763  H HB3  . ARG A 1 37  ? 15.581  9.447  18.990 1.00 19.90  ? 37  ARG A HB3  1 
ATOM   764  H HG2  . ARG A 1 37  ? 14.954  8.630  21.207 1.00 22.34  ? 37  ARG A HG2  1 
ATOM   765  H HG3  . ARG A 1 37  ? 14.662  7.251  20.475 1.00 22.34  ? 37  ARG A HG3  1 
ATOM   766  H HD2  . ARG A 1 37  ? 16.780  7.206  21.401 1.00 26.70  ? 37  ARG A HD2  1 
ATOM   767  H HD3  . ARG A 1 37  ? 16.907  7.166  19.809 1.00 26.70  ? 37  ARG A HD3  1 
ATOM   768  H HE   . ARG A 1 37  ? 17.864  9.194  19.789 1.00 27.16  ? 37  ARG A HE   1 
ATOM   769  H HH11 . ARG A 1 37  ? 16.589  8.602  22.917 1.00 34.10  ? 37  ARG A HH11 1 
ATOM   770  H HH12 . ARG A 1 37  ? 17.169  9.819  23.550 1.00 34.10  ? 37  ARG A HH12 1 
ATOM   771  H HH21 . ARG A 1 37  ? 18.632  11.014 20.820 1.00 31.90  ? 37  ARG A HH21 1 
ATOM   772  H HH22 . ARG A 1 37  ? 18.415  11.289 22.268 1.00 31.90  ? 37  ARG A HH22 1 
ATOM   773  N N    . ALA A 1 38  ? 14.427  11.783 19.840 1.00 16.71  ? 38  ALA A N    1 
ATOM   774  C CA   . ALA A 1 38  ? 14.693  12.896 20.750 1.00 17.36  ? 38  ALA A CA   1 
ATOM   775  C C    . ALA A 1 38  ? 13.431  13.709 21.059 1.00 16.17  ? 38  ALA A C    1 
ATOM   776  O O    . ALA A 1 38  ? 13.289  14.201 22.179 1.00 19.48  ? 38  ALA A O    1 
ATOM   777  C CB   . ALA A 1 38  ? 15.804  13.803 20.194 1.00 21.19  ? 38  ALA A CB   1 
ATOM   778  H H    . ALA A 1 38  ? 14.778  11.868 19.059 1.00 19.93  ? 38  ALA A H    1 
ATOM   779  H HA   . ALA A 1 38  ? 15.016  12.528 21.598 1.00 20.72  ? 38  ALA A HA   1 
ATOM   780  H HB1  . ALA A 1 38  ? 15.958  14.522 20.811 1.00 25.31  ? 38  ALA A HB1  1 
ATOM   781  H HB2  . ALA A 1 38  ? 16.606  13.285 20.089 1.00 25.31  ? 38  ALA A HB2  1 
ATOM   782  H HB3  . ALA A 1 38  ? 15.526  14.152 19.344 1.00 25.31  ? 38  ALA A HB3  1 
ATOM   783  N N    . LEU A 1 39  ? 12.544  13.870 20.068 1.00 17.58  ? 39  LEU A N    1 
ATOM   784  C CA   . LEU A 1 39  ? 11.263  14.558 20.291 1.00 16.17  ? 39  LEU A CA   1 
ATOM   785  C C    . LEU A 1 39  ? 10.384  13.753 21.241 1.00 14.58  ? 39  LEU A C    1 
ATOM   786  O O    . LEU A 1 39  ? 9.607   14.321 22.023 1.00 17.00  ? 39  LEU A O    1 
ATOM   787  C CB   . LEU A 1 39  ? 10.535  14.828 18.958 1.00 16.58  ? 39  LEU A CB   1 
ATOM   788  C CG   . LEU A 1 39  ? 11.263  15.824 18.066 1.00 17.88  ? 39  LEU A CG   1 
ATOM   789  C CD1  . LEU A 1 39  ? 10.549  15.943 16.718 1.00 18.52  ? 39  LEU A CD1  1 
ATOM   790  C CD2  . LEU A 1 39  ? 11.348  17.181 18.725 1.00 18.95  ? 39  LEU A CD2  1 
ATOM   791  H H    . LEU A 1 39  ? 12.658  13.592 19.262 1.00 20.98  ? 39  LEU A H    1 
ATOM   792  H HA   . LEU A 1 39  ? 11.442  15.424 20.713 1.00 19.29  ? 39  LEU A HA   1 
ATOM   793  H HB2  . LEU A 1 39  ? 10.454  13.994 18.470 1.00 19.78  ? 39  LEU A HB2  1 
ATOM   794  H HB3  . LEU A 1 39  ? 9.654   15.187 19.149 1.00 19.78  ? 39  LEU A HB3  1 
ATOM   795  H HG   . LEU A 1 39  ? 12.166  15.508 17.904 1.00 21.34  ? 39  LEU A HG   1 
ATOM   796  H HD11 . LEU A 1 39  ? 11.021  16.574 16.169 1.00 22.11  ? 39  LEU A HD11 1 
ATOM   797  H HD12 . LEU A 1 39  ? 10.539  15.082 16.293 1.00 22.11  ? 39  LEU A HD12 1 
ATOM   798  H HD13 . LEU A 1 39  ? 9.650   16.246 16.866 1.00 22.11  ? 39  LEU A HD13 1 
ATOM   799  H HD21 . LEU A 1 39  ? 11.811  17.784 18.139 1.00 22.62  ? 39  LEU A HD21 1 
ATOM   800  H HD22 . LEU A 1 39  ? 10.459  17.503 18.892 1.00 22.62  ? 39  LEU A HD22 1 
ATOM   801  H HD23 . LEU A 1 39  ? 11.826  17.096 19.553 1.00 22.62  ? 39  LEU A HD23 1 
ATOM   802  N N    . SER A 1 40  ? 10.551  12.441 21.246 1.00 16.12  ? 40  SER A N    1 
ATOM   803  C CA   . SER A 1 40  ? 9.765   11.582 22.138 1.00 16.62  ? 40  SER A CA   1 
ATOM   804  C C    . SER A 1 40  ? 10.250  11.613 23.588 1.00 17.19  ? 40  SER A C    1 
ATOM   805  O O    . SER A 1 40  ? 9.459   11.445 24.490 1.00 22.81  ? 40  SER A O    1 
ATOM   806  C CB   . SER A 1 40  ? 9.770   10.137 21.651 1.00 17.07  ? 40  SER A CB   1 
ATOM   807  O OG   . SER A 1 40  ? 9.140   10.025 20.386 1.00 19.00  ? 40  SER A OG   1 
ATOM   808  H H    . SER A 1 40  ? 11.108  12.018 20.746 1.00 19.23  ? 40  SER A H    1 
ATOM   809  H HA   . SER A 1 40  ? 8.836   11.894 22.131 1.00 19.83  ? 40  SER A HA   1 
ATOM   810  H HB2  . SER A 1 40  ? 10.687  9.833  21.574 1.00 20.37  ? 40  SER A HB2  1 
ATOM   811  H HB3  . SER A 1 40  ? 9.291   9.587  22.291 1.00 20.37  ? 40  SER A HB3  1 
ATOM   812  H HG   . SER A 1 40  ? 8.882   10.761 20.135 1.00 22.69  ? 40  SER A HG   1 
ATOM   813  N N    . THR A 1 41  ? 11.539  11.831 23.819 1.00 18.87  ? 41  THR A N    1 
ATOM   814  C CA   . THR A 1 41  ? 12.051  11.885 25.176 1.00 19.61  ? 41  THR A CA   1 
ATOM   815  C C    . THR A 1 41  ? 12.046  13.310 25.721 1.00 23.94  ? 41  THR A C    1 
ATOM   816  O O    . THR A 1 41  ? 12.119  13.512 26.938 1.00 30.55  ? 41  THR A O    1 
ATOM   817  C CB   . THR A 1 41  ? 13.514  11.389 25.238 1.00 24.53  ? 41  THR A CB   1 
ATOM   818  O OG1  . THR A 1 41  ? 14.338  12.280 24.488 1.00 22.08  ? 41  THR A OG1  1 
ATOM   819  C CG2  . THR A 1 41  ? 13.642  9.965  24.674 1.00 26.00  ? 41  THR A CG2  1 
ATOM   820  H H    . THR A 1 41  ? 12.134  11.949 23.209 1.00 22.53  ? 41  THR A H    1 
ATOM   821  H HA   . THR A 1 41  ? 11.502  11.322 25.761 1.00 23.41  ? 41  THR A HA   1 
ATOM   822  H HB   . THR A 1 41  ? 13.811  11.379 26.162 1.00 29.32  ? 41  THR A HB   1 
ATOM   823  H HG1  . THR A 1 41  ? 15.118  12.028 24.512 1.00 26.38  ? 41  THR A HG1  1 
ATOM   824  H HG21 . THR A 1 41  ? 14.556  9.675  24.720 1.00 31.08  ? 41  THR A HG21 1 
ATOM   825  H HG22 . THR A 1 41  ? 13.097  9.361  25.182 1.00 31.08  ? 41  THR A HG22 1 
ATOM   826  H HG23 . THR A 1 41  ? 13.356  9.949  23.757 1.00 31.08  ? 41  THR A HG23 1 
ATOM   827  N N    . GLY A 1 42  ? 12.020  14.284 24.803 1.00 22.28  ? 42  GLY A N    1 
ATOM   828  C CA   . GLY A 1 42  ? 12.022  15.696 25.145 1.00 23.25  ? 42  GLY A CA   1 
ATOM   829  C C    . GLY A 1 42  ? 13.366  16.187 25.619 1.00 22.88  ? 42  GLY A C    1 
ATOM   830  O O    . GLY A 1 42  ? 13.443  17.243 26.233 1.00 29.30  ? 42  GLY A O    1 
ATOM   831  H H    . GLY A 1 42  ? 12.001  14.140 23.956 1.00 26.62  ? 42  GLY A H    1 
ATOM   832  H HA2  . GLY A 1 42  ? 11.765  16.215 24.368 1.00 27.79  ? 42  GLY A HA2  1 
ATOM   833  H HA3  . GLY A 1 42  ? 11.374  15.857 25.848 1.00 27.79  ? 42  GLY A HA3  1 
ATOM   834  N N    . GLU A 1 43  ? 14.417  15.425 25.337 1.00 22.58  ? 43  GLU A N    1 
ATOM   835  C CA   . GLU A 1 43  ? 15.734  15.713 25.886 1.00 28.20  ? 43  GLU A CA   1 
ATOM   836  C C    . GLU A 1 43  ? 16.376  17.001 25.353 1.00 35.65  ? 43  GLU A C    1 
ATOM   837  O O    . GLU A 1 43  ? 17.272  17.533 25.995 1.00 35.41  ? 43  GLU A O    1 
ATOM   838  C CB   . GLU A 1 43  ? 16.666  14.515 25.693 1.00 29.84  ? 43  GLU A CB   1 
ATOM   839  C CG   . GLU A 1 43  ? 17.089  14.289 24.261 1.00 33.05  ? 43  GLU A CG   1 
ATOM   840  C CD   . GLU A 1 43  ? 17.713  12.930 24.078 1.00 46.25  ? 43  GLU A CD   1 
ATOM   841  O OE1  . GLU A 1 43  ? 17.057  11.916 24.410 1.00 31.93  ? 43  GLU A OE1  1 
ATOM   842  O OE2  . GLU A 1 43  ? 18.868  12.882 23.624 1.00 35.47  ? 43  GLU A OE2  1 
ATOM   843  H H    . GLU A 1 43  ? 14.393  14.733 24.828 1.00 26.98  ? 43  GLU A H    1 
ATOM   844  H HA   . GLU A 1 43  ? 15.629  15.833 26.853 1.00 33.72  ? 43  GLU A HA   1 
ATOM   845  H HB2  . GLU A 1 43  ? 17.469  14.656 26.220 1.00 35.69  ? 43  GLU A HB2  1 
ATOM   846  H HB3  . GLU A 1 43  ? 16.212  13.714 25.997 1.00 35.69  ? 43  GLU A HB3  1 
ATOM   847  H HG2  . GLU A 1 43  ? 16.311  14.347 23.685 1.00 39.54  ? 43  GLU A HG2  1 
ATOM   848  H HG3  . GLU A 1 43  ? 17.744  14.960 24.011 1.00 39.54  ? 43  GLU A HG3  1 
ATOM   849  N N    . LYS A 1 44  ? 15.912  17.508 24.208 1.00 31.49  ? 44  LYS A N    1 
ATOM   850  C CA   . LYS A 1 44  ? 16.380  18.801 23.693 1.00 37.78  ? 44  LYS A CA   1 
ATOM   851  C C    . LYS A 1 44  ? 15.611  19.999 24.249 1.00 35.21  ? 44  LYS A C    1 
ATOM   852  O O    . LYS A 1 44  ? 15.919  21.131 23.885 1.00 34.16  ? 44  LYS A O    1 
ATOM   853  C CB   . LYS A 1 44  ? 16.297  18.868 22.163 1.00 37.30  ? 44  LYS A CB   1 
ATOM   854  C CG   . LYS A 1 44  ? 17.077  17.811 21.401 1.00 40.07  ? 44  LYS A CG   1 
ATOM   855  C CD   . LYS A 1 44  ? 18.566  17.977 21.555 1.00 53.70  ? 44  LYS A CD   1 
ATOM   856  C CE   . LYS A 1 44  ? 19.304  16.765 21.029 1.00 64.99  ? 44  LYS A CE   1 
ATOM   857  N NZ   . LYS A 1 44  ? 20.731  16.727 21.478 1.00 71.29  ? 44  LYS A NZ   1 
ATOM   858  H H    . LYS A 1 44  ? 15.325  17.124 23.710 1.00 37.67  ? 44  LYS A H    1 
ATOM   859  H HA   . LYS A 1 44  ? 17.321  18.912 23.943 1.00 45.21  ? 44  LYS A HA   1 
ATOM   860  H HB2  . LYS A 1 44  ? 15.366  18.781 21.905 1.00 44.64  ? 44  LYS A HB2  1 
ATOM   861  H HB3  . LYS A 1 44  ? 16.629  19.733 21.878 1.00 44.64  ? 44  LYS A HB3  1 
ATOM   862  H HG2  . LYS A 1 44  ? 16.836  16.934 21.738 1.00 47.96  ? 44  LYS A HG2  1 
ATOM   863  H HG3  . LYS A 1 44  ? 16.863  17.876 20.458 1.00 47.96  ? 44  LYS A HG3  1 
ATOM   864  H HD2  . LYS A 1 44  ? 18.856  18.754 21.053 1.00 64.32  ? 44  LYS A HD2  1 
ATOM   865  H HD3  . LYS A 1 44  ? 18.782  18.082 22.495 1.00 64.32  ? 44  LYS A HD3  1 
ATOM   866  H HE2  . LYS A 1 44  ? 18.865  15.962 21.350 1.00 77.88  ? 44  LYS A HE2  1 
ATOM   867  H HE3  . LYS A 1 44  ? 19.295  16.785 20.059 1.00 77.88  ? 44  LYS A HE3  1 
ATOM   868  H HZ1  . LYS A 1 44  ? 21.165  15.946 21.126 1.00 85.44  ? 44  LYS A HZ1  1 
ATOM   869  H HZ2  . LYS A 1 44  ? 21.193  17.508 21.168 1.00 85.44  ? 44  LYS A HZ2  1 
ATOM   870  H HZ3  . LYS A 1 44  ? 20.772  16.700 22.437 1.00 85.44  ? 44  LYS A HZ3  1 
ATOM   871  N N    . GLY A 1 45  ? 14.603  19.764 25.089 1.00 27.17  ? 45  GLY A N    1 
ATOM   872  C CA   . GLY A 1 45  ? 13.864  20.858 25.718 1.00 40.92  ? 45  GLY A CA   1 
ATOM   873  C C    . GLY A 1 45  ? 12.488  21.116 25.113 1.00 38.78  ? 45  GLY A C    1 
ATOM   874  O O    . GLY A 1 45  ? 11.752  22.001 25.583 1.00 36.96  ? 45  GLY A O    1 
ATOM   875  H H    . GLY A 1 45  ? 14.326  18.980 25.310 1.00 32.49  ? 45  GLY A H    1 
ATOM   876  H HA2  . GLY A 1 45  ? 13.745  20.660 26.660 1.00 48.98  ? 45  GLY A HA2  1 
ATOM   877  H HA3  . GLY A 1 45  ? 14.383  21.674 25.645 1.00 48.98  ? 45  GLY A HA3  1 
ATOM   878  N N    . PHE A 1 46  ? 12.158  20.355 24.069 1.00 25.34  ? 46  PHE A N    1 
ATOM   879  C CA   . PHE A 1 46  ? 10.858  20.397 23.406 1.00 24.35  ? 46  PHE A CA   1 
ATOM   880  C C    . PHE A 1 46  ? 10.536  19.037 22.770 1.00 18.77  ? 46  PHE A C    1 
ATOM   881  O O    . PHE A 1 46  ? 11.413  18.174 22.632 1.00 21.32  ? 46  PHE A O    1 
ATOM   882  C CB   . PHE A 1 46  ? 10.833  21.516 22.348 1.00 26.78  ? 46  PHE A CB   1 
ATOM   883  C CG   . PHE A 1 46  ? 11.932  21.417 21.335 1.00 25.39  ? 46  PHE A CG   1 
ATOM   884  C CD1  . PHE A 1 46  ? 13.138  22.067 21.549 1.00 28.31  ? 46  PHE A CD1  1 
ATOM   885  C CD2  . PHE A 1 46  ? 11.772  20.675 20.178 1.00 22.65  ? 46  PHE A CD2  1 
ATOM   886  C CE1  . PHE A 1 46  ? 14.167  21.980 20.627 1.00 34.23  ? 46  PHE A CE1  1 
ATOM   887  C CE2  . PHE A 1 46  ? 12.790  20.588 19.242 1.00 29.38  ? 46  PHE A CE2  1 
ATOM   888  C CZ   . PHE A 1 46  ? 14.000  21.244 19.466 1.00 33.96  ? 46  PHE A CZ   1 
ATOM   889  H H    . PHE A 1 46  ? 12.696  19.784 23.714 1.00 30.29  ? 46  PHE A H    1 
ATOM   890  H HA   . PHE A 1 46  ? 10.166  20.593 24.071 1.00 29.10  ? 46  PHE A HA   1 
ATOM   891  H HB2  . PHE A 1 46  ? 9.989   21.478 21.873 1.00 32.02  ? 46  PHE A HB2  1 
ATOM   892  H HB3  . PHE A 1 46  ? 10.920  22.372 22.796 1.00 32.02  ? 46  PHE A HB3  1 
ATOM   893  H HD1  . PHE A 1 46  ? 13.260  22.564 22.325 1.00 33.86  ? 46  PHE A HD1  1 
ATOM   894  H HD2  . PHE A 1 46  ? 10.966  20.237 20.022 1.00 27.06  ? 46  PHE A HD2  1 
ATOM   895  H HE1  . PHE A 1 46  ? 14.969  22.424 20.783 1.00 40.96  ? 46  PHE A HE1  1 
ATOM   896  H HE2  . PHE A 1 46  ? 12.669  20.087 18.468 1.00 35.14  ? 46  PHE A HE2  1 
ATOM   897  H HZ   . PHE A 1 46  ? 14.688  21.186 18.844 1.00 40.63  ? 46  PHE A HZ   1 
ATOM   898  N N    . GLY A 1 47  ? 9.287   18.821 22.406 1.00 19.18  ? 47  GLY A N    1 
ATOM   899  C CA   . GLY A 1 47  ? 8.917   17.536 21.858 1.00 19.14  ? 47  GLY A CA   1 
ATOM   900  C C    . GLY A 1 47  ? 7.440   17.230 21.919 1.00 15.96  ? 47  GLY A C    1 
ATOM   901  O O    . GLY A 1 47  ? 6.581   18.123 22.029 1.00 19.10  ? 47  GLY A O    1 
ATOM   902  H H    . GLY A 1 47  ? 8.645   19.391 22.464 1.00 22.90  ? 47  GLY A H    1 
ATOM   903  H HA2  . GLY A 1 47  ? 9.194   17.496 20.930 1.00 22.84  ? 47  GLY A HA2  1 
ATOM   904  H HA3  . GLY A 1 47  ? 9.388   16.839 22.342 1.00 22.84  ? 47  GLY A HA3  1 
ATOM   905  N N    . TYR A 1 48  ? 7.135   15.941 21.803 1.00 15.17  ? 48  TYR A N    1 
ATOM   906  C CA   . TYR A 1 48  ? 5.766   15.492 21.580 1.00 13.87  ? 48  TYR A CA   1 
ATOM   907  C C    . TYR A 1 48  ? 4.853   15.415 22.789 1.00 13.67  ? 48  TYR A C    1 
ATOM   908  O O    . TYR A 1 48  ? 3.637   15.341 22.625 1.00 15.19  ? 48  TYR A O    1 
ATOM   909  C CB   . TYR A 1 48  ? 5.778   14.116 20.936 1.00 15.34  ? 48  TYR A CB   1 
ATOM   910  C CG   . TYR A 1 48  ? 6.379   14.045 19.542 1.00 13.51  ? 48  TYR A CG   1 
ATOM   911  C CD1  . TYR A 1 48  ? 6.066   14.979 18.562 1.00 14.41  ? 48  TYR A CD1  1 
ATOM   912  C CD2  . TYR A 1 48  ? 7.227   13.016 19.204 1.00 15.76  ? 48  TYR A CD2  1 
ATOM   913  C CE1  . TYR A 1 48  ? 6.594   14.882 17.291 1.00 14.56  ? 48  TYR A CE1  1 
ATOM   914  C CE2  . TYR A 1 48  ? 7.757   12.891 17.936 1.00 14.80  ? 48  TYR A CE2  1 
ATOM   915  C CZ   . TYR A 1 48  ? 7.436   13.844 16.975 1.00 14.02  ? 48  TYR A CZ   1 
ATOM   916  O OH   . TYR A 1 48  ? 7.961   13.731 15.697 1.00 14.98  ? 48  TYR A OH   1 
ATOM   917  H H    . TYR A 1 48  ? 7.709   15.302 21.850 1.00 18.08  ? 48  TYR A H    1 
ATOM   918  H HA   . TYR A 1 48  ? 5.346   16.107 20.943 1.00 16.53  ? 48  TYR A HA   1 
ATOM   919  H HB2  . TYR A 1 48  ? 6.288   13.517 21.503 1.00 18.29  ? 48  TYR A HB2  1 
ATOM   920  H HB3  . TYR A 1 48  ? 4.863   13.800 20.873 1.00 18.29  ? 48  TYR A HB3  1 
ATOM   921  H HD1  . TYR A 1 48  ? 5.490   15.680 18.766 1.00 17.17  ? 48  TYR A HD1  1 
ATOM   922  H HD2  . TYR A 1 48  ? 7.433   12.373 19.843 1.00 18.80  ? 48  TYR A HD2  1 
ATOM   923  H HE1  . TYR A 1 48  ? 6.374   15.516 16.647 1.00 17.35  ? 48  TYR A HE1  1 
ATOM   924  H HE2  . TYR A 1 48  ? 8.330   12.188 17.731 1.00 17.64  ? 48  TYR A HE2  1 
ATOM   925  H HH   . TYR A 1 48  ? 8.404   14.397 15.517 1.00 17.86  ? 48  TYR A HH   1 
ATOM   926  N N    . LYS A 1 49  ? 5.402   15.374 23.993 1.00 15.01  ? 49  LYS A N    1 
ATOM   927  C CA   . LYS A 1 49  ? 4.561   15.182 25.171 1.00 15.51  ? 49  LYS A CA   1 
ATOM   928  C C    . LYS A 1 49  ? 3.519   16.300 25.283 1.00 15.70  ? 49  LYS A C    1 
ATOM   929  O O    . LYS A 1 49  ? 3.842   17.487 25.263 1.00 18.95  ? 49  LYS A O    1 
ATOM   930  C CB   . LYS A 1 49  ? 5.391   15.096 26.440 1.00 19.51  ? 49  LYS A CB   1 
ATOM   931  C CG   . LYS A 1 49  ? 4.565   14.793 27.660 1.00 19.64  ? 49  LYS A CG   1 
ATOM   932  C CD   . LYS A 1 49  ? 5.433   14.580 28.887 1.00 28.71  ? 49  LYS A CD   1 
ATOM   933  C CE   . LYS A 1 49  ? 4.590   14.328 30.131 1.00 31.59  ? 49  LYS A CE   1 
ATOM   934  N NZ   . LYS A 1 49  ? 5.430   14.059 31.347 1.00 55.71  ? 49  LYS A NZ   1 
ATOM   935  H H    . LYS A 1 49  ? 6.243   15.453 24.158 1.00 17.89  ? 49  LYS A H    1 
ATOM   936  H HA   . LYS A 1 49  ? 4.078   14.335 25.075 1.00 18.49  ? 49  LYS A HA   1 
ATOM   937  H HB2  . LYS A 1 49  ? 6.048   14.390 26.340 1.00 23.29  ? 49  LYS A HB2  1 
ATOM   938  H HB3  . LYS A 1 49  ? 5.836   15.946 26.584 1.00 23.29  ? 49  LYS A HB3  1 
ATOM   939  H HG2  . LYS A 1 49  ? 3.969   15.537 27.836 1.00 23.45  ? 49  LYS A HG2  1 
ATOM   940  H HG3  . LYS A 1 49  ? 4.053   13.983 27.507 1.00 23.45  ? 49  LYS A HG3  1 
ATOM   941  H HD2  . LYS A 1 49  ? 6.004   13.808 28.745 1.00 34.34  ? 49  LYS A HD2  1 
ATOM   942  H HD3  . LYS A 1 49  ? 5.971   15.372 29.039 1.00 34.34  ? 49  LYS A HD3  1 
ATOM   943  H HE2  . LYS A 1 49  ? 4.045   15.111 30.308 1.00 37.79  ? 49  LYS A HE2  1 
ATOM   944  H HE3  . LYS A 1 49  ? 4.023   13.555 29.979 1.00 37.79  ? 49  LYS A HE3  1 
ATOM   945  H HZ1  . LYS A 1 49  ? 4.866   13.906 32.108 1.00 66.73  ? 49  LYS A HZ1  1 
ATOM   946  H HZ2  . LYS A 1 49  ? 5.977   13.283 31.202 1.00 66.73  ? 49  LYS A HZ2  1 
ATOM   947  H HZ3  . LYS A 1 49  ? 5.998   14.812 31.526 1.00 66.73  ? 49  LYS A HZ3  1 
ATOM   948  N N    . GLY A 1 50  ? 2.253   15.887 25.377 1.00 15.40  ? 50  GLY A N    1 
ATOM   949  C CA   . GLY A 1 50  ? 1.121   16.794 25.474 1.00 15.22  ? 50  GLY A CA   1 
ATOM   950  C C    . GLY A 1 50  ? 0.497   17.242 24.161 1.00 15.42  ? 50  GLY A C    1 
ATOM   951  O O    . GLY A 1 50  ? -0.529  17.931 24.169 1.00 21.09  ? 50  GLY A O    1 
ATOM   952  H H    . GLY A 1 50  ? 2.024   15.058 25.386 1.00 18.36  ? 50  GLY A H    1 
ATOM   953  H HA2  . GLY A 1 50  ? 0.426   16.366 25.998 1.00 18.14  ? 50  GLY A HA2  1 
ATOM   954  H HA3  . GLY A 1 50  ? 1.403   17.590 25.951 1.00 18.14  ? 50  GLY A HA3  1 
ATOM   955  N N    . SER A 1 51  ? 1.074   16.817 23.036 1.00 15.01  ? 51  SER A N    1 
ATOM   956  C CA   . SER A 1 51  ? 0.613   17.251 21.714 1.00 15.57  ? 51  SER A CA   1 
ATOM   957  C C    . SER A 1 51  ? -0.527  16.349 21.246 1.00 13.43  ? 51  SER A C    1 
ATOM   958  O O    . SER A 1 51  ? -0.780  15.307 21.843 1.00 16.15  ? 51  SER A O    1 
ATOM   959  C CB   . SER A 1 51  ? 1.792   17.274 20.720 1.00 16.52  ? 51  SER A CB   1 
ATOM   960  O OG   . SER A 1 51  ? 2.273   15.980 20.425 1.00 16.69  ? 51  SER A OG   1 
ATOM   961  H H    . SER A 1 51  ? 1.740   16.273 23.011 1.00 17.89  ? 51  SER A H    1 
ATOM   962  H HA   . SER A 1 51  ? 0.263   18.164 21.784 1.00 18.57  ? 51  SER A HA   1 
ATOM   963  H HB2  . SER A 1 51  ? 1.496   17.691 19.896 1.00 19.71  ? 51  SER A HB2  1 
ATOM   964  H HB3  . SER A 1 51  ? 2.515   17.793 21.107 1.00 19.71  ? 51  SER A HB3  1 
ATOM   965  H HG   . SER A 1 51  ? 1.839   15.419 20.837 1.00 19.91  ? 51  SER A HG   1 
ATOM   966  N N    . CYS A 1 52  ? -1.239  16.769 20.209 1.00 15.69  ? 52  CYS A N    1 
ATOM   967  C CA   . CYS A 1 52  ? -2.392  16.040 19.733 1.00 16.85  ? 52  CYS A CA   1 
ATOM   968  C C    . CYS A 1 52  ? -2.205  15.429 18.353 1.00 16.12  ? 52  CYS A C    1 
ATOM   969  O O    . CYS A 1 52  ? -1.287  15.779 17.598 1.00 17.07  ? 52  CYS A O    1 
ATOM   970  C CB   . CYS A 1 52  ? -3.627  16.940 19.719 1.00 18.88  ? 52  CYS A CB   1 
ATOM   971  S SG   . CYS A 1 52  ? -3.705  18.121 18.387 1.00 22.40  ? 52  CYS A SG   1 
ATOM   972  H H    . CYS A 1 52  ? -1.069  17.484 19.762 1.00 18.71  ? 52  CYS A H    1 
ATOM   973  H HA   . CYS A 1 52  ? -2.571  15.305 20.356 1.00 20.10  ? 52  CYS A HA   1 
ATOM   974  H HB2  . CYS A 1 52  ? -4.415  16.378 19.654 1.00 22.54  ? 52  CYS A HB2  1 
ATOM   975  H HB3  . CYS A 1 52  ? -3.653  17.438 20.551 1.00 22.54  ? 52  CYS A HB3  1 
ATOM   976  H HG   . CYS A 1 52  ? -3.698  17.464 17.220 1.00 26.77  ? 52  CYS A HG   1 
ATOM   977  N N    . PHE A 1 53  ? -3.065  14.473 18.047 1.00 15.25  ? 53  PHE A N    1 
ATOM   978  C CA   . PHE A 1 53  ? -3.238  14.007 16.685 1.00 14.68  ? 53  PHE A CA   1 
ATOM   979  C C    . PHE A 1 53  ? -4.342  14.851 16.080 1.00 14.59  ? 53  PHE A C    1 
ATOM   980  O O    . PHE A 1 53  ? -5.512  14.724 16.441 1.00 20.14  ? 53  PHE A O    1 
ATOM   981  C CB   . PHE A 1 53  ? -3.630  12.531 16.669 1.00 17.61  ? 53  PHE A CB   1 
ATOM   982  C CG   . PHE A 1 53  ? -2.467  11.613 16.894 1.00 15.94  ? 53  PHE A CG   1 
ATOM   983  C CD1  . PHE A 1 53  ? -2.018  11.333 18.173 1.00 18.94  ? 53  PHE A CD1  1 
ATOM   984  C CD2  . PHE A 1 53  ? -1.822  11.040 15.822 1.00 16.10  ? 53  PHE A CD2  1 
ATOM   985  C CE1  . PHE A 1 53  ? -0.917  10.505 18.370 1.00 19.02  ? 53  PHE A CE1  1 
ATOM   986  C CE2  . PHE A 1 53  ? -0.726  10.214 16.011 1.00 20.13  ? 53  PHE A CE2  1 
ATOM   987  C CZ   . PHE A 1 53  ? -0.293  9.936  17.287 1.00 18.84  ? 53  PHE A CZ   1 
ATOM   988  H H    . PHE A 1 53  ? -3.567  14.072 18.619 1.00 18.19  ? 53  PHE A H    1 
ATOM   989  H HA   . PHE A 1 53  ? -2.413  14.132 16.172 1.00 17.50  ? 53  PHE A HA   1 
ATOM   990  H HB2  . PHE A 1 53  ? -4.278  12.370 17.372 1.00 21.01  ? 53  PHE A HB2  1 
ATOM   991  H HB3  . PHE A 1 53  ? -4.017  12.317 15.806 1.00 21.01  ? 53  PHE A HB3  1 
ATOM   992  H HD1  . PHE A 1 53  ? -2.441  11.720 18.906 1.00 22.62  ? 53  PHE A HD1  1 
ATOM   993  H HD2  . PHE A 1 53  ? -2.112  11.227 14.958 1.00 19.20  ? 53  PHE A HD2  1 
ATOM   994  H HE1  . PHE A 1 53  ? -0.624  10.315 19.232 1.00 22.70  ? 53  PHE A HE1  1 
ATOM   995  H HE2  . PHE A 1 53  ? -0.301  9.827  15.279 1.00 24.03  ? 53  PHE A HE2  1 
ATOM   996  H HZ   . PHE A 1 53  ? 0.438   9.375  17.415 1.00 22.49  ? 53  PHE A HZ   1 
ATOM   997  N N    . HIS A 1 54  ? -3.965  15.735 15.172 1.00 13.97  ? 54  HIS A N    1 
ATOM   998  C CA   . HIS A 1 54  ? -4.916  16.700 14.653 1.00 16.66  ? 54  HIS A CA   1 
ATOM   999  C C    . HIS A 1 54  ? -5.715  16.247 13.426 1.00 16.47  ? 54  HIS A C    1 
ATOM   1000 O O    . HIS A 1 54  ? -6.718  16.885 13.065 1.00 20.28  ? 54  HIS A O    1 
ATOM   1001 C CB   . HIS A 1 54  ? -4.192  18.001 14.339 1.00 18.99  ? 54  HIS A CB   1 
ATOM   1002 C CG   . HIS A 1 54  ? -3.212  17.880 13.214 1.00 17.95  ? 54  HIS A CG   1 
ATOM   1003 N ND1  . HIS A 1 54  ? -1.922  17.440 13.400 1.00 18.87  ? 54  HIS A ND1  1 
ATOM   1004 C CD2  . HIS A 1 54  ? -3.337  18.143 11.888 1.00 19.60  ? 54  HIS A CD2  1 
ATOM   1005 C CE1  . HIS A 1 54  ? -1.290  17.441 12.238 1.00 22.32  ? 54  HIS A CE1  1 
ATOM   1006 N NE2  . HIS A 1 54  ? -2.128  17.867 11.305 1.00 22.26  ? 54  HIS A NE2  1 
ATOM   1007 H H    . HIS A 1 54  ? -3.172  15.798 14.843 1.00 16.65  ? 54  HIS A H    1 
ATOM   1008 H HA   . HIS A 1 54  ? -5.566  16.895 15.361 1.00 19.87  ? 54  HIS A HA   1 
ATOM   1009 H HB2  . HIS A 1 54  ? -4.847  18.673 14.093 1.00 22.67  ? 54  HIS A HB2  1 
ATOM   1010 H HB3  . HIS A 1 54  ? -3.706  18.287 15.128 1.00 22.67  ? 54  HIS A HB3  1 
ATOM   1011 H HD2  . HIS A 1 54  ? -4.098  18.460 11.457 1.00 23.40  ? 54  HIS A HD2  1 
ATOM   1012 H HE1  . HIS A 1 54  ? -0.407  17.185 12.100 1.00 26.66  ? 54  HIS A HE1  1 
ATOM   1013 N N    A ARG A 1 55  ? -5.259  15.170 12.783 0.63 15.47  ? 55  ARG A N    1 
ATOM   1014 N N    B ARG A 1 55  ? -5.296  15.159 12.784 0.37 18.09  ? 55  ARG A N    1 
ATOM   1015 C CA   A ARG A 1 55  ? -5.873  14.681 11.561 0.63 16.06  ? 55  ARG A CA   1 
ATOM   1016 C CA   B ARG A 1 55  ? -5.939  14.719 11.546 0.37 18.01  ? 55  ARG A CA   1 
ATOM   1017 C C    A ARG A 1 55  ? -5.918  13.148 11.589 0.63 19.81  ? 55  ARG A C    1 
ATOM   1018 C C    B ARG A 1 55  ? -5.942  13.190 11.454 0.37 15.50  ? 55  ARG A C    1 
ATOM   1019 O O    A ARG A 1 55  ? -4.893  12.488 11.667 0.63 16.58  ? 55  ARG A O    1 
ATOM   1020 O O    B ARG A 1 55  ? -4.902  12.571 11.302 0.37 19.08  ? 55  ARG A O    1 
ATOM   1021 C CB   A ARG A 1 55  ? -5.092  15.203 10.341 0.63 19.43  ? 55  ARG A CB   1 
ATOM   1022 C CB   B ARG A 1 55  ? -5.219  15.344 10.335 0.37 25.79  ? 55  ARG A CB   1 
ATOM   1023 C CG   A ARG A 1 55  ? -5.711  14.879 8.987  0.63 21.62  ? 55  ARG A CG   1 
ATOM   1024 C CG   B ARG A 1 55  ? -5.899  15.156 8.975  0.37 33.30  ? 55  ARG A CG   1 
ATOM   1025 C CD   A ARG A 1 55  ? -5.002  15.693 7.880  0.63 28.25  ? 55  ARG A CD   1 
ATOM   1026 C CD   B ARG A 1 55  ? -5.417  16.238 7.981  0.37 31.23  ? 55  ARG A CD   1 
ATOM   1027 N NE   A ARG A 1 55  ? -5.490  15.428 6.531  0.63 49.31  ? 55  ARG A NE   1 
ATOM   1028 N NE   B ARG A 1 55  ? -5.574  15.906 6.557  0.37 42.59  ? 55  ARG A NE   1 
ATOM   1029 C CZ   A ARG A 1 55  ? -4.912  14.589 5.676  0.63 68.64  ? 55  ARG A CZ   1 
ATOM   1030 C CZ   B ARG A 1 55  ? -6.739  15.717 5.938  0.37 46.28  ? 55  ARG A CZ   1 
ATOM   1031 N NH1  A ARG A 1 55  ? -3.824  13.907 6.022  0.63 91.77  ? 55  ARG A NH1  1 
ATOM   1032 N NH1  B ARG A 1 55  ? -7.869  15.792 6.619  0.37 71.88  ? 55  ARG A NH1  1 
ATOM   1033 N NH2  A ARG A 1 55  ? -5.421  14.426 4.469  0.63 81.97  ? 55  ARG A NH2  1 
ATOM   1034 N NH2  B ARG A 1 55  ? -6.779  15.437 4.634  0.37 24.89  ? 55  ARG A NH2  1 
ATOM   1035 H H    A ARG A 1 55  ? -4.585  14.703 13.042 0.63 18.44  ? 55  ARG A H    1 
ATOM   1036 H H    B ARG A 1 55  ? -4.644  14.660 13.041 0.37 21.59  ? 55  ARG A H    1 
ATOM   1037 H HA   A ARG A 1 55  ? -6.792  15.015 11.504 0.63 19.16  ? 55  ARG A HA   1 
ATOM   1038 H HA   B ARG A 1 55  ? -6.869  15.027 11.541 0.37 21.50  ? 55  ARG A HA   1 
ATOM   1039 H HB2  A ARG A 1 55  ? -5.027  16.169 10.408 0.63 23.20  ? 55  ARG A HB2  1 
ATOM   1040 H HB2  B ARG A 1 55  ? -5.139  16.299 10.488 0.37 30.82  ? 55  ARG A HB2  1 
ATOM   1041 H HB3  A ARG A 1 55  ? -4.203  14.816 10.355 0.63 23.20  ? 55  ARG A HB3  1 
ATOM   1042 H HB3  B ARG A 1 55  ? -4.334  14.953 10.272 0.37 30.82  ? 55  ARG A HB3  1 
ATOM   1043 H HG2  A ARG A 1 55  ? -5.601  13.935 8.796  0.63 25.83  ? 55  ARG A HG2  1 
ATOM   1044 H HG2  B ARG A 1 55  ? -5.671  14.284 8.617  0.37 39.84  ? 55  ARG A HG2  1 
ATOM   1045 H HG3  A ARG A 1 55  ? -6.651  15.119 8.993  0.63 25.83  ? 55  ARG A HG3  1 
ATOM   1046 H HG3  B ARG A 1 55  ? -6.860  15.240 9.079  0.37 39.84  ? 55  ARG A HG3  1 
ATOM   1047 H HD2  A ARG A 1 55  ? -5.130  16.638 8.060  0.63 33.78  ? 55  ARG A HD2  1 
ATOM   1048 H HD2  B ARG A 1 55  ? -5.918  17.052 8.146  0.37 37.36  ? 55  ARG A HD2  1 
ATOM   1049 H HD3  A ARG A 1 55  ? -4.056  15.482 7.898  0.63 33.78  ? 55  ARG A HD3  1 
ATOM   1050 H HD3  B ARG A 1 55  ? -4.474  16.400 8.139  0.37 37.36  ? 55  ARG A HD3  1 
ATOM   1051 H HE   A ARG A 1 55  ? -6.289  15.894 6.238  0.63 59.06  ? 55  ARG A HE   1 
ATOM   1052 H HE   B ARG A 1 55  ? -4.767  15.817 6.027  0.37 50.99  ? 55  ARG A HE   1 
ATOM   1053 H HH11 A ARG A 1 55  ? -3.483  14.010 6.804  0.63 110.01 ? 55  ARG A HH11 1 
ATOM   1054 H HH11 B ARG A 1 55  ? -7.853  15.976 7.459  0.37 86.13  ? 55  ARG A HH11 1 
ATOM   1055 H HH12 A ARG A 1 55  ? -3.460  13.366 5.461  0.63 110.01 ? 55  ARG A HH12 1 
ATOM   1056 H HH12 B ARG A 1 55  ? -8.620  15.666 6.220  0.37 86.13  ? 55  ARG A HH12 1 
ATOM   1057 H HH21 A ARG A 1 55  ? -6.126  14.860 4.238  0.63 98.25  ? 55  ARG A HH21 1 
ATOM   1058 H HH21 B ARG A 1 55  ? -6.049  15.379 4.184  0.37 29.75  ? 55  ARG A HH21 1 
ATOM   1059 H HH22 A ARG A 1 55  ? -5.052  13.879 3.917  0.63 98.25  ? 55  ARG A HH22 1 
ATOM   1060 H HH22 B ARG A 1 55  ? -7.535  15.305 4.246  0.37 29.75  ? 55  ARG A HH22 1 
ATOM   1061 N N    . ILE A 1 56  ? -7.121  12.588 11.568 1.00 14.63  ? 56  ILE A N    1 
ATOM   1062 C CA   . ILE A 1 56  ? -7.261  11.143 11.567 1.00 13.75  ? 56  ILE A CA   1 
ATOM   1063 C C    . ILE A 1 56  ? -8.309  10.799 10.535 1.00 13.78  ? 56  ILE A C    1 
ATOM   1064 O O    . ILE A 1 56  ? -9.483  11.209 10.642 1.00 16.02  ? 56  ILE A O    1 
ATOM   1065 C CB   . ILE A 1 56  ? -7.680  10.576 12.951 1.00 15.71  ? 56  ILE A CB   1 
ATOM   1066 C CG1  . ILE A 1 56  ? -6.588  10.877 14.010 1.00 18.22  ? 56  ILE A CG1  1 
ATOM   1067 C CG2  . ILE A 1 56  ? -7.921  9.075  12.852 1.00 18.58  ? 56  ILE A CG2  1 
ATOM   1068 C CD1  . ILE A 1 56  ? -6.873  10.303 15.396 1.00 21.54  ? 56  ILE A CD1  1 
ATOM   1069 H H    A ILE A 1 56  ? -7.865  13.020 11.555 0.60 17.44  ? 56  ILE A H    1 
ATOM   1070 H H    B ILE A 1 56  ? -7.868  13.007 11.648 0.40 17.44  ? 56  ILE A H    1 
ATOM   1071 H HA   . ILE A 1 56  ? -6.413  10.730 11.302 1.00 16.39  ? 56  ILE A HA   1 
ATOM   1072 H HB   . ILE A 1 56  ? -8.505  11.006 13.225 1.00 18.73  ? 56  ILE A HB   1 
ATOM   1073 H HG12 . ILE A 1 56  ? -5.747  10.503 13.704 1.00 21.75  ? 56  ILE A HG12 1 
ATOM   1074 H HG13 . ILE A 1 56  ? -6.502  11.839 14.103 1.00 21.75  ? 56  ILE A HG13 1 
ATOM   1075 H HG21 . ILE A 1 56  ? -8.178  8.742  13.715 1.00 22.17  ? 56  ILE A HG21 1 
ATOM   1076 H HG22 . ILE A 1 56  ? -8.622  8.913  12.216 1.00 22.17  ? 56  ILE A HG22 1 
ATOM   1077 H HG23 . ILE A 1 56  ? -7.111  8.647  12.564 1.00 22.17  ? 56  ILE A HG23 1 
ATOM   1078 H HD11 . ILE A 1 56  ? -6.151  10.535 15.984 1.00 25.74  ? 56  ILE A HD11 1 
ATOM   1079 H HD12 . ILE A 1 56  ? -7.695  10.673 15.724 1.00 25.74  ? 56  ILE A HD12 1 
ATOM   1080 H HD13 . ILE A 1 56  ? -6.947  9.348  15.329 1.00 25.74  ? 56  ILE A HD13 1 
ATOM   1081 N N    . ILE A 1 57  ? -7.884  10.048 9.521  1.00 13.97  ? 57  ILE A N    1 
ATOM   1082 C CA   . ILE A 1 57  ? -8.769  9.632  8.430  1.00 15.49  ? 57  ILE A CA   1 
ATOM   1083 C C    . ILE A 1 57  ? -8.820  8.128  8.436  1.00 16.37  ? 57  ILE A C    1 
ATOM   1084 O O    . ILE A 1 57  ? -7.855  7.465  8.116  1.00 16.27  ? 57  ILE A O    1 
ATOM   1085 C CB   . ILE A 1 57  ? -8.285  10.157 7.072  1.00 15.59  ? 57  ILE A CB   1 
ATOM   1086 C CG1  . ILE A 1 57  ? -8.208  11.684 7.114  1.00 18.70  ? 57  ILE A CG1  1 
ATOM   1087 C CG2  . ILE A 1 57  ? -9.226  9.691  5.977  1.00 19.25  ? 57  ILE A CG2  1 
ATOM   1088 C CD1  . ILE A 1 57  ? -7.565  12.309 5.952  1.00 24.56  ? 57  ILE A CD1  1 
ATOM   1089 H H    . ILE A 1 57  ? -7.077  9.763  9.439  1.00 16.65  ? 57  ILE A H    1 
ATOM   1090 H HA   . ILE A 1 57  ? -9.673  9.975  8.592  1.00 18.47  ? 57  ILE A HA   1 
ATOM   1091 H HB   . ILE A 1 57  ? -7.399  9.803  6.896  1.00 18.59  ? 57  ILE A HB   1 
ATOM   1092 H HG12 . ILE A 1 57  ? -9.110  12.036 7.173  1.00 22.32  ? 57  ILE A HG12 1 
ATOM   1093 H HG13 . ILE A 1 57  ? -7.705  11.945 7.902  1.00 22.32  ? 57  ILE A HG13 1 
ATOM   1094 H HG21 . ILE A 1 57  ? -8.913  10.025 5.133  1.00 22.99  ? 57  ILE A HG21 1 
ATOM   1095 H HG22 . ILE A 1 57  ? -9.240  8.732  5.965  1.00 22.99  ? 57  ILE A HG22 1 
ATOM   1096 H HG23 . ILE A 1 57  ? -10.106 10.030 6.157  1.00 22.99  ? 57  ILE A HG23 1 
ATOM   1097 H HD11 . ILE A 1 57  ? -7.565  13.262 6.071  1.00 29.35  ? 57  ILE A HD11 1 
ATOM   1098 H HD12 . ILE A 1 57  ? -6.663  11.988 5.884  1.00 29.35  ? 57  ILE A HD12 1 
ATOM   1099 H HD13 . ILE A 1 57  ? -8.057  12.078 5.161  1.00 29.35  ? 57  ILE A HD13 1 
ATOM   1100 N N    . PRO A 1 58  ? -9.961  7.569  8.839  1.00 16.47  ? 58  PRO A N    1 
ATOM   1101 C CA   . PRO A 1 58  ? -10.043 6.121  8.962  1.00 17.74  ? 58  PRO A CA   1 
ATOM   1102 C C    . PRO A 1 58  ? -9.827  5.449  7.621  1.00 18.05  ? 58  PRO A C    1 
ATOM   1103 O O    . PRO A 1 58  ? -10.321 5.914  6.574  1.00 20.41  ? 58  PRO A O    1 
ATOM   1104 C CB   . PRO A 1 58  ? -11.474 5.899  9.444  1.00 22.25  ? 58  PRO A CB   1 
ATOM   1105 C CG   . PRO A 1 58  ? -11.848 7.168  10.132 1.00 21.19  ? 58  PRO A CG   1 
ATOM   1106 C CD   . PRO A 1 58  ? -11.177 8.239  9.332  1.00 20.54  ? 58  PRO A CD   1 
ATOM   1107 H HA   . PRO A 1 58  ? -9.404  5.782  9.623  1.00 21.17  ? 58  PRO A HA   1 
ATOM   1108 H HB2  . PRO A 1 58  ? -12.054 5.736  8.684  1.00 26.58  ? 58  PRO A HB2  1 
ATOM   1109 H HB3  . PRO A 1 58  ? -11.499 5.152  10.063 1.00 26.58  ? 58  PRO A HB3  1 
ATOM   1110 H HG2  . PRO A 1 58  ? -12.812 7.278  10.116 1.00 25.31  ? 58  PRO A HG2  1 
ATOM   1111 H HG3  . PRO A 1 58  ? -11.516 7.158  11.043 1.00 25.31  ? 58  PRO A HG3  1 
ATOM   1112 H HD2  . PRO A 1 58  ? -11.739 8.511  8.590  1.00 24.53  ? 58  PRO A HD2  1 
ATOM   1113 H HD3  . PRO A 1 58  ? -10.945 8.991  9.899  1.00 24.53  ? 58  PRO A HD3  1 
ATOM   1114 N N    . GLY A 1 59  ? -9.075  4.359  7.658  1.00 19.11  ? 59  GLY A N    1 
ATOM   1115 C CA   . GLY A 1 59  ? -8.764  3.616  6.449  1.00 21.61  ? 59  GLY A CA   1 
ATOM   1116 C C    . GLY A 1 59  ? -7.624  4.281  5.674  1.00 22.21  ? 59  GLY A C    1 
ATOM   1117 O O    . GLY A 1 59  ? -7.371  3.942  4.514  1.00 24.68  ? 59  GLY A O    1 
ATOM   1118 H H    . GLY A 1 59  ? -8.732  4.028  8.374  1.00 22.82  ? 59  GLY A H    1 
ATOM   1119 H HA2  . GLY A 1 59  ? -8.498  2.712  6.680  1.00 25.82  ? 59  GLY A HA2  1 
ATOM   1120 H HA3  . GLY A 1 59  ? -9.547  3.575  5.879  1.00 25.82  ? 59  GLY A HA3  1 
ATOM   1121 N N    A PHE A 1 60  ? -6.979  5.248  6.307  0.63 15.88  ? 60  PHE A N    1 
ATOM   1122 N N    B PHE A 1 60  ? -6.883  5.182  6.308  0.37 21.90  ? 60  PHE A N    1 
ATOM   1123 C CA   A PHE A 1 60  ? -5.873  5.948  5.682  0.63 13.99  ? 60  PHE A CA   1 
ATOM   1124 C CA   B PHE A 1 60  ? -5.743  5.784  5.619  0.37 17.75  ? 60  PHE A CA   1 
ATOM   1125 C C    A PHE A 1 60  ? -4.697  6.130  6.677  0.63 12.13  ? 60  PHE A C    1 
ATOM   1126 C C    B PHE A 1 60  ? -4.534  6.015  6.528  0.37 17.94  ? 60  PHE A C    1 
ATOM   1127 O O    A PHE A 1 60  ? -3.679  5.385  6.647  0.63 10.21  ? 60  PHE A O    1 
ATOM   1128 O O    B PHE A 1 60  ? -3.416  5.597  6.208  0.37 21.38  ? 60  PHE A O    1 
ATOM   1129 C CB   A PHE A 1 60  ? -6.385  7.277  5.105  0.63 16.45  ? 60  PHE A CB   1 
ATOM   1130 C CB   B PHE A 1 60  ? -6.160  7.091  4.938  0.37 21.51  ? 60  PHE A CB   1 
ATOM   1131 C CG   A PHE A 1 60  ? -5.341  8.094  4.384  0.63 15.43  ? 60  PHE A CG   1 
ATOM   1132 C CG   B PHE A 1 60  ? -5.020  7.830  4.278  0.37 27.52  ? 60  PHE A CG   1 
ATOM   1133 C CD1  A PHE A 1 60  ? -4.124  7.542  4.027  0.63 17.26  ? 60  PHE A CD1  1 
ATOM   1134 C CD1  B PHE A 1 60  ? -3.891  7.157  3.829  0.37 25.48  ? 60  PHE A CD1  1 
ATOM   1135 C CD2  A PHE A 1 60  ? -5.584  9.429  4.072  0.63 15.07  ? 60  PHE A CD2  1 
ATOM   1136 C CD2  B PHE A 1 60  ? -5.081  9.204  4.111  0.37 28.86  ? 60  PHE A CD2  1 
ATOM   1137 C CE1  A PHE A 1 60  ? -3.172  8.297  3.373  0.63 16.16  ? 60  PHE A CE1  1 
ATOM   1138 C CE1  B PHE A 1 60  ? -2.847  7.845  3.230  0.37 33.31  ? 60  PHE A CE1  1 
ATOM   1139 C CE2  A PHE A 1 60  ? -4.635  10.188 3.409  0.63 16.54  ? 60  PHE A CE2  1 
ATOM   1140 C CE2  B PHE A 1 60  ? -4.042  9.896  3.517  0.37 26.08  ? 60  PHE A CE2  1 
ATOM   1141 C CZ   A PHE A 1 60  ? -3.418  9.619  3.071  0.63 16.02  ? 60  PHE A CZ   1 
ATOM   1142 C CZ   B PHE A 1 60  ? -2.929  9.219  3.068  0.37 34.58  ? 60  PHE A CZ   1 
ATOM   1143 H H    A PHE A 1 60  ? -7.163  5.518  7.103  0.63 18.94  ? 60  PHE A H    1 
ATOM   1144 H H    B PHE A 1 60  ? -7.011  5.456  7.113  0.37 26.17  ? 60  PHE A H    1 
ATOM   1145 H HA   A PHE A 1 60  ? -5.545  5.407  4.933  0.63 16.67  ? 60  PHE A HA   1 
ATOM   1146 H HA   B PHE A 1 60  ? -5.457  5.169  4.912  0.37 21.18  ? 60  PHE A HA   1 
ATOM   1147 H HB2  A PHE A 1 60  ? -7.097  7.087  4.473  0.63 19.62  ? 60  PHE A HB2  1 
ATOM   1148 H HB2  B PHE A 1 60  ? -6.818  6.890  4.253  0.37 25.70  ? 60  PHE A HB2  1 
ATOM   1149 H HB3  A PHE A 1 60  ? -6.731  7.818  5.832  0.63 19.62  ? 60  PHE A HB3  1 
ATOM   1150 H HB3  B PHE A 1 60  ? -6.549  7.680  5.604  0.37 25.70  ? 60  PHE A HB3  1 
ATOM   1151 H HD1  A PHE A 1 60  ? -3.945  6.653  4.233  0.63 20.60  ? 60  PHE A HD1  1 
ATOM   1152 H HD1  B PHE A 1 60  ? -3.834  6.234  3.934  0.37 30.45  ? 60  PHE A HD1  1 
ATOM   1153 H HD2  A PHE A 1 60  ? -6.398  9.813  4.304  0.63 17.96  ? 60  PHE A HD2  1 
ATOM   1154 H HD2  B PHE A 1 60  ? -5.829  9.668  4.409  0.37 34.51  ? 60  PHE A HD2  1 
ATOM   1155 H HE1  A PHE A 1 60  ? -2.358  7.913  3.141  0.63 19.28  ? 60  PHE A HE1  1 
ATOM   1156 H HE1  B PHE A 1 60  ? -2.097  7.384  2.930  0.37 39.85  ? 60  PHE A HE1  1 
ATOM   1157 H HE2  A PHE A 1 60  ? -4.807  11.079 3.208  0.63 19.73  ? 60  PHE A HE2  1 
ATOM   1158 H HE2  B PHE A 1 60  ? -4.100  10.818 3.409  0.37 31.18  ? 60  PHE A HE2  1 
ATOM   1159 H HZ   A PHE A 1 60  ? -2.776  10.122 2.624  0.63 19.11  ? 60  PHE A HZ   1 
ATOM   1160 H HZ   B PHE A 1 60  ? -2.230  9.684  2.667  0.37 41.38  ? 60  PHE A HZ   1 
ATOM   1161 N N    A MET A 1 61  ? -4.809  7.126  7.537  0.63 9.20   ? 61  MET A N    1 
ATOM   1162 N N    B MET A 1 61  ? -4.784  6.640  7.670  0.37 25.61  ? 61  MET A N    1 
ATOM   1163 C CA   A MET A 1 61  ? -3.724  7.453  8.465  0.63 12.04  ? 61  MET A CA   1 
ATOM   1164 C CA   B MET A 1 61  ? -3.759  7.142  8.590  0.37 17.37  ? 61  MET A CA   1 
ATOM   1165 C C    A MET A 1 61  ? -4.159  8.239  9.681  0.63 15.90  ? 61  MET A C    1 
ATOM   1166 C C    B MET A 1 61  ? -4.310  8.017  9.715  0.37 16.70  ? 61  MET A C    1 
ATOM   1167 O O    A MET A 1 61  ? -5.250  8.808  9.712  0.63 11.77  ? 61  MET A O    1 
ATOM   1168 O O    B MET A 1 61  ? -5.451  8.487  9.654  0.37 30.34  ? 61  MET A O    1 
ATOM   1169 C CB   A MET A 1 61  ? -2.648  8.250  7.726  0.63 17.01  ? 61  MET A CB   1 
ATOM   1170 C CB   B MET A 1 61  ? -2.657  7.899  7.827  0.37 17.49  ? 61  MET A CB   1 
ATOM   1171 C CG   A MET A 1 61  ? -3.183  9.531  7.093  0.63 24.17  ? 61  MET A CG   1 
ATOM   1172 C CG   B MET A 1 61  ? -3.103  9.166  7.101  0.37 18.89  ? 61  MET A CG   1 
ATOM   1173 S SD   A MET A 1 61  ? -1.912  10.770 6.883  0.63 50.37  ? 61  MET A SD   1 
ATOM   1174 S SD   B MET A 1 61  ? -3.508  10.581 8.146  0.37 38.32  ? 61  MET A SD   1 
ATOM   1175 C CE   A MET A 1 61  ? -1.086  10.200 5.378  0.63 76.40  ? 61  MET A CE   1 
ATOM   1176 C CE   B MET A 1 61  ? -2.007  10.972 8.903  0.37 48.46  ? 61  MET A CE   1 
ATOM   1177 H H    A MET A 1 61  ? -5.500  7.632  7.610  0.63 10.92  ? 61  MET A H    1 
ATOM   1178 H H    B MET A 1 61  ? -5.582  6.795  7.951  0.37 30.62  ? 61  MET A H    1 
ATOM   1179 H HA   A MET A 1 61  ? -3.314  6.616  8.768  0.63 14.33  ? 61  MET A HA   1 
ATOM   1180 H HA   B MET A 1 61  ? -3.329  6.365  9.004  0.37 20.72  ? 61  MET A HA   1 
ATOM   1181 H HB2  A MET A 1 61  ? -1.951  8.495  8.354  0.63 20.30  ? 61  MET A HB2  1 
ATOM   1182 H HB2  B MET A 1 61  ? -1.968  8.155  8.460  0.37 20.87  ? 61  MET A HB2  1 
ATOM   1183 H HB3  A MET A 1 61  ? -2.278  7.699  7.019  0.63 20.30  ? 61  MET A HB3  1 
ATOM   1184 H HB3  B MET A 1 61  ? -2.280  7.302  7.162  0.37 20.87  ? 61  MET A HB3  1 
ATOM   1185 H HG2  A MET A 1 61  ? -3.549  9.324  6.219  0.63 28.89  ? 61  MET A HG2  1 
ATOM   1186 H HG2  B MET A 1 61  ? -2.390  9.442  6.505  0.37 22.56  ? 61  MET A HG2  1 
ATOM   1187 H HG3  A MET A 1 61  ? -3.874  9.902  7.664  0.63 28.89  ? 61  MET A HG3  1 
ATOM   1188 H HG3  B MET A 1 61  ? -3.894  8.956  6.580  0.37 22.56  ? 61  MET A HG3  1 
ATOM   1189 H HE1  A MET A 1 61  ? -0.370  10.804 5.167  0.63 91.56  ? 61  MET A HE1  1 
ATOM   1190 H HE1  B MET A 1 61  ? -2.137  11.725 9.484  0.37 58.03  ? 61  MET A HE1  1 
ATOM   1191 H HE2  A MET A 1 61  ? -0.737  9.318  5.528  0.63 91.56  ? 61  MET A HE2  1 
ATOM   1192 H HE2  B MET A 1 61  ? -1.707  10.214 9.411  0.37 58.03  ? 61  MET A HE2  1 
ATOM   1193 H HE3  A MET A 1 61  ? -1.723  10.182 4.660  0.63 91.56  ? 61  MET A HE3  1 
ATOM   1194 H HE3  B MET A 1 61  ? -1.363  11.189 8.225  0.37 58.03  ? 61  MET A HE3  1 
ATOM   1195 N N    A CYS A 1 62  ? -3.240  8.252  10.664 0.63 10.48  ? 62  CYS A N    1 
ATOM   1196 N N    B CYS A 1 62  ? -3.406  8.311  10.657 0.37 18.92  ? 62  CYS A N    1 
ATOM   1197 C CA   A CYS A 1 62  ? -3.285  9.135  11.805 0.63 10.45  ? 62  CYS A CA   1 
ATOM   1198 C CA   B CYS A 1 62  ? -3.587  9.309  11.710 0.37 22.16  ? 62  CYS A CA   1 
ATOM   1199 C C    A CYS A 1 62  ? -2.093  10.046 11.700 0.63 9.03   ? 62  CYS A C    1 
ATOM   1200 C C    B CYS A 1 62  ? -2.315  10.181 11.903 0.37 24.33  ? 62  CYS A C    1 
ATOM   1201 O O    A CYS A 1 62  ? -0.974  9.592  11.552 0.63 13.32  ? 62  CYS A O    1 
ATOM   1202 O O    B CYS A 1 62  ? -1.243  9.681  12.245 0.37 16.86  ? 62  CYS A O    1 
ATOM   1203 C CB   A CYS A 1 62  ? -3.213  8.361  13.142 0.63 10.68  ? 62  CYS A CB   1 
ATOM   1204 C CB   B CYS A 1 62  ? -3.954  8.616  13.026 0.37 39.16  ? 62  CYS A CB   1 
ATOM   1205 S SG   A CYS A 1 62  ? -4.579  7.155  13.361 0.63 12.29  ? 62  CYS A SG   1 
ATOM   1206 S SG   B CYS A 1 62  ? -2.807  7.327  13.526 0.37 61.95  ? 62  CYS A SG   1 
ATOM   1207 H H    A CYS A 1 62  ? -2.558  7.728  10.675 0.63 12.46  ? 62  CYS A H    1 
ATOM   1208 H H    B CYS A 1 62  ? -2.641  7.922  10.703 0.37 22.59  ? 62  CYS A H    1 
ATOM   1209 H HA   A CYS A 1 62  ? -4.105  9.672  11.786 0.63 12.43  ? 62  CYS A HA   1 
ATOM   1210 H HA   B CYS A 1 62  ? -4.327  9.902  11.463 0.37 26.48  ? 62  CYS A HA   1 
ATOM   1211 H HB2  A CYS A 1 62  ? -2.376  7.873  13.178 0.63 12.70  ? 62  CYS A HB2  1 
ATOM   1212 H HB2  B CYS A 1 62  ? -3.977  9.281  13.732 0.37 46.88  ? 62  CYS A HB2  1 
ATOM   1213 H HB3  A CYS A 1 62  ? -3.257  8.996  13.875 0.63 12.70  ? 62  CYS A HB3  1 
ATOM   1214 H HB3  B CYS A 1 62  ? -4.830  8.210  12.930 0.37 46.88  ? 62  CYS A HB3  1 
ATOM   1215 H HG   A CYS A 1 62  ? -4.431  6.538  14.542 0.63 14.63  ? 62  CYS A HG   1 
ATOM   1216 H HG   B CYS A 1 62  ? -3.226  6.795  14.682 0.37 74.22  ? 62  CYS A HG   1 
ATOM   1217 N N    A GLN A 1 63  ? -2.321  11.343 11.841 0.63 13.65  ? 63  GLN A N    1 
ATOM   1218 N N    B GLN A 1 63  ? -2.458  11.491 11.694 0.37 13.09  ? 63  GLN A N    1 
ATOM   1219 C CA   A GLN A 1 63  ? -1.247  12.314 11.739 0.63 13.15  ? 63  GLN A CA   1 
ATOM   1220 C CA   B GLN A 1 63  ? -1.351  12.464 11.672 0.37 15.07  ? 63  GLN A CA   1 
ATOM   1221 C C    A GLN A 1 63  ? -1.152  13.177 12.987 0.63 16.07  ? 63  GLN A C    1 
ATOM   1222 C C    B GLN A 1 63  ? -1.171  13.185 13.004 0.37 9.11   ? 63  GLN A C    1 
ATOM   1223 O O    A GLN A 1 63  ? -2.154  13.687 13.505 0.63 14.98  ? 63  GLN A O    1 
ATOM   1224 O O    B GLN A 1 63  ? -2.155  13.631 13.606 0.37 14.70  ? 63  GLN A O    1 
ATOM   1225 C CB   A GLN A 1 63  ? -1.429  13.207 10.511 0.63 13.60  ? 63  GLN A CB   1 
ATOM   1226 C CB   B GLN A 1 63  ? -1.633  13.557 10.623 0.37 16.38  ? 63  GLN A CB   1 
ATOM   1227 C CG   A GLN A 1 63  ? -0.399  14.320 10.429 0.63 14.28  ? 63  GLN A CG   1 
ATOM   1228 C CG   B GLN A 1 63  ? -0.426  14.316 10.116 0.37 27.36  ? 63  GLN A CG   1 
ATOM   1229 C CD   A GLN A 1 63  ? -0.293  14.950 9.049  0.63 23.07  ? 63  GLN A CD   1 
ATOM   1230 C CD   B GLN A 1 63  ? -0.791  15.232 8.964  0.37 20.16  ? 63  GLN A CD   1 
ATOM   1231 O OE1  A GLN A 1 63  ? -0.866  14.459 8.073  0.63 24.59  ? 63  GLN A OE1  1 
ATOM   1232 O OE1  B GLN A 1 63  ? -1.647  14.903 8.137  0.37 21.59  ? 63  GLN A OE1  1 
ATOM   1233 N NE2  A GLN A 1 63  ? 0.469   16.033 8.959  0.63 20.13  ? 63  GLN A NE2  1 
ATOM   1234 N NE2  B GLN A 1 63  ? -0.132  16.377 8.889  0.37 22.39  ? 63  GLN A NE2  1 
ATOM   1235 H H    A GLN A 1 63  ? -3.093  11.687 11.998 0.63 16.26  ? 63  GLN A H    1 
ATOM   1236 H H    B GLN A 1 63  ? -3.223  11.860 11.557 0.37 15.59  ? 63  GLN A H    1 
ATOM   1237 H HA   A GLN A 1 63  ? -0.398  11.836 11.639 0.63 15.66  ? 63  GLN A HA   1 
ATOM   1238 H HA   B GLN A 1 63  ? -0.513  12.010 11.441 0.37 17.97  ? 63  GLN A HA   1 
ATOM   1239 H HB2  A GLN A 1 63  ? -1.347  12.664 9.711  0.63 16.20  ? 63  GLN A HB2  1 
ATOM   1240 H HB2  B GLN A 1 63  ? -2.057  13.141 9.856  0.37 19.54  ? 63  GLN A HB2  1 
ATOM   1241 H HB3  A GLN A 1 63  ? -2.309  13.615 10.546 0.63 16.20  ? 63  GLN A HB3  1 
ATOM   1242 H HB3  B GLN A 1 63  ? -2.239  14.206 11.014 0.37 19.54  ? 63  GLN A HB3  1 
ATOM   1243 H HG2  A GLN A 1 63  ? -0.642  15.019 11.057 0.63 17.02  ? 63  GLN A HG2  1 
ATOM   1244 H HG2  B GLN A 1 63  ? -0.064  14.859 10.834 0.37 32.72  ? 63  GLN A HG2  1 
ATOM   1245 H HG3  A GLN A 1 63  ? 0.471   13.959 10.659 0.63 17.02  ? 63  GLN A HG3  1 
ATOM   1246 H HG3  B GLN A 1 63  ? 0.241   13.684 9.803  0.37 32.72  ? 63  GLN A HG3  1 
ATOM   1247 H HE21 A GLN A 1 63  ? 0.564   16.431 8.202  0.63 24.04  ? 63  GLN A HE21 1 
ATOM   1248 H HE21 B GLN A 1 63  ? -0.303  16.930 8.253  0.37 26.75  ? 63  GLN A HE21 1 
ATOM   1249 H HE22 A GLN A 1 63  ? 0.867   16.338 9.658  0.63 24.04  ? 63  GLN A HE22 1 
ATOM   1250 H HE22 B GLN A 1 63  ? 0.467   16.568 9.475  0.37 26.75  ? 63  GLN A HE22 1 
ATOM   1251 N N    . GLY A 1 64  ? 0.082   13.371 13.423 1.00 11.97  ? 64  GLY A N    1 
ATOM   1252 C CA   . GLY A 1 64  ? 0.373   14.198 14.570 1.00 12.84  ? 64  GLY A CA   1 
ATOM   1253 C C    . GLY A 1 64  ? 1.732   14.847 14.474 1.00 11.19  ? 64  GLY A C    1 
ATOM   1254 O O    . GLY A 1 64  ? 2.311   14.998 13.379 1.00 14.24  ? 64  GLY A O    1 
ATOM   1255 H H    A GLY A 1 64  ? 0.781   13.025 13.060 0.67 14.24  ? 64  GLY A H    1 
ATOM   1256 H H    B GLY A 1 64  ? 0.776   13.024 13.053 0.33 14.24  ? 64  GLY A H    1 
ATOM   1257 H HA2  . GLY A 1 64  ? -0.297  14.895 14.645 1.00 15.29  ? 64  GLY A HA2  1 
ATOM   1258 H HA3  . GLY A 1 64  ? 0.347   13.657 15.375 1.00 15.29  ? 64  GLY A HA3  1 
ATOM   1259 N N    . GLY A 1 65  ? 2.186   15.340 15.625 1.00 12.40  ? 65  GLY A N    1 
ATOM   1260 C CA   . GLY A 1 65  ? 3.510   15.909 15.762 1.00 13.54  ? 65  GLY A CA   1 
ATOM   1261 C C    . GLY A 1 65  ? 3.613   17.412 15.669 1.00 12.46  ? 65  GLY A C    1 
ATOM   1262 O O    . GLY A 1 65  ? 4.713   17.944 15.742 1.00 14.13  ? 65  GLY A O    1 
ATOM   1263 H H    . GLY A 1 65  ? 1.729   15.354 16.354 1.00 14.77  ? 65  GLY A H    1 
ATOM   1264 H HA2  . GLY A 1 65  ? 3.873   15.644 16.622 1.00 16.13  ? 65  GLY A HA2  1 
ATOM   1265 H HA3  . GLY A 1 65  ? 4.080   15.534 15.073 1.00 16.13  ? 65  GLY A HA3  1 
ATOM   1266 N N    . ASP A 1 66  ? 2.498   18.107 15.491 1.00 12.43  ? 66  ASP A N    1 
ATOM   1267 C CA   . ASP A 1 66  ? 2.546   19.558 15.453 1.00 12.66  ? 66  ASP A CA   1 
ATOM   1268 C C    . ASP A 1 66  ? 2.398   20.086 16.875 1.00 13.31  ? 66  ASP A C    1 
ATOM   1269 O O    . ASP A 1 66  ? 1.292   20.408 17.347 1.00 14.34  ? 66  ASP A O    1 
ATOM   1270 C CB   . ASP A 1 66  ? 1.449   20.139 14.591 1.00 12.79  ? 66  ASP A CB   1 
ATOM   1271 C CG   . ASP A 1 66  ? 1.478   21.647 14.559 1.00 13.97  ? 66  ASP A CG   1 
ATOM   1272 O OD1  . ASP A 1 66  ? 2.346   22.250 15.253 1.00 14.42  ? 66  ASP A OD1  1 
ATOM   1273 O OD2  . ASP A 1 66  ? 0.657   22.213 13.794 1.00 16.25  ? 66  ASP A OD2  1 
ATOM   1274 H H    . ASP A 1 66  ? 1.714   17.769 15.391 1.00 14.80  ? 66  ASP A H    1 
ATOM   1275 H HA   . ASP A 1 66  ? 3.412   19.850 15.098 1.00 15.07  ? 66  ASP A HA   1 
ATOM   1276 H HB2  . ASP A 1 66  ? 1.556   19.817 13.682 1.00 15.23  ? 66  ASP A HB2  1 
ATOM   1277 H HB3  . ASP A 1 66  ? 0.589   19.862 14.943 1.00 15.23  ? 66  ASP A HB3  1 
ATOM   1278 N N    . PHE A 1 67  ? 3.515   20.158 17.580 1.00 13.40  ? 67  PHE A N    1 
ATOM   1279 C CA   . PHE A 1 67  ? 3.475   20.540 18.976 1.00 14.84  ? 67  PHE A CA   1 
ATOM   1280 C C    . PHE A 1 67  ? 3.571   22.028 19.155 1.00 16.48  ? 67  PHE A C    1 
ATOM   1281 O O    . PHE A 1 67  ? 3.548   22.492 20.309 1.00 18.25  ? 67  PHE A O    1 
ATOM   1282 C CB   . PHE A 1 67  ? 4.587   19.831 19.778 1.00 15.42  ? 67  PHE A CB   1 
ATOM   1283 C CG   . PHE A 1 67  ? 5.992   20.063 19.257 1.00 15.81  ? 67  PHE A CG   1 
ATOM   1284 C CD1  . PHE A 1 67  ? 6.730   21.172 19.650 1.00 19.91  ? 67  PHE A CD1  1 
ATOM   1285 C CD2  . PHE A 1 67  ? 6.578   19.171 18.386 1.00 19.61  ? 67  PHE A CD2  1 
ATOM   1286 C CE1  . PHE A 1 67  ? 8.042   21.358 19.172 1.00 20.91  ? 67  PHE A CE1  1 
ATOM   1287 C CE2  . PHE A 1 67  ? 7.864   19.373 17.925 1.00 25.56  ? 67  PHE A CE2  1 
ATOM   1288 C CZ   . PHE A 1 67  ? 8.580   20.453 18.303 1.00 22.19  ? 67  PHE A CZ   1 
ATOM   1289 H H    . PHE A 1 67  ? 4.302   19.993 17.276 1.00 15.96  ? 67  PHE A H    1 
ATOM   1290 H HA   . PHE A 1 67  ? 2.615   20.255 19.351 1.00 17.68  ? 67  PHE A HA   1 
ATOM   1291 H HB2  . PHE A 1 67  ? 4.558   20.147 20.694 1.00 18.38  ? 67  PHE A HB2  1 
ATOM   1292 H HB3  . PHE A 1 67  ? 4.421   18.875 19.758 1.00 18.38  ? 67  PHE A HB3  1 
ATOM   1293 H HD1  . PHE A 1 67  ? 6.362   21.787 20.243 1.00 23.78  ? 67  PHE A HD1  1 
ATOM   1294 H HD2  . PHE A 1 67  ? 6.105   18.419 18.111 1.00 23.42  ? 67  PHE A HD2  1 
ATOM   1295 H HE1  . PHE A 1 67  ? 8.533   22.104 19.432 1.00 24.97  ? 67  PHE A HE1  1 
ATOM   1296 H HE2  . PHE A 1 67  ? 8.238   18.761 17.334 1.00 30.56  ? 67  PHE A HE2  1 
ATOM   1297 H HZ   . PHE A 1 67  ? 9.443   20.575 17.980 1.00 26.51  ? 67  PHE A HZ   1 
ATOM   1298 N N    . THR A 1 68  ? 3.608   22.805 18.059 1.00 16.71  ? 68  THR A N    1 
ATOM   1299 C CA   . THR A 1 68  ? 3.636   24.274 18.238 1.00 16.71  ? 68  THR A CA   1 
ATOM   1300 C C    . THR A 1 68  ? 2.341   24.979 17.890 1.00 17.65  ? 68  THR A C    1 
ATOM   1301 O O    . THR A 1 68  ? 2.039   25.987 18.496 1.00 19.01  ? 68  THR A O    1 
ATOM   1302 C CB   . THR A 1 68  ? 4.785   24.981 17.503 1.00 19.80  ? 68  THR A CB   1 
ATOM   1303 O OG1  . THR A 1 68  ? 4.623   24.842 16.079 1.00 20.14  ? 68  THR A OG1  1 
ATOM   1304 C CG2  . THR A 1 68  ? 6.157   24.441 17.983 1.00 21.22  ? 68  THR A CG2  1 
ATOM   1305 H H    . THR A 1 68  ? 3.618   22.529 17.245 1.00 19.94  ? 68  THR A H    1 
ATOM   1306 H HA   . THR A 1 68  ? 3.785   24.439 19.193 1.00 19.94  ? 68  THR A HA   1 
ATOM   1307 H HB   . THR A 1 68  ? 4.753   25.925 17.723 1.00 23.65  ? 68  THR A HB   1 
ATOM   1308 H HG1  . THR A 1 68  ? 5.237   25.221 15.689 1.00 24.05  ? 68  THR A HG1  1 
ATOM   1309 H HG21 . THR A 1 68  ? 6.867   24.889 17.517 1.00 25.35  ? 68  THR A HG21 1 
ATOM   1310 H HG22 . THR A 1 68  ? 6.258   24.592 18.925 1.00 25.35  ? 68  THR A HG22 1 
ATOM   1311 H HG23 . THR A 1 68  ? 6.217   23.498 17.810 1.00 25.35  ? 68  THR A HG23 1 
ATOM   1312 N N    . ARG A 1 69  ? 1.555   24.431 16.965 1.00 16.37  ? 69  ARG A N    1 
ATOM   1313 C CA   . ARG A 1 69  ? 0.316   25.084 16.552 1.00 17.83  ? 69  ARG A CA   1 
ATOM   1314 C C    . ARG A 1 69  ? -0.886  24.173 16.598 1.00 15.98  ? 69  ARG A C    1 
ATOM   1315 O O    . ARG A 1 69  ? -2.011  24.649 16.463 1.00 18.23  ? 69  ARG A O    1 
ATOM   1316 C CB   . ARG A 1 69  ? 0.469   25.705 15.166 1.00 18.52  ? 69  ARG A CB   1 
ATOM   1317 C CG   . ARG A 1 69  ? 1.527   26.800 15.173 1.00 24.59  ? 69  ARG A CG   1 
ATOM   1318 C CD   . ARG A 1 69  ? 1.640   27.496 13.855 1.00 26.50  ? 69  ARG A CD   1 
ATOM   1319 N NE   . ARG A 1 69  ? 0.410   28.218 13.538 1.00 28.33  ? 69  ARG A NE   1 
ATOM   1320 C CZ   . ARG A 1 69  ? -0.012  29.312 14.179 1.00 55.43  ? 69  ARG A CZ   1 
ATOM   1321 N NH1  . ARG A 1 69  ? 0.687   29.835 15.189 1.00 52.27  ? 69  ARG A NH1  1 
ATOM   1322 N NH2  . ARG A 1 69  ? -1.148  29.882 13.805 1.00 44.04  ? 69  ARG A NH2  1 
ATOM   1323 H H    . ARG A 1 69  ? 1.716   23.688 16.564 1.00 19.53  ? 69  ARG A H    1 
ATOM   1324 H HA   . ARG A 1 69  ? 0.140   25.818 17.176 1.00 21.27  ? 69  ARG A HA   1 
ATOM   1325 H HB2  . ARG A 1 69  ? 0.742   25.021 14.535 1.00 22.10  ? 69  ARG A HB2  1 
ATOM   1326 H HB3  . ARG A 1 69  ? -0.376  26.098 14.894 1.00 22.10  ? 69  ARG A HB3  1 
ATOM   1327 H HG2  . ARG A 1 69  ? 1.294   27.462 15.843 1.00 29.39  ? 69  ARG A HG2  1 
ATOM   1328 H HG3  . ARG A 1 69  ? 2.389   26.407 15.380 1.00 29.39  ? 69  ARG A HG3  1 
ATOM   1329 H HD2  . ARG A 1 69  ? 2.369   28.135 13.889 1.00 31.69  ? 69  ARG A HD2  1 
ATOM   1330 H HD3  . ARG A 1 69  ? 1.798   26.841 13.157 1.00 31.69  ? 69  ARG A HD3  1 
ATOM   1331 H HE   . ARG A 1 69  ? -0.137  27.881 12.812 1.00 33.87  ? 69  ARG A HE   1 
ATOM   1332 H HH11 . ARG A 1 69  ? 1.424   29.468 15.437 1.00 62.61  ? 69  ARG A HH11 1 
ATOM   1333 H HH12 . ARG A 1 69  ? 0.400   30.539 15.591 1.00 62.61  ? 69  ARG A HH12 1 
ATOM   1334 H HH21 . ARG A 1 69  ? -1.603  29.550 13.155 1.00 52.73  ? 69  ARG A HH21 1 
ATOM   1335 H HH22 . ARG A 1 69  ? -1.430  30.586 14.210 1.00 52.73  ? 69  ARG A HH22 1 
ATOM   1336 N N    . HIS A 1 70  ? -0.649  22.869 16.786 1.00 14.25  ? 70  HIS A N    1 
ATOM   1337 C CA   . HIS A 1 70  ? -1.703  21.889 17.095 1.00 15.74  ? 70  HIS A CA   1 
ATOM   1338 C C    . HIS A 1 70  ? -2.695  21.671 15.968 1.00 18.05  ? 70  HIS A C    1 
ATOM   1339 O O    . HIS A 1 70  ? -3.782  21.152 16.213 1.00 19.25  ? 70  HIS A O    1 
ATOM   1340 C CB   . HIS A 1 70  ? -2.446  22.307 18.381 1.00 15.48  ? 70  HIS A CB   1 
ATOM   1341 C CG   . HIS A 1 70  ? -1.553  22.979 19.368 1.00 15.88  ? 70  HIS A CG   1 
ATOM   1342 N ND1  . HIS A 1 70  ? -0.538  22.312 20.024 1.00 17.32  ? 70  HIS A ND1  1 
ATOM   1343 C CD2  . HIS A 1 70  ? -1.472  24.277 19.758 1.00 16.32  ? 70  HIS A CD2  1 
ATOM   1344 C CE1  . HIS A 1 70  ? 0.118   23.173 20.789 1.00 16.86  ? 70  HIS A CE1  1 
ATOM   1345 N NE2  . HIS A 1 70  ? -0.428  24.370 20.639 1.00 18.06  ? 70  HIS A NE2  1 
ATOM   1346 H H    . HIS A 1 70  ? 0.135   22.518 16.738 1.00 16.98  ? 70  HIS A H    1 
ATOM   1347 H HA   . HIS A 1 70  ? -1.275  21.026 17.274 1.00 18.78  ? 70  HIS A HA   1 
ATOM   1348 H HB2  . HIS A 1 70  ? -3.156  22.925 18.148 1.00 18.46  ? 70  HIS A HB2  1 
ATOM   1349 H HB3  . HIS A 1 70  ? -2.818  21.516 18.802 1.00 18.46  ? 70  HIS A HB3  1 
ATOM   1350 H HD2  . HIS A 1 70  ? -2.018  24.974 19.473 1.00 19.46  ? 70  HIS A HD2  1 
ATOM   1351 H HE1  . HIS A 1 70  ? 0.833   22.969 21.347 1.00 20.12  ? 70  HIS A HE1  1 
ATOM   1352 N N    . ASN A 1 71  ? -2.329  22.037 14.732 1.00 16.71  ? 71  ASN A N    1 
ATOM   1353 C CA   . ASN A 1 71  ? -3.303  21.978 13.624 1.00 16.43  ? 71  ASN A CA   1 
ATOM   1354 C C    . ASN A 1 71  ? -2.748  21.594 12.270 1.00 18.19  ? 71  ASN A C    1 
ATOM   1355 O O    . ASN A 1 71  ? -3.471  21.646 11.267 1.00 22.88  ? 71  ASN A O    1 
ATOM   1356 C CB   . ASN A 1 71  ? -4.078  23.302 13.509 1.00 17.97  ? 71  ASN A CB   1 
ATOM   1357 C CG   . ASN A 1 71  ? -3.205  24.486 13.161 1.00 24.49  ? 71  ASN A CG   1 
ATOM   1358 O OD1  . ASN A 1 71  ? -2.033  24.339 12.860 1.00 20.35  ? 71  ASN A OD1  1 
ATOM   1359 N ND2  . ASN A 1 71  ? -3.800  25.685 13.156 1.00 31.09  ? 71  ASN A ND2  1 
ATOM   1360 H H    . ASN A 1 71  ? -1.547  22.316 14.510 1.00 19.93  ? 71  ASN A H    1 
ATOM   1361 H HA   . ASN A 1 71  ? -3.963  21.290 13.854 1.00 19.60  ? 71  ASN A HA   1 
ATOM   1362 H HB2  . ASN A 1 71  ? -4.749  23.213 12.814 1.00 21.44  ? 71  ASN A HB2  1 
ATOM   1363 H HB3  . ASN A 1 71  ? -4.507  23.489 14.359 1.00 21.44  ? 71  ASN A HB3  1 
ATOM   1364 H HD21 . ASN A 1 71  ? -3.282  26.488 12.938 1.00 37.19  ? 71  ASN A HD21 1 
ATOM   1365 H HD22 . ASN A 1 71  ? -4.753  25.760 13.371 1.00 37.19  ? 71  ASN A HD22 1 
ATOM   1366 N N    . GLY A 1 72  ? -1.462  21.244 12.232 1.00 16.17  ? 72  GLY A N    1 
ATOM   1367 C CA   . GLY A 1 72  ? -0.826  20.863 10.989 1.00 16.91  ? 72  GLY A CA   1 
ATOM   1368 C C    . GLY A 1 72  ? 0.033   21.938 10.350 1.00 17.15  ? 72  GLY A C    1 
ATOM   1369 O O    . GLY A 1 72  ? 0.683   21.676 9.338  1.00 22.37  ? 72  GLY A O    1 
ATOM   1370 H H    . GLY A 1 72  ? -0.942  21.221 12.916 1.00 19.29  ? 72  GLY A H    1 
ATOM   1371 H HA2  . GLY A 1 72  ? -0.265  20.088 11.149 1.00 20.18  ? 72  GLY A HA2  1 
ATOM   1372 H HA3  . GLY A 1 72  ? -1.511  20.610 10.351 1.00 20.18  ? 72  GLY A HA3  1 
ATOM   1373 N N    . THR A 1 73  ? 0.082   23.127 10.957 1.00 18.39  ? 73  THR A N    1 
ATOM   1374 C CA   . THR A 1 73  ? 0.842   24.237 10.365 1.00 19.27  ? 73  THR A CA   1 
ATOM   1375 C C    . THR A 1 73  ? 2.174   24.511 11.056 1.00 20.96  ? 73  THR A C    1 
ATOM   1376 O O    . THR A 1 73  ? 2.943   25.364 10.623 1.00 27.33  ? 73  THR A O    1 
ATOM   1377 C CB   . THR A 1 73  ? 0.039   25.559 10.354 1.00 23.20  ? 73  THR A CB   1 
ATOM   1378 O OG1  . THR A 1 73  ? -0.232  25.975 11.690 1.00 23.02  ? 73  THR A OG1  1 
ATOM   1379 C CG2  . THR A 1 73  ? -1.253  25.414 9.595  1.00 23.51  ? 73  THR A CG2  1 
ATOM   1380 H H    . THR A 1 73  ? -0.308  23.316 11.700 1.00 21.95  ? 73  THR A H    1 
ATOM   1381 H HA   . THR A 1 73  ? 1.040   24.009 9.432  1.00 23.01  ? 73  THR A HA   1 
ATOM   1382 H HB   . THR A 1 73  ? 0.567   26.243 9.914  1.00 27.72  ? 73  THR A HB   1 
ATOM   1383 H HG1  . THR A 1 73  ? -0.669  25.400 12.080 1.00 27.50  ? 73  THR A HG1  1 
ATOM   1384 H HG21 . THR A 1 73  ? -1.732  26.245 9.602  1.00 28.10  ? 73  THR A HG21 1 
ATOM   1385 H HG22 . THR A 1 73  ? -1.072  25.166 8.685  1.00 28.10  ? 73  THR A HG22 1 
ATOM   1386 H HG23 . THR A 1 73  ? -1.797  24.735 10.001 1.00 28.10  ? 73  THR A HG23 1 
ATOM   1387 N N    . GLY A 1 74  ? 2.444   23.784 12.139 1.00 17.40  ? 74  GLY A N    1 
ATOM   1388 C CA   . GLY A 1 74  ? 3.632   24.009 12.937 1.00 18.14  ? 74  GLY A CA   1 
ATOM   1389 C C    . GLY A 1 74  ? 4.532   22.788 13.081 1.00 17.03  ? 74  GLY A C    1 
ATOM   1390 O O    . GLY A 1 74  ? 4.555   21.873 12.246 1.00 19.97  ? 74  GLY A O    1 
ATOM   1391 H H    . GLY A 1 74  ? 1.944   23.148 12.431 1.00 20.76  ? 74  GLY A H    1 
ATOM   1392 H HA2  . GLY A 1 74  ? 4.154   24.721 12.535 1.00 21.65  ? 74  GLY A HA2  1 
ATOM   1393 H HA3  . GLY A 1 74  ? 3.368   24.294 13.826 1.00 21.65  ? 74  GLY A HA3  1 
ATOM   1394 N N    . GLY A 1 75  ? 5.297   22.788 14.151 1.00 17.48  ? 75  GLY A N    1 
ATOM   1395 C CA   . GLY A 1 75  ? 6.302   21.785 14.394 1.00 16.88  ? 75  GLY A CA   1 
ATOM   1396 C C    . GLY A 1 75  ? 7.683   22.282 14.014 1.00 17.26  ? 75  GLY A C    1 
ATOM   1397 O O    . GLY A 1 75  ? 7.843   23.240 13.248 1.00 23.43  ? 75  GLY A O    1 
ATOM   1398 H H    . GLY A 1 75  ? 5.249   23.381 14.772 1.00 20.85  ? 75  GLY A H    1 
ATOM   1399 H HA2  . GLY A 1 75  ? 6.306   21.548 15.334 1.00 20.14  ? 75  GLY A HA2  1 
ATOM   1400 H HA3  . GLY A 1 75  ? 6.104   20.991 13.874 1.00 20.14  ? 75  GLY A HA3  1 
ATOM   1401 N N    . LYS A 1 76  ? 8.686   21.592 14.536 1.00 18.46  ? 76  LYS A N    1 
ATOM   1402 C CA   . LYS A 1 76  ? 10.073  21.833 14.168 1.00 21.04  ? 76  LYS A CA   1 
ATOM   1403 C C    . LYS A 1 76  ? 10.897  20.615 14.536 1.00 17.76  ? 76  LYS A C    1 
ATOM   1404 O O    . LYS A 1 76  ? 10.530  19.844 15.427 1.00 18.38  ? 76  LYS A O    1 
ATOM   1405 C CB   . LYS A 1 76  ? 10.642  23.119 14.825 1.00 25.91  ? 76  LYS A CB   1 
ATOM   1406 C CG   . LYS A 1 76  ? 10.685  23.123 16.342 1.00 31.32  ? 76  LYS A CG   1 
ATOM   1407 C CD   . LYS A 1 76  ? 11.294  24.427 16.912 1.00 41.75  ? 76  LYS A CD   1 
ATOM   1408 C CE   . LYS A 1 76  ? 11.470  24.323 18.418 1.00 61.65  ? 76  LYS A CE   1 
ATOM   1409 N NZ   . LYS A 1 76  ? 12.216  25.472 19.000 1.00 66.58  ? 76  LYS A NZ   1 
ATOM   1410 H H    . LYS A 1 76  ? 8.588   20.966 15.117 1.00 22.03  ? 76  LYS A H    1 
ATOM   1411 H HA   . LYS A 1 76  ? 10.125  21.946 13.196 1.00 25.13  ? 76  LYS A HA   1 
ATOM   1412 H HB2  . LYS A 1 76  ? 11.551  23.247 14.509 1.00 30.98  ? 76  LYS A HB2  1 
ATOM   1413 H HB3  . LYS A 1 76  ? 10.096  23.871 14.548 1.00 30.98  ? 76  LYS A HB3  1 
ATOM   1414 H HG2  . LYS A 1 76  ? 9.782   23.037 16.685 1.00 37.47  ? 76  LYS A HG2  1 
ATOM   1415 H HG3  . LYS A 1 76  ? 11.229  22.379 16.646 1.00 37.47  ? 76  LYS A HG3  1 
ATOM   1416 H HD2  . LYS A 1 76  ? 12.164  24.579 16.511 1.00 49.98  ? 76  LYS A HD2  1 
ATOM   1417 H HD3  . LYS A 1 76  ? 10.699  25.170 16.723 1.00 49.98  ? 76  LYS A HD3  1 
ATOM   1418 H HE2  . LYS A 1 76  ? 10.595  24.293 18.835 1.00 73.86  ? 76  LYS A HE2  1 
ATOM   1419 H HE3  . LYS A 1 76  ? 11.962  23.513 18.622 1.00 73.86  ? 76  LYS A HE3  1 
ATOM   1420 H HZ1  . LYS A 1 76  ? 12.301  25.360 19.950 1.00 79.78  ? 76  LYS A HZ1  1 
ATOM   1421 H HZ2  . LYS A 1 76  ? 13.093  25.523 18.613 1.00 79.78  ? 76  LYS A HZ2  1 
ATOM   1422 H HZ3  . LYS A 1 76  ? 11.748  26.291 18.823 1.00 79.78  ? 76  LYS A HZ3  1 
ATOM   1423 N N    . SER A 1 77  ? 11.990  20.412 13.805 1.00 19.02  ? 77  SER A N    1 
ATOM   1424 C CA   . SER A 1 77  ? 12.933  19.327 14.092 1.00 18.00  ? 77  SER A CA   1 
ATOM   1425 C C    . SER A 1 77  ? 14.001  19.737 15.099 1.00 20.14  ? 77  SER A C    1 
ATOM   1426 O O    . SER A 1 77  ? 14.120  20.902 15.491 1.00 22.60  ? 77  SER A O    1 
ATOM   1427 C CB   . SER A 1 77  ? 13.593  18.829 12.788 1.00 19.38  ? 77  SER A CB   1 
ATOM   1428 O OG   . SER A 1 77  ? 14.750  19.587 12.419 1.00 19.94  ? 77  SER A OG   1 
ATOM   1429 H H    . SER A 1 77  ? 12.213  20.894 13.129 1.00 22.70  ? 77  SER A H    1 
ATOM   1430 H HA   . SER A 1 77  ? 12.435  18.576 14.478 1.00 21.48  ? 77  SER A HA   1 
ATOM   1431 H HB2  . SER A 1 77  ? 13.857  17.903 12.910 1.00 23.14  ? 77  SER A HB2  1 
ATOM   1432 H HB3  . SER A 1 77  ? 12.943  18.889 12.070 1.00 23.14  ? 77  SER A HB3  1 
ATOM   1433 H HG   . SER A 1 77  ? 14.885  20.180 12.969 1.00 23.81  ? 77  SER A HG   1 
ATOM   1434 N N    . ILE A 1 78  ? 14.763  18.749 15.532 1.00 19.14  ? 78  ILE A N    1 
ATOM   1435 C CA   . ILE A 1 78  ? 15.896  18.984 16.429 1.00 19.73  ? 78  ILE A CA   1 
ATOM   1436 C C    . ILE A 1 78  ? 17.093  19.590 15.688 1.00 24.48  ? 78  ILE A C    1 
ATOM   1437 O O    . ILE A 1 78  ? 18.067  19.966 16.317 1.00 30.58  ? 78  ILE A O    1 
ATOM   1438 C CB   . ILE A 1 78  ? 16.343  17.685 17.162 1.00 21.13  ? 78  ILE A CB   1 
ATOM   1439 C CG1  . ILE A 1 78  ? 16.904  16.658 16.171 1.00 22.00  ? 78  ILE A CG1  1 
ATOM   1440 C CG2  . ILE A 1 78  ? 15.172  17.117 18.008 1.00 25.46  ? 78  ILE A CG2  1 
ATOM   1441 C CD1  . ILE A 1 78  ? 17.658  15.511 16.836 1.00 25.03  ? 78  ILE A CD1  1 
ATOM   1442 H H    . ILE A 1 78  ? 14.650  17.923 15.322 1.00 22.85  ? 78  ILE A H    1 
ATOM   1443 H HA   . ILE A 1 78  ? 15.619  19.627 17.114 1.00 23.56  ? 78  ILE A HA   1 
ATOM   1444 H HB   . ILE A 1 78  ? 17.058  17.923 17.773 1.00 25.24  ? 78  ILE A HB   1 
ATOM   1445 H HG12 . ILE A 1 78  ? 16.168  16.276 15.667 1.00 26.29  ? 78  ILE A HG12 1 
ATOM   1446 H HG13 . ILE A 1 78  ? 17.518  17.107 15.569 1.00 26.29  ? 78  ILE A HG13 1 
ATOM   1447 H HG21 . ILE A 1 78  ? 15.467  16.318 18.452 1.00 30.44  ? 78  ILE A HG21 1 
ATOM   1448 H HG22 . ILE A 1 78  ? 14.909  17.774 18.657 1.00 30.44  ? 78  ILE A HG22 1 
ATOM   1449 H HG23 . ILE A 1 78  ? 14.435  16.916 17.426 1.00 30.44  ? 78  ILE A HG23 1 
ATOM   1450 H HD11 . ILE A 1 78  ? 17.977  14.912 16.157 1.00 29.92  ? 78  ILE A HD11 1 
ATOM   1451 H HD12 . ILE A 1 78  ? 18.398  15.869 17.332 1.00 29.92  ? 78  ILE A HD12 1 
ATOM   1452 H HD13 . ILE A 1 78  ? 17.061  15.047 17.428 1.00 29.92  ? 78  ILE A HD13 1 
ATOM   1453 N N    . TYR A 1 79  ? 16.990  19.673 14.358 1.00 21.23  ? 79  TYR A N    1 
ATOM   1454 C CA   . TYR A 1 79  ? 18.039  20.207 13.485 1.00 23.76  ? 79  TYR A CA   1 
ATOM   1455 C C    . TYR A 1 79  ? 17.737  21.618 12.989 1.00 27.29  ? 79  TYR A C    1 
ATOM   1456 O O    . TYR A 1 79  ? 18.538  22.203 12.252 1.00 41.76  ? 79  TYR A O    1 
ATOM   1457 C CB   . TYR A 1 79  ? 18.203  19.297 12.255 1.00 26.89  ? 79  TYR A CB   1 
ATOM   1458 C CG   . TYR A 1 79  ? 18.359  17.841 12.613 1.00 22.81  ? 79  TYR A CG   1 
ATOM   1459 C CD1  . TYR A 1 79  ? 19.438  17.408 13.360 1.00 24.75  ? 79  TYR A CD1  1 
ATOM   1460 C CD2  . TYR A 1 79  ? 17.429  16.897 12.194 1.00 24.84  ? 79  TYR A CD2  1 
ATOM   1461 C CE1  . TYR A 1 79  ? 19.588  16.073 13.701 1.00 26.19  ? 79  TYR A CE1  1 
ATOM   1462 C CE2  . TYR A 1 79  ? 17.563  15.567 12.532 1.00 23.63  ? 79  TYR A CE2  1 
ATOM   1463 C CZ   . TYR A 1 79  ? 18.657  15.161 13.286 1.00 21.67  ? 79  TYR A CZ   1 
ATOM   1464 O OH   . TYR A 1 79  ? 18.804  13.830 13.634 1.00 22.07  ? 79  TYR A OH   1 
ATOM   1465 H H    . TYR A 1 79  ? 16.294  19.416 13.924 1.00 25.36  ? 79  TYR A H    1 
ATOM   1466 H HA   . TYR A 1 79  ? 18.889  20.227 13.972 1.00 28.40  ? 79  TYR A HA   1 
ATOM   1467 H HB2  . TYR A 1 79  ? 17.418  19.384 11.692 1.00 32.15  ? 79  TYR A HB2  1 
ATOM   1468 H HB3  . TYR A 1 79  ? 18.994  19.570 11.764 1.00 32.15  ? 79  TYR A HB3  1 
ATOM   1469 H HD1  . TYR A 1 79  ? 20.071  18.026 13.647 1.00 29.58  ? 79  TYR A HD1  1 
ATOM   1470 H HD2  . TYR A 1 79  ? 16.694  17.170 11.694 1.00 29.69  ? 79  TYR A HD2  1 
ATOM   1471 H HE1  . TYR A 1 79  ? 20.317  15.799 14.210 1.00 31.32  ? 79  TYR A HE1  1 
ATOM   1472 H HE2  . TYR A 1 79  ? 16.931  14.946 12.251 1.00 28.24  ? 79  TYR A HE2  1 
ATOM   1473 H HH   . TYR A 1 79  ? 18.861  13.368 12.959 1.00 26.36  ? 79  TYR A HH   1 
ATOM   1474 N N    . GLY A 1 80  ? 16.586  22.161 13.380 1.00 27.57  ? 80  GLY A N    1 
ATOM   1475 C CA   . GLY A 1 80  ? 16.099  23.424 12.845 1.00 29.10  ? 80  GLY A CA   1 
ATOM   1476 C C    . GLY A 1 80  ? 14.675  23.289 12.327 1.00 25.85  ? 80  GLY A C    1 
ATOM   1477 O O    . GLY A 1 80  ? 13.998  22.265 12.534 1.00 25.24  ? 80  GLY A O    1 
ATOM   1478 H H    . GLY A 1 80  ? 16.063  21.808 13.964 1.00 32.97  ? 80  GLY A H    1 
ATOM   1479 H HA2  . GLY A 1 80  ? 16.114  24.101 13.539 1.00 34.80  ? 80  GLY A HA2  1 
ATOM   1480 H HA3  . GLY A 1 80  ? 16.669  23.712 12.116 1.00 34.80  ? 80  GLY A HA3  1 
ATOM   1481 N N    . GLU A 1 81  ? 14.185  24.327 11.658 1.00 37.34  ? 81  GLU A N    1 
ATOM   1482 C CA   . GLU A 1 81  ? 12.805  24.332 11.175 1.00 35.35  ? 81  GLU A CA   1 
ATOM   1483 C C    . GLU A 1 81  ? 12.528  23.116 10.302 1.00 24.38  ? 81  GLU A C    1 
ATOM   1484 O O    . GLU A 1 81  ? 11.494  22.448 10.451 1.00 29.37  ? 81  GLU A O    1 
ATOM   1485 C CB   . GLU A 1 81  ? 12.522  25.617 10.393 1.00 39.79  ? 81  GLU A CB   1 
ATOM   1486 C CG   . GLU A 1 81  ? 12.625  26.878 11.235 1.00 77.92  ? 81  GLU A CG   1 
ATOM   1487 C CD   . GLU A 1 81  ? 11.363  27.138 12.032 1.00 100.48 ? 81  GLU A CD   1 
ATOM   1488 O OE1  . GLU A 1 81  ? 11.336  26.810 13.242 1.00 93.75  ? 81  GLU A OE1  1 
ATOM   1489 O OE2  . GLU A 1 81  ? 10.396  27.666 11.436 1.00 98.32  ? 81  GLU A OE2  1 
ATOM   1490 H H    . GLU A 1 81  ? 14.629  25.039 11.469 1.00 44.69  ? 81  GLU A H    1 
ATOM   1491 H HA   . GLU A 1 81  ? 12.196  24.302 11.942 1.00 42.30  ? 81  GLU A HA   1 
ATOM   1492 H HB2  . GLU A 1 81  ? 13.163  25.691 9.669  1.00 47.64  ? 81  GLU A HB2  1 
ATOM   1493 H HB3  . GLU A 1 81  ? 11.622  25.573 10.032 1.00 47.64  ? 81  GLU A HB3  1 
ATOM   1494 H HG2  . GLU A 1 81  ? 13.361  26.785 11.859 1.00 93.39  ? 81  GLU A HG2  1 
ATOM   1495 H HG3  . GLU A 1 81  ? 12.775  27.639 10.652 1.00 93.39  ? 81  GLU A HG3  1 
ATOM   1496 N N    . LYS A 1 82  ? 13.466  22.808 9.412  1.00 21.19  ? 82  LYS A N    1 
ATOM   1497 C CA   . LYS A 1 82  ? 13.278  21.705 8.472  1.00 20.59  ? 82  LYS A CA   1 
ATOM   1498 C C    . LYS A 1 82  ? 14.588  20.967 8.229  1.00 18.03  ? 82  LYS A C    1 
ATOM   1499 O O    . LYS A 1 82  ? 15.689  21.519 8.423  1.00 24.04  ? 82  LYS A O    1 
ATOM   1500 C CB   . LYS A 1 82  ? 12.695  22.216 7.143  1.00 26.58  ? 82  LYS A CB   1 
ATOM   1501 C CG   . LYS A 1 82  ? 13.574  23.195 6.396  1.00 51.19  ? 82  LYS A CG   1 
ATOM   1502 C CD   . LYS A 1 82  ? 12.851  23.799 5.196  1.00 75.89  ? 82  LYS A CD   1 
ATOM   1503 C CE   . LYS A 1 82  ? 13.736  24.796 4.441  1.00 91.95  ? 82  LYS A CE   1 
ATOM   1504 N NZ   . LYS A 1 82  ? 14.912  24.156 3.763  1.00 110.77 ? 82  LYS A NZ   1 
ATOM   1505 H H    . LYS A 1 82  ? 14.217  23.220 9.330  1.00 25.31  ? 82  LYS A H    1 
ATOM   1506 H HA   . LYS A 1 82  ? 12.639  21.067 8.855  1.00 24.59  ? 82  LYS A HA   1 
ATOM   1507 H HB2  . LYS A 1 82  ? 12.543  21.456 6.560  1.00 31.78  ? 82  LYS A HB2  1 
ATOM   1508 H HB3  . LYS A 1 82  ? 11.852  22.660 7.326  1.00 31.78  ? 82  LYS A HB3  1 
ATOM   1509 H HG2  . LYS A 1 82  ? 13.827  23.916 6.992  1.00 61.31  ? 82  LYS A HG2  1 
ATOM   1510 H HG3  . LYS A 1 82  ? 14.364  22.733 6.073  1.00 61.31  ? 82  LYS A HG3  1 
ATOM   1511 H HD2  . LYS A 1 82  ? 12.602  23.090 4.582  1.00 90.96  ? 82  LYS A HD2  1 
ATOM   1512 H HD3  . LYS A 1 82  ? 12.060  24.269 5.503  1.00 90.96  ? 82  LYS A HD3  1 
ATOM   1513 H HE2  . LYS A 1 82  ? 13.203  25.236 3.760  1.00 110.22 ? 82  LYS A HE2  1 
ATOM   1514 H HE3  . LYS A 1 82  ? 14.076  25.452 5.069  1.00 110.22 ? 82  LYS A HE3  1 
ATOM   1515 H HZ1  . LYS A 1 82  ? 15.430  24.823 3.307  1.00 132.80 ? 82  LYS A HZ1  1 
ATOM   1516 H HZ2  . LYS A 1 82  ? 15.467  23.720 4.413  1.00 132.80 ? 82  LYS A HZ2  1 
ATOM   1517 H HZ3  . LYS A 1 82  ? 14.609  23.506 3.125  1.00 132.80 ? 82  LYS A HZ3  1 
ATOM   1518 N N    . PHE A 1 83  ? 14.476  19.721 7.782  1.00 18.00  ? 83  PHE A N    1 
ATOM   1519 C CA   . PHE A 1 83  ? 15.643  19.001 7.321  1.00 18.43  ? 83  PHE A CA   1 
ATOM   1520 C C    . PHE A 1 83  ? 15.306  18.155 6.103  1.00 15.96  ? 83  PHE A C    1 
ATOM   1521 O O    . PHE A 1 83  ? 14.138  17.995 5.723  1.00 16.01  ? 83  PHE A O    1 
ATOM   1522 C CB   . PHE A 1 83  ? 16.318  18.187 8.429  1.00 17.10  ? 83  PHE A CB   1 
ATOM   1523 C CG   . PHE A 1 83  ? 15.522  17.027 8.934  1.00 18.10  ? 83  PHE A CG   1 
ATOM   1524 C CD1  . PHE A 1 83  ? 14.472  17.218 9.819  1.00 17.84  ? 83  PHE A CD1  1 
ATOM   1525 C CD2  . PHE A 1 83  ? 15.852  15.735 8.553  1.00 20.23  ? 83  PHE A CD2  1 
ATOM   1526 C CE1  . PHE A 1 83  ? 13.751  16.138 10.315 1.00 17.53  ? 83  PHE A CE1  1 
ATOM   1527 C CE2  . PHE A 1 83  ? 15.130  14.642 9.044  1.00 22.13  ? 83  PHE A CE2  1 
ATOM   1528 C CZ   . PHE A 1 83  ? 14.083  14.848 9.922  1.00 18.03  ? 83  PHE A CZ   1 
ATOM   1529 H H    . PHE A 1 83  ? 13.740  19.278 7.737  1.00 21.48  ? 83  PHE A H    1 
ATOM   1530 H HA   . PHE A 1 83  ? 16.300  19.665 7.026  1.00 22.00  ? 83  PHE A HA   1 
ATOM   1531 H HB2  . PHE A 1 83  ? 17.158  17.840 8.089  1.00 20.40  ? 83  PHE A HB2  1 
ATOM   1532 H HB3  . PHE A 1 83  ? 16.489  18.774 9.182  1.00 20.40  ? 83  PHE A HB3  1 
ATOM   1533 H HD1  . PHE A 1 83  ? 14.251  18.080 10.090 1.00 21.29  ? 83  PHE A HD1  1 
ATOM   1534 H HD2  . PHE A 1 83  ? 16.560  15.594 7.966  1.00 24.16  ? 83  PHE A HD2  1 
ATOM   1535 H HE1  . PHE A 1 83  ? 13.043  16.279 10.902 1.00 20.92  ? 83  PHE A HE1  1 
ATOM   1536 H HE2  . PHE A 1 83  ? 15.352  13.779 8.777  1.00 26.44  ? 83  PHE A HE2  1 
ATOM   1537 H HZ   . PHE A 1 83  ? 13.596  14.124 10.243 1.00 21.52  ? 83  PHE A HZ   1 
ATOM   1538 N N    . GLU A 1 84  ? 16.365  17.681 5.463  1.00 16.15  ? 84  GLU A N    1 
ATOM   1539 C CA   . GLU A 1 84  ? 16.282  17.025 4.182  1.00 15.92  ? 84  GLU A CA   1 
ATOM   1540 C C    . GLU A 1 84  ? 15.644  15.635 4.261  1.00 15.60  ? 84  GLU A C    1 
ATOM   1541 O O    . GLU A 1 84  ? 15.593  15.007 5.324  1.00 16.59  ? 84  GLU A O    1 
ATOM   1542 C CB   . GLU A 1 84  ? 17.686  16.903 3.568  1.00 17.43  ? 84  GLU A CB   1 
ATOM   1543 C CG   . GLU A 1 84  ? 18.605  15.876 4.256  1.00 21.42  ? 84  GLU A CG   1 
ATOM   1544 C CD   . GLU A 1 84  ? 19.382  16.419 5.457  1.00 24.22  ? 84  GLU A CD   1 
ATOM   1545 O OE1  . GLU A 1 84  ? 19.050  17.488 6.022  1.00 22.41  ? 84  GLU A OE1  1 
ATOM   1546 O OE2  . GLU A 1 84  ? 20.382  15.756 5.823  1.00 23.39  ? 84  GLU A OE2  1 
ATOM   1547 H H    . GLU A 1 84  ? 17.168  17.734 5.767  1.00 19.26  ? 84  GLU A H    1 
ATOM   1548 H HA   . GLU A 1 84  ? 15.737  17.572 3.580  1.00 18.98  ? 84  GLU A HA   1 
ATOM   1549 H HB2  . GLU A 1 84  ? 17.596  16.640 2.639  1.00 20.80  ? 84  GLU A HB2  1 
ATOM   1550 H HB3  . GLU A 1 84  ? 18.122  17.768 3.621  1.00 20.80  ? 84  GLU A HB3  1 
ATOM   1551 H HG2  . GLU A 1 84  ? 18.062  15.135 4.568  1.00 25.59  ? 84  GLU A HG2  1 
ATOM   1552 H HG3  . GLU A 1 84  ? 19.252  15.556 3.608  1.00 25.59  ? 84  GLU A HG3  1 
ATOM   1553 N N    . ASP A 1 85  ? 15.187  15.173 3.101  1.00 14.28  ? 85  ASP A N    1 
ATOM   1554 C CA   . ASP A 1 85  ? 14.776  13.790 2.899  1.00 14.68  ? 85  ASP A CA   1 
ATOM   1555 C C    . ASP A 1 85  ? 16.011  12.921 2.908  1.00 14.81  ? 85  ASP A C    1 
ATOM   1556 O O    . ASP A 1 85  ? 16.881  13.025 2.026  1.00 18.21  ? 85  ASP A O    1 
ATOM   1557 C CB   . ASP A 1 85  ? 14.014  13.610 1.588  1.00 15.07  ? 85  ASP A CB   1 
ATOM   1558 C CG   . ASP A 1 85  ? 12.696  14.377 1.566  1.00 14.06  ? 85  ASP A CG   1 
ATOM   1559 O OD1  . ASP A 1 85  ? 11.929  14.341 2.562  1.00 15.80  ? 85  ASP A OD1  1 
ATOM   1560 O OD2  . ASP A 1 85  ? 12.420  15.044 0.552  1.00 14.63  ? 85  ASP A OD2  1 
ATOM   1561 H H    . ASP A 1 85  ? 15.105  15.658 2.395  1.00 17.02  ? 85  ASP A H    1 
ATOM   1562 H HA   . ASP A 1 85  ? 14.194  13.511 3.637  1.00 17.49  ? 85  ASP A HA   1 
ATOM   1563 H HB2  . ASP A 1 85  ? 14.562  13.934 0.856  1.00 17.97  ? 85  ASP A HB2  1 
ATOM   1564 H HB3  . ASP A 1 85  ? 13.816  12.669 1.463  1.00 17.97  ? 85  ASP A HB3  1 
ATOM   1565 N N    . GLU A 1 86  ? 16.106  12.062 3.916  1.00 14.78  ? 86  GLU A N    1 
ATOM   1566 C CA   . GLU A 1 86  ? 17.343  11.332 4.161  1.00 15.93  ? 86  GLU A CA   1 
ATOM   1567 C C    . GLU A 1 86  ? 17.592  10.264 3.093  1.00 16.89  ? 86  GLU A C    1 
ATOM   1568 O O    . GLU A 1 86  ? 18.677  10.202 2.494  1.00 20.68  ? 86  GLU A O    1 
ATOM   1569 C CB   . GLU A 1 86  ? 17.295  10.724 5.556  1.00 18.01  ? 86  GLU A CB   1 
ATOM   1570 C CG   . GLU A 1 86  ? 18.615  10.052 5.954  1.00 18.70  ? 86  GLU A CG   1 
ATOM   1571 C CD   . GLU A 1 86  ? 18.659  9.660  7.409  1.00 19.07  ? 86  GLU A CD   1 
ATOM   1572 O OE1  . GLU A 1 86  ? 17.599  9.740  8.091  1.00 17.77  ? 86  GLU A OE1  1 
ATOM   1573 O OE2  . GLU A 1 86  ? 19.755  9.302  7.896  1.00 21.58  ? 86  GLU A OE2  1 
ATOM   1574 H H    . GLU A 1 86  ? 15.472  11.884 4.469  1.00 17.62  ? 86  GLU A H    1 
ATOM   1575 H HA   . GLU A 1 86  ? 18.092  11.963 4.134  1.00 19.00  ? 86  GLU A HA   1 
ATOM   1576 H HB2  . GLU A 1 86  ? 17.109  11.425 6.200  1.00 21.50  ? 86  GLU A HB2  1 
ATOM   1577 H HB3  . GLU A 1 86  ? 16.595  10.053 5.584  1.00 21.50  ? 86  GLU A HB3  1 
ATOM   1578 H HG2  . GLU A 1 86  ? 18.731  9.247  5.424  1.00 22.32  ? 86  GLU A HG2  1 
ATOM   1579 H HG3  . GLU A 1 86  ? 19.345  10.667 5.786  1.00 22.32  ? 86  GLU A HG3  1 
ATOM   1580 N N    . ASN A 1 87  ? 16.590  9.431  2.859  1.00 16.89  ? 87  ASN A N    1 
ATOM   1581 C CA   . ASN A 1 87  ? 16.621  8.431  1.783  1.00 17.22  ? 87  ASN A CA   1 
ATOM   1582 C C    . ASN A 1 87  ? 15.199  7.885  1.647  1.00 17.18  ? 87  ASN A C    1 
ATOM   1583 O O    . ASN A 1 87  ? 14.334  8.196  2.478  1.00 16.70  ? 87  ASN A O    1 
ATOM   1584 C CB   . ASN A 1 87  ? 17.664  7.321  2.051  1.00 18.69  ? 87  ASN A CB   1 
ATOM   1585 C CG   . ASN A 1 87  ? 17.336  6.463  3.260  1.00 24.11  ? 87  ASN A CG   1 
ATOM   1586 O OD1  . ASN A 1 87  ? 16.247  5.902  3.375  1.00 19.93  ? 87  ASN A OD1  1 
ATOM   1587 N ND2  . ASN A 1 87  ? 18.296  6.335  4.168  1.00 24.52  ? 87  ASN A ND2  1 
ATOM   1588 H H    . ASN A 1 87  ? 15.862  9.419  3.317  1.00 20.15  ? 87  ASN A H    1 
ATOM   1589 H HA   . ASN A 1 87  ? 16.858  8.874  0.941  1.00 20.55  ? 87  ASN A HA   1 
ATOM   1590 H HB2  . ASN A 1 87  ? 17.710  6.740  1.277  1.00 22.31  ? 87  ASN A HB2  1 
ATOM   1591 H HB3  . ASN A 1 87  ? 18.529  7.734  2.205  1.00 22.31  ? 87  ASN A HB3  1 
ATOM   1592 H HD21 . ASN A 1 87  ? 18.142  5.793  4.970  1.00 29.31  ? 87  ASN A HD21 1 
ATOM   1593 H HD22 . ASN A 1 87  ? 19.158  6.782  4.037  1.00 29.31  ? 87  ASN A HD22 1 
ATOM   1594 N N    . PHE A 1 88  ? 14.956  7.094  0.597  1.00 18.85  ? 88  PHE A N    1 
ATOM   1595 C CA   . PHE A 1 88  ? 13.662  6.468  0.411  1.00 17.21  ? 88  PHE A CA   1 
ATOM   1596 C C    . PHE A 1 88  ? 13.796  4.949  0.285  1.00 20.20  ? 88  PHE A C    1 
ATOM   1597 O O    . PHE A 1 88  ? 13.123  4.315  -0.535 1.00 22.92  ? 88  PHE A O    1 
ATOM   1598 C CB   . PHE A 1 88  ? 12.938  7.061  -0.788 1.00 18.48  ? 88  PHE A CB   1 
ATOM   1599 C CG   . PHE A 1 88  ? 12.653  8.535  -0.660 1.00 16.34  ? 88  PHE A CG   1 
ATOM   1600 C CD1  . PHE A 1 88  ? 11.641  8.979  0.161  1.00 16.29  ? 88  PHE A CD1  1 
ATOM   1601 C CD2  . PHE A 1 88  ? 13.419  9.477  -1.330 1.00 18.59  ? 88  PHE A CD2  1 
ATOM   1602 C CE1  . PHE A 1 88  ? 11.356  10.319 0.311  1.00 16.54  ? 88  PHE A CE1  1 
ATOM   1603 C CE2  . PHE A 1 88  ? 13.151  10.833 -1.174 1.00 19.78  ? 88  PHE A CE2  1 
ATOM   1604 C CZ   . PHE A 1 88  ? 12.103  11.256 -0.378 1.00 16.42  ? 88  PHE A CZ   1 
ATOM   1605 H H    . PHE A 1 88  ? 15.529  6.909  -0.017 1.00 22.50  ? 88  PHE A H    1 
ATOM   1606 H HA   . PHE A 1 88  ? 13.114  6.649  1.203  1.00 20.53  ? 88  PHE A HA   1 
ATOM   1607 H HB2  . PHE A 1 88  ? 13.485  6.932  -1.578 1.00 22.06  ? 88  PHE A HB2  1 
ATOM   1608 H HB3  . PHE A 1 88  ? 12.089  6.604  -0.898 1.00 22.06  ? 88  PHE A HB3  1 
ATOM   1609 H HD1  . PHE A 1 88  ? 11.121  8.355  0.614  1.00 19.43  ? 88  PHE A HD1  1 
ATOM   1610 H HD2  . PHE A 1 88  ? 14.117  9.201  -1.880 1.00 22.19  ? 88  PHE A HD2  1 
ATOM   1611 H HE1  . PHE A 1 88  ? 10.656  10.590 0.860  1.00 19.73  ? 88  PHE A HE1  1 
ATOM   1612 H HE2  . PHE A 1 88  ? 13.657  11.459 -1.640 1.00 23.62  ? 88  PHE A HE2  1 
ATOM   1613 H HZ   . PHE A 1 88  ? 11.930  12.164 -0.274 1.00 19.59  ? 88  PHE A HZ   1 
ATOM   1614 N N    A ILE A 1 89  ? 14.689  4.383  1.094  0.46 20.35  ? 89  ILE A N    1 
ATOM   1615 N N    B ILE A 1 89  ? 14.668  4.358  1.089  0.54 21.24  ? 89  ILE A N    1 
ATOM   1616 C CA   A ILE A 1 89  ? 14.905  2.940  1.114  0.46 25.39  ? 89  ILE A CA   1 
ATOM   1617 C CA   B ILE A 1 89  ? 14.920  2.922  1.004  0.54 22.23  ? 89  ILE A CA   1 
ATOM   1618 C C    A ILE A 1 89  ? 13.612  2.219  1.493  0.46 19.89  ? 89  ILE A C    1 
ATOM   1619 C C    B ILE A 1 89  ? 13.668  2.101  1.340  0.54 23.17  ? 89  ILE A C    1 
ATOM   1620 O O    A ILE A 1 89  ? 13.206  1.248  0.845  0.46 28.19  ? 89  ILE A O    1 
ATOM   1621 O O    B ILE A 1 89  ? 13.380  1.072  0.721  0.54 21.77  ? 89  ILE A O    1 
ATOM   1622 C CB   A ILE A 1 89  ? 16.038  2.547  2.115  0.46 24.61  ? 89  ILE A CB   1 
ATOM   1623 C CB   B ILE A 1 89  ? 16.074  2.524  1.960  0.54 28.18  ? 89  ILE A CB   1 
ATOM   1624 C CG1  A ILE A 1 89  ? 17.423  2.761  1.502  0.46 36.91  ? 89  ILE A CG1  1 
ATOM   1625 C CG1  B ILE A 1 89  ? 17.357  3.267  1.584  0.54 43.46  ? 89  ILE A CG1  1 
ATOM   1626 C CG2  A ILE A 1 89  ? 15.932  1.075  2.521  0.46 35.74  ? 89  ILE A CG2  1 
ATOM   1627 C CG2  B ILE A 1 89  ? 16.312  1.016  1.922  0.54 26.59  ? 89  ILE A CG2  1 
ATOM   1628 C CD1  A ILE A 1 89  ? 18.010  4.107  1.764  0.46 55.99  ? 89  ILE A CD1  1 
ATOM   1629 C CD1  B ILE A 1 89  ? 17.780  3.024  0.157  0.54 49.31  ? 89  ILE A CD1  1 
ATOM   1630 H H    A ILE A 1 89  ? 15.187  4.817  1.645  0.46 24.31  ? 89  ILE A H    1 
ATOM   1631 H H    B ILE A 1 89  ? 15.127  4.763  1.693  0.54 25.37  ? 89  ILE A H    1 
ATOM   1632 H HA   A ILE A 1 89  ? 15.171  2.642  0.219  0.46 30.34  ? 89  ILE A HA   1 
ATOM   1633 H HA   B ILE A 1 89  ? 15.193  2.700  0.089  0.54 26.56  ? 89  ILE A HA   1 
ATOM   1634 H HB   A ILE A 1 89  ? 15.958  3.098  2.910  0.46 29.42  ? 89  ILE A HB   1 
ATOM   1635 H HB   B ILE A 1 89  ? 15.826  2.775  2.864  0.54 33.70  ? 89  ILE A HB   1 
ATOM   1636 H HG12 A ILE A 1 89  ? 18.030  2.099  1.867  0.46 44.18  ? 89  ILE A HG12 1 
ATOM   1637 H HG12 B ILE A 1 89  ? 17.215  4.220  1.696  0.54 52.03  ? 89  ILE A HG12 1 
ATOM   1638 H HG13 A ILE A 1 89  ? 17.358  2.650  0.541  0.46 44.18  ? 89  ILE A HG13 1 
ATOM   1639 H HG13 B ILE A 1 89  ? 18.075  2.969  2.164  0.54 52.03  ? 89  ILE A HG13 1 
ATOM   1640 H HG21 A ILE A 1 89  ? 16.642  0.869  3.134  0.46 42.77  ? 89  ILE A HG21 1 
ATOM   1641 H HG21 B ILE A 1 89  ? 17.029  0.798  2.521  0.54 31.79  ? 89  ILE A HG21 1 
ATOM   1642 H HG22 A ILE A 1 89  ? 15.082  0.928  2.942  0.46 42.77  ? 89  ILE A HG22 1 
ATOM   1643 H HG22 B ILE A 1 89  ? 15.509  0.567  2.195  0.54 31.79  ? 89  ILE A HG22 1 
ATOM   1644 H HG23 A ILE A 1 89  ? 16.009  0.529  1.736  0.46 42.77  ? 89  ILE A HG23 1 
ATOM   1645 H HG23 B ILE A 1 89  ? 16.543  0.759  1.026  0.54 31.79  ? 89  ILE A HG23 1 
ATOM   1646 H HD11 A ILE A 1 89  ? 18.874  4.157  1.347  0.46 67.07  ? 89  ILE A HD11 1 
ATOM   1647 H HD11 B ILE A 1 89  ? 18.587  3.514  -0.017 0.54 59.05  ? 89  ILE A HD11 1 
ATOM   1648 H HD12 A ILE A 1 89  ? 17.430  4.778  1.397  0.46 67.07  ? 89  ILE A HD12 1 
ATOM   1649 H HD12 B ILE A 1 89  ? 17.934  2.084  0.033  0.54 59.05  ? 89  ILE A HD12 1 
ATOM   1650 H HD13 A ILE A 1 89  ? 18.096  4.231  2.712  0.46 67.07  ? 89  ILE A HD13 1 
ATOM   1651 H HD13 B ILE A 1 89  ? 17.082  3.322  -0.430 0.54 59.05  ? 89  ILE A HD13 1 
ATOM   1652 N N    A LEU A 1 90  ? 12.960  2.717  2.539  0.46 15.28  ? 90  LEU A N    1 
ATOM   1653 N N    B LEU A 1 90  ? 12.915  2.592  2.312  0.54 26.99  ? 90  LEU A N    1 
ATOM   1654 C CA   A LEU A 1 90  ? 11.802  2.037  3.126  0.46 25.45  ? 90  LEU A CA   1 
ATOM   1655 C CA   B LEU A 1 90  ? 11.810  1.861  2.926  0.54 16.10  ? 90  LEU A CA   1 
ATOM   1656 C C    A LEU A 1 90  ? 10.490  2.500  2.506  0.46 22.25  ? 90  LEU A C    1 
ATOM   1657 C C    B LEU A 1 90  ? 10.487  2.361  2.369  0.54 19.63  ? 90  LEU A C    1 
ATOM   1658 O O    A LEU A 1 90  ? 10.307  3.672  2.200  0.46 19.81  ? 90  LEU A O    1 
ATOM   1659 O O    B LEU A 1 90  ? 10.379  3.495  1.907  0.54 19.38  ? 90  LEU A O    1 
ATOM   1660 C CB   A LEU A 1 90  ? 11.767  2.205  4.650  0.46 19.17  ? 90  LEU A CB   1 
ATOM   1661 C CB   B LEU A 1 90  ? 11.849  1.988  4.456  0.54 21.76  ? 90  LEU A CB   1 
ATOM   1662 C CG   A LEU A 1 90  ? 12.947  1.588  5.413  0.46 22.11  ? 90  LEU A CG   1 
ATOM   1663 C CG   B LEU A 1 90  ? 13.038  1.366  5.196  0.54 35.31  ? 90  LEU A CG   1 
ATOM   1664 C CD1  A LEU A 1 90  ? 14.224  2.342  5.154  0.46 52.47  ? 90  LEU A CD1  1 
ATOM   1665 C CD1  B LEU A 1 90  ? 13.006  1.698  6.667  0.54 60.22  ? 90  LEU A CD1  1 
ATOM   1666 C CD2  A LEU A 1 90  ? 12.661  1.600  6.895  0.46 27.32  ? 90  LEU A CD2  1 
ATOM   1667 C CD2  B LEU A 1 90  ? 13.003  -0.144 4.977  0.54 22.63  ? 90  LEU A CD2  1 
ATOM   1668 H H    A LEU A 1 90  ? 13.168  3.453  2.932  0.46 18.22  ? 90  LEU A H    1 
ATOM   1669 H H    B LEU A 1 90  ? 13.027  3.376  2.647  0.54 32.27  ? 90  LEU A H    1 
ATOM   1670 H HA   A LEU A 1 90  ? 11.886  1.078  2.942  0.46 30.42  ? 90  LEU A HA   1 
ATOM   1671 H HA   B LEU A 1 90  ? 11.893  0.911  2.700  0.54 19.20  ? 90  LEU A HA   1 
ATOM   1672 H HB2  A LEU A 1 90  ? 11.754  3.153  4.853  0.46 22.88  ? 90  LEU A HB2  1 
ATOM   1673 H HB2  B LEU A 1 90  ? 11.841  2.932  4.677  0.54 25.99  ? 90  LEU A HB2  1 
ATOM   1674 H HB3  A LEU A 1 90  ? 10.956  1.791  4.985  0.46 22.88  ? 90  LEU A HB3  1 
ATOM   1675 H HB3  B LEU A 1 90  ? 11.047  1.573  4.810  0.54 25.99  ? 90  LEU A HB3  1 
ATOM   1676 H HG   A LEU A 1 90  ? 13.070  0.668  5.131  0.46 26.42  ? 90  LEU A HG   1 
ATOM   1677 H HG   B LEU A 1 90  ? 13.865  1.710  4.823  0.54 42.25  ? 90  LEU A HG   1 
ATOM   1678 H HD11 A LEU A 1 90  ? 14.936  1.928  5.646  0.46 62.84  ? 90  LEU A HD11 1 
ATOM   1679 H HD11 B LEU A 1 90  ? 13.764  1.292  7.095  0.54 72.15  ? 90  LEU A HD11 1 
ATOM   1680 H HD12 A LEU A 1 90  ? 14.417  2.316  4.214  0.46 62.84  ? 90  LEU A HD12 1 
ATOM   1681 H HD12 B LEU A 1 90  ? 13.041  2.652  6.773  0.54 72.15  ? 90  LEU A HD12 1 
ATOM   1682 H HD13 A LEU A 1 90  ? 14.113  3.251  5.441  0.46 62.84  ? 90  LEU A HD13 1 
ATOM   1683 H HD13 B LEU A 1 90  ? 12.193  1.356  7.046  0.54 72.15  ? 90  LEU A HD13 1 
ATOM   1684 H HD21 A LEU A 1 90  ? 13.406  1.212  7.360  0.46 32.66  ? 90  LEU A HD21 1 
ATOM   1685 H HD21 B LEU A 1 90  ? 13.745  -0.543 5.437  0.54 27.04  ? 90  LEU A HD21 1 
ATOM   1686 H HD22 A LEU A 1 90  ? 12.533  2.508  7.181  0.46 32.66  ? 90  LEU A HD22 1 
ATOM   1687 H HD22 B LEU A 1 90  ? 12.177  -0.490 5.323  0.54 27.04  ? 90  LEU A HD22 1 
ATOM   1688 H HD23 A LEU A 1 90  ? 11.867  1.088  7.064  0.46 32.66  ? 90  LEU A HD23 1 
ATOM   1689 H HD23 B LEU A 1 90  ? 13.065  -0.324 4.036  0.54 27.04  ? 90  LEU A HD23 1 
ATOM   1690 N N    A LYS A 1 91  ? 9.595   1.550  2.267  0.46 22.91  ? 91  LYS A N    1 
ATOM   1691 N N    B LYS A 1 91  ? 9.543   1.446  2.237  0.54 22.55  ? 91  LYS A N    1 
ATOM   1692 C CA   A LYS A 1 91  ? 8.356   1.816  1.556  0.46 20.42  ? 91  LYS A CA   1 
ATOM   1693 C CA   B LYS A 1 91  ? 8.324   1.741  1.507  0.54 19.60  ? 91  LYS A CA   1 
ATOM   1694 C C    A LYS A 1 91  ? 7.134   1.663  2.447  0.46 17.44  ? 91  LYS A C    1 
ATOM   1695 C C    B LYS A 1 91  ? 7.152   1.708  2.465  0.54 17.82  ? 91  LYS A C    1 
ATOM   1696 O O    A LYS A 1 91  ? 7.184   1.026  3.503  0.46 21.70  ? 91  LYS A O    1 
ATOM   1697 O O    B LYS A 1 91  ? 7.262   1.222  3.600  0.54 15.06  ? 91  LYS A O    1 
ATOM   1698 C CB   A LYS A 1 91  ? 8.225   0.890  0.346  0.46 24.74  ? 91  LYS A CB   1 
ATOM   1699 C CB   B LYS A 1 91  ? 8.107   0.736  0.373  0.54 27.37  ? 91  LYS A CB   1 
ATOM   1700 C CG   A LYS A 1 91  ? 9.337   1.016  -0.673 0.46 25.40  ? 91  LYS A CG   1 
ATOM   1701 C CG   B LYS A 1 91  ? 9.313   0.510  -0.526 0.54 37.67  ? 91  LYS A CG   1 
ATOM   1702 C CD   A LYS A 1 91  ? 9.079   0.085  -1.855 0.46 41.74  ? 91  LYS A CD   1 
ATOM   1703 C CD   B LYS A 1 91  ? 9.633   1.706  -1.421 0.54 47.50  ? 91  LYS A CD   1 
ATOM   1704 C CE   A LYS A 1 91  ? 10.350  -0.210 -2.657 0.46 61.93  ? 91  LYS A CE   1 
ATOM   1705 C CE   B LYS A 1 91  ? 10.857  1.423  -2.298 0.54 61.05  ? 91  LYS A CE   1 
ATOM   1706 N NZ   A LYS A 1 91  ? 11.175  -1.305 -2.062 0.46 72.81  ? 91  LYS A NZ   1 
ATOM   1707 N NZ   B LYS A 1 91  ? 11.047  2.436  -3.368 0.54 81.01  ? 91  LYS A NZ   1 
ATOM   1708 H H    A LYS A 1 91  ? 9.685   0.731  2.512  0.46 27.37  ? 91  LYS A H    1 
ATOM   1709 H H    B LYS A 1 91  ? 9.583   0.649  2.559  0.54 26.94  ? 91  LYS A H    1 
ATOM   1710 H HA   A LYS A 1 91  ? 8.373   2.739  1.226  0.46 24.39  ? 91  LYS A HA   1 
ATOM   1711 H HA   B LYS A 1 91  ? 8.384   2.639  1.120  0.54 23.40  ? 91  LYS A HA   1 
ATOM   1712 H HB2  A LYS A 1 91  ? 8.216   -0.028 0.659  0.46 29.56  ? 91  LYS A HB2  1 
ATOM   1713 H HB2  B LYS A 1 91  ? 7.867   -0.120 0.761  0.54 32.72  ? 91  LYS A HB2  1 
ATOM   1714 H HB3  A LYS A 1 91  ? 7.389   1.088  -0.105 0.46 29.56  ? 91  LYS A HB3  1 
ATOM   1715 H HB3  B LYS A 1 91  ? 7.381   1.054  -0.187 0.54 32.72  ? 91  LYS A HB3  1 
ATOM   1716 H HG2  A LYS A 1 91  ? 9.374   1.928  -1.002 0.46 30.36  ? 91  LYS A HG2  1 
ATOM   1717 H HG2  B LYS A 1 91  ? 10.090  0.336  0.028  0.54 45.09  ? 91  LYS A HG2  1 
ATOM   1718 H HG3  A LYS A 1 91  ? 10.181  0.768  -0.264 0.46 30.36  ? 91  LYS A HG3  1 
ATOM   1719 H HG3  B LYS A 1 91  ? 9.140   -0.254 -1.099 0.54 45.09  ? 91  LYS A HG3  1 
ATOM   1720 H HD2  A LYS A 1 91  ? 8.731   -0.758 -1.524 0.46 49.97  ? 91  LYS A HD2  1 
ATOM   1721 H HD2  B LYS A 1 91  ? 8.877   1.885  -2.001 0.54 56.88  ? 91  LYS A HD2  1 
ATOM   1722 H HD3  A LYS A 1 91  ? 8.436   0.500  -2.451 0.46 49.97  ? 91  LYS A HD3  1 
ATOM   1723 H HD3  B LYS A 1 91  ? 9.826   2.479  -0.868 0.54 56.88  ? 91  LYS A HD3  1 
ATOM   1724 H HE2  A LYS A 1 91  ? 10.100  -0.477 -3.555 0.46 74.19  ? 91  LYS A HE2  1 
ATOM   1725 H HE2  B LYS A 1 91  ? 11.651  1.423  -1.741 0.54 73.14  ? 91  LYS A HE2  1 
ATOM   1726 H HE3  A LYS A 1 91  ? 10.895  0.592  -2.690 0.46 74.19  ? 91  LYS A HE3  1 
ATOM   1727 H HE3  B LYS A 1 91  ? 10.748  0.557  -2.721 0.54 73.14  ? 91  LYS A HE3  1 
ATOM   1728 H HZ1  A LYS A 1 91  ? 11.958  -1.453 -2.597 0.46 87.25  ? 91  LYS A HZ1  1 
ATOM   1729 H HZ1  B LYS A 1 91  ? 11.823  2.219  -3.891 0.54 97.09  ? 91  LYS A HZ1  1 
ATOM   1730 H HZ2  A LYS A 1 91  ? 11.446  -1.065 -1.172 0.46 87.25  ? 91  LYS A HZ2  1 
ATOM   1731 H HZ2  B LYS A 1 91  ? 10.278  2.453  -3.943 0.54 97.09  ? 91  LYS A HZ2  1 
ATOM   1732 H HZ3  A LYS A 1 91  ? 10.665  -2.117 -2.024 0.46 87.25  ? 91  LYS A HZ3  1 
ATOM   1733 H HZ3  B LYS A 1 91  ? 11.166  3.305  -2.979 0.54 97.09  ? 91  LYS A HZ3  1 
ATOM   1734 N N    . HIS A 1 92  ? 6.036   2.253  1.990  1.00 16.73  ? 92  HIS A N    1 
ATOM   1735 C CA   . HIS A 1 92  ? 4.791   2.253  2.717  1.00 15.95  ? 92  HIS A CA   1 
ATOM   1736 C C    . HIS A 1 92  ? 4.060   0.946  2.411  1.00 18.41  ? 92  HIS A C    1 
ATOM   1737 O O    . HIS A 1 92  ? 3.205   0.872  1.523  1.00 21.30  ? 92  HIS A O    1 
ATOM   1738 C CB   . HIS A 1 92  ? 3.956   3.460  2.297  1.00 16.45  ? 92  HIS A CB   1 
ATOM   1739 C CG   . HIS A 1 92  ? 4.596   4.775  2.594  1.00 14.29  ? 92  HIS A CG   1 
ATOM   1740 N ND1  . HIS A 1 92  ? 5.536   5.361  1.769  1.00 14.42  ? 92  HIS A ND1  1 
ATOM   1741 C CD2  . HIS A 1 92  ? 4.387   5.650  3.612  1.00 15.13  ? 92  HIS A CD2  1 
ATOM   1742 C CE1  . HIS A 1 92  ? 5.901   6.523  2.288  1.00 14.26  ? 92  HIS A CE1  1 
ATOM   1743 N NE2  . HIS A 1 92  ? 5.215   6.722  3.405  1.00 15.00  ? 92  HIS A NE2  1 
ATOM   1744 H H    A HIS A 1 92  ? 5.994   2.670  1.238  0.45 19.96  ? 92  HIS A H    1 
ATOM   1745 H H    B HIS A 1 92  ? 5.983   2.639  1.223  0.55 19.96  ? 92  HIS A H    1 
ATOM   1746 H HA   . HIS A 1 92  ? 4.965   2.305  3.680  1.00 19.02  ? 92  HIS A HA   1 
ATOM   1747 H HB2  . HIS A 1 92  ? 3.802   3.415  1.340  1.00 19.62  ? 92  HIS A HB2  1 
ATOM   1748 H HB3  . HIS A 1 92  ? 3.107   3.431  2.767  1.00 19.62  ? 92  HIS A HB3  1 
ATOM   1749 H HD2  . HIS A 1 92  ? 3.803   5.535  4.327  1.00 18.04  ? 92  HIS A HD2  1 
ATOM   1750 H HE1  . HIS A 1 92  ? 6.529   7.106  1.926  1.00 16.99  ? 92  HIS A HE1  1 
ATOM   1751 N N    . THR A 1 93  ? 4.370   -0.089 3.182  1.00 17.95  ? 93  THR A N    1 
ATOM   1752 C CA   . THR A 1 93  ? 3.942   -1.439 2.823  1.00 22.34  ? 93  THR A CA   1 
ATOM   1753 C C    . THR A 1 93  ? 2.630   -1.904 3.437  1.00 21.33  ? 93  THR A C    1 
ATOM   1754 O O    . THR A 1 93  ? 2.100   -2.953 3.054  1.00 27.04  ? 93  THR A O    1 
ATOM   1755 C CB   . THR A 1 93  ? 5.023   -2.452 3.238  1.00 24.25  ? 93  THR A CB   1 
ATOM   1756 O OG1  . THR A 1 93  ? 5.388   -2.211 4.605  1.00 27.11  ? 93  THR A OG1  1 
ATOM   1757 C CG2  . THR A 1 93  ? 6.243   -2.290 2.344  1.00 30.49  ? 93  THR A CG2  1 
ATOM   1758 H H    . THR A 1 93  ? 4.822   -0.040 3.912  1.00 21.43  ? 93  THR A H    1 
ATOM   1759 H HA   . THR A 1 93  ? 3.847   -1.487 1.849  1.00 26.70  ? 93  THR A HA   1 
ATOM   1760 H HB   . THR A 1 93  ? 4.682   -3.355 3.142  1.00 28.98  ? 93  THR A HB   1 
ATOM   1761 H HG1  . THR A 1 93  ? 5.965   -2.745 4.839  1.00 32.41  ? 93  THR A HG1  1 
ATOM   1762 H HG21 . THR A 1 93  ? 6.922   -2.920 2.599  1.00 36.47  ? 93  THR A HG21 1 
ATOM   1763 H HG22 . THR A 1 93  ? 6.002   -2.445 1.428  1.00 36.47  ? 93  THR A HG22 1 
ATOM   1764 H HG23 . THR A 1 93  ? 6.596   -1.401 2.429  1.00 36.47  ? 93  THR A HG23 1 
ATOM   1765 N N    . GLY A 1 94  ? 2.091   -1.144 4.377  1.00 21.19  ? 94  GLY A N    1 
ATOM   1766 C CA   . GLY A 1 94  ? 0.876   -1.549 5.049  1.00 20.41  ? 94  GLY A CA   1 
ATOM   1767 C C    . GLY A 1 94  ? 0.621   -0.795 6.330  1.00 20.56  ? 94  GLY A C    1 
ATOM   1768 O O    . GLY A 1 94  ? 1.317   0.164  6.637  1.00 20.48  ? 94  GLY A O    1 
ATOM   1769 H H    . GLY A 1 94  ? 2.411   -0.391 4.641  1.00 25.31  ? 94  GLY A H    1 
ATOM   1770 H HA2  . GLY A 1 94  ? 0.121   -1.407 4.457  1.00 24.37  ? 94  GLY A HA2  1 
ATOM   1771 H HA3  . GLY A 1 94  ? 0.926   -2.495 5.258  1.00 24.37  ? 94  GLY A HA3  1 
ATOM   1772 N N    . PRO A 1 95  ? -0.393  -1.236 7.093  1.00 18.96  ? 95  PRO A N    1 
ATOM   1773 C CA   . PRO A 1 95  ? -0.693  -0.623 8.386  1.00 19.27  ? 95  PRO A CA   1 
ATOM   1774 C C    . PRO A 1 95  ? 0.496   -0.713 9.329  1.00 20.32  ? 95  PRO A C    1 
ATOM   1775 O O    . PRO A 1 95  ? 1.267   -1.688 9.341  1.00 22.80  ? 95  PRO A O    1 
ATOM   1776 C CB   . PRO A 1 95  ? -1.882  -1.458 8.903  1.00 24.10  ? 95  PRO A CB   1 
ATOM   1777 C CG   . PRO A 1 95  ? -2.446  -2.159 7.712  1.00 32.30  ? 95  PRO A CG   1 
ATOM   1778 C CD   . PRO A 1 95  ? -1.304  -2.363 6.776  1.00 24.33  ? 95  PRO A CD   1 
ATOM   1779 H HA   . PRO A 1 95  ? -0.964  0.312  8.276  1.00 23.01  ? 95  PRO A HA   1 
ATOM   1780 H HB2  . PRO A 1 95  ? -1.567  -2.101 9.558  1.00 28.80  ? 95  PRO A HB2  1 
ATOM   1781 H HB3  . PRO A 1 95  ? -2.545  -0.869 9.296  1.00 28.80  ? 95  PRO A HB3  1 
ATOM   1782 H HG2  . PRO A 1 95  ? -2.819  -3.012 7.984  1.00 38.64  ? 95  PRO A HG2  1 
ATOM   1783 H HG3  . PRO A 1 95  ? -3.128  -1.605 7.301  1.00 38.64  ? 95  PRO A HG3  1 
ATOM   1784 H HD2  . PRO A 1 95  ? -0.868  -3.210 6.954  1.00 29.08  ? 95  PRO A HD2  1 
ATOM   1785 H HD3  . PRO A 1 95  ? -1.606  -2.304 5.856  1.00 29.08  ? 95  PRO A HD3  1 
ATOM   1786 N N    . GLY A 1 96  ? 0.661   0.350  10.109 1.00 17.96  ? 96  GLY A N    1 
ATOM   1787 C CA   . GLY A 1 96  ? 1.640   0.425  11.166 1.00 16.31  ? 96  GLY A CA   1 
ATOM   1788 C C    . GLY A 1 96  ? 2.915   1.159  10.767 1.00 14.60  ? 96  GLY A C    1 
ATOM   1789 O O    . GLY A 1 96  ? 3.758   1.410  11.602 1.00 17.95  ? 96  GLY A O    1 
ATOM   1790 H H    . GLY A 1 96  ? 0.192   1.067  10.034 1.00 21.44  ? 96  GLY A H    1 
ATOM   1791 H HA2  . GLY A 1 96  ? 1.252   0.883  11.928 1.00 19.46  ? 96  GLY A HA2  1 
ATOM   1792 H HA3  . GLY A 1 96  ? 1.881   -0.473 11.442 1.00 19.46  ? 96  GLY A HA3  1 
ATOM   1793 N N    A ILE A 1 97  ? 3.052   1.478  9.478  0.63 16.86  ? 97  ILE A N    1 
ATOM   1794 N N    B ILE A 1 97  ? 3.035   1.528  9.500  0.37 15.73  ? 97  ILE A N    1 
ATOM   1795 C CA   A ILE A 1 97  ? 4.216   2.207  8.981  0.63 14.20  ? 97  ILE A CA   1 
ATOM   1796 C CA   B ILE A 1 97  ? 4.223   2.222  9.043  0.37 13.24  ? 97  ILE A CA   1 
ATOM   1797 C C    A ILE A 1 97  ? 4.213   3.626  9.572  0.63 10.91  ? 97  ILE A C    1 
ATOM   1798 C C    B ILE A 1 97  ? 4.177   3.696  9.417  0.37 23.96  ? 97  ILE A C    1 
ATOM   1799 O O    A ILE A 1 97  ? 3.161   4.258  9.706  0.63 11.38  ? 97  ILE A O    1 
ATOM   1800 O O    B ILE A 1 97  ? 3.209   4.421  9.080  0.37 15.43  ? 97  ILE A O    1 
ATOM   1801 C CB   A ILE A 1 97  ? 4.214   2.244  7.427  0.63 19.48  ? 97  ILE A CB   1 
ATOM   1802 C CB   B ILE A 1 97  ? 4.386   2.093  7.529  0.37 14.73  ? 97  ILE A CB   1 
ATOM   1803 C CG1  A ILE A 1 97  ? 4.659   0.882  6.859  0.63 18.86  ? 97  ILE A CG1  1 
ATOM   1804 C CG1  B ILE A 1 97  ? 4.484   0.615  7.143  0.37 26.07  ? 97  ILE A CG1  1 
ATOM   1805 C CG2  A ILE A 1 97  ? 5.077   3.401  6.892  0.63 13.09  ? 97  ILE A CG2  1 
ATOM   1806 C CG2  B ILE A 1 97  ? 5.607   2.872  7.056  0.37 25.13  ? 97  ILE A CG2  1 
ATOM   1807 C CD1  A ILE A 1 97  ? 6.131   0.536  7.156  0.63 22.14  ? 97  ILE A CD1  1 
ATOM   1808 C CD1  B ILE A 1 97  ? 5.698   -0.093 7.723  0.37 34.61  ? 97  ILE A CD1  1 
ATOM   1809 H H    A ILE A 1 97  ? 2.478   1.281  8.868  0.63 20.11  ? 97  ILE A H    1 
ATOM   1810 H H    B ILE A 1 97  ? 2.446   1.388  8.890  0.37 18.75  ? 97  ILE A H    1 
ATOM   1811 H HA   A ILE A 1 97  ? 5.032   1.752  9.276  0.63 16.93  ? 97  ILE A HA   1 
ATOM   1812 H HA   B ILE A 1 97  ? 5.010   1.825  9.469  0.37 15.77  ? 97  ILE A HA   1 
ATOM   1813 H HB   A ILE A 1 97  ? 3.301   2.399  7.138  0.63 23.26  ? 97  ILE A HB   1 
ATOM   1814 H HB   B ILE A 1 97  ? 3.600   2.468  7.103  0.37 17.56  ? 97  ILE A HB   1 
ATOM   1815 H HG12 A ILE A 1 97  ? 4.106   0.186  7.247  0.63 22.51  ? 97  ILE A HG12 1 
ATOM   1816 H HG12 B ILE A 1 97  ? 3.692   0.155  7.464  0.37 31.17  ? 97  ILE A HG12 1 
ATOM   1817 H HG13 A ILE A 1 97  ? 4.546   0.894  5.896  0.63 22.51  ? 97  ILE A HG13 1 
ATOM   1818 H HG13 B ILE A 1 97  ? 4.534   0.547  6.177  0.37 31.17  ? 97  ILE A HG13 1 
ATOM   1819 H HG21 A ILE A 1 97  ? 5.051   3.392  5.932  0.63 15.59  ? 97  ILE A HG21 1 
ATOM   1820 H HG21 B ILE A 1 97  ? 5.689   2.776  6.104  0.37 30.04  ? 97  ILE A HG21 1 
ATOM   1821 H HG22 A ILE A 1 97  ? 4.724   4.231  7.221  0.63 15.59  ? 97  ILE A HG22 1 
ATOM   1822 H HG22 B ILE A 1 97  ? 5.494   3.798  7.283  0.37 30.04  ? 97  ILE A HG22 1 
ATOM   1823 H HG23 A ILE A 1 97  ? 5.979   3.285  7.197  0.63 15.59  ? 97  ILE A HG23 1 
ATOM   1824 H HG23 B ILE A 1 97  ? 6.389   2.522  7.489  0.37 30.04  ? 97  ILE A HG23 1 
ATOM   1825 H HD11 A ILE A 1 97  ? 6.334   -0.320 6.774  0.63 26.45  ? 97  ILE A HD11 1 
ATOM   1826 H HD11 B ILE A 1 97  ? 5.690   -1.010 7.439  0.37 41.42  ? 97  ILE A HD11 1 
ATOM   1827 H HD12 A ILE A 1 97  ? 6.695   1.210  6.769  0.63 26.45  ? 97  ILE A HD12 1 
ATOM   1828 H HD12 B ILE A 1 97  ? 6.493   0.342  7.406  0.37 41.42  ? 97  ILE A HD12 1 
ATOM   1829 H HD13 A ILE A 1 97  ? 6.260   0.509  8.108  0.63 26.45  ? 97  ILE A HD13 1 
ATOM   1830 H HD13 B ILE A 1 97  ? 5.659   -0.046 8.681  0.37 41.42  ? 97  ILE A HD13 1 
ATOM   1831 N N    A LEU A 1 98  ? 5.400   4.097  9.945  0.63 11.08  ? 98  LEU A N    1 
ATOM   1832 N N    B LEU A 1 98  ? 5.228   4.108  10.122 0.37 18.12  ? 98  LEU A N    1 
ATOM   1833 C CA   A LEU A 1 98  ? 5.592   5.439  10.505 0.63 15.52  ? 98  LEU A CA   1 
ATOM   1834 C CA   B LEU A 1 98  ? 5.523   5.512  10.398 0.37 17.11  ? 98  LEU A CA   1 
ATOM   1835 C C    A LEU A 1 98  ? 6.444   6.264  9.502  0.63 13.18  ? 98  LEU A C    1 
ATOM   1836 C C    B LEU A 1 98  ? 6.278   6.121  9.224  0.37 11.74  ? 98  LEU A C    1 
ATOM   1837 O O    A LEU A 1 98  ? 7.597   5.924  9.185  0.63 9.61   ? 98  LEU A O    1 
ATOM   1838 O O    B LEU A 1 98  ? 7.194   5.512  8.675  0.37 10.05  ? 98  LEU A O    1 
ATOM   1839 C CB   A LEU A 1 98  ? 6.272   5.307  11.875 0.63 24.37  ? 98  LEU A CB   1 
ATOM   1840 C CB   B LEU A 1 98  ? 6.403   5.648  11.644 0.37 13.06  ? 98  LEU A CB   1 
ATOM   1841 C CG   A LEU A 1 98  ? 6.617   6.547  12.685 0.63 18.15  ? 98  LEU A CG   1 
ATOM   1842 C CG   B LEU A 1 98  ? 5.830   5.352  13.024 0.37 27.32  ? 98  LEU A CG   1 
ATOM   1843 C CD1  A LEU A 1 98  ? 5.406   7.348  13.086 0.63 17.96  ? 98  LEU A CD1  1 
ATOM   1844 C CD1  B LEU A 1 98  ? 6.950   5.330  14.046 0.37 46.80  ? 98  LEU A CD1  1 
ATOM   1845 C CD2  A LEU A 1 98  ? 7.377   6.094  13.924 0.63 18.26  ? 98  LEU A CD2  1 
ATOM   1846 C CD2  B LEU A 1 98  ? 4.786   6.374  13.399 0.37 31.17  ? 98  LEU A CD2  1 
ATOM   1847 H H    A LEU A 1 98  ? 6.130   3.647  9.883  0.63 13.18  ? 98  LEU A H    1 
ATOM   1848 H H    B LEU A 1 98  ? 5.806   3.571  10.465 0.37 21.63  ? 98  LEU A H    1 
ATOM   1849 H HA   A LEU A 1 98  ? 4.724   5.879  10.622 0.63 18.51  ? 98  LEU A HA   1 
ATOM   1850 H HA   B LEU A 1 98  ? 4.691   6.010  10.538 0.37 20.41  ? 98  LEU A HA   1 
ATOM   1851 H HB2  A LEU A 1 98  ? 5.692   4.768  12.435 0.63 29.13  ? 98  LEU A HB2  1 
ATOM   1852 H HB2  B LEU A 1 98  ? 7.162   5.054  11.529 0.37 15.55  ? 98  LEU A HB2  1 
ATOM   1853 H HB3  A LEU A 1 98  ? 7.104   4.828  11.740 0.63 29.13  ? 98  LEU A HB3  1 
ATOM   1854 H HB3  B LEU A 1 98  ? 6.727   6.562  11.671 0.37 15.55  ? 98  LEU A HB3  1 
ATOM   1855 H HG   A LEU A 1 98  ? 7.201   7.119  12.162 0.63 21.66  ? 98  LEU A HG   1 
ATOM   1856 H HG   B LEU A 1 98  ? 5.410   4.478  13.015 0.37 32.66  ? 98  LEU A HG   1 
ATOM   1857 H HD11 A LEU A 1 98  ? 5.690   8.113  13.591 0.63 21.43  ? 98  LEU A HD11 1 
ATOM   1858 H HD11 B LEU A 1 98  ? 6.580   5.143  14.911 0.37 56.05  ? 98  LEU A HD11 1 
ATOM   1859 H HD12 A LEU A 1 98  ? 4.943   7.632  12.294 0.63 21.43  ? 98  LEU A HD12 1 
ATOM   1860 H HD12 B LEU A 1 98  ? 7.580   4.647  13.804 0.37 56.05  ? 98  LEU A HD12 1 
ATOM   1861 H HD13 A LEU A 1 98  ? 4.831   6.796  13.622 0.63 21.43  ? 98  LEU A HD13 1 
ATOM   1862 H HD13 B LEU A 1 98  ? 7.383   6.187  14.052 0.37 56.05  ? 98  LEU A HD13 1 
ATOM   1863 H HD21 A LEU A 1 98  ? 7.605   6.865  14.450 0.63 21.80  ? 98  LEU A HD21 1 
ATOM   1864 H HD21 B LEU A 1 98  ? 4.442   6.164  14.271 0.37 37.28  ? 98  LEU A HD21 1 
ATOM   1865 H HD22 A LEU A 1 98  ? 6.818   5.503  14.434 0.63 21.80  ? 98  LEU A HD22 1 
ATOM   1866 H HD22 B LEU A 1 98  ? 5.190   7.245  13.407 0.37 37.28  ? 98  LEU A HD22 1 
ATOM   1867 H HD23 A LEU A 1 98  ? 8.175   5.636  13.651 0.63 21.80  ? 98  LEU A HD23 1 
ATOM   1868 H HD23 B LEU A 1 98  ? 4.077   6.348  12.752 0.37 37.28  ? 98  LEU A HD23 1 
ATOM   1869 N N    A SER A 1 99  ? 5.848   7.341  9.003  0.63 12.49  ? 99  SER A N    1 
ATOM   1870 N N    B SER A 1 99  ? 5.897   7.337  8.855  0.37 15.41  ? 99  SER A N    1 
ATOM   1871 C CA   A SER A 1 99  ? 6.394   8.125  7.899  0.63 13.11  ? 99  SER A CA   1 
ATOM   1872 C CA   B SER A 1 99  ? 6.614   8.098  7.832  0.37 16.40  ? 99  SER A CA   1 
ATOM   1873 C C    A SER A 1 99  ? 6.336   9.629  8.205  0.63 12.52  ? 99  SER A C    1 
ATOM   1874 C C    B SER A 1 99  ? 6.423   9.596  8.097  0.37 19.14  ? 99  SER A C    1 
ATOM   1875 O O    A SER A 1 99  ? 5.485   10.103 8.943  0.63 12.68  ? 99  SER A O    1 
ATOM   1876 O O    B SER A 1 99  ? 5.483   10.013 8.762  0.37 17.56  ? 99  SER A O    1 
ATOM   1877 C CB   A SER A 1 99  ? 5.606   7.828  6.617  0.63 13.57  ? 99  SER A CB   1 
ATOM   1878 C CB   B SER A 1 99  ? 6.150   7.721  6.417  0.37 16.85  ? 99  SER A CB   1 
ATOM   1879 O OG   A SER A 1 99  ? 6.268   8.360  5.479  0.63 13.95  ? 99  SER A OG   1 
ATOM   1880 O OG   B SER A 1 99  ? 4.883   8.287  6.124  0.37 27.21  ? 99  SER A OG   1 
ATOM   1881 H H    A SER A 1 99  ? 5.100   7.648  9.297  0.63 14.88  ? 99  SER A H    1 
ATOM   1882 H H    B SER A 1 99  ? 5.218   7.751  9.183  0.37 18.37  ? 99  SER A H    1 
ATOM   1883 H HA   A SER A 1 99  ? 7.330   7.875  7.752  0.63 15.61  ? 99  SER A HA   1 
ATOM   1884 H HA   B SER A 1 99  ? 7.571   7.898  7.899  0.37 19.56  ? 99  SER A HA   1 
ATOM   1885 H HB2  A SER A 1 99  ? 5.523   6.867  6.513  0.63 16.17  ? 99  SER A HB2  1 
ATOM   1886 H HB2  B SER A 1 99  ? 6.798   8.051  5.775  0.37 20.11  ? 99  SER A HB2  1 
ATOM   1887 H HB3  A SER A 1 99  ? 4.726   8.231  6.687  0.63 16.17  ? 99  SER A HB3  1 
ATOM   1888 H HB3  B SER A 1 99  ? 6.084   6.755  6.355  0.37 20.11  ? 99  SER A HB3  1 
ATOM   1889 H HG   A SER A 1 99  ? 5.837   8.194  4.801  0.63 16.62  ? 99  SER A HG   1 
ATOM   1890 H HG   B SER A 1 99  ? 4.615   8.722  6.766  0.37 32.53  ? 99  SER A HG   1 
ATOM   1891 N N    A MET A 1 100 ? 7.250   10.392 7.626  0.63 15.44  ? 100 MET A N    1 
ATOM   1892 N N    B MET A 1 100 ? 7.321   10.404 7.558  0.37 10.82  ? 100 MET A N    1 
ATOM   1893 C CA   A MET A 1 100 ? 7.303   11.846 7.832  0.63 14.86  ? 100 MET A CA   1 
ATOM   1894 C CA   B MET A 1 100 ? 7.355   11.848 7.846  0.37 12.08  ? 100 MET A CA   1 
ATOM   1895 C C    A MET A 1 100 ? 6.303   12.576 6.947  0.63 12.24  ? 100 MET A C    1 
ATOM   1896 C C    B MET A 1 100 ? 6.380   12.629 6.953  0.37 17.09  ? 100 MET A C    1 
ATOM   1897 O O    A MET A 1 100 ? 6.229   12.341 5.735  0.63 15.74  ? 100 MET A O    1 
ATOM   1898 O O    B MET A 1 100 ? 6.383   12.466 5.727  0.37 14.24  ? 100 MET A O    1 
ATOM   1899 C CB   A MET A 1 100 ? 8.709   12.365 7.527  0.63 18.70  ? 100 MET A CB   1 
ATOM   1900 C CB   B MET A 1 100 ? 8.769   12.376 7.622  0.37 17.08  ? 100 MET A CB   1 
ATOM   1901 C CG   A MET A 1 100 ? 9.734   11.929 8.558  0.63 21.90  ? 100 MET A CG   1 
ATOM   1902 C CG   B MET A 1 100 ? 9.783   11.947 8.692  0.37 20.29  ? 100 MET A CG   1 
ATOM   1903 S SD   A MET A 1 100 ? 9.334   12.420 10.247 0.63 18.18  ? 100 MET A SD   1 
ATOM   1904 S SD   B MET A 1 100 ? 9.345   12.432 10.382 0.37 14.17  ? 100 MET A SD   1 
ATOM   1905 C CE   A MET A 1 100 ? 9.564   14.206 10.174 0.63 16.52  ? 100 MET A CE   1 
ATOM   1906 C CE   B MET A 1 100 ? 10.875  12.151 11.345 0.37 49.87  ? 100 MET A CE   1 
ATOM   1907 H H    A MET A 1 100 ? 7.863   10.095 7.102  0.63 18.41  ? 100 MET A H    1 
ATOM   1908 H H    B MET A 1 100 ? 7.934   10.146 7.012  0.37 12.86  ? 100 MET A H    1 
ATOM   1909 H HA   A MET A 1 100 ? 7.103   12.044 8.770  0.63 17.72  ? 100 MET A HA   1 
ATOM   1910 H HA   B MET A 1 100 ? 7.118   11.994 8.786  0.37 14.37  ? 100 MET A HA   1 
ATOM   1911 H HB2  A MET A 1 100 ? 8.991   12.026 6.663  0.63 22.33  ? 100 MET A HB2  1 
ATOM   1912 H HB2  B MET A 1 100 ? 9.090   12.052 6.766  0.37 20.38  ? 100 MET A HB2  1 
ATOM   1913 H HB3  A MET A 1 100 ? 8.692   13.335 7.513  0.63 22.33  ? 100 MET A HB3  1 
ATOM   1914 H HB3  B MET A 1 100 ? 8.741   13.346 7.615  0.37 20.38  ? 100 MET A HB3  1 
ATOM   1915 H HG2  A MET A 1 100 ? 9.803   10.962 8.540  0.63 26.17  ? 100 MET A HG2  1 
ATOM   1916 H HG2  B MET A 1 100 ? 9.861   10.980 8.675  0.37 24.23  ? 100 MET A HG2  1 
ATOM   1917 H HG3  A MET A 1 100 ? 10.591  12.323 8.332  0.63 26.17  ? 100 MET A HG3  1 
ATOM   1918 H HG3  B MET A 1 100 ? 10.641  12.348 8.485  0.37 24.23  ? 100 MET A HG3  1 
ATOM   1919 H HE1  A MET A 1 100 ? 9.374   14.580 11.037 0.63 19.71  ? 100 MET A HE1  1 
ATOM   1920 H HE1  B MET A 1 100 ? 10.715  12.390 12.261 0.37 59.72  ? 100 MET A HE1  1 
ATOM   1921 H HE2  A MET A 1 100 ? 10.472  14.394 9.928  0.63 19.71  ? 100 MET A HE2  1 
ATOM   1922 H HE2  B MET A 1 100 ? 11.115  11.223 11.285 0.37 59.72  ? 100 MET A HE2  1 
ATOM   1923 H HE3  A MET A 1 100 ? 8.964   14.571 9.519  0.63 19.71  ? 100 MET A HE3  1 
ATOM   1924 H HE3  B MET A 1 100 ? 11.577  12.695 10.982 0.37 59.72  ? 100 MET A HE3  1 
ATOM   1925 N N    . ALA A 1 101 ? 5.542   13.459 7.574  1.00 12.32  ? 101 ALA A N    1 
ATOM   1926 C CA   . ALA A 1 101 ? 4.751   14.448 6.849  1.00 13.65  ? 101 ALA A CA   1 
ATOM   1927 C C    . ALA A 1 101 ? 5.705   15.500 6.303  1.00 14.00  ? 101 ALA A C    1 
ATOM   1928 O O    . ALA A 1 101 ? 6.804   15.709 6.848  1.00 16.51  ? 101 ALA A O    1 
ATOM   1929 C CB   . ALA A 1 101 ? 3.690   15.098 7.768  1.00 15.08  ? 101 ALA A CB   1 
ATOM   1930 H H    A ALA A 1 101 ? 5.464   13.509 8.429  0.65 14.66  ? 101 ALA A H    1 
ATOM   1931 H H    B ALA A 1 101 ? 5.414   13.468 8.424  0.35 14.66  ? 101 ALA A H    1 
ATOM   1932 H HA   . ALA A 1 101 ? 4.293   14.018 6.097  1.00 16.26  ? 101 ALA A HA   1 
ATOM   1933 H HB1  . ALA A 1 101 ? 3.189   15.741 7.260  1.00 17.98  ? 101 ALA A HB1  1 
ATOM   1934 H HB2  . ALA A 1 101 ? 3.103   14.415 8.100  1.00 17.98  ? 101 ALA A HB2  1 
ATOM   1935 H HB3  . ALA A 1 101 ? 4.135   15.533 8.499  1.00 17.98  ? 101 ALA A HB3  1 
ATOM   1936 N N    . ASN A 1 102 ? 5.325   16.130 5.202  1.00 13.67  ? 102 ASN A N    1 
ATOM   1937 C CA   . ASN A 1 102 ? 6.125   17.204 4.655  1.00 13.95  ? 102 ASN A CA   1 
ATOM   1938 C C    . ASN A 1 102 ? 5.301   18.119 3.762  1.00 16.74  ? 102 ASN A C    1 
ATOM   1939 O O    . ASN A 1 102 ? 4.114   17.853 3.517  1.00 21.10  ? 102 ASN A O    1 
ATOM   1940 C CB   . ASN A 1 102 ? 7.375   16.653 3.925  1.00 16.66  ? 102 ASN A CB   1 
ATOM   1941 C CG   . ASN A 1 102 ? 7.026   15.886 2.681  1.00 16.87  ? 102 ASN A CG   1 
ATOM   1942 O OD1  . ASN A 1 102 ? 6.298   16.379 1.831  1.00 18.45  ? 102 ASN A OD1  1 
ATOM   1943 N ND2  . ASN A 1 102 ? 7.567   14.672 2.554  1.00 17.25  ? 102 ASN A ND2  1 
ATOM   1944 H H    . ASN A 1 102 ? 4.611   15.954 4.757  1.00 16.29  ? 102 ASN A H    1 
ATOM   1945 H HA   . ASN A 1 102 ? 6.449   17.750 5.401  1.00 16.62  ? 102 ASN A HA   1 
ATOM   1946 H HB2  . ASN A 1 102 ? 7.946   17.395 3.671  1.00 19.88  ? 102 ASN A HB2  1 
ATOM   1947 H HB3  . ASN A 1 102 ? 7.853   16.056 4.522  1.00 19.88  ? 102 ASN A HB3  1 
ATOM   1948 H HD21 . ASN A 1 102 ? 7.372   14.129 1.762  1.00 20.59  ? 102 ASN A HD21 1 
ATOM   1949 H HD22 . ASN A 1 102 ? 8.160   14.324 3.253  1.00 20.59  ? 102 ASN A HD22 1 
ATOM   1950 N N    . ALA A 1 103 ? 5.949   19.174 3.257  1.00 17.67  ? 103 ALA A N    1 
ATOM   1951 C CA   . ALA A 1 103 ? 5.297   20.190 2.429  1.00 20.93  ? 103 ALA A CA   1 
ATOM   1952 C C    . ALA A 1 103 ? 6.037   20.404 1.136  1.00 21.15  ? 103 ALA A C    1 
ATOM   1953 O O    . ALA A 1 103 ? 5.971   21.475 0.551  1.00 28.35  ? 103 ALA A O    1 
ATOM   1954 C CB   . ALA A 1 103 ? 5.213   21.506 3.187  1.00 24.60  ? 103 ALA A CB   1 
ATOM   1955 H H    . ALA A 1 103 ? 6.786   19.325 3.384  1.00 21.09  ? 103 ALA A H    1 
ATOM   1956 H HA   . ALA A 1 103 ? 4.385   19.899 2.216  1.00 25.00  ? 103 ALA A HA   1 
ATOM   1957 H HB1  . ALA A 1 103 ? 4.784   22.160 2.631  1.00 29.41  ? 103 ALA A HB1  1 
ATOM   1958 H HB2  . ALA A 1 103 ? 4.703   21.372 3.989  1.00 29.41  ? 103 ALA A HB2  1 
ATOM   1959 H HB3  . ALA A 1 103 ? 6.101   21.796 3.408  1.00 29.41  ? 103 ALA A HB3  1 
ATOM   1960 N N    . GLY A 1 104 ? 6.707   19.365 0.661  1.00 18.37  ? 104 GLY A N    1 
ATOM   1961 C CA   . GLY A 1 104 ? 7.568   19.498 -0.502 1.00 20.02  ? 104 GLY A CA   1 
ATOM   1962 C C    . GLY A 1 104 ? 8.879   18.795 -0.232 1.00 16.11  ? 104 GLY A C    1 
ATOM   1963 O O    . GLY A 1 104 ? 9.103   18.312 0.874  1.00 16.06  ? 104 GLY A O    1 
ATOM   1964 H H    . GLY A 1 104 ? 6.681   18.573 0.994  1.00 21.93  ? 104 GLY A H    1 
ATOM   1965 H HA2  . GLY A 1 104 ? 7.145   19.097 -1.278 1.00 23.90  ? 104 GLY A HA2  1 
ATOM   1966 H HA3  . GLY A 1 104 ? 7.741   20.435 -0.684 1.00 23.90  ? 104 GLY A HA3  1 
ATOM   1967 N N    . PRO A 1 105 ? 9.741   18.714 -1.249 1.00 15.49  ? 105 PRO A N    1 
ATOM   1968 C CA   . PRO A 1 105 ? 11.077  18.147 -1.044 1.00 16.00  ? 105 PRO A CA   1 
ATOM   1969 C C    . PRO A 1 105 ? 11.869  18.802 0.084  1.00 15.68  ? 105 PRO A C    1 
ATOM   1970 O O    . PRO A 1 105 ? 11.882  20.024 0.229  1.00 18.37  ? 105 PRO A O    1 
ATOM   1971 C CB   . PRO A 1 105 ? 11.780  18.375 -2.400 1.00 19.52  ? 105 PRO A CB   1 
ATOM   1972 C CG   . PRO A 1 105 ? 10.792  18.955 -3.300 1.00 35.06  ? 105 PRO A CG   1 
ATOM   1973 C CD   . PRO A 1 105 ? 9.598   19.370 -2.558 1.00 20.17  ? 105 PRO A CD   1 
ATOM   1974 H HA   . PRO A 1 105 ? 11.012  17.184 -0.874 1.00 19.08  ? 105 PRO A HA   1 
ATOM   1975 H HB2  . PRO A 1 105 ? 12.524  18.986 -2.278 1.00 23.31  ? 105 PRO A HB2  1 
ATOM   1976 H HB3  . PRO A 1 105 ? 12.095  17.526 -2.746 1.00 23.31  ? 105 PRO A HB3  1 
ATOM   1977 H HG2  . PRO A 1 105 ? 11.187  19.724 -3.740 1.00 41.96  ? 105 PRO A HG2  1 
ATOM   1978 H HG3  . PRO A 1 105 ? 10.549  18.290 -3.963 1.00 41.96  ? 105 PRO A HG3  1 
ATOM   1979 H HD2  . PRO A 1 105 ? 9.588   20.334 -2.451 1.00 24.09  ? 105 PRO A HD2  1 
ATOM   1980 H HD3  . PRO A 1 105 ? 8.798   19.055 -3.006 1.00 24.09  ? 105 PRO A HD3  1 
ATOM   1981 N N    . ASN A 1 106 ? 12.477  17.979 0.924  1.00 15.31  ? 106 ASN A N    1 
ATOM   1982 C CA   . ASN A 1 106 ? 13.382  18.459 1.975  1.00 15.78  ? 106 ASN A CA   1 
ATOM   1983 C C    . ASN A 1 106 ? 12.774  19.452 2.944  1.00 17.04  ? 106 ASN A C    1 
ATOM   1984 O O    . ASN A 1 106 ? 13.377  20.492 3.267  1.00 18.21  ? 106 ASN A O    1 
ATOM   1985 C CB   . ASN A 1 106 ? 14.636  19.020 1.313  1.00 17.37  ? 106 ASN A CB   1 
ATOM   1986 C CG   . ASN A 1 106 ? 15.270  18.000 0.361  1.00 15.59  ? 106 ASN A CG   1 
ATOM   1987 O OD1  . ASN A 1 106 ? 15.567  16.863 0.768  1.00 17.08  ? 106 ASN A OD1  1 
ATOM   1988 N ND2  . ASN A 1 106 ? 15.440  18.381 -0.912 1.00 17.95  ? 106 ASN A ND2  1 
ATOM   1989 H H    . ASN A 1 106 ? 12.384  17.124 0.912  1.00 18.25  ? 106 ASN A H    1 
ATOM   1990 H HA   . ASN A 1 106 ? 13.663  17.684 2.505  1.00 18.81  ? 106 ASN A HA   1 
ATOM   1991 H HB2  . ASN A 1 106 ? 14.402  19.810 0.800  1.00 20.72  ? 106 ASN A HB2  1 
ATOM   1992 H HB3  . ASN A 1 106 ? 15.287  19.244 1.996  1.00 20.72  ? 106 ASN A HB3  1 
ATOM   1993 H HD21 . ASN A 1 106 ? 15.841  17.764 -1.559 1.00 21.42  ? 106 ASN A HD21 1 
ATOM   1994 H HD22 . ASN A 1 106 ? 15.164  19.278 -1.196 1.00 21.42  ? 106 ASN A HD22 1 
ATOM   1995 N N    . THR A 1 107 ? 11.572  19.114 3.431  1.00 15.05  ? 107 THR A N    1 
ATOM   1996 C CA   . THR A 1 107 ? 10.861  19.963 4.370  1.00 15.18  ? 107 THR A CA   1 
ATOM   1997 C C    . THR A 1 107 ? 10.353  19.196 5.586  1.00 14.64  ? 107 THR A C    1 
ATOM   1998 O O    . THR A 1 107 ? 9.291   19.519 6.163  1.00 19.81  ? 107 THR A O    1 
ATOM   1999 C CB   . THR A 1 107 ? 9.673   20.689 3.700  1.00 17.27  ? 107 THR A CB   1 
ATOM   2000 O OG1  . THR A 1 107 ? 8.731   19.735 3.182  1.00 17.88  ? 107 THR A OG1  1 
ATOM   2001 C CG2  . THR A 1 107 ? 10.122  21.627 2.587  1.00 19.76  ? 107 THR A CG2  1 
ATOM   2002 H H    . THR A 1 107 ? 11.152  18.392 3.225  1.00 17.95  ? 107 THR A H    1 
ATOM   2003 H HA   . THR A 1 107 ? 11.480  20.650 4.694  1.00 18.10  ? 107 THR A HA   1 
ATOM   2004 H HB   . THR A 1 107 ? 9.225   21.228 4.371  1.00 20.61  ? 107 THR A HB   1 
ATOM   2005 H HG1  . THR A 1 107 ? 9.095   19.256 2.625  1.00 21.34  ? 107 THR A HG1  1 
ATOM   2006 H HG21 . THR A 1 107 ? 9.360   22.060 2.195  1.00 23.59  ? 107 THR A HG21 1 
ATOM   2007 H HG22 . THR A 1 107 ? 10.713  22.296 2.941  1.00 23.59  ? 107 THR A HG22 1 
ATOM   2008 H HG23 . THR A 1 107 ? 10.584  21.132 1.907  1.00 23.59  ? 107 THR A HG23 1 
ATOM   2009 N N    . ASN A 1 108 ? 11.119  18.196 6.007  1.00 15.13  ? 108 ASN A N    1 
ATOM   2010 C CA   . ASN A 1 108 ? 10.772  17.454 7.214  1.00 14.73  ? 108 ASN A CA   1 
ATOM   2011 C C    . ASN A 1 108 ? 10.908  18.326 8.466  1.00 14.65  ? 108 ASN A C    1 
ATOM   2012 O O    . ASN A 1 108 ? 11.890  19.048 8.629  1.00 18.24  ? 108 ASN A O    1 
ATOM   2013 C CB   . ASN A 1 108 ? 11.659  16.214 7.328  1.00 15.77  ? 108 ASN A CB   1 
ATOM   2014 C CG   . ASN A 1 108 ? 11.474  15.278 6.171  1.00 15.90  ? 108 ASN A CG   1 
ATOM   2015 O OD1  . ASN A 1 108 ? 10.442  14.623 6.042  1.00 17.28  ? 108 ASN A OD1  1 
ATOM   2016 N ND2  . ASN A 1 108 ? 12.461  15.231 5.292  1.00 17.23  ? 108 ASN A ND2  1 
ATOM   2017 H H    . ASN A 1 108 ? 11.838  17.929 5.616  1.00 18.04  ? 108 ASN A H    1 
ATOM   2018 H HA   . ASN A 1 108 ? 9.841   17.156 7.151  1.00 17.55  ? 108 ASN A HA   1 
ATOM   2019 H HB2  . ASN A 1 108 ? 12.589  16.488 7.348  1.00 18.81  ? 108 ASN A HB2  1 
ATOM   2020 H HB3  . ASN A 1 108 ? 11.435  15.736 8.142  1.00 18.81  ? 108 ASN A HB3  1 
ATOM   2021 H HD21 . ASN A 1 108 ? 12.397  14.638 4.515  1.00 20.56  ? 108 ASN A HD21 1 
ATOM   2022 H HD22 . ASN A 1 108 ? 13.257  15.789 5.418  1.00 20.56  ? 108 ASN A HD22 1 
ATOM   2023 N N    . GLY A 1 109 ? 9.937   18.199 9.378  1.00 15.67  ? 109 GLY A N    1 
ATOM   2024 C CA   . GLY A 1 109 ? 9.971   18.906 10.654 1.00 14.41  ? 109 GLY A CA   1 
ATOM   2025 C C    . GLY A 1 109 ? 9.764   17.928 11.789 1.00 14.78  ? 109 GLY A C    1 
ATOM   2026 O O    . GLY A 1 109 ? 10.624  17.085 12.049 1.00 16.40  ? 109 GLY A O    1 
ATOM   2027 H H    . GLY A 1 109 ? 9.242   17.702 9.276  1.00 18.69  ? 109 GLY A H    1 
ATOM   2028 H HA2  . GLY A 1 109 ? 10.829  19.345 10.767 1.00 17.17  ? 109 GLY A HA2  1 
ATOM   2029 H HA3  . GLY A 1 109 ? 9.269   19.575 10.681 1.00 17.17  ? 109 GLY A HA3  1 
ATOM   2030 N N    . SER A 1 110 ? 8.588   17.994 12.422 1.00 12.85  ? 110 SER A N    1 
ATOM   2031 C CA   . SER A 1 110 ? 8.248   17.062 13.493 1.00 12.26  ? 110 SER A CA   1 
ATOM   2032 C C    . SER A 1 110 ? 6.986   16.258 13.215 1.00 12.46  ? 110 SER A C    1 
ATOM   2033 O O    . SER A 1 110 ? 6.690   15.302 13.919 1.00 14.34  ? 110 SER A O    1 
ATOM   2034 C CB   . SER A 1 110 ? 8.088   17.824 14.794 1.00 15.41  ? 110 SER A CB   1 
ATOM   2035 O OG   . SER A 1 110 ? 7.091   18.815 14.641 1.00 14.62  ? 110 SER A OG   1 
ATOM   2036 H H    . SER A 1 110 ? 7.973   18.570 12.248 1.00 15.30  ? 110 SER A H    1 
ATOM   2037 H HA   . SER A 1 110 ? 8.987   16.429 13.606 1.00 14.60  ? 110 SER A HA   1 
ATOM   2038 H HB2  . SER A 1 110 ? 7.823   17.209 15.495 1.00 18.37  ? 110 SER A HB2  1 
ATOM   2039 H HB3  . SER A 1 110 ? 8.930   18.250 15.021 1.00 18.37  ? 110 SER A HB3  1 
ATOM   2040 H HG   . SER A 1 110 ? 6.999   19.231 15.341 1.00 17.42  ? 110 SER A HG   1 
ATOM   2041 N N    . GLN A 1 111 ? 6.232   16.633 12.187 1.00 12.04  ? 111 GLN A N    1 
ATOM   2042 C CA   . GLN A 1 111 ? 4.973   15.934 11.879 1.00 12.16  ? 111 GLN A CA   1 
ATOM   2043 C C    . GLN A 1 111 ? 5.182   14.600 11.201 1.00 11.66  ? 111 GLN A C    1 
ATOM   2044 O O    . GLN A 1 111 ? 6.098   14.458 10.367 1.00 13.93  ? 111 GLN A O    1 
ATOM   2045 C CB   . GLN A 1 111 ? 4.043   16.823 11.051 1.00 12.90  ? 111 GLN A CB   1 
ATOM   2046 C CG   . GLN A 1 111 ? 3.521   18.054 11.798 1.00 14.51  ? 111 GLN A CG   1 
ATOM   2047 C CD   . GLN A 1 111 ? 2.536   18.809 10.955 1.00 15.56  ? 111 GLN A CD   1 
ATOM   2048 O OE1  . GLN A 1 111 ? 1.565   18.244 10.460 1.00 19.27  ? 111 GLN A OE1  1 
ATOM   2049 N NE2  . GLN A 1 111 ? 2.798   20.098 10.752 1.00 17.72  ? 111 GLN A NE2  1 
ATOM   2050 H H    . GLN A 1 111 ? 6.419   17.281 11.654 1.00 14.34  ? 111 GLN A H    1 
ATOM   2051 H HA   . GLN A 1 111 ? 4.515   15.754 12.726 1.00 14.47  ? 111 GLN A HA   1 
ATOM   2052 H HB2  . GLN A 1 111 ? 4.524   17.135 10.269 1.00 15.36  ? 111 GLN A HB2  1 
ATOM   2053 H HB3  . GLN A 1 111 ? 3.275   16.298 10.775 1.00 15.36  ? 111 GLN A HB3  1 
ATOM   2054 H HG2  . GLN A 1 111 ? 3.075   17.772 12.612 1.00 17.29  ? 111 GLN A HG2  1 
ATOM   2055 H HG3  . GLN A 1 111 ? 4.263   18.644 12.006 1.00 17.29  ? 111 GLN A HG3  1 
ATOM   2056 H HE21 . GLN A 1 111 ? 2.264   20.575 10.275 1.00 21.15  ? 111 GLN A HE21 1 
ATOM   2057 H HE22 . GLN A 1 111 ? 3.501   20.454 11.096 1.00 21.15  ? 111 GLN A HE22 1 
ATOM   2058 N N    A PHE A 1 112 ? 4.343   13.639 11.576 0.63 12.03  ? 112 PHE A N    1 
ATOM   2059 N N    B PHE A 1 112 ? 4.344   13.622 11.524 0.37 17.51  ? 112 PHE A N    1 
ATOM   2060 C CA   A PHE A 1 112 ? 4.505   12.252 11.157 0.63 17.91  ? 112 PHE A CA   1 
ATOM   2061 C CA   B PHE A 1 112 ? 4.496   12.277 10.977 0.37 9.88   ? 112 PHE A CA   1 
ATOM   2062 C C    A PHE A 1 112 ? 3.128   11.680 10.985 0.63 13.99  ? 112 PHE A C    1 
ATOM   2063 C C    B PHE A 1 112 ? 3.132   11.647 10.736 0.37 19.11  ? 112 PHE A C    1 
ATOM   2064 O O    A PHE A 1 112 ? 2.118   12.253 11.489 0.63 11.81  ? 112 PHE A O    1 
ATOM   2065 O O    B PHE A 1 112 ? 2.125   12.125 11.265 0.37 18.19  ? 112 PHE A O    1 
ATOM   2066 C CB   A PHE A 1 112 ? 5.228   11.441 12.233 0.63 14.84  ? 112 PHE A CB   1 
ATOM   2067 C CB   B PHE A 1 112 ? 5.262   11.407 11.966 0.37 15.53  ? 112 PHE A CB   1 
ATOM   2068 C CG   A PHE A 1 112 ? 4.485   11.403 13.546 0.63 13.67  ? 112 PHE A CG   1 
ATOM   2069 C CG   B PHE A 1 112 ? 4.638   11.372 13.329 0.37 14.66  ? 112 PHE A CG   1 
ATOM   2070 C CD1  A PHE A 1 112 ? 3.529   10.433 13.776 0.63 17.29  ? 112 PHE A CD1  1 
ATOM   2071 C CD1  B PHE A 1 112 ? 3.698   10.409 13.648 0.37 16.82  ? 112 PHE A CD1  1 
ATOM   2072 C CD2  A PHE A 1 112 ? 4.684   12.379 14.508 0.63 15.68  ? 112 PHE A CD2  1 
ATOM   2073 C CD2  B PHE A 1 112 ? 4.962   12.324 14.276 0.37 18.20  ? 112 PHE A CD2  1 
ATOM   2074 C CE1  A PHE A 1 112 ? 2.821   10.396 14.957 0.63 21.23  ? 112 PHE A CE1  1 
ATOM   2075 C CE1  B PHE A 1 112 ? 3.115   10.379 14.890 0.37 16.95  ? 112 PHE A CE1  1 
ATOM   2076 C CE2  A PHE A 1 112 ? 3.973   12.348 15.706 0.63 19.92  ? 112 PHE A CE2  1 
ATOM   2077 C CE2  B PHE A 1 112 ? 4.376   12.296 15.521 0.37 16.26  ? 112 PHE A CE2  1 
ATOM   2078 C CZ   A PHE A 1 112 ? 3.030   11.365 15.924 0.63 16.36  ? 112 PHE A CZ   1 
ATOM   2079 C CZ   B PHE A 1 112 ? 3.455   11.328 15.832 0.37 21.63  ? 112 PHE A CZ   1 
ATOM   2080 H H    A PHE A 1 112 ? 3.660   13.769 12.083 0.63 14.32  ? 112 PHE A H    1 
ATOM   2081 H H    B PHE A 1 112 ? 3.677   13.711 12.059 0.37 20.90  ? 112 PHE A H    1 
ATOM   2082 H HA   A PHE A 1 112 ? 4.997   12.198 10.310 0.63 21.38  ? 112 PHE A HA   1 
ATOM   2083 H HA   B PHE A 1 112 ? 4.989   12.310 10.131 0.37 11.74  ? 112 PHE A HA   1 
ATOM   2084 H HB2  A PHE A 1 112 ? 5.332   10.528 11.922 0.63 17.69  ? 112 PHE A HB2  1 
ATOM   2085 H HB2  B PHE A 1 112 ? 5.292   10.499 11.628 0.37 18.52  ? 112 PHE A HB2  1 
ATOM   2086 H HB3  A PHE A 1 112 ? 6.099   11.837 12.393 0.63 17.69  ? 112 PHE A HB3  1 
ATOM   2087 H HB3  B PHE A 1 112 ? 6.163   11.755 12.058 0.37 18.52  ? 112 PHE A HB3  1 
ATOM   2088 H HD1  A PHE A 1 112 ? 3.376   9.781  13.131 0.63 20.63  ? 112 PHE A HD1  1 
ATOM   2089 H HD1  B PHE A 1 112 ? 3.467   9.765  13.017 0.37 20.06  ? 112 PHE A HD1  1 
ATOM   2090 H HD2  A PHE A 1 112 ? 5.315   13.047 14.363 0.63 18.69  ? 112 PHE A HD2  1 
ATOM   2091 H HD2  B PHE A 1 112 ? 5.587   12.983 14.074 0.37 21.72  ? 112 PHE A HD2  1 
ATOM   2092 H HE1  A PHE A 1 112 ? 2.191   9.726  15.099 0.63 25.36  ? 112 PHE A HE1  1 
ATOM   2093 H HE1  B PHE A 1 112 ? 2.491   9.721  15.097 0.37 20.22  ? 112 PHE A HE1  1 
ATOM   2094 H HE2  A PHE A 1 112 ? 4.123   12.999 16.353 0.63 23.79  ? 112 PHE A HE2  1 
ATOM   2095 H HE2  B PHE A 1 112 ? 4.608   12.935 16.155 0.37 19.39  ? 112 PHE A HE2  1 
ATOM   2096 H HZ   A PHE A 1 112 ? 2.558   11.337 16.725 0.63 19.52  ? 112 PHE A HZ   1 
ATOM   2097 H HZ   B PHE A 1 112 ? 3.061   11.311 16.675 0.37 25.84  ? 112 PHE A HZ   1 
ATOM   2098 N N    A PHE A 1 113 ? 3.050   10.553 10.300 0.63 9.41   ? 113 PHE A N    1 
ATOM   2099 N N    B PHE A 1 113 ? 3.114   10.573 9.945  0.37 22.48  ? 113 PHE A N    1 
ATOM   2100 C CA   A PHE A 1 113 ? 1.808   9.838  10.309 0.63 11.09  ? 113 PHE A CA   1 
ATOM   2101 C CA   B PHE A 1 113 ? 1.930   9.754  9.751  0.37 14.35  ? 113 PHE A CA   1 
ATOM   2102 C C    A PHE A 1 113 ? 2.041   8.376  10.478 0.63 11.82  ? 113 PHE A C    1 
ATOM   2103 C C    B PHE A 1 113 ? 2.130   8.398  10.395 0.37 14.01  ? 113 PHE A C    1 
ATOM   2104 O O    A PHE A 1 113 ? 3.080   7.811  10.121 0.63 16.73  ? 113 PHE A O    1 
ATOM   2105 O O    B PHE A 1 113 ? 3.210   7.818  10.321 0.37 13.49  ? 113 PHE A O    1 
ATOM   2106 C CB   A PHE A 1 113 ? 0.944   10.142 9.075  0.63 12.51  ? 113 PHE A CB   1 
ATOM   2107 C CB   B PHE A 1 113 ? 1.674   9.433  8.273  0.37 10.84  ? 113 PHE A CB   1 
ATOM   2108 C CG   A PHE A 1 113 ? 1.639   9.916  7.759  0.63 14.16  ? 113 PHE A CG   1 
ATOM   2109 C CG   B PHE A 1 113 ? 1.607   10.614 7.353  0.37 22.10  ? 113 PHE A CG   1 
ATOM   2110 C CD1  A PHE A 1 113 ? 2.401   10.903 7.191  0.63 13.06  ? 113 PHE A CD1  1 
ATOM   2111 C CD1  B PHE A 1 113 ? 0.953   11.788 7.697  0.37 19.63  ? 113 PHE A CD1  1 
ATOM   2112 C CD2  A PHE A 1 113 ? 1.486   8.716  7.066  0.63 14.36  ? 113 PHE A CD2  1 
ATOM   2113 C CD2  B PHE A 1 113 ? 2.157   10.507 6.090  0.37 15.99  ? 113 PHE A CD2  1 
ATOM   2114 C CE1  A PHE A 1 113 ? 3.016   10.713 5.961  0.63 14.46  ? 113 PHE A CE1  1 
ATOM   2115 C CE1  B PHE A 1 113 ? 0.901   12.840 6.805  0.37 22.28  ? 113 PHE A CE1  1 
ATOM   2116 C CE2  A PHE A 1 113 ? 2.099   8.521  5.837  0.63 17.54  ? 113 PHE A CE2  1 
ATOM   2117 C CE2  B PHE A 1 113 ? 2.107   11.556 5.201  0.37 26.31  ? 113 PHE A CE2  1 
ATOM   2118 C CZ   A PHE A 1 113 ? 2.873   9.515  5.299  0.63 14.68  ? 113 PHE A CZ   1 
ATOM   2119 C CZ   B PHE A 1 113 ? 1.464   12.720 5.554  0.37 24.99  ? 113 PHE A CZ   1 
ATOM   2120 H H    A PHE A 1 113 ? 3.683   10.197 9.839  0.63 11.17  ? 113 PHE A H    1 
ATOM   2121 H H    B PHE A 1 113 ? 3.796   10.297 9.501  0.37 26.86  ? 113 PHE A H    1 
ATOM   2122 H HA   A PHE A 1 113 ? 1.297   10.136 11.091 0.63 13.19  ? 113 PHE A HA   1 
ATOM   2123 H HA   B PHE A 1 113 ? 1.140   10.188 10.136 0.37 17.10  ? 113 PHE A HA   1 
ATOM   2124 H HB2  A PHE A 1 113 ? 0.161   9.571  9.096  0.63 14.89  ? 113 PHE A HB2  1 
ATOM   2125 H HB2  B PHE A 1 113 ? 2.390   8.859  7.957  0.37 12.89  ? 113 PHE A HB2  1 
ATOM   2126 H HB3  A PHE A 1 113 ? 0.672   11.072 9.108  0.63 14.89  ? 113 PHE A HB3  1 
ATOM   2127 H HB3  B PHE A 1 113 ? 0.829   8.962  8.204  0.37 12.89  ? 113 PHE A HB3  1 
ATOM   2128 H HD1  A PHE A 1 113 ? 2.504   11.714 7.634  0.63 15.55  ? 113 PHE A HD1  1 
ATOM   2129 H HD1  B PHE A 1 113 ? 0.567   11.874 8.539  0.37 23.44  ? 113 PHE A HD1  1 
ATOM   2130 H HD2  A PHE A 1 113 ? 0.964   8.039  7.431  0.63 17.11  ? 113 PHE A HD2  1 
ATOM   2131 H HD2  B PHE A 1 113 ? 2.589   9.721  5.844  0.37 19.07  ? 113 PHE A HD2  1 
ATOM   2132 H HE1  A PHE A 1 113 ? 3.542   11.387 5.595  0.63 17.23  ? 113 PHE A HE1  1 
ATOM   2133 H HE1  B PHE A 1 113 ? 0.471   13.629 7.045  0.37 26.62  ? 113 PHE A HE1  1 
ATOM   2134 H HE2  A PHE A 1 113 ? 2.002   7.711  5.391  0.63 20.93  ? 113 PHE A HE2  1 
ATOM   2135 H HE2  B PHE A 1 113 ? 2.492   11.473 4.358  0.37 31.46  ? 113 PHE A HE2  1 
ATOM   2136 H HZ   A PHE A 1 113 ? 3.289   9.386  4.477  0.63 17.50  ? 113 PHE A HZ   1 
ATOM   2137 H HZ   B PHE A 1 113 ? 1.431   13.433 4.957  0.37 29.87  ? 113 PHE A HZ   1 
ATOM   2138 N N    A ILE A 1 114 ? 1.017   7.782  11.083 0.63 10.66  ? 114 ILE A N    1 
ATOM   2139 N N    B ILE A 1 114 ? 1.056   7.868  10.972 0.37 19.44  ? 114 ILE A N    1 
ATOM   2140 C CA   A ILE A 1 114 ? 0.937   6.340  11.281 0.63 11.60  ? 114 ILE A CA   1 
ATOM   2141 C CA   B ILE A 1 114 ? 0.939   6.427  11.210 0.37 27.28  ? 114 ILE A CA   1 
ATOM   2142 C C    A ILE A 1 114 ? -0.080  5.837  10.260 0.63 12.57  ? 114 ILE A C    1 
ATOM   2143 C C    B ILE A 1 114 ? -0.074  5.921  10.194 0.37 27.74  ? 114 ILE A C    1 
ATOM   2144 O O    A ILE A 1 114 ? -1.251  6.181  10.311 0.63 17.70  ? 114 ILE A O    1 
ATOM   2145 O O    B ILE A 1 114 ? -1.253  6.293  10.235 0.37 14.31  ? 114 ILE A O    1 
ATOM   2146 C CB   A ILE A 1 114 ? 0.463   5.977  12.709 0.63 12.23  ? 114 ILE A CB   1 
ATOM   2147 C CB   B ILE A 1 114 ? 0.468   6.080  12.611 0.37 21.53  ? 114 ILE A CB   1 
ATOM   2148 C CG1  A ILE A 1 114 ? 1.218   6.783  13.772 0.63 12.77  ? 114 ILE A CG1  1 
ATOM   2149 C CG1  B ILE A 1 114 ? 1.551   6.408  13.637 0.37 25.88  ? 114 ILE A CG1  1 
ATOM   2150 C CG2  A ILE A 1 114 ? 0.627   4.473  12.941 0.63 19.51  ? 114 ILE A CG2  1 
ATOM   2151 C CG2  B ILE A 1 114 ? 0.154   4.603  12.655 0.37 14.40  ? 114 ILE A CG2  1 
ATOM   2152 C CD1  A ILE A 1 114 ? 0.597   6.647  15.135 0.63 14.91  ? 114 ILE A CD1  1 
ATOM   2153 C CD1  B ILE A 1 114 ? 1.105   6.179  15.074 0.37 23.56  ? 114 ILE A CD1  1 
ATOM   2154 H H    A ILE A 1 114 ? 0.338   8.207  11.396 0.63 12.67  ? 114 ILE A H    1 
ATOM   2155 H H    B ILE A 1 114 ? 0.376   8.322  11.238 0.37 23.21  ? 114 ILE A H    1 
ATOM   2156 H HA   A ILE A 1 114 ? 1.806   5.922  11.109 0.63 13.80  ? 114 ILE A HA   1 
ATOM   2157 H HA   B ILE A 1 114 ? 1.800   5.990  11.046 0.37 32.62  ? 114 ILE A HA   1 
ATOM   2158 H HB   A ILE A 1 114 ? -0.480  6.194  12.779 0.63 14.56  ? 114 ILE A HB   1 
ATOM   2159 H HB   B ILE A 1 114 ? -0.334  6.585  12.816 0.37 25.72  ? 114 ILE A HB   1 
ATOM   2160 H HG12 A ILE A 1 114 ? 2.132   6.463  13.824 0.63 15.21  ? 114 ILE A HG12 1 
ATOM   2161 H HG12 B ILE A 1 114 ? 2.323   5.845  13.470 0.37 30.94  ? 114 ILE A HG12 1 
ATOM   2162 H HG13 A ILE A 1 114 ? 1.206   7.722  13.528 0.63 15.21  ? 114 ILE A HG13 1 
ATOM   2163 H HG13 B ILE A 1 114 ? 1.797   7.342  13.546 0.37 30.94  ? 114 ILE A HG13 1 
ATOM   2164 H HG21 A ILE A 1 114 ? 0.330   4.259  13.828 0.63 23.30  ? 114 ILE A HG21 1 
ATOM   2165 H HG21 B ILE A 1 114 ? -0.145  4.374  13.538 0.37 17.16  ? 114 ILE A HG21 1 
ATOM   2166 H HG22 A ILE A 1 114 ? 0.098   3.998  12.295 0.63 23.30  ? 114 ILE A HG22 1 
ATOM   2167 H HG22 B ILE A 1 114 ? -0.535  4.411  12.015 0.37 17.16  ? 114 ILE A HG22 1 
ATOM   2168 H HG23 A ILE A 1 114 ? 1.553   4.241  12.840 0.63 23.30  ? 114 ILE A HG23 1 
ATOM   2169 H HG23 B ILE A 1 114 ? 0.948   4.109  12.439 0.37 17.16  ? 114 ILE A HG23 1 
ATOM   2170 H HD11 A ILE A 1 114 ? 1.103   7.168  15.763 0.63 17.78  ? 114 ILE A HD11 1 
ATOM   2171 H HD11 B ILE A 1 114 ? 1.829   6.403  15.665 0.37 28.16  ? 114 ILE A HD11 1 
ATOM   2172 H HD12 A ILE A 1 114 ? -0.308  6.966  15.099 0.63 17.78  ? 114 ILE A HD12 1 
ATOM   2173 H HD12 B ILE A 1 114 ? 0.347   6.737  15.259 0.37 28.16  ? 114 ILE A HD12 1 
ATOM   2174 H HD13 A ILE A 1 114 ? 0.608   5.722  15.392 0.63 17.78  ? 114 ILE A HD13 1 
ATOM   2175 H HD13 B ILE A 1 114 ? 0.867   5.255  15.183 0.37 28.16  ? 114 ILE A HD13 1 
ATOM   2176 N N    . CYS A 1 115 ? 0.373   5.058  9.285  1.00 13.90  ? 115 CYS A N    1 
ATOM   2177 C CA   . CYS A 1 115 ? -0.507  4.524  8.261  1.00 13.94  ? 115 CYS A CA   1 
ATOM   2178 C C    . CYS A 1 115 ? -1.379  3.434  8.839  1.00 15.24  ? 115 CYS A C    1 
ATOM   2179 O O    . CYS A 1 115 ? -0.929  2.632  9.668  1.00 19.10  ? 115 CYS A O    1 
ATOM   2180 C CB   . CYS A 1 115 ? 0.318   3.930  7.137  1.00 18.26  ? 115 CYS A CB   1 
ATOM   2181 S SG   . CYS A 1 115 ? 1.363   5.108  6.280  1.00 21.40  ? 115 CYS A SG   1 
ATOM   2182 H H    A CYS A 1 115 ? 1.195   4.824  9.195  0.70 16.56  ? 115 CYS A H    1 
ATOM   2183 H H    B CYS A 1 115 ? 1.182   4.769  9.242  0.30 16.56  ? 115 CYS A H    1 
ATOM   2184 H HA   . CYS A 1 115 ? -1.077  5.235  7.901  1.00 16.61  ? 115 CYS A HA   1 
ATOM   2185 H HB2  . CYS A 1 115 ? 0.893   3.241  7.504  1.00 21.79  ? 115 CYS A HB2  1 
ATOM   2186 H HB3  . CYS A 1 115 ? -0.283  3.541  6.483  1.00 21.79  ? 115 CYS A HB3  1 
ATOM   2187 H HG   . CYS A 1 115 ? 0.593   6.065  5.743  1.00 25.56  ? 115 CYS A HG   1 
ATOM   2188 N N    . THR A 1 116 ? -2.641  3.427  8.422  1.00 14.50  ? 116 THR A N    1 
ATOM   2189 C CA   . THR A 1 116 ? -3.561  2.381  8.832  1.00 17.56  ? 116 THR A CA   1 
ATOM   2190 C C    . THR A 1 116 ? -4.007  1.582  7.617  1.00 20.01  ? 116 THR A C    1 
ATOM   2191 O O    . THR A 1 116 ? -4.928  0.775  7.704  1.00 27.58  ? 116 THR A O    1 
ATOM   2192 C CB   . THR A 1 116 ? -4.765  2.956  9.601  1.00 18.92  ? 116 THR A CB   1 
ATOM   2193 O OG1  . THR A 1 116 ? -5.427  3.943  8.795  1.00 20.61  ? 116 THR A OG1  1 
ATOM   2194 C CG2  . THR A 1 116 ? -4.287  3.571  10.946 1.00 20.66  ? 116 THR A CG2  1 
ATOM   2195 H H    . THR A 1 116 ? -2.986  4.017  7.901  1.00 17.28  ? 116 THR A H    1 
ATOM   2196 H HA   . THR A 1 116 ? -3.089  1.768  9.435  1.00 20.95  ? 116 THR A HA   1 
ATOM   2197 H HB   . THR A 1 116 ? -5.387  2.238  9.800  1.00 22.58  ? 116 THR A HB   1 
ATOM   2198 H HG1  . THR A 1 116 ? -6.069  4.251  9.201  1.00 24.62  ? 116 THR A HG1  1 
ATOM   2199 H HG21 . THR A 1 116 ? -5.037  3.930  11.427 1.00 24.68  ? 116 THR A HG21 1 
ATOM   2200 H HG22 . THR A 1 116 ? -3.866  2.897  11.484 1.00 24.68  ? 116 THR A HG22 1 
ATOM   2201 H HG23 . THR A 1 116 ? -3.658  4.276  10.779 1.00 24.68  ? 116 THR A HG23 1 
ATOM   2202 N N    . ALA A 1 117 ? -3.309  1.807  6.504  1.00 18.96  ? 117 ALA A N    1 
ATOM   2203 C CA   . ALA A 1 117 ? -3.500  1.093  5.259  1.00 19.72  ? 117 ALA A CA   1 
ATOM   2204 C C    . ALA A 1 117 ? -2.208  1.149  4.471  1.00 19.85  ? 117 ALA A C    1 
ATOM   2205 O O    . ALA A 1 117 ? -1.323  1.897  4.795  1.00 18.60  ? 117 ALA A O    1 
ATOM   2206 C CB   . ALA A 1 117 ? -4.649  1.720  4.452  1.00 29.80  ? 117 ALA A CB   1 
ATOM   2207 H H    . ALA A 1 117 ? -2.690  2.401  6.454  1.00 22.64  ? 117 ALA A H    1 
ATOM   2208 H HA   . ALA A 1 117 ? -3.718  0.156  5.443  1.00 23.55  ? 117 ALA A HA   1 
ATOM   2209 H HB1  . ALA A 1 117 ? -4.758  1.232  3.633  1.00 35.64  ? 117 ALA A HB1  1 
ATOM   2210 H HB2  . ALA A 1 117 ? -5.456  1.673  4.971  1.00 35.64  ? 117 ALA A HB2  1 
ATOM   2211 H HB3  . ALA A 1 117 ? -4.434  2.636  4.262  1.00 35.64  ? 117 ALA A HB3  1 
ATOM   2212 N N    . LYS A 1 118 ? -2.110  0.367  3.404  1.00 21.81  ? 118 LYS A N    1 
ATOM   2213 C CA   . LYS A 1 118 ? -0.992  0.430  2.480  1.00 19.08  ? 118 LYS A CA   1 
ATOM   2214 C C    . LYS A 1 118 ? -1.142  1.719  1.676  1.00 22.37  ? 118 LYS A C    1 
ATOM   2215 O O    . LYS A 1 118 ? -2.200  1.974  1.105  1.00 22.34  ? 118 LYS A O    1 
ATOM   2216 C CB   . LYS A 1 118 ? -1.012  -0.814 1.559  1.00 24.54  ? 118 LYS A CB   1 
ATOM   2217 C CG   . LYS A 1 118 ? 0.111   -0.861 0.530  1.00 27.05  ? 118 LYS A CG   1 
ATOM   2218 C CD   . LYS A 1 118 ? 0.103   -2.176 -0.333 1.00 34.72  ? 118 LYS A CD   1 
ATOM   2219 C CE   . LYS A 1 118 ? 1.245   -2.219 -1.353 1.00 69.46  ? 118 LYS A CE   1 
ATOM   2220 N NZ   . LYS A 1 118 ? 0.749   -2.099 -2.756 1.00 106.31 ? 118 LYS A NZ   1 
ATOM   2221 H H    . LYS A 1 118 ? -2.697  -0.224 3.190  1.00 26.05  ? 118 LYS A H    1 
ATOM   2222 H HA   . LYS A 1 118 ? -0.146  0.453  2.973  1.00 22.78  ? 118 LYS A HA   1 
ATOM   2223 H HB2  . LYS A 1 118 ? -0.938  -1.608 2.111  1.00 29.34  ? 118 LYS A HB2  1 
ATOM   2224 H HB3  . LYS A 1 118 ? -1.853  -0.828 1.077  1.00 29.34  ? 118 LYS A HB3  1 
ATOM   2225 H HG2  . LYS A 1 118 ? 0.017   -0.108 -0.073 1.00 32.35  ? 118 LYS A HG2  1 
ATOM   2226 H HG3  . LYS A 1 118 ? 0.963   -0.812 0.991  1.00 32.35  ? 118 LYS A HG3  1 
ATOM   2227 H HD2  . LYS A 1 118 ? 0.197   -2.941 0.256  1.00 41.54  ? 118 LYS A HD2  1 
ATOM   2228 H HD3  . LYS A 1 118 ? -0.735  -2.231 -0.818 1.00 41.54  ? 118 LYS A HD3  1 
ATOM   2229 H HE2  . LYS A 1 118 ? 1.851   -1.482 -1.182 1.00 83.23  ? 118 LYS A HE2  1 
ATOM   2230 H HE3  . LYS A 1 118 ? 1.714   -3.064 -1.270 1.00 83.23  ? 118 LYS A HE3  1 
ATOM   2231 H HZ1  . LYS A 1 118 ? 1.488   -2.129 -3.368 1.00 127.45 ? 118 LYS A HZ1  1 
ATOM   2232 H HZ2  . LYS A 1 118 ? 0.149   -2.821 -2.954 1.00 127.45 ? 118 LYS A HZ2  1 
ATOM   2233 H HZ3  . LYS A 1 118 ? 0.284   -1.267 -2.869 1.00 127.45 ? 118 LYS A HZ3  1 
ATOM   2234 N N    . THR A 1 119 ? -0.092  2.543  1.621  1.00 19.39  ? 119 THR A N    1 
ATOM   2235 C CA   . THR A 1 119 ? -0.206  3.836  0.946  1.00 17.01  ? 119 THR A CA   1 
ATOM   2236 C C    . THR A 1 119 ? 0.940   4.002  -0.039 1.00 16.22  ? 119 THR A C    1 
ATOM   2237 O O    . THR A 1 119 ? 1.799   4.864  0.098  1.00 17.39  ? 119 THR A O    1 
ATOM   2238 C CB   . THR A 1 119 ? -0.234  4.986  1.964  1.00 16.74  ? 119 THR A CB   1 
ATOM   2239 O OG1  . THR A 1 119 ? 0.952   4.937  2.750  1.00 18.52  ? 119 THR A OG1  1 
ATOM   2240 C CG2  . THR A 1 119 ? -1.398  4.833  2.910  1.00 19.91  ? 119 THR A CG2  1 
ATOM   2241 H H    . THR A 1 119 ? 0.682   2.381  1.959  1.00 23.15  ? 119 THR A H    1 
ATOM   2242 H HA   . THR A 1 119 ? -1.045  3.859  0.441  1.00 20.29  ? 119 THR A HA   1 
ATOM   2243 H HB   . THR A 1 119 ? -0.301  5.840  1.508  1.00 19.97  ? 119 THR A HB   1 
ATOM   2244 H HG1  . THR A 1 119 ? 0.950   5.546  3.299  1.00 22.11  ? 119 THR A HG1  1 
ATOM   2245 H HG21 . THR A 1 119 ? -1.405  5.557  3.540  1.00 23.77  ? 119 THR A HG21 1 
ATOM   2246 H HG22 . THR A 1 119 ? -2.222  4.839  2.418  1.00 23.77  ? 119 THR A HG22 1 
ATOM   2247 H HG23 . THR A 1 119 ? -1.325  4.003  3.387  1.00 23.77  ? 119 THR A HG23 1 
ATOM   2248 N N    . GLU A 1 120 ? 0.925   3.173  -1.073 1.00 17.86  ? 120 GLU A N    1 
ATOM   2249 C CA   . GLU A 1 120 ? 2.086   3.020  -1.952 1.00 19.64  ? 120 GLU A CA   1 
ATOM   2250 C C    . GLU A 1 120 ? 2.367   4.283  -2.744 1.00 16.92  ? 120 GLU A C    1 
ATOM   2251 O O    . GLU A 1 120 ? 3.506   4.511  -3.184 1.00 19.45  ? 120 GLU A O    1 
ATOM   2252 C CB   . GLU A 1 120 ? 1.870   1.820  -2.902 1.00 23.24  ? 120 GLU A CB   1 
ATOM   2253 C CG   . GLU A 1 120 ? 0.689   1.976  -3.882 1.00 47.06  ? 120 GLU A CG   1 
ATOM   2254 C CD   . GLU A 1 120 ? -0.682  1.455  -3.376 1.00 56.04  ? 120 GLU A CD   1 
ATOM   2255 O OE1  . GLU A 1 120 ? -0.934  1.334  -2.142 1.00 33.67  ? 120 GLU A OE1  1 
ATOM   2256 O OE2  . GLU A 1 120 ? -1.528  1.173  -4.254 1.00 70.73  ? 120 GLU A OE2  1 
ATOM   2257 H H    . GLU A 1 120 ? 0.253   2.684  -1.292 1.00 21.31  ? 120 GLU A H    1 
ATOM   2258 H HA   . GLU A 1 120 ? 2.875   2.829  -1.402 1.00 23.46  ? 120 GLU A HA   1 
ATOM   2259 H HB2  . GLU A 1 120 ? 2.675   1.695  -3.429 1.00 27.77  ? 120 GLU A HB2  1 
ATOM   2260 H HB3  . GLU A 1 120 ? 1.705   1.028  -2.367 1.00 27.77  ? 120 GLU A HB3  1 
ATOM   2261 H HG2  . GLU A 1 120 ? 0.583   2.919  -4.086 1.00 56.35  ? 120 GLU A HG2  1 
ATOM   2262 H HG3  . GLU A 1 120 ? 0.901   1.492  -4.696 1.00 56.35  ? 120 GLU A HG3  1 
ATOM   2263 N N    . TRP A 1 121 ? 1.336   5.098  -2.936 1.00 16.41  ? 121 TRP A N    1 
ATOM   2264 C CA   . TRP A 1 121 ? 1.491   6.343  -3.692 1.00 16.45  ? 121 TRP A CA   1 
ATOM   2265 C C    . TRP A 1 121 ? 2.376   7.361  -2.953 1.00 16.55  ? 121 TRP A C    1 
ATOM   2266 O O    . TRP A 1 121 ? 2.801   8.354  -3.554 1.00 18.95  ? 121 TRP A O    1 
ATOM   2267 C CB   . TRP A 1 121 ? 0.106   6.971  -4.040 1.00 18.87  ? 121 TRP A CB   1 
ATOM   2268 C CG   . TRP A 1 121 ? -0.686  7.370  -2.846 1.00 19.34  ? 121 TRP A CG   1 
ATOM   2269 C CD1  . TRP A 1 121 ? -0.661  8.581  -2.217 1.00 21.46  ? 121 TRP A CD1  1 
ATOM   2270 C CD2  . TRP A 1 121 ? -1.614  6.556  -2.115 1.00 18.69  ? 121 TRP A CD2  1 
ATOM   2271 N NE1  . TRP A 1 121 ? -1.498  8.562  -1.138 1.00 22.70  ? 121 TRP A NE1  1 
ATOM   2272 C CE2  . TRP A 1 121 ? -2.111  7.341  -1.064 1.00 22.22  ? 121 TRP A CE2  1 
ATOM   2273 C CE3  . TRP A 1 121 ? -2.103  5.252  -2.271 1.00 19.47  ? 121 TRP A CE3  1 
ATOM   2274 C CZ2  . TRP A 1 121 ? -3.054  6.857  -0.148 1.00 24.57  ? 121 TRP A CZ2  1 
ATOM   2275 C CZ3  . TRP A 1 121 ? -3.035  4.779  -1.367 1.00 24.95  ? 121 TRP A CZ3  1 
ATOM   2276 C CH2  . TRP A 1 121 ? -3.495  5.576  -0.315 1.00 28.95  ? 121 TRP A CH2  1 
ATOM   2277 H H    . TRP A 1 121 ? 0.540   4.958  -2.643 1.00 19.57  ? 121 TRP A H    1 
ATOM   2278 H HA   . TRP A 1 121 ? 1.936   6.133  -4.539 1.00 19.62  ? 121 TRP A HA   1 
ATOM   2279 H HB2  . TRP A 1 121 ? 0.248   7.764  -4.581 1.00 22.52  ? 121 TRP A HB2  1 
ATOM   2280 H HB3  . TRP A 1 121 ? -0.416  6.322  -4.539 1.00 22.52  ? 121 TRP A HB3  1 
ATOM   2281 H HD1  . TRP A 1 121 ? -0.121  9.298  -2.460 1.00 25.63  ? 121 TRP A HD1  1 
ATOM   2282 H HE1  . TRP A 1 121 ? -1.635  9.221  -0.602 1.00 27.13  ? 121 TRP A HE1  1 
ATOM   2283 H HE3  . TRP A 1 121 ? -1.790  4.708  -2.957 1.00 23.24  ? 121 TRP A HE3  1 
ATOM   2284 H HZ2  . TRP A 1 121 ? -3.371  7.390  0.545  1.00 29.36  ? 121 TRP A HZ2  1 
ATOM   2285 H HZ3  . TRP A 1 121 ? -3.350  3.907  -1.449 1.00 29.83  ? 121 TRP A HZ3  1 
ATOM   2286 H HH2  . TRP A 1 121 ? -4.126  5.232  0.275  1.00 34.62  ? 121 TRP A HH2  1 
ATOM   2287 N N    . LEU A 1 122 ? 2.662   7.121  -1.671 1.00 15.63  ? 122 LEU A N    1 
ATOM   2288 C CA   . LEU A 1 122 ? 3.561   7.997  -0.919 1.00 15.45  ? 122 LEU A CA   1 
ATOM   2289 C C    . LEU A 1 122 ? 5.027   7.584  -1.057 1.00 14.52  ? 122 LEU A C    1 
ATOM   2290 O O    . LEU A 1 122 ? 5.924   8.299  -0.620 1.00 15.31  ? 122 LEU A O    1 
ATOM   2291 C CB   . LEU A 1 122 ? 3.164   8.061  0.548  1.00 14.41  ? 122 LEU A CB   1 
ATOM   2292 C CG   . LEU A 1 122 ? 1.723   8.547  0.787  1.00 16.08  ? 122 LEU A CG   1 
ATOM   2293 C CD1  . LEU A 1 122 ? 1.405   8.479  2.267  1.00 24.21  ? 122 LEU A CD1  1 
ATOM   2294 C CD2  . LEU A 1 122 ? 1.542   9.960  0.285  1.00 18.88  ? 122 LEU A CD2  1 
ATOM   2295 H H    . LEU A 1 122 ? 2.351   6.461  -1.217 1.00 18.64  ? 122 LEU A H    1 
ATOM   2296 H HA   . LEU A 1 122 ? 3.479   8.904  -1.282 1.00 18.43  ? 122 LEU A HA   1 
ATOM   2297 H HB2  . LEU A 1 122 ? 3.244   7.173  0.931  1.00 17.18  ? 122 LEU A HB2  1 
ATOM   2298 H HB3  . LEU A 1 122 ? 3.761   8.671  1.006  1.00 17.18  ? 122 LEU A HB3  1 
ATOM   2299 H HG   . LEU A 1 122 ? 1.104   7.970  0.312  1.00 19.18  ? 122 LEU A HG   1 
ATOM   2300 H HD11 . LEU A 1 122 ? 0.505   8.784  2.407  1.00 28.93  ? 122 LEU A HD11 1 
ATOM   2301 H HD12 . LEU A 1 122 ? 1.493   7.571  2.564  1.00 28.93  ? 122 LEU A HD12 1 
ATOM   2302 H HD13 . LEU A 1 122 ? 2.019   9.041  2.744  1.00 28.93  ? 122 LEU A HD13 1 
ATOM   2303 H HD21 . LEU A 1 122 ? 0.637   10.236 0.447  1.00 22.54  ? 122 LEU A HD21 1 
ATOM   2304 H HD22 . LEU A 1 122 ? 2.149   10.538 0.754  1.00 22.54  ? 122 LEU A HD22 1 
ATOM   2305 H HD23 . LEU A 1 122 ? 1.729   9.984  -0.657 1.00 22.54  ? 122 LEU A HD23 1 
ATOM   2306 N N    . ASP A 1 123 ? 5.279   6.421  -1.641 1.00 15.16  ? 123 ASP A N    1 
ATOM   2307 C CA   . ASP A 1 123 ? 6.657   5.941  -1.779 1.00 15.49  ? 123 ASP A CA   1 
ATOM   2308 C C    . ASP A 1 123 ? 7.510   6.918  -2.601 1.00 15.20  ? 123 ASP A C    1 
ATOM   2309 O O    . ASP A 1 123 ? 7.105   7.401  -3.667 1.00 18.60  ? 123 ASP A O    1 
ATOM   2310 C CB   . ASP A 1 123 ? 6.713   4.568  -2.470 1.00 17.09  ? 123 ASP A CB   1 
ATOM   2311 C CG   . ASP A 1 123 ? 6.185   3.435  -1.608 1.00 16.49  ? 123 ASP A CG   1 
ATOM   2312 O OD1  . ASP A 1 123 ? 6.017   3.635  -0.403 1.00 17.54  ? 123 ASP A OD1  1 
ATOM   2313 O OD2  . ASP A 1 123 ? 5.975   2.317  -2.153 1.00 20.22  ? 123 ASP A OD2  1 
ATOM   2314 H H    . ASP A 1 123 ? 4.682   5.892  -1.963 1.00 18.07  ? 123 ASP A H    1 
ATOM   2315 H HA   . ASP A 1 123 ? 7.059   5.854  -0.889 1.00 18.48  ? 123 ASP A HA   1 
ATOM   2316 H HB2  . ASP A 1 123 ? 6.178   4.602  -3.278 1.00 20.39  ? 123 ASP A HB2  1 
ATOM   2317 H HB3  . ASP A 1 123 ? 7.635   4.367  -2.693 1.00 20.39  ? 123 ASP A HB3  1 
ATOM   2318 N N    . GLY A 1 124 ? 8.700   7.230  -2.084 1.00 14.97  ? 124 GLY A N    1 
ATOM   2319 C CA   . GLY A 1 124 ? 9.627   8.100  -2.788 1.00 15.98  ? 124 GLY A CA   1 
ATOM   2320 C C    . GLY A 1 124 ? 9.355   9.587  -2.554 1.00 14.95  ? 124 GLY A C    1 
ATOM   2321 O O    . GLY A 1 124 ? 10.070  10.425 -3.099 1.00 20.08  ? 124 GLY A O    1 
ATOM   2322 H H    . GLY A 1 124 ? 8.990   6.947  -1.326 1.00 17.85  ? 124 GLY A H    1 
ATOM   2323 H HA2  . GLY A 1 124 ? 10.532  7.907  -2.496 1.00 19.06  ? 124 GLY A HA2  1 
ATOM   2324 H HA3  . GLY A 1 124 ? 9.570   7.926  -3.740 1.00 19.06  ? 124 GLY A HA3  1 
ATOM   2325 N N    . LYS A 1 125 ? 8.303   9.891  -1.794 1.00 15.36  ? 125 LYS A N    1 
ATOM   2326 C CA   . LYS A 1 125 ? 7.921   11.268 -1.477 1.00 16.53  ? 125 LYS A CA   1 
ATOM   2327 C C    . LYS A 1 125 ? 7.967   11.546 0.036  1.00 14.89  ? 125 LYS A C    1 
ATOM   2328 O O    . LYS A 1 125 ? 8.203   12.679 0.434  1.00 15.53  ? 125 LYS A O    1 
ATOM   2329 C CB   . LYS A 1 125 ? 6.488   11.583 -1.971 1.00 29.81  ? 125 LYS A CB   1 
ATOM   2330 C CG   . LYS A 1 125 ? 6.210   11.218 -3.377 1.00 46.74  ? 125 LYS A CG   1 
ATOM   2331 C CD   . LYS A 1 125 ? 4.789   11.638 -3.801 1.00 53.01  ? 125 LYS A CD   1 
ATOM   2332 C CE   . LYS A 1 125 ? 4.140   12.549 -2.768 1.00 57.63  ? 125 LYS A CE   1 
ATOM   2333 N NZ   . LYS A 1 125 ? 2.928   13.255 -3.278 1.00 77.27  ? 125 LYS A NZ   1 
ATOM   2334 H H    . LYS A 1 125 ? 7.783   9.303  -1.442 1.00 18.32  ? 125 LYS A H    1 
ATOM   2335 H HA   . LYS A 1 125 ? 8.541   11.884 -1.921 1.00 19.72  ? 125 LYS A HA   1 
ATOM   2336 H HB2  . LYS A 1 125 ? 5.858   11.099 -1.415 1.00 35.65  ? 125 LYS A HB2  1 
ATOM   2337 H HB3  . LYS A 1 125 ? 6.334   12.536 -1.882 1.00 35.65  ? 125 LYS A HB3  1 
ATOM   2338 H HG2  . LYS A 1 125 ? 6.845   11.668 -3.955 1.00 55.97  ? 125 LYS A HG2  1 
ATOM   2339 H HG3  . LYS A 1 125 ? 6.285   10.256 -3.478 1.00 55.97  ? 125 LYS A HG3  1 
ATOM   2340 H HD2  . LYS A 1 125 ? 4.836   12.119 -4.642 1.00 63.50  ? 125 LYS A HD2  1 
ATOM   2341 H HD3  . LYS A 1 125 ? 4.237   10.847 -3.897 1.00 63.50  ? 125 LYS A HD3  1 
ATOM   2342 H HE2  . LYS A 1 125 ? 3.874   12.016 -2.003 1.00 69.04  ? 125 LYS A HE2  1 
ATOM   2343 H HE3  . LYS A 1 125 ? 4.783   13.221 -2.494 1.00 69.04  ? 125 LYS A HE3  1 
ATOM   2344 H HZ1  . LYS A 1 125 ? 2.560   13.814 -2.589 1.00 92.60  ? 125 LYS A HZ1  1 
ATOM   2345 H HZ2  . LYS A 1 125 ? 3.160   13.802 -4.032 1.00 92.60  ? 125 LYS A HZ2  1 
ATOM   2346 H HZ3  . LYS A 1 125 ? 2.265   12.615 -3.548 1.00 92.60  ? 125 LYS A HZ3  1 
ATOM   2347 N N    . HIS A 1 126 ? 7.678   10.533 0.861  1.00 12.45  ? 126 HIS A N    1 
ATOM   2348 C CA   . HIS A 1 126 ? 7.677   10.658 2.329  1.00 12.58  ? 126 HIS A CA   1 
ATOM   2349 C C    . HIS A 1 126 ? 8.662   9.616  2.857  1.00 12.30  ? 126 HIS A C    1 
ATOM   2350 O O    . HIS A 1 126 ? 8.640   8.441  2.433  1.00 14.58  ? 126 HIS A O    1 
ATOM   2351 C CB   . HIS A 1 126 ? 6.246   10.465 2.928  1.00 13.36  ? 126 HIS A CB   1 
ATOM   2352 C CG   . HIS A 1 126 ? 5.282   11.525 2.487  1.00 13.40  ? 126 HIS A CG   1 
ATOM   2353 N ND1  . HIS A 1 126 ? 5.023   12.649 3.242  1.00 14.36  ? 126 HIS A ND1  1 
ATOM   2354 C CD2  . HIS A 1 126 ? 4.533   11.651 1.355  1.00 16.45  ? 126 HIS A CD2  1 
ATOM   2355 C CE1  . HIS A 1 126 ? 4.168   13.420 2.592  1.00 17.20  ? 126 HIS A CE1  1 
ATOM   2356 N NE2  . HIS A 1 126 ? 3.857   12.840 1.446  1.00 18.89  ? 126 HIS A NE2  1 
ATOM   2357 H H    . HIS A 1 126 ? 7.474   9.743  0.589  1.00 14.82  ? 126 HIS A H    1 
ATOM   2358 H HA   . HIS A 1 126 ? 8.001   11.548 2.581  1.00 14.98  ? 126 HIS A HA   1 
ATOM   2359 H HB2  . HIS A 1 126 ? 5.897   9.606  2.643  1.00 15.91  ? 126 HIS A HB2  1 
ATOM   2360 H HB3  . HIS A 1 126 ? 6.302   10.495 3.896  1.00 15.91  ? 126 HIS A HB3  1 
ATOM   2361 H HD2  . HIS A 1 126 ? 4.502   11.051 0.645  1.00 19.62  ? 126 HIS A HD2  1 
ATOM   2362 H HE1  . HIS A 1 126 ? 3.829   14.230 2.898  1.00 20.53  ? 126 HIS A HE1  1 
ATOM   2363 N N    A VAL A 1 127 ? 9.520   10.051 3.780  0.74 12.49  ? 127 VAL A N    1 
ATOM   2364 N N    B VAL A 1 127 ? 9.552   10.060 3.737  0.26 19.68  ? 127 VAL A N    1 
ATOM   2365 C CA   A VAL A 1 127 ? 10.545  9.185  4.374  0.74 15.14  ? 127 VAL A CA   1 
ATOM   2366 C CA   B VAL A 1 127 ? 10.575  9.191  4.296  0.26 12.46  ? 127 VAL A CA   1 
ATOM   2367 C C    A VAL A 1 127 ? 9.949   8.252  5.452  0.74 12.45  ? 127 VAL A C    1 
ATOM   2368 C C    B VAL A 1 127 ? 9.974   8.374  5.442  0.26 15.52  ? 127 VAL A C    1 
ATOM   2369 O O    A VAL A 1 127 ? 9.458   8.698  6.488  0.74 14.09  ? 127 VAL A O    1 
ATOM   2370 O O    B VAL A 1 127 ? 9.541   8.918  6.457  0.26 15.56  ? 127 VAL A O    1 
ATOM   2371 C CB   A VAL A 1 127 ? 11.753  9.977  4.957  0.74 12.70  ? 127 VAL A CB   1 
ATOM   2372 C CB   B VAL A 1 127 ? 11.812  9.991  4.764  0.26 22.46  ? 127 VAL A CB   1 
ATOM   2373 C CG1  A VAL A 1 127 ? 12.764  9.023  5.627  0.74 11.40  ? 127 VAL A CG1  1 
ATOM   2374 C CG1  B VAL A 1 127 ? 12.300  10.889 3.641  0.26 21.38  ? 127 VAL A CG1  1 
ATOM   2375 C CG2  A VAL A 1 127 ? 12.413  10.818 3.865  0.74 16.04  ? 127 VAL A CG2  1 
ATOM   2376 C CG2  B VAL A 1 127 ? 11.503  10.818 6.003  0.26 50.24  ? 127 VAL A CG2  1 
ATOM   2377 H H    A VAL A 1 127 ? 9.531   10.855 4.085  0.74 14.87  ? 127 VAL A H    1 
ATOM   2378 H H    B VAL A 1 127 ? 9.583   10.868 4.029  0.26 23.50  ? 127 VAL A H    1 
ATOM   2379 H HA   A VAL A 1 127 ? 10.899  8.610  3.664  0.74 18.05  ? 127 VAL A HA   1 
ATOM   2380 H HA   B VAL A 1 127 ? 10.869  8.563  3.603  0.26 14.84  ? 127 VAL A HA   1 
ATOM   2381 H HB   A VAL A 1 127 ? 11.422  10.590 5.646  0.74 15.12  ? 127 VAL A HB   1 
ATOM   2382 H HB   B VAL A 1 127 ? 12.533  9.366  4.988  0.26 26.84  ? 127 VAL A HB   1 
ATOM   2383 H HG11 A VAL A 1 127 ? 13.495  9.538  5.976  0.74 13.57  ? 127 VAL A HG11 1 
ATOM   2384 H HG11 B VAL A 1 127 ? 13.067  11.380 3.945  0.26 25.54  ? 127 VAL A HG11 1 
ATOM   2385 H HG12 A VAL A 1 127 ? 12.325  8.553  6.339  0.74 13.57  ? 127 VAL A HG12 1 
ATOM   2386 H HG12 B VAL A 1 127 ? 12.536  10.345 2.887  0.26 25.54  ? 127 VAL A HG12 1 
ATOM   2387 H HG13 A VAL A 1 127 ? 13.086  8.399  4.972  0.74 13.57  ? 127 VAL A HG13 1 
ATOM   2388 H HG13 B VAL A 1 127 ? 11.597  11.497 3.400  0.26 25.54  ? 127 VAL A HG13 1 
ATOM   2389 H HG21 A VAL A 1 127 ? 13.153  11.297 4.245  0.74 19.13  ? 127 VAL A HG21 1 
ATOM   2390 H HG21 B VAL A 1 127 ? 12.292  11.299 6.263  0.26 60.17  ? 127 VAL A HG21 1 
ATOM   2391 H HG22 A VAL A 1 127 ? 12.722  10.236 3.167  0.74 19.13  ? 127 VAL A HG22 1 
ATOM   2392 H HG22 B VAL A 1 127 ? 10.796  11.434 5.799  0.26 60.17  ? 127 VAL A HG22 1 
ATOM   2393 H HG23 A VAL A 1 127 ? 11.768  11.436 3.515  0.74 19.13  ? 127 VAL A HG23 1 
ATOM   2394 H HG23 B VAL A 1 127 ? 11.230  10.229 6.711  0.26 60.17  ? 127 VAL A HG23 1 
ATOM   2395 N N    A VAL A 1 128 ? 9.979   6.955  5.163  0.74 14.49  ? 128 VAL A N    1 
ATOM   2396 N N    B VAL A 1 128 ? 9.914   7.064  5.242  0.26 14.62  ? 128 VAL A N    1 
ATOM   2397 C CA   A VAL A 1 128 ? 9.599   5.902  6.127  0.74 10.57  ? 128 VAL A CA   1 
ATOM   2398 C CA   B VAL A 1 128 ? 9.483   6.134  6.272  0.26 24.88  ? 128 VAL A CA   1 
ATOM   2399 C C    A VAL A 1 128 ? 10.723  5.639  7.138  0.74 16.07  ? 128 VAL A C    1 
ATOM   2400 C C    B VAL A 1 128 ? 10.682  5.816  7.150  0.26 14.08  ? 128 VAL A C    1 
ATOM   2401 O O    A VAL A 1 128 ? 11.869  5.425  6.745  0.74 14.77  ? 128 VAL A O    1 
ATOM   2402 O O    B VAL A 1 128 ? 11.817  5.706  6.680  0.26 18.82  ? 128 VAL A O    1 
ATOM   2403 C CB   A VAL A 1 128 ? 9.209   4.580  5.400  0.74 11.22  ? 128 VAL A CB   1 
ATOM   2404 C CB   B VAL A 1 128 ? 8.909   4.827  5.683  0.26 25.12  ? 128 VAL A CB   1 
ATOM   2405 C CG1  A VAL A 1 128 ? 8.966   3.475  6.415  0.74 12.25  ? 128 VAL A CG1  1 
ATOM   2406 C CG1  B VAL A 1 128 ? 7.893   5.124  4.592  0.26 15.28  ? 128 VAL A CG1  1 
ATOM   2407 C CG2  A VAL A 1 128 ? 7.963   4.805  4.505  0.74 16.27  ? 128 VAL A CG2  1 
ATOM   2408 C CG2  B VAL A 1 128 ? 10.007  3.979  5.136  0.26 55.00  ? 128 VAL A CG2  1 
ATOM   2409 H H    A VAL A 1 128 ? 10.222  6.643  4.399  0.74 17.27  ? 128 VAL A H    1 
ATOM   2410 H H    B VAL A 1 128 ? 10.124  6.682  4.500  0.26 17.43  ? 128 VAL A H    1 
ATOM   2411 H HA   A VAL A 1 128 ? 8.814   6.207  6.629  0.74 12.57  ? 128 VAL A HA   1 
ATOM   2412 H HA   B VAL A 1 128 ? 8.794   6.556  6.826  0.26 29.73  ? 128 VAL A HA   1 
ATOM   2413 H HB   A VAL A 1 128 ? 9.951   4.303  4.823  0.74 13.34  ? 128 VAL A HB   1 
ATOM   2414 H HB   B VAL A 1 128 ? 8.458   4.324  6.393  0.26 30.03  ? 128 VAL A HB   1 
ATOM   2415 H HG11 A VAL A 1 128 ? 8.728   2.670  5.949  0.74 14.58  ? 128 VAL A HG11 1 
ATOM   2416 H HG11 B VAL A 1 128 ? 7.555   4.295  4.246  0.26 18.22  ? 128 VAL A HG11 1 
ATOM   2417 H HG12 A VAL A 1 128 ? 9.769   3.335  6.922  0.74 14.58  ? 128 VAL A HG12 1 
ATOM   2418 H HG12 B VAL A 1 128 ? 7.175   5.641  4.965  0.26 18.22  ? 128 VAL A HG12 1 
ATOM   2419 H HG13 A VAL A 1 128 ? 8.252   3.740  6.999  0.74 14.58  ? 128 VAL A HG13 1 
ATOM   2420 H HG13 B VAL A 1 128 ? 8.324   5.619  3.891  0.26 18.22  ? 128 VAL A HG13 1 
ATOM   2421 H HG21 A VAL A 1 128 ? 7.740   3.980  4.067  0.74 19.40  ? 128 VAL A HG21 1 
ATOM   2422 H HG21 B VAL A 1 128 ? 9.629   3.174  4.776  0.26 65.88  ? 128 VAL A HG21 1 
ATOM   2423 H HG22 A VAL A 1 128 ? 7.231   5.092  5.056  0.74 19.40  ? 128 VAL A HG22 1 
ATOM   2424 H HG22 B VAL A 1 128 ? 10.462  4.466  4.445  0.26 65.88  ? 128 VAL A HG22 1 
ATOM   2425 H HG23 A VAL A 1 128 ? 8.166   5.479  3.852  0.74 19.40  ? 128 VAL A HG23 1 
ATOM   2426 H HG23 B VAL A 1 128 ? 10.619  3.766  5.844  0.26 65.88  ? 128 VAL A HG23 1 
ATOM   2427 N N    . PHE A 1 129 ? 10.422  5.684  8.436  1.00 12.84  ? 129 PHE A N    1 
ATOM   2428 C CA   . PHE A 1 129 ? 11.484  5.595  9.420  1.00 14.72  ? 129 PHE A CA   1 
ATOM   2429 C C    . PHE A 1 129 ? 11.177  4.711  10.623 1.00 12.54  ? 129 PHE A C    1 
ATOM   2430 O O    . PHE A 1 129 ? 12.027  4.575  11.512 1.00 16.49  ? 129 PHE A O    1 
ATOM   2431 C CB   . PHE A 1 129 ? 11.859  7.016  9.893  1.00 15.30  ? 129 PHE A CB   1 
ATOM   2432 C CG   . PHE A 1 129 ? 10.777  7.717  10.676 1.00 14.25  ? 129 PHE A CG   1 
ATOM   2433 C CD1  . PHE A 1 129 ? 9.792   8.451  10.031 1.00 16.31  ? 129 PHE A CD1  1 
ATOM   2434 C CD2  . PHE A 1 129 ? 10.768  7.646  12.054 1.00 16.73  ? 129 PHE A CD2  1 
ATOM   2435 C CE1  . PHE A 1 129 ? 8.814   9.081  10.749 1.00 14.56  ? 129 PHE A CE1  1 
ATOM   2436 C CE2  . PHE A 1 129 ? 9.788   8.287  12.799 1.00 18.43  ? 129 PHE A CE2  1 
ATOM   2437 C CZ   . PHE A 1 129 ? 8.813   9.022  12.127 1.00 17.92  ? 129 PHE A CZ   1 
ATOM   2438 H H    A PHE A 1 129 ? 9.630   5.763  8.761  0.75 15.30  ? 129 PHE A H    1 
ATOM   2439 H H    B PHE A 1 129 ? 9.631   5.642  8.770  0.25 15.30  ? 129 PHE A H    1 
ATOM   2440 H HA   . PHE A 1 129 ? 12.274  5.217  8.981  1.00 17.55  ? 129 PHE A HA   1 
ATOM   2441 H HB2  . PHE A 1 129 ? 12.643  6.958  10.461 1.00 18.25  ? 129 PHE A HB2  1 
ATOM   2442 H HB3  . PHE A 1 129 ? 12.059  7.560  9.114  1.00 18.25  ? 129 PHE A HB3  1 
ATOM   2443 H HD1  . PHE A 1 129 ? 9.789   8.504  9.103  1.00 19.46  ? 129 PHE A HD1  1 
ATOM   2444 H HD2  . PHE A 1 129 ? 11.430  7.161  12.492 1.00 19.96  ? 129 PHE A HD2  1 
ATOM   2445 H HE1  . PHE A 1 129 ? 8.160   9.572  10.307 1.00 17.36  ? 129 PHE A HE1  1 
ATOM   2446 H HE2  . PHE A 1 129 ? 9.788   8.237  13.727 1.00 22.00  ? 129 PHE A HE2  1 
ATOM   2447 H HZ   . PHE A 1 129 ? 8.143   9.451  12.608 1.00 21.38  ? 129 PHE A HZ   1 
ATOM   2448 N N    . GLY A 1 130 ? 9.988   4.111  10.663 1.00 13.66  ? 130 GLY A N    1 
ATOM   2449 C CA   . GLY A 1 130 ? 9.626   3.236  11.759 1.00 14.56  ? 130 GLY A CA   1 
ATOM   2450 C C    . GLY A 1 130 ? 8.379   2.415  11.499 1.00 12.96  ? 130 GLY A C    1 
ATOM   2451 O O    . GLY A 1 130 ? 7.764   2.518  10.449 1.00 16.38  ? 130 GLY A O    1 
ATOM   2452 H H    . GLY A 1 130 ? 9.376   4.199  10.065 1.00 16.27  ? 130 GLY A H    1 
ATOM   2453 H HA2  . GLY A 1 130 ? 10.360  2.625  11.933 1.00 17.36  ? 130 GLY A HA2  1 
ATOM   2454 H HA3  . GLY A 1 130 ? 9.478   3.768  12.556 1.00 17.36  ? 130 GLY A HA3  1 
ATOM   2455 N N    . LYS A 1 131 ? 8.008   1.616  12.496 1.00 14.90  ? 131 LYS A N    1 
ATOM   2456 C CA   . LYS A 1 131 ? 6.805   0.793  12.451 1.00 17.57  ? 131 LYS A CA   1 
ATOM   2457 C C    . LYS A 1 131 ? 6.286   0.572  13.862 1.00 15.18  ? 131 LYS A C    1 
ATOM   2458 O O    . LYS A 1 131 ? 7.044   0.490  14.811 1.00 17.70  ? 131 LYS A O    1 
ATOM   2459 C CB   . LYS A 1 131 ? 7.053   -0.548 11.727 1.00 19.40  ? 131 LYS A CB   1 
ATOM   2460 C CG   . LYS A 1 131 ? 7.778   -1.600 12.548 1.00 33.73  ? 131 LYS A CG   1 
ATOM   2461 C CD   . LYS A 1 131 ? 7.763   -2.975 11.843 1.00 64.70  ? 131 LYS A CD   1 
ATOM   2462 C CE   . LYS A 1 131 ? 8.541   -4.020 12.626 1.00 84.56  ? 131 LYS A CE   1 
ATOM   2463 N NZ   . LYS A 1 131 ? 8.757   -5.261 11.818 1.00 94.89  ? 131 LYS A NZ   1 
ATOM   2464 H H    . LYS A 1 131 ? 8.451   1.532  13.229 1.00 17.76  ? 131 LYS A H    1 
ATOM   2465 H HA   . LYS A 1 131 ? 6.113   1.277  11.952 1.00 20.97  ? 131 LYS A HA   1 
ATOM   2466 H HB2  . LYS A 1 131 ? 6.196   -0.920 11.466 1.00 23.17  ? 131 LYS A HB2  1 
ATOM   2467 H HB3  . LYS A 1 131 ? 7.587   -0.376 10.936 1.00 23.17  ? 131 LYS A HB3  1 
ATOM   2468 H HG2  . LYS A 1 131 ? 8.702   -1.331 12.671 1.00 40.36  ? 131 LYS A HG2  1 
ATOM   2469 H HG3  . LYS A 1 131 ? 7.338   -1.695 13.408 1.00 40.36  ? 131 LYS A HG3  1 
ATOM   2470 H HD2  . LYS A 1 131 ? 6.846   -3.280 11.758 1.00 77.53  ? 131 LYS A HD2  1 
ATOM   2471 H HD3  . LYS A 1 131 ? 8.169   -2.888 10.966 1.00 77.53  ? 131 LYS A HD3  1 
ATOM   2472 H HE2  . LYS A 1 131 ? 9.409   -3.659 12.867 1.00 101.36 ? 131 LYS A HE2  1 
ATOM   2473 H HE3  . LYS A 1 131 ? 8.043   -4.259 13.423 1.00 101.36 ? 131 LYS A HE3  1 
ATOM   2474 H HZ1  . LYS A 1 131 ? 9.249   -5.905 12.332 1.00 113.75 ? 131 LYS A HZ1  1 
ATOM   2475 H HZ2  . LYS A 1 131 ? 7.911   -5.641 11.568 1.00 113.75 ? 131 LYS A HZ2  1 
ATOM   2476 H HZ3  . LYS A 1 131 ? 9.252   -5.052 11.022 1.00 113.75 ? 131 LYS A HZ3  1 
ATOM   2477 N N    . VAL A 1 132 ? 4.971   0.472  13.985 1.00 15.36  ? 132 VAL A N    1 
ATOM   2478 C CA   . VAL A 1 132 ? 4.355   0.022  15.221 1.00 15.64  ? 132 VAL A CA   1 
ATOM   2479 C C    . VAL A 1 132 ? 4.823   -1.388 15.557 1.00 17.38  ? 132 VAL A C    1 
ATOM   2480 O O    . VAL A 1 132 ? 4.770   -2.309 14.721 1.00 21.99  ? 132 VAL A O    1 
ATOM   2481 C CB   . VAL A 1 132 ? 2.814   0.044  15.123 1.00 16.69  ? 132 VAL A CB   1 
ATOM   2482 C CG1  . VAL A 1 132 ? 2.156   -0.541 16.395 1.00 18.99  ? 132 VAL A CG1  1 
ATOM   2483 C CG2  . VAL A 1 132 ? 2.320   1.474  14.876 1.00 17.34  ? 132 VAL A CG2  1 
ATOM   2484 H H    . VAL A 1 132 ? 4.410   0.661  13.362 1.00 18.32  ? 132 VAL A H    1 
ATOM   2485 H HA   . VAL A 1 132 ? 4.625   0.617  15.951 1.00 18.65  ? 132 VAL A HA   1 
ATOM   2486 H HB   . VAL A 1 132 ? 2.536   -0.506 14.360 1.00 19.91  ? 132 VAL A HB   1 
ATOM   2487 H HG11 . VAL A 1 132 ? 1.201   -0.509 16.295 1.00 22.67  ? 132 VAL A HG11 1 
ATOM   2488 H HG12 . VAL A 1 132 ? 2.444   -1.450 16.506 1.00 22.67  ? 132 VAL A HG12 1 
ATOM   2489 H HG13 . VAL A 1 132 ? 2.423   -0.017 17.154 1.00 22.67  ? 132 VAL A HG13 1 
ATOM   2490 H HG21 . VAL A 1 132 ? 1.362   1.468  14.818 1.00 20.69  ? 132 VAL A HG21 1 
ATOM   2491 H HG22 . VAL A 1 132 ? 2.601   2.031  15.606 1.00 20.69  ? 132 VAL A HG22 1 
ATOM   2492 H HG23 . VAL A 1 132 ? 2.696   1.796  14.054 1.00 20.69  ? 132 VAL A HG23 1 
ATOM   2493 N N    . LYS A 1 133 ? 5.286   -1.511 16.792 1.00 17.28  ? 133 LYS A N    1 
ATOM   2494 C CA   . LYS A 1 133 ? 5.784   -2.760 17.367 1.00 19.78  ? 133 LYS A CA   1 
ATOM   2495 C C    . LYS A 1 133 ? 4.723   -3.384 18.264 1.00 22.98  ? 133 LYS A C    1 
ATOM   2496 O O    . LYS A 1 133 ? 4.434   -4.560 18.145 1.00 30.38  ? 133 LYS A O    1 
ATOM   2497 C CB   . LYS A 1 133 ? 7.089   -2.478 18.119 1.00 27.61  ? 133 LYS A CB   1 
ATOM   2498 C CG   . LYS A 1 133 ? 7.795   -3.661 18.693 1.00 48.95  ? 133 LYS A CG   1 
ATOM   2499 C CD   . LYS A 1 133 ? 9.060   -3.176 19.398 1.00 49.70  ? 133 LYS A CD   1 
ATOM   2500 C CE   . LYS A 1 133 ? 9.959   -4.319 19.840 1.00 79.23  ? 133 LYS A CE   1 
ATOM   2501 N NZ   . LYS A 1 133 ? 11.195  -3.797 20.494 1.00 78.88  ? 133 LYS A NZ   1 
ATOM   2502 H H    . LYS A 1 133 ? 5.325   -0.853 17.344 1.00 20.61  ? 133 LYS A H    1 
ATOM   2503 H HA   . LYS A 1 133 ? 5.980   -3.391 16.644 1.00 23.61  ? 133 LYS A HA   1 
ATOM   2504 H HB2  . LYS A 1 133 ? 7.704   -2.045 17.507 1.00 33.01  ? 133 LYS A HB2  1 
ATOM   2505 H HB3  . LYS A 1 133 ? 6.891   -1.876 18.854 1.00 33.01  ? 133 LYS A HB3  1 
ATOM   2506 H HG2  . LYS A 1 133 ? 7.225   -4.102 19.342 1.00 58.63  ? 133 LYS A HG2  1 
ATOM   2507 H HG3  . LYS A 1 133 ? 8.047   -4.271 17.982 1.00 58.63  ? 133 LYS A HG3  1 
ATOM   2508 H HD2  . LYS A 1 133 ? 9.566   -2.614 18.790 1.00 59.52  ? 133 LYS A HD2  1 
ATOM   2509 H HD3  . LYS A 1 133 ? 8.809   -2.669 20.186 1.00 59.52  ? 133 LYS A HD3  1 
ATOM   2510 H HE2  . LYS A 1 133 ? 9.485   -4.874 20.479 1.00 94.96  ? 133 LYS A HE2  1 
ATOM   2511 H HE3  . LYS A 1 133 ? 10.220  -4.842 19.066 1.00 94.96  ? 133 LYS A HE3  1 
ATOM   2512 H HZ1  . LYS A 1 133 ? 11.755  -4.528 20.769 1.00 94.53  ? 133 LYS A HZ1  1 
ATOM   2513 H HZ2  . LYS A 1 133 ? 11.683  -3.245 19.880 1.00 94.53  ? 133 LYS A HZ2  1 
ATOM   2514 H HZ3  . LYS A 1 133 ? 10.963  -3.276 21.266 1.00 94.53  ? 133 LYS A HZ3  1 
ATOM   2515 N N    . GLU A 1 134 ? 4.182   -2.611 19.189 1.00 20.40  ? 134 GLU A N    1 
ATOM   2516 C CA   . GLU A 1 134 ? 3.078   -3.045 20.032 1.00 18.53  ? 134 GLU A CA   1 
ATOM   2517 C C    . GLU A 1 134 ? 1.981   -2.023 20.050 1.00 18.09  ? 134 GLU A C    1 
ATOM   2518 O O    . GLU A 1 134 ? 2.223   -0.830 19.925 1.00 18.38  ? 134 GLU A O    1 
ATOM   2519 C CB   . GLU A 1 134 ? 3.528   -3.235 21.470 1.00 25.37  ? 134 GLU A CB   1 
ATOM   2520 C CG   . GLU A 1 134 ? 4.593   -4.225 21.650 1.00 39.87  ? 134 GLU A CG   1 
ATOM   2521 C CD   . GLU A 1 134 ? 4.825   -4.438 23.104 1.00 45.54  ? 134 GLU A CD   1 
ATOM   2522 O OE1  . GLU A 1 134 ? 4.423   -5.503 23.619 1.00 62.65  ? 134 GLU A OE1  1 
ATOM   2523 O OE2  . GLU A 1 134 ? 5.370   -3.506 23.718 1.00 43.07  ? 134 GLU A OE2  1 
ATOM   2524 H H    . GLU A 1 134 ? 4.443   -1.809 19.354 1.00 24.36  ? 134 GLU A H    1 
ATOM   2525 H HA   . GLU A 1 134 ? 2.717   -3.893 19.698 1.00 22.12  ? 134 GLU A HA   1 
ATOM   2526 H HB2  . GLU A 1 134 ? 3.856   -2.386 21.807 1.00 30.33  ? 134 GLU A HB2  1 
ATOM   2527 H HB3  . GLU A 1 134 ? 2.767   -3.523 21.998 1.00 30.33  ? 134 GLU A HB3  1 
ATOM   2528 H HG2  . GLU A 1 134 ? 4.327   -5.068 21.251 1.00 47.73  ? 134 GLU A HG2  1 
ATOM   2529 H HG3  . GLU A 1 134 ? 5.414   -3.900 21.249 1.00 47.73  ? 134 GLU A HG3  1 
ATOM   2530 N N    . GLY A 1 135 ? 0.757   -2.486 20.276 1.00 19.33  ? 135 GLY A N    1 
ATOM   2531 C CA   . GLY A 1 135 ? -0.379  -1.597 20.381 1.00 17.76  ? 135 GLY A CA   1 
ATOM   2532 C C    . GLY A 1 135 ? -0.991  -1.152 19.080 1.00 15.66  ? 135 GLY A C    1 
ATOM   2533 O O    . GLY A 1 135 ? -1.607  -0.106 19.030 1.00 17.73  ? 135 GLY A O    1 
ATOM   2534 H H    . GLY A 1 135 ? 0.562   -3.318 20.372 1.00 23.08  ? 135 GLY A H    1 
ATOM   2535 H HA2  . GLY A 1 135 ? -1.072  -2.037 20.897 1.00 21.20  ? 135 GLY A HA2  1 
ATOM   2536 H HA3  . GLY A 1 135 ? -0.108  -0.802 20.866 1.00 21.20  ? 135 GLY A HA3  1 
ATOM   2537 N N    . MET A 1 136 ? -0.859  -1.938 18.025 1.00 17.55  ? 136 MET A N    1 
ATOM   2538 C CA   . MET A 1 136 ? -1.569  -1.598 16.809 1.00 17.00  ? 136 MET A CA   1 
ATOM   2539 C C    . MET A 1 136 ? -3.068  -1.536 17.073 1.00 15.86  ? 136 MET A C    1 
ATOM   2540 O O    . MET A 1 136 ? -3.777  -0.744 16.446 1.00 19.55  ? 136 MET A O    1 
ATOM   2541 C CB   . MET A 1 136 ? -1.288  -2.628 15.728 1.00 21.62  ? 136 MET A CB   1 
ATOM   2542 C CG   . MET A 1 136 ? -1.738  -2.186 14.359 1.00 28.37  ? 136 MET A CG   1 
ATOM   2543 S SD   . MET A 1 136 ? -0.951  -0.680 13.713 1.00 24.40  ? 136 MET A SD   1 
ATOM   2544 C CE   . MET A 1 136 ? -2.156  -0.131 12.493 1.00 30.11  ? 136 MET A CE   1 
ATOM   2545 H H    . MET A 1 136 ? -0.381  -2.651 17.986 1.00 20.94  ? 136 MET A H    1 
ATOM   2546 H HA   . MET A 1 136 ? -1.261  -0.725 16.488 1.00 20.28  ? 136 MET A HA   1 
ATOM   2547 H HB2  . MET A 1 136 ? -0.332  -2.792 15.691 1.00 25.83  ? 136 MET A HB2  1 
ATOM   2548 H HB3  . MET A 1 136 ? -1.756  -3.450 15.946 1.00 25.83  ? 136 MET A HB3  1 
ATOM   2549 H HG2  . MET A 1 136 ? -1.553  -2.901 13.730 1.00 33.93  ? 136 MET A HG2  1 
ATOM   2550 H HG3  . MET A 1 136 ? -2.694  -2.022 14.389 1.00 33.93  ? 136 MET A HG3  1 
ATOM   2551 H HE1  . MET A 1 136 ? -1.837  0.675  12.080 1.00 36.02  ? 136 MET A HE1  1 
ATOM   2552 H HE2  . MET A 1 136 ? -2.265  -0.818 11.831 1.00 36.02  ? 136 MET A HE2  1 
ATOM   2553 H HE3  . MET A 1 136 ? -2.993  0.036  12.933 1.00 36.02  ? 136 MET A HE3  1 
ATOM   2554 N N    . ASN A 1 137 ? -3.543  -2.341 18.024 1.00 18.03  ? 137 ASN A N    1 
ATOM   2555 C CA   . ASN A 1 137 ? -4.965  -2.313 18.398 1.00 20.01  ? 137 ASN A CA   1 
ATOM   2556 C C    . ASN A 1 137 ? -5.377  -0.950 18.964 1.00 22.04  ? 137 ASN A C    1 
ATOM   2557 O O    . ASN A 1 137 ? -6.539  -0.546 18.828 1.00 21.28  ? 137 ASN A O    1 
ATOM   2558 C CB   . ASN A 1 137 ? -5.314  -3.380 19.442 1.00 19.51  ? 137 ASN A CB   1 
ATOM   2559 C CG   . ASN A 1 137 ? -4.440  -3.288 20.699 1.00 20.12  ? 137 ASN A CG   1 
ATOM   2560 O OD1  . ASN A 1 137 ? -3.205  -3.253 20.617 1.00 20.30  ? 137 ASN A OD1  1 
ATOM   2561 N ND2  . ASN A 1 137 ? -5.075  -3.277 21.865 1.00 22.14  ? 137 ASN A ND2  1 
ATOM   2562 H H    . ASN A 1 137 ? -3.071  -2.908 18.466 1.00 21.52  ? 137 ASN A H    1 
ATOM   2563 H HA   . ASN A 1 137 ? -5.506  -2.484 17.599 1.00 23.90  ? 137 ASN A HA   1 
ATOM   2564 H HB2  . ASN A 1 137 ? -6.239  -3.268 19.711 1.00 23.30  ? 137 ASN A HB2  1 
ATOM   2565 H HB3  . ASN A 1 137 ? -5.186  -4.258 19.052 1.00 23.30  ? 137 ASN A HB3  1 
ATOM   2566 H HD21 . ASN A 1 137 ? -4.566  -3.220 22.700 1.00 26.45  ? 137 ASN A HD21 1 
ATOM   2567 H HD22 . ASN A 1 137 ? -6.054  -3.326 21.890 1.00 26.45  ? 137 ASN A HD22 1 
ATOM   2568 N N    . ILE A 1 138 ? -4.424  -0.251 19.587 1.00 15.62  ? 138 ILE A N    1 
ATOM   2569 C CA   . ILE A 1 138 ? -4.670  1.084  20.114 1.00 15.67  ? 138 ILE A CA   1 
ATOM   2570 C C    . ILE A 1 138 ? -4.760  2.114  18.981 1.00 17.15  ? 138 ILE A C    1 
ATOM   2571 O O    . ILE A 1 138 ? -5.606  3.030  18.995 1.00 17.34  ? 138 ILE A O    1 
ATOM   2572 C CB   . ILE A 1 138 ? -3.593  1.475  21.164 1.00 17.56  ? 138 ILE A CB   1 
ATOM   2573 C CG1  . ILE A 1 138 ? -3.615  0.505  22.362 1.00 18.31  ? 138 ILE A CG1  1 
ATOM   2574 C CG2  . ILE A 1 138 ? -3.768  2.901  21.682 1.00 18.76  ? 138 ILE A CG2  1 
ATOM   2575 C CD1  . ILE A 1 138 ? -4.989  0.386  23.086 1.00 23.32  ? 138 ILE A CD1  1 
ATOM   2576 H H    . ILE A 1 138 ? -3.623  -0.534 19.716 1.00 18.62  ? 138 ILE A H    1 
ATOM   2577 H HA   . ILE A 1 138 ? -5.536  1.079  20.573 1.00 18.69  ? 138 ILE A HA   1 
ATOM   2578 H HB   . ILE A 1 138 ? -2.723  1.412  20.740 1.00 20.95  ? 138 ILE A HB   1 
ATOM   2579 H HG12 . ILE A 1 138 ? -3.373  -0.380 22.047 1.00 21.85  ? 138 ILE A HG12 1 
ATOM   2580 H HG13 . ILE A 1 138 ? -2.965  0.806  23.016 1.00 21.85  ? 138 ILE A HG13 1 
ATOM   2581 H HG21 . ILE A 1 138 ? -3.079  3.086  22.324 1.00 22.39  ? 138 ILE A HG21 1 
ATOM   2582 H HG22 . ILE A 1 138 ? -3.702  3.511  20.944 1.00 22.39  ? 138 ILE A HG22 1 
ATOM   2583 H HG23 . ILE A 1 138 ? -4.631  2.979  22.096 1.00 22.39  ? 138 ILE A HG23 1 
ATOM   2584 H HD11 . ILE A 1 138 ? -4.907  -0.235 23.813 1.00 27.86  ? 138 ILE A HD11 1 
ATOM   2585 H HD12 . ILE A 1 138 ? -5.241  1.250  23.421 1.00 27.86  ? 138 ILE A HD12 1 
ATOM   2586 H HD13 . ILE A 1 138 ? -5.646  0.073  22.460 1.00 27.86  ? 138 ILE A HD13 1 
ATOM   2587 N N    . VAL A 1 139 ? -3.895  1.970  17.988 1.00 15.17  ? 139 VAL A N    1 
ATOM   2588 C CA   . VAL A 1 139 ? -3.991  2.808  16.788 1.00 14.27  ? 139 VAL A CA   1 
ATOM   2589 C C    . VAL A 1 139 ? -5.360  2.589  16.113 1.00 17.29  ? 139 VAL A C    1 
ATOM   2590 O O    . VAL A 1 139 ? -6.016  3.527  15.677 1.00 17.91  ? 139 VAL A O    1 
ATOM   2591 C CB   . VAL A 1 139 ? -2.858  2.497  15.832 1.00 17.08  ? 139 VAL A CB   1 
ATOM   2592 C CG1  . VAL A 1 139 ? -3.046  3.261  14.500 1.00 19.89  ? 139 VAL A CG1  1 
ATOM   2593 C CG2  . VAL A 1 139 ? -1.521  2.841  16.476 1.00 19.39  ? 139 VAL A CG2  1 
ATOM   2594 H H    . VAL A 1 139 ? -3.249  1.403  17.977 1.00 18.09  ? 139 VAL A H    1 
ATOM   2595 H HA   . VAL A 1 139 ? -3.924  3.751  17.046 1.00 17.00  ? 139 VAL A HA   1 
ATOM   2596 H HB   . VAL A 1 139 ? -2.861  1.537  15.635 1.00 20.38  ? 139 VAL A HB   1 
ATOM   2597 H HG11 . VAL A 1 139 ? -2.317  3.048  13.913 1.00 23.75  ? 139 VAL A HG11 1 
ATOM   2598 H HG12 . VAL A 1 139 ? -3.877  2.993  14.102 1.00 23.75  ? 139 VAL A HG12 1 
ATOM   2599 H HG13 . VAL A 1 139 ? -3.057  4.204  14.680 1.00 23.75  ? 139 VAL A HG13 1 
ATOM   2600 H HG21 . VAL A 1 139 ? -0.815  2.637  15.857 1.00 23.15  ? 139 VAL A HG21 1 
ATOM   2601 H HG22 . VAL A 1 139 ? -1.509  3.776  16.691 1.00 23.15  ? 139 VAL A HG22 1 
ATOM   2602 H HG23 . VAL A 1 139 ? -1.416  2.320  17.275 1.00 23.15  ? 139 VAL A HG23 1 
ATOM   2603 N N    . GLU A 1 140 ? -5.814  1.341  16.066 1.00 16.66  ? 140 GLU A N    1 
ATOM   2604 C CA   . GLU A 1 140 ? -7.119  1.038  15.478 1.00 17.79  ? 140 GLU A CA   1 
ATOM   2605 C C    . GLU A 1 140 ? -8.252  1.695  16.287 1.00 17.49  ? 140 GLU A C    1 
ATOM   2606 O O    . GLU A 1 140 ? -9.208  2.221  15.720 1.00 21.55  ? 140 GLU A O    1 
ATOM   2607 C CB   . GLU A 1 140 ? -7.327  -0.478 15.375 1.00 21.78  ? 140 GLU A CB   1 
ATOM   2608 C CG   . GLU A 1 140 ? -6.409  -1.183 14.340 1.00 24.60  ? 140 GLU A CG   1 
ATOM   2609 C CD   . GLU A 1 140 ? -6.413  -2.714 14.461 1.00 41.50  ? 140 GLU A CD   1 
ATOM   2610 O OE1  . GLU A 1 140 ? -7.001  -3.279 15.428 1.00 48.70  ? 140 GLU A OE1  1 
ATOM   2611 O OE2  . GLU A 1 140 ? -5.822  -3.368 13.572 1.00 43.75  ? 140 GLU A OE2  1 
ATOM   2612 H H    . GLU A 1 140 ? -5.390  0.655  16.364 1.00 19.87  ? 140 GLU A H    1 
ATOM   2613 H HA   . GLU A 1 140 ? -7.149  1.405  14.570 1.00 21.23  ? 140 GLU A HA   1 
ATOM   2614 H HB2  . GLU A 1 140 ? -7.151  -0.874 16.242 1.00 26.02  ? 140 GLU A HB2  1 
ATOM   2615 H HB3  . GLU A 1 140 ? -8.246  -0.648 15.118 1.00 26.02  ? 140 GLU A HB3  1 
ATOM   2616 H HG2  . GLU A 1 140 ? -6.711  -0.954 13.447 1.00 29.40  ? 140 GLU A HG2  1 
ATOM   2617 H HG3  . GLU A 1 140 ? -5.498  -0.876 14.469 1.00 29.40  ? 140 GLU A HG3  1 
ATOM   2618 N N    . ALA A 1 141 ? -8.123  1.722  17.612 1.00 17.92  ? 141 ALA A N    1 
ATOM   2619 C CA   . ALA A 1 141 ? -9.113  2.382  18.456 1.00 20.07  ? 141 ALA A CA   1 
ATOM   2620 C C    . ALA A 1 141 ? -9.137  3.900  18.220 1.00 20.76  ? 141 ALA A C    1 
ATOM   2621 O O    . ALA A 1 141 ? -10.203 4.507  18.202 1.00 23.28  ? 141 ALA A O    1 
ATOM   2622 C CB   . ALA A 1 141 ? -8.834  2.068  19.921 1.00 23.46  ? 141 ALA A CB   1 
ATOM   2623 H H    . ALA A 1 141 ? -7.471  1.365  18.045 1.00 21.38  ? 141 ALA A H    1 
ATOM   2624 H HA   . ALA A 1 141 ? -10.001 2.030  18.237 1.00 23.97  ? 141 ALA A HA   1 
ATOM   2625 H HB1  . ALA A 1 141 ? -9.492  2.508  20.465 1.00 28.03  ? 141 ALA A HB1  1 
ATOM   2626 H HB2  . ALA A 1 141 ? -8.884  1.118  20.051 1.00 28.03  ? 141 ALA A HB2  1 
ATOM   2627 H HB3  . ALA A 1 141 ? -7.957  2.385  20.146 1.00 28.03  ? 141 ALA A HB3  1 
ATOM   2628 N N    . MET A 1 142 ? -7.959  4.497  17.997 1.00 19.17  ? 142 MET A N    1 
ATOM   2629 C CA   . MET A 1 142 ? -7.861  5.941  17.716 1.00 19.16  ? 142 MET A CA   1 
ATOM   2630 C C    . MET A 1 142 ? -8.575  6.305  16.434 1.00 21.14  ? 142 MET A C    1 
ATOM   2631 O O    . MET A 1 142 ? -9.202  7.365  16.307 1.00 21.17  ? 142 MET A O    1 
ATOM   2632 C CB   . MET A 1 142 ? -6.381  6.361  17.538 1.00 21.46  ? 142 MET A CB   1 
ATOM   2633 C CG   . MET A 1 142 ? -5.592  6.352  18.770 1.00 24.18  ? 142 MET A CG   1 
ATOM   2634 S SD   . MET A 1 142 ? -3.816  6.478  18.440 1.00 26.54  ? 142 MET A SD   1 
ATOM   2635 C CE   . MET A 1 142 ? -3.840  7.958  17.569 1.00 23.66  ? 142 MET A CE   1 
ATOM   2636 H H    . MET A 1 142 ? -7.201  4.090  18.003 1.00 22.89  ? 142 MET A H    1 
ATOM   2637 H HA   . MET A 1 142 ? -8.243  6.448  18.462 1.00 22.87  ? 142 MET A HA   1 
ATOM   2638 H HB2  . MET A 1 142 ? -5.958  5.750  16.914 1.00 25.63  ? 142 MET A HB2  1 
ATOM   2639 H HB3  . MET A 1 142 ? -6.356  7.262  17.179 1.00 25.63  ? 142 MET A HB3  1 
ATOM   2640 H HG2  . MET A 1 142 ? -5.852  7.107  19.319 1.00 28.90  ? 142 MET A HG2  1 
ATOM   2641 H HG3  . MET A 1 142 ? -5.753  5.522  19.245 1.00 28.90  ? 142 MET A HG3  1 
ATOM   2642 H HE1  . MET A 1 142 ? -2.944  8.182  17.308 1.00 28.28  ? 142 MET A HE1  1 
ATOM   2643 H HE2  . MET A 1 142 ? -4.391  7.853  16.790 1.00 28.28  ? 142 MET A HE2  1 
ATOM   2644 H HE3  . MET A 1 142 ? -4.198  8.647  18.134 1.00 28.28  ? 142 MET A HE3  1 
ATOM   2645 N N    . GLU A 1 143 ? -8.446  5.409  15.470 1.00 21.21  ? 143 GLU A N    1 
ATOM   2646 C CA   . GLU A 1 143 ? -8.943  5.608  14.136 1.00 26.57  ? 143 GLU A CA   1 
ATOM   2647 C C    . GLU A 1 143 ? -10.414 5.901  14.204 1.00 27.95  ? 143 GLU A C    1 
ATOM   2648 O O    . GLU A 1 143 ? -10.949 6.598  13.363 1.00 29.67  ? 143 GLU A O    1 
ATOM   2649 C CB   . GLU A 1 143 ? -8.706  4.333  13.317 1.00 35.56  ? 143 GLU A CB   1 
ATOM   2650 C CG   . GLU A 1 143 ? -8.262  4.611  11.971 1.00 36.66  ? 143 GLU A CG   1 
ATOM   2651 C CD   . GLU A 1 143 ? -8.099  3.385  11.107 1.00 28.73  ? 143 GLU A CD   1 
ATOM   2652 O OE1  . GLU A 1 143 ? -8.249  2.210  11.519 1.00 37.53  ? 143 GLU A OE1  1 
ATOM   2653 O OE2  . GLU A 1 143 ? -7.846  3.600  9.940  1.00 30.61  ? 143 GLU A OE2  1 
ATOM   2654 H H    . GLU A 1 143 ? -8.058  4.650  15.577 1.00 25.34  ? 143 GLU A H    1 
ATOM   2655 H HA   . GLU A 1 143 ? -8.481  6.359  13.709 1.00 31.77  ? 143 GLU A HA   1 
ATOM   2656 H HB2  . GLU A 1 143 ? -8.025  3.798  13.754 1.00 42.55  ? 143 GLU A HB2  1 
ATOM   2657 H HB3  . GLU A 1 143 ? -9.536  3.834  13.262 1.00 42.55  ? 143 GLU A HB3  1 
ATOM   2658 H HG2  . GLU A 1 143 ? -8.911  5.190  11.542 1.00 43.87  ? 143 GLU A HG2  1 
ATOM   2659 H HG3  . GLU A 1 143 ? -7.402  5.058  12.013 1.00 43.87  ? 143 GLU A HG3  1 
ATOM   2660 N N    . ARG A 1 144 ? -11.076 5.339  15.208 1.00 24.36  ? 144 ARG A N    1 
ATOM   2661 C CA   . ARG A 1 144 ? -12.536 5.407  15.270 1.00 33.15  ? 144 ARG A CA   1 
ATOM   2662 C C    . ARG A 1 144 ? -13.033 6.796  15.668 1.00 26.89  ? 144 ARG A C    1 
ATOM   2663 O O    . ARG A 1 144 ? -14.224 7.116  15.500 1.00 33.53  ? 144 ARG A O    1 
ATOM   2664 C CB   . ARG A 1 144 ? -13.079 4.315  16.198 1.00 35.71  ? 144 ARG A CB   1 
ATOM   2665 C CG   . ARG A 1 144 ? -12.986 2.904  15.576 1.00 58.81  ? 144 ARG A CG   1 
ATOM   2666 C CD   . ARG A 1 144 ? -13.818 1.874  16.316 1.00 84.62  ? 144 ARG A CD   1 
ATOM   2667 N NE   . ARG A 1 144 ? -13.214 1.458  17.582 1.00 90.74  ? 144 ARG A NE   1 
ATOM   2668 C CZ   . ARG A 1 144 ? -12.360 0.445  17.716 1.00 77.00  ? 144 ARG A CZ   1 
ATOM   2669 N NH1  . ARG A 1 144 ? -11.992 -0.273 16.657 1.00 79.50  ? 144 ARG A NH1  1 
ATOM   2670 N NH2  . ARG A 1 144 ? -11.874 0.143  18.916 1.00 80.49  ? 144 ARG A NH2  1 
ATOM   2671 H H    . ARG A 1 144 ? -10.711 4.916  15.861 1.00 29.12  ? 144 ARG A H    1 
ATOM   2672 H HA   . ARG A 1 144 ? -12.887 5.223  14.374 1.00 39.66  ? 144 ARG A HA   1 
ATOM   2673 H HB2  . ARG A 1 144 ? -12.564 4.315  17.021 1.00 42.74  ? 144 ARG A HB2  1 
ATOM   2674 H HB3  . ARG A 1 144 ? -14.012 4.498  16.390 1.00 42.74  ? 144 ARG A HB3  1 
ATOM   2675 H HG2  . ARG A 1 144 ? -13.303 2.942  14.660 1.00 70.45  ? 144 ARG A HG2  1 
ATOM   2676 H HG3  . ARG A 1 144 ? -12.062 2.611  15.595 1.00 70.45  ? 144 ARG A HG3  1 
ATOM   2677 H HD2  . ARG A 1 144 ? -14.690 2.253  16.510 1.00 101.42 ? 144 ARG A HD2  1 
ATOM   2678 H HD3  . ARG A 1 144 ? -13.916 1.087  15.757 1.00 101.42 ? 144 ARG A HD3  1 
ATOM   2679 H HE   . ARG A 1 144 ? -13.453 1.955  18.380 1.00 108.77 ? 144 ARG A HE   1 
ATOM   2680 H HH11 . ARG A 1 144 ? -12.306 -0.083 15.879 1.00 95.29  ? 144 ARG A HH11 1 
ATOM   2681 H HH12 . ARG A 1 144 ? -11.440 -0.926 16.750 1.00 95.29  ? 144 ARG A HH12 1 
ATOM   2682 H HH21 . ARG A 1 144 ? -12.108 0.605  19.603 1.00 96.47  ? 144 ARG A HH21 1 
ATOM   2683 H HH22 . ARG A 1 144 ? -11.321 -0.509 19.005 1.00 96.47  ? 144 ARG A HH22 1 
ATOM   2684 N N    . PHE A 1 145 ? -12.112 7.634  16.143 1.00 23.35  ? 145 PHE A N    1 
ATOM   2685 C CA   . PHE A 1 145 ? -12.443 9.015  16.510 1.00 22.27  ? 145 PHE A CA   1 
ATOM   2686 C C    . PHE A 1 145 ? -12.171 9.980  15.375 1.00 22.50  ? 145 PHE A C    1 
ATOM   2687 O O    . PHE A 1 145 ? -12.305 11.189 15.533 1.00 25.41  ? 145 PHE A O    1 
ATOM   2688 C CB   . PHE A 1 145 ? -11.672 9.438  17.772 1.00 21.27  ? 145 PHE A CB   1 
ATOM   2689 C CG   . PHE A 1 145 ? -12.054 8.640  18.993 1.00 21.64  ? 145 PHE A CG   1 
ATOM   2690 C CD1  . PHE A 1 145 ? -13.266 8.861  19.634 1.00 31.63  ? 145 PHE A CD1  1 
ATOM   2691 C CD2  . PHE A 1 145 ? -11.232 7.642  19.458 1.00 22.07  ? 145 PHE A CD2  1 
ATOM   2692 C CE1  . PHE A 1 145 ? -13.616 8.109  20.715 1.00 41.35  ? 145 PHE A CE1  1 
ATOM   2693 C CE2  . PHE A 1 145 ? -11.594 6.879  20.550 1.00 24.16  ? 145 PHE A CE2  1 
ATOM   2694 C CZ   . PHE A 1 145 ? -12.777 7.116  21.166 1.00 31.77  ? 145 PHE A CZ   1 
ATOM   2695 H H    . PHE A 1 145 ? -11.286 7.429  16.263 1.00 27.90  ? 145 PHE A H    1 
ATOM   2696 H HA   . PHE A 1 145 ? -13.399 9.063  16.717 1.00 26.61  ? 145 PHE A HA   1 
ATOM   2697 H HB2  . PHE A 1 145 ? -10.722 9.313  17.618 1.00 25.40  ? 145 PHE A HB2  1 
ATOM   2698 H HB3  . PHE A 1 145 ? -11.856 10.372 17.955 1.00 25.40  ? 145 PHE A HB3  1 
ATOM   2699 H HD1  . PHE A 1 145 ? -13.840 9.525  19.325 1.00 37.84  ? 145 PHE A HD1  1 
ATOM   2700 H HD2  . PHE A 1 145 ? -10.425 7.474  19.027 1.00 26.37  ? 145 PHE A HD2  1 
ATOM   2701 H HE1  . PHE A 1 145 ? -14.424 8.266  21.147 1.00 49.50  ? 145 PHE A HE1  1 
ATOM   2702 H HE2  . PHE A 1 145 ? -11.027 6.213  20.864 1.00 28.87  ? 145 PHE A HE2  1 
ATOM   2703 H HZ   . PHE A 1 145 ? -13.017 6.614  21.912 1.00 38.00  ? 145 PHE A HZ   1 
ATOM   2704 N N    . GLY A 1 146 ? -11.748 9.442  14.238 1.00 19.54  ? 146 GLY A N    1 
ATOM   2705 C CA   . GLY A 1 146 ? -11.537 10.256 13.052 1.00 18.92  ? 146 GLY A CA   1 
ATOM   2706 C C    . GLY A 1 146 ? -12.775 10.378 12.182 1.00 19.26  ? 146 GLY A C    1 
ATOM   2707 O O    . GLY A 1 146 ? -13.867 9.917  12.537 1.00 23.01  ? 146 GLY A O    1 
ATOM   2708 H H    . GLY A 1 146 ? -11.575 8.607  14.128 1.00 23.33  ? 146 GLY A H    1 
ATOM   2709 H HA2  . GLY A 1 146 ? -11.263 11.147 13.319 1.00 22.58  ? 146 GLY A HA2  1 
ATOM   2710 H HA3  . GLY A 1 146 ? -10.827 9.866  12.518 1.00 22.58  ? 146 GLY A HA3  1 
ATOM   2711 N N    . SER A 1 147 ? -12.594 11.000 11.026 1.00 18.19  ? 147 SER A N    1 
ATOM   2712 C CA   . SER A 1 147 ? -13.680 11.238 10.074 1.00 18.17  ? 147 SER A CA   1 
ATOM   2713 C C    . SER A 1 147 ? -13.126 11.420 8.652  1.00 17.38  ? 147 SER A C    1 
ATOM   2714 O O    . SER A 1 147 ? -11.907 11.521 8.454  1.00 18.13  ? 147 SER A O    1 
ATOM   2715 C CB   . SER A 1 147 ? -14.469 12.472 10.495 1.00 23.55  ? 147 SER A CB   1 
ATOM   2716 O OG   . SER A 1 147 ? -13.682 13.626 10.327 1.00 22.93  ? 147 SER A OG   1 
ATOM   2717 H H    . SER A 1 147 ? -11.835 11.302 10.761 1.00 21.71  ? 147 SER A H    1 
ATOM   2718 H HA   . SER A 1 147 ? -14.287 10.468 10.074 1.00 21.69  ? 147 SER A HA   1 
ATOM   2719 H HB2  . SER A 1 147 ? -15.263 12.546 9.944  1.00 28.14  ? 147 SER A HB2  1 
ATOM   2720 H HB3  . SER A 1 147 ? -14.716 12.389 11.429 1.00 28.14  ? 147 SER A HB3  1 
ATOM   2721 H HG   . SER A 1 147 ? -14.106 14.291 10.553 1.00 27.40  ? 147 SER A HG   1 
ATOM   2722 N N    . ARG A 1 148 ? -14.014 11.471 7.668  1.00 18.92  ? 148 ARG A N    1 
ATOM   2723 C CA   . ARG A 1 148 ? -13.593 11.566 6.274  1.00 19.37  ? 148 ARG A CA   1 
ATOM   2724 C C    . ARG A 1 148 ? -12.749 12.784 6.008  1.00 19.70  ? 148 ARG A C    1 
ATOM   2725 O O    . ARG A 1 148 ? -11.810 12.704 5.233  1.00 21.12  ? 148 ARG A O    1 
ATOM   2726 C CB   . ARG A 1 148 ? -14.806 11.598 5.342  1.00 21.54  ? 148 ARG A CB   1 
ATOM   2727 C CG   . ARG A 1 148 ? -15.552 10.279 5.210  1.00 24.78  ? 148 ARG A CG   1 
ATOM   2728 C CD   . ARG A 1 148 ? -14.786 9.232  4.403  1.00 31.21  ? 148 ARG A CD   1 
ATOM   2729 N NE   . ARG A 1 148 ? -14.318 9.732  3.108  1.00 23.62  ? 148 ARG A NE   1 
ATOM   2730 C CZ   . ARG A 1 148 ? -15.020 9.770  1.972  1.00 24.60  ? 148 ARG A CZ   1 
ATOM   2731 N NH1  . ARG A 1 148 ? -16.280 9.334  1.910  1.00 29.74  ? 148 ARG A NH1  1 
ATOM   2732 N NH2  . ARG A 1 148 ? -14.441 10.240 0.865  1.00 21.55  ? 148 ARG A NH2  1 
ATOM   2733 H H    . ARG A 1 148 ? -14.866 11.452 7.779  1.00 22.58  ? 148 ARG A H    1 
ATOM   2734 H HA   . ARG A 1 148 ? -13.061 10.774 6.049  1.00 23.13  ? 148 ARG A HA   1 
ATOM   2735 H HB2  . ARG A 1 148 ? -15.434 12.257 5.677  1.00 25.73  ? 148 ARG A HB2  1 
ATOM   2736 H HB3  . ARG A 1 148 ? -14.507 11.854 4.456  1.00 25.73  ? 148 ARG A HB3  1 
ATOM   2737 H HG2  . ARG A 1 148 ? -15.709 9.917  6.096  1.00 29.62  ? 148 ARG A HG2  1 
ATOM   2738 H HG3  . ARG A 1 148 ? -16.398 10.440 4.764  1.00 29.62  ? 148 ARG A HG3  1 
ATOM   2739 H HD2  . ARG A 1 148 ? -14.010 8.948  4.911  1.00 37.33  ? 148 ARG A HD2  1 
ATOM   2740 H HD3  . ARG A 1 148 ? -15.368 8.474  4.237  1.00 37.33  ? 148 ARG A HD3  1 
ATOM   2741 H HE   . ARG A 1 148 ? -13.408 10.068 3.071  1.00 28.22  ? 148 ARG A HE   1 
ATOM   2742 H HH11 . ARG A 1 148 ? -16.663 9.023  2.615  1.00 35.57  ? 148 ARG A HH11 1 
ATOM   2743 H HH12 . ARG A 1 148 ? -16.711 9.369  1.167  1.00 35.57  ? 148 ARG A HH12 1 
ATOM   2744 H HH21 . ARG A 1 148 ? -13.630 10.525 0.891  1.00 25.74  ? 148 ARG A HH21 1 
ATOM   2745 H HH22 . ARG A 1 148 ? -14.885 10.274 0.129  1.00 25.74  ? 148 ARG A HH22 1 
ATOM   2746 N N    . ASN A 1 149 ? -13.054 13.910 6.655  1.00 18.28  ? 149 ASN A N    1 
ATOM   2747 C CA   . ASN A 1 149 ? -12.238 15.123 6.448  1.00 19.86  ? 149 ASN A CA   1 
ATOM   2748 C C    . ASN A 1 149 ? -11.073 15.296 7.441  1.00 16.79  ? 149 ASN A C    1 
ATOM   2749 O O    . ASN A 1 149 ? -10.335 16.274 7.361  1.00 24.44  ? 149 ASN A O    1 
ATOM   2750 C CB   . ASN A 1 149 ? -13.116 16.384 6.380  1.00 23.28  ? 149 ASN A CB   1 
ATOM   2751 C CG   . ASN A 1 149 ? -13.726 16.767 7.723  1.00 25.49  ? 149 ASN A CG   1 
ATOM   2752 O OD1  . ASN A 1 149 ? -13.385 16.223 8.766  1.00 28.05  ? 149 ASN A OD1  1 
ATOM   2753 N ND2  . ASN A 1 149 ? -14.645 17.716 7.694  1.00 40.50  ? 149 ASN A ND2  1 
ATOM   2754 H H    . ASN A 1 149 ? -13.707 14.004 7.207  1.00 21.82  ? 149 ASN A H    1 
ATOM   2755 H HA   . ASN A 1 149 ? -11.824 15.037 5.564  1.00 23.72  ? 149 ASN A HA   1 
ATOM   2756 H HB2  . ASN A 1 149 ? -12.574 17.128 6.076  1.00 27.82  ? 149 ASN A HB2  1 
ATOM   2757 H HB3  . ASN A 1 149 ? -13.843 16.228 5.756  1.00 27.82  ? 149 ASN A HB3  1 
ATOM   2758 H HD21 . ASN A 1 149 ? -15.075 18.007 8.525  1.00 48.49  ? 149 ASN A HD21 1 
ATOM   2759 H HD22 . ASN A 1 149 ? -14.896 18.129 6.842  1.00 48.49  ? 149 ASN A HD22 1 
ATOM   2760 N N    . GLY A 1 150 ? -10.908 14.330 8.347  1.00 18.58  ? 150 GLY A N    1 
ATOM   2761 C CA   . GLY A 1 150 ? -9.756  14.264 9.224  1.00 17.72  ? 150 GLY A CA   1 
ATOM   2762 C C    . GLY A 1 150 ? -9.944  14.831 10.624 1.00 20.05  ? 150 GLY A C    1 
ATOM   2763 O O    . GLY A 1 150 ? -9.157  14.596 11.482 1.00 20.03  ? 150 GLY A O    1 
ATOM   2764 H H    . GLY A 1 150 ? -11.468 13.689 8.469  1.00 22.18  ? 150 GLY A H    1 
ATOM   2765 H HA2  . GLY A 1 150 ? -9.490  13.336 9.316  1.00 21.14  ? 150 GLY A HA2  1 
ATOM   2766 H HA3  . GLY A 1 150 ? -9.023  14.743 8.808  1.00 21.14  ? 150 GLY A HA3  1 
ATOM   2767 N N    . LYS A 1 151 ? -11.037 15.535 10.871 1.00 19.78  ? 151 LYS A N    1 
ATOM   2768 C CA   . LYS A 1 151 ? -11.351 16.129 12.154 1.00 23.01  ? 151 LYS A CA   1 
ATOM   2769 C C    . LYS A 1 151 ? -11.688 15.031 13.159 1.00 28.83  ? 151 LYS A C    1 
ATOM   2770 O O    . LYS A 1 151 ? -12.416 14.087 12.861 1.00 26.50  ? 151 LYS A O    1 
ATOM   2771 C CB   . LYS A 1 151 ? -12.511 17.111 12.009 1.00 32.58  ? 151 LYS A CB   1 
ATOM   2772 C CG   . LYS A 1 151 ? -12.140 18.331 11.178 1.00 62.72  ? 151 LYS A CG   1 
ATOM   2773 C CD   . LYS A 1 151 ? -13.343 19.305 11.022 1.00 90.31  ? 151 LYS A CD   1 
ATOM   2774 C CE   . LYS A 1 151 ? -13.008 20.580 10.201 1.00 95.18  ? 151 LYS A CE   1 
ATOM   2775 N NZ   . LYS A 1 151 ? -14.174 21.535 10.015 1.00 91.38  ? 151 LYS A NZ   1 
ATOM   2776 H H    . LYS A 1 151 ? -11.641 15.688 10.278 1.00 23.61  ? 151 LYS A H    1 
ATOM   2777 H HA   . LYS A 1 151 ? -10.570 16.621 12.484 1.00 27.49  ? 151 LYS A HA   1 
ATOM   2778 H HB2  . LYS A 1 151 ? -13.252 16.663 11.572 1.00 38.98  ? 151 LYS A HB2  1 
ATOM   2779 H HB3  . LYS A 1 151 ? -12.779 17.417 12.890 1.00 38.98  ? 151 LYS A HB3  1 
ATOM   2780 H HG2  . LYS A 1 151 ? -11.418 18.808 11.615 1.00 75.15  ? 151 LYS A HG2  1 
ATOM   2781 H HG3  . LYS A 1 151 ? -11.865 18.044 10.293 1.00 75.15  ? 151 LYS A HG3  1 
ATOM   2782 H HD2  . LYS A 1 151 ? -14.065 18.841 10.569 1.00 108.25 ? 151 LYS A HD2  1 
ATOM   2783 H HD3  . LYS A 1 151 ? -13.634 19.587 11.903 1.00 108.25 ? 151 LYS A HD3  1 
ATOM   2784 H HE2  . LYS A 1 151 ? -12.301 21.064 10.655 1.00 114.10 ? 151 LYS A HE2  1 
ATOM   2785 H HE3  . LYS A 1 151 ? -12.705 20.311 9.320  1.00 114.10 ? 151 LYS A HE3  1 
ATOM   2786 H HZ1  . LYS A 1 151 ? -13.895 22.296 9.501  1.00 109.54 ? 151 LYS A HZ1  1 
ATOM   2787 H HZ2  . LYS A 1 151 ? -14.890 21.092 9.554  1.00 109.54 ? 151 LYS A HZ2  1 
ATOM   2788 H HZ3  . LYS A 1 151 ? -14.492 21.835 10.870 1.00 109.54 ? 151 LYS A HZ3  1 
ATOM   2789 N N    . THR A 1 152 ? -11.205 15.184 14.354 1.00 22.35  ? 152 THR A N    1 
ATOM   2790 C CA   . THR A 1 152 ? -11.424 14.165 15.334 1.00 21.74  ? 152 THR A CA   1 
ATOM   2791 C C    . THR A 1 152 ? -12.642 14.591 16.151 1.00 21.42  ? 152 THR A C    1 
ATOM   2792 O O    . THR A 1 152 ? -12.868 15.791 16.383 1.00 24.74  ? 152 THR A O    1 
ATOM   2793 C CB   . THR A 1 152 ? -10.191 13.973 16.173 1.00 23.54  ? 152 THR A CB   1 
ATOM   2794 O OG1  . THR A 1 152 ? -9.859  15.196 16.829 1.00 24.15  ? 152 THR A OG1  1 
ATOM   2795 C CG2  . THR A 1 152 ? -9.037  13.558 15.296 1.00 21.29  ? 152 THR A CG2  1 
ATOM   2796 H H    . THR A 1 152 ? -10.749 15.861 14.626 1.00 26.70  ? 152 THR A H    1 
ATOM   2797 H HA   . THR A 1 152 ? -11.631 13.318 14.886 1.00 25.98  ? 152 THR A HA   1 
ATOM   2798 H HB   . THR A 1 152 ? -10.348 13.279 16.832 1.00 28.13  ? 152 THR A HB   1 
ATOM   2799 H HG1  . THR A 1 152 ? -10.478 15.432 17.313 1.00 28.86  ? 152 THR A HG1  1 
ATOM   2800 H HG21 . THR A 1 152 ? -8.248  13.435 15.830 1.00 25.43  ? 152 THR A HG21 1 
ATOM   2801 H HG22 . THR A 1 152 ? -9.244  12.733 14.851 1.00 25.43  ? 152 THR A HG22 1 
ATOM   2802 H HG23 . THR A 1 152 ? -8.865  14.234 14.637 1.00 25.43  ? 152 THR A HG23 1 
ATOM   2803 N N    . SER A 1 153 ? -13.423 13.611 16.575 1.00 22.47  ? 153 SER A N    1 
ATOM   2804 C CA   . SER A 1 153 ? -14.636 13.876 17.328 1.00 27.82  ? 153 SER A CA   1 
ATOM   2805 C C    . SER A 1 153 ? -14.357 14.063 18.829 1.00 29.01  ? 153 SER A C    1 
ATOM   2806 O O    . SER A 1 153 ? -15.183 14.605 19.561 1.00 32.69  ? 153 SER A O    1 
ATOM   2807 C CB   . SER A 1 153 ? -15.634 12.753 17.096 1.00 34.74  ? 153 SER A CB   1 
ATOM   2808 O OG   . SER A 1 153 ? -15.060 11.518 17.464 1.00 33.01  ? 153 SER A OG   1 
ATOM   2809 H H    . SER A 1 153 ? -13.271 12.776 16.439 1.00 26.85  ? 153 SER A H    1 
ATOM   2810 H HA   . SER A 1 153 ? -15.038 14.705 16.995 1.00 33.27  ? 153 SER A HA   1 
ATOM   2811 H HB2  . SER A 1 153 ? -16.423 12.911 17.637 1.00 41.57  ? 153 SER A HB2  1 
ATOM   2812 H HB3  . SER A 1 153 ? -15.871 12.726 16.156 1.00 41.57  ? 153 SER A HB3  1 
ATOM   2813 H HG   . SER A 1 153 ? -15.597 10.911 17.339 1.00 39.50  ? 153 SER A HG   1 
ATOM   2814 N N    . LYS A 1 154 ? -13.174 13.631 19.258 1.00 25.38  ? 154 LYS A N    1 
ATOM   2815 C CA   . LYS A 1 154 ? -12.683 13.831 20.609 1.00 26.77  ? 154 LYS A CA   1 
ATOM   2816 C C    . LYS A 1 154 ? -11.199 14.195 20.468 1.00 22.61  ? 154 LYS A C    1 
ATOM   2817 O O    . LYS A 1 154 ? -10.592 13.972 19.428 1.00 23.23  ? 154 LYS A O    1 
ATOM   2818 C CB   . LYS A 1 154 ? -12.849 12.564 21.439 1.00 26.63  ? 154 LYS A CB   1 
ATOM   2819 C CG   . LYS A 1 154 ? -14.299 12.264 21.786 1.00 38.46  ? 154 LYS A CG   1 
ATOM   2820 C CD   . LYS A 1 154 ? -14.405 11.263 22.909 1.00 56.83  ? 154 LYS A CD   1 
ATOM   2821 C CE   . LYS A 1 154 ? -15.782 11.289 23.550 1.00 79.54  ? 154 LYS A CE   1 
ATOM   2822 N NZ   . LYS A 1 154 ? -16.824 10.805 22.612 1.00 91.00  ? 154 LYS A NZ   1 
ATOM   2823 H H    . LYS A 1 154 ? -12.620 13.202 18.760 1.00 30.34  ? 154 LYS A H    1 
ATOM   2824 H HA   . LYS A 1 154 ? -13.160 14.570 21.041 1.00 32.00  ? 154 LYS A HA   1 
ATOM   2825 H HB2  . LYS A 1 154 ? -12.499 11.811 20.937 1.00 31.83  ? 154 LYS A HB2  1 
ATOM   2826 H HB3  . LYS A 1 154 ? -12.357 12.665 22.269 1.00 31.83  ? 154 LYS A HB3  1 
ATOM   2827 H HG2  . LYS A 1 154 ? -14.737 13.083 22.067 1.00 46.03  ? 154 LYS A HG2  1 
ATOM   2828 H HG3  . LYS A 1 154 ? -14.744 11.895 21.007 1.00 46.03  ? 154 LYS A HG3  1 
ATOM   2829 H HD2  . LYS A 1 154 ? -14.250 10.372 22.559 1.00 68.08  ? 154 LYS A HD2  1 
ATOM   2830 H HD3  . LYS A 1 154 ? -13.748 11.475 23.590 1.00 68.08  ? 154 LYS A HD3  1 
ATOM   2831 H HE2  . LYS A 1 154 ? -15.783 10.712 24.330 1.00 95.33  ? 154 LYS A HE2  1 
ATOM   2832 H HE3  . LYS A 1 154 ? -16.000 12.199 23.804 1.00 95.33  ? 154 LYS A HE3  1 
ATOM   2833 H HZ1  . LYS A 1 154 ? -17.685 10.830 23.037 1.00 109.08 ? 154 LYS A HZ1  1 
ATOM   2834 H HZ2  . LYS A 1 154 ? -16.846 11.362 21.831 1.00 109.08 ? 154 LYS A HZ2  1 
ATOM   2835 H HZ3  . LYS A 1 154 ? -16.633 9.903  22.347 1.00 109.08 ? 154 LYS A HZ3  1 
ATOM   2836 N N    . LYS A 1 155 ? -10.635 14.816 21.495 1.00 20.81  ? 155 LYS A N    1 
ATOM   2837 C CA   . LYS A 1 155 ? -9.242  15.250 21.453 1.00 20.18  ? 155 LYS A CA   1 
ATOM   2838 C C    . LYS A 1 155 ? -8.338  14.084 21.799 1.00 16.57  ? 155 LYS A C    1 
ATOM   2839 O O    . LYS A 1 155 ? -8.450  13.480 22.871 1.00 21.55  ? 155 LYS A O    1 
ATOM   2840 C CB   . LYS A 1 155 ? -9.009  16.385 22.448 1.00 32.71  ? 155 LYS A CB   1 
ATOM   2841 C CG   . LYS A 1 155 ? -7.761  17.160 22.152 1.00 52.20  ? 155 LYS A CG   1 
ATOM   2842 C CD   . LYS A 1 155 ? -7.962  18.079 20.950 1.00 65.71  ? 155 LYS A CD   1 
ATOM   2843 C CE   . LYS A 1 155 ? -6.848  19.083 20.853 1.00 55.78  ? 155 LYS A CE   1 
ATOM   2844 N NZ   . LYS A 1 155 ? -6.329  19.335 22.232 1.00 96.17  ? 155 LYS A NZ   1 
ATOM   2845 H H    . LYS A 1 155 ? -11.038 15.001 22.232 1.00 24.86  ? 155 LYS A H    1 
ATOM   2846 H HA   . LYS A 1 155 ? -9.019  15.567 20.553 1.00 24.10  ? 155 LYS A HA   1 
ATOM   2847 H HB2  . LYS A 1 155 ? -9.760  16.998 22.411 1.00 39.14  ? 155 LYS A HB2  1 
ATOM   2848 H HB3  . LYS A 1 155 ? -8.927  16.013 23.340 1.00 39.14  ? 155 LYS A HB3  1 
ATOM   2849 H HG2  . LYS A 1 155 ? -7.532  17.707 22.920 1.00 62.52  ? 155 LYS A HG2  1 
ATOM   2850 H HG3  . LYS A 1 155 ? -7.040  16.544 21.949 1.00 62.52  ? 155 LYS A HG3  1 
ATOM   2851 H HD2  . LYS A 1 155 ? -7.969  17.550 20.137 1.00 78.74  ? 155 LYS A HD2  1 
ATOM   2852 H HD3  . LYS A 1 155 ? -8.800  18.559 21.048 1.00 78.74  ? 155 LYS A HD3  1 
ATOM   2853 H HE2  . LYS A 1 155 ? -6.129  18.728 20.307 1.00 66.82  ? 155 LYS A HE2  1 
ATOM   2854 H HE3  . LYS A 1 155 ? -7.184  19.915 20.486 1.00 66.82  ? 155 LYS A HE3  1 
ATOM   2855 H HZ1  . LYS A 1 155 ? -5.614  19.975 22.201 1.00 115.29 ? 155 LYS A HZ1  1 
ATOM   2856 H HZ2  . LYS A 1 155 ? -7.031  19.680 22.789 1.00 115.29 ? 155 LYS A HZ2  1 
ATOM   2857 H HZ3  . LYS A 1 155 ? -6.001  18.518 22.614 1.00 115.29 ? 155 LYS A HZ3  1 
ATOM   2858 N N    A ILE A 1 156 ? -7.498  13.737 20.838 0.61 20.47  ? 156 ILE A N    1 
ATOM   2859 N N    B ILE A 1 156 ? -7.420  13.768 20.898 0.39 14.73  ? 156 ILE A N    1 
ATOM   2860 C CA   A ILE A 1 156 ? -6.634  12.573 20.946 0.61 17.37  ? 156 ILE A CA   1 
ATOM   2861 C CA   B ILE A 1 156 ? -6.474  12.667 21.075 0.39 20.15  ? 156 ILE A CA   1 
ATOM   2862 C C    A ILE A 1 156 ? -5.246  13.110 21.231 0.61 19.39  ? 156 ILE A C    1 
ATOM   2863 C C    B ILE A 1 156 ? -5.071  13.226 21.318 0.39 15.19  ? 156 ILE A C    1 
ATOM   2864 O O    A ILE A 1 156 ? -4.660  13.777 20.382 0.61 16.63  ? 156 ILE A O    1 
ATOM   2865 O O    B ILE A 1 156 ? -4.534  13.952 20.485 0.39 19.32  ? 156 ILE A O    1 
ATOM   2866 C CB   A ILE A 1 156 ? -6.629  11.755 19.630 0.61 17.08  ? 156 ILE A CB   1 
ATOM   2867 C CB   B ILE A 1 156 ? -6.487  11.738 19.841 0.39 17.51  ? 156 ILE A CB   1 
ATOM   2868 C CG1  A ILE A 1 156 ? -8.065  11.427 19.180 0.61 20.26  ? 156 ILE A CG1  1 
ATOM   2869 C CG1  B ILE A 1 156 ? -7.892  11.181 19.633 0.39 23.83  ? 156 ILE A CG1  1 
ATOM   2870 C CG2  A ILE A 1 156 ? -5.771  10.494 19.776 0.61 21.53  ? 156 ILE A CG2  1 
ATOM   2871 C CG2  B ILE A 1 156 ? -5.491  10.587 20.005 0.39 20.49  ? 156 ILE A CG2  1 
ATOM   2872 C CD1  A ILE A 1 156 ? -8.906  10.672 20.222 0.61 23.26  ? 156 ILE A CD1  1 
ATOM   2873 C CD1  B ILE A 1 156 ? -8.029  10.340 18.398 0.39 30.01  ? 156 ILE A CD1  1 
ATOM   2874 H H    A ILE A 1 156 ? -7.409  14.168 20.099 0.61 24.45  ? 156 ILE A H    1 
ATOM   2875 H H    B ILE A 1 156 ? -7.320  14.186 20.153 0.39 17.56  ? 156 ILE A H    1 
ATOM   2876 H HA   A ILE A 1 156 ? -6.922  12.000 21.687 0.61 20.73  ? 156 ILE A HA   1 
ATOM   2877 H HA   B ILE A 1 156 ? -6.735  12.139 21.859 0.39 24.06  ? 156 ILE A HA   1 
ATOM   2878 H HB   A ILE A 1 156 ? -6.225  12.307 18.942 0.61 20.38  ? 156 ILE A HB   1 
ATOM   2879 H HB   B ILE A 1 156 ? -6.238  12.256 19.060 0.39 20.90  ? 156 ILE A HB   1 
ATOM   2880 H HG12 A ILE A 1 156 ? -8.523  12.257 18.978 0.61 24.19  ? 156 ILE A HG12 1 
ATOM   2881 H HG12 B ILE A 1 156 ? -8.127  10.629 20.395 0.39 28.48  ? 156 ILE A HG12 1 
ATOM   2882 H HG13 A ILE A 1 156 ? -8.021  10.876 18.383 0.61 24.19  ? 156 ILE A HG13 1 
ATOM   2883 H HG13 B ILE A 1 156 ? -8.515  11.921 19.559 0.39 28.48  ? 156 ILE A HG13 1 
ATOM   2884 H HG21 A ILE A 1 156 ? -5.786  10.009 18.948 0.61 25.72  ? 156 ILE A HG21 1 
ATOM   2885 H HG21 B ILE A 1 156 ? -5.525  10.031 19.222 0.39 24.47  ? 156 ILE A HG21 1 
ATOM   2886 H HG22 A ILE A 1 156 ? -4.871  10.752 19.988 0.61 25.72  ? 156 ILE A HG22 1 
ATOM   2887 H HG22 B ILE A 1 156 ? -4.609  10.950 20.111 0.39 24.47  ? 156 ILE A HG22 1 
ATOM   2888 H HG23 A ILE A 1 156 ? -6.131  9.952  20.481 0.61 25.72  ? 156 ILE A HG23 1 
ATOM   2889 H HG23 B ILE A 1 156 ? -5.731  10.075 20.781 0.39 24.47  ? 156 ILE A HG23 1 
ATOM   2890 H HD11 A ILE A 1 156 ? -9.781  10.511 19.859 0.61 27.80  ? 156 ILE A HD11 1 
ATOM   2891 H HD11 B ILE A 1 156 ? -8.934  10.026 18.333 0.39 35.89  ? 156 ILE A HD11 1 
ATOM   2892 H HD12 A ILE A 1 156 ? -8.477  9.838  20.425 0.61 27.80  ? 156 ILE A HD12 1 
ATOM   2893 H HD12 B ILE A 1 156 ? -7.812  10.875 17.631 0.39 35.89  ? 156 ILE A HD12 1 
ATOM   2894 H HD13 A ILE A 1 156 ? -8.975  11.208 21.015 0.61 27.80  ? 156 ILE A HD13 1 
ATOM   2895 H HD13 B ILE A 1 156 ? -7.427  9.595  18.459 0.39 35.89  ? 156 ILE A HD13 1 
ATOM   2896 N N    A THR A 1 157 ? -4.736  12.866 22.432 0.61 16.32  ? 157 THR A N    1 
ATOM   2897 N N    B THR A 1 157 ? -4.500  12.891 22.473 0.39 17.56  ? 157 THR A N    1 
ATOM   2898 C CA   A THR A 1 157 ? -3.449  13.416 22.812 0.61 18.15  ? 157 THR A CA   1 
ATOM   2899 C CA   B THR A 1 157 ? -3.253  13.476 22.946 0.39 20.28  ? 157 THR A CA   1 
ATOM   2900 C C    A THR A 1 157 ? -2.407  12.351 23.142 0.61 12.96  ? 157 THR A C    1 
ATOM   2901 C C    B THR A 1 157 ? -2.228  12.433 23.394 0.39 25.42  ? 157 THR A C    1 
ATOM   2902 O O    A THR A 1 157 ? -2.716  11.172 23.453 0.61 12.20  ? 157 THR A O    1 
ATOM   2903 O O    B THR A 1 157 ? -2.572  11.403 23.984 0.39 17.38  ? 157 THR A O    1 
ATOM   2904 C CB   A THR A 1 157 ? -3.582  14.404 24.016 0.61 22.76  ? 157 THR A CB   1 
ATOM   2905 C CB   B THR A 1 157 ? -3.509  14.365 24.175 0.39 20.94  ? 157 THR A CB   1 
ATOM   2906 O OG1  A THR A 1 157 ? -4.083  13.723 25.178 0.61 17.14  ? 157 THR A OG1  1 
ATOM   2907 O OG1  B THR A 1 157 ? -4.222  15.550 23.792 0.39 39.86  ? 157 THR A OG1  1 
ATOM   2908 C CG2  A THR A 1 157 ? -4.522  15.548 23.668 0.61 21.13  ? 157 THR A CG2  1 
ATOM   2909 C CG2  B THR A 1 157 ? -2.206  14.744 24.843 0.39 30.60  ? 157 THR A CG2  1 
ATOM   2910 H H    A THR A 1 157 ? -5.113  12.388 23.039 0.61 19.47  ? 157 THR A H    1 
ATOM   2911 H H    B THR A 1 157 ? -4.829  12.310 23.015 0.39 20.95  ? 157 THR A H    1 
ATOM   2912 H HA   A THR A 1 157 ? -3.104  13.931 22.053 0.61 21.67  ? 157 THR A HA   1 
ATOM   2913 H HA   B THR A 1 157 ? -2.855  14.024 22.238 0.39 24.22  ? 157 THR A HA   1 
ATOM   2914 H HB   A THR A 1 157 ? -2.710  14.779 24.218 0.61 27.19  ? 157 THR A HB   1 
ATOM   2915 H HB   B THR A 1 157 ? -4.042  13.870 24.816 0.39 25.01  ? 157 THR A HB   1 
ATOM   2916 H HG1  A THR A 1 157 ? -4.822  13.405 25.019 0.61 20.45  ? 157 THR A HG1  1 
ATOM   2917 H HG1  B THR A 1 157 ? -4.357  16.021 24.449 0.39 47.72  ? 157 THR A HG1  1 
ATOM   2918 H HG21 A THR A 1 157 ? -4.597  16.149 24.413 0.61 25.24  ? 157 THR A HG21 1 
ATOM   2919 H HG21 B THR A 1 157 ? -2.379  15.298 25.608 0.39 36.61  ? 157 THR A HG21 1 
ATOM   2920 H HG22 A THR A 1 157 ? -4.184  16.031 22.910 0.61 25.24  ? 157 THR A HG22 1 
ATOM   2921 H HG22 B THR A 1 157 ? -1.742  13.954 25.129 0.39 36.61  ? 157 THR A HG22 1 
ATOM   2922 H HG23 A THR A 1 157 ? -5.392  15.204 23.456 0.61 25.24  ? 157 THR A HG23 1 
ATOM   2923 H HG23 B THR A 1 157 ? -1.650  15.227 24.227 0.39 36.61  ? 157 THR A HG23 1 
ATOM   2924 N N    A ILE A 1 158 ? -1.158  12.799 23.098 0.61 16.38  ? 158 ILE A N    1 
ATOM   2925 N N    B ILE A 1 158 ? -0.960  12.718 23.122 0.39 19.81  ? 158 ILE A N    1 
ATOM   2926 C CA   A ILE A 1 158 ? -0.025  12.055 23.635 0.61 18.35  ? 158 ILE A CA   1 
ATOM   2927 C CA   B ILE A 1 158 ? 0.157   11.952 23.657 0.39 18.11  ? 158 ILE A CA   1 
ATOM   2928 C C    A ILE A 1 158 ? 0.179   12.510 25.081 0.61 21.24  ? 158 ILE A C    1 
ATOM   2929 C C    B ILE A 1 158 ? 0.379   12.361 25.105 0.39 15.26  ? 158 ILE A C    1 
ATOM   2930 O O    A ILE A 1 158 ? 0.763   13.565 25.350 0.61 15.73  ? 158 ILE A O    1 
ATOM   2931 O O    B ILE A 1 158 ? 1.174   13.253 25.390 0.39 20.63  ? 158 ILE A O    1 
ATOM   2932 C CB   A ILE A 1 158 ? 1.238   12.282 22.779 0.61 18.59  ? 158 ILE A CB   1 
ATOM   2933 C CB   B ILE A 1 158 ? 1.444   12.234 22.858 0.39 16.53  ? 158 ILE A CB   1 
ATOM   2934 C CG1  A ILE A 1 158 ? 0.931   11.875 21.342 0.61 19.38  ? 158 ILE A CG1  1 
ATOM   2935 C CG1  B ILE A 1 158 ? 1.250   11.834 21.399 0.39 15.25  ? 158 ILE A CG1  1 
ATOM   2936 C CG2  A ILE A 1 158 ? 2.433   11.487 23.341 0.61 22.60  ? 158 ILE A CG2  1 
ATOM   2937 C CG2  B ILE A 1 158 ? 2.632   11.487 23.454 0.39 20.18  ? 158 ILE A CG2  1 
ATOM   2938 C CD1  A ILE A 1 158 ? 1.869   12.488 20.309 0.61 16.83  ? 158 ILE A CD1  1 
ATOM   2939 C CD1  B ILE A 1 158 ? 2.490   12.049 20.526 0.39 9.89   ? 158 ILE A CD1  1 
ATOM   2940 H H    A ILE A 1 158 ? -0.936  13.554 22.752 0.61 19.54  ? 158 ILE A H    1 
ATOM   2941 H H    B ILE A 1 158 ? -0.716  13.369 22.616 0.39 23.65  ? 158 ILE A H    1 
ATOM   2942 H HA   A ILE A 1 158 ? -0.232  11.097 23.636 0.61 21.90  ? 158 ILE A HA   1 
ATOM   2943 H HA   B ILE A 1 158 ? -0.041  10.993 23.619 0.39 21.62  ? 158 ILE A HA   1 
ATOM   2944 H HB   A ILE A 1 158 ? 1.458   13.227 22.794 0.61 22.19  ? 158 ILE A HB   1 
ATOM   2945 H HB   B ILE A 1 158 ? 1.627   13.186 22.896 0.39 19.72  ? 158 ILE A HB   1 
ATOM   2946 H HG12 A ILE A 1 158 ? 1.002   10.910 21.270 0.61 23.14  ? 158 ILE A HG12 1 
ATOM   2947 H HG12 B ILE A 1 158 ? 1.022   10.892 21.362 0.39 18.18  ? 158 ILE A HG12 1 
ATOM   2948 H HG13 A ILE A 1 158 ? 0.028   12.154 21.125 0.61 23.14  ? 158 ILE A HG13 1 
ATOM   2949 H HG13 B ILE A 1 158 ? 0.529   12.363 21.024 0.39 18.18  ? 158 ILE A HG13 1 
ATOM   2950 H HG21 A ILE A 1 158 ? 3.202   11.648 22.790 0.61 27.00  ? 158 ILE A HG21 1 
ATOM   2951 H HG21 B ILE A 1 158 ? 3.415   11.684 22.935 0.39 24.10  ? 158 ILE A HG21 1 
ATOM   2952 H HG22 A ILE A 1 158 ? 2.607   11.779 24.239 0.61 27.00  ? 158 ILE A HG22 1 
ATOM   2953 H HG22 B ILE A 1 158 ? 2.758   11.775 24.361 0.39 24.10  ? 158 ILE A HG22 1 
ATOM   2954 H HG23 A ILE A 1 158 ? 2.216   10.552 23.337 0.61 27.00  ? 158 ILE A HG23 1 
ATOM   2955 H HG23 B ILE A 1 158 ? 2.451   10.545 23.431 0.39 24.10  ? 158 ILE A HG23 1 
ATOM   2956 H HD11 A ILE A 1 158 ? 1.611   12.185 19.435 0.61 20.08  ? 158 ILE A HD11 1 
ATOM   2957 H HD11 B ILE A 1 158 ? 2.291   11.776 19.628 0.39 11.75  ? 158 ILE A HD11 1 
ATOM   2958 H HD12 A ILE A 1 158 ? 1.803   13.445 20.357 0.61 20.08  ? 158 ILE A HD12 1 
ATOM   2959 H HD12 B ILE A 1 158 ? 2.725   12.980 20.541 0.39 11.75  ? 158 ILE A HD12 1 
ATOM   2960 H HD13 A ILE A 1 158 ? 2.768   12.211 20.500 0.61 20.08  ? 158 ILE A HD13 1 
ATOM   2961 H HD13 B ILE A 1 158 ? 3.213   11.523 20.876 0.39 11.75  ? 158 ILE A HD13 1 
ATOM   2962 N N    . ALA A 1 159 ? -0.336  11.714 26.015 1.00 14.80  ? 159 ALA A N    1 
ATOM   2963 C CA   . ALA A 1 159 ? -0.259  12.043 27.446 1.00 17.27  ? 159 ALA A CA   1 
ATOM   2964 C C    . ALA A 1 159 ? 1.160   11.876 28.023 1.00 16.79  ? 159 ALA A C    1 
ATOM   2965 O O    . ALA A 1 159 ? 1.576   12.623 28.914 1.00 20.58  ? 159 ALA A O    1 
ATOM   2966 C CB   . ALA A 1 159 ? -1.250  11.214 28.224 1.00 20.93  ? 159 ALA A CB   1 
ATOM   2967 H H    A ALA A 1 159 ? -0.738  10.971 25.850 0.64 17.64  ? 159 ALA A H    1 
ATOM   2968 H H    B ALA A 1 159 ? -0.880  11.072 25.835 0.36 17.64  ? 159 ALA A H    1 
ATOM   2969 H HA   . ALA A 1 159 ? -0.511  12.983 27.559 1.00 20.60  ? 159 ALA A HA   1 
ATOM   2970 H HB1  . ALA A 1 159 ? -1.185  11.442 29.154 1.00 25.00  ? 159 ALA A HB1  1 
ATOM   2971 H HB2  . ALA A 1 159 ? -2.134  11.401 27.902 1.00 25.00  ? 159 ALA A HB2  1 
ATOM   2972 H HB3  . ALA A 1 159 ? -1.045  10.284 28.100 1.00 25.00  ? 159 ALA A HB3  1 
ATOM   2973 N N    . ASP A 1 160 ? 1.891   10.884 27.526 1.00 16.08  ? 160 ASP A N    1 
ATOM   2974 C CA   . ASP A 1 160 ? 3.270   10.669 27.939 1.00 17.00  ? 160 ASP A CA   1 
ATOM   2975 C C    . ASP A 1 160 ? 3.956   9.985  26.773 1.00 15.04  ? 160 ASP A C    1 
ATOM   2976 O O    . ASP A 1 160 ? 3.321   9.360  25.929 1.00 15.90  ? 160 ASP A O    1 
ATOM   2977 C CB   . ASP A 1 160 ? 3.356   9.775  29.181 1.00 18.71  ? 160 ASP A CB   1 
ATOM   2978 C CG   . ASP A 1 160 ? 4.685   9.911  29.928 1.00 23.44  ? 160 ASP A CG   1 
ATOM   2979 O OD1  . ASP A 1 160 ? 5.501   10.792 29.580 1.00 26.66  ? 160 ASP A OD1  1 
ATOM   2980 O OD2  . ASP A 1 160 ? 4.895   9.141  30.891 1.00 34.58  ? 160 ASP A OD2  1 
ATOM   2981 H H    . ASP A 1 160 ? 1.607   10.318 26.944 1.00 19.18  ? 160 ASP A H    1 
ATOM   2982 H HA   . ASP A 1 160 ? 3.711   11.525 28.121 1.00 20.28  ? 160 ASP A HA   1 
ATOM   2983 H HB2  . ASP A 1 160 ? 2.643   10.016 29.793 1.00 22.34  ? 160 ASP A HB2  1 
ATOM   2984 H HB3  . ASP A 1 160 ? 3.260   8.849  28.909 1.00 22.34  ? 160 ASP A HB3  1 
ATOM   2985 N N    . CYS A 1 161 ? 5.268   10.125 26.715 1.00 15.65  ? 161 CYS A N    1 
ATOM   2986 C CA   . CYS A 1 161 ? 6.053   9.448  25.709 1.00 17.20  ? 161 CYS A CA   1 
ATOM   2987 C C    . CYS A 1 161 ? 7.485   9.370  26.199 1.00 18.13  ? 161 CYS A C    1 
ATOM   2988 O O    . CYS A 1 161 ? 7.915   10.121 27.092 1.00 20.23  ? 161 CYS A O    1 
ATOM   2989 C CB   . CYS A 1 161 ? 5.966   10.167 24.349 1.00 18.03  ? 161 CYS A CB   1 
ATOM   2990 S SG   . CYS A 1 161 ? 6.196   11.969 24.392 1.00 18.25  ? 161 CYS A SG   1 
ATOM   2991 H H    . CYS A 1 161 ? 5.729   10.613 27.253 1.00 18.66  ? 161 CYS A H    1 
ATOM   2992 H HA   . CYS A 1 161 ? 5.716   8.535  25.596 1.00 20.52  ? 161 CYS A HA   1 
ATOM   2993 H HB2  . CYS A 1 161 ? 6.649   9.802  23.766 1.00 21.52  ? 161 CYS A HB2  1 
ATOM   2994 H HB3  . CYS A 1 161 ? 5.091   9.996  23.968 1.00 21.52  ? 161 CYS A HB3  1 
ATOM   2995 H HG   . CYS A 1 161 ? 7.410   12.242 24.890 1.00 21.78  ? 161 CYS A HG   1 
ATOM   2996 N N    . GLY A 1 162 ? 8.235   8.464  25.592 1.00 18.76  ? 162 GLY A N    1 
ATOM   2997 C CA   . GLY A 1 162 ? 9.611   8.302  25.978 1.00 20.10  ? 162 GLY A CA   1 
ATOM   2998 C C    . GLY A 1 162 ? 10.227  7.114  25.305 1.00 20.66  ? 162 GLY A C    1 
ATOM   2999 O O    . GLY A 1 162 ? 9.662   6.550  24.374 1.00 20.05  ? 162 GLY A O    1 
ATOM   3000 H H    . GLY A 1 162 ? 7.970   7.941  24.963 1.00 22.40  ? 162 GLY A H    1 
ATOM   3001 H HA2  . GLY A 1 162 ? 10.115  9.094  25.733 1.00 24.00  ? 162 GLY A HA2  1 
ATOM   3002 H HA3  . GLY A 1 162 ? 9.670   8.181  26.939 1.00 24.00  ? 162 GLY A HA3  1 
ATOM   3003 N N    . GLN A 1 163 ? 11.398  6.725  25.782 1.00 22.85  ? 163 GLN A N    1 
ATOM   3004 C CA   . GLN A 1 163 ? 12.123  5.628  25.190 1.00 22.59  ? 163 GLN A CA   1 
ATOM   3005 C C    . GLN A 1 163 ? 12.073  4.406  26.101 1.00 28.52  ? 163 GLN A C    1 
ATOM   3006 O O    . GLN A 1 163 ? 12.346  4.508  27.297 1.00 34.74  ? 163 GLN A O    1 
ATOM   3007 C CB   . GLN A 1 163 ? 13.585  6.039  24.964 1.00 25.80  ? 163 GLN A CB   1 
ATOM   3008 C CG   . GLN A 1 163 ? 14.426  4.985  24.289 1.00 30.31  ? 163 GLN A CG   1 
ATOM   3009 C CD   . GLN A 1 163 ? 15.696  5.538  23.680 1.00 33.26  ? 163 GLN A CD   1 
ATOM   3010 O OE1  . GLN A 1 163 ? 15.978  6.732  23.777 1.00 28.96  ? 163 GLN A OE1  1 
ATOM   3011 N NE2  . GLN A 1 163 ? 16.466  4.672  23.035 1.00 41.94  ? 163 GLN A NE2  1 
ATOM   3012 H H    . GLN A 1 163 ? 11.794  7.086  26.455 1.00 27.30  ? 163 GLN A H    1 
ATOM   3013 H HA   . GLN A 1 163 ? 11.724  5.394  24.326 1.00 27.00  ? 163 GLN A HA   1 
ATOM   3014 H HB2  . GLN A 1 163 ? 13.603  6.833  24.406 1.00 30.85  ? 163 GLN A HB2  1 
ATOM   3015 H HB3  . GLN A 1 163 ? 13.990  6.234  25.824 1.00 30.85  ? 163 GLN A HB3  1 
ATOM   3016 H HG2  . GLN A 1 163 ? 14.676  4.314  24.943 1.00 36.26  ? 163 GLN A HG2  1 
ATOM   3017 H HG3  . GLN A 1 163 ? 13.907  4.576  23.578 1.00 36.26  ? 163 GLN A HG3  1 
ATOM   3018 H HE21 . GLN A 1 163 ? 17.199  4.936  22.671 1.00 50.21  ? 163 GLN A HE21 1 
ATOM   3019 H HE22 . GLN A 1 163 ? 16.232  3.846  22.981 1.00 50.21  ? 163 GLN A HE22 1 
ATOM   3020 N N    . LEU A 1 164 ? 11.681  3.267  25.521 1.00 25.24  ? 164 LEU A N    1 
ATOM   3021 C CA   . LEU A 1 164 ? 11.738  1.978  26.189 1.00 30.33  ? 164 LEU A CA   1 
ATOM   3022 C C    . LEU A 1 164 ? 13.050  1.307  25.837 1.00 41.60  ? 164 LEU A C    1 
ATOM   3023 O O    . LEU A 1 164 ? 13.622  0.668  26.701 1.00 46.80  ? 164 LEU A O    1 
ATOM   3024 C CB   . LEU A 1 164 ? 10.592  1.063  25.748 1.00 34.15  ? 164 LEU A CB   1 
ATOM   3025 C CG   . LEU A 1 164 ? 9.163   1.454  26.095 1.00 36.96  ? 164 LEU A CG   1 
ATOM   3026 C CD1  . LEU A 1 164 ? 8.206   0.461  25.451 1.00 39.74  ? 164 LEU A CD1  1 
ATOM   3027 C CD2  . LEU A 1 164 ? 8.939   1.543  27.614 1.00 45.95  ? 164 LEU A CD2  1 
ATOM   3028 H H    . LEU A 1 164 ? 11.371  3.222  24.720 1.00 30.17  ? 164 LEU A H    1 
ATOM   3029 H HA   . LEU A 1 164 ? 11.693  2.101  27.160 1.00 36.28  ? 164 LEU A HA   1 
ATOM   3030 H HB2  . LEU A 1 164 ? 10.633  0.983  24.782 1.00 40.87  ? 164 LEU A HB2  1 
ATOM   3031 H HB3  . LEU A 1 164 ? 10.745  0.189  26.141 1.00 40.87  ? 164 LEU A HB3  1 
ATOM   3032 H HG   . LEU A 1 164 ? 8.979   2.329  25.717 1.00 44.24  ? 164 LEU A HG   1 
ATOM   3033 H HD11 . LEU A 1 164 ? 7.305   0.709  25.670 1.00 47.58  ? 164 LEU A HD11 1 
ATOM   3034 H HD12 . LEU A 1 164 ? 8.329   0.481  24.499 1.00 47.58  ? 164 LEU A HD12 1 
ATOM   3035 H HD13 . LEU A 1 164 ? 8.395   -0.418 25.788 1.00 47.58  ? 164 LEU A HD13 1 
ATOM   3036 H HD21 . LEU A 1 164 ? 8.027   1.792  27.781 1.00 55.02  ? 164 LEU A HD21 1 
ATOM   3037 H HD22 . LEU A 1 164 ? 9.122   0.687  28.007 1.00 55.02  ? 164 LEU A HD22 1 
ATOM   3038 H HD23 . LEU A 1 164 ? 9.531   2.205  27.979 1.00 55.02  ? 164 LEU A HD23 1 
HETATM 3039 O O    . HOH B 2 .   ? 10.326  16.577 2.763  1.00 15.03  ? 166 HOH A O    1 
HETATM 3040 O O    . HOH B 2 .   ? 14.325  12.524 6.177  1.00 16.21  ? 167 HOH A O    1 
HETATM 3041 O O    . HOH B 2 .   ? -0.304  17.556 15.758 1.00 16.78  ? 168 HOH A O    1 
HETATM 3042 O O    . HOH B 2 .   ? 9.621   13.073 4.027  1.00 16.82  ? 169 HOH A O    1 
HETATM 3043 O O    . HOH B 2 .   ? 9.818   14.726 -0.393 1.00 17.74  ? 170 HOH A O    1 
HETATM 3044 O O    . HOH B 2 .   ? 13.620  5.088  4.325  1.00 18.84  ? 171 HOH A O    1 
HETATM 3045 O O    . HOH B 2 .   ? 9.109   6.194  0.665  1.00 17.71  ? 172 HOH A O    1 
HETATM 3046 O O    . HOH B 2 .   ? 7.313   16.879 9.222  1.00 17.96  ? 173 HOH A O    1 
HETATM 3047 O O    . HOH B 2 .   ? -0.383  19.468 19.345 1.00 19.73  ? 174 HOH A O    1 
HETATM 3048 O O    . HOH B 2 .   ? -7.381  15.221 18.321 1.00 20.59  ? 175 HOH A O    1 
HETATM 3049 O O    . HOH B 2 .   ? 1.201   14.805 18.134 1.00 20.28  ? 176 HOH A O    1 
HETATM 3050 O O    . HOH B 2 .   ? 8.392   14.956 24.615 1.00 19.91  ? 177 HOH A O    1 
HETATM 3051 O O    . HOH B 2 .   ? 6.617   19.899 11.274 1.00 21.71  ? 178 HOH A O    1 
HETATM 3052 O O    . HOH B 2 .   ? 13.469  14.650 -2.081 1.00 21.37  ? 179 HOH A O    1 
HETATM 3053 O O    . HOH B 2 .   ? 1.688   2.124  4.345  1.00 21.83  ? 180 HOH A O    1 
HETATM 3054 O O    . HOH B 2 .   ? 17.112  14.774 -0.053 1.00 21.64  ? 181 HOH A O    1 
HETATM 3055 O O    . HOH B 2 .   ? -4.814  25.110 16.807 1.00 23.12  ? 182 HOH A O    1 
HETATM 3056 O O    . HOH B 2 .   ? 13.816  16.901 22.373 1.00 25.00  ? 183 HOH A O    1 
HETATM 3057 O O    . HOH B 2 .   ? -6.892  13.864 25.294 1.00 23.62  ? 184 HOH A O    1 
HETATM 3058 O O    . HOH B 2 .   ? 4.665   0.270  -0.984 1.00 26.22  ? 185 HOH A O    1 
HETATM 3059 O O    . HOH B 2 .   ? 2.749   32.545 16.451 1.00 25.02  ? 186 HOH A O    1 
HETATM 3060 O O    . HOH B 2 .   ? -1.796  11.239 0.116  1.00 24.19  ? 187 HOH A O    1 
HETATM 3061 O O    . HOH B 2 .   ? -2.154  -5.733 22.219 1.00 26.23  ? 188 HOH A O    1 
HETATM 3062 O O    . HOH B 2 .   ? -2.313  18.484 8.502  1.00 29.45  ? 189 HOH A O    1 
HETATM 3063 O O    . HOH B 2 .   ? -9.876  13.562 3.411  1.00 25.57  ? 190 HOH A O    1 
HETATM 3064 O O    . HOH B 2 .   ? 0.245   -5.349 20.892 1.00 26.96  ? 191 HOH A O    1 
HETATM 3065 O O    . HOH B 2 .   ? 2.321   15.542 4.444  1.00 25.27  ? 192 HOH A O    1 
HETATM 3066 O O    . HOH B 2 .   ? -9.012  17.358 14.592 1.00 28.68  ? 193 HOH A O    1 
HETATM 3067 O O    . HOH B 2 .   ? 7.453   20.778 23.555 1.00 27.88  ? 194 HOH A O    1 
HETATM 3068 O O    . HOH B 2 .   ? 18.473  7.254  17.192 1.00 30.18  ? 195 HOH A O    1 
HETATM 3069 O O    . HOH B 2 .   ? -11.740 10.940 3.132  1.00 24.73  ? 196 HOH A O    1 
HETATM 3070 O O    . HOH B 2 .   ? 3.771   16.904 0.623  1.00 28.65  ? 197 HOH A O    1 
HETATM 3071 O O    . HOH B 2 .   ? 8.771   17.480 25.738 1.00 34.05  ? 198 HOH A O    1 
HETATM 3072 O O    . HOH B 2 .   ? 12.214  9.382  -4.685 1.00 28.99  ? 199 HOH A O    1 
HETATM 3073 O O    . HOH B 2 .   ? 19.857  7.366  14.845 1.00 33.39  ? 200 HOH A O    1 
HETATM 3074 O O    . HOH B 2 .   ? 8.740   -0.723 4.975  1.00 33.91  ? 201 HOH A O    1 
HETATM 3075 O O    . HOH B 2 .   ? 4.371   19.253 23.221 1.00 26.98  ? 202 HOH A O    1 
HETATM 3076 O O    . HOH B 2 .   ? 12.379  8.313  28.019 1.00 31.54  ? 203 HOH A O    1 
HETATM 3077 O O    . HOH B 2 .   ? 10.299  -1.473 2.467  1.00 33.14  ? 204 HOH A O    1 
HETATM 3078 O O    . HOH B 2 .   ? -2.941  28.203 11.920 1.00 34.61  ? 205 HOH A O    1 
HETATM 3079 O O    . HOH B 2 .   ? -16.951 10.973 8.369  1.00 31.57  ? 206 HOH A O    1 
HETATM 3080 O O    . HOH B 2 .   ? 16.912  6.720  -1.597 1.00 30.88  ? 207 HOH A O    1 
HETATM 3081 O O    . HOH B 2 .   ? 5.238   8.975  -4.938 1.00 38.19  ? 208 HOH A O    1 
HETATM 3082 O O    . HOH B 2 .   ? 20.969  7.539  3.749  1.00 35.06  ? 209 HOH A O    1 
HETATM 3083 O O    . HOH B 2 .   ? -7.963  -2.887 22.122 1.00 37.09  ? 210 HOH A O    1 
HETATM 3084 O O    . HOH B 2 .   ? -4.114  -1.804 3.041  1.00 38.88  ? 211 HOH A O    1 
HETATM 3085 O O    . HOH B 2 .   ? 8.688   13.184 26.921 1.00 30.38  ? 212 HOH A O    1 
HETATM 3086 O O    . HOH B 2 .   ? -12.241 3.539  19.921 1.00 34.29  ? 213 HOH A O    1 
HETATM 3087 O O    . HOH B 2 .   ? 10.947  22.404 -0.851 1.00 37.56  ? 214 HOH A O    1 
HETATM 3088 O O    . HOH B 2 .   ? 20.632  13.064 5.425  1.00 33.59  ? 215 HOH A O    1 
HETATM 3089 O O    . HOH B 2 .   ? 5.733   26.940 14.822 1.00 42.84  ? 216 HOH A O    1 
HETATM 3090 O O    . HOH B 2 .   ? -10.219 1.074  13.201 1.00 39.41  ? 217 HOH A O    1 
HETATM 3091 O O    . HOH B 2 .   ? -5.317  -0.920 10.158 1.00 45.59  ? 218 HOH A O    1 
HETATM 3092 O O    . HOH B 2 .   ? -7.571  18.036 17.792 1.00 38.05  ? 219 HOH A O    1 
HETATM 3093 O O    . HOH B 2 .   ? 0.136   19.207 7.645  1.00 40.81  ? 220 HOH A O    1 
HETATM 3094 O O    . HOH B 2 .   ? -18.290 8.144  3.634  1.00 44.98  ? 221 HOH A O    1 
HETATM 3095 O O    . HOH B 2 .   ? 0.936   -4.399 17.455 1.00 35.17  ? 222 HOH A O    1 
HETATM 3096 O O    . HOH B 2 .   ? 21.680  8.526  6.302  1.00 35.91  ? 223 HOH A O    1 
HETATM 3097 O O    . HOH B 2 .   ? -8.908  -1.899 19.480 1.00 38.65  ? 224 HOH A O    1 
HETATM 3098 O O    . HOH B 2 .   ? 2.012   14.096 -0.017 1.00 39.16  ? 225 HOH A O    1 
HETATM 3099 O O    . HOH B 2 .   ? -2.941  18.828 22.900 1.00 41.93  ? 226 HOH A O    1 
HETATM 3100 O O    . HOH B 2 .   ? 2.286   34.447 14.401 1.00 38.65  ? 227 HOH A O    1 
HETATM 3101 O O    . HOH B 2 .   ? -6.832  25.808 13.785 1.00 44.99  ? 228 HOH A O    1 
HETATM 3102 O O    . HOH B 2 .   ? 0.752   15.398 29.118 1.00 41.07  ? 229 HOH A O    1 
HETATM 3103 O O    . HOH B 2 .   ? 20.311  19.489 9.276  1.00 43.74  ? 230 HOH A O    1 
HETATM 3104 O O    . HOH B 2 .   ? 16.063  21.041 4.271  1.00 40.22  ? 231 HOH A O    1 
HETATM 3105 O O    . HOH B 2 .   ? -8.757  2.476  2.899  1.00 38.96  ? 232 HOH A O    1 
HETATM 3106 O O    . HOH B 2 .   ? 18.634  20.404 5.743  1.00 37.56  ? 233 HOH A O    1 
HETATM 3107 O O    . HOH B 2 .   ? 4.756   -7.258 19.429 1.00 46.39  ? 234 HOH A O    1 
HETATM 3108 O O    . HOH B 2 .   ? 20.920  3.686  5.006  1.00 40.18  ? 235 HOH A O    1 
HETATM 3109 O O    . HOH B 2 .   ? 19.777  5.540  18.921 1.00 42.22  ? 236 HOH A O    1 
HETATM 3110 O O    . HOH B 2 .   ? 18.192  21.439 8.894  1.00 36.50  ? 237 HOH A O    1 
HETATM 3111 O O    . HOH B 2 .   ? -8.570  0.881  26.289 1.00 43.01  ? 238 HOH A O    1 
HETATM 3112 O O    . HOH B 2 .   ? 6.451   1.702  -4.678 1.00 45.54  ? 239 HOH A O    1 
HETATM 3113 O O    . HOH B 2 .   ? 7.099   2.243  31.175 1.00 47.20  ? 240 HOH A O    1 
HETATM 3114 O O    . HOH B 2 .   ? 16.023  26.637 11.334 1.00 46.34  ? 241 HOH A O    1 
HETATM 3115 O O    . HOH B 2 .   ? 0.562   7.715  31.034 1.00 46.79  ? 242 HOH A O    1 
HETATM 3116 O O    . HOH B 2 .   ? 3.648   6.700  31.117 1.00 44.83  ? 243 HOH A O    1 
HETATM 3117 O O    . HOH B 2 .   ? -6.114  21.001 11.263 1.00 41.53  ? 244 HOH A O    1 
HETATM 3118 O O    . HOH B 2 .   ? -7.182  16.372 26.153 1.00 41.88  ? 245 HOH A O    1 
HETATM 3119 O O    . HOH B 2 .   ? -4.701  1.478  0.527  1.00 39.04  ? 246 HOH A O    1 
HETATM 3120 O O    . HOH B 2 .   ? -3.286  14.603 27.472 1.00 41.13  ? 247 HOH A O    1 
HETATM 3121 O O    . HOH B 2 .   ? -15.534 10.199 14.805 1.00 43.86  ? 248 HOH A O    1 
HETATM 3122 O O    . HOH B 2 .   ? 20.568  13.969 19.191 1.00 46.62  ? 249 HOH A O    1 
HETATM 3123 O O    . HOH B 2 .   ? -13.017 9.776  26.565 1.00 39.78  ? 250 HOH A O    1 
HETATM 3124 O O    . HOH B 2 .   ? 6.424   18.862 25.631 1.00 45.62  ? 251 HOH A O    1 
HETATM 3125 O O    . HOH B 2 .   ? -0.603  12.450 2.216  1.00 41.17  ? 252 HOH A O    1 
HETATM 3126 O O    . HOH B 2 .   ? 14.983  23.346 16.236 1.00 45.53  ? 253 HOH A O    1 
HETATM 3127 O O    . HOH B 2 .   ? 5.903   19.181 8.362  1.00 41.85  ? 254 HOH A O    1 
HETATM 3128 O O    . HOH B 2 .   ? 21.554  12.674 13.861 1.00 37.32  ? 255 HOH A O    1 
HETATM 3129 O O    . HOH B 2 .   ? 15.720  13.104 -2.259 1.00 28.33  ? 256 HOH A O    1 
HETATM 3130 O O    . HOH B 2 .   ? -1.690  -5.265 18.367 1.00 44.74  ? 257 HOH A O    1 
HETATM 3131 O O    . HOH B 2 .   ? 4.956   -1.171 24.832 1.00 38.63  ? 258 HOH A O    1 
HETATM 3132 O O    . HOH B 2 .   ? 19.111  5.107  21.639 1.00 48.30  ? 259 HOH A O    1 
HETATM 3133 O O    . HOH B 2 .   ? -12.337 2.642  11.681 1.00 50.15  ? 260 HOH A O    1 
HETATM 3134 O O    . HOH B 2 .   ? -16.079 14.186 7.640  1.00 44.19  ? 261 HOH A O    1 
HETATM 3135 O O    . HOH B 2 .   ? -12.111 3.072  22.642 1.00 53.76  ? 262 HOH A O    1 
HETATM 3136 O O    . HOH B 2 .   ? 9.100   -3.036 0.424  1.00 50.57  ? 263 HOH A O    1 
HETATM 3137 O O    . HOH B 2 .   ? 15.198  1.952  23.019 1.00 27.57  ? 264 HOH A O    1 
HETATM 3138 O O    . HOH B 2 .   ? 3.368   29.989 15.331 1.00 36.14  ? 265 HOH A O    1 
HETATM 3139 O O    . HOH B 2 .   ? 1.232   10.854 -4.338 1.00 47.42  ? 266 HOH A O    1 
HETATM 3140 O O    . HOH B 2 .   ? 3.841   -3.703 6.350  1.00 47.01  ? 267 HOH A O    1 
HETATM 3141 O O    . HOH B 2 .   ? 6.862   20.458 6.213  1.00 45.36  ? 268 HOH A O    1 
HETATM 3142 O O    . HOH B 2 .   ? 20.567  0.468  15.016 1.00 43.85  ? 269 HOH A O    1 
HETATM 3143 O O    . HOH B 2 .   ? 1.864   -3.915 7.901  1.00 52.70  ? 270 HOH A O    1 
HETATM 3144 O O    . HOH B 2 .   ? -7.888  0.881  8.670  1.00 47.78  ? 271 HOH A O    1 
HETATM 3145 O O    . HOH B 2 .   ? 11.430  5.978  2.865  1.00 16.82  ? 272 HOH A O    1 
HETATM 3146 O O    . HOH B 2 .   ? -14.252 5.008  12.100 1.00 49.52  ? 273 HOH A O    1 
HETATM 3147 O O    . HOH B 2 .   ? -7.760  18.147 10.910 1.00 37.12  ? 274 HOH A O    1 
HETATM 3148 O O    . HOH B 2 .   ? 15.021  21.099 -1.923 1.00 23.87  ? 275 HOH A O    1 
HETATM 3149 O O    . HOH B 2 .   ? -15.922 15.644 10.392 1.00 39.83  ? 276 HOH A O    1 
HETATM 3150 O O    . HOH B 2 .   ? 22.247  11.541 7.214  1.00 47.41  ? 277 HOH A O    1 
HETATM 3151 O O    . HOH B 2 .   ? 12.717  6.866  -4.607 1.00 49.06  ? 278 HOH A O    1 
HETATM 3152 O O    . HOH B 2 .   ? -15.312 14.473 13.581 1.00 43.46  ? 279 HOH A O    1 
HETATM 3153 O O    . HOH B 2 .   ? -8.996  -0.914 23.837 1.00 58.61  ? 280 HOH A O    1 
HETATM 3154 O O    . HOH B 2 .   ? -13.265 17.267 22.808 1.00 47.75  ? 281 HOH A O    1 
HETATM 3155 O O    . HOH B 2 .   ? -6.385  23.040 18.093 1.00 40.39  ? 282 HOH A O    1 
HETATM 3156 O O    . HOH B 2 .   ? 4.088   36.924 13.968 1.00 51.75  ? 283 HOH A O    1 
HETATM 3157 O O    . HOH B 2 .   ? 7.853   -2.696 23.056 1.00 56.29  ? 284 HOH A O    1 
HETATM 3158 O O    . HOH B 2 .   ? -12.778 7.285  6.154  1.00 37.94  ? 285 HOH A O    1 
HETATM 3159 O O    . HOH B 2 .   ? -14.817 7.603  7.988  1.00 43.34  ? 286 HOH A O    1 
HETATM 3160 O O    . HOH B 2 .   ? 14.914  -1.127 21.393 1.00 46.23  ? 287 HOH A O    1 
HETATM 3161 O O    . HOH B 2 .   ? 9.840   27.091 8.928  1.00 62.45  ? 288 HOH A O    1 
HETATM 3162 O O    . HOH B 2 .   ? 0.134   -4.825 3.651  1.00 53.48  ? 289 HOH A O    1 
HETATM 3163 O O    . HOH B 2 .   ? 7.261   24.092 1.129  1.00 50.89  ? 290 HOH A O    1 
HETATM 3164 O O    . HOH B 2 .   ? 19.554  10.575 -0.116 1.00 53.12  ? 291 HOH A O    1 
HETATM 3165 O O    . HOH B 2 .   ? 4.410   -2.524 9.888  1.00 54.55  ? 292 HOH A O    1 
HETATM 3166 O O    . HOH B 2 .   ? 3.415   -2.684 12.347 1.00 42.47  ? 293 HOH A O    1 
HETATM 3167 O O    . HOH B 2 .   ? -2.180  18.244 26.462 1.00 44.24  ? 294 HOH A O    1 
HETATM 3168 O O    . HOH B 2 .   ? 24.306  5.897  12.563 1.00 57.70  ? 295 HOH A O    1 
HETATM 3169 O O    . HOH B 2 .   ? 16.001  24.759 8.766  1.00 51.44  ? 296 HOH A O    1 
HETATM 3170 O O    . HOH B 2 .   ? 12.988  -1.680 1.342  1.00 54.12  ? 297 HOH A O    1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . VAL A 2   ? 0.9886 0.6634 0.7606 0.3707  -0.1819 0.1704  2   VAL A N   
2    C CA  . VAL A 2   ? 0.9390 0.6017 0.7972 0.4538  0.0276  0.0363  2   VAL A CA  
3    C C   . VAL A 2   ? 0.4662 0.9013 0.5008 0.3518  -0.0714 0.2457  2   VAL A C   
4    O O   . VAL A 2   ? 0.4366 1.0884 0.7353 0.2591  -0.0830 0.0898  2   VAL A O   
5    C CB  . VAL A 2   ? 1.0029 0.9121 1.0911 0.2212  -0.0467 0.0586  2   VAL A CB  
6    C CG1 . VAL A 2   ? 1.0398 1.1091 1.1935 0.0982  -0.0689 0.1119  2   VAL A CG1 
7    C CG2 . VAL A 2   ? 1.0988 1.0733 1.2153 0.3274  0.0969  0.1192  2   VAL A CG2 
16   N N   . ASN A 3   ? 0.3908 0.5470 0.3622 0.2422  -0.0071 0.1175  3   ASN A N   
17   C CA  . ASN A 3   ? 0.3986 0.5641 0.2892 0.2082  0.0191  -0.0262 3   ASN A CA  
18   C C   . ASN A 3   ? 0.2313 0.4678 0.2602 0.1844  -0.0205 0.0665  3   ASN A C   
19   O O   . ASN A 3   ? 0.4069 0.4128 0.3074 0.1756  0.0262  0.1046  3   ASN A O   
20   C CB  . ASN A 3   ? 0.3172 0.2760 0.3380 0.1669  0.0140  0.0708  3   ASN A CB  
21   C CG  . ASN A 3   ? 0.4267 0.5362 0.3304 0.3443  0.1621  0.2516  3   ASN A CG  
22   O OD1 . ASN A 3   ? 0.3220 0.4549 0.3403 0.1849  0.0758  0.0978  3   ASN A OD1 
23   N ND2 . ASN A 3   ? 0.5166 0.4542 0.3600 0.2466  -0.0049 0.0103  3   ASN A ND2 
30   N N   . PRO A 4   ? 0.2746 0.6813 0.3565 0.3474  -0.0702 -0.0892 4   PRO A N   
31   C CA  . PRO A 4   ? 0.2714 0.3449 0.3296 0.1802  0.0086  0.0628  4   PRO A CA  
32   C C   . PRO A 4   ? 0.1802 0.2927 0.3539 0.0825  0.0229  0.0952  4   PRO A C   
33   O O   . PRO A 4   ? 0.2626 0.3987 0.2914 0.1066  -0.0354 0.0715  4   PRO A O   
34   C CB  . PRO A 4   ? 0.2529 0.4150 0.4709 0.0836  -0.1257 -0.0575 4   PRO A CB  
35   C CG  . PRO A 4   ? 0.8268 0.5471 0.3364 -0.1560 0.0718  0.1997  4   PRO A CG  
36   C CD  . PRO A 4   ? 0.9912 0.5296 0.5771 0.2098  0.1519  0.0275  4   PRO A CD  
44   N N   A THR A 5   ? 0.4408 0.3329 0.3142 0.2904  -0.2004 -0.1073 5   THR A N   
45   N N   B THR A 5   ? 0.1246 0.3863 0.2649 -0.0580 0.0937  0.1123  5   THR A N   
46   C CA  A THR A 5   ? 0.3619 0.1585 0.1774 0.1459  -0.1083 -0.0249 5   THR A CA  
47   C CA  B THR A 5   ? 0.1542 0.4555 0.2635 -0.1225 0.0926  0.0112  5   THR A CA  
48   C C   A THR A 5   ? 0.3216 0.3182 0.3441 0.1876  0.0998  0.1096  5   THR A C   
49   C C   B THR A 5   ? 0.3184 0.5048 0.1295 -0.2171 -0.0557 -0.1270 5   THR A C   
50   O O   A THR A 5   ? 0.2634 0.2806 0.1924 0.0661  -0.0060 0.0274  5   THR A O   
51   O O   B THR A 5   ? 0.4478 0.2728 0.2322 0.0864  0.0270  0.1460  5   THR A O   
52   C CB  A THR A 5   ? 0.4078 0.1997 0.4510 0.0913  0.0330  0.1742  5   THR A CB  
53   C CB  B THR A 5   ? 0.1391 0.2615 0.4689 -0.0366 0.1940  -0.0269 5   THR A CB  
54   O OG1 A THR A 5   ? 0.4995 0.2832 0.4451 0.1980  0.1145  0.0510  5   THR A OG1 
55   O OG1 B THR A 5   ? 0.3813 0.2803 0.4524 -0.0694 -0.1038 0.1668  5   THR A OG1 
56   C CG2 A THR A 5   ? 0.2694 0.3126 0.5197 -0.0168 0.1731  -0.1395 5   THR A CG2 
57   C CG2 B THR A 5   ? 0.5348 0.2610 0.5010 0.1501  -0.0020 0.2451  5   THR A CG2 
72   N N   A VAL A 6   ? 0.2138 0.2545 0.2213 0.0471  -0.0096 0.0905  6   VAL A N   
73   N N   B VAL A 6   ? 0.1941 0.2139 0.3544 0.0296  -0.0127 -0.0645 6   VAL A N   
74   C CA  A VAL A 6   ? 0.3024 0.2510 0.1062 0.1833  -0.0003 0.0271  6   VAL A CA  
75   C CA  B VAL A 6   ? 0.3504 0.1033 0.3512 -0.1611 -0.2286 0.0960  6   VAL A CA  
76   C C   A VAL A 6   ? 0.1540 0.3378 0.1018 0.1062  -0.0612 0.0184  6   VAL A C   
77   C C   B VAL A 6   ? 0.5177 0.2400 0.2783 -0.1575 -0.1044 0.1676  6   VAL A C   
78   O O   A VAL A 6   ? 0.1933 0.3438 0.1356 0.0027  -0.0230 0.0556  6   VAL A O   
79   O O   B VAL A 6   ? 0.3412 0.2178 0.2996 -0.0056 -0.0153 -0.1310 6   VAL A O   
80   C CB  A VAL A 6   ? 0.1606 0.3238 0.2599 0.0400  -0.0970 -0.1233 6   VAL A CB  
81   C CB  B VAL A 6   ? 0.0704 0.2360 0.1952 0.0577  -0.1012 -0.0708 6   VAL A CB  
82   C CG1 A VAL A 6   ? 0.3247 0.2654 0.1670 0.0623  -0.0850 0.1214  6   VAL A CG1 
83   C CG1 B VAL A 6   ? 0.4914 0.2789 0.1623 -0.1329 0.1544  -0.1145 6   VAL A CG1 
84   C CG2 A VAL A 6   ? 0.2948 0.2644 0.2464 -0.0590 -0.1654 0.0835  6   VAL A CG2 
85   C CG2 B VAL A 6   ? 0.2226 0.3404 0.2098 0.1315  -0.1280 0.0847  6   VAL A CG2 
104  N N   A PHE A 7   ? 0.1874 0.2183 0.2185 0.0488  0.0018  -0.0389 7   PHE A N   
105  N N   B PHE A 7   ? 0.3967 0.3945 0.2284 -0.0036 0.0157  0.1991  7   PHE A N   
106  C CA  A PHE A 7   ? 0.1507 0.2533 0.2981 0.0406  0.0285  -0.0513 7   PHE A CA  
107  C CA  B PHE A 7   ? 0.4517 0.0815 0.1688 -0.0642 0.0296  0.0333  7   PHE A CA  
108  C C   A PHE A 7   ? 0.2727 0.1796 0.2258 -0.0306 -0.0984 -0.0273 7   PHE A C   
109  C C   B PHE A 7   ? 0.2159 0.1190 0.2609 0.1494  0.2247  0.1539  7   PHE A C   
110  O O   A PHE A 7   ? 0.2673 0.1037 0.2058 -0.0354 -0.0895 -0.0139 7   PHE A O   
111  O O   B PHE A 7   ? 0.2594 0.3376 0.3458 0.0738  0.1140  0.2342  7   PHE A O   
112  C CB  A PHE A 7   ? 0.3001 0.1360 0.3183 -0.0395 -0.0637 -0.0221 7   PHE A CB  
113  C CB  B PHE A 7   ? 0.4561 0.2218 0.2392 0.1807  0.1685  0.1780  7   PHE A CB  
114  C CG  A PHE A 7   ? 0.2188 0.1903 0.2106 -0.0211 0.0379  0.0262  7   PHE A CG  
115  C CG  B PHE A 7   ? 0.4871 0.3767 0.2741 0.0126  0.0483  0.0828  7   PHE A CG  
116  C CD1 A PHE A 7   ? 0.3297 0.2835 0.2135 0.0411  0.0643  -0.0462 7   PHE A CD1 
117  C CD1 B PHE A 7   ? 0.3361 0.1291 0.2900 -0.0640 0.1193  0.0930  7   PHE A CD1 
118  C CD2 A PHE A 7   ? 0.3063 0.2969 0.1088 -0.0281 -0.0193 0.0633  7   PHE A CD2 
119  C CD2 B PHE A 7   ? 0.3535 0.3459 0.2490 -0.0424 -0.0498 0.2227  7   PHE A CD2 
120  C CE1 A PHE A 7   ? 0.3084 0.3826 0.1755 -0.1370 -0.0704 0.0762  7   PHE A CE1 
121  C CE1 B PHE A 7   ? 0.2708 0.1246 0.2172 -0.0418 0.1354  -0.0348 7   PHE A CE1 
122  C CE2 A PHE A 7   ? 0.2030 0.3643 0.1775 -0.0785 -0.0291 0.1678  7   PHE A CE2 
123  C CE2 B PHE A 7   ? 0.3974 0.5693 0.3211 0.0054  0.1410  0.2794  7   PHE A CE2 
124  C CZ  A PHE A 7   ? 0.4193 0.3147 0.1629 -0.1178 -0.0407 0.0646  7   PHE A CZ  
125  C CZ  B PHE A 7   ? 0.4293 0.4499 0.1881 -0.3885 -0.0256 0.0905  7   PHE A CZ  
144  N N   . PHE A 8   ? 0.1563 0.2194 0.2027 0.0362  -0.0055 0.0203  8   PHE A N   
145  C CA  . PHE A 8   ? 0.1848 0.2611 0.1657 0.0211  0.0580  0.0497  8   PHE A CA  
146  C C   . PHE A 8   ? 0.2831 0.1545 0.1394 0.0415  0.0176  -0.0395 8   PHE A C   
147  O O   . PHE A 8   ? 0.3196 0.1618 0.1890 0.0086  0.0356  -0.0198 8   PHE A O   
148  C CB  . PHE A 8   ? 0.2500 0.2089 0.1447 -0.0089 0.0067  0.0452  8   PHE A CB  
149  C CG  . PHE A 8   ? 0.1776 0.1652 0.2465 0.0317  -0.0085 -0.0266 8   PHE A CG  
150  C CD1 . PHE A 8   ? 0.2570 0.1865 0.1366 0.0190  0.0473  0.0356  8   PHE A CD1 
151  C CD2 . PHE A 8   ? 0.2471 0.1929 0.2163 0.0064  -0.0116 0.0403  8   PHE A CD2 
152  C CE1 . PHE A 8   ? 0.2260 0.2104 0.1813 0.0010  0.0139  0.0195  8   PHE A CE1 
153  C CE2 . PHE A 8   ? 0.2847 0.1851 0.1916 0.0143  -0.0134 0.0293  8   PHE A CE2 
154  C CZ  . PHE A 8   ? 0.3384 0.1826 0.1743 -0.0127 0.0217  0.0220  8   PHE A CZ  
165  N N   . ASP A 9   ? 0.2369 0.1465 0.1631 -0.0162 0.0353  0.0264  9   ASP A N   
166  C CA  . ASP A 9   ? 0.2621 0.1139 0.1698 0.0076  0.0197  -0.0150 9   ASP A CA  
167  C C   . ASP A 9   ? 0.2699 0.1039 0.1993 -0.0032 0.0477  -0.0080 9   ASP A C   
168  O O   . ASP A 9   ? 0.2863 0.1243 0.2280 -0.0033 -0.0289 0.0040  9   ASP A O   
169  C CB  . ASP A 9   ? 0.2507 0.1794 0.1824 0.0054  -0.0039 -0.0011 9   ASP A CB  
170  C CG  . ASP A 9   ? 0.3095 0.2636 0.1756 0.0418  -0.0025 0.0287  9   ASP A CG  
171  O OD1 . ASP A 9   ? 0.4289 0.2209 0.2359 0.0692  -0.0173 0.0365  9   ASP A OD1 
172  O OD2 . ASP A 9   ? 0.5373 0.2254 0.2480 0.0115  -0.1227 0.0472  9   ASP A OD2 
177  N N   . ILE A 10  ? 0.2627 0.1379 0.1834 -0.0133 0.0046  0.0386  10  ILE A N   
178  C CA  . ILE A 10  ? 0.2468 0.1608 0.1895 -0.0340 -0.0115 0.0420  10  ILE A CA  
179  C C   . ILE A 10  ? 0.2164 0.2030 0.1831 0.0170  0.0272  0.0357  10  ILE A C   
180  O O   . ILE A 10  ? 0.2875 0.2073 0.1977 -0.0091 0.0472  0.0710  10  ILE A O   
181  C CB  . ILE A 10  ? 0.2616 0.1945 0.1748 -0.0336 -0.0076 0.0315  10  ILE A CB  
182  C CG1 . ILE A 10  ? 0.2941 0.2520 0.1895 0.0473  0.0199  0.0121  10  ILE A CG1 
183  C CG2 . ILE A 10  ? 0.2689 0.2516 0.2037 0.0103  -0.0221 0.0232  10  ILE A CG2 
184  C CD1 . ILE A 10  ? 0.2664 0.3124 0.2317 -0.0365 0.0421  0.0188  10  ILE A CD1 
196  N N   . ALA A 11  ? 0.3044 0.1843 0.1872 0.0357  0.0538  0.0258  11  ALA A N   
197  C CA  . ALA A 11  ? 0.2085 0.2149 0.2108 0.0034  0.0224  0.0038  11  ALA A CA  
198  C C   . ALA A 11  ? 0.1742 0.2091 0.2006 0.0299  0.0526  0.0016  11  ALA A C   
199  O O   . ALA A 11  ? 0.2717 0.2157 0.2163 0.0032  0.0767  0.0446  11  ALA A O   
200  C CB  . ALA A 11  ? 0.2573 0.2464 0.2248 0.0123  0.0260  -0.0245 11  ALA A CB  
206  N N   . VAL A 12  ? 0.2134 0.2501 0.1895 0.0258  0.0444  0.0319  12  VAL A N   
207  C CA  . VAL A 12  ? 0.3051 0.2479 0.2269 0.0722  0.0999  0.0055  12  VAL A CA  
208  C C   . VAL A 12  ? 0.3375 0.2696 0.2649 0.0329  0.0275  0.0678  12  VAL A C   
209  O O   . VAL A 12  ? 0.3379 0.3104 0.2395 0.0288  0.1048  0.0170  12  VAL A O   
210  C CB  . VAL A 12  ? 0.4622 0.2422 0.2854 0.0527  0.0955  -0.0387 12  VAL A CB  
211  C CG1 . VAL A 12  ? 0.3064 0.3876 0.4055 0.0310  0.0330  0.0449  12  VAL A CG1 
212  C CG2 . VAL A 12  ? 0.2698 0.2970 0.3332 -0.0309 -0.0573 0.0554  12  VAL A CG2 
222  N N   . ASP A 13  ? 0.2911 0.3290 0.1840 0.0631  0.0937  0.0493  13  ASP A N   
223  C CA  . ASP A 13  ? 0.3240 0.4161 0.2492 0.1037  0.1593  0.0104  13  ASP A CA  
224  C C   . ASP A 13  ? 0.3563 0.2959 0.2223 0.0629  0.0739  -0.0253 13  ASP A C   
225  O O   . ASP A 13  ? 0.5365 0.3775 0.2430 0.1040  0.1626  -0.0043 13  ASP A O   
226  C CB  . ASP A 13  ? 0.3332 0.4632 0.2658 0.0762  0.1063  0.0996  13  ASP A CB  
227  C CG  . ASP A 13  ? 0.3934 0.4754 0.2908 0.0292  0.2034  -0.0122 13  ASP A CG  
228  O OD1 . ASP A 13  ? 0.4053 0.4423 0.2752 0.1461  0.1573  0.0214  13  ASP A OD1 
229  O OD2 . ASP A 13  ? 0.3420 0.7369 0.4827 0.0761  0.1008  0.0742  13  ASP A OD2 
234  N N   A GLY A 14  ? 0.3513 0.4744 0.2682 0.2410  0.1544  0.1085  14  GLY A N   
235  N N   B GLY A 14  ? 0.3740 0.1582 0.3309 -0.0491 0.0373  -0.1132 14  GLY A N   
236  C CA  A GLY A 14  ? 0.5524 0.4578 0.2775 0.1553  0.0693  -0.1562 14  GLY A CA  
237  C CA  B GLY A 14  ? 0.3101 0.2796 0.3561 -0.0851 -0.1213 0.1019  14  GLY A CA  
238  C C   A GLY A 14  ? 0.2707 0.4278 0.3359 -0.0240 0.1221  0.0457  14  GLY A C   
239  C C   B GLY A 14  ? 0.3774 0.1970 0.3257 -0.0649 0.2672  0.0093  14  GLY A C   
240  O O   A GLY A 14  ? 0.3587 0.5763 0.2218 -0.1218 0.0836  0.0896  14  GLY A O   
241  O O   B GLY A 14  ? 0.2803 0.3198 0.2894 -0.0656 0.0694  0.0173  14  GLY A O   
248  N N   A GLU A 15  ? 0.3249 0.4060 0.3197 0.1546  0.0795  -0.1494 15  GLU A N   
249  N N   B GLU A 15  ? 0.3077 0.2824 0.3780 0.0480  0.1004  0.2545  15  GLU A N   
250  C CA  A GLU A 15  ? 0.3817 0.4465 0.3031 0.0851  0.1959  0.2182  15  GLU A CA  
251  C CA  B GLU A 15  ? 0.4669 0.5160 0.3474 0.4191  0.0688  -0.1027 15  GLU A CA  
252  C C   A GLU A 15  ? 0.3105 0.2252 0.2143 0.0455  -0.0530 0.0442  15  GLU A C   
253  C C   B GLU A 15  ? 0.2464 0.4494 0.2515 0.0342  0.2150  0.1736  15  GLU A C   
254  O O   A GLU A 15  ? 0.2685 0.2652 0.1463 -0.0230 0.0730  0.0459  15  GLU A O   
255  O O   B GLU A 15  ? 0.5791 0.4321 0.3013 0.1679  0.2993  0.2549  15  GLU A O   
256  C CB  A GLU A 15  ? 0.2676 0.4945 0.4401 -0.0869 0.2266  -0.1528 15  GLU A CB  
257  C CB  B GLU A 15  ? 0.4583 0.2251 0.3448 0.0173  0.2230  0.1377  15  GLU A CB  
258  C CG  A GLU A 15  ? 0.7573 0.7613 0.5971 0.1883  0.2124  0.1051  15  GLU A CG  
259  C CG  B GLU A 15  ? 0.5007 0.5878 0.6208 0.0642  0.4595  -0.0696 15  GLU A CG  
260  C CD  A GLU A 15  ? 0.8012 0.9963 0.8009 -0.0644 0.3432  0.2471  15  GLU A CD  
261  C CD  B GLU A 15  ? 0.6122 0.7566 0.4936 -0.0456 0.5301  0.0336  15  GLU A CD  
262  O OE1 A GLU A 15  ? 0.8071 1.0205 0.8056 0.0677  0.3057  0.2723  15  GLU A OE1 
263  O OE1 B GLU A 15  ? 0.4428 1.0634 0.6511 -0.2162 0.3491  0.2535  15  GLU A OE1 
264  O OE2 A GLU A 15  ? 0.8302 0.9514 0.6856 0.1384  0.3325  0.0322  15  GLU A OE2 
265  O OE2 B GLU A 15  ? 0.7382 0.8399 0.4159 -0.0972 0.2940  -0.0768 15  GLU A OE2 
277  N N   A PRO A 16  ? 0.4972 0.2393 0.0912 -0.0637 0.0035  0.0762  16  PRO A N   
278  N N   B PRO A 16  ? 0.2735 0.4991 0.4180 -0.0106 0.1028  0.0143  16  PRO A N   
279  C CA  A PRO A 16  ? 0.5193 0.2331 0.3326 0.0808  0.1161  -0.0564 16  PRO A CA  
280  C CA  B PRO A 16  ? 0.4106 0.4185 0.2820 0.0963  0.2112  0.1839  16  PRO A CA  
281  C C   A PRO A 16  ? 0.3777 0.1992 0.3276 0.0664  -0.0207 -0.0773 16  PRO A C   
282  C C   B PRO A 16  ? 0.3483 0.2633 0.3010 0.0576  0.1543  0.2415  16  PRO A C   
283  O O   A PRO A 16  ? 0.2559 0.3790 0.2431 0.0311  0.0263  0.1264  16  PRO A O   
284  O O   B PRO A 16  ? 0.3884 0.2633 0.3049 0.0158  0.0233  0.1485  16  PRO A O   
285  C CB  A PRO A 16  ? 0.5295 0.4232 0.2559 -0.0852 -0.2210 0.1635  16  PRO A CB  
286  C CB  B PRO A 16  ? 0.4734 0.4111 0.3006 0.0950  0.2576  0.1263  16  PRO A CB  
287  C CG  A PRO A 16  ? 0.6772 0.3632 0.1205 0.0687  0.0397  0.0148  16  PRO A CG  
288  C CG  B PRO A 16  ? 0.4139 0.6334 0.3509 0.0198  -0.1276 0.2888  16  PRO A CG  
289  C CD  A PRO A 16  ? 0.4212 0.2301 0.2655 0.0363  0.0219  0.1631  16  PRO A CD  
290  C CD  B PRO A 16  ? 0.4061 0.1665 0.4806 -0.0325 0.1915  0.1658  16  PRO A CD  
305  N N   . LEU A 17  ? 0.3576 0.1740 0.2491 -0.0029 0.0975  0.0132  17  LEU A N   
306  C CA  . LEU A 17  ? 0.2973 0.1591 0.2495 -0.0040 0.0561  0.0683  17  LEU A CA  
307  C C   . LEU A 17  ? 0.2679 0.2410 0.2778 -0.0243 0.0722  0.1017  17  LEU A C   
308  O O   . LEU A 17  ? 0.3012 0.2127 0.4261 -0.0312 0.0581  0.0890  17  LEU A O   
309  C CB  . LEU A 17  ? 0.2854 0.1683 0.2938 -0.0098 0.0193  -0.0224 17  LEU A CB  
310  C CG  . LEU A 17  ? 0.2557 0.2484 0.2632 0.0061  0.0363  0.0273  17  LEU A CG  
311  C CD1 . LEU A 17  ? 0.2992 0.4873 0.3149 -0.1432 -0.0137 0.0001  17  LEU A CD1 
312  C CD2 . LEU A 17  ? 0.4147 0.2936 0.2595 0.0759  0.0086  0.0350  17  LEU A CD2 
325  N N   . GLY A 18  ? 0.2428 0.1826 0.2325 -0.0432 0.0417  0.0377  18  GLY A N   
326  C CA  . GLY A 18  ? 0.1899 0.2351 0.2325 0.0196  0.0502  0.0329  18  GLY A CA  
327  C C   . GLY A 18  ? 0.2296 0.1408 0.1876 0.0230  0.0566  0.0663  18  GLY A C   
328  O O   . GLY A 18  ? 0.2925 0.1274 0.2894 0.0086  0.0588  0.0630  18  GLY A O   
332  N N   A ARG A 19  ? 0.5699 0.1070 0.2682 0.0010  -0.1481 0.0736  19  ARG A N   
333  N N   B ARG A 19  ? 0.0656 0.1945 0.1252 0.0175  0.0820  0.0055  19  ARG A N   
334  C CA  A ARG A 19  ? 0.5919 0.1163 0.0993 -0.0827 0.1161  -0.0132 19  ARG A CA  
335  C CA  B ARG A 19  ? 0.1053 0.2452 0.3054 0.1081  -0.0268 0.0558  19  ARG A CA  
336  C C   A ARG A 19  ? 0.2771 0.0722 0.2324 -0.0116 0.0895  0.0115  19  ARG A C   
337  C C   B ARG A 19  ? 0.0146 0.3860 0.2951 -0.0240 -0.0033 0.0939  19  ARG A C   
338  O O   A ARG A 19  ? 0.4123 0.0830 0.1539 -0.0344 0.0664  0.0370  19  ARG A O   
339  O O   B ARG A 19  ? 0.1374 0.2593 0.3865 -0.0044 -0.0549 -0.0225 19  ARG A O   
340  C CB  A ARG A 19  ? 0.4398 0.1206 0.1237 -0.0387 0.1095  -0.0118 19  ARG A CB  
341  C CB  B ARG A 19  ? 0.1351 0.3144 0.3426 0.0840  -0.1354 0.1307  19  ARG A CB  
342  C CG  A ARG A 19  ? 0.3277 0.1816 0.1485 0.0365  -0.0321 -0.0494 19  ARG A CG  
343  C CG  B ARG A 19  ? 0.1206 0.2343 0.3320 0.0498  0.0014  0.2059  19  ARG A CG  
344  C CD  A ARG A 19  ? 0.2359 0.2984 0.1583 0.0227  -0.0362 -0.0343 19  ARG A CD  
345  C CD  B ARG A 19  ? 0.5435 0.0200 0.3143 0.0138  0.0834  0.0555  19  ARG A CD  
346  N NE  A ARG A 19  ? 0.3758 0.2043 0.2374 -0.0267 -0.0521 0.0335  19  ARG A NE  
347  N NE  B ARG A 19  ? 0.2227 0.1058 0.1444 0.0371  -0.0001 0.0915  19  ARG A NE  
348  C CZ  A ARG A 19  ? 0.4094 0.4101 0.1561 -0.1920 -0.1907 0.1733  19  ARG A CZ  
349  C CZ  B ARG A 19  ? 0.2978 0.1992 0.3703 0.1538  0.1517  0.2472  19  ARG A CZ  
350  N NH1 A ARG A 19  ? 0.4516 0.2124 0.2375 0.0220  -0.1728 0.0654  19  ARG A NH1 
351  N NH1 B ARG A 19  ? 0.2095 0.4797 0.4451 0.1214  0.1409  0.2695  19  ARG A NH1 
352  N NH2 A ARG A 19  ? 0.4100 0.1843 0.1915 -0.0154 -0.0882 0.0274  19  ARG A NH2 
353  N NH2 B ARG A 19  ? 0.3686 0.3805 0.2776 0.0183  0.0419  0.2143  19  ARG A NH2 
380  N N   A VAL A 20  ? 0.2879 0.1128 0.1069 -0.0551 0.0407  0.0333  20  VAL A N   
381  N N   B VAL A 20  ? 0.0402 0.4715 0.3395 0.0672  0.0754  -0.0605 20  VAL A N   
382  C CA  A VAL A 20  ? 0.3041 0.0841 0.1296 -0.0486 0.0654  0.0470  20  VAL A CA  
383  C CA  B VAL A 20  ? 0.2916 0.2628 0.3787 0.2590  0.1615  0.1075  20  VAL A CA  
384  C C   A VAL A 20  ? 0.3362 0.1133 0.1644 -0.0342 0.0867  0.0076  20  VAL A C   
385  C C   B VAL A 20  ? 0.2367 0.3929 0.1770 0.2711  0.0773  -0.0052 20  VAL A C   
386  O O   A VAL A 20  ? 0.2723 0.1782 0.2630 0.0410  -0.0095 -0.0826 20  VAL A O   
387  O O   B VAL A 20  ? 0.2497 0.2732 0.1941 -0.0155 0.0129  0.1457  20  VAL A O   
388  C CB  A VAL A 20  ? 0.2732 0.1356 0.1604 0.0006  0.0616  0.0449  20  VAL A CB  
389  C CB  B VAL A 20  ? 0.3009 0.1291 0.4385 0.0298  0.0548  0.2260  20  VAL A CB  
390  C CG1 A VAL A 20  ? 0.2750 0.1908 0.1366 0.0353  0.0501  0.0352  20  VAL A CG1 
391  C CG1 B VAL A 20  ? 0.4624 0.4693 0.4943 -0.0538 -0.3822 0.2207  20  VAL A CG1 
392  C CG2 A VAL A 20  ? 0.3431 0.1802 0.2040 0.0301  0.0667  0.0422  20  VAL A CG2 
393  C CG2 B VAL A 20  ? 0.2700 0.2688 0.2115 -0.0989 -0.0371 0.0543  20  VAL A CG2 
412  N N   A SER A 21  ? 0.1677 0.2392 0.1815 0.0121  0.0618  0.0050  21  SER A N   
413  N N   B SER A 21  ? 0.4073 0.0919 0.2481 -0.0543 -0.1475 0.0613  21  SER A N   
414  C CA  A SER A 21  ? 0.4695 0.0978 0.0826 0.0085  -0.0378 -0.0009 21  SER A CA  
415  C CA  B SER A 21  ? 0.1970 0.4307 0.2418 -0.1097 -0.0659 0.0606  21  SER A CA  
416  C C   A SER A 21  ? 0.2099 0.4076 0.1346 0.2092  -0.0265 0.0549  21  SER A C   
417  C C   B SER A 21  ? 0.3668 0.0991 0.1420 -0.0879 -0.1138 0.0048  21  SER A C   
418  O O   A SER A 21  ? 0.2266 0.1746 0.1486 0.0609  -0.0001 0.0430  21  SER A O   
419  O O   B SER A 21  ? 0.2448 0.1081 0.1477 0.0739  0.0121  0.0062  21  SER A O   
420  C CB  A SER A 21  ? 0.3673 0.2372 0.1933 0.0159  -0.0365 0.1179  21  SER A CB  
421  C CB  B SER A 21  ? 0.3249 0.3270 0.1240 0.1827  0.0812  0.0329  21  SER A CB  
422  O OG  A SER A 21  ? 0.4354 0.1594 0.3099 0.0714  0.0683  0.0564  21  SER A OG  
423  O OG  B SER A 21  ? 0.3130 0.4602 0.1294 0.0790  -0.0116 0.1459  21  SER A OG  
434  N N   A PHE A 22  ? 0.2060 0.1275 0.2052 0.0313  -0.0347 -0.0247 22  PHE A N   
435  N N   B PHE A 22  ? 0.2611 0.1215 0.2131 -0.0161 0.0809  -0.0150 22  PHE A N   
436  C CA  A PHE A 22  ? 0.2561 0.1435 0.2425 0.0537  0.0202  -0.0220 22  PHE A CA  
437  C CA  B PHE A 22  ? 0.2069 0.2506 0.0961 0.1183  -0.0314 0.0250  22  PHE A CA  
438  C C   A PHE A 22  ? 0.2903 0.1437 0.1352 -0.0133 -0.0532 0.0776  22  PHE A C   
439  C C   B PHE A 22  ? 0.2840 0.1191 0.2411 0.1078  -0.0564 0.0586  22  PHE A C   
440  O O   A PHE A 22  ? 0.2468 0.1884 0.1824 0.0764  -0.0046 0.0954  22  PHE A O   
441  O O   B PHE A 22  ? 0.2429 0.1018 0.1505 -0.0143 -0.0247 0.1161  22  PHE A O   
442  C CB  A PHE A 22  ? 0.2010 0.1610 0.1980 0.0715  -0.0089 0.0497  22  PHE A CB  
443  C CB  B PHE A 22  ? 0.2928 0.2031 0.1678 0.0261  -0.1172 0.0950  22  PHE A CB  
444  C CG  A PHE A 22  ? 0.2699 0.1618 0.2503 0.0493  -0.1185 0.0412  22  PHE A CG  
445  C CG  B PHE A 22  ? 0.1865 0.1985 0.1892 -0.0772 0.0653  0.0507  22  PHE A CG  
446  C CD1 A PHE A 22  ? 0.2664 0.1043 0.4279 -0.0060 -0.0999 0.0831  22  PHE A CD1 
447  C CD1 B PHE A 22  ? 0.4580 0.2886 0.1166 0.0767  0.2026  -0.0175 22  PHE A CD1 
448  C CD2 A PHE A 22  ? 0.3041 0.2714 0.2204 -0.0601 -0.0326 0.0853  22  PHE A CD2 
449  C CD2 B PHE A 22  ? 0.1579 0.2928 0.2759 0.0979  -0.0606 -0.1501 22  PHE A CD2 
450  C CE1 A PHE A 22  ? 0.2299 0.2061 0.3341 -0.0170 -0.0800 -0.0341 22  PHE A CE1 
451  C CE1 B PHE A 22  ? 0.1833 0.2934 0.1428 0.1345  0.0864  0.0563  22  PHE A CE1 
452  C CE2 A PHE A 22  ? 0.2928 0.2837 0.3319 0.0988  0.0064  0.0186  22  PHE A CE2 
453  C CE2 B PHE A 22  ? 0.2412 0.2935 0.2464 -0.0825 -0.1151 -0.0250 22  PHE A CE2 
454  C CZ  A PHE A 22  ? 0.1960 0.2310 0.3586 0.0905  -0.0261 0.0901  22  PHE A CZ  
455  C CZ  B PHE A 22  ? 0.4724 0.1600 0.1353 0.0134  0.0894  -0.0429 22  PHE A CZ  
474  N N   . GLU A 23  ? 0.2418 0.1951 0.2045 0.0570  -0.0289 0.0164  23  GLU A N   
475  C CA  . GLU A 23  ? 0.2510 0.1974 0.2006 0.0553  -0.0121 0.0676  23  GLU A CA  
476  C C   . GLU A 23  ? 0.1886 0.2269 0.2015 0.0826  0.0095  0.0132  23  GLU A C   
477  O O   . GLU A 23  ? 0.2447 0.2257 0.2188 0.0354  -0.0416 0.0434  23  GLU A O   
478  C CB  . GLU A 23  ? 0.2982 0.1931 0.2794 0.0948  0.0182  0.0064  23  GLU A CB  
479  C CG  . GLU A 23  ? 0.3006 0.2869 0.3729 0.1391  0.0859  0.0348  23  GLU A CG  
480  C CD  . GLU A 23  ? 0.3309 0.3167 0.4060 0.1432  0.1169  0.0270  23  GLU A CD  
481  O OE1 . GLU A 23  ? 0.6627 0.2562 0.6161 0.0543  0.1975  -0.0359 23  GLU A OE1 
482  O OE2 . GLU A 23  ? 0.3919 0.2821 0.4645 0.1201  0.0975  0.0314  23  GLU A OE2 
490  N N   . LEU A 24  ? 0.1991 0.2631 0.2017 0.0578  0.0072  0.0599  24  LEU A N   
491  C CA  . LEU A 24  ? 0.2076 0.1961 0.2163 0.1021  0.0083  0.0043  24  LEU A CA  
492  C C   . LEU A 24  ? 0.2695 0.2267 0.2183 0.0719  -0.0221 0.0645  24  LEU A C   
493  O O   . LEU A 24  ? 0.2375 0.3055 0.2405 0.1089  0.0195  0.0662  24  LEU A O   
494  C CB  . LEU A 24  ? 0.2668 0.2142 0.2058 0.0510  0.0106  0.0232  24  LEU A CB  
495  C CG  . LEU A 24  ? 0.2642 0.2173 0.1838 0.0517  -0.0093 -0.0074 24  LEU A CG  
496  C CD1 . LEU A 24  ? 0.3626 0.2295 0.2621 0.0755  -0.0139 -0.0119 24  LEU A CD1 
497  C CD2 . LEU A 24  ? 0.2517 0.2220 0.2869 0.0409  -0.0308 -0.0053 24  LEU A CD2 
509  N N   . PHE A 25  ? 0.1823 0.2548 0.2424 0.0974  0.0148  0.0629  25  PHE A N   
510  C CA  . PHE A 25  ? 0.1998 0.2513 0.3136 0.0954  -0.0233 0.0033  25  PHE A CA  
511  C C   . PHE A 25  ? 0.2514 0.2677 0.3744 0.1154  -0.0776 0.0614  25  PHE A C   
512  O O   . PHE A 25  ? 0.2707 0.3174 0.2936 0.1143  0.0166  0.1037  25  PHE A O   
513  C CB  . PHE A 25  ? 0.2396 0.2899 0.3264 0.0352  -0.0254 -0.0552 25  PHE A CB  
514  C CG  . PHE A 25  ? 0.3709 0.3106 0.2055 0.0965  0.0376  -0.0181 25  PHE A CG  
515  C CD1 . PHE A 25  ? 0.3486 0.4646 0.3196 -0.0712 0.0571  -0.0438 25  PHE A CD1 
516  C CD2 . PHE A 25  ? 0.2703 0.4120 0.3136 0.1051  -0.0494 -0.0738 25  PHE A CD2 
517  C CE1 . PHE A 25  ? 0.4907 0.4127 0.3446 0.0780  0.0382  -0.0334 25  PHE A CE1 
518  C CE2 . PHE A 25  ? 0.2669 0.4735 0.3979 0.1128  0.0798  -0.1226 25  PHE A CE2 
519  C CZ  . PHE A 25  ? 0.4967 0.3842 0.2969 -0.1051 0.1495  -0.0766 25  PHE A CZ  
529  N N   . ALA A 26  ? 0.2081 0.3205 0.3272 0.0905  0.0356  0.0760  26  ALA A N   
530  C CA  . ALA A 26  ? 0.3036 0.2966 0.3427 0.1068  0.0827  -0.0380 26  ALA A CA  
531  C C   . ALA A 26  ? 0.3757 0.2835 0.3312 0.0859  -0.1202 -0.0265 26  ALA A C   
532  O O   . ALA A 26  ? 0.2623 0.3237 0.4718 0.0574  0.0147  0.0303  26  ALA A O   
533  C CB  . ALA A 26  ? 0.2325 0.5020 0.3136 0.0795  0.0304  -0.0154 26  ALA A CB  
539  N N   . ASP A 27  ? 0.2816 0.3669 0.2985 0.2030  0.0258  0.0078  27  ASP A N   
540  C CA  . ASP A 27  ? 0.3055 0.3393 0.3946 0.2108  -0.0190 0.0478  27  ASP A CA  
541  C C   . ASP A 27  ? 0.3856 0.4564 0.3562 0.2399  -0.0294 0.0943  27  ASP A C   
542  O O   . ASP A 27  ? 0.3146 0.7359 0.4877 0.2060  0.1204  0.0992  27  ASP A O   
543  C CB  . ASP A 27  ? 0.6075 0.4993 0.6083 0.4269  0.0642  0.0158  27  ASP A CB  
544  C CG  . ASP A 27  ? 0.7218 0.4111 0.5503 0.2402  0.2948  -0.0069 27  ASP A CG  
545  O OD1 . ASP A 27  ? 0.4359 0.3207 0.3424 0.0572  0.0414  -0.0189 27  ASP A OD1 
546  O OD2 . ASP A 27  ? 0.8633 0.5182 0.8506 0.3118  0.1614  -0.1626 27  ASP A OD2 
551  N N   A LYS A 28  ? 0.2971 0.3154 0.2708 0.1307  0.0228  0.0525  28  LYS A N   
552  N N   B LYS A 28  ? 0.2756 0.3746 0.3224 0.1359  0.0343  0.0384  28  LYS A N   
553  C CA  A LYS A 28  ? 0.4320 0.2096 0.3103 0.1319  0.0633  0.0128  28  LYS A CA  
554  C CA  B LYS A 28  ? 0.4005 0.3228 0.3381 0.1454  0.1067  -0.0528 28  LYS A CA  
555  C C   A LYS A 28  ? 0.1642 0.5312 0.2717 0.1142  0.0682  -0.0239 28  LYS A C   
556  C C   B LYS A 28  ? 0.2348 0.4914 0.2867 0.1495  0.0011  -0.1890 28  LYS A C   
557  O O   A LYS A 28  ? 0.2679 0.3865 0.2390 0.0997  0.1117  -0.0009 28  LYS A O   
558  O O   B LYS A 28  ? 0.1337 0.5290 0.3707 0.1181  -0.1402 -0.0702 28  LYS A O   
559  C CB  A LYS A 28  ? 0.4709 0.4010 0.3542 -0.0361 -0.0657 0.0719  28  LYS A CB  
560  C CB  B LYS A 28  ? 0.4066 0.3155 0.4444 0.0542  -0.0267 0.0425  28  LYS A CB  
561  C CG  A LYS A 28  ? 0.5311 0.2978 0.5614 -0.0041 -0.0858 0.1505  28  LYS A CG  
562  C CG  B LYS A 28  ? 0.5739 0.4739 0.6465 -0.0567 -0.1197 0.0891  28  LYS A CG  
563  C CD  A LYS A 28  ? 0.7234 0.7080 0.8060 -0.0773 -0.2859 0.0835  28  LYS A CD  
564  C CD  B LYS A 28  ? 0.7407 0.6727 0.8194 -0.0290 -0.2920 0.0986  28  LYS A CD  
565  C CE  A LYS A 28  ? 0.7456 0.5700 0.9054 0.0649  -0.1636 -0.1464 28  LYS A CE  
566  C CE  B LYS A 28  ? 0.8529 0.7239 0.9756 0.0448  -0.1080 -0.1068 28  LYS A CE  
567  N NZ  A LYS A 28  ? 1.3247 1.0432 1.1634 0.0625  0.1159  0.1235  28  LYS A NZ  
568  N NZ  B LYS A 28  ? 1.3062 1.0622 1.2279 0.0588  0.1086  0.0643  28  LYS A NZ  
595  N N   A VAL A 29  ? 0.2192 0.2840 0.2911 0.1564  0.0379  0.0383  29  VAL A N   
596  N N   B VAL A 29  ? 0.1742 0.2793 0.3202 0.0800  -0.0104 -0.0315 29  VAL A N   
597  C CA  A VAL A 29  ? 0.1624 0.3356 0.2111 0.1348  -0.0754 -0.0383 29  VAL A CA  
598  C CA  B VAL A 29  ? 0.1176 0.2910 0.2778 0.0040  0.1352  0.1370  29  VAL A CA  
599  C C   A VAL A 29  ? 0.1292 0.3800 0.3091 0.0738  0.0241  0.0639  29  VAL A C   
600  C C   B VAL A 29  ? 0.1061 0.4053 0.2971 0.1022  -0.0701 0.1686  29  VAL A C   
601  O O   A VAL A 29  ? 0.1316 0.3253 0.2979 0.0833  0.0184  0.1352  29  VAL A O   
602  O O   B VAL A 29  ? 0.3009 0.2663 0.1083 0.0049  0.0132  -0.0518 29  VAL A O   
603  C CB  A VAL A 29  ? 0.1526 0.2622 0.3452 0.0866  0.0786  -0.0833 29  VAL A CB  
604  C CB  B VAL A 29  ? 0.2058 0.3394 0.3376 -0.0856 -0.1133 -0.0905 29  VAL A CB  
605  C CG1 A VAL A 29  ? 0.2364 0.3333 0.1768 0.0105  -0.0604 0.0581  29  VAL A CG1 
606  C CG1 B VAL A 29  ? 0.2732 0.5279 0.3596 0.0295  0.1428  -0.1072 29  VAL A CG1 
607  C CG2 A VAL A 29  ? 0.1771 0.3920 0.2914 -0.0130 -0.0025 0.1098  29  VAL A CG2 
608  C CG2 B VAL A 29  ? 0.2494 0.5288 0.4384 -0.0232 0.1810  0.1302  29  VAL A CG2 
625  N N   A PRO A 30  ? 0.1564 0.2804 0.2753 0.0571  0.0353  0.0404  30  PRO A N   
626  N N   B PRO A 30  ? 0.1086 0.3416 0.3364 0.1067  0.0365  -0.0598 30  PRO A N   
627  C CA  A PRO A 30  ? 0.1733 0.3421 0.2188 0.0920  -0.0570 -0.0615 30  PRO A CA  
628  C CA  B PRO A 30  ? 0.3316 0.3233 0.3462 0.1051  0.0896  -0.0077 30  PRO A CA  
629  C C   A PRO A 30  ? 0.1326 0.3787 0.1884 -0.0371 0.0186  0.0282  30  PRO A C   
630  C C   B PRO A 30  ? 0.2261 0.4334 0.2809 -0.0067 0.0010  -0.0113 30  PRO A C   
631  O O   A PRO A 30  ? 0.2393 0.3177 0.2146 0.0645  -0.0017 0.0288  30  PRO A O   
632  O O   B PRO A 30  ? 0.1516 0.4321 0.1990 0.0109  -0.0122 -0.0499 30  PRO A O   
633  C CB  A PRO A 30  ? 0.1784 0.4092 0.2912 0.0466  0.0132  -0.0563 30  PRO A CB  
634  C CB  B PRO A 30  ? 0.2046 0.3735 0.4601 0.1805  -0.1107 0.1639  30  PRO A CB  
635  C CG  A PRO A 30  ? 0.3116 0.4429 0.3042 0.1237  0.0632  0.0170  30  PRO A CG  
636  C CG  B PRO A 30  ? 0.0394 0.5011 0.3741 -0.0715 -0.0378 0.0509  30  PRO A CG  
637  C CD  A PRO A 30  ? 0.1964 0.3365 0.3037 0.0991  -0.0203 0.0566  30  PRO A CD  
638  C CD  B PRO A 30  ? 0.0566 0.4314 0.3672 0.1244  -0.0678 -0.0389 30  PRO A CD  
653  N N   . LYS A 31  ? 0.1533 0.3710 0.2301 0.0515  0.0036  0.0248  31  LYS A N   
654  C CA  . LYS A 31  ? 0.1247 0.4527 0.2079 -0.0056 -0.0097 0.0350  31  LYS A CA  
655  C C   . LYS A 31  ? 0.1331 0.3115 0.2119 -0.0223 -0.0332 0.0659  31  LYS A C   
656  O O   . LYS A 31  ? 0.2078 0.3422 0.2089 -0.0098 -0.0027 -0.0386 31  LYS A O   
657  C CB  . LYS A 31  ? 0.1687 0.4327 0.2526 -0.0183 -0.0005 0.0248  31  LYS A CB  
658  C CG  . LYS A 31  ? 0.2732 0.3198 0.2776 0.0134  0.0380  0.0560  31  LYS A CG  
659  C CD  . LYS A 31  ? 0.2925 0.3393 0.3469 -0.0454 0.0185  0.0693  31  LYS A CD  
660  C CE  . LYS A 31  ? 0.3580 0.4154 0.3089 -0.1375 0.0115  0.0613  31  LYS A CE  
661  N NZ  . LYS A 31  ? 0.2879 0.4443 0.3492 -0.1208 0.0161  -0.0102 31  LYS A NZ  
676  N N   . THR A 32  ? 0.1557 0.2412 0.2031 0.0073  -0.0216 0.0307  32  THR A N   
677  C CA  . THR A 32  ? 0.1295 0.2202 0.2294 0.0257  0.0117  0.0592  32  THR A CA  
678  C C   . THR A 32  ? 0.1748 0.2048 0.1956 0.0258  -0.0195 0.0247  32  THR A C   
679  O O   . THR A 32  ? 0.1734 0.2602 0.1850 0.0354  0.0083  -0.0098 32  THR A O   
680  C CB  . THR A 32  ? 0.2545 0.2103 0.1608 -0.0251 0.0049  0.0267  32  THR A CB  
681  O OG1 . THR A 32  ? 0.1742 0.2639 0.1901 0.0177  0.0007  0.0243  32  THR A OG1 
682  C CG2 . THR A 32  ? 0.1432 0.2900 0.2449 0.0232  -0.0186 0.0005  32  THR A CG2 
690  N N   . ALA A 33  ? 0.1697 0.2344 0.2059 0.0368  -0.0104 0.0276  33  ALA A N   
691  C CA  . ALA A 33  ? 0.1748 0.2158 0.2244 -0.0259 -0.0265 0.0222  33  ALA A CA  
692  C C   . ALA A 33  ? 0.1303 0.2414 0.2560 0.0244  -0.0564 -0.0118 33  ALA A C   
693  O O   . ALA A 33  ? 0.1770 0.2951 0.1966 0.0341  0.0230  0.0149  33  ALA A O   
694  C CB  . ALA A 33  ? 0.2916 0.2019 0.2505 0.0314  0.0049  0.0343  33  ALA A CB  
700  N N   . GLU A 34  ? 0.1608 0.2714 0.2128 0.0139  -0.0677 0.0178  34  GLU A N   
701  C CA  . GLU A 34  ? 0.1422 0.2613 0.2369 0.0101  -0.0447 0.0304  34  GLU A CA  
702  C C   . GLU A 34  ? 0.1780 0.2528 0.2105 0.0029  0.0053  0.0515  34  GLU A C   
703  O O   . GLU A 34  ? 0.1978 0.3219 0.1991 0.0074  -0.0150 0.0260  34  GLU A O   
704  C CB  . GLU A 34  ? 0.1564 0.3848 0.2261 -0.0002 -0.0135 0.0004  34  GLU A CB  
705  C CG  . GLU A 34  ? 0.1858 0.3654 0.3383 -0.0245 -0.0248 0.0082  34  GLU A CG  
706  C CD  . GLU A 34  ? 0.2004 0.4033 0.3058 0.0630  -0.0249 0.1040  34  GLU A CD  
707  O OE1 . GLU A 34  ? 0.2910 0.3971 0.2628 0.0391  -0.0562 0.0643  34  GLU A OE1 
708  O OE2 . GLU A 34  ? 0.4362 0.6309 0.2936 -0.0621 -0.0658 -0.0093 34  GLU A OE2 
715  N N   . ASN A 35  ? 0.1949 0.2553 0.1814 0.0054  -0.0201 0.0242  35  ASN A N   
716  C CA  . ASN A 35  ? 0.2023 0.2250 0.2022 0.0266  -0.0184 0.0225  35  ASN A CA  
717  C C   . ASN A 35  ? 0.1420 0.3063 0.1830 -0.0394 -0.0121 0.0458  35  ASN A C   
718  O O   . ASN A 35  ? 0.2148 0.2701 0.1801 -0.0106 -0.0066 -0.0062 35  ASN A O   
719  C CB  . ASN A 35  ? 0.1972 0.1897 0.2241 0.0013  -0.0008 0.0293  35  ASN A CB  
720  C CG  . ASN A 35  ? 0.1910 0.1771 0.1714 -0.0449 0.0005  -0.0054 35  ASN A CG  
721  O OD1 . ASN A 35  ? 0.2409 0.2179 0.2529 -0.0341 -0.0497 -0.0223 35  ASN A OD1 
722  N ND2 . ASN A 35  ? 0.1796 0.2718 0.2088 -0.0233 0.0133  -0.0197 35  ASN A ND2 
729  N N   . PHE A 36  ? 0.1701 0.2692 0.1709 -0.0250 -0.0312 0.0048  36  PHE A N   
730  C CA  . PHE A 36  ? 0.1531 0.2181 0.1846 -0.0126 0.0062  0.0023  36  PHE A CA  
731  C C   . PHE A 36  ? 0.1865 0.2383 0.1744 -0.0037 -0.0287 0.0441  36  PHE A C   
732  O O   . PHE A 36  ? 0.2032 0.2550 0.1605 -0.0159 -0.0010 0.0123  36  PHE A O   
733  C CB  . PHE A 36  ? 0.2615 0.2034 0.1893 -0.0618 -0.0348 0.0239  36  PHE A CB  
734  C CG  . PHE A 36  ? 0.1993 0.1462 0.1511 -0.0155 -0.0015 -0.0059 36  PHE A CG  
735  C CD1 . PHE A 36  ? 0.1896 0.2187 0.2206 0.0627  -0.0596 -0.0337 36  PHE A CD1 
736  C CD2 . PHE A 36  ? 0.2547 0.1556 0.1961 0.0114  0.0153  0.0230  36  PHE A CD2 
737  C CE1 . PHE A 36  ? 0.2167 0.2095 0.2408 0.0785  -0.0632 -0.0430 36  PHE A CE1 
738  C CE2 . PHE A 36  ? 0.3602 0.2344 0.2316 -0.1026 0.1300  -0.0399 36  PHE A CE2 
739  C CZ  . PHE A 36  ? 0.2131 0.3118 0.2996 0.0256  -0.0444 -0.0937 36  PHE A CZ  
749  N N   . ARG A 37  ? 0.1812 0.2485 0.1827 0.0166  -0.0277 0.0408  37  ARG A N   
750  C CA  . ARG A 37  ? 0.2005 0.2071 0.2295 0.0169  -0.0451 0.0456  37  ARG A CA  
751  C C   . ARG A 37  ? 0.2341 0.2487 0.2210 0.0073  -0.0204 0.0322  37  ARG A C   
752  O O   . ARG A 37  ? 0.2345 0.2511 0.1984 -0.0024 -0.0447 0.0237  37  ARG A O   
753  C CB  . ARG A 37  ? 0.1971 0.2495 0.1874 0.0448  -0.0223 0.0418  37  ARG A CB  
754  C CG  . ARG A 37  ? 0.2334 0.2509 0.2266 0.0487  -0.0193 0.0477  37  ARG A CG  
755  C CD  . ARG A 37  ? 0.2734 0.3221 0.2536 0.0879  -0.0211 0.0618  37  ARG A CD  
756  N NE  . ARG A 37  ? 0.2286 0.3675 0.2675 0.0529  -0.0658 0.0481  37  ARG A NE  
757  C CZ  . ARG A 37  ? 0.2581 0.4759 0.3188 -0.0690 -0.1262 0.0403  37  ARG A CZ  
758  N NH1 . ARG A 37  ? 0.3033 0.4981 0.2821 0.0110  -0.0557 0.0422  37  ARG A NH1 
759  N NH2 . ARG A 37  ? 0.2361 0.4789 0.2989 -0.0181 -0.0601 -0.0010 37  ARG A NH2 
773  N N   . ALA A 38  ? 0.2214 0.2614 0.1520 0.0148  -0.0142 0.0016  38  ALA A N   
774  C CA  . ALA A 38  ? 0.1827 0.2778 0.1991 0.0314  -0.0200 -0.0143 38  ALA A CA  
775  C C   . ALA A 38  ? 0.2256 0.2427 0.1459 -0.0396 -0.0581 0.0119  38  ALA A C   
776  O O   . ALA A 38  ? 0.2756 0.2850 0.1796 -0.0292 -0.0724 -0.0225 38  ALA A O   
777  C CB  . ALA A 38  ? 0.2215 0.3338 0.2498 -0.0374 -0.0165 -0.0076 38  ALA A CB  
783  N N   . LEU A 39  ? 0.2245 0.2824 0.1610 -0.0048 -0.0429 -0.0131 39  LEU A N   
784  C CA  . LEU A 39  ? 0.2166 0.2105 0.1873 -0.0037 0.0186  0.0007  39  LEU A CA  
785  C C   . LEU A 39  ? 0.2123 0.2138 0.1280 0.0070  -0.0361 0.0016  39  LEU A C   
786  O O   . LEU A 39  ? 0.2470 0.2203 0.1787 -0.0132 0.0340  -0.0220 39  LEU A O   
787  C CB  . LEU A 39  ? 0.2377 0.2085 0.1837 -0.0118 -0.0269 0.0251  39  LEU A CB  
788  C CG  . LEU A 39  ? 0.3105 0.1549 0.2139 -0.0489 -0.0429 -0.0064 39  LEU A CG  
789  C CD1 . LEU A 39  ? 0.2342 0.2800 0.1897 -0.0669 -0.0236 0.0179  39  LEU A CD1 
790  C CD2 . LEU A 39  ? 0.2612 0.2222 0.2364 -0.0701 -0.0199 0.0427  39  LEU A CD2 
802  N N   . SER A 40  ? 0.2271 0.1852 0.2003 -0.0150 -0.0319 -0.0081 40  SER A N   
803  C CA  . SER A 40  ? 0.2512 0.1705 0.2098 -0.0378 -0.0598 -0.0016 40  SER A CA  
804  C C   . SER A 40  ? 0.1803 0.2448 0.2279 0.0169  -0.0798 -0.0047 40  SER A C   
805  O O   . SER A 40  ? 0.2505 0.4045 0.2116 -0.0218 0.0097  0.0198  40  SER A O   
806  C CB  . SER A 40  ? 0.2451 0.2258 0.1777 -0.0150 -0.0576 0.0235  40  SER A CB  
807  O OG  . SER A 40  ? 0.2662 0.2398 0.2160 0.0141  -0.0357 -0.0039 40  SER A OG  
813  N N   . THR A 41  ? 0.2217 0.3064 0.1889 -0.0106 -0.0518 0.0056  41  THR A N   
814  C CA  . THR A 41  ? 0.2067 0.3540 0.1843 -0.1125 -0.0566 0.0445  41  THR A CA  
815  C C   . THR A 41  ? 0.2118 0.3143 0.3836 -0.0836 -0.0260 -0.0473 41  THR A C   
816  O O   . THR A 41  ? 0.5178 0.3684 0.2746 -0.0191 -0.0626 -0.0542 41  THR A O   
817  C CB  . THR A 41  ? 0.2496 0.4865 0.1960 -0.1056 -0.0555 -0.0070 41  THR A CB  
818  O OG1 . THR A 41  ? 0.2169 0.3826 0.2397 0.0102  -0.0333 0.0265  41  THR A OG1 
819  C CG2 . THR A 41  ? 0.2910 0.3999 0.2969 -0.0418 -0.0612 -0.0229 41  THR A CG2 
827  N N   . GLY A 42  ? 0.2892 0.3251 0.2323 -0.0427 -0.0012 -0.0169 42  GLY A N   
828  C CA  . GLY A 42  ? 0.2965 0.3403 0.2467 0.0251  -0.0677 -0.0288 42  GLY A CA  
829  C C   . GLY A 42  ? 0.2272 0.4209 0.2212 0.0566  -0.0353 -0.0514 42  GLY A C   
830  O O   . GLY A 42  ? 0.3305 0.4549 0.3277 -0.0595 0.0094  -0.1358 42  GLY A O   
834  N N   . GLU A 43  ? 0.2337 0.2979 0.3263 -0.0321 -0.0599 -0.0434 43  GLU A N   
835  C CA  . GLU A 43  ? 0.1599 0.5828 0.3286 -0.0583 -0.0252 -0.0556 43  GLU A CA  
836  C C   . GLU A 43  ? 0.1936 0.6284 0.5324 -0.1691 0.0008  -0.1494 43  GLU A C   
837  O O   . GLU A 43  ? 0.3330 0.5069 0.5053 -0.1051 -0.1392 -0.0798 43  GLU A O   
838  C CB  . GLU A 43  ? 0.2656 0.6070 0.2610 0.0138  -0.0192 -0.0362 43  GLU A CB  
839  C CG  . GLU A 43  ? 0.2312 0.6336 0.3910 -0.1075 -0.0095 0.0190  43  GLU A CG  
840  C CD  . GLU A 43  ? 0.6301 0.7606 0.3666 -0.0762 -0.1626 -0.1268 43  GLU A CD  
841  O OE1 . GLU A 43  ? 0.2694 0.5464 0.3973 0.0481  -0.0414 -0.0689 43  GLU A OE1 
842  O OE2 . GLU A 43  ? 0.3063 0.5443 0.4971 -0.0515 0.0089  -0.0287 43  GLU A OE2 
849  N N   . LYS A 44  ? 0.3250 0.3788 0.4927 -0.0375 -0.1116 -0.1103 44  LYS A N   
850  C CA  . LYS A 44  ? 0.5292 0.3922 0.5139 -0.1082 -0.2071 -0.1539 44  LYS A CA  
851  C C   . LYS A 44  ? 0.5081 0.5427 0.2870 -0.3624 -0.0372 0.0331  44  LYS A C   
852  O O   . LYS A 44  ? 0.3063 0.4932 0.4986 -0.1681 -0.0776 0.0571  44  LYS A O   
853  C CB  . LYS A 44  ? 0.5712 0.5041 0.3419 -0.2728 -0.0212 -0.0187 44  LYS A CB  
854  C CG  . LYS A 44  ? 0.5490 0.4964 0.4770 -0.1217 0.0072  0.0595  44  LYS A CG  
855  C CD  . LYS A 44  ? 0.4085 0.8692 0.7625 0.1286  -0.1572 -0.1695 44  LYS A CD  
856  C CE  . LYS A 44  ? 0.6182 1.0208 0.8305 0.6335  -0.1128 -0.2100 44  LYS A CE  
857  N NZ  . LYS A 44  ? 0.5494 1.1635 0.9960 0.2911  0.2744  -0.0311 44  LYS A NZ  
871  N N   . GLY A 45  ? 0.3769 0.4064 0.2491 -0.0739 -0.0515 -0.0659 45  GLY A N   
872  C CA  . GLY A 45  ? 0.4028 0.6362 0.5156 0.0432  -0.2189 -0.3823 45  GLY A CA  
873  C C   . GLY A 45  ? 0.6924 0.4207 0.3605 -0.2468 -0.1718 -0.1845 45  GLY A C   
874  O O   . GLY A 45  ? 0.5066 0.3971 0.5005 -0.0156 -0.1357 -0.1947 45  GLY A O   
878  N N   . PHE A 46  ? 0.3237 0.3175 0.3217 -0.1424 -0.0468 -0.1190 46  PHE A N   
879  C CA  . PHE A 46  ? 0.3702 0.2737 0.2812 -0.1944 -0.0278 -0.1156 46  PHE A CA  
880  C C   . PHE A 46  ? 0.2187 0.2229 0.2716 -0.0354 -0.0641 -0.0389 46  PHE A C   
881  O O   . PHE A 46  ? 0.2276 0.2724 0.3098 0.0003  -0.0381 -0.0744 46  PHE A O   
882  C CB  . PHE A 46  ? 0.4038 0.2905 0.3232 -0.0701 0.0178  -0.0740 46  PHE A CB  
883  C CG  . PHE A 46  ? 0.4342 0.2586 0.2718 -0.0234 -0.1004 -0.0884 46  PHE A CG  
884  C CD1 . PHE A 46  ? 0.3905 0.3514 0.3339 -0.1263 -0.0962 -0.0710 46  PHE A CD1 
885  C CD2 . PHE A 46  ? 0.3418 0.2544 0.2643 -0.0786 -0.0185 -0.0219 46  PHE A CD2 
886  C CE1 . PHE A 46  ? 0.4521 0.5035 0.3449 -0.2000 0.0589  -0.0718 46  PHE A CE1 
887  C CE2 . PHE A 46  ? 0.4319 0.3505 0.3338 -0.1355 -0.0410 -0.0722 46  PHE A CE2 
888  C CZ  . PHE A 46  ? 0.4842 0.4766 0.3295 -0.1182 0.0394  -0.0887 46  PHE A CZ  
898  N N   . GLY A 47  ? 0.2875 0.1817 0.2598 -0.0731 -0.0222 -0.0456 47  GLY A N   
899  C CA  . GLY A 47  ? 0.2222 0.2110 0.2938 -0.0871 0.0082  -0.0924 47  GLY A CA  
900  C C   . GLY A 47  ? 0.2314 0.1690 0.2059 -0.0923 -0.0292 -0.0245 47  GLY A C   
901  O O   . GLY A 47  ? 0.2865 0.1962 0.2428 0.0094  -0.0199 -0.0265 47  GLY A O   
905  N N   . TYR A 48  ? 0.1939 0.2008 0.1815 -0.0586 -0.0206 -0.0151 48  TYR A N   
906  C CA  . TYR A 48  ? 0.2314 0.1619 0.1337 -0.0304 0.0014  -0.0215 48  TYR A CA  
907  C C   . TYR A 48  ? 0.2503 0.1607 0.1086 -0.0167 -0.0126 0.0116  48  TYR A C   
908  O O   . TYR A 48  ? 0.2267 0.2090 0.1414 -0.0124 -0.0040 -0.0192 48  TYR A O   
909  C CB  . TYR A 48  ? 0.2281 0.1929 0.1619 -0.0055 0.0113  -0.0297 48  TYR A CB  
910  C CG  . TYR A 48  ? 0.2047 0.1652 0.1433 -0.0232 -0.0058 -0.0191 48  TYR A CG  
911  C CD1 . TYR A 48  ? 0.2164 0.1879 0.1430 0.0005  0.0099  0.0061  48  TYR A CD1 
912  C CD2 . TYR A 48  ? 0.2569 0.1841 0.1579 0.0103  0.0297  -0.0312 48  TYR A CD2 
913  C CE1 . TYR A 48  ? 0.1808 0.1963 0.1760 -0.0246 -0.0220 0.0058  48  TYR A CE1 
914  C CE2 . TYR A 48  ? 0.2284 0.1897 0.1442 0.0288  -0.0259 -0.0301 48  TYR A CE2 
915  C CZ  . TYR A 48  ? 0.2117 0.2071 0.1139 -0.0136 0.0070  -0.0178 48  TYR A CZ  
916  O OH  . TYR A 48  ? 0.2178 0.1917 0.1597 -0.0040 0.0054  -0.0075 48  TYR A OH  
926  N N   . LYS A 49  ? 0.2628 0.2048 0.1026 -0.0061 0.0019  -0.0038 49  LYS A N   
927  C CA  . LYS A 49  ? 0.2841 0.2124 0.0927 -0.0134 0.0137  -0.0106 49  LYS A CA  
928  C C   . LYS A 49  ? 0.2239 0.2176 0.1549 0.0008  0.0048  -0.0594 49  LYS A C   
929  O O   . LYS A 49  ? 0.3155 0.1648 0.2397 -0.0413 0.0409  -0.0433 49  LYS A O   
930  C CB  . LYS A 49  ? 0.4380 0.2298 0.0735 -0.0178 -0.0239 -0.0175 49  LYS A CB  
931  C CG  . LYS A 49  ? 0.3575 0.2813 0.1074 -0.0175 -0.0429 -0.0012 49  LYS A CG  
932  C CD  . LYS A 49  ? 0.5509 0.3955 0.1445 -0.0175 0.0233  0.0125  49  LYS A CD  
933  C CE  . LYS A 49  ? 0.5367 0.4622 0.2013 0.0000  -0.0931 -0.0077 49  LYS A CE  
934  N NZ  . LYS A 49  ? 0.8138 0.9735 0.3293 -0.0847 -0.1398 0.1186  49  LYS A NZ  
948  N N   . GLY A 50  ? 0.2504 0.1737 0.1611 -0.0046 0.0075  -0.0154 50  GLY A N   
949  C CA  . GLY A 50  ? 0.2494 0.1950 0.1338 -0.0054 -0.0024 -0.0162 50  GLY A CA  
950  C C   . GLY A 50  ? 0.2344 0.1796 0.1718 -0.0090 -0.0047 -0.0344 50  GLY A C   
951  O O   . GLY A 50  ? 0.3020 0.2446 0.2548 0.0591  0.0371  -0.0106 50  GLY A O   
955  N N   . SER A 51  ? 0.2479 0.1513 0.1710 -0.0084 0.0256  -0.0271 51  SER A N   
956  C CA  . SER A 51  ? 0.2545 0.1622 0.1749 -0.0329 0.0027  0.0420  51  SER A CA  
957  C C   . SER A 51  ? 0.2295 0.1449 0.1357 -0.0372 0.0222  -0.0080 51  SER A C   
958  O O   . SER A 51  ? 0.2643 0.1421 0.2072 -0.0284 -0.0061 0.0205  51  SER A O   
959  C CB  . SER A 51  ? 0.2772 0.1693 0.1813 -0.0566 0.0017  0.0415  51  SER A CB  
960  O OG  . SER A 51  ? 0.2767 0.1749 0.1826 0.0170  0.0087  -0.0048 51  SER A OG  
966  N N   . CYS A 52  ? 0.2728 0.1993 0.1241 0.0138  -0.0276 0.0070  52  CYS A N   
967  C CA  . CYS A 52  ? 0.2098 0.2643 0.1661 -0.0082 -0.0496 0.0008  52  CYS A CA  
968  C C   . CYS A 52  ? 0.2776 0.1827 0.1522 0.0146  -0.0413 0.0261  52  CYS A C   
969  O O   . CYS A 52  ? 0.2587 0.2066 0.1832 -0.0460 0.0248  -0.0081 52  CYS A O   
970  C CB  . CYS A 52  ? 0.2650 0.2560 0.1964 -0.0025 -0.0213 -0.0478 52  CYS A CB  
971  S SG  . CYS A 52  ? 0.3574 0.2390 0.2549 0.0599  -0.0043 0.0000  52  CYS A SG  
977  N N   . PHE A 53  ? 0.2434 0.1785 0.1577 -0.0041 0.0441  -0.0100 53  PHE A N   
978  C CA  . PHE A 53  ? 0.1891 0.2210 0.1475 0.0022  0.0138  -0.0400 53  PHE A CA  
979  C C   . PHE A 53  ? 0.1990 0.2007 0.1544 0.0025  -0.0078 -0.0377 53  PHE A C   
980  O O   . PHE A 53  ? 0.2181 0.2733 0.2736 0.0364  0.0321  0.0417  53  PHE A O   
981  C CB  . PHE A 53  ? 0.2492 0.2044 0.2155 0.0277  -0.0328 -0.0240 53  PHE A CB  
982  C CG  . PHE A 53  ? 0.2342 0.2143 0.1573 -0.0290 -0.0070 0.0007  53  PHE A CG  
983  C CD1 . PHE A 53  ? 0.2914 0.2240 0.2045 0.0017  -0.0125 -0.0313 53  PHE A CD1 
984  C CD2 . PHE A 53  ? 0.2999 0.1567 0.1551 0.0132  0.0324  0.0098  53  PHE A CD2 
985  C CE1 . PHE A 53  ? 0.2837 0.2666 0.1722 -0.0469 -0.0275 0.0267  53  PHE A CE1 
986  C CE2 . PHE A 53  ? 0.3753 0.1680 0.2214 0.0149  0.0628  0.0032  53  PHE A CE2 
987  C CZ  . PHE A 53  ? 0.2510 0.2390 0.2258 0.0016  0.0120  0.0490  53  PHE A CZ  
997  N N   . HIS A 54  ? 0.1770 0.1629 0.1910 0.0112  0.0243  -0.0067 54  HIS A N   
998  C CA  . HIS A 54  ? 0.2165 0.1740 0.2425 0.0285  -0.0009 0.0060  54  HIS A CA  
999  C C   . HIS A 54  ? 0.2968 0.1759 0.1530 -0.0053 -0.0166 -0.0051 54  HIS A C   
1000 O O   . HIS A 54  ? 0.2743 0.2192 0.2772 0.0961  -0.0726 -0.0254 54  HIS A O   
1001 C CB  . HIS A 54  ? 0.2325 0.2249 0.2640 0.0215  -0.0259 0.0159  54  HIS A CB  
1002 C CG  . HIS A 54  ? 0.2862 0.1541 0.2417 -0.0590 -0.0115 0.0339  54  HIS A CG  
1003 N ND1 . HIS A 54  ? 0.2452 0.2356 0.2359 -0.0333 0.0157  0.0067  54  HIS A ND1 
1004 C CD2 . HIS A 54  ? 0.3377 0.1800 0.2270 -0.0669 -0.0379 0.0510  54  HIS A CD2 
1005 C CE1 . HIS A 54  ? 0.3233 0.1903 0.3343 -0.0436 0.1170  0.0226  54  HIS A CE1 
1006 N NE2 . HIS A 54  ? 0.3630 0.2117 0.2713 -0.0226 -0.0038 -0.0250 54  HIS A NE2 
1013 N N   A ARG A 55  ? 0.2451 0.1996 0.1430 0.0234  0.0406  -0.0631 55  ARG A N   
1014 N N   B ARG A 55  ? 0.2903 0.1222 0.2749 -0.0474 -0.0914 0.0112  55  ARG A N   
1015 C CA  A ARG A 55  ? 0.1746 0.1958 0.2399 0.1336  0.0332  0.0433  55  ARG A CA  
1016 C CA  B ARG A 55  ? 0.3409 0.1591 0.1843 -0.0447 0.0286  -0.0957 55  ARG A CA  
1017 C C   A ARG A 55  ? 0.4334 0.0649 0.2542 0.0770  -0.1118 -0.0790 55  ARG A C   
1018 C C   B ARG A 55  ? 0.2086 0.2713 0.1090 0.0401  0.0122  0.1224  55  ARG A C   
1019 O O   A ARG A 55  ? 0.2742 0.1927 0.1629 -0.0064 -0.0671 -0.0101 55  ARG A O   
1020 O O   B ARG A 55  ? 0.1146 0.0814 0.5289 0.0814  0.0022  0.0507  55  ARG A O   
1021 C CB  A ARG A 55  ? 0.3673 0.1867 0.1842 -0.0342 -0.0996 0.0071  55  ARG A CB  
1022 C CB  B ARG A 55  ? 0.2518 0.4349 0.2930 0.0946  0.1637  0.0848  55  ARG A CB  
1023 C CG  A ARG A 55  ? 0.3547 0.1976 0.2692 -0.0044 -0.1435 0.0337  55  ARG A CG  
1024 C CG  B ARG A 55  ? 0.3267 0.5570 0.3816 0.0497  0.2793  0.1029  55  ARG A CG  
1025 C CD  A ARG A 55  ? 0.3254 0.3875 0.3604 0.0446  0.0128  0.1841  55  ARG A CD  
1026 C CD  B ARG A 55  ? 0.5122 0.5824 0.0920 -0.2441 0.0593  -0.0508 55  ARG A CD  
1027 N NE  A ARG A 55  ? 0.8385 0.3872 0.6479 -0.2467 0.0099  0.2463  55  ARG A NE  
1028 N NE  B ARG A 55  ? 0.7544 0.3878 0.4759 -0.1613 0.2179  -0.0784 55  ARG A NE  
1029 C CZ  A ARG A 55  ? 0.8691 0.9085 0.8304 -0.2131 -0.3322 -0.0269 55  ARG A CZ  
1030 C CZ  B ARG A 55  ? 0.7339 0.3536 0.6708 -0.1635 0.1665  0.1191  55  ARG A CZ  
1031 N NH1 A ARG A 55  ? 1.1336 1.1702 1.1831 -0.1908 -0.0085 -0.2875 55  ARG A NH1 
1032 N NH1 B ARG A 55  ? 0.9171 0.8307 0.9831 0.0622  0.1069  0.1098  55  ARG A NH1 
1033 N NH2 A ARG A 55  ? 1.1089 1.0456 0.9601 -0.2772 -0.1191 0.0194  55  ARG A NH2 
1034 N NH2 B ARG A 55  ? 0.4851 0.2736 0.1870 -0.1619 -0.0474 0.0372  55  ARG A NH2 
1061 N N   . ILE A 56  ? 0.1841 0.1829 0.1889 -0.0078 0.0020  -0.0294 56  ILE A N   
1062 C CA  . ILE A 56  ? 0.1433 0.2092 0.1701 -0.0252 0.0089  -0.0224 56  ILE A CA  
1063 C C   . ILE A 56  ? 0.1864 0.1650 0.1722 -0.0020 0.0019  -0.0185 56  ILE A C   
1064 O O   . ILE A 56  ? 0.1503 0.2597 0.1986 0.0244  -0.0038 -0.0049 56  ILE A O   
1065 C CB  . ILE A 56  ? 0.1966 0.1945 0.2058 -0.0321 0.0154  -0.0097 56  ILE A CB  
1066 C CG1 . ILE A 56  ? 0.2183 0.2450 0.2291 0.0346  -0.0562 -0.0292 56  ILE A CG1 
1067 C CG2 . ILE A 56  ? 0.1945 0.2655 0.2458 -0.0104 -0.0373 0.0075  56  ILE A CG2 
1068 C CD1 . ILE A 56  ? 0.3313 0.3016 0.1858 0.0373  -0.0008 0.0696  56  ILE A CD1 
1081 N N   . ILE A 57  ? 0.1686 0.1996 0.1627 0.0210  -0.0501 -0.0130 57  ILE A N   
1082 C CA  . ILE A 57  ? 0.1769 0.2381 0.1736 0.0417  -0.0036 0.0258  57  ILE A CA  
1083 C C   . ILE A 57  ? 0.1664 0.2567 0.1991 0.0113  -0.0092 0.0291  57  ILE A C   
1084 O O   . ILE A 57  ? 0.1843 0.2361 0.1980 -0.0170 -0.0236 -0.0088 57  ILE A O   
1085 C CB  . ILE A 57  ? 0.2136 0.2144 0.1644 -0.0093 -0.0594 -0.0288 57  ILE A CB  
1086 C CG1 . ILE A 57  ? 0.2432 0.2532 0.2142 0.0060  -0.0004 0.0225  57  ILE A CG1 
1087 C CG2 . ILE A 57  ? 0.2758 0.2411 0.2147 -0.0013 -0.0480 -0.0171 57  ILE A CG2 
1088 C CD1 . ILE A 57  ? 0.4157 0.2603 0.2572 0.0477  -0.0162 0.0140  57  ILE A CD1 
1100 N N   . PRO A 58  ? 0.1607 0.2609 0.2041 -0.0544 0.0187  0.0016  58  PRO A N   
1101 C CA  . PRO A 58  ? 0.1659 0.2582 0.2499 -0.0865 0.0121  0.0399  58  PRO A CA  
1102 C C   . PRO A 58  ? 0.2322 0.2375 0.2160 -0.0377 -0.0069 0.0123  58  PRO A C   
1103 O O   . PRO A 58  ? 0.2528 0.2925 0.2303 -0.0380 -0.0247 0.0244  58  PRO A O   
1104 C CB  . PRO A 58  ? 0.3049 0.2480 0.2923 -0.0682 0.0340  0.0102  58  PRO A CB  
1105 C CG  . PRO A 58  ? 0.1879 0.3971 0.2202 0.0113  0.0095  0.0476  58  PRO A CG  
1106 C CD  . PRO A 58  ? 0.2172 0.3685 0.1946 -0.0843 0.0416  -0.0238 58  PRO A CD  
1114 N N   . GLY A 59  ? 0.2521 0.2089 0.2652 -0.0532 0.0030  -0.0359 59  GLY A N   
1115 C CA  . GLY A 59  ? 0.2518 0.2227 0.3468 -0.1050 0.0036  -0.0959 59  GLY A CA  
1116 C C   . GLY A 59  ? 0.2157 0.2316 0.3966 -0.0693 -0.0339 -0.1795 59  GLY A C   
1117 O O   . GLY A 59  ? 0.3267 0.3019 0.3089 -0.0732 0.0150  -0.1506 59  GLY A O   
1121 N N   A PHE A 60  ? 0.1296 0.2235 0.2504 -0.0525 -0.0087 0.0820  60  PHE A N   
1122 N N   B PHE A 60  ? 0.3481 0.3365 0.1476 -0.1214 0.0166  -0.1881 60  PHE A N   
1123 C CA  A PHE A 60  ? 0.1674 0.2146 0.1495 -0.0393 -0.0653 -0.0240 60  PHE A CA  
1124 C CA  B PHE A 60  ? 0.2726 0.1929 0.2090 -0.1154 0.0060  0.0045  60  PHE A CA  
1125 C C   A PHE A 60  ? 0.1921 0.2075 0.0611 -0.0628 0.0444  -0.0871 60  PHE A C   
1126 C C   B PHE A 60  ? 0.3096 0.0900 0.2820 0.1445  0.0775  0.0670  60  PHE A C   
1127 O O   A PHE A 60  ? 0.1432 0.1489 0.0956 0.0502  0.0192  -0.0163 60  PHE A O   
1128 O O   B PHE A 60  ? 0.4729 0.1831 0.1563 -0.1381 0.0614  0.0090  60  PHE A O   
1129 C CB  A PHE A 60  ? 0.2669 0.1970 0.1611 -0.0173 -0.0430 0.0286  60  PHE A CB  
1130 C CB  B PHE A 60  ? 0.3086 0.3677 0.1411 -0.1713 0.1803  -0.1545 60  PHE A CB  
1131 C CG  A PHE A 60  ? 0.1800 0.2711 0.1351 0.0488  -0.0141 0.0604  60  PHE A CG  
1132 C CG  B PHE A 60  ? 0.3506 0.3770 0.3180 -0.1577 -0.0947 -0.2472 60  PHE A CG  
1133 C CD1 A PHE A 60  ? 0.2843 0.1379 0.2337 -0.0992 0.0423  0.0754  60  PHE A CD1 
1134 C CD1 B PHE A 60  ? 0.2039 0.5442 0.2199 0.0628  -0.1246 -0.1399 60  PHE A CD1 
1135 C CD2 A PHE A 60  ? 0.3116 0.1436 0.1172 -0.0006 -0.0308 0.0211  60  PHE A CD2 
1136 C CD2 B PHE A 60  ? 0.3487 0.3655 0.3822 0.0090  -0.0174 -0.1032 60  PHE A CD2 
1137 C CE1 A PHE A 60  ? 0.2724 0.1316 0.2101 0.0465  -0.0376 0.0390  60  PHE A CE1 
1138 C CE1 B PHE A 60  ? 0.5118 0.3825 0.3712 0.2031  -0.1893 0.1076  60  PHE A CE1 
1139 C CE2 A PHE A 60  ? 0.2369 0.1498 0.2419 -0.0233 -0.1088 0.0706  60  PHE A CE2 
1140 C CE2 B PHE A 60  ? 0.3821 0.3202 0.2888 0.0314  -0.2504 0.0504  60  PHE A CE2 
1141 C CZ  A PHE A 60  ? 0.1567 0.2547 0.1974 -0.0054 0.0296  0.0944  60  PHE A CZ  
1142 C CZ  B PHE A 60  ? 0.4241 0.4456 0.4443 0.2881  -0.0935 0.2506  60  PHE A CZ  
1161 N N   A MET A 61  ? 0.1231 0.1208 0.1055 0.0057  0.0177  0.0069  61  MET A N   
1162 N N   B MET A 61  ? 0.3033 0.5030 0.1668 -0.0960 -0.1780 -0.0881 61  MET A N   
1163 C CA  A MET A 61  ? 0.2011 0.1145 0.1418 -0.0348 0.0410  0.0175  61  MET A CA  
1164 C CA  B MET A 61  ? 0.3885 0.1797 0.0916 0.0676  -0.1244 -0.0865 61  MET A CA  
1165 C C   A MET A 61  ? 0.1930 0.3099 0.1011 -0.2128 -0.0201 -0.0501 61  MET A C   
1166 C C   B MET A 61  ? 0.1464 0.0942 0.3941 0.1014  -0.0456 0.0062  61  MET A C   
1167 O O   A MET A 61  ? 0.1044 0.1800 0.1627 -0.0438 -0.0292 0.0054  61  MET A O   
1168 O O   B MET A 61  ? 0.3352 0.4489 0.3689 0.1784  -0.0692 -0.2103 61  MET A O   
1169 C CB  A MET A 61  ? 0.2957 0.1844 0.1662 -0.0513 0.0406  0.0043  61  MET A CB  
1170 C CB  B MET A 61  ? 0.2591 0.1322 0.2732 -0.0946 -0.1724 0.1092  61  MET A CB  
1171 C CG  A MET A 61  ? 0.5113 0.2381 0.1690 -0.2879 -0.0373 -0.0733 61  MET A CG  
1172 C CG  B MET A 61  ? 0.2222 0.2209 0.2748 -0.0450 0.0909  0.1473  61  MET A CG  
1173 S SD  A MET A 61  ? 0.6068 0.2668 1.0401 -0.0213 -0.6164 0.0300  61  MET A SD  
1174 S SD  B MET A 61  ? 1.0453 0.2199 0.1909 0.1017  0.0276  -0.0098 61  MET A SD  
1175 C CE  A MET A 61  ? 0.9018 0.9958 1.0052 0.2351  -0.4304 -0.2464 61  MET A CE  
1176 C CE  B MET A 61  ? 0.7073 0.3657 0.7682 0.0700  0.6548  0.2935  61  MET A CE  
1195 N N   A CYS A 62  ? 0.1171 0.1598 0.1214 0.0382  -0.0446 -0.0676 62  CYS A N   
1196 N N   B CYS A 62  ? 0.1832 0.1128 0.4230 -0.1307 0.0476  -0.0863 62  CYS A N   
1197 C CA  A CYS A 62  ? 0.1255 0.1109 0.1608 -0.0299 0.0032  -0.0385 62  CYS A CA  
1198 C CA  B CYS A 62  ? 0.5156 0.1778 0.1485 -0.1289 -0.1785 0.0210  62  CYS A CA  
1199 C C   A CYS A 62  ? 0.1867 0.0750 0.0815 -0.0670 -0.0005 0.0025  62  CYS A C   
1200 C C   B CYS A 62  ? 0.3571 0.3557 0.2117 0.1572  -0.1107 0.1622  62  CYS A C   
1201 O O   A CYS A 62  ? 0.1088 0.1842 0.2131 0.0258  0.0411  -0.0841 62  CYS A O   
1202 O O   B CYS A 62  ? 0.5131 0.0737 0.0536 0.0268  -0.0727 -0.0019 62  CYS A O   
1203 C CB  A CYS A 62  ? 0.1365 0.1256 0.1437 0.0603  -0.0045 -0.0261 62  CYS A CB  
1204 C CB  B CYS A 62  ? 0.5097 0.6125 0.3657 0.5409  -0.2416 -0.2574 62  CYS A CB  
1205 S SG  A CYS A 62  ? 0.1718 0.1329 0.1621 -0.0368 0.0094  0.0424  62  CYS A SG  
1206 S SG  B CYS A 62  ? 1.2554 0.6999 0.3986 0.0373  -0.0784 -0.1681 62  CYS A SG  
1217 N N   A GLN A 63  ? 0.2000 0.0995 0.2192 -0.0792 -0.0447 -0.0416 63  GLN A N   
1218 N N   B GLN A 63  ? 0.1113 0.2869 0.0991 0.1097  0.0472  0.1557  63  GLN A N   
1219 C CA  A GLN A 63  ? 0.1113 0.1160 0.2723 0.0069  -0.0647 -0.0520 63  GLN A CA  
1220 C CA  B GLN A 63  ? 0.3721 0.0915 0.1092 0.0266  0.1758  -0.0124 63  GLN A CA  
1221 C C   A GLN A 63  ? 0.3736 0.1147 0.1222 0.0096  0.0848  -0.0408 63  GLN A C   
1222 C C   B GLN A 63  ? 0.0342 0.1022 0.2097 -0.0491 -0.0204 0.0070  63  GLN A C   
1223 O O   A GLN A 63  ? 0.3407 0.1085 0.1198 -0.0221 0.0499  -0.0403 63  GLN A O   
1224 O O   B GLN A 63  ? 0.0241 0.3168 0.2176 0.0666  -0.0108 -0.0137 63  GLN A O   
1225 C CB  A GLN A 63  ? 0.1244 0.1890 0.2034 0.0418  -0.0115 -0.0448 63  GLN A CB  
1226 C CB  B GLN A 63  ? 0.3765 0.0755 0.1705 -0.0359 0.1366  0.0587  63  GLN A CB  
1227 C CG  A GLN A 63  ? 0.1813 0.1990 0.1624 -0.0203 -0.0018 0.1117  63  GLN A CG  
1228 C CG  B GLN A 63  ? 0.5284 0.2544 0.2569 -0.1533 0.1792  -0.1998 63  GLN A CG  
1229 C CD  A GLN A 63  ? 0.2668 0.3184 0.2911 0.0929  0.0598  0.0182  63  GLN A CD  
1230 C CD  B GLN A 63  ? 0.4692 0.1806 0.1162 -0.1291 0.0716  -0.0232 63  GLN A CD  
1231 O OE1 A GLN A 63  ? 0.4323 0.2573 0.2445 -0.1262 -0.0791 0.0670  63  GLN A OE1 
1232 O OE1 B GLN A 63  ? 0.3773 0.2890 0.1541 0.1225  -0.0852 -0.0459 63  GLN A OE1 
1233 N NE2 A GLN A 63  ? 0.2328 0.2820 0.2501 0.0117  0.0179  0.1636  63  GLN A NE2 
1234 N NE2 B GLN A 63  ? 0.3662 0.2411 0.2433 0.2107  -0.1837 -0.0884 63  GLN A NE2 
1251 N N   . GLY A 64  ? 0.1471 0.1322 0.1753 -0.0307 0.0038  -0.0167 64  GLY A N   
1252 C CA  . GLY A 64  ? 0.1614 0.1654 0.1610 -0.0425 -0.0113 -0.0343 64  GLY A CA  
1253 C C   . GLY A 64  ? 0.1697 0.0806 0.1747 -0.0156 -0.0503 -0.0135 64  GLY A C   
1254 O O   . GLY A 64  ? 0.2230 0.1690 0.1489 -0.0142 0.0346  -0.0186 64  GLY A O   
1259 N N   . GLY A 65  ? 0.1603 0.1326 0.1783 -0.0273 -0.0344 -0.0391 65  GLY A N   
1260 C CA  . GLY A 65  ? 0.2100 0.1266 0.1777 0.0130  -0.0159 -0.0327 65  GLY A CA  
1261 C C   . GLY A 65  ? 0.2359 0.0834 0.1542 0.0040  0.0511  -0.0113 65  GLY A C   
1262 O O   . GLY A 65  ? 0.1987 0.1328 0.2053 -0.0237 0.0286  -0.0096 65  GLY A O   
1266 N N   . ASP A 66  ? 0.2089 0.1006 0.1629 0.0150  -0.0050 -0.0166 66  ASP A N   
1267 C CA  . ASP A 66  ? 0.2252 0.1159 0.1399 0.0377  0.0179  -0.0286 66  ASP A CA  
1268 C C   . ASP A 66  ? 0.2042 0.1298 0.1716 0.0382  0.0168  0.0049  66  ASP A C   
1269 O O   . ASP A 66  ? 0.2197 0.1609 0.1642 -0.0027 0.0159  -0.0244 66  ASP A O   
1270 C CB  . ASP A 66  ? 0.2391 0.0998 0.1470 -0.0172 0.0139  -0.0272 66  ASP A CB  
1271 C CG  . ASP A 66  ? 0.2468 0.1645 0.1196 0.0094  0.0058  -0.0389 66  ASP A CG  
1272 O OD1 . ASP A 66  ? 0.2601 0.1173 0.1704 0.0030  -0.0019 -0.0290 66  ASP A OD1 
1273 O OD2 . ASP A 66  ? 0.2700 0.1632 0.1841 0.0013  -0.0118 0.0068  66  ASP A OD2 
1278 N N   . PHE A 67  ? 0.2218 0.1406 0.1466 0.0191  0.0164  0.0049  67  PHE A N   
1279 C CA  . PHE A 67  ? 0.2269 0.1669 0.1699 -0.0172 -0.0042 -0.0299 67  PHE A CA  
1280 C C   . PHE A 67  ? 0.2266 0.2578 0.1418 -0.0082 0.0321  -0.0477 67  PHE A C   
1281 O O   . PHE A 67  ? 0.3432 0.2098 0.1405 0.0152  0.0101  -0.0437 67  PHE A O   
1282 C CB  . PHE A 67  ? 0.2165 0.2106 0.1587 -0.0312 0.0233  -0.0502 67  PHE A CB  
1283 C CG  . PHE A 67  ? 0.2764 0.1786 0.1457 0.0280  -0.0381 -0.0259 67  PHE A CG  
1284 C CD1 . PHE A 67  ? 0.2327 0.2119 0.3120 -0.0268 -0.0205 -0.0536 67  PHE A CD1 
1285 C CD2 . PHE A 67  ? 0.2498 0.2539 0.2414 0.0548  -0.0378 -0.0770 67  PHE A CD2 
1286 C CE1 . PHE A 67  ? 0.2416 0.2748 0.2780 -0.0433 -0.0347 -0.0604 67  PHE A CE1 
1287 C CE2 . PHE A 67  ? 0.3438 0.3798 0.2476 0.1002  -0.1447 -0.1469 67  PHE A CE2 
1288 C CZ  . PHE A 67  ? 0.3151 0.3464 0.1816 0.0263  0.0356  -0.0428 67  PHE A CZ  
1298 N N   . THR A 68  ? 0.3392 0.1172 0.1787 -0.0222 0.0542  -0.0621 68  THR A N   
1299 C CA  . THR A 68  ? 0.2455 0.2097 0.1798 -0.0127 0.0315  -0.0646 68  THR A CA  
1300 C C   . THR A 68  ? 0.2495 0.1362 0.2849 -0.0492 0.0472  -0.0531 68  THR A C   
1301 O O   . THR A 68  ? 0.3366 0.1428 0.2428 0.0090  0.0366  -0.0614 68  THR A O   
1302 C CB  . THR A 68  ? 0.2844 0.1529 0.3151 -0.0094 0.0358  -0.0196 68  THR A CB  
1303 O OG1 . THR A 68  ? 0.2971 0.2153 0.2526 -0.0293 0.0733  -0.0514 68  THR A OG1 
1304 C CG2 . THR A 68  ? 0.3269 0.2086 0.2708 -0.0268 0.0232  -0.0673 68  THR A CG2 
1312 N N   . ARG A 69  ? 0.2511 0.1086 0.2624 0.0005  0.0616  -0.0373 69  ARG A N   
1313 C CA  . ARG A 69  ? 0.3296 0.0794 0.2683 -0.0192 0.0272  -0.0013 69  ARG A CA  
1314 C C   . ARG A 69  ? 0.3789 0.0622 0.1659 0.0228  0.0515  -0.0414 69  ARG A C   
1315 O O   . ARG A 69  ? 0.2804 0.1460 0.2662 0.0313  0.0543  0.0077  69  ARG A O   
1316 C CB  . ARG A 69  ? 0.3008 0.1391 0.2636 0.0086  0.0447  0.0118  69  ARG A CB  
1317 C CG  . ARG A 69  ? 0.4682 0.1667 0.2993 -0.0417 0.1214  0.0618  69  ARG A CG  
1318 C CD  . ARG A 69  ? 0.4381 0.2497 0.3192 -0.0145 0.0644  0.0529  69  ARG A CD  
1319 N NE  . ARG A 69  ? 0.4187 0.2695 0.3881 0.0135  0.0305  -0.0245 69  ARG A NE  
1320 C CZ  . ARG A 69  ? 1.1002 0.5513 0.4544 0.0925  0.3395  0.2440  69  ARG A CZ  
1321 N NH1 . ARG A 69  ? 1.0000 0.3224 0.6636 0.3380  0.4718  0.1871  69  ARG A NH1 
1322 N NH2 . ARG A 69  ? 0.7947 0.3828 0.4956 0.2033  -0.1555 -0.1055 69  ARG A NH2 
1336 N N   . HIS A 70  ? 0.1993 0.1348 0.2071 -0.0068 0.0010  -0.0583 70  HIS A N   
1337 C CA  . HIS A 70  ? 0.1945 0.1686 0.2351 -0.0546 -0.0168 -0.0668 70  HIS A CA  
1338 C C   . HIS A 70  ? 0.2369 0.1036 0.3455 -0.0941 0.0117  -0.0299 70  HIS A C   
1339 O O   . HIS A 70  ? 0.3191 0.1962 0.2162 -0.0755 0.0003  -0.0020 70  HIS A O   
1340 C CB  . HIS A 70  ? 0.2264 0.1675 0.1943 -0.0084 0.0206  -0.0049 70  HIS A CB  
1341 C CG  . HIS A 70  ? 0.2851 0.1335 0.1848 0.0109  0.0094  -0.0003 70  HIS A CG  
1342 N ND1 . HIS A 70  ? 0.3280 0.1642 0.1659 -0.0211 0.0107  -0.0322 70  HIS A ND1 
1343 C CD2 . HIS A 70  ? 0.2728 0.1564 0.1907 0.0319  -0.0031 -0.0074 70  HIS A CD2 
1344 C CE1 . HIS A 70  ? 0.2470 0.2021 0.1916 0.0240  0.0068  -0.0536 70  HIS A CE1 
1345 N NE2 . HIS A 70  ? 0.3360 0.1695 0.1808 0.0166  0.0197  -0.0076 70  HIS A NE2 
1352 N N   . ASN A 71  ? 0.2356 0.1654 0.2339 0.0045  0.0238  0.0188  71  ASN A N   
1353 C CA  . ASN A 71  ? 0.1488 0.2103 0.2653 0.0107  -0.0164 0.0096  71  ASN A CA  
1354 C C   . ASN A 71  ? 0.2709 0.1430 0.2772 0.0624  0.0742  -0.0221 71  ASN A C   
1355 O O   . ASN A 71  ? 0.3258 0.2733 0.2701 0.0637  -0.0507 -0.0606 71  ASN A O   
1356 C CB  . ASN A 71  ? 0.2384 0.2450 0.1993 0.0622  -0.0131 -0.0562 71  ASN A CB  
1357 C CG  . ASN A 71  ? 0.4018 0.3150 0.2138 -0.1363 -0.0719 0.0078  71  ASN A CG  
1358 O OD1 . ASN A 71  ? 0.3449 0.1571 0.2713 0.0176  0.0015  0.0130  71  ASN A OD1 
1359 N ND2 . ASN A 71  ? 0.4657 0.2201 0.4953 0.0904  -0.0882 0.0123  71  ASN A ND2 
1366 N N   . GLY A 72  ? 0.2785 0.1547 0.1812 0.0384  0.0040  -0.0292 72  GLY A N   
1367 C CA  . GLY A 72  ? 0.2326 0.1682 0.2417 0.0165  -0.0300 -0.0252 72  GLY A CA  
1368 C C   . GLY A 72  ? 0.2480 0.1789 0.2247 -0.0012 -0.0463 -0.0063 72  GLY A C   
1369 O O   . GLY A 72  ? 0.4150 0.2047 0.2304 0.0562  0.0116  0.0324  72  GLY A O   
1373 N N   . THR A 73  ? 0.3051 0.1919 0.2018 -0.0161 -0.0239 0.0183  73  THR A N   
1374 C CA  . THR A 73  ? 0.3375 0.2178 0.1771 0.0593  -0.0071 0.0231  73  THR A CA  
1375 C C   . THR A 73  ? 0.3375 0.2485 0.2105 0.0453  -0.0500 0.0504  73  THR A C   
1376 O O   . THR A 73  ? 0.4779 0.2909 0.2697 -0.0743 0.0377  0.0812  73  THR A O   
1377 C CB  . THR A 73  ? 0.4225 0.2191 0.2398 -0.0030 -0.0350 0.0198  73  THR A CB  
1378 O OG1 . THR A 73  ? 0.4306 0.1700 0.2740 -0.0320 -0.0117 0.0302  73  THR A OG1 
1379 C CG2 . THR A 73  ? 0.3952 0.2365 0.2617 -0.0158 0.0039  0.0312  73  THR A CG2 
1387 N N   . GLY A 74  ? 0.2864 0.1801 0.1947 0.0359  -0.0032 0.0195  74  GLY A N   
1388 C CA  . GLY A 74  ? 0.2992 0.1700 0.2200 0.0315  0.0112  0.0301  74  GLY A CA  
1389 C C   . GLY A 74  ? 0.2417 0.2241 0.1812 -0.0569 -0.0106 -0.0256 74  GLY A C   
1390 O O   . GLY A 74  ? 0.3287 0.2188 0.2111 -0.0042 -0.0192 -0.0559 74  GLY A O   
1394 N N   . GLY A 75  ? 0.3068 0.1338 0.2235 0.0008  0.0416  -0.0389 75  GLY A N   
1395 C CA  . GLY A 75  ? 0.2691 0.1286 0.2436 0.0064  0.0695  0.0029  75  GLY A CA  
1396 C C   . GLY A 75  ? 0.2370 0.1702 0.2488 -0.0294 0.0447  -0.0342 75  GLY A C   
1397 O O   . GLY A 75  ? 0.2872 0.2852 0.3180 -0.0419 0.0229  0.0613  75  GLY A O   
1401 N N   . LYS A 76  ? 0.2095 0.1966 0.2952 0.0016  -0.0156 0.0065  76  LYS A N   
1402 C CA  . LYS A 76  ? 0.2894 0.1551 0.3548 -0.0027 -0.0554 -0.0067 76  LYS A CA  
1403 C C   . LYS A 76  ? 0.2323 0.2419 0.2005 -0.0572 0.0314  -0.0044 76  LYS A C   
1404 O O   . LYS A 76  ? 0.2282 0.2547 0.2156 -0.0349 0.0310  -0.0089 76  LYS A O   
1405 C CB  . LYS A 76  ? 0.3324 0.2512 0.4009 0.0003  0.0872  0.0118  76  LYS A CB  
1406 C CG  . LYS A 76  ? 0.5814 0.3144 0.2943 -0.0845 0.0910  -0.0408 76  LYS A CG  
1407 C CD  . LYS A 76  ? 0.6429 0.3600 0.5834 -0.1989 0.0581  -0.2626 76  LYS A CD  
1408 C CE  . LYS A 76  ? 0.9027 0.5776 0.8620 -0.1320 -0.1091 -0.4153 76  LYS A CE  
1409 N NZ  . LYS A 76  ? 1.0331 0.4639 1.0327 -0.1879 -0.0266 -0.3957 76  LYS A NZ  
1423 N N   . SER A 77  ? 0.2222 0.2410 0.2593 -0.0514 0.0283  -0.0229 77  SER A N   
1424 C CA  . SER A 77  ? 0.1471 0.2741 0.2627 -0.0357 0.0039  0.0464  77  SER A CA  
1425 C C   . SER A 77  ? 0.1821 0.3610 0.2220 0.0306  0.0039  -0.0003 77  SER A C   
1426 O O   . SER A 77  ? 0.2940 0.3094 0.2553 -0.0483 0.0171  -0.0328 77  SER A O   
1427 C CB  . SER A 77  ? 0.2629 0.2609 0.2126 0.0094  0.0074  -0.0234 77  SER A CB  
1428 O OG  . SER A 77  ? 0.2258 0.2728 0.2589 -0.0575 0.0312  -0.0085 77  SER A OG  
1434 N N   . ILE A 78  ? 0.2140 0.2698 0.2433 -0.0556 -0.0310 0.0039  78  ILE A N   
1435 C CA  . ILE A 78  ? 0.2310 0.2886 0.2300 -0.0076 -0.0361 -0.0633 78  ILE A CA  
1436 C C   . ILE A 78  ? 0.2411 0.3870 0.3019 -0.0483 -0.0356 0.1161  78  ILE A C   
1437 O O   . ILE A 78  ? 0.3251 0.4842 0.3526 -0.1493 -0.0865 0.0549  78  ILE A O   
1438 C CB  . ILE A 78  ? 0.2009 0.2901 0.3120 -0.0326 -0.0492 -0.0078 78  ILE A CB  
1439 C CG1 . ILE A 78  ? 0.2934 0.2665 0.2760 -0.0237 -0.0502 0.0016  78  ILE A CG1 
1440 C CG2 . ILE A 78  ? 0.2116 0.4583 0.2976 -0.0497 -0.0006 -0.0620 78  ILE A CG2 
1441 C CD1 . ILE A 78  ? 0.1753 0.4618 0.3141 -0.0645 -0.0727 0.0034  78  ILE A CD1 
1453 N N   . TYR A 79  ? 0.2527 0.2616 0.2925 -0.0873 -0.0228 0.0420  79  TYR A N   
1454 C CA  . TYR A 79  ? 0.2733 0.3329 0.2967 -0.1292 -0.0259 0.0313  79  TYR A CA  
1455 C C   . TYR A 79  ? 0.3924 0.3069 0.3376 -0.0687 0.0078  0.0658  79  TYR A C   
1456 O O   . TYR A 79  ? 0.6389 0.3767 0.5712 -0.0626 0.3439  0.0641  79  TYR A O   
1457 C CB  . TYR A 79  ? 0.3396 0.3799 0.3022 -0.0898 0.0246  0.0052  79  TYR A CB  
1458 C CG  . TYR A 79  ? 0.1773 0.4181 0.2713 -0.0363 0.0139  0.0249  79  TYR A CG  
1459 C CD1 . TYR A 79  ? 0.2644 0.3659 0.3100 -0.0824 0.0280  -0.0450 79  TYR A CD1 
1460 C CD2 . TYR A 79  ? 0.1852 0.4994 0.2592 -0.0390 0.0237  0.0587  79  TYR A CD2 
1461 C CE1 . TYR A 79  ? 0.2054 0.4327 0.3572 -0.0338 -0.1011 -0.0884 79  TYR A CE1 
1462 C CE2 . TYR A 79  ? 0.2268 0.4767 0.1944 -0.1011 -0.0120 0.0043  79  TYR A CE2 
1463 C CZ  . TYR A 79  ? 0.2621 0.3344 0.2268 -0.0503 -0.0164 -0.0207 79  TYR A CZ  
1464 O OH  . TYR A 79  ? 0.2502 0.3406 0.2477 -0.0359 -0.0031 -0.0446 79  TYR A OH  
1474 N N   . GLY A 80  ? 0.3975 0.2767 0.3734 -0.1313 0.0016  -0.0332 80  GLY A N   
1475 C CA  . GLY A 80  ? 0.4084 0.1703 0.5269 -0.0838 0.0293  0.0177  80  GLY A CA  
1476 C C   . GLY A 80  ? 0.2126 0.4114 0.3580 -0.1268 0.0624  -0.1180 80  GLY A C   
1477 O O   . GLY A 80  ? 0.2662 0.3603 0.3325 -0.0748 0.0016  0.0149  80  GLY A O   
1481 N N   . GLU A 81  ? 0.9076 0.1935 0.3176 -0.0140 0.1259  -0.0227 81  GLU A N   
1482 C CA  . GLU A 81  ? 0.6102 0.3147 0.4182 -0.0799 0.1183  -0.1877 81  GLU A CA  
1483 C C   . GLU A 81  ? 0.4757 0.1775 0.2731 -0.0358 0.1620  0.0041  81  GLU A C   
1484 O O   . GLU A 81  ? 0.3734 0.2904 0.4521 -0.0185 0.1290  -0.0239 81  GLU A O   
1485 C CB  . GLU A 81  ? 0.8846 0.1501 0.4773 0.0096  -0.0656 -0.0583 81  GLU A CB  
1486 C CG  . GLU A 81  ? 1.0318 0.9438 0.9852 0.1347  0.1815  -0.1439 81  GLU A CG  
1487 C CD  . GLU A 81  ? 1.3703 1.2485 1.1990 0.1107  0.0057  -0.0228 81  GLU A CD  
1488 O OE1 . GLU A 81  ? 1.3785 1.0162 1.1676 -0.0014 0.1248  -0.0341 81  GLU A OE1 
1489 O OE2 . GLU A 81  ? 1.3376 1.1606 1.2377 0.5169  -0.1440 0.1551  81  GLU A OE2 
1496 N N   . LYS A 82  ? 0.3483 0.2082 0.2488 -0.0573 0.0646  -0.0360 82  LYS A N   
1497 C CA  . LYS A 82  ? 0.2402 0.2297 0.3122 -0.0553 0.0535  -0.0764 82  LYS A CA  
1498 C C   . LYS A 82  ? 0.1960 0.2651 0.2241 -0.0994 0.0548  -0.0011 82  LYS A C   
1499 O O   . LYS A 82  ? 0.2522 0.2366 0.4248 -0.0676 0.0800  -0.0493 82  LYS A O   
1500 C CB  . LYS A 82  ? 0.3778 0.3147 0.3173 -0.0458 -0.0561 -0.0911 82  LYS A CB  
1501 C CG  . LYS A 82  ? 0.8791 0.3991 0.6669 -0.2170 0.2549  -0.2942 82  LYS A CG  
1502 C CD  . LYS A 82  ? 0.9479 0.9998 0.9359 -0.1555 -0.1845 -0.2308 82  LYS A CD  
1503 C CE  . LYS A 82  ? 1.2470 1.0025 1.2442 -0.2817 0.1081  0.1541  82  LYS A CE  
1504 N NZ  . LYS A 82  ? 1.4383 1.2827 1.4876 -0.3631 0.1216  0.4325  82  LYS A NZ  
1518 N N   . PHE A 83  ? 0.2557 0.2015 0.2268 -0.0720 0.0345  -0.0489 83  PHE A N   
1519 C CA  . PHE A 83  ? 0.3001 0.2158 0.1845 -0.0445 0.0960  -0.0078 83  PHE A CA  
1520 C C   . PHE A 83  ? 0.2205 0.1954 0.1907 -0.0166 0.0710  0.0003  83  PHE A C   
1521 O O   . PHE A 83  ? 0.1686 0.2254 0.2142 -0.0204 0.0401  -0.0079 83  PHE A O   
1522 C CB  . PHE A 83  ? 0.2184 0.2226 0.2086 -0.0774 0.0344  -0.0173 83  PHE A CB  
1523 C CG  . PHE A 83  ? 0.2552 0.2742 0.1582 -0.0216 0.0140  -0.0321 83  PHE A CG  
1524 C CD1 . PHE A 83  ? 0.3217 0.2062 0.1500 -0.0612 0.0199  0.0229  83  PHE A CD1 
1525 C CD2 . PHE A 83  ? 0.3016 0.2646 0.2026 -0.0504 -0.0228 -0.0175 83  PHE A CD2 
1526 C CE1 . PHE A 83  ? 0.2779 0.2282 0.1600 0.0427  -0.0372 -0.0258 83  PHE A CE1 
1527 C CE2 . PHE A 83  ? 0.3146 0.3255 0.2007 0.0942  -0.0282 -0.0860 83  PHE A CE2 
1528 C CZ  . PHE A 83  ? 0.2764 0.2283 0.1805 -0.0092 0.0042  0.0117  83  PHE A CZ  
1538 N N   . GLU A 84  ? 0.1852 0.2352 0.1933 -0.0340 0.0436  -0.0287 84  GLU A N   
1539 C CA  . GLU A 84  ? 0.1908 0.1989 0.2150 -0.0096 0.0738  -0.0136 84  GLU A CA  
1540 C C   . GLU A 84  ? 0.1933 0.2662 0.1333 0.0064  0.0432  -0.0005 84  GLU A C   
1541 O O   . GLU A 84  ? 0.2211 0.2324 0.1766 -0.0330 0.0191  0.0084  84  GLU A O   
1542 C CB  . GLU A 84  ? 0.2228 0.2265 0.2132 0.0045  0.0292  0.0087  84  GLU A CB  
1543 C CG  . GLU A 84  ? 0.2593 0.3207 0.2338 -0.0304 -0.0102 -0.0249 84  GLU A CG  
1544 C CD  . GLU A 84  ? 0.2162 0.3257 0.3784 0.0403  0.1234  0.1262  84  GLU A CD  
1545 O OE1 . GLU A 84  ? 0.2025 0.3825 0.2667 -0.0257 0.0066  0.0004  84  GLU A OE1 
1546 O OE2 . GLU A 84  ? 0.2745 0.3186 0.2957 0.0268  -0.0094 0.0131  84  GLU A OE2 
1553 N N   . ASP A 85  ? 0.1987 0.1967 0.1473 0.0183  0.0382  0.0208  85  ASP A N   
1554 C CA  . ASP A 85  ? 0.1918 0.1741 0.1918 0.0352  0.0362  0.0333  85  ASP A CA  
1555 C C   . ASP A 85  ? 0.2074 0.1772 0.1781 -0.0045 0.0044  0.0228  85  ASP A C   
1556 O O   . ASP A 85  ? 0.2002 0.2658 0.2258 0.0354  0.0400  0.0449  85  ASP A O   
1557 C CB  . ASP A 85  ? 0.1467 0.2579 0.1682 0.0577  0.0019  0.0044  85  ASP A CB  
1558 C CG  . ASP A 85  ? 0.1971 0.1947 0.1423 -0.0355 0.0220  0.0036  85  ASP A CG  
1559 O OD1 . ASP A 85  ? 0.2163 0.2073 0.1766 0.0326  0.0431  0.0206  85  ASP A OD1 
1560 O OD2 . ASP A 85  ? 0.1904 0.1841 0.1813 0.0078  0.0274  0.0059  85  ASP A OD2 
1565 N N   . GLU A 86  ? 0.1561 0.2184 0.1870 0.0233  0.0042  0.0382  86  GLU A N   
1566 C CA  . GLU A 86  ? 0.1880 0.2156 0.2018 0.0169  -0.0066 0.0202  86  GLU A CA  
1567 C C   . GLU A 86  ? 0.1671 0.2613 0.2133 0.0361  0.0223  0.0293  86  GLU A C   
1568 O O   . GLU A 86  ? 0.1958 0.2868 0.3030 0.0403  0.0575  -0.0183 86  GLU A O   
1569 C CB  . GLU A 86  ? 0.1981 0.3011 0.1853 0.0522  -0.0038 0.0006  86  GLU A CB  
1570 C CG  . GLU A 86  ? 0.1779 0.3602 0.1723 0.0515  0.0365  0.0156  86  GLU A CG  
1571 C CD  . GLU A 86  ? 0.2138 0.3040 0.2067 0.0291  0.0752  -0.0336 86  GLU A CD  
1572 O OE1 . GLU A 86  ? 0.1713 0.3101 0.1937 0.0299  0.0087  0.0180  86  GLU A OE1 
1573 O OE2 . GLU A 86  ? 0.1943 0.3485 0.2771 0.0443  -0.0036 0.0515  86  GLU A OE2 
1580 N N   . ASN A 87  ? 0.1568 0.2942 0.1907 0.0155  0.0207  -0.0095 87  ASN A N   
1581 C CA  . ASN A 87  ? 0.1638 0.3098 0.1807 0.0393  0.0714  0.0081  87  ASN A CA  
1582 C C   . ASN A 87  ? 0.1483 0.2509 0.2535 0.0451  0.1084  0.0469  87  ASN A C   
1583 O O   . ASN A 87  ? 0.1521 0.2423 0.2400 0.0373  0.0306  0.0029  87  ASN A O   
1584 C CB  . ASN A 87  ? 0.1564 0.2614 0.2923 0.0729  0.0376  -0.0285 87  ASN A CB  
1585 C CG  . ASN A 87  ? 0.3719 0.2469 0.2974 0.0788  0.2136  0.0482  87  ASN A CG  
1586 O OD1 . ASN A 87  ? 0.2392 0.2810 0.2370 0.0422  0.0378  0.0473  87  ASN A OD1 
1587 N ND2 . ASN A 87  ? 0.2751 0.3493 0.3074 0.0932  -0.0161 0.0224  87  ASN A ND2 
1594 N N   . PHE A 88  ? 0.1895 0.2984 0.2282 0.0674  0.0330  -0.0516 88  PHE A N   
1595 C CA  . PHE A 88  ? 0.1746 0.2641 0.2150 0.0776  0.0121  0.0523  88  PHE A CA  
1596 C C   . PHE A 88  ? 0.3070 0.2190 0.2414 0.0911  0.1256  0.0136  88  PHE A C   
1597 O O   . PHE A 88  ? 0.3441 0.2288 0.2981 0.0366  0.0162  -0.0080 88  PHE A O   
1598 C CB  . PHE A 88  ? 0.2064 0.2623 0.2333 0.0893  0.0163  -0.0550 88  PHE A CB  
1599 C CG  . PHE A 88  ? 0.2001 0.2421 0.1787 0.0579  0.0397  -0.0011 88  PHE A CG  
1600 C CD1 . PHE A 88  ? 0.2090 0.2245 0.1853 -0.0197 0.0052  -0.0277 88  PHE A CD1 
1601 C CD2 . PHE A 88  ? 0.2332 0.2692 0.2040 0.0330  0.0245  0.0053  88  PHE A CD2 
1602 C CE1 . PHE A 88  ? 0.2181 0.2455 0.1648 0.0121  0.0075  0.0010  88  PHE A CE1 
1603 C CE2 . PHE A 88  ? 0.1857 0.2825 0.2835 0.0269  0.0291  0.0435  88  PHE A CE2 
1604 C CZ  . PHE A 88  ? 0.2239 0.2015 0.1985 0.0384  -0.0143 0.0378  88  PHE A CZ  
1614 N N   A ILE A 89  ? 0.1241 0.3496 0.2996 0.0327  0.0172  -0.0757 89  ILE A N   
1615 N N   B ILE A 89  ? 0.4080 0.2072 0.1918 0.1829  0.0158  0.0359  89  ILE A N   
1616 C CA  A ILE A 89  ? 0.2702 0.3418 0.3525 0.0897  0.1512  -0.1984 89  ILE A CA  
1617 C CA  B ILE A 89  ? 0.2153 0.2328 0.3967 0.0123  -0.0944 0.0928  89  ILE A CA  
1618 C C   A ILE A 89  ? 0.2441 0.1639 0.3480 0.1580  -0.1038 -0.0903 89  ILE A C   
1619 C C   B ILE A 89  ? 0.1475 0.3288 0.4041 -0.0344 0.0488  0.1874  89  ILE A C   
1620 O O   A ILE A 89  ? 0.2948 0.3052 0.4711 -0.0230 0.1665  -0.2272 89  ILE A O   
1621 O O   B ILE A 89  ? 0.3409 0.2207 0.2655 0.0866  0.0442  0.0448  89  ILE A O   
1622 C CB  A ILE A 89  ? 0.1967 0.2630 0.4755 0.1258  0.1484  0.1222  89  ILE A CB  
1623 C CB  B ILE A 89  ? 0.2899 0.2984 0.4825 -0.0159 0.0743  0.0513  89  ILE A CB  
1624 C CG1 A ILE A 89  ? 0.6010 0.1720 0.6295 0.0944  0.3986  0.0640  89  ILE A CG1 
1625 C CG1 B ILE A 89  ? 0.7424 0.2249 0.6837 0.1505  0.2360  -0.2395 89  ILE A CG1 
1626 C CG2 A ILE A 89  ? 0.5195 0.3381 0.5003 0.2555  0.1189  0.0015  89  ILE A CG2 
1627 C CG2 B ILE A 89  ? 0.3580 0.2960 0.3562 0.1179  -0.0373 -0.0318 89  ILE A CG2 
1628 C CD1 A ILE A 89  ? 0.6814 0.6894 0.7566 -0.1942 0.4828  -0.0190 89  ILE A CD1 
1629 C CD1 B ILE A 89  ? 0.4949 0.6170 0.7616 -0.4053 0.0317  0.0409  89  ILE A CD1 
1652 N N   A LEU A 90  ? 0.1087 0.2980 0.1740 0.0816  0.0517  0.0122  90  LEU A N   
1653 N N   B LEU A 90  ? 0.3739 0.2661 0.3857 0.1985  0.0296  -0.0438 90  LEU A N   
1654 C CA  A LEU A 90  ? 0.2892 0.2199 0.4578 0.0555  0.0866  -0.2748 90  LEU A CA  
1655 C CA  B LEU A 90  ? 0.2123 0.2529 0.1464 0.0220  0.0339  -0.0173 90  LEU A CA  
1656 C C   A LEU A 90  ? 0.2526 0.2517 0.3410 -0.0950 -0.1302 -0.0395 90  LEU A C   
1657 C C   B LEU A 90  ? 0.0863 0.4114 0.2482 0.1223  0.0821  -0.0339 90  LEU A C   
1658 O O   A LEU A 90  ? 0.2662 0.1400 0.3465 0.0376  -0.0960 -0.0033 90  LEU A O   
1659 O O   B LEU A 90  ? 0.2015 0.3436 0.1912 0.0462  0.0447  -0.0578 90  LEU A O   
1660 C CB  A LEU A 90  ? 0.2322 0.1755 0.3205 0.1623  0.0818  0.0878  90  LEU A CB  
1661 C CB  B LEU A 90  ? 0.2709 0.3113 0.2444 -0.0208 0.0138  -0.1417 90  LEU A CB  
1662 C CG  A LEU A 90  ? 0.3395 0.0983 0.4024 0.0948  0.0846  0.0380  90  LEU A CG  
1663 C CG  B LEU A 90  ? 0.3309 0.5742 0.4364 0.1299  -0.1772 -0.0028 90  LEU A CG  
1664 C CD1 A LEU A 90  ? 0.5579 0.6988 0.7369 0.2875  -0.0234 0.0588  90  LEU A CD1 
1665 C CD1 B LEU A 90  ? 0.6844 0.8390 0.7647 0.2672  -0.1542 0.1342  90  LEU A CD1 
1666 C CD2 A LEU A 90  ? 0.3607 0.3727 0.3045 0.0731  -0.1668 -0.0467 90  LEU A CD2 
1667 C CD2 B LEU A 90  ? 0.2606 0.2490 0.3504 0.0851  0.0323  0.1108  90  LEU A CD2 
1690 N N   A LYS A 91  ? 0.4847 0.1477 0.2380 0.1162  -0.1671 -0.0347 91  LYS A N   
1691 N N   B LYS A 91  ? 0.0572 0.4170 0.3824 0.0292  0.1010  -0.0137 91  LYS A N   
1692 C CA  A LYS A 91  ? 0.3801 0.1041 0.2916 0.0166  0.0891  0.0781  91  LYS A CA  
1693 C CA  B LYS A 91  ? 0.1230 0.3847 0.2370 -0.0380 0.0446  -0.2019 91  LYS A CA  
1694 C C   A LYS A 91  ? 0.4867 0.0465 0.1295 -0.0047 0.1353  0.0208  91  LYS A C   
1695 C C   B LYS A 91  ? 0.1476 0.2538 0.2755 0.0614  -0.0648 -0.0652 91  LYS A C   
1696 O O   A LYS A 91  ? 0.2807 0.1325 0.4113 0.0332  0.0653  -0.0780 91  LYS A O   
1697 O O   B LYS A 91  ? 0.2455 0.1858 0.1409 0.0008  0.0065  0.0555  91  LYS A O   
1698 C CB  A LYS A 91  ? 0.2637 0.2929 0.3831 0.1396  -0.0673 0.0565  91  LYS A CB  
1699 C CB  B LYS A 91  ? 0.3097 0.4316 0.2984 -0.1607 0.1590  -0.2145 91  LYS A CB  
1700 C CG  A LYS A 91  ? 0.4360 0.2905 0.2386 0.0320  0.0606  -0.1480 91  LYS A CG  
1701 C CG  B LYS A 91  ? 0.3466 0.5621 0.5227 -0.0407 0.2947  0.0477  91  LYS A CG  
1702 C CD  A LYS A 91  ? 0.6110 0.5316 0.4433 0.1342  0.3156  -0.0348 91  LYS A CD  
1703 C CD  B LYS A 91  ? 0.5237 0.6372 0.6439 -0.0216 0.4316  0.0278  91  LYS A CD  
1704 C CE  A LYS A 91  ? 0.7983 0.7377 0.8169 0.1656  0.2006  -0.0129 91  LYS A CE  
1705 C CE  B LYS A 91  ? 0.7022 0.7524 0.8649 -0.1323 0.6083  0.2118  91  LYS A CE  
1706 N NZ  A LYS A 91  ? 0.8144 0.9899 0.9621 0.1748  0.4356  -0.1539 91  LYS A NZ  
1707 N NZ  B LYS A 91  ? 0.9440 1.0756 1.0584 0.0746  0.5829  0.2131  91  LYS A NZ  
1734 N N   . HIS A 92  ? 0.2315 0.1692 0.2350 0.0331  -0.0156 -0.0258 92  HIS A N   
1735 C CA  . HIS A 92  ? 0.2118 0.1419 0.2523 -0.0375 -0.0068 -0.0361 92  HIS A CA  
1736 C C   . HIS A 92  ? 0.2615 0.2326 0.2054 0.0388  0.0010  -0.0107 92  HIS A C   
1737 O O   . HIS A 92  ? 0.3439 0.1926 0.2728 -0.0333 -0.0484 -0.0205 92  HIS A O   
1738 C CB  . HIS A 92  ? 0.2674 0.1518 0.2059 0.0157  0.0200  0.0224  92  HIS A CB  
1739 C CG  . HIS A 92  ? 0.2237 0.1093 0.2099 0.0113  0.0185  -0.0087 92  HIS A CG  
1740 N ND1 . HIS A 92  ? 0.2168 0.1147 0.2165 -0.0079 0.0075  0.0153  92  HIS A ND1 
1741 C CD2 . HIS A 92  ? 0.1980 0.2134 0.1633 0.0199  0.0260  0.0215  92  HIS A CD2 
1742 C CE1 . HIS A 92  ? 0.2071 0.1456 0.1890 -0.0145 0.0133  0.0041  92  HIS A CE1 
1743 N NE2 . HIS A 92  ? 0.1909 0.2025 0.1766 0.0127  0.0075  0.0132  92  HIS A NE2 
1751 N N   . THR A 93  ? 0.3016 0.1430 0.2375 0.0021  0.0180  -0.0156 93  THR A N   
1752 C CA  . THR A 93  ? 0.3803 0.1701 0.2986 0.0268  0.0460  -0.0459 93  THR A CA  
1753 C C   . THR A 93  ? 0.3206 0.2026 0.2872 -0.0482 0.0198  -0.0318 93  THR A C   
1754 O O   . THR A 93  ? 0.4200 0.2596 0.3478 -0.1053 0.0394  -0.0911 93  THR A O   
1755 C CB  . THR A 93  ? 0.3651 0.1867 0.3695 -0.0520 0.0656  -0.1020 93  THR A CB  
1756 O OG1 . THR A 93  ? 0.4742 0.1880 0.3679 0.0654  -0.0411 -0.0466 93  THR A OG1 
1757 C CG2 . THR A 93  ? 0.4064 0.2537 0.4984 0.0502  0.1027  -0.1246 93  THR A CG2 
1765 N N   . GLY A 94  ? 0.3741 0.1968 0.2340 -0.0439 0.0496  -0.0016 94  GLY A N   
1766 C CA  . GLY A 94  ? 0.3128 0.2004 0.2622 -0.0235 0.0336  -0.0009 94  GLY A CA  
1767 C C   . GLY A 94  ? 0.3346 0.2131 0.2333 0.0160  0.1254  0.0172  94  GLY A C   
1768 O O   . GLY A 94  ? 0.3120 0.1567 0.3096 -0.0369 0.0368  -0.0026 94  GLY A O   
1772 N N   . PRO A 95  ? 0.3243 0.1853 0.2108 -0.0440 -0.0075 -0.0365 95  PRO A N   
1773 C CA  . PRO A 95  ? 0.3073 0.1874 0.2374 -0.0802 0.0564  -0.0659 95  PRO A CA  
1774 C C   . PRO A 95  ? 0.2427 0.3398 0.1898 -0.0612 -0.0165 -0.0071 95  PRO A C   
1775 O O   . PRO A 95  ? 0.3327 0.2330 0.3007 0.0276  0.0171  -0.0020 95  PRO A O   
1776 C CB  . PRO A 95  ? 0.3564 0.2851 0.2742 -0.1441 0.0255  -0.0824 95  PRO A CB  
1777 C CG  . PRO A 95  ? 0.4962 0.3740 0.3569 -0.2874 0.1618  -0.1247 95  PRO A CG  
1778 C CD  . PRO A 95  ? 0.3737 0.2942 0.2567 -0.1456 0.0419  -0.0226 95  PRO A CD  
1786 N N   . GLY A 96  ? 0.2985 0.1986 0.1854 -0.0230 -0.0307 -0.0077 96  GLY A N   
1787 C CA  . GLY A 96  ? 0.2727 0.1872 0.1600 -0.0233 0.0226  -0.0039 96  GLY A CA  
1788 C C   . GLY A 96  ? 0.1838 0.1348 0.2362 0.0120  0.0356  0.0550  96  GLY A C   
1789 O O   . GLY A 96  ? 0.2397 0.2453 0.1970 0.0080  -0.0003 0.0631  96  GLY A O   
1793 N N   A ILE A 97  ? 0.3035 0.1044 0.2325 0.0508  0.1060  0.0841  97  ILE A N   
1794 N N   B ILE A 97  ? 0.1914 0.2042 0.2019 -0.1115 -0.0018 -0.0809 97  ILE A N   
1795 C CA  A ILE A 97  ? 0.1882 0.0988 0.2527 0.0111  0.0497  -0.0838 97  ILE A CA  
1796 C CA  B ILE A 97  ? 0.3086 0.1526 0.0418 -0.0662 -0.0702 0.0280  97  ILE A CA  
1797 C C   A ILE A 97  ? 0.1159 0.1676 0.1312 -0.0777 0.0386  -0.0045 97  ILE A C   
1798 C C   B ILE A 97  ? 0.3581 0.4081 0.1442 0.3355  -0.1338 -0.0454 97  ILE A C   
1799 O O   A ILE A 97  ? 0.1785 0.1343 0.1196 0.0024  0.0236  -0.0136 97  ILE A O   
1800 O O   B ILE A 97  ? 0.1350 0.3081 0.1432 0.0893  -0.0299 0.0154  97  ILE A O   
1801 C CB  A ILE A 97  ? 0.2658 0.1727 0.3018 0.0009  0.0613  -0.1213 97  ILE A CB  
1802 C CB  B ILE A 97  ? 0.2794 0.2378 0.0427 -0.1208 0.0063  0.0588  97  ILE A CB  
1803 C CG1 A ILE A 97  ? 0.2686 0.2244 0.2234 -0.1184 0.0621  -0.1281 97  ILE A CG1 
1804 C CG1 B ILE A 97  ? 0.4119 0.3538 0.2249 0.0275  0.0642  0.1402  97  ILE A CG1 
1805 C CG2 A ILE A 97  ? 0.1534 0.1780 0.1660 0.0221  0.0229  0.0220  97  ILE A CG2 
1806 C CG2 B ILE A 97  ? 0.3472 0.2409 0.3669 0.2169  -0.0450 0.0729  97  ILE A CG2 
1807 C CD1 A ILE A 97  ? 0.3198 0.2196 0.3017 0.0308  0.0692  -0.0044 97  ILE A CD1 
1808 C CD1 B ILE A 97  ? 0.6015 0.3514 0.3622 0.1237  0.1563  0.0082  97  ILE A CD1 
1831 N N   A LEU A 98  ? 0.1121 0.1491 0.1600 0.0644  -0.0058 0.0486  98  LEU A N   
1832 N N   B LEU A 98  ? 0.4482 0.0783 0.1620 -0.1479 0.0834  -0.0410 98  LEU A N   
1833 C CA  A LEU A 98  ? 0.1431 0.1924 0.2544 0.0946  0.1075  0.0233  98  LEU A CA  
1834 C CA  B LEU A 98  ? 0.3494 0.1013 0.1994 -0.1249 -0.1691 -0.0089 98  LEU A CA  
1835 C C   A LEU A 98  ? 0.1271 0.2103 0.1635 0.0252  0.0567  -0.0346 98  LEU A C   
1836 C C   B LEU A 98  ? 0.1429 0.0435 0.2596 -0.0547 -0.0978 0.0803  98  LEU A C   
1837 O O   A LEU A 98  ? 0.1179 0.1252 0.1220 -0.0263 -0.0271 -0.0407 98  LEU A O   
1838 O O   B LEU A 98  ? 0.0982 0.1353 0.1482 -0.0020 -0.0562 -0.0723 98  LEU A O   
1839 C CB  A LEU A 98  ? 0.3289 0.3773 0.2200 -0.0572 -0.0515 0.0627  98  LEU A CB  
1840 C CB  B LEU A 98  ? 0.0810 0.0880 0.3272 -0.0073 0.0748  -0.1092 98  LEU A CB  
1841 C CG  A LEU A 98  ? 0.3020 0.2136 0.1738 0.0407  0.0218  -0.0362 98  LEU A CG  
1842 C CG  B LEU A 98  ? 0.1871 0.4124 0.4384 -0.1047 0.1225  0.1479  98  LEU A CG  
1843 C CD1 A LEU A 98  ? 0.2258 0.2172 0.2393 0.0138  0.0393  -0.0821 98  LEU A CD1 
1844 C CD1 B LEU A 98  ? 0.6815 0.5621 0.5347 -0.0587 0.0770  0.1638  98  LEU A CD1 
1845 C CD2 A LEU A 98  ? 0.2110 0.3216 0.1612 0.1005  -0.0489 -0.0632 98  LEU A CD2 
1846 C CD2 B LEU A 98  ? 0.1060 0.7414 0.3367 0.1411  0.0959  0.2016  98  LEU A CD2 
1869 N N   A SER A 99  ? 0.1356 0.1631 0.1760 0.0944  0.0173  -0.0221 99  SER A N   
1870 N N   B SER A 99  ? 0.3723 0.0682 0.1450 -0.1448 -0.0215 0.0298  99  SER A N   
1871 C CA  A SER A 99  ? 0.2371 0.1161 0.1448 -0.0017 0.0736  0.0285  99  SER A CA  
1872 C CA  B SER A 99  ? 0.3570 0.0146 0.2514 0.0263  -0.1594 -0.0223 99  SER A CA  
1873 C C   A SER A 99  ? 0.1739 0.1336 0.1681 -0.0614 0.1240  -0.0147 99  SER A C   
1874 C C   B SER A 99  ? 0.1866 0.1643 0.3764 0.1274  -0.2024 -0.0476 99  SER A C   
1875 O O   A SER A 99  ? 0.1407 0.1874 0.1538 -0.0306 0.0723  -0.0073 99  SER A O   
1876 O O   B SER A 99  ? 0.3755 0.0731 0.2185 0.0732  -0.0108 0.0008  99  SER A O   
1877 C CB  A SER A 99  ? 0.1824 0.1577 0.1755 0.0814  0.0409  -0.0259 99  SER A CB  
1878 C CB  B SER A 99  ? 0.1411 0.3011 0.1981 0.0033  0.0685  -0.1259 99  SER A CB  
1879 O OG  A SER A 99  ? 0.2763 0.1384 0.1151 -0.0098 0.0729  -0.0086 99  SER A OG  
1880 O OG  B SER A 99  ? 0.3140 0.3376 0.3823 0.1918  -0.0918 -0.2027 99  SER A OG  
1891 N N   A MET A 100 ? 0.1295 0.2790 0.1782 0.0395  0.0525  -0.0223 100 MET A N   
1892 N N   B MET A 100 ? 0.1931 0.0291 0.1887 -0.0576 0.0048  -0.0278 100 MET A N   
1893 C CA  A MET A 100 ? 0.1854 0.1399 0.2393 -0.0745 0.0515  -0.0174 100 MET A CA  
1894 C CA  B MET A 100 ? 0.2649 0.1349 0.0590 0.1069  -0.0937 -0.0333 100 MET A CA  
1895 C C   A MET A 100 ? 0.2461 0.1276 0.0915 -0.0128 -0.0213 -0.0380 100 MET A C   
1896 C C   B MET A 100 ? 0.0986 0.3806 0.1703 0.0281  0.1020  0.0529  100 MET A C   
1897 O O   A MET A 100 ? 0.2994 0.1293 0.1692 0.0436  0.0108  -0.0047 100 MET A O   
1898 O O   B MET A 100 ? 0.1035 0.3111 0.1265 0.0066  0.0028  -0.0581 100 MET A O   
1899 C CB  A MET A 100 ? 0.1387 0.3317 0.2403 0.0040  0.0724  0.0108  100 MET A CB  
1900 C CB  B MET A 100 ? 0.2824 0.0713 0.2953 -0.1235 -0.0857 0.0141  100 MET A CB  
1901 C CG  A MET A 100 ? 0.2680 0.3863 0.1780 -0.0436 0.1048  -0.1286 100 MET A CG  
1902 C CG  B MET A 100 ? 0.0898 0.1114 0.5695 -0.0180 -0.2056 0.1152  100 MET A CG  
1903 S SD  A MET A 100 ? 0.2262 0.1855 0.2791 0.0220  -0.0087 0.0083  100 MET A SD  
1904 S SD  B MET A 100 ? 0.1798 0.1849 0.1738 -0.0138 -0.0527 0.0032  100 MET A SD  
1905 C CE  A MET A 100 ? 0.2317 0.1053 0.2906 0.0030  -0.0672 -0.0218 100 MET A CE  
1906 C CE  B MET A 100 ? 0.8623 0.0516 0.9808 0.1296  0.8876  0.1077  100 MET A CE  
1925 N N   . ALA A 101 ? 0.1926 0.1399 0.1355 0.0026  0.0443  -0.0125 101 ALA A N   
1926 C CA  . ALA A 101 ? 0.2490 0.1429 0.1267 -0.0287 0.0177  0.0384  101 ALA A CA  
1927 C C   . ALA A 101 ? 0.2338 0.1774 0.1209 0.0665  0.0278  0.0267  101 ALA A C   
1928 O O   . ALA A 101 ? 0.2232 0.1968 0.2073 0.0307  -0.0126 0.0208  101 ALA A O   
1929 C CB  . ALA A 101 ? 0.1830 0.2053 0.1846 0.0479  0.0771  0.0044  101 ALA A CB  
1936 N N   . ASN A 102 ? 0.2123 0.1374 0.1697 0.0052  0.0293  0.0235  102 ASN A N   
1937 C CA  . ASN A 102 ? 0.1790 0.1556 0.1953 0.0661  0.0044  0.0447  102 ASN A CA  
1938 C C   . ASN A 102 ? 0.2313 0.1886 0.2162 0.0473  0.0559  -0.0075 102 ASN A C   
1939 O O   . ASN A 102 ? 0.2163 0.2722 0.3133 0.0443  0.0378  0.1247  102 ASN A O   
1940 C CB  . ASN A 102 ? 0.1785 0.2226 0.2320 0.0682  0.0294  -0.0051 102 ASN A CB  
1941 C CG  . ASN A 102 ? 0.2313 0.1809 0.2287 0.0038  0.0751  -0.0048 102 ASN A CG  
1942 O OD1 . ASN A 102 ? 0.2829 0.2014 0.2167 0.0617  0.0197  0.0170  102 ASN A OD1 
1943 N ND2 . ASN A 102 ? 0.2241 0.2300 0.2014 0.0098  0.0021  -0.0066 102 ASN A ND2 
1950 N N   . ALA A 103 ? 0.2567 0.1803 0.2344 0.0508  0.0698  0.0583  103 ALA A N   
1951 C CA  . ALA A 103 ? 0.2777 0.2337 0.2837 0.0621  0.1258  0.0761  103 ALA A CA  
1952 C C   . ALA A 103 ? 0.3196 0.2061 0.2779 0.0734  0.0602  0.0625  103 ALA A C   
1953 O O   . ALA A 103 ? 0.4155 0.2784 0.3832 0.1682  0.1702  0.1461  103 ALA A O   
1954 C CB  . ALA A 103 ? 0.3715 0.2109 0.3525 0.0505  0.1148  0.0151  103 ALA A CB  
1960 N N   . GLY A 104 ? 0.2385 0.2227 0.2368 0.0567  0.0333  0.0322  104 GLY A N   
1961 C CA  . GLY A 104 ? 0.2824 0.2460 0.2322 0.0982  0.0476  0.0512  104 GLY A CA  
1962 C C   . GLY A 104 ? 0.2498 0.2044 0.1577 0.0024  0.0532  0.0093  104 GLY A C   
1963 O O   . GLY A 104 ? 0.2115 0.2096 0.1892 0.0362  0.0341  0.0311  104 GLY A O   
1967 N N   . PRO A 105 ? 0.2058 0.2348 0.1480 -0.0017 0.0041  0.0474  105 PRO A N   
1968 C CA  . PRO A 105 ? 0.1964 0.2538 0.1577 0.0426  0.0274  0.0069  105 PRO A CA  
1969 C C   . PRO A 105 ? 0.1907 0.2511 0.1539 0.0109  0.0206  -0.0109 105 PRO A C   
1970 O O   . PRO A 105 ? 0.2554 0.2322 0.2105 0.0192  0.0322  -0.0118 105 PRO A O   
1971 C CB  . PRO A 105 ? 0.3133 0.2666 0.1619 0.0157  0.0449  -0.0135 105 PRO A CB  
1972 C CG  . PRO A 105 ? 0.3958 0.6526 0.2838 0.2568  0.1277  0.1997  105 PRO A CG  
1973 C CD  . PRO A 105 ? 0.2247 0.3460 0.1957 0.0572  0.0225  0.0355  105 PRO A CD  
1981 N N   . ASN A 106 ? 0.2435 0.1921 0.1461 0.0098  0.0321  0.0166  106 ASN A N   
1982 C CA  . ASN A 106 ? 0.1640 0.2645 0.1709 -0.0219 0.0567  0.0182  106 ASN A CA  
1983 C C   . ASN A 106 ? 0.2171 0.2797 0.1507 0.0477  0.0284  -0.0501 106 ASN A C   
1984 O O   . ASN A 106 ? 0.2700 0.2371 0.1846 -0.0386 0.0639  -0.0308 106 ASN A O   
1985 C CB  . ASN A 106 ? 0.2349 0.2771 0.1478 0.0364  0.0574  -0.0228 106 ASN A CB  
1986 C CG  . ASN A 106 ? 0.1761 0.2327 0.1835 -0.0661 0.0464  0.0153  106 ASN A CG  
1987 O OD1 . ASN A 106 ? 0.2583 0.2097 0.1811 -0.0227 0.0526  0.0196  106 ASN A OD1 
1988 N ND2 . ASN A 106 ? 0.2298 0.2789 0.1733 0.0074  0.0550  0.0136  106 ASN A ND2 
1995 N N   . THR A 107 ? 0.1611 0.2097 0.2012 0.0275  0.0601  -0.0128 107 THR A N   
1996 C CA  . THR A 107 ? 0.1699 0.2125 0.1945 0.0152  0.0244  0.0111  107 THR A CA  
1997 C C   . THR A 107 ? 0.2031 0.1748 0.1784 -0.0109 0.0451  -0.0081 107 THR A C   
1998 O O   . THR A 107 ? 0.2555 0.2691 0.2281 0.0527  0.0739  0.0479  107 THR A O   
1999 C CB  . THR A 107 ? 0.2973 0.1840 0.1749 0.0611  0.0300  -0.0068 107 THR A CB  
2000 O OG1 . THR A 107 ? 0.2494 0.1897 0.2403 0.0292  0.0124  -0.0173 107 THR A OG1 
2001 C CG2 . THR A 107 ? 0.3660 0.1621 0.2226 0.0235  0.0271  0.0462  107 THR A CG2 
2009 N N   . ASN A 108 ? 0.2098 0.1734 0.1918 0.0340  0.0512  0.0141  108 ASN A N   
2010 C CA  . ASN A 108 ? 0.2010 0.1854 0.1731 -0.0172 0.0582  -0.0135 108 ASN A CA  
2011 C C   . ASN A 108 ? 0.2521 0.1590 0.1456 0.0265  0.0362  0.0068  108 ASN A C   
2012 O O   . ASN A 108 ? 0.2291 0.2334 0.2304 -0.0605 0.0370  -0.0396 108 ASN A O   
2013 C CB  . ASN A 108 ? 0.2179 0.1556 0.2258 -0.0263 0.0147  -0.0059 108 ASN A CB  
2014 C CG  . ASN A 108 ? 0.2839 0.1267 0.1937 -0.0176 -0.0189 -0.0317 108 ASN A CG  
2015 O OD1 . ASN A 108 ? 0.2235 0.2209 0.2121 -0.0658 0.0391  -0.0541 108 ASN A OD1 
2016 N ND2 . ASN A 108 ? 0.2154 0.2525 0.1868 -0.0185 0.0611  -0.0126 108 ASN A ND2 
2023 N N   . GLY A 109 ? 0.2319 0.2104 0.1531 -0.0361 0.0531  -0.0172 109 GLY A N   
2024 C CA  . GLY A 109 ? 0.2314 0.1595 0.1566 -0.0225 0.0341  -0.0017 109 GLY A CA  
2025 C C   . GLY A 109 ? 0.2059 0.1386 0.2172 0.0413  0.0410  -0.0456 109 GLY A C   
2026 O O   . GLY A 109 ? 0.1897 0.1864 0.2469 -0.0053 0.0732  -0.0126 109 GLY A O   
2030 N N   . SER A 110 ? 0.1680 0.1702 0.1500 -0.0029 0.0205  -0.0241 110 SER A N   
2031 C CA  . SER A 110 ? 0.1777 0.1374 0.1507 -0.0304 0.0148  0.0058  110 SER A CA  
2032 C C   . SER A 110 ? 0.1770 0.1492 0.1471 0.0176  0.0077  -0.0477 110 SER A C   
2033 O O   . SER A 110 ? 0.2138 0.1545 0.1767 -0.0255 0.0017  0.0236  110 SER A O   
2034 C CB  . SER A 110 ? 0.2131 0.1861 0.1861 -0.0002 0.0243  -0.0283 110 SER A CB  
2035 O OG  . SER A 110 ? 0.2253 0.1541 0.1761 -0.0014 0.0293  -0.0425 110 SER A OG  
2041 N N   . GLN A 111 ? 0.1648 0.1479 0.1449 -0.0365 0.0091  -0.0155 111 GLN A N   
2042 C CA  . GLN A 111 ? 0.1590 0.1596 0.1433 -0.0128 -0.0180 0.0302  111 GLN A CA  
2043 C C   . GLN A 111 ? 0.2194 0.0751 0.1487 0.0033  -0.0104 -0.0471 111 GLN A C   
2044 O O   . GLN A 111 ? 0.1972 0.1622 0.1699 0.0138  0.0262  -0.0264 111 GLN A O   
2045 C CB  . GLN A 111 ? 0.2043 0.1479 0.1380 -0.0052 0.0282  -0.0274 111 GLN A CB  
2046 C CG  . GLN A 111 ? 0.2287 0.1355 0.1871 0.0225  -0.0127 -0.0530 111 GLN A CG  
2047 C CD  . GLN A 111 ? 0.2386 0.1306 0.2219 0.0172  0.0078  -0.0316 111 GLN A CD  
2048 O OE1 . GLN A 111 ? 0.2778 0.1405 0.3141 0.0078  -0.0607 -0.0291 111 GLN A OE1 
2049 N NE2 . GLN A 111 ? 0.2866 0.1607 0.2260 0.0219  -0.0092 0.0083  111 GLN A NE2 
2058 N N   A PHE A 112 ? 0.1583 0.1089 0.1901 -0.0530 -0.0571 -0.0301 112 PHE A N   
2059 N N   B PHE A 112 ? 0.2485 0.2021 0.2149 -0.0103 0.1867  0.0620  112 PHE A N   
2060 C CA  A PHE A 112 ? 0.3783 0.0337 0.2686 -0.0398 0.1204  0.0016  112 PHE A CA  
2061 C CA  B PHE A 112 ? 0.0244 0.2222 0.1290 0.0193  -0.0069 -0.0765 112 PHE A CA  
2062 C C   A PHE A 112 ? 0.1900 0.2696 0.0722 0.1708  0.0367  0.0021  112 PHE A C   
2063 C C   B PHE A 112 ? 0.2417 0.1428 0.3417 -0.1705 -0.0777 -0.0025 112 PHE A C   
2064 O O   A PHE A 112 ? 0.1317 0.1141 0.2029 0.0133  0.0657  -0.0688 112 PHE A O   
2065 O O   B PHE A 112 ? 0.2765 0.1920 0.2224 -0.0549 -0.0723 0.1419  112 PHE A O   
2066 C CB  A PHE A 112 ? 0.1715 0.1796 0.2129 0.0924  -0.0164 -0.0197 112 PHE A CB  
2067 C CB  B PHE A 112 ? 0.2900 0.1664 0.1336 -0.1826 0.0442  0.0413  112 PHE A CB  
2068 C CG  A PHE A 112 ? 0.1936 0.2151 0.1108 0.0017  -0.0511 0.0498  112 PHE A CG  
2069 C CG  B PHE A 112 ? 0.1505 0.0671 0.3392 -0.0277 0.0655  -0.1043 112 PHE A CG  
2070 C CD1 A PHE A 112 ? 0.3891 0.2049 0.0628 -0.0211 -0.0548 -0.0268 112 PHE A CD1 
2071 C CD1 B PHE A 112 ? 0.1468 0.1171 0.3751 -0.0856 0.1114  -0.0073 112 PHE A CD1 
2072 C CD2 A PHE A 112 ? 0.2339 0.2341 0.1276 -0.1029 -0.0662 0.0916  112 PHE A CD2 
2073 C CD2 B PHE A 112 ? 0.2525 0.1688 0.2701 0.1500  0.0257  -0.0756 112 PHE A CD2 
2074 C CE1 A PHE A 112 ? 0.3920 0.2773 0.1373 0.0414  -0.0442 0.0301  112 PHE A CE1 
2075 C CE1 B PHE A 112 ? 0.4113 0.1099 0.1228 -0.1365 -0.0864 -0.0447 112 PHE A CE1 
2076 C CE2 A PHE A 112 ? 0.3545 0.2449 0.1576 0.0665  0.0806  0.1070  112 PHE A CE2 
2077 C CE2 B PHE A 112 ? 0.2971 0.0664 0.2541 0.0608  -0.2069 -0.1056 112 PHE A CE2 
2078 C CZ  A PHE A 112 ? 0.1732 0.2415 0.2069 -0.0636 0.0516  0.1207  112 PHE A CZ  
2079 C CZ  B PHE A 112 ? 0.3918 0.2065 0.2237 0.0575  -0.0549 -0.0308 112 PHE A CZ  
2098 N N   A PHE A 113 ? 0.0962 0.0910 0.1702 -0.0088 0.0638  -0.0737 113 PHE A N   
2099 N N   B PHE A 113 ? 0.5220 0.1712 0.1610 -0.0675 -0.1633 0.0540  113 PHE A N   
2100 C CA  A PHE A 113 ? 0.1465 0.1150 0.1600 -0.0684 0.0354  -0.0298 113 PHE A CA  
2101 C CA  B PHE A 113 ? 0.3095 0.1060 0.1297 0.1211  0.0639  -0.0297 113 PHE A CA  
2102 C C   A PHE A 113 ? 0.2521 0.0570 0.1402 -0.0319 0.0862  0.0125  113 PHE A C   
2103 C C   B PHE A 113 ? 0.2314 0.0729 0.2280 -0.0565 -0.0933 -0.0687 113 PHE A C   
2104 O O   A PHE A 113 ? 0.3335 0.1125 0.1896 0.0878  0.0357  0.0393  113 PHE A O   
2105 O O   B PHE A 113 ? 0.0681 0.2360 0.2085 0.0012  0.0612  -0.0545 113 PHE A O   
2106 C CB  A PHE A 113 ? 0.1890 0.1458 0.1405 0.0022  0.0144  0.0018  113 PHE A CB  
2107 C CB  B PHE A 113 ? 0.1116 0.0851 0.2152 0.0113  0.0193  -0.0723 113 PHE A CB  
2108 C CG  A PHE A 113 ? 0.2543 0.1293 0.1546 -0.1028 -0.0062 0.0309  113 PHE A CG  
2109 C CG  B PHE A 113 ? 0.4156 0.1061 0.3180 -0.2006 0.0047  -0.0061 113 PHE A CG  
2110 C CD1 A PHE A 113 ? 0.2486 0.0875 0.1601 -0.1062 -0.0918 0.0052  113 PHE A CD1 
2111 C CD1 B PHE A 113 ? 0.4450 0.1592 0.1418 0.1532  -0.0061 -0.0100 113 PHE A CD1 
2112 C CD2 A PHE A 113 ? 0.2374 0.1406 0.1676 -0.0407 0.0045  0.0007  113 PHE A CD2 
2113 C CD2 B PHE A 113 ? 0.0947 0.2477 0.2651 -0.0058 -0.1203 -0.1405 113 PHE A CD2 
2114 C CE1 A PHE A 113 ? 0.1372 0.2530 0.1592 -0.1334 -0.0261 -0.0094 113 PHE A CE1 
2115 C CE1 B PHE A 113 ? 0.1398 0.2456 0.4612 0.0618  0.0186  -0.0554 113 PHE A CE1 
2116 C CE2 A PHE A 113 ? 0.3209 0.1746 0.1709 -0.0057 0.0313  0.0219  113 PHE A CE2 
2117 C CE2 B PHE A 113 ? 0.2550 0.6024 0.1424 0.2383  -0.0550 -0.0441 113 PHE A CE2 
2118 C CZ  A PHE A 113 ? 0.1691 0.2253 0.1633 -0.0535 -0.0029 0.0094  113 PHE A CZ  
2119 C CZ  B PHE A 113 ? 0.4789 0.3138 0.1569 -0.2177 -0.0226 0.0759  113 PHE A CZ  
2138 N N   A ILE A 114 ? 0.1006 0.1256 0.1788 0.0646  0.0312  0.0423  114 ILE A N   
2139 N N   B ILE A 114 ? 0.4870 0.1363 0.1152 -0.2396 -0.0100 0.0364  114 ILE A N   
2140 C CA  A ILE A 114 ? 0.1350 0.1968 0.1090 0.0729  -0.0405 -0.0194 114 ILE A CA  
2141 C CA  B ILE A 114 ? 0.6325 0.2859 0.1181 -0.3478 0.1072  0.0289  114 ILE A CA  
2142 C C   A ILE A 114 ? 0.3202 0.0814 0.0759 0.1340  0.0265  -0.0218 114 ILE A C   
2143 C C   B ILE A 114 ? 0.4629 0.3688 0.2223 -0.3803 -0.0434 -0.0516 114 ILE A C   
2144 O O   A ILE A 114 ? 0.3830 0.1053 0.1840 0.0743  0.0435  -0.0770 114 ILE A O   
2145 O O   B ILE A 114 ? 0.0604 0.2102 0.2729 -0.0345 -0.0371 0.1391  114 ILE A O   
2146 C CB  A ILE A 114 ? 0.1476 0.0593 0.2578 -0.0144 0.0475  0.0559  114 ILE A CB  
2147 C CB  B ILE A 114 ? 0.3691 0.2888 0.1601 -0.0799 -0.1091 0.0847  114 ILE A CB  
2148 C CG1 A ILE A 114 ? 0.1788 0.1805 0.1260 -0.0264 -0.0092 -0.0092 114 ILE A CG1 
2149 C CG1 B ILE A 114 ? 0.2494 0.4626 0.2715 0.1302  0.1798  0.1006  114 ILE A CG1 
2150 C CG2 A ILE A 114 ? 0.1745 0.2209 0.3460 -0.0392 -0.1047 0.0331  114 ILE A CG2 
2151 C CG2 B ILE A 114 ? 0.2105 0.2240 0.1126 -0.0296 0.0480  0.1204  114 ILE A CG2 
2152 C CD1 A ILE A 114 ? 0.1768 0.1871 0.2027 0.0527  -0.0410 0.0140  114 ILE A CD1 
2153 C CD1 B ILE A 114 ? 0.4139 0.1976 0.2838 0.1850  0.0447  0.0357  114 ILE A CD1 
2176 N N   . CYS A 115 ? 0.1898 0.1479 0.1903 -0.0116 -0.0216 -0.0099 115 CYS A N   
2177 C CA  . CYS A 115 ? 0.1689 0.2029 0.1578 0.0007  -0.0003 -0.0423 115 CYS A CA  
2178 C C   . CYS A 115 ? 0.2217 0.2183 0.1391 -0.0742 0.0023  -0.0267 115 CYS A C   
2179 O O   . CYS A 115 ? 0.2946 0.2064 0.2247 -0.0205 -0.0385 0.0209  115 CYS A O   
2180 C CB  . CYS A 115 ? 0.2694 0.2676 0.1567 0.0284  -0.0013 -0.0420 115 CYS A CB  
2181 S SG  . CYS A 115 ? 0.2660 0.3498 0.1972 -0.0393 0.0285  0.0114  115 CYS A SG  
2188 N N   . THR A 116 ? 0.1966 0.1745 0.1799 -0.0634 -0.0090 -0.0191 116 THR A N   
2189 C CA  . THR A 116 ? 0.2644 0.2002 0.2025 -0.0456 -0.0442 -0.0355 116 THR A CA  
2190 C C   . THR A 116 ? 0.2898 0.2557 0.2149 -0.0446 0.0440  0.0166  116 THR A C   
2191 O O   . THR A 116 ? 0.3868 0.3799 0.2813 -0.1866 0.0876  -0.0638 116 THR A O   
2192 C CB  . THR A 116 ? 0.2388 0.2008 0.2792 0.0121  0.0498  -0.0439 116 THR A CB  
2193 O OG1 . THR A 116 ? 0.2351 0.2937 0.2543 0.0265  0.0132  0.0243  116 THR A OG1 
2194 C CG2 . THR A 116 ? 0.2910 0.3069 0.1873 -0.0164 -0.0042 -0.0266 116 THR A CG2 
2202 N N   . ALA A 117 ? 0.2916 0.2431 0.1859 -0.0891 -0.0107 -0.0399 117 ALA A N   
2203 C CA  . ALA A 117 ? 0.2596 0.2617 0.2279 -0.0980 -0.0114 -0.0391 117 ALA A CA  
2204 C C   . ALA A 117 ? 0.3082 0.2478 0.1982 -0.0532 0.0492  -0.0344 117 ALA A C   
2205 O O   . ALA A 117 ? 0.2531 0.2432 0.2103 -0.0501 -0.0059 -0.0182 117 ALA A O   
2206 C CB  . ALA A 117 ? 0.3925 0.4705 0.2693 -0.1320 -0.0009 -0.1917 117 ALA A CB  
2212 N N   . LYS A 118 ? 0.3625 0.2475 0.2185 -0.0940 0.0593  -0.0653 118 LYS A N   
2213 C CA  . LYS A 118 ? 0.2541 0.2509 0.2199 0.0254  -0.0140 -0.0738 118 LYS A CA  
2214 C C   . LYS A 118 ? 0.3503 0.3209 0.1787 0.0859  -0.1035 -0.0653 118 LYS A C   
2215 O O   . LYS A 118 ? 0.3195 0.2976 0.2318 -0.0621 -0.0337 0.0110  118 LYS A O   
2216 C CB  . LYS A 118 ? 0.4123 0.2711 0.2492 -0.1013 0.0466  -0.0973 118 LYS A CB  
2217 C CG  . LYS A 118 ? 0.4700 0.3094 0.2486 0.0148  0.0112  -0.0177 118 LYS A CG  
2218 C CD  . LYS A 118 ? 0.6672 0.2331 0.4187 -0.0592 0.2477  -0.1489 118 LYS A CD  
2219 C CE  . LYS A 118 ? 1.0215 0.8284 0.7891 -0.2763 0.1201  0.1749  118 LYS A CE  
2220 N NZ  . LYS A 118 ? 1.4548 1.2022 1.3822 -0.3293 0.0141  -0.0790 118 LYS A NZ  
2234 N N   . THR A 119 ? 0.2513 0.2111 0.2743 -0.0265 -0.0214 -0.0473 119 THR A N   
2235 C CA  . THR A 119 ? 0.2162 0.2246 0.2053 -0.0245 -0.0206 -0.0225 119 THR A CA  
2236 C C   . THR A 119 ? 0.1986 0.2114 0.2062 -0.0171 0.0306  -0.0165 119 THR A C   
2237 O O   . THR A 119 ? 0.2280 0.2299 0.2030 -0.0473 -0.0093 0.0017  119 THR A O   
2238 C CB  . THR A 119 ? 0.1893 0.1999 0.2469 -0.0026 0.0053  0.0209  119 THR A CB  
2239 O OG1 . THR A 119 ? 0.2532 0.2305 0.2201 0.0152  -0.0286 -0.0444 119 THR A OG1 
2240 C CG2 . THR A 119 ? 0.2400 0.2762 0.2403 0.0096  0.0185  0.0240  119 THR A CG2 
2248 N N   . GLU A 120 ? 0.2707 0.1857 0.2220 -0.0135 0.0136  -0.0568 120 GLU A N   
2249 C CA  . GLU A 120 ? 0.3146 0.1907 0.2412 0.0750  -0.0132 -0.0498 120 GLU A CA  
2250 C C   . GLU A 120 ? 0.2078 0.2248 0.2102 0.0751  -0.0478 -0.0892 120 GLU A C   
2251 O O   . GLU A 120 ? 0.2276 0.2897 0.2219 0.0291  0.0128  -0.0570 120 GLU A O   
2252 C CB  . GLU A 120 ? 0.3186 0.2223 0.3421 -0.0387 0.0677  -0.0588 120 GLU A CB  
2253 C CG  . GLU A 120 ? 0.9054 0.4962 0.3864 -0.0582 -0.0608 -0.2472 120 GLU A CG  
2254 C CD  . GLU A 120 ? 0.8664 0.6005 0.6623 -0.2277 -0.0427 -0.1980 120 GLU A CD  
2255 O OE1 . GLU A 120 ? 0.4945 0.4022 0.3825 -0.1374 -0.0765 -0.0867 120 GLU A OE1 
2256 O OE2 . GLU A 120 ? 1.1800 1.0752 0.4323 -0.1707 -0.2529 -0.2271 120 GLU A OE2 
2263 N N   . TRP A 121 ? 0.2103 0.2202 0.1930 -0.0062 -0.0184 -0.0206 121 TRP A N   
2264 C CA  . TRP A 121 ? 0.2133 0.2391 0.1725 -0.0220 -0.0120 -0.0368 121 TRP A CA  
2265 C C   . TRP A 121 ? 0.2237 0.1703 0.2348 -0.0183 0.0030  0.0091  121 TRP A C   
2266 O O   . TRP A 121 ? 0.2562 0.2346 0.2292 -0.0194 -0.0219 0.0292  121 TRP A O   
2267 C CB  . TRP A 121 ? 0.2433 0.2808 0.1928 -0.0297 -0.0416 0.0160  121 TRP A CB  
2268 C CG  . TRP A 121 ? 0.2167 0.3337 0.1844 0.0548  -0.0754 -0.0369 121 TRP A CG  
2269 C CD1 . TRP A 121 ? 0.2719 0.2707 0.2727 0.0580  -0.1291 -0.0317 121 TRP A CD1 
2270 C CD2 . TRP A 121 ? 0.1962 0.2881 0.2258 0.0318  -0.0166 0.0169  121 TRP A CD2 
2271 N NE1 . TRP A 121 ? 0.2502 0.3685 0.2439 0.0623  -0.0416 -0.0660 121 TRP A NE1 
2272 C CE2 . TRP A 121 ? 0.1889 0.4532 0.2022 0.0240  -0.0262 -0.0692 121 TRP A CE2 
2273 C CE3 . TRP A 121 ? 0.2450 0.2877 0.2070 0.0188  -0.0049 0.0261  121 TRP A CE3 
2274 C CZ2 . TRP A 121 ? 0.2246 0.4522 0.2567 0.1064  -0.0351 -0.0232 121 TRP A CZ2 
2275 C CZ3 . TRP A 121 ? 0.2132 0.3911 0.3439 -0.0534 -0.0212 0.1335  121 TRP A CZ3 
2276 C CH2 . TRP A 121 ? 0.3036 0.5119 0.2844 0.1590  -0.0458 0.0101  121 TRP A CH2 
2287 N N   . LEU A 122 ? 0.2154 0.2001 0.1785 -0.0021 -0.0309 -0.0203 122 LEU A N   
2288 C CA  . LEU A 122 ? 0.1880 0.2061 0.1930 0.0556  -0.0090 0.0012  122 LEU A CA  
2289 C C   . LEU A 122 ? 0.2231 0.1609 0.1677 0.0168  -0.0160 0.0123  122 LEU A C   
2290 O O   . LEU A 122 ? 0.1875 0.1940 0.2001 0.0156  0.0205  -0.0229 122 LEU A O   
2291 C CB  . LEU A 122 ? 0.1978 0.1642 0.1857 0.0413  -0.0026 -0.0436 122 LEU A CB  
2292 C CG  . LEU A 122 ? 0.1477 0.1985 0.2648 0.0237  0.0112  -0.0694 122 LEU A CG  
2293 C CD1 . LEU A 122 ? 0.2576 0.3915 0.2708 -0.0355 0.0801  -0.1281 122 LEU A CD1 
2294 C CD2 . LEU A 122 ? 0.1863 0.2140 0.3170 0.0160  -0.0435 -0.0511 122 LEU A CD2 
2306 N N   . ASP A 123 ? 0.1898 0.1768 0.2094 0.0112  0.0341  -0.0126 123 ASP A N   
2307 C CA  . ASP A 123 ? 0.2243 0.1858 0.1786 0.0220  0.0212  -0.0364 123 ASP A CA  
2308 C C   . ASP A 123 ? 0.1969 0.2124 0.1682 0.0021  0.0349  -0.0033 123 ASP A C   
2309 O O   . ASP A 123 ? 0.2756 0.2619 0.1691 -0.0019 0.0132  0.0189  123 ASP A O   
2310 C CB  . ASP A 123 ? 0.2410 0.2415 0.1668 0.0798  0.0165  -0.0291 123 ASP A CB  
2311 C CG  . ASP A 123 ? 0.2711 0.1677 0.1878 0.0202  0.0117  -0.0010 123 ASP A CG  
2312 O OD1 . ASP A 123 ? 0.3011 0.1984 0.1669 0.0263  0.0247  -0.0155 123 ASP A OD1 
2313 O OD2 . ASP A 123 ? 0.3140 0.1731 0.2812 -0.0051 0.0188  -0.0596 123 ASP A OD2 
2318 N N   . GLY A 124 ? 0.1610 0.1938 0.2141 0.0119  0.0225  -0.0166 124 GLY A N   
2319 C CA  . GLY A 124 ? 0.1927 0.2602 0.1541 -0.0049 0.0485  -0.0281 124 GLY A CA  
2320 C C   . GLY A 124 ? 0.1996 0.2472 0.1213 0.0412  0.0265  0.0021  124 GLY A C   
2321 O O   . GLY A 124 ? 0.2687 0.2854 0.2088 -0.0108 0.0618  0.0589  124 GLY A O   
2325 N N   . LYS A 125 ? 0.2214 0.1967 0.1655 0.0143  0.0383  -0.0139 125 LYS A N   
2326 C CA  . LYS A 125 ? 0.2577 0.2246 0.1459 0.0470  -0.0204 0.0092  125 LYS A CA  
2327 C C   . LYS A 125 ? 0.1736 0.1768 0.2154 -0.0070 0.0080  0.0489  125 LYS A C   
2328 O O   . LYS A 125 ? 0.2513 0.1662 0.1728 -0.0124 0.0159  0.0277  125 LYS A O   
2329 C CB  . LYS A 125 ? 0.5070 0.3940 0.2315 0.2399  -0.1167 -0.0588 125 LYS A CB  
2330 C CG  . LYS A 125 ? 0.3269 0.6419 0.8072 -0.2388 -0.1637 0.2815  125 LYS A CG  
2331 C CD  . LYS A 125 ? 0.4048 0.7557 0.8538 0.1473  0.1232  0.4449  125 LYS A CD  
2332 C CE  . LYS A 125 ? 0.6283 0.7796 0.7816 0.5125  -0.1574 0.1661  125 LYS A CE  
2333 N NZ  . LYS A 125 ? 0.9659 0.9082 1.0616 0.4263  -0.0523 0.3873  125 LYS A NZ  
2347 N N   . HIS A 126 ? 0.1530 0.1634 0.1566 0.0349  0.0199  0.0145  126 HIS A N   
2348 C CA  . HIS A 126 ? 0.2254 0.1181 0.1346 0.0074  0.0115  0.0175  126 HIS A CA  
2349 C C   . HIS A 126 ? 0.1447 0.1326 0.1898 -0.0030 0.0010  0.0433  126 HIS A C   
2350 O O   . HIS A 126 ? 0.2041 0.1166 0.2332 0.0171  -0.0046 -0.0116 126 HIS A O   
2351 C CB  . HIS A 126 ? 0.1987 0.1735 0.1353 -0.0360 0.0437  -0.0201 126 HIS A CB  
2352 C CG  . HIS A 126 ? 0.1117 0.1455 0.2520 0.0552  0.0104  0.0547  126 HIS A CG  
2353 N ND1 . HIS A 126 ? 0.2199 0.1472 0.1784 0.0307  0.0429  -0.0300 126 HIS A ND1 
2354 C CD2 . HIS A 126 ? 0.1643 0.2798 0.1810 0.0538  -0.0403 0.0057  126 HIS A CD2 
2355 C CE1 . HIS A 126 ? 0.2332 0.2321 0.1883 0.0856  -0.0301 0.0142  126 HIS A CE1 
2356 N NE2 . HIS A 126 ? 0.2377 0.2305 0.2496 0.0875  0.0288  0.0358  126 HIS A NE2 
2363 N N   A VAL A 127 ? 0.1158 0.1400 0.2186 0.0274  -0.0576 0.0732  127 VAL A N   
2364 N N   B VAL A 127 ? 0.2123 0.3421 0.1932 -0.0683 0.1115  -0.2348 127 VAL A N   
2365 C CA  A VAL A 127 ? 0.3154 0.1092 0.1507 0.0172  0.0780  0.0314  127 VAL A CA  
2366 C CA  B VAL A 127 ? 0.0373 0.2492 0.1871 0.0711  -0.0367 -0.0253 127 VAL A CA  
2367 C C   A VAL A 127 ? 0.2096 0.0876 0.1761 0.0229  -0.0495 0.0076  127 VAL A C   
2368 C C   B VAL A 127 ? 0.1136 0.2678 0.2083 -0.1288 0.0640  0.0517  127 VAL A C   
2369 O O   A VAL A 127 ? 0.1927 0.1230 0.2195 0.0244  0.0489  0.0295  127 VAL A O   
2370 O O   B VAL A 127 ? 0.1954 0.3273 0.0683 0.0193  0.0240  -0.0276 127 VAL A O   
2371 C CB  A VAL A 127 ? 0.1394 0.1584 0.1848 -0.0366 -0.0105 0.0145  127 VAL A CB  
2372 C CB  B VAL A 127 ? 0.1931 0.4018 0.2585 0.0978  0.0329  -0.2238 127 VAL A CB  
2373 C CG1 A VAL A 127 ? 0.1050 0.1690 0.1593 0.0698  -0.0061 0.0529  127 VAL A CG1 
2374 C CG1 B VAL A 127 ? 0.0976 0.3638 0.3509 -0.1361 0.1288  -0.0966 127 VAL A CG1 
2375 C CG2 A VAL A 127 ? 0.2313 0.1947 0.1834 0.0397  0.0052  0.0821  127 VAL A CG2 
2376 C CG2 B VAL A 127 ? 0.5293 0.7741 0.6056 -0.1720 -0.1584 -0.0407 127 VAL A CG2 
2395 N N   A VAL A 128 ? 0.2254 0.1272 0.1979 0.0207  -0.0380 0.0942  128 VAL A N   
2396 N N   B VAL A 128 ? 0.0688 0.3114 0.1754 -0.1274 0.0977  -0.1861 128 VAL A N   
2397 C CA  A VAL A 128 ? 0.1377 0.1037 0.1602 0.0089  0.0023  -0.0154 128 VAL A CA  
2398 C CA  B VAL A 128 ? 0.3318 0.2264 0.3870 0.2503  0.0377  -0.0659 128 VAL A CA  
2399 C C   A VAL A 128 ? 0.1993 0.2210 0.1904 0.1005  -0.0878 -0.1310 128 VAL A C   
2400 C C   B VAL A 128 ? 0.0984 0.2338 0.2025 0.1428  0.1312  0.2022  128 VAL A C   
2401 O O   A VAL A 128 ? 0.2013 0.1929 0.1670 0.0534  0.0370  -0.0088 128 VAL A O   
2402 O O   B VAL A 128 ? 0.1490 0.2756 0.2906 0.1794  -0.0209 0.0805  128 VAL A O   
2403 C CB  A VAL A 128 ? 0.1571 0.1231 0.1459 0.0134  0.0096  -0.0370 128 VAL A CB  
2404 C CB  B VAL A 128 ? 0.3253 0.2384 0.3909 0.2016  0.1508  -0.0684 128 VAL A CB  
2405 C CG1 A VAL A 128 ? 0.1620 0.0904 0.2130 0.0424  0.0126  0.0161  128 VAL A CG1 
2406 C CG1 B VAL A 128 ? 0.0997 0.1030 0.3778 -0.0506 0.1314  0.0034  128 VAL A CG1 
2407 C CG2 A VAL A 128 ? 0.2621 0.2075 0.1485 0.0318  -0.0703 -0.0450 128 VAL A CG2 
2408 C CG2 B VAL A 128 ? 0.7399 0.6711 0.6787 -0.0060 0.0037  -0.0287 128 VAL A CG2 
2427 N N   . PHE A 129 ? 0.1673 0.1532 0.1675 0.0267  0.0045  -0.0044 129 PHE A N   
2428 C CA  . PHE A 129 ? 0.1705 0.2050 0.1838 0.0294  0.0163  -0.0085 129 PHE A CA  
2429 C C   . PHE A 129 ? 0.1449 0.1467 0.1846 -0.0033 0.0458  0.0154  129 PHE A C   
2430 O O   . PHE A 129 ? 0.1958 0.2224 0.2085 0.0324  -0.0381 0.0270  129 PHE A O   
2431 C CB  . PHE A 129 ? 0.1890 0.2057 0.1867 0.0387  0.0234  0.0215  129 PHE A CB  
2432 C CG  . PHE A 129 ? 0.1970 0.1891 0.1554 0.0011  0.0066  -0.0159 129 PHE A CG  
2433 C CD1 . PHE A 129 ? 0.1903 0.1980 0.2314 0.0222  -0.0509 0.0044  129 PHE A CD1 
2434 C CD2 . PHE A 129 ? 0.2726 0.2408 0.1223 0.0367  -0.0155 0.0224  129 PHE A CD2 
2435 C CE1 . PHE A 129 ? 0.2003 0.1431 0.2100 0.0360  -0.0190 0.0400  129 PHE A CE1 
2436 C CE2 . PHE A 129 ? 0.3450 0.2007 0.1547 0.0040  0.0215  -0.0139 129 PHE A CE2 
2437 C CZ  . PHE A 129 ? 0.3555 0.1984 0.1269 0.0457  -0.0071 0.0193  129 PHE A CZ  
2448 N N   . GLY A 130 ? 0.2107 0.1540 0.1542 -0.0046 0.0346  0.0443  130 GLY A N   
2449 C CA  . GLY A 130 ? 0.1651 0.1725 0.2156 0.0228  0.0249  0.0248  130 GLY A CA  
2450 C C   . GLY A 130 ? 0.2243 0.1142 0.1538 -0.0085 0.0631  0.0240  130 GLY A C   
2451 O O   . GLY A 130 ? 0.2457 0.1899 0.1867 0.0349  -0.0104 0.0143  130 GLY A O   
2455 N N   . LYS A 131 ? 0.2547 0.1663 0.1452 0.0077  0.0101  0.0193  131 LYS A N   
2456 C CA  . LYS A 131 ? 0.2653 0.2249 0.1776 0.0084  0.0443  0.0383  131 LYS A CA  
2457 C C   . LYS A 131 ? 0.2482 0.1697 0.1590 0.0264  -0.0216 -0.0065 131 LYS A C   
2458 O O   . LYS A 131 ? 0.2411 0.2436 0.1876 -0.0104 0.0081  0.0227  131 LYS A O   
2459 C CB  . LYS A 131 ? 0.2771 0.2007 0.2594 0.0618  0.0585  -0.0424 131 LYS A CB  
2460 C CG  . LYS A 131 ? 0.4492 0.4310 0.4013 0.0849  0.1225  -0.0996 131 LYS A CG  
2461 C CD  . LYS A 131 ? 0.9973 0.4799 0.9812 0.2458  -0.1360 -0.4949 131 LYS A CD  
2462 C CE  . LYS A 131 ? 1.2274 0.7957 1.1899 0.4721  -0.3866 0.0492  131 LYS A CE  
2463 N NZ  . LYS A 131 ? 1.3588 0.9293 1.3173 0.2790  -0.0117 -0.3034 131 LYS A NZ  
2477 N N   . VAL A 132 ? 0.2497 0.1534 0.1806 0.0388  -0.0161 0.0288  132 VAL A N   
2478 C CA  . VAL A 132 ? 0.2474 0.1466 0.2003 0.0101  -0.0008 0.0664  132 VAL A CA  
2479 C C   . VAL A 132 ? 0.2472 0.1924 0.2206 -0.0015 0.0167  0.0889  132 VAL A C   
2480 O O   . VAL A 132 ? 0.4371 0.1931 0.2054 0.0162  0.0249  -0.0077 132 VAL A O   
2481 C CB  . VAL A 132 ? 0.2580 0.1630 0.2131 -0.0029 -0.0054 0.0258  132 VAL A CB  
2482 C CG1 . VAL A 132 ? 0.2600 0.2626 0.1988 -0.0057 0.0237  0.0518  132 VAL A CG1 
2483 C CG2 . VAL A 132 ? 0.2569 0.1804 0.2214 0.0295  0.0100  0.0200  132 VAL A CG2 
2493 N N   . LYS A 133 ? 0.3051 0.1426 0.2087 0.0455  -0.0005 0.0359  133 LYS A N   
2494 C CA  . LYS A 133 ? 0.2935 0.2066 0.2512 0.0164  0.0064  0.0549  133 LYS A CA  
2495 C C   . LYS A 133 ? 0.4515 0.1317 0.2899 0.0187  -0.0196 0.0171  133 LYS A C   
2496 O O   . LYS A 133 ? 0.6446 0.2262 0.2833 -0.0910 0.0896  -0.0226 133 LYS A O   
2497 C CB  . LYS A 133 ? 0.4435 0.2515 0.3541 0.0965  -0.0590 0.0992  133 LYS A CB  
2498 C CG  . LYS A 133 ? 0.5654 0.6796 0.6150 0.0220  -0.1345 0.1151  133 LYS A CG  
2499 C CD  . LYS A 133 ? 0.6565 0.4240 0.8077 0.1917  -0.2405 0.0826  133 LYS A CD  
2500 C CE  . LYS A 133 ? 0.8782 1.0146 1.1175 0.2808  -0.3519 -0.0076 133 LYS A CE  
2501 N NZ  . LYS A 133 ? 0.9905 0.8756 1.1308 0.0435  -0.3639 -0.4851 133 LYS A NZ  
2515 N N   . GLU A 134 ? 0.3131 0.1603 0.3015 0.0431  0.0670  0.0529  134 GLU A N   
2516 C CA  . GLU A 134 ? 0.3433 0.1885 0.1723 -0.0220 -0.0188 0.0436  134 GLU A CA  
2517 C C   . GLU A 134 ? 0.3098 0.1888 0.1888 0.1120  0.0154  0.0073  134 GLU A C   
2518 O O   . GLU A 134 ? 0.3288 0.1366 0.2331 0.0191  0.0338  0.0133  134 GLU A O   
2519 C CB  . GLU A 134 ? 0.3671 0.2625 0.3343 0.0079  0.0677  0.0813  134 GLU A CB  
2520 C CG  . GLU A 134 ? 0.7145 0.4708 0.3297 0.3018  0.0644  0.0906  134 GLU A CG  
2521 C CD  . GLU A 134 ? 1.0670 0.3251 0.3382 -0.1845 0.1626  0.0837  134 GLU A CD  
2522 O OE1 . GLU A 134 ? 1.1799 0.7946 0.4061 0.6747  0.3295  0.2920  134 GLU A OE1 
2523 O OE2 . GLU A 134 ? 0.5836 0.6080 0.4449 0.3125  -0.2036 -0.1306 134 GLU A OE2 
2530 N N   . GLY A 135 ? 0.3153 0.2192 0.2001 -0.0049 0.0057  0.0483  135 GLY A N   
2531 C CA  . GLY A 135 ? 0.2647 0.2348 0.1753 -0.0299 0.0066  0.0376  135 GLY A CA  
2532 C C   . GLY A 135 ? 0.2593 0.1729 0.1627 -0.0270 0.0264  -0.0058 135 GLY A C   
2533 O O   . GLY A 135 ? 0.2933 0.1487 0.2317 0.0039  0.0205  -0.0102 135 GLY A O   
2537 N N   . MET A 136 ? 0.3504 0.1676 0.1487 -0.0009 0.0067  0.0147  136 MET A N   
2538 C CA  . MET A 136 ? 0.3450 0.1848 0.1161 -0.0655 0.0313  -0.0165 136 MET A CA  
2539 C C   . MET A 136 ? 0.3283 0.1364 0.1377 -0.0753 0.0270  0.0217  136 MET A C   
2540 O O   . MET A 136 ? 0.3872 0.1802 0.1755 0.0175  0.0108  0.0596  136 MET A O   
2541 C CB  . MET A 136 ? 0.4035 0.2677 0.1503 -0.0499 0.0011  -0.0045 136 MET A CB  
2542 C CG  . MET A 136 ? 0.5971 0.3188 0.1621 -0.0766 0.0287  -0.0630 136 MET A CG  
2543 S SD  . MET A 136 ? 0.3845 0.3204 0.2222 -0.0534 0.0207  0.0483  136 MET A SD  
2544 C CE  . MET A 136 ? 0.3943 0.4115 0.3384 -0.0551 -0.0786 0.0073  136 MET A CE  
2554 N N   . ASN A 137 ? 0.3549 0.1663 0.1640 -0.0323 0.0444  0.0318  137 ASN A N   
2555 C CA  . ASN A 137 ? 0.4504 0.1246 0.1855 -0.0722 0.0561  0.0053  137 ASN A CA  
2556 C C   . ASN A 137 ? 0.3943 0.3070 0.1361 -0.2214 -0.0535 0.0713  137 ASN A C   
2557 O O   . ASN A 137 ? 0.3462 0.2408 0.2217 -0.0806 -0.0206 0.0342  137 ASN A O   
2558 C CB  . ASN A 137 ? 0.3477 0.1969 0.1968 -0.0580 -0.0194 0.0258  137 ASN A CB  
2559 C CG  . ASN A 137 ? 0.2917 0.1712 0.3014 -0.0629 0.0804  0.0528  137 ASN A CG  
2560 O OD1 . ASN A 137 ? 0.3299 0.2454 0.1959 -0.0337 0.0178  0.0628  137 ASN A OD1 
2561 N ND2 . ASN A 137 ? 0.2582 0.2890 0.2938 -0.0530 -0.0132 0.0903  137 ASN A ND2 
2568 N N   . ILE A 138 ? 0.3015 0.1514 0.1405 -0.0083 0.0022  0.0090  138 ILE A N   
2569 C CA  . ILE A 138 ? 0.2561 0.2251 0.1143 -0.0233 0.0512  -0.0051 138 ILE A CA  
2570 C C   . ILE A 138 ? 0.2627 0.2973 0.0915 -0.0606 0.0322  0.0642  138 ILE A C   
2571 O O   . ILE A 138 ? 0.2798 0.2093 0.1697 0.0018  0.0096  0.0443  138 ILE A O   
2572 C CB  . ILE A 138 ? 0.3980 0.1243 0.1447 -0.0369 -0.0200 0.0016  138 ILE A CB  
2573 C CG1 . ILE A 138 ? 0.3549 0.1686 0.1721 -0.0047 -0.0234 0.0330  138 ILE A CG1 
2574 C CG2 . ILE A 138 ? 0.2828 0.2123 0.2177 -0.0314 -0.0079 0.0276  138 ILE A CG2 
2575 C CD1 . ILE A 138 ? 0.4111 0.2813 0.1936 -0.0636 0.0314  0.0716  138 ILE A CD1 
2587 N N   . VAL A 139 ? 0.2668 0.1893 0.1202 -0.0737 0.0221  0.0448  139 VAL A N   
2588 C CA  . VAL A 139 ? 0.2254 0.1916 0.1251 -0.0503 0.0302  0.0370  139 VAL A CA  
2589 C C   . VAL A 139 ? 0.3299 0.1433 0.1837 -0.0494 0.0282  0.0192  139 VAL A C   
2590 O O   . VAL A 139 ? 0.2711 0.1938 0.2155 -0.0282 -0.0094 0.0443  139 VAL A O   
2591 C CB  . VAL A 139 ? 0.2927 0.2147 0.1416 -0.0119 0.0306  0.0943  139 VAL A CB  
2592 C CG1 . VAL A 139 ? 0.2899 0.2670 0.1989 -0.0016 0.0241  0.0491  139 VAL A CG1 
2593 C CG2 . VAL A 139 ? 0.1913 0.3183 0.2271 -0.0523 -0.0200 0.0468  139 VAL A CG2 
2603 N N   . GLU A 140 ? 0.2402 0.1970 0.1956 -0.0365 -0.0335 0.0381  140 GLU A N   
2604 C CA  . GLU A 140 ? 0.2953 0.2052 0.1754 -0.0420 0.0067  0.0207  140 GLU A CA  
2605 C C   . GLU A 140 ? 0.2649 0.2111 0.1886 -0.0284 -0.0128 0.0519  140 GLU A C   
2606 O O   . GLU A 140 ? 0.2914 0.2613 0.2663 -0.0595 -0.0099 0.0467  140 GLU A O   
2607 C CB  . GLU A 140 ? 0.3371 0.2192 0.2712 -0.0728 -0.0333 0.0005  140 GLU A CB  
2608 C CG  . GLU A 140 ? 0.3175 0.3052 0.3119 -0.0268 0.0237  -0.0710 140 GLU A CG  
2609 C CD  . GLU A 140 ? 0.7604 0.2361 0.5805 -0.1545 -0.0001 -0.1771 140 GLU A CD  
2610 O OE1 . GLU A 140 ? 0.9946 0.2708 0.5850 -0.1393 0.2289  -0.0679 140 GLU A OE1 
2611 O OE2 . GLU A 140 ? 0.9726 0.2695 0.4203 -0.0229 0.0221  -0.0690 140 GLU A OE2 
2618 N N   . ALA A 141 ? 0.2409 0.2488 0.1911 -0.0572 0.0077  0.0452  141 ALA A N   
2619 C CA  . ALA A 141 ? 0.2647 0.2484 0.2496 -0.0738 0.0387  0.0842  141 ALA A CA  
2620 C C   . ALA A 141 ? 0.2507 0.3210 0.2172 -0.0373 0.0539  0.0592  141 ALA A C   
2621 O O   . ALA A 141 ? 0.2746 0.2988 0.3113 -0.0447 0.0154  0.0303  141 ALA A O   
2622 C CB  . ALA A 141 ? 0.3305 0.3081 0.2527 -0.0319 0.1051  0.0513  141 ALA A CB  
2628 N N   . MET A 142 ? 0.2788 0.2383 0.2114 0.0108  0.0294  0.0382  142 MET A N   
2629 C CA  . MET A 142 ? 0.1803 0.2352 0.3125 -0.0088 -0.0215 -0.0176 142 MET A CA  
2630 C C   . MET A 142 ? 0.1963 0.4217 0.1853 -0.0744 -0.0052 0.0054  142 MET A C   
2631 O O   . MET A 142 ? 0.2415 0.2571 0.3059 0.0092  0.0312  0.0337  142 MET A O   
2632 C CB  . MET A 142 ? 0.2961 0.2134 0.3058 0.0235  -0.0567 -0.0147 142 MET A CB  
2633 C CG  . MET A 142 ? 0.3142 0.2452 0.3593 -0.0279 0.0130  0.0566  142 MET A CG  
2634 S SD  . MET A 142 ? 0.3130 0.3807 0.3148 -0.0616 -0.0056 -0.0113 142 MET A SD  
2635 C CE  . MET A 142 ? 0.3196 0.1219 0.4575 -0.0422 -0.0604 0.0197  142 MET A CE  
2645 N N   . GLU A 143 ? 0.3315 0.2799 0.1946 -0.0231 0.0182  0.0990  143 GLU A N   
2646 C CA  . GLU A 143 ? 0.5379 0.2259 0.2459 0.0053  0.0423  0.0344  143 GLU A CA  
2647 C C   . GLU A 143 ? 0.6035 0.2753 0.1832 0.0043  -0.0180 0.0534  143 GLU A C   
2648 O O   . GLU A 143 ? 0.6214 0.3004 0.2056 0.0450  -0.0276 0.0244  143 GLU A O   
2649 C CB  . GLU A 143 ? 0.8263 0.2831 0.2416 0.0455  0.0009  0.0403  143 GLU A CB  
2650 C CG  . GLU A 143 ? 0.5033 0.4087 0.4809 -0.0115 0.1559  0.0017  143 GLU A CG  
2651 C CD  . GLU A 143 ? 0.3084 0.3317 0.4516 -0.0362 0.0520  -0.2040 143 GLU A CD  
2652 O OE1 . GLU A 143 ? 0.7227 0.3625 0.3408 -0.2175 0.1343  -0.1201 143 GLU A OE1 
2653 O OE2 . GLU A 143 ? 0.3115 0.4766 0.3749 0.0244  0.0932  -0.0003 143 GLU A OE2 
2660 N N   . ARG A 144 ? 0.3163 0.3208 0.2885 -0.0049 -0.0908 0.0271  144 ARG A N   
2661 C CA  . ARG A 144 ? 0.5493 0.3015 0.4087 -0.2322 -0.1741 0.1107  144 ARG A CA  
2662 C C   . ARG A 144 ? 0.3512 0.3489 0.3215 -0.1382 -0.0374 0.0620  144 ARG A C   
2663 O O   . ARG A 144 ? 0.3121 0.4194 0.5428 -0.0676 -0.1183 0.1119  144 ARG A O   
2664 C CB  . ARG A 144 ? 0.2663 0.3618 0.7289 -0.0862 -0.1020 0.1250  144 ARG A CB  
2665 C CG  . ARG A 144 ? 0.7799 0.5201 0.9344 -0.2102 0.0004  0.3919  144 ARG A CG  
2666 C CD  . ARG A 144 ? 1.0258 0.9794 1.2099 -0.0117 -0.1545 0.4419  144 ARG A CD  
2667 N NE  . ARG A 144 ? 1.0163 1.0820 1.3495 -0.2761 -0.0688 0.3449  144 ARG A NE  
2668 C CZ  . ARG A 144 ? 0.7606 0.9307 1.2342 -0.5692 0.0368  0.3206  144 ARG A CZ  
2669 N NH1 . ARG A 144 ? 1.0093 0.8793 1.1322 -0.2487 0.2689  -0.3953 144 ARG A NH1 
2670 N NH2 . ARG A 144 ? 0.8885 1.1377 1.0321 -0.4419 -0.2907 0.6620  144 ARG A NH2 
2684 N N   . PHE A 145 ? 0.2063 0.3971 0.2838 -0.0217 0.0065  0.0966  145 PHE A N   
2685 C CA  . PHE A 145 ? 0.1919 0.4515 0.2028 0.0555  0.0064  0.1236  145 PHE A CA  
2686 C C   . PHE A 145 ? 0.2119 0.4159 0.2272 0.0591  0.0545  -0.0365 145 PHE A C   
2687 O O   . PHE A 145 ? 0.3660 0.3803 0.2191 0.0744  0.0627  0.0487  145 PHE A O   
2688 C CB  . PHE A 145 ? 0.2398 0.3167 0.2516 0.0246  -0.0171 0.0854  145 PHE A CB  
2689 C CG  . PHE A 145 ? 0.3402 0.3158 0.1660 -0.0384 0.0009  0.0671  145 PHE A CG  
2690 C CD1 . PHE A 145 ? 0.3818 0.4807 0.3393 0.0722  0.0742  0.0627  145 PHE A CD1 
2691 C CD2 . PHE A 145 ? 0.2947 0.3281 0.2158 -0.0103 0.0207  0.0716  145 PHE A CD2 
2692 C CE1 . PHE A 145 ? 0.6523 0.4327 0.4862 -0.0329 0.1478  0.2157  145 PHE A CE1 
2693 C CE2 . PHE A 145 ? 0.4151 0.3000 0.2028 -0.0567 0.0269  0.0529  145 PHE A CE2 
2694 C CZ  . PHE A 145 ? 0.4876 0.4111 0.3083 -0.1275 0.1411  0.0929  145 PHE A CZ  
2704 N N   . GLY A 146 ? 0.2231 0.3166 0.2025 0.0418  0.0319  0.0538  146 GLY A N   
2705 C CA  . GLY A 146 ? 0.1952 0.2984 0.2251 -0.0204 0.0351  0.0079  146 GLY A CA  
2706 C C   . GLY A 146 ? 0.2772 0.2379 0.2167 -0.0081 -0.0050 0.0375  146 GLY A C   
2707 O O   . GLY A 146 ? 0.2263 0.4080 0.2399 -0.0461 -0.0033 0.0937  146 GLY A O   
2711 N N   . SER A 147 ? 0.1926 0.3128 0.1858 -0.0128 -0.0218 0.0521  147 SER A N   
2712 C CA  . SER A 147 ? 0.1633 0.3442 0.1829 -0.0338 -0.0089 0.0118  147 SER A CA  
2713 C C   . SER A 147 ? 0.2096 0.2902 0.1607 0.0392  -0.0032 0.0061  147 SER A C   
2714 O O   . SER A 147 ? 0.1829 0.3077 0.1983 0.0251  -0.0022 0.0261  147 SER A O   
2715 C CB  . SER A 147 ? 0.2386 0.3996 0.2565 0.0529  0.0186  -0.0164 147 SER A CB  
2716 O OG  . SER A 147 ? 0.3135 0.3134 0.2444 0.0846  -0.0224 -0.0062 147 SER A OG  
2722 N N   . ARG A 148 ? 0.1865 0.3169 0.2153 0.0177  -0.0228 0.0330  148 ARG A N   
2723 C CA  . ARG A 148 ? 0.2688 0.2722 0.1949 0.0399  0.0245  0.0205  148 ARG A CA  
2724 C C   . ARG A 148 ? 0.2929 0.2896 0.1660 0.0578  -0.0103 0.0330  148 ARG A C   
2725 O O   . ARG A 148 ? 0.2816 0.3087 0.2121 0.0211  0.0178  0.0194  148 ARG A O   
2726 C CB  . ARG A 148 ? 0.2436 0.3523 0.2225 0.0234  -0.0744 0.0219  148 ARG A CB  
2727 C CG  . ARG A 148 ? 0.3382 0.3212 0.2823 -0.0138 -0.0564 -0.0098 148 ARG A CG  
2728 C CD  . ARG A 148 ? 0.2628 0.5383 0.3847 -0.0296 0.0112  0.2131  148 ARG A CD  
2729 N NE  . ARG A 148 ? 0.3522 0.3011 0.2441 -0.0542 0.0048  0.0463  148 ARG A NE  
2730 C CZ  . ARG A 148 ? 0.3549 0.3626 0.2171 -0.0433 -0.1134 0.0612  148 ARG A CZ  
2731 N NH1 . ARG A 148 ? 0.2865 0.4895 0.3541 -0.0740 -0.0250 -0.0869 148 ARG A NH1 
2732 N NH2 . ARG A 148 ? 0.3278 0.2878 0.2033 -0.0601 -0.0402 0.0485  148 ARG A NH2 
2746 N N   . ASN A 149 ? 0.1910 0.2936 0.2099 -0.0005 -0.0163 0.0374  149 ASN A N   
2747 C CA  . ASN A 149 ? 0.2332 0.2944 0.2270 0.0702  0.0196  0.0075  149 ASN A CA  
2748 C C   . ASN A 149 ? 0.1626 0.3147 0.1608 0.0153  -0.0390 -0.0554 149 ASN A C   
2749 O O   . ASN A 149 ? 0.2926 0.3607 0.2752 -0.0125 -0.0422 0.0499  149 ASN A O   
2750 C CB  . ASN A 149 ? 0.3360 0.2830 0.2657 0.0399  0.0178  0.0283  149 ASN A CB  
2751 C CG  . ASN A 149 ? 0.2829 0.2935 0.3920 0.1011  -0.0037 0.0565  149 ASN A CG  
2752 O OD1 . ASN A 149 ? 0.3501 0.4415 0.2741 0.2175  0.0213  0.0386  149 ASN A OD1 
2753 N ND2 . ASN A 149 ? 0.5686 0.5995 0.3708 0.3347  -0.0639 0.0359  149 ASN A ND2 
2760 N N   . GLY A 150 ? 0.2539 0.2882 0.1638 0.0799  -0.0089 0.0477  150 GLY A N   
2761 C CA  . GLY A 150 ? 0.1999 0.2720 0.2013 0.1149  0.0253  0.0141  150 GLY A CA  
2762 C C   . GLY A 150 ? 0.1725 0.1795 0.4099 0.1208  0.1358  0.0485  150 GLY A C   
2763 O O   . GLY A 150 ? 0.2117 0.2656 0.2836 0.0974  -0.0061 0.0080  150 GLY A O   
2767 N N   . LYS A 151 ? 0.2450 0.3164 0.1901 0.0476  -0.0157 0.0528  151 LYS A N   
2768 C CA  . LYS A 151 ? 0.2877 0.4213 0.1650 0.1693  -0.0264 -0.0872 151 LYS A CA  
2769 C C   . LYS A 151 ? 0.2946 0.5100 0.2909 0.1912  0.1424  0.2713  151 LYS A C   
2770 O O   . LYS A 151 ? 0.2759 0.4784 0.2525 0.0579  0.0114  0.0375  151 LYS A O   
2771 C CB  . LYS A 151 ? 0.4553 0.5049 0.2776 0.2521  0.0545  -0.0007 151 LYS A CB  
2772 C CG  . LYS A 151 ? 0.6310 0.8545 0.8977 0.5528  -0.2065 -0.1667 151 LYS A CG  
2773 C CD  . LYS A 151 ? 1.0486 1.1656 1.2172 0.0066  -0.1923 0.1285  151 LYS A CD  
2774 C CE  . LYS A 151 ? 1.0830 1.1948 1.3388 -0.1849 -0.1947 -0.0099 151 LYS A CE  
2775 N NZ  . LYS A 151 ? 1.0415 1.0876 1.3431 -0.2255 -0.1390 -0.1467 151 LYS A NZ  
2789 N N   . THR A 152 ? 0.3379 0.3333 0.1779 0.1497  -0.0279 0.0196  152 THR A N   
2790 C CA  . THR A 152 ? 0.2559 0.3622 0.2081 0.0473  0.0556  0.0496  152 THR A CA  
2791 C C   . THR A 152 ? 0.2164 0.3665 0.2312 -0.0279 0.0089  0.0055  152 THR A C   
2792 O O   . THR A 152 ? 0.3102 0.3573 0.2726 0.0912  0.0439  -0.0017 152 THR A O   
2793 C CB  . THR A 152 ? 0.2806 0.3721 0.2418 0.1454  0.0062  0.0241  152 THR A CB  
2794 O OG1 . THR A 152 ? 0.2742 0.3975 0.2460 0.1139  0.0156  -0.0330 152 THR A OG1 
2795 C CG2 . THR A 152 ? 0.2607 0.3308 0.2174 0.0970  0.0395  -0.0380 152 THR A CG2 
2803 N N   . SER A 153 ? 0.1678 0.4106 0.2754 0.0492  0.0256  0.0492  153 SER A N   
2804 C CA  . SER A 153 ? 0.2073 0.5551 0.2946 0.1021  0.0016  0.0938  153 SER A CA  
2805 C C   . SER A 153 ? 0.2417 0.4137 0.4467 0.1477  0.0088  0.0614  153 SER A C   
2806 O O   . SER A 153 ? 0.3014 0.5827 0.3581 0.1933  0.0801  0.0103  153 SER A O   
2807 C CB  . SER A 153 ? 0.2671 0.6723 0.3807 -0.0486 0.0048  -0.0273 153 SER A CB  
2808 O OG  . SER A 153 ? 0.3213 0.5186 0.4145 -0.0040 0.0813  0.0049  153 SER A OG  
2814 N N   . LYS A 154 ? 0.2876 0.4475 0.2294 0.0817  0.0584  -0.0035 154 LYS A N   
2815 C CA  . LYS A 154 ? 0.2814 0.3627 0.3728 0.0255  0.1768  0.0649  154 LYS A CA  
2816 C C   . LYS A 154 ? 0.4409 0.2676 0.1505 0.0897  0.0618  -0.0135 154 LYS A C   
2817 O O   . LYS A 154 ? 0.2586 0.4243 0.1999 0.0821  0.0315  -0.0064 154 LYS A O   
2818 C CB  . LYS A 154 ? 0.2930 0.4262 0.2925 -0.0746 0.0318  0.0120  154 LYS A CB  
2819 C CG  . LYS A 154 ? 0.2234 0.7281 0.5097 -0.1267 0.0081  0.2556  154 LYS A CG  
2820 C CD  . LYS A 154 ? 0.3545 0.9025 0.9023 -0.2765 0.1452  0.1590  154 LYS A CD  
2821 C CE  . LYS A 154 ? 0.8258 1.0493 1.1471 -0.2925 0.1263  0.0344  154 LYS A CE  
2822 N NZ  . LYS A 154 ? 0.8351 1.3533 1.2692 -0.2371 0.2554  0.1314  154 LYS A NZ  
2836 N N   . LYS A 155 ? 0.2735 0.3133 0.2040 0.0392  0.0966  -0.0252 155 LYS A N   
2837 C CA  . LYS A 155 ? 0.2713 0.2414 0.2541 0.0500  0.1296  -0.0306 155 LYS A CA  
2838 C C   . LYS A 155 ? 0.2457 0.1486 0.2353 0.0206  0.1255  -0.0132 155 LYS A C   
2839 O O   . LYS A 155 ? 0.2969 0.2916 0.2303 0.0507  0.1228  0.0677  155 LYS A O   
2840 C CB  . LYS A 155 ? 0.6870 0.3106 0.2455 0.3028  0.1329  0.0420  155 LYS A CB  
2841 C CG  . LYS A 155 ? 0.6884 0.5600 0.7348 0.1267  -0.1311 -0.4006 155 LYS A CG  
2842 C CD  . LYS A 155 ? 0.7016 0.9167 0.8785 -0.3123 0.1770  -0.1042 155 LYS A CD  
2843 C CE  . LYS A 155 ? 0.3697 0.7947 0.9550 -0.0538 0.0520  -0.6161 155 LYS A CE  
2844 N NZ  . LYS A 155 ? 1.2590 1.0018 1.3932 -0.1635 0.0838  -0.6626 155 LYS A NZ  
2858 N N   A ILE A 156 ? 0.3273 0.1512 0.2993 0.1349  -0.0060 -0.0978 156 ILE A N   
2859 N N   B ILE A 156 ? 0.1215 0.3284 0.1098 -0.0323 0.0472  0.1224  156 ILE A N   
2860 C CA  A ILE A 156 ? 0.3422 0.1749 0.1429 -0.0616 -0.1076 0.0287  156 ILE A CA  
2861 C CA  B ILE A 156 ? 0.1792 0.1973 0.3890 0.0814  0.1953  -0.0628 156 ILE A CA  
2862 C C   A ILE A 156 ? 0.3247 0.1776 0.2344 0.1360  0.0537  0.0562  156 ILE A C   
2863 C C   B ILE A 156 ? 0.1794 0.3509 0.0470 -0.0957 0.0700  -0.0536 156 ILE A C   
2864 O O   A ILE A 156 ? 0.2747 0.2502 0.1070 -0.0717 0.0231  -0.0629 156 ILE A O   
2865 O O   B ILE A 156 ? 0.2400 0.2153 0.2786 0.0030  0.1136  0.1740  156 ILE A O   
2866 C CB  A ILE A 156 ? 0.2568 0.1501 0.2420 -0.0559 -0.0627 0.0011  156 ILE A CB  
2867 C CB  B ILE A 156 ? 0.1843 0.2143 0.2668 0.0397  0.0822  -0.1588 156 ILE A CB  
2868 C CG1 A ILE A 156 ? 0.2762 0.2696 0.2239 -0.0911 -0.0646 -0.0528 156 ILE A CG1 
2869 C CG1 B ILE A 156 ? 0.3273 0.3370 0.2410 0.0213  -0.0494 -0.0331 156 ILE A CG1 
2870 C CG2 A ILE A 156 ? 0.2540 0.2547 0.3093 -0.0592 -0.0363 0.0635  156 ILE A CG2 
2871 C CG2 B ILE A 156 ? 0.3554 0.2339 0.1893 0.1828  0.0752  -0.1075 156 ILE A CG2 
2872 C CD1 A ILE A 156 ? 0.3110 0.2717 0.3012 -0.0552 0.1547  0.0653  156 ILE A CD1 
2873 C CD1 B ILE A 156 ? 0.2896 0.4036 0.4470 -0.2592 -0.2336 0.1389  156 ILE A CD1 
2896 N N   A THR A 157 ? 0.1543 0.2170 0.2490 -0.0130 -0.0330 -0.0424 157 THR A N   
2897 N N   B THR A 157 ? 0.3044 0.2112 0.1516 0.1330  0.1839  0.1270  157 THR A N   
2898 C CA  A THR A 157 ? 0.1808 0.2732 0.2357 0.0180  0.0009  0.0500  157 THR A CA  
2899 C CA  B THR A 157 ? 0.2631 0.1501 0.3574 -0.0303 0.0009  0.0447  157 THR A CA  
2900 C C   A THR A 157 ? 0.1248 0.2860 0.0818 -0.0469 0.0439  0.0659  157 THR A C   
2901 C C   B THR A 157 ? 0.5307 0.1178 0.3172 0.2366  -0.0360 -0.0432 157 THR A C   
2902 O O   A THR A 157 ? 0.2290 0.1169 0.1177 -0.0174 0.0294  0.0309  157 THR A O   
2903 O O   B THR A 157 ? 0.2211 0.3478 0.0915 -0.0128 0.0106  -0.0620 157 THR A O   
2904 C CB  A THR A 157 ? 0.4565 0.1208 0.2873 -0.0176 0.0145  -0.0505 157 THR A CB  
2905 C CB  B THR A 157 ? 0.2217 0.3766 0.1974 0.1630  -0.0769 -0.2473 157 THR A CB  
2906 O OG1 A THR A 157 ? 0.2608 0.2285 0.1620 0.0276  0.0286  0.0003  157 THR A OG1 
2907 O OG1 B THR A 157 ? 0.5494 0.5115 0.4538 0.1772  0.1100  -0.3335 157 THR A OG1 
2908 C CG2 A THR A 157 ? 0.2758 0.1324 0.3946 0.0246  0.0052  -0.0082 157 THR A CG2 
2909 C CG2 B THR A 157 ? 0.5207 0.2951 0.3470 0.1177  -0.2106 -0.1588 157 THR A CG2 
2924 N N   A ILE A 158 ? 0.1716 0.2779 0.1731 0.1374  -0.0250 -0.0448 158 ILE A N   
2925 N N   B ILE A 158 ? 0.4218 0.1430 0.1878 -0.1560 0.1255  0.0573  158 ILE A N   
2926 C CA  A ILE A 158 ? 0.3488 0.0425 0.3058 -0.0421 0.0167  -0.0168 158 ILE A CA  
2927 C CA  B ILE A 158 ? 0.3186 0.2920 0.0776 0.0418  0.0960  0.1072  158 ILE A CA  
2928 C C   A ILE A 158 ? 0.2448 0.2956 0.2667 0.0700  0.0872  0.2307  158 ILE A C   
2929 C C   B ILE A 158 ? 0.2340 0.2360 0.1097 -0.0295 0.0207  -0.1486 158 ILE A C   
2930 O O   A ILE A 158 ? 0.2611 0.1279 0.2086 -0.0352 -0.0126 -0.0116 158 ILE A O   
2931 O O   B ILE A 158 ? 0.3162 0.2497 0.2179 0.0765  0.0273  0.0137  158 ILE A O   
2932 C CB  A ILE A 158 ? 0.3743 0.1859 0.1459 -0.1749 -0.0523 0.0629  158 ILE A CB  
2933 C CB  B ILE A 158 ? 0.2139 0.2769 0.1374 0.1602  0.0338  -0.0734 158 ILE A CB  
2934 C CG1 A ILE A 158 ? 0.2055 0.2917 0.2390 0.0425  0.0799  0.0693  158 ILE A CG1 
2935 C CG1 B ILE A 158 ? 0.2824 0.1005 0.1965 0.0520  -0.0128 -0.0505 158 ILE A CG1 
2936 C CG2 A ILE A 158 ? 0.2311 0.4054 0.2221 0.1345  -0.1099 -0.0966 158 ILE A CG2 
2937 C CG2 B ILE A 158 ? 0.3410 0.2193 0.2066 0.0712  0.0849  0.2017  158 ILE A CG2 
2938 C CD1 A ILE A 158 ? 0.1575 0.1857 0.2963 0.1176  -0.0433 0.0161  158 ILE A CD1 
2939 C CD1 B ILE A 158 ? 0.1433 0.1077 0.1247 0.1065  -0.0387 0.0118  158 ILE A CD1 
2962 N N   . ALA A 159 ? 0.2371 0.1706 0.1546 0.0195  0.0328  0.0131  159 ALA A N   
2963 C CA  . ALA A 159 ? 0.2902 0.2328 0.1330 -0.0221 0.0470  -0.0223 159 ALA A CA  
2964 C C   . ALA A 159 ? 0.3172 0.1659 0.1548 -0.0164 -0.0233 -0.0053 159 ALA A C   
2965 O O   . ALA A 159 ? 0.3253 0.2441 0.2125 0.0154  -0.0236 -0.0337 159 ALA A O   
2966 C CB  . ALA A 159 ? 0.2995 0.3136 0.1822 -0.0131 0.0448  -0.0015 159 ALA A CB  
2973 N N   . ASP A 160 ? 0.2640 0.1662 0.1806 0.0137  0.0038  -0.0149 160 ASP A N   
2974 C CA  . ASP A 160 ? 0.2560 0.2234 0.1664 0.0310  -0.0309 -0.0138 160 ASP A CA  
2975 C C   . ASP A 160 ? 0.2360 0.1439 0.1917 -0.0452 0.0089  -0.0271 160 ASP A C   
2976 O O   . ASP A 160 ? 0.2522 0.1690 0.1828 -0.0272 -0.0108 -0.0163 160 ASP A O   
2977 C CB  . ASP A 160 ? 0.2894 0.2604 0.1613 0.0335  -0.0579 0.0793  160 ASP A CB  
2978 C CG  . ASP A 160 ? 0.4070 0.3413 0.1421 0.0644  -0.0801 -0.0126 160 ASP A CG  
2979 O OD1 . ASP A 160 ? 0.4166 0.3627 0.2336 0.0162  -0.0842 -0.0114 160 ASP A OD1 
2980 O OD2 . ASP A 160 ? 0.4916 0.5480 0.2743 -0.0232 -0.1583 0.1302  160 ASP A OD2 
2985 N N   . CYS A 161 ? 0.2163 0.1941 0.1841 -0.0394 -0.0176 0.0082  161 CYS A N   
2986 C CA  . CYS A 161 ? 0.2387 0.2483 0.1665 0.0374  -0.0302 0.0026  161 CYS A CA  
2987 C C   . CYS A 161 ? 0.3662 0.2057 0.1171 0.0295  0.0004  -0.0114 161 CYS A C   
2988 O O   . CYS A 161 ? 0.3140 0.2639 0.1906 0.0075  -0.0048 -0.0131 161 CYS A O   
2989 C CB  . CYS A 161 ? 0.2558 0.2042 0.2252 0.0190  -0.0478 -0.0126 161 CYS A CB  
2990 S SG  . CYS A 161 ? 0.2791 0.1881 0.2262 -0.0071 -0.0137 -0.0001 161 CYS A SG  
2996 N N   . GLY A 162 ? 0.2674 0.2349 0.2107 -0.0125 -0.0183 0.0049  162 GLY A N   
2997 C CA  . GLY A 162 ? 0.2538 0.2639 0.2459 0.0401  -0.0694 -0.0662 162 GLY A CA  
2998 C C   . GLY A 162 ? 0.3549 0.2550 0.1750 -0.0050 -0.0147 0.0220  162 GLY A C   
2999 O O   . GLY A 162 ? 0.2530 0.2874 0.2216 0.0543  -0.0261 -0.0203 162 GLY A O   
3003 N N   . GLN A 163 ? 0.2962 0.2729 0.2989 0.0751  -0.0597 0.0045  163 GLN A N   
3004 C CA  . GLN A 163 ? 0.2881 0.2996 0.2708 0.1110  -0.1017 0.0461  163 GLN A CA  
3005 C C   . GLN A 163 ? 0.3344 0.3637 0.3856 0.0953  -0.2018 -0.0420 163 GLN A C   
3006 O O   . GLN A 163 ? 0.6068 0.3777 0.3356 0.0528  -0.1700 0.0296  163 GLN A O   
3007 C CB  . GLN A 163 ? 0.2071 0.5061 0.2672 0.0809  -0.0552 0.0197  163 GLN A CB  
3008 C CG  . GLN A 163 ? 0.2799 0.5249 0.3470 0.0420  -0.0088 0.0984  163 GLN A CG  
3009 C CD  . GLN A 163 ? 0.4389 0.5110 0.3140 -0.0560 -0.0523 0.1783  163 GLN A CD  
3010 O OE1 . GLN A 163 ? 0.3140 0.4791 0.3072 0.0362  -0.0055 0.0729  163 GLN A OE1 
3011 N NE2 . GLN A 163 ? 0.3896 0.8848 0.3190 0.1689  -0.0553 0.0681  163 GLN A NE2 
3020 N N   . LEU A 164 ? 0.3467 0.3920 0.2205 0.0218  -0.0675 0.0887  164 LEU A N   
3021 C CA  . LEU A 164 ? 0.4587 0.4136 0.2802 0.1893  -0.0365 0.1145  164 LEU A CA  
3022 C C   . LEU A 164 ? 0.7792 0.2406 0.5609 0.1624  -0.3805 0.0942  164 LEU A C   
3023 O O   . LEU A 164 ? 0.5462 0.4045 0.8276 0.2018  -0.0313 -0.0534 164 LEU A O   
3024 C CB  . LEU A 164 ? 0.5130 0.3468 0.4378 0.0423  -0.0383 0.1391  164 LEU A CB  
3025 C CG  . LEU A 164 ? 0.3265 0.4965 0.5814 -0.0174 -0.0877 -0.0294 164 LEU A CG  
3026 C CD1 . LEU A 164 ? 0.4012 0.4886 0.6203 0.0091  -0.0360 0.2467  164 LEU A CD1 
3027 C CD2 . LEU A 164 ? 0.6955 0.4228 0.6275 0.1649  0.1572  0.0903  164 LEU A CD2 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   1   ?   ?   ?   A . n 
A 1 2   VAL 2   2   2   VAL VAL A . n 
A 1 3   ASN 3   3   3   ASN ASN A . n 
A 1 4   PRO 4   4   4   PRO PRO A . n 
A 1 5   THR 5   5   5   THR THR A . n 
A 1 6   VAL 6   6   6   VAL VAL A . n 
A 1 7   PHE 7   7   7   PHE PHE A . n 
A 1 8   PHE 8   8   8   PHE PHE A . n 
A 1 9   ASP 9   9   9   ASP ASP A . n 
A 1 10  ILE 10  10  10  ILE ILE A . n 
A 1 11  ALA 11  11  11  ALA ALA A . n 
A 1 12  VAL 12  12  12  VAL VAL A . n 
A 1 13  ASP 13  13  13  ASP ASP A . n 
A 1 14  GLY 14  14  14  GLY GLY A . n 
A 1 15  GLU 15  15  15  GLU GLU A . n 
A 1 16  PRO 16  16  16  PRO PRO A . n 
A 1 17  LEU 17  17  17  LEU LEU A . n 
A 1 18  GLY 18  18  18  GLY GLY A . n 
A 1 19  ARG 19  19  19  ARG ARG A . n 
A 1 20  VAL 20  20  20  VAL VAL A . n 
A 1 21  SER 21  21  21  SER SER A . n 
A 1 22  PHE 22  22  22  PHE PHE A . n 
A 1 23  GLU 23  23  23  GLU GLU A . n 
A 1 24  LEU 24  24  24  LEU LEU A . n 
A 1 25  PHE 25  25  25  PHE PHE A . n 
A 1 26  ALA 26  26  26  ALA ALA A . n 
A 1 27  ASP 27  27  27  ASP ASP A . n 
A 1 28  LYS 28  28  28  LYS LYS A . n 
A 1 29  VAL 29  29  29  VAL VAL A . n 
A 1 30  PRO 30  30  30  PRO PRO A . n 
A 1 31  LYS 31  31  31  LYS LYS A . n 
A 1 32  THR 32  32  32  THR THR A . n 
A 1 33  ALA 33  33  33  ALA ALA A . n 
A 1 34  GLU 34  34  34  GLU GLU A . n 
A 1 35  ASN 35  35  35  ASN ASN A . n 
A 1 36  PHE 36  36  36  PHE PHE A . n 
A 1 37  ARG 37  37  37  ARG ARG A . n 
A 1 38  ALA 38  38  38  ALA ALA A . n 
A 1 39  LEU 39  39  39  LEU LEU A . n 
A 1 40  SER 40  40  40  SER SER A . n 
A 1 41  THR 41  41  41  THR THR A . n 
A 1 42  GLY 42  42  42  GLY GLY A . n 
A 1 43  GLU 43  43  43  GLU GLU A . n 
A 1 44  LYS 44  44  44  LYS LYS A . n 
A 1 45  GLY 45  45  45  GLY GLY A . n 
A 1 46  PHE 46  46  46  PHE PHE A . n 
A 1 47  GLY 47  47  47  GLY GLY A . n 
A 1 48  TYR 48  48  48  TYR TYR A . n 
A 1 49  LYS 49  49  49  LYS LYS A . n 
A 1 50  GLY 50  50  50  GLY GLY A . n 
A 1 51  SER 51  51  51  SER SER A . n 
A 1 52  CYS 52  52  52  CYS CYS A . n 
A 1 53  PHE 53  53  53  PHE PHE A . n 
A 1 54  HIS 54  54  54  HIS HIS A . n 
A 1 55  ARG 55  55  55  ARG ARG A . n 
A 1 56  ILE 56  56  56  ILE ILE A . n 
A 1 57  ILE 57  57  57  ILE ILE A . n 
A 1 58  PRO 58  58  58  PRO PRO A . n 
A 1 59  GLY 59  59  59  GLY GLY A . n 
A 1 60  PHE 60  60  60  PHE PHE A . n 
A 1 61  MET 61  61  61  MET MET A . n 
A 1 62  CYS 62  62  62  CYS CYS A . n 
A 1 63  GLN 63  63  63  GLN GLN A . n 
A 1 64  GLY 64  64  64  GLY GLY A . n 
A 1 65  GLY 65  65  65  GLY GLY A . n 
A 1 66  ASP 66  66  66  ASP ASP A . n 
A 1 67  PHE 67  67  67  PHE PHE A . n 
A 1 68  THR 68  68  68  THR THR A . n 
A 1 69  ARG 69  69  69  ARG ARG A . n 
A 1 70  HIS 70  70  70  HIS HIS A . n 
A 1 71  ASN 71  71  71  ASN ASN A . n 
A 1 72  GLY 72  72  72  GLY GLY A . n 
A 1 73  THR 73  73  73  THR THR A . n 
A 1 74  GLY 74  74  74  GLY GLY A . n 
A 1 75  GLY 75  75  75  GLY GLY A . n 
A 1 76  LYS 76  76  76  LYS LYS A . n 
A 1 77  SER 77  77  77  SER SER A . n 
A 1 78  ILE 78  78  78  ILE ILE A . n 
A 1 79  TYR 79  79  79  TYR TYR A . n 
A 1 80  GLY 80  80  80  GLY GLY A . n 
A 1 81  GLU 81  81  81  GLU GLU A . n 
A 1 82  LYS 82  82  82  LYS LYS A . n 
A 1 83  PHE 83  83  83  PHE PHE A . n 
A 1 84  GLU 84  84  84  GLU GLU A . n 
A 1 85  ASP 85  85  85  ASP ASP A . n 
A 1 86  GLU 86  86  86  GLU GLU A . n 
A 1 87  ASN 87  87  87  ASN ASN A . n 
A 1 88  PHE 88  88  88  PHE PHE A . n 
A 1 89  ILE 89  89  89  ILE ILE A . n 
A 1 90  LEU 90  90  90  LEU LEU A . n 
A 1 91  LYS 91  91  91  LYS LYS A . n 
A 1 92  HIS 92  92  92  HIS HIS A . n 
A 1 93  THR 93  93  93  THR THR A . n 
A 1 94  GLY 94  94  94  GLY GLY A . n 
A 1 95  PRO 95  95  95  PRO PRO A . n 
A 1 96  GLY 96  96  96  GLY GLY A . n 
A 1 97  ILE 97  97  97  ILE ILE A . n 
A 1 98  LEU 98  98  98  LEU LEU A . n 
A 1 99  SER 99  99  99  SER SER A . n 
A 1 100 MET 100 100 100 MET MET A . n 
A 1 101 ALA 101 101 101 ALA ALA A . n 
A 1 102 ASN 102 102 102 ASN ASN A . n 
A 1 103 ALA 103 103 103 ALA ALA A . n 
A 1 104 GLY 104 104 104 GLY GLY A . n 
A 1 105 PRO 105 105 105 PRO PRO A . n 
A 1 106 ASN 106 106 106 ASN ASN A . n 
A 1 107 THR 107 107 107 THR THR A . n 
A 1 108 ASN 108 108 108 ASN ASN A . n 
A 1 109 GLY 109 109 109 GLY GLY A . n 
A 1 110 SER 110 110 110 SER SER A . n 
A 1 111 GLN 111 111 111 GLN GLN A . n 
A 1 112 PHE 112 112 112 PHE PHE A . n 
A 1 113 PHE 113 113 113 PHE PHE A . n 
A 1 114 ILE 114 114 114 ILE ILE A . n 
A 1 115 CYS 115 115 115 CYS CYS A . n 
A 1 116 THR 116 116 116 THR THR A . n 
A 1 117 ALA 117 117 117 ALA ALA A . n 
A 1 118 LYS 118 118 118 LYS LYS A . n 
A 1 119 THR 119 119 119 THR THR A . n 
A 1 120 GLU 120 120 120 GLU GLU A . n 
A 1 121 TRP 121 121 121 TRP TRP A . n 
A 1 122 LEU 122 122 122 LEU LEU A . n 
A 1 123 ASP 123 123 123 ASP ASP A . n 
A 1 124 GLY 124 124 124 GLY GLY A . n 
A 1 125 LYS 125 125 125 LYS LYS A . n 
A 1 126 HIS 126 126 126 HIS HIS A . n 
A 1 127 VAL 127 127 127 VAL VAL A . n 
A 1 128 VAL 128 128 128 VAL VAL A . n 
A 1 129 PHE 129 129 129 PHE PHE A . n 
A 1 130 GLY 130 130 130 GLY GLY A . n 
A 1 131 LYS 131 131 131 LYS LYS A . n 
A 1 132 VAL 132 132 132 VAL VAL A . n 
A 1 133 LYS 133 133 133 LYS LYS A . n 
A 1 134 GLU 134 134 134 GLU GLU A . n 
A 1 135 GLY 135 135 135 GLY GLY A . n 
A 1 136 MET 136 136 136 MET MET A . n 
A 1 137 ASN 137 137 137 ASN ASN A . n 
A 1 138 ILE 138 138 138 ILE ILE A . n 
A 1 139 VAL 139 139 139 VAL VAL A . n 
A 1 140 GLU 140 140 140 GLU GLU A . n 
A 1 141 ALA 141 141 141 ALA ALA A . n 
A 1 142 MET 142 142 142 MET MET A . n 
A 1 143 GLU 143 143 143 GLU GLU A . n 
A 1 144 ARG 144 144 144 ARG ARG A . n 
A 1 145 PHE 145 145 145 PHE PHE A . n 
A 1 146 GLY 146 146 146 GLY GLY A . n 
A 1 147 SER 147 147 147 SER SER A . n 
A 1 148 ARG 148 148 148 ARG ARG A . n 
A 1 149 ASN 149 149 149 ASN ASN A . n 
A 1 150 GLY 150 150 150 GLY GLY A . n 
A 1 151 LYS 151 151 151 LYS LYS A . n 
A 1 152 THR 152 152 152 THR THR A . n 
A 1 153 SER 153 153 153 SER SER A . n 
A 1 154 LYS 154 154 154 LYS LYS A . n 
A 1 155 LYS 155 155 155 LYS LYS A . n 
A 1 156 ILE 156 156 156 ILE ILE A . n 
A 1 157 THR 157 157 157 THR THR A . n 
A 1 158 ILE 158 158 158 ILE ILE A . n 
A 1 159 ALA 159 159 159 ALA ALA A . n 
A 1 160 ASP 160 160 160 ASP ASP A . n 
A 1 161 CYS 161 161 161 CYS CYS A . n 
A 1 162 GLY 162 162 162 GLY GLY A . n 
A 1 163 GLN 163 163 163 GLN GLN A . n 
A 1 164 LEU 164 164 164 LEU LEU A . n 
A 1 165 GLU 165 165 ?   ?   ?   A . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-12-08 
2 'Structure model' 1 1 2011-07-13 
3 'Structure model' 1 2 2013-06-19 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Version format compliance' 
2 3 'Structure model' 'Database references'       
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' .                          ? 1 
PHASER   phasing           .                          ? 2 
PHENIX   refinement        '(phenix.refine: 1.4_162)' ? 3 
HKL-2000 'data reduction'  .                          ? 4 
HKL-2000 'data scaling'    .                          ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 PHE A 60 ? A -136.20 -80.40 
2 1 PHE A 60 ? B -142.21 -49.94 
3 1 MET A 61 ? B 170.64  170.83 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1 1 Y 1 A MET 1   ? A MET 1   
2 1 Y 1 A GLU 165 ? A GLU 165 
# 
_pdbx_entity_nonpoly.entity_id   2 
_pdbx_entity_nonpoly.name        water 
_pdbx_entity_nonpoly.comp_id     HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 HOH 1   166 1   HOH HOH A . 
B 2 HOH 2   167 2   HOH HOH A . 
B 2 HOH 3   168 3   HOH HOH A . 
B 2 HOH 4   169 4   HOH HOH A . 
B 2 HOH 5   170 5   HOH HOH A . 
B 2 HOH 6   171 6   HOH HOH A . 
B 2 HOH 7   172 7   HOH HOH A . 
B 2 HOH 8   173 8   HOH HOH A . 
B 2 HOH 9   174 9   HOH HOH A . 
B 2 HOH 10  175 10  HOH HOH A . 
B 2 HOH 11  176 11  HOH HOH A . 
B 2 HOH 12  177 12  HOH HOH A . 
B 2 HOH 13  178 13  HOH HOH A . 
B 2 HOH 14  179 14  HOH HOH A . 
B 2 HOH 15  180 15  HOH HOH A . 
B 2 HOH 16  181 16  HOH HOH A . 
B 2 HOH 17  182 17  HOH HOH A . 
B 2 HOH 18  183 18  HOH HOH A . 
B 2 HOH 19  184 19  HOH HOH A . 
B 2 HOH 20  185 20  HOH HOH A . 
B 2 HOH 21  186 21  HOH HOH A . 
B 2 HOH 22  187 22  HOH HOH A . 
B 2 HOH 23  188 23  HOH HOH A . 
B 2 HOH 24  189 24  HOH HOH A . 
B 2 HOH 25  190 25  HOH HOH A . 
B 2 HOH 26  191 26  HOH HOH A . 
B 2 HOH 27  192 27  HOH HOH A . 
B 2 HOH 28  193 28  HOH HOH A . 
B 2 HOH 29  194 29  HOH HOH A . 
B 2 HOH 30  195 30  HOH HOH A . 
B 2 HOH 31  196 31  HOH HOH A . 
B 2 HOH 32  197 32  HOH HOH A . 
B 2 HOH 33  198 33  HOH HOH A . 
B 2 HOH 34  199 34  HOH HOH A . 
B 2 HOH 35  200 35  HOH HOH A . 
B 2 HOH 36  201 36  HOH HOH A . 
B 2 HOH 37  202 37  HOH HOH A . 
B 2 HOH 38  203 38  HOH HOH A . 
B 2 HOH 39  204 39  HOH HOH A . 
B 2 HOH 40  205 40  HOH HOH A . 
B 2 HOH 41  206 41  HOH HOH A . 
B 2 HOH 42  207 42  HOH HOH A . 
B 2 HOH 43  208 43  HOH HOH A . 
B 2 HOH 44  209 44  HOH HOH A . 
B 2 HOH 45  210 45  HOH HOH A . 
B 2 HOH 46  211 46  HOH HOH A . 
B 2 HOH 47  212 47  HOH HOH A . 
B 2 HOH 48  213 48  HOH HOH A . 
B 2 HOH 49  214 49  HOH HOH A . 
B 2 HOH 50  215 50  HOH HOH A . 
B 2 HOH 51  216 51  HOH HOH A . 
B 2 HOH 52  217 52  HOH HOH A . 
B 2 HOH 53  218 53  HOH HOH A . 
B 2 HOH 54  219 54  HOH HOH A . 
B 2 HOH 55  220 55  HOH HOH A . 
B 2 HOH 56  221 56  HOH HOH A . 
B 2 HOH 57  222 57  HOH HOH A . 
B 2 HOH 58  223 58  HOH HOH A . 
B 2 HOH 59  224 59  HOH HOH A . 
B 2 HOH 60  225 60  HOH HOH A . 
B 2 HOH 61  226 61  HOH HOH A . 
B 2 HOH 62  227 62  HOH HOH A . 
B 2 HOH 63  228 63  HOH HOH A . 
B 2 HOH 64  229 64  HOH HOH A . 
B 2 HOH 65  230 65  HOH HOH A . 
B 2 HOH 66  231 66  HOH HOH A . 
B 2 HOH 67  232 67  HOH HOH A . 
B 2 HOH 68  233 68  HOH HOH A . 
B 2 HOH 69  234 69  HOH HOH A . 
B 2 HOH 70  235 70  HOH HOH A . 
B 2 HOH 71  236 71  HOH HOH A . 
B 2 HOH 72  237 72  HOH HOH A . 
B 2 HOH 73  238 73  HOH HOH A . 
B 2 HOH 74  239 74  HOH HOH A . 
B 2 HOH 75  240 75  HOH HOH A . 
B 2 HOH 76  241 76  HOH HOH A . 
B 2 HOH 77  242 77  HOH HOH A . 
B 2 HOH 78  243 78  HOH HOH A . 
B 2 HOH 79  244 79  HOH HOH A . 
B 2 HOH 80  245 80  HOH HOH A . 
B 2 HOH 81  246 81  HOH HOH A . 
B 2 HOH 82  247 82  HOH HOH A . 
B 2 HOH 83  248 83  HOH HOH A . 
B 2 HOH 84  249 84  HOH HOH A . 
B 2 HOH 85  250 85  HOH HOH A . 
B 2 HOH 86  251 86  HOH HOH A . 
B 2 HOH 87  252 87  HOH HOH A . 
B 2 HOH 88  253 88  HOH HOH A . 
B 2 HOH 89  254 89  HOH HOH A . 
B 2 HOH 90  255 90  HOH HOH A . 
B 2 HOH 91  256 91  HOH HOH A . 
B 2 HOH 92  257 92  HOH HOH A . 
B 2 HOH 93  258 93  HOH HOH A . 
B 2 HOH 94  259 94  HOH HOH A . 
B 2 HOH 95  260 95  HOH HOH A . 
B 2 HOH 96  261 96  HOH HOH A . 
B 2 HOH 97  262 97  HOH HOH A . 
B 2 HOH 98  263 98  HOH HOH A . 
B 2 HOH 99  264 99  HOH HOH A . 
B 2 HOH 100 265 100 HOH HOH A . 
B 2 HOH 101 266 101 HOH HOH A . 
B 2 HOH 102 267 102 HOH HOH A . 
B 2 HOH 103 268 103 HOH HOH A . 
B 2 HOH 104 269 104 HOH HOH A . 
B 2 HOH 105 270 105 HOH HOH A . 
B 2 HOH 106 271 106 HOH HOH A . 
B 2 HOH 107 272 107 HOH HOH A . 
B 2 HOH 108 273 108 HOH HOH A . 
B 2 HOH 109 274 109 HOH HOH A . 
B 2 HOH 110 275 110 HOH HOH A . 
B 2 HOH 111 276 111 HOH HOH A . 
B 2 HOH 112 277 112 HOH HOH A . 
B 2 HOH 113 278 113 HOH HOH A . 
B 2 HOH 114 279 114 HOH HOH A . 
B 2 HOH 115 280 115 HOH HOH A . 
B 2 HOH 116 281 116 HOH HOH A . 
B 2 HOH 117 282 117 HOH HOH A . 
B 2 HOH 118 283 118 HOH HOH A . 
B 2 HOH 119 284 119 HOH HOH A . 
B 2 HOH 120 285 120 HOH HOH A . 
B 2 HOH 121 286 121 HOH HOH A . 
B 2 HOH 122 287 122 HOH HOH A . 
B 2 HOH 123 288 123 HOH HOH A . 
B 2 HOH 124 289 124 HOH HOH A . 
B 2 HOH 125 290 125 HOH HOH A . 
B 2 HOH 126 291 126 HOH HOH A . 
B 2 HOH 127 292 127 HOH HOH A . 
B 2 HOH 128 293 128 HOH HOH A . 
B 2 HOH 129 294 129 HOH HOH A . 
B 2 HOH 130 295 130 HOH HOH A . 
B 2 HOH 131 296 131 HOH HOH A . 
B 2 HOH 132 297 132 HOH HOH A . 
#