data_3K0W
# 
_entry.id   3K0W 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3K0W         
RCSB  RCSB055405   
WWPDB D_1000055405 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3BFO 
'Crystal structure of Ig-like C2-type 2 domain of the human Mucosa-associated lymphoid tissue lymphoma translocation protein 1' 
unspecified 
PDB 2G7R 'X-ray structure of the death domain of the human mucosa associated lymphoid tissue lymphoma translocation protein 1' 
unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3K0W 
_pdbx_database_status.recvd_initial_deposition_date   2009-09-25 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        Y 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Walker, J.R.'                         1  
'Qiu, L.'                              2  
'Butler-Cole, C.'                      3  
'Weigelt, J.'                          4  
'Bountra, C.'                          5  
'Arrowsmith, C.H.'                     6  
'Edwards, A.M.'                        7  
'Bochkarev, A.'                        8  
'Dhe-Paganon, S.'                      9  
'Structural Genomics Consortium (SGC)' 10 
# 
_citation.id                        primary 
_citation.title                     
'Structure of the Tandem Ig-Like C2-Type 2 Domains of the Human Mucosa-Associated Lymphoid Tissue Lymphoma Translocation Protein 1.' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Walker, J.R.'     1 
primary 'Qiu, L.'          2 
primary 'Butler-Cole, C.'  3 
primary 'Bountra, C.'      4 
primary 'Weigelt, J.'      5 
primary 'Arrowsmith, C.H.' 6 
primary 'Edwards, A.M.'    7 
primary 'Bochkarev, A.'    8 
primary 'Dhe-Paganon, S.'  9 
# 
_cell.entry_id           3K0W 
_cell.length_a           90.355 
_cell.length_b           90.355 
_cell.length_c           182.173 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.00 
_cell.angle_gamma        120.00 
_cell.Z_PDB              12 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3K0W 
_symmetry.space_group_name_H-M             'P 62 2 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                180 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2' 24890.014 1  3.4.22.- ? 
'Tandem IG-like C2-type 2 domain: UNP residues 128-326' ? 
2 non-polymer syn 'CHLORIDE ION'                                                                  35.453    1  ?        ? ? ? 
3 water       nat water                                                                           18.015    14 ?        ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'MALT lymphoma-associated translocation, Paracaspase' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGSSHHHHHHSSGLVPRGSKITVNPESKAVLAGQFVKLCCRATGHPFVQYQWFKMNKEIPNGNTSELIFNAVHVKDAGFY
VCRVNNNFTFEFSQWSQLDVCDIPESFQRSVDGVSESKLQICVEPTSQKLMPGSTLVLQCVAVGSPIPHYQWFKNELPLT
HETKKLYMVPYVDLEHQGTYWCHVYNDRDSQDSKKVEIIIDELNNLGHPDNKEQTTDQ
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGSSHHHHHHSSGLVPRGSKITVNPESKAVLAGQFVKLCCRATGHPFVQYQWFKMNKEIPNGNTSELIFNAVHVKDAGFY
VCRVNNNFTFEFSQWSQLDVCDIPESFQRSVDGVSESKLQICVEPTSQKLMPGSTLVLQCVAVGSPIPHYQWFKNELPLT
HETKKLYMVPYVDLEHQGTYWCHVYNDRDSQDSKKVEIIIDELNNLGHPDNKEQTTDQ
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   SER n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  SER n 
1 12  SER n 
1 13  GLY n 
1 14  LEU n 
1 15  VAL n 
1 16  PRO n 
1 17  ARG n 
1 18  GLY n 
1 19  SER n 
1 20  LYS n 
1 21  ILE n 
1 22  THR n 
1 23  VAL n 
1 24  ASN n 
1 25  PRO n 
1 26  GLU n 
1 27  SER n 
1 28  LYS n 
1 29  ALA n 
1 30  VAL n 
1 31  LEU n 
1 32  ALA n 
1 33  GLY n 
1 34  GLN n 
1 35  PHE n 
1 36  VAL n 
1 37  LYS n 
1 38  LEU n 
1 39  CYS n 
1 40  CYS n 
1 41  ARG n 
1 42  ALA n 
1 43  THR n 
1 44  GLY n 
1 45  HIS n 
1 46  PRO n 
1 47  PHE n 
1 48  VAL n 
1 49  GLN n 
1 50  TYR n 
1 51  GLN n 
1 52  TRP n 
1 53  PHE n 
1 54  LYS n 
1 55  MET n 
1 56  ASN n 
1 57  LYS n 
1 58  GLU n 
1 59  ILE n 
1 60  PRO n 
1 61  ASN n 
1 62  GLY n 
1 63  ASN n 
1 64  THR n 
1 65  SER n 
1 66  GLU n 
1 67  LEU n 
1 68  ILE n 
1 69  PHE n 
1 70  ASN n 
1 71  ALA n 
1 72  VAL n 
1 73  HIS n 
1 74  VAL n 
1 75  LYS n 
1 76  ASP n 
1 77  ALA n 
1 78  GLY n 
1 79  PHE n 
1 80  TYR n 
1 81  VAL n 
1 82  CYS n 
1 83  ARG n 
1 84  VAL n 
1 85  ASN n 
1 86  ASN n 
1 87  ASN n 
1 88  PHE n 
1 89  THR n 
1 90  PHE n 
1 91  GLU n 
1 92  PHE n 
1 93  SER n 
1 94  GLN n 
1 95  TRP n 
1 96  SER n 
1 97  GLN n 
1 98  LEU n 
1 99  ASP n 
1 100 VAL n 
1 101 CYS n 
1 102 ASP n 
1 103 ILE n 
1 104 PRO n 
1 105 GLU n 
1 106 SER n 
1 107 PHE n 
1 108 GLN n 
1 109 ARG n 
1 110 SER n 
1 111 VAL n 
1 112 ASP n 
1 113 GLY n 
1 114 VAL n 
1 115 SER n 
1 116 GLU n 
1 117 SER n 
1 118 LYS n 
1 119 LEU n 
1 120 GLN n 
1 121 ILE n 
1 122 CYS n 
1 123 VAL n 
1 124 GLU n 
1 125 PRO n 
1 126 THR n 
1 127 SER n 
1 128 GLN n 
1 129 LYS n 
1 130 LEU n 
1 131 MET n 
1 132 PRO n 
1 133 GLY n 
1 134 SER n 
1 135 THR n 
1 136 LEU n 
1 137 VAL n 
1 138 LEU n 
1 139 GLN n 
1 140 CYS n 
1 141 VAL n 
1 142 ALA n 
1 143 VAL n 
1 144 GLY n 
1 145 SER n 
1 146 PRO n 
1 147 ILE n 
1 148 PRO n 
1 149 HIS n 
1 150 TYR n 
1 151 GLN n 
1 152 TRP n 
1 153 PHE n 
1 154 LYS n 
1 155 ASN n 
1 156 GLU n 
1 157 LEU n 
1 158 PRO n 
1 159 LEU n 
1 160 THR n 
1 161 HIS n 
1 162 GLU n 
1 163 THR n 
1 164 LYS n 
1 165 LYS n 
1 166 LEU n 
1 167 TYR n 
1 168 MET n 
1 169 VAL n 
1 170 PRO n 
1 171 TYR n 
1 172 VAL n 
1 173 ASP n 
1 174 LEU n 
1 175 GLU n 
1 176 HIS n 
1 177 GLN n 
1 178 GLY n 
1 179 THR n 
1 180 TYR n 
1 181 TRP n 
1 182 CYS n 
1 183 HIS n 
1 184 VAL n 
1 185 TYR n 
1 186 ASN n 
1 187 ASP n 
1 188 ARG n 
1 189 ASP n 
1 190 SER n 
1 191 GLN n 
1 192 ASP n 
1 193 SER n 
1 194 LYS n 
1 195 LYS n 
1 196 VAL n 
1 197 GLU n 
1 198 ILE n 
1 199 ILE n 
1 200 ILE n 
1 201 ASP n 
1 202 GLU n 
1 203 LEU n 
1 204 ASN n 
1 205 ASN n 
1 206 LEU n 
1 207 GLY n 
1 208 HIS n 
1 209 PRO n 
1 210 ASP n 
1 211 ASN n 
1 212 LYS n 
1 213 GLU n 
1 214 GLN n 
1 215 THR n 
1 216 THR n 
1 217 ASP n 
1 218 GLN n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'MALT1, MLT' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   'THE SEQUENCE MGSSHHHHHHSSGLVPRGS BELONGS TO THE VECTOR.' 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          Plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28a-LIC 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    MALT1_HUMAN 
_struct_ref.pdbx_db_accession          Q9UDY8-2 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;KITVNPESKAVLAGQFVKLCCRATGHPFVQYQWFKMNKEIPNGNTSELIFNAVHVKDAGFYVCRVNNNFTFEFSQWSQLD
VCDIPESFQRSVDGVSESKLQICVEPTSQKLMPGSTLVLQCVAVGSPIPHYQWFKNELPLTHETKKLYMVPYVDLEHQGT
YWCHVYNDRDSQDSKKVEIIIDELNNLGHPDNKEQTTDQ
;
_struct_ref.pdbx_align_begin           128 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              3K0W 
_struct_ref_seq.pdbx_strand_id                A 
_struct_ref_seq.seq_align_beg                 20 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 218 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q9UDY8-2 
_struct_ref_seq.db_align_beg                  128 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  326 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       128 
_struct_ref_seq.pdbx_auth_seq_align_end       326 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3K0W MET A 1  ? UNP Q9UDY8-2 ? ? 'EXPRESSION TAG' 109 1  
1 3K0W GLY A 2  ? UNP Q9UDY8-2 ? ? 'EXPRESSION TAG' 110 2  
1 3K0W SER A 3  ? UNP Q9UDY8-2 ? ? 'EXPRESSION TAG' 111 3  
1 3K0W SER A 4  ? UNP Q9UDY8-2 ? ? 'EXPRESSION TAG' 112 4  
1 3K0W HIS A 5  ? UNP Q9UDY8-2 ? ? 'EXPRESSION TAG' 113 5  
1 3K0W HIS A 6  ? UNP Q9UDY8-2 ? ? 'EXPRESSION TAG' 114 6  
1 3K0W HIS A 7  ? UNP Q9UDY8-2 ? ? 'EXPRESSION TAG' 115 7  
1 3K0W HIS A 8  ? UNP Q9UDY8-2 ? ? 'EXPRESSION TAG' 116 8  
1 3K0W HIS A 9  ? UNP Q9UDY8-2 ? ? 'EXPRESSION TAG' 117 9  
1 3K0W HIS A 10 ? UNP Q9UDY8-2 ? ? 'EXPRESSION TAG' 118 10 
1 3K0W SER A 11 ? UNP Q9UDY8-2 ? ? 'EXPRESSION TAG' 119 11 
1 3K0W SER A 12 ? UNP Q9UDY8-2 ? ? 'EXPRESSION TAG' 120 12 
1 3K0W GLY A 13 ? UNP Q9UDY8-2 ? ? 'EXPRESSION TAG' 121 13 
1 3K0W LEU A 14 ? UNP Q9UDY8-2 ? ? 'EXPRESSION TAG' 122 14 
1 3K0W VAL A 15 ? UNP Q9UDY8-2 ? ? 'EXPRESSION TAG' 123 15 
1 3K0W PRO A 16 ? UNP Q9UDY8-2 ? ? 'EXPRESSION TAG' 124 16 
1 3K0W ARG A 17 ? UNP Q9UDY8-2 ? ? 'EXPRESSION TAG' 125 17 
1 3K0W GLY A 18 ? UNP Q9UDY8-2 ? ? 'EXPRESSION TAG' 126 18 
1 3K0W SER A 19 ? UNP Q9UDY8-2 ? ? 'EXPRESSION TAG' 127 19 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CL  non-polymer         . 'CHLORIDE ION'  ? 'Cl -1'          35.453  
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
# 
_exptl.entry_id          3K0W 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      4.31 
_exptl_crystal.density_percent_sol   71.48 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            289 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              9.0 
_exptl_crystal_grow.pdbx_details    
;1:1 VOLUME RATIO OF PROTEIN SOLUTION (10 mg/mL) AND RESERVOIR SOLUTION (1.5 M MAGNESIUM CHLORIDE, 0.1 M BICINE pH 9.0), VAPOR DIFFUSION, SITTING DROP, temperature 289K
;
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'MARMOSAIC 225 mm CCD' 
_diffrn_detector.pdbx_collection_date   2009-09-09 
_diffrn_detector.details                Mirrors 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    'DOUBLE CRYSTAL' 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   0.97920 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'CLSI BEAMLINE 08ID-1' 
_diffrn_source.pdbx_synchrotron_site       CLSI 
_diffrn_source.pdbx_synchrotron_beamline   08ID-1 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        0.97920 
# 
_reflns.entry_id                     3K0W 
_reflns.observed_criterion_sigma_I   -3.000 
_reflns.observed_criterion_sigma_F   0 
_reflns.d_resolution_low             40.47 
_reflns.d_resolution_high            2.80 
_reflns.number_obs                   11498 
_reflns.number_all                   11498 
_reflns.percent_possible_obs         99.9 
_reflns.pdbx_Rmerge_I_obs            ? 
_reflns.pdbx_Rsym_value              0.082 
_reflns.pdbx_netI_over_sigmaI        43.44 
_reflns.B_iso_Wilson_estimate        96.13 
_reflns.pdbx_redundancy              18.80 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             2.80 
_reflns_shell.d_res_low              2.90 
_reflns_shell.percent_possible_all   91.8 
_reflns_shell.Rmerge_I_obs           ? 
_reflns_shell.pdbx_Rsym_value        0.791 
_reflns_shell.meanI_over_sigI_obs    2.82 
_reflns_shell.pdbx_redundancy        17.9 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      1104 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3K0W 
_refine.ls_number_reflns_obs                     11447 
_refine.ls_number_reflns_all                     11447 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          0.0 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             40.47 
_refine.ls_d_res_high                            2.80 
_refine.ls_percent_reflns_obs                    ? 
_refine.ls_R_factor_obs                          0.2196 
_refine.ls_R_factor_all                          0.2196 
_refine.ls_R_factor_R_work                       0.2183 
_refine.ls_R_factor_R_free                       0.2489 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.80 
_refine.ls_number_reflns_R_free                  549 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.occupancy_min                            ? 
_refine.occupancy_max                            ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               87.14 
_refine.aniso_B[1][1]                            -1.0991 
_refine.aniso_B[2][2]                            -1.0991 
_refine.aniso_B[3][3]                            2.1982 
_refine.aniso_B[1][2]                            0.0000 
_refine.aniso_B[1][3]                            0.0000 
_refine.aniso_B[2][3]                            0.0000 
_refine.solvent_model_details                    ? 
_refine.solvent_model_param_ksol                 ? 
_refine.solvent_model_param_bsol                 ? 
_refine.pdbx_solvent_vdw_probe_radii             ? 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             ? 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB entry 3BFO' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       'Engh & Huber' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            ? 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.B_iso_min                                ? 
_refine.B_iso_max                                ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1457 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         1 
_refine_hist.number_atoms_solvent             14 
_refine_hist.number_atoms_total               1472 
_refine_hist.d_res_high                       2.80 
_refine_hist.d_res_low                        40.47 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
o_bond_d    0.010 ? ? ? 'X-RAY DIFFRACTION' ? 
o_angle_deg 1.32  ? ? ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.pdbx_total_number_of_bins_used   6 
_refine_ls_shell.d_res_high                       2.80 
_refine_ls_shell.d_res_low                        3.07 
_refine_ls_shell.number_reflns_R_work             2506 
_refine_ls_shell.R_factor_R_work                  0.2674 
_refine_ls_shell.percent_reflns_obs               ? 
_refine_ls_shell.R_factor_R_free                  0.3238 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.percent_reflns_R_free            5.22 
_refine_ls_shell.number_reflns_R_free             138 
_refine_ls_shell.number_reflns_all                ? 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.number_reflns_obs                2644 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3K0W 
_struct.title                     
;Crystal structure of the tandem IG-like C2-type 2 domains of the human mucosa-associated lymphoid tissue lymphoma translocation protein 1
;
_struct.pdbx_descriptor           'Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2 (E.C.3.4.22.-)' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            N 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3K0W 
_struct_keywords.pdbx_keywords   HYDROLASE 
_struct_keywords.text            
;HYDROLASE, IMMUNOGLOBULIN DOMAIN, NUCLEUS, PROTEASE, CHROMOSOMAL TRANSLOCATION, LYMPHOMA, UBL CONJUGATION PATHWAY, STRUCTURAL GENOMICS CONSORTIUM, SGC, Alternative splicing, Chromosomal rearrangement, Cytoplasm, Disulfide bond, Phosphoprotein, Polymorphism
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 HIS A 73  ? ALA A 77  ? HIS A 181 ALA A 185 5 ? 5 
HELX_P HELX_P2 2 PRO A 104 ? GLN A 108 ? PRO A 212 GLN A 216 5 ? 5 
HELX_P HELX_P3 3 ASP A 173 ? GLN A 177 ? ASP A 281 GLN A 285 5 ? 5 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 HIS 45  A . ? HIS 153 A PRO 46  A ? PRO 154 A 1 1.30 
2 SER 145 A . ? SER 253 A PRO 146 A ? PRO 254 A 1 4.58 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 2 ? 
B ? 5 ? 
C ? 4 ? 
D ? 2 ? 
E ? 2 ? 
F ? 5 ? 
G ? 4 ? 
H ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
B 1 2 ? parallel      
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
C 1 2 ? parallel      
C 2 3 ? anti-parallel 
C 3 4 ? anti-parallel 
D 1 2 ? anti-parallel 
E 1 2 ? anti-parallel 
F 1 2 ? parallel      
F 2 3 ? anti-parallel 
F 3 4 ? anti-parallel 
F 4 5 ? anti-parallel 
G 1 2 ? parallel      
G 2 3 ? anti-parallel 
G 3 4 ? anti-parallel 
H 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 ILE A 21  ? VAL A 23  ? ILE A 129 VAL A 131 
A 2 ARG A 41  ? ALA A 42  ? ARG A 149 ALA A 150 
B 1 LYS A 28  ? LEU A 31  ? LYS A 136 LEU A 139 
B 2 SER A 96  ? CYS A 101 ? SER A 204 CYS A 209 
B 3 GLY A 78  ? ASN A 85  ? GLY A 186 ASN A 193 
B 4 GLN A 49  ? LYS A 54  ? GLN A 157 LYS A 162 
B 5 LYS A 57  ? GLU A 58  ? LYS A 165 GLU A 166 
C 1 LYS A 28  ? LEU A 31  ? LYS A 136 LEU A 139 
C 2 SER A 96  ? CYS A 101 ? SER A 204 CYS A 209 
C 3 GLY A 78  ? ASN A 85  ? GLY A 186 ASN A 193 
C 4 GLU A 91  ? PHE A 92  ? GLU A 199 PHE A 200 
D 1 VAL A 36  ? CYS A 39  ? VAL A 144 CYS A 147 
D 2 GLU A 66  ? PHE A 69  ? GLU A 174 PHE A 177 
E 1 GLN A 120 ? VAL A 123 ? GLN A 228 VAL A 231 
E 2 VAL A 141 ? VAL A 143 ? VAL A 249 VAL A 251 
F 1 GLN A 128 ? LEU A 130 ? GLN A 236 LEU A 238 
F 2 VAL A 196 ? ILE A 200 ? VAL A 304 ILE A 308 
F 3 GLY A 178 ? TYR A 185 ? GLY A 286 TYR A 293 
F 4 HIS A 149 ? LYS A 154 ? HIS A 257 LYS A 262 
F 5 LEU A 157 ? PRO A 158 ? LEU A 265 PRO A 266 
G 1 GLN A 128 ? LEU A 130 ? GLN A 236 LEU A 238 
G 2 VAL A 196 ? ILE A 200 ? VAL A 304 ILE A 308 
G 3 GLY A 178 ? TYR A 185 ? GLY A 286 TYR A 293 
G 4 SER A 190 ? ASP A 192 ? SER A 298 ASP A 300 
H 1 LEU A 136 ? GLN A 139 ? LEU A 244 GLN A 247 
H 2 LEU A 166 ? VAL A 169 ? LEU A 274 VAL A 277 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N VAL A 23  ? N VAL A 131 O ARG A 41  ? O ARG A 149 
B 1 2 N LYS A 28  ? N LYS A 136 O ASP A 99  ? O ASP A 207 
B 2 3 O LEU A 98  ? O LEU A 206 N GLY A 78  ? N GLY A 186 
B 3 4 O ARG A 83  ? O ARG A 191 N GLN A 51  ? N GLN A 159 
B 4 5 N LYS A 54  ? N LYS A 162 O LYS A 57  ? O LYS A 165 
C 1 2 N LYS A 28  ? N LYS A 136 O ASP A 99  ? O ASP A 207 
C 2 3 O LEU A 98  ? O LEU A 206 N GLY A 78  ? N GLY A 186 
C 3 4 N VAL A 84  ? N VAL A 192 O GLU A 91  ? O GLU A 199 
D 1 2 N VAL A 36  ? N VAL A 144 O PHE A 69  ? O PHE A 177 
E 1 2 N CYS A 122 ? N CYS A 230 O VAL A 141 ? O VAL A 249 
F 1 2 N LEU A 130 ? N LEU A 238 O ILE A 199 ? O ILE A 307 
F 2 3 O VAL A 196 ? O VAL A 304 N TYR A 180 ? N TYR A 288 
F 3 4 O TRP A 181 ? O TRP A 289 N PHE A 153 ? N PHE A 261 
F 4 5 N LYS A 154 ? N LYS A 262 O LEU A 157 ? O LEU A 265 
G 1 2 N LEU A 130 ? N LEU A 238 O ILE A 199 ? O ILE A 307 
G 2 3 O VAL A 196 ? O VAL A 304 N TYR A 180 ? N TYR A 288 
G 3 4 N VAL A 184 ? N VAL A 292 O GLN A 191 ? O GLN A 299 
H 1 2 N LEU A 138 ? N LEU A 246 O TYR A 167 ? O TYR A 275 
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    4 
_struct_site.details              'BINDING SITE FOR RESIDUE CL A 401' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1 AC1 4 PRO A 25 ? PRO A 133 . ? 1_555 ? 
2 AC1 4 GLU A 26 ? GLU A 134 . ? 1_555 ? 
3 AC1 4 LYS A 28 ? LYS A 136 . ? 1_555 ? 
4 AC1 4 CYS A 39 ? CYS A 147 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3K0W 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3K0W 
_atom_sites.fract_transf_matrix[1][1]   0.011067 
_atom_sites.fract_transf_matrix[1][2]   0.006390 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.012780 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.005489 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
CL 
N  
O  
S  
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . SER A 1 19  ? -7.131  38.151 -4.400 1.00 105.34 ? 127 SER A N   1 
ATOM   2    C  CA  . SER A 1 19  ? -7.951  38.442 -5.577 1.00 106.85 ? 127 SER A CA  1 
ATOM   3    C  C   . SER A 1 19  ? -9.462  38.245 -5.291 1.00 108.15 ? 127 SER A C   1 
ATOM   4    O  O   . SER A 1 19  ? -9.834  38.148 -4.123 1.00 103.31 ? 127 SER A O   1 
ATOM   5    C  CB  . SER A 1 19  ? -7.455  37.672 -6.807 1.00 111.70 ? 127 SER A CB  1 
ATOM   6    O  OG  . SER A 1 19  ? -7.125  36.318 -6.537 1.00 115.01 ? 127 SER A OG  1 
ATOM   7    N  N   . LYS A 1 20  ? -10.326 38.236 -6.354 1.00 106.53 ? 128 LYS A N   1 
ATOM   8    C  CA  . LYS A 1 20  ? -11.795 38.069 -6.297 1.00 103.68 ? 128 LYS A CA  1 
ATOM   9    C  C   . LYS A 1 20  ? -12.184 36.707 -5.672 1.00 102.98 ? 128 LYS A C   1 
ATOM   10   O  O   . LYS A 1 20  ? -11.403 35.750 -5.732 1.00 103.31 ? 128 LYS A O   1 
ATOM   11   C  CB  . LYS A 1 20  ? -12.393 38.238 -7.716 1.00 108.78 ? 128 LYS A CB  1 
ATOM   12   C  CG  . LYS A 1 20  ? -13.906 38.395 -7.797 1.00 118.35 ? 128 LYS A CG  1 
ATOM   13   C  CD  . LYS A 1 20  ? -14.360 39.848 -7.686 1.00 126.26 ? 128 LYS A CD  1 
ATOM   14   C  CE  . LYS A 1 20  ? -15.864 39.988 -7.796 1.00 120.72 ? 128 LYS A CE  1 
ATOM   15   N  NZ  . LYS A 1 20  ? -16.250 41.216 -8.546 1.00 119.55 ? 128 LYS A NZ  1 
ATOM   16   N  N   . ILE A 1 21  ? -13.382 36.639 -5.066 1.00 94.98  ? 129 ILE A N   1 
ATOM   17   C  CA  . ILE A 1 21  ? -13.912 35.461 -4.376 1.00 91.55  ? 129 ILE A CA  1 
ATOM   18   C  C   . ILE A 1 21  ? -15.005 34.804 -5.217 1.00 95.82  ? 129 ILE A C   1 
ATOM   19   O  O   . ILE A 1 21  ? -15.959 35.476 -5.619 1.00 96.23  ? 129 ILE A O   1 
ATOM   20   C  CB  . ILE A 1 21  ? -14.403 35.836 -2.930 1.00 90.76  ? 129 ILE A CB  1 
ATOM   21   C  CG1 . ILE A 1 21  ? -13.266 36.492 -2.114 1.00 90.23  ? 129 ILE A CG1 1 
ATOM   22   C  CG2 . ILE A 1 21  ? -14.974 34.623 -2.196 1.00 88.41  ? 129 ILE A CG2 1 
ATOM   23   C  CD1 . ILE A 1 21  ? -13.628 37.107 -0.792 1.00 92.47  ? 129 ILE A CD1 1 
ATOM   24   N  N   . THR A 1 22  ? -14.874 33.481 -5.441 1.00 92.31  ? 130 THR A N   1 
ATOM   25   C  CA  . THR A 1 22  ? -15.796 32.643 -6.225 1.00 93.69  ? 130 THR A CA  1 
ATOM   26   C  C   . THR A 1 22  ? -16.909 32.089 -5.345 1.00 94.88  ? 130 THR A C   1 
ATOM   27   O  O   . THR A 1 22  ? -18.075 32.085 -5.753 1.00 95.64  ? 130 THR A O   1 
ATOM   28   C  CB  . THR A 1 22  ? -15.018 31.500 -6.911 1.00 101.27 ? 130 THR A CB  1 
ATOM   29   O  OG1 . THR A 1 22  ? -13.815 32.013 -7.500 1.00 107.29 ? 130 THR A OG1 1 
ATOM   30   C  CG2 . THR A 1 22  ? -15.856 30.746 -7.943 1.00 98.03  ? 130 THR A CG2 1 
ATOM   31   N  N   . VAL A 1 23  ? -16.536 31.566 -4.167 1.00 88.84  ? 131 VAL A N   1 
ATOM   32   C  CA  . VAL A 1 23  ? -17.469 30.983 -3.202 1.00 85.96  ? 131 VAL A CA  1 
ATOM   33   C  C   . VAL A 1 23  ? -17.367 31.764 -1.907 1.00 85.87  ? 131 VAL A C   1 
ATOM   34   O  O   . VAL A 1 23  ? -16.275 31.865 -1.345 1.00 86.78  ? 131 VAL A O   1 
ATOM   35   C  CB  . VAL A 1 23  ? -17.209 29.465 -2.951 1.00 89.41  ? 131 VAL A CB  1 
ATOM   36   C  CG1 . VAL A 1 23  ? -18.175 28.895 -1.913 1.00 86.64  ? 131 VAL A CG1 1 
ATOM   37   C  CG2 . VAL A 1 23  ? -17.267 28.656 -4.238 1.00 92.83  ? 131 VAL A CG2 1 
ATOM   38   N  N   . ASN A 1 24  ? -18.505 32.279 -1.433 1.00 78.44  ? 132 ASN A N   1 
ATOM   39   C  CA  . ASN A 1 24  ? -18.687 32.980 -0.159 1.00 74.15  ? 132 ASN A CA  1 
ATOM   40   C  C   . ASN A 1 24  ? -19.316 31.994 0.835  1.00 74.91  ? 132 ASN A C   1 
ATOM   41   O  O   . ASN A 1 24  ? -20.095 31.128 0.414  1.00 75.71  ? 132 ASN A O   1 
ATOM   42   C  CB  . ASN A 1 24  ? -19.630 34.182 -0.332 1.00 70.28  ? 132 ASN A CB  1 
ATOM   43   C  CG  . ASN A 1 24  ? -18.929 35.463 -0.694 1.00 88.80  ? 132 ASN A CG  1 
ATOM   44   O  OD1 . ASN A 1 24  ? -18.215 36.059 0.111  1.00 81.68  ? 132 ASN A OD1 1 
ATOM   45   N  ND2 . ASN A 1 24  ? -19.142 35.938 -1.899 1.00 82.69  ? 132 ASN A ND2 1 
ATOM   46   N  N   . PRO A 1 25  ? -19.013 32.088 2.147  1.00 67.71  ? 133 PRO A N   1 
ATOM   47   C  CA  . PRO A 1 25  ? -19.665 31.176 3.101  1.00 65.92  ? 133 PRO A CA  1 
ATOM   48   C  C   . PRO A 1 25  ? -21.129 31.507 3.360  1.00 70.57  ? 133 PRO A C   1 
ATOM   49   O  O   . PRO A 1 25  ? -21.569 32.665 3.306  1.00 68.84  ? 133 PRO A O   1 
ATOM   50   C  CB  . PRO A 1 25  ? -18.809 31.284 4.363  1.00 65.80  ? 133 PRO A CB  1 
ATOM   51   C  CG  . PRO A 1 25  ? -17.993 32.496 4.208  1.00 69.83  ? 133 PRO A CG  1 
ATOM   52   C  CD  . PRO A 1 25  ? -18.122 33.046 2.826  1.00 67.77  ? 133 PRO A CD  1 
ATOM   53   N  N   . GLU A 1 26  ? -21.891 30.455 3.606  1.00 69.76  ? 134 GLU A N   1 
ATOM   54   C  CA  . GLU A 1 26  ? -23.315 30.536 3.902  1.00 69.63  ? 134 GLU A CA  1 
ATOM   55   C  C   . GLU A 1 26  ? -23.500 30.622 5.417  1.00 71.65  ? 134 GLU A C   1 
ATOM   56   O  O   . GLU A 1 26  ? -22.728 30.034 6.177  1.00 70.06  ? 134 GLU A O   1 
ATOM   57   C  CB  . GLU A 1 26  ? -24.019 29.274 3.372  1.00 73.04  ? 134 GLU A CB  1 
ATOM   58   C  CG  . GLU A 1 26  ? -24.941 29.483 2.173  1.00 90.50  ? 134 GLU A CG  1 
ATOM   59   C  CD  . GLU A 1 26  ? -25.598 28.232 1.593  1.00 124.99 ? 134 GLU A CD  1 
ATOM   60   O  OE1 . GLU A 1 26  ? -26.253 28.348 0.530  1.00 117.32 ? 134 GLU A OE1 1 
ATOM   61   O  OE2 . GLU A 1 26  ? -25.444 27.134 2.179  1.00 124.82 ? 134 GLU A OE2 1 
ATOM   62   N  N   . SER A 1 27  ? -24.523 31.360 5.857  1.00 68.51  ? 135 SER A N   1 
ATOM   63   C  CA  . SER A 1 27  ? -24.911 31.413 7.273  1.00 65.42  ? 135 SER A CA  1 
ATOM   64   C  C   . SER A 1 27  ? -25.722 30.123 7.478  1.00 69.30  ? 135 SER A C   1 
ATOM   65   O  O   . SER A 1 27  ? -26.461 29.728 6.575  1.00 68.84  ? 135 SER A O   1 
ATOM   66   C  CB  . SER A 1 27  ? -25.781 32.635 7.557  1.00 64.87  ? 135 SER A CB  1 
ATOM   67   O  OG  . SER A 1 27  ? -25.053 33.799 7.213  1.00 71.18  ? 135 SER A OG  1 
ATOM   68   N  N   . LYS A 1 28  ? -25.540 29.431 8.615  1.00 65.44  ? 136 LYS A N   1 
ATOM   69   C  CA  . LYS A 1 28  ? -26.220 28.148 8.844  1.00 65.13  ? 136 LYS A CA  1 
ATOM   70   C  C   . LYS A 1 28  ? -26.484 27.844 10.303 1.00 68.76  ? 136 LYS A C   1 
ATOM   71   O  O   . LYS A 1 28  ? -25.778 28.325 11.193 1.00 67.30  ? 136 LYS A O   1 
ATOM   72   C  CB  . LYS A 1 28  ? -25.418 26.993 8.194  1.00 68.19  ? 136 LYS A CB  1 
ATOM   73   C  CG  . LYS A 1 28  ? -23.936 26.916 8.631  1.00 69.76  ? 136 LYS A CG  1 
ATOM   74   C  CD  . LYS A 1 28  ? -23.095 25.943 7.817  1.00 72.99  ? 136 LYS A CD  1 
ATOM   75   C  CE  . LYS A 1 28  ? -22.647 26.468 6.475  1.00 77.35  ? 136 LYS A CE  1 
ATOM   76   N  NZ  . LYS A 1 28  ? -21.983 25.409 5.677  1.00 92.16  ? 136 LYS A NZ  1 
ATOM   77   N  N   . ALA A 1 29  ? -27.513 27.030 10.545 1.00 67.90  ? 137 ALA A N   1 
ATOM   78   C  CA  . ALA A 1 29  ? -27.882 26.542 11.875 1.00 66.66  ? 137 ALA A CA  1 
ATOM   79   C  C   . ALA A 1 29  ? -27.652 25.034 11.889 1.00 70.12  ? 137 ALA A C   1 
ATOM   80   O  O   . ALA A 1 29  ? -28.030 24.335 10.949 1.00 71.23  ? 137 ALA A O   1 
ATOM   81   C  CB  . ALA A 1 29  ? -29.327 26.868 12.189 1.00 67.25  ? 137 ALA A CB  1 
ATOM   82   N  N   . VAL A 1 30  ? -26.938 24.571 12.909 1.00 65.83  ? 138 VAL A N   1 
ATOM   83   C  CA  . VAL A 1 30  ? -26.523 23.189 13.129 1.00 67.50  ? 138 VAL A CA  1 
ATOM   84   C  C   . VAL A 1 30  ? -26.775 22.820 14.602 1.00 70.52  ? 138 VAL A C   1 
ATOM   85   O  O   . VAL A 1 30  ? -26.923 23.705 15.450 1.00 67.26  ? 138 VAL A O   1 
ATOM   86   C  CB  . VAL A 1 30  ? -24.997 23.011 12.785 1.00 72.08  ? 138 VAL A CB  1 
ATOM   87   C  CG1 . VAL A 1 30  ? -24.684 23.403 11.338 1.00 71.86  ? 138 VAL A CG1 1 
ATOM   88   C  CG2 . VAL A 1 30  ? -24.109 23.798 13.751 1.00 70.08  ? 138 VAL A CG2 1 
ATOM   89   N  N   . LEU A 1 31  ? -26.780 21.512 14.901 1.00 69.70  ? 139 LEU A N   1 
ATOM   90   C  CA  . LEU A 1 31  ? -26.874 20.998 16.259 1.00 69.62  ? 139 LEU A CA  1 
ATOM   91   C  C   . LEU A 1 31  ? -25.442 20.791 16.754 1.00 73.92  ? 139 LEU A C   1 
ATOM   92   O  O   . LEU A 1 31  ? -24.550 20.457 15.967 1.00 73.04  ? 139 LEU A O   1 
ATOM   93   C  CB  . LEU A 1 31  ? -27.587 19.644 16.281 1.00 72.62  ? 139 LEU A CB  1 
ATOM   94   C  CG  . LEU A 1 31  ? -29.118 19.578 16.199 1.00 78.87  ? 139 LEU A CG  1 
ATOM   95   C  CD1 . LEU A 1 31  ? -29.817 20.949 16.392 1.00 76.17  ? 139 LEU A CD1 1 
ATOM   96   C  CD2 . LEU A 1 31  ? -29.553 18.854 14.953 1.00 84.04  ? 139 LEU A CD2 1 
ATOM   97   N  N   . ALA A 1 32  ? -25.224 20.964 18.058 1.00 71.75  ? 140 ALA A N   1 
ATOM   98   C  CA  . ALA A 1 32  ? -23.927 20.722 18.683 1.00 71.90  ? 140 ALA A CA  1 
ATOM   99   C  C   . ALA A 1 32  ? -23.556 19.231 18.515 1.00 78.81  ? 140 ALA A C   1 
ATOM   100  O  O   . ALA A 1 32  ? -24.452 18.372 18.451 1.00 79.48  ? 140 ALA A O   1 
ATOM   101  C  CB  . ALA A 1 32  ? -23.974 21.118 20.146 1.00 71.87  ? 140 ALA A CB  1 
ATOM   102  N  N   . GLY A 1 33  ? -22.253 18.973 18.334 1.00 76.22  ? 141 GLY A N   1 
ATOM   103  C  CA  . GLY A 1 33  ? -21.696 17.645 18.106 1.00 78.72  ? 141 GLY A CA  1 
ATOM   104  C  C   . GLY A 1 33  ? -21.530 17.303 16.637 1.00 84.01  ? 141 GLY A C   1 
ATOM   105  O  O   . GLY A 1 33  ? -20.721 16.433 16.297 1.00 87.38  ? 141 GLY A O   1 
ATOM   106  N  N   . GLN A 1 34  ? -22.303 17.977 15.751 1.00 77.01  ? 142 GLN A N   1 
ATOM   107  C  CA  . GLN A 1 34  ? -22.288 17.771 14.302 1.00 76.93  ? 142 GLN A CA  1 
ATOM   108  C  C   . GLN A 1 34  ? -20.990 18.260 13.617 1.00 81.22  ? 142 GLN A C   1 
ATOM   109  O  O   . GLN A 1 34  ? -20.316 19.163 14.122 1.00 78.97  ? 142 GLN A O   1 
ATOM   110  C  CB  . GLN A 1 34  ? -23.510 18.460 13.657 1.00 76.01  ? 142 GLN A CB  1 
ATOM   111  C  CG  . GLN A 1 34  ? -24.735 17.559 13.506 1.00 89.98  ? 142 GLN A CG  1 
ATOM   112  C  CD  . GLN A 1 34  ? -25.851 18.197 12.705 1.00 111.21 ? 142 GLN A CD  1 
ATOM   113  O  OE1 . GLN A 1 34  ? -26.261 19.349 12.926 1.00 101.77 ? 142 GLN A OE1 1 
ATOM   114  N  NE2 . GLN A 1 34  ? -26.415 17.431 11.785 1.00 114.50 ? 142 GLN A NE2 1 
ATOM   115  N  N   . PHE A 1 35  ? -20.661 17.666 12.448 1.00 79.33  ? 143 PHE A N   1 
ATOM   116  C  CA  . PHE A 1 35  ? -19.523 18.063 11.618 1.00 78.46  ? 143 PHE A CA  1 
ATOM   117  C  C   . PHE A 1 35  ? -19.992 19.243 10.756 1.00 82.20  ? 143 PHE A C   1 
ATOM   118  O  O   . PHE A 1 35  ? -20.988 19.120 10.033 1.00 84.13  ? 143 PHE A O   1 
ATOM   119  C  CB  . PHE A 1 35  ? -19.064 16.900 10.721 1.00 82.85  ? 143 PHE A CB  1 
ATOM   120  C  CG  . PHE A 1 35  ? -17.923 17.268 9.807  1.00 83.66  ? 143 PHE A CG  1 
ATOM   121  C  CD1 . PHE A 1 35  ? -16.605 17.076 10.203 1.00 87.18  ? 143 PHE A CD1 1 
ATOM   122  C  CD2 . PHE A 1 35  ? -18.161 17.831 8.557  1.00 83.86  ? 143 PHE A CD2 1 
ATOM   123  C  CE1 . PHE A 1 35  ? -15.548 17.429 9.358  1.00 87.47  ? 143 PHE A CE1 1 
ATOM   124  C  CE2 . PHE A 1 35  ? -17.103 18.197 7.721  1.00 86.02  ? 143 PHE A CE2 1 
ATOM   125  C  CZ  . PHE A 1 35  ? -15.808 17.989 8.123  1.00 84.81  ? 143 PHE A CZ  1 
ATOM   126  N  N   . VAL A 1 36  ? -19.283 20.383 10.831 1.00 75.05  ? 144 VAL A N   1 
ATOM   127  C  CA  . VAL A 1 36  ? -19.630 21.596 10.086 1.00 71.14  ? 144 VAL A CA  1 
ATOM   128  C  C   . VAL A 1 36  ? -18.413 22.195 9.430  1.00 73.38  ? 144 VAL A C   1 
ATOM   129  O  O   . VAL A 1 36  ? -17.341 22.264 10.030 1.00 73.13  ? 144 VAL A O   1 
ATOM   130  C  CB  . VAL A 1 36  ? -20.318 22.671 10.958 1.00 72.11  ? 144 VAL A CB  1 
ATOM   131  C  CG1 . VAL A 1 36  ? -21.054 23.695 10.093 1.00 70.59  ? 144 VAL A CG1 1 
ATOM   132  C  CG2 . VAL A 1 36  ? -21.269 22.042 11.955 1.00 72.60  ? 144 VAL A CG2 1 
ATOM   133  N  N   . LYS A 1 37  ? -18.625 22.711 8.218  1.00 68.71  ? 145 LYS A N   1 
ATOM   134  C  CA  . LYS A 1 37  ? -17.661 23.439 7.435  1.00 67.56  ? 145 LYS A CA  1 
ATOM   135  C  C   . LYS A 1 37  ? -18.264 24.780 7.075  1.00 71.72  ? 145 LYS A C   1 
ATOM   136  O  O   . LYS A 1 37  ? -19.480 24.913 6.882  1.00 69.71  ? 145 LYS A O   1 
ATOM   137  C  CB  . LYS A 1 37  ? -17.382 22.706 6.130  1.00 72.01  ? 145 LYS A CB  1 
ATOM   138  C  CG  . LYS A 1 37  ? -16.414 21.547 6.203  1.00 88.73  ? 145 LYS A CG  1 
ATOM   139  C  CD  . LYS A 1 37  ? -16.512 20.663 4.941  1.00 92.05  ? 145 LYS A CD  1 
ATOM   140  C  CE  . LYS A 1 37  ? -16.621 21.439 3.651  1.00 83.88  ? 145 LYS A CE  1 
ATOM   141  N  NZ  . LYS A 1 37  ? -16.861 20.544 2.503  1.00 91.35  ? 145 LYS A NZ  1 
ATOM   142  N  N   . LEU A 1 38  ? -17.381 25.754 6.898  1.00 71.56  ? 146 LEU A N   1 
ATOM   143  C  CA  . LEU A 1 38  ? -17.644 27.086 6.356  1.00 71.26  ? 146 LEU A CA  1 
ATOM   144  C  C   . LEU A 1 38  ? -16.658 27.166 5.170  1.00 77.83  ? 146 LEU A C   1 
ATOM   145  O  O   . LEU A 1 38  ? -15.528 26.705 5.328  1.00 76.96  ? 146 LEU A O   1 
ATOM   146  C  CB  . LEU A 1 38  ? -17.338 28.145 7.420  1.00 69.27  ? 146 LEU A CB  1 
ATOM   147  C  CG  . LEU A 1 38  ? -18.526 28.931 7.999  1.00 71.50  ? 146 LEU A CG  1 
ATOM   148  C  CD1 . LEU A 1 38  ? -19.712 28.040 8.356  1.00 70.63  ? 146 LEU A CD1 1 
ATOM   149  C  CD2 . LEU A 1 38  ? -18.085 29.752 9.182  1.00 71.49  ? 146 LEU A CD2 1 
ATOM   150  N  N   . CYS A 1 39  ? -17.097 27.632 3.974  1.00 77.14  ? 147 CYS A N   1 
ATOM   151  C  CA  . CYS A 1 39  ? -16.228 27.673 2.791  1.00 80.28  ? 147 CYS A CA  1 
ATOM   152  C  C   . CYS A 1 39  ? -16.040 29.026 2.176  1.00 81.30  ? 147 CYS A C   1 
ATOM   153  O  O   . CYS A 1 39  ? -16.975 29.805 2.070  1.00 77.86  ? 147 CYS A O   1 
ATOM   154  C  CB  . CYS A 1 39  ? -16.646 26.654 1.730  1.00 85.08  ? 147 CYS A CB  1 
ATOM   155  S  SG  . CYS A 1 39  ? -16.792 24.949 2.333  1.00 91.46  ? 147 CYS A SG  1 
ATOM   156  N  N   . CYS A 1 40  ? -14.816 29.274 1.715  1.00 79.54  ? 148 CYS A N   1 
ATOM   157  C  CA  . CYS A 1 40  ? -14.447 30.443 0.949  1.00 79.46  ? 148 CYS A CA  1 
ATOM   158  C  C   . CYS A 1 40  ? -13.488 29.992 -0.099 1.00 86.41  ? 148 CYS A C   1 
ATOM   159  O  O   . CYS A 1 40  ? -12.507 29.330 0.215  1.00 86.14  ? 148 CYS A O   1 
ATOM   160  C  CB  . CYS A 1 40  ? -13.856 31.557 1.799  1.00 77.84  ? 148 CYS A CB  1 
ATOM   161  S  SG  . CYS A 1 40  ? -13.529 33.068 0.856  1.00 82.94  ? 148 CYS A SG  1 
ATOM   162  N  N   . ARG A 1 41  ? -13.780 30.312 -1.350 1.00 86.63  ? 149 ARG A N   1 
ATOM   163  C  CA  . ARG A 1 41  ? -12.922 29.909 -2.447 1.00 89.79  ? 149 ARG A CA  1 
ATOM   164  C  C   . ARG A 1 41  ? -12.710 31.100 -3.353 1.00 96.62  ? 149 ARG A C   1 
ATOM   165  O  O   . ARG A 1 41  ? -13.675 31.766 -3.716 1.00 97.59  ? 149 ARG A O   1 
ATOM   166  C  CB  . ARG A 1 41  ? -13.547 28.721 -3.198 1.00 91.73  ? 149 ARG A CB  1 
ATOM   167  C  CG  . ARG A 1 41  ? -12.531 27.670 -3.621 1.00 109.95 ? 149 ARG A CG  1 
ATOM   168  C  CD  . ARG A 1 41  ? -13.155 26.661 -4.567 1.00 124.17 ? 149 ARG A CD  1 
ATOM   169  N  NE  . ARG A 1 41  ? -12.166 25.928 -5.366 1.00 130.05 ? 149 ARG A NE  1 
ATOM   170  C  CZ  . ARG A 1 41  ? -11.714 24.713 -5.070 1.00 140.07 ? 149 ARG A CZ  1 
ATOM   171  N  NH1 . ARG A 1 41  ? -10.832 24.114 -5.864 1.00 125.54 ? 149 ARG A NH1 1 
ATOM   172  N  NH2 . ARG A 1 41  ? -12.140 24.084 -3.980 1.00 121.29 ? 149 ARG A NH2 1 
ATOM   173  N  N   . ALA A 1 42  ? -11.454 31.399 -3.662 1.00 95.06  ? 150 ALA A N   1 
ATOM   174  C  CA  . ALA A 1 42  ? -11.052 32.482 -4.564 1.00 98.44  ? 150 ALA A CA  1 
ATOM   175  C  C   . ALA A 1 42  ? -10.832 31.961 -6.009 1.00 107.74 ? 150 ALA A C   1 
ATOM   176  O  O   . ALA A 1 42  ? -10.741 30.747 -6.230 1.00 108.16 ? 150 ALA A O   1 
ATOM   177  C  CB  . ALA A 1 42  ? -9.768  33.122 -4.060 1.00 99.00  ? 150 ALA A CB  1 
ATOM   178  N  N   . THR A 1 43  ? -10.723 32.890 -6.978 1.00 107.68 ? 151 THR A N   1 
ATOM   179  C  CA  . THR A 1 43  ? -10.487 32.563 -8.393 1.00 112.19 ? 151 THR A CA  1 
ATOM   180  C  C   . THR A 1 43  ? -9.062  31.986 -8.575 1.00 118.36 ? 151 THR A C   1 
ATOM   181  O  O   . THR A 1 43  ? -8.859  31.042 -9.347 1.00 120.81 ? 151 THR A O   1 
ATOM   182  C  CB  . THR A 1 43  ? -10.791 33.775 -9.323 1.00 120.82 ? 151 THR A CB  1 
ATOM   183  O  OG1 . THR A 1 43  ? -9.701  34.710 -9.335 1.00 119.81 ? 151 THR A OG1 1 
ATOM   184  C  CG2 . THR A 1 43  ? -12.109 34.480 -8.983 1.00 116.24 ? 151 THR A CG2 1 
ATOM   185  N  N   . GLY A 1 44  ? -8.115  32.538 -7.817 1.00 113.17 ? 152 GLY A N   1 
ATOM   186  C  CA  . GLY A 1 44  ? -6.718  32.127 -7.823 1.00 113.84 ? 152 GLY A CA  1 
ATOM   187  C  C   . GLY A 1 44  ? -6.403  30.799 -7.157 1.00 116.89 ? 152 GLY A C   1 
ATOM   188  O  O   . GLY A 1 44  ? -5.286  30.309 -7.328 1.00 119.69 ? 152 GLY A O   1 
ATOM   189  N  N   . HIS A 1 45  ? -7.369  30.195 -6.404 1.00 110.04 ? 153 HIS A N   1 
ATOM   190  C  CA  . HIS A 1 45  ? -7.226  28.913 -5.690 1.00 108.77 ? 153 HIS A CA  1 
ATOM   191  C  C   . HIS A 1 45  ? -6.521  27.840 -6.525 1.00 118.59 ? 153 HIS A C   1 
ATOM   192  O  O   . HIS A 1 45  ? -6.864  27.683 -7.701 1.00 122.99 ? 153 HIS A O   1 
ATOM   193  C  CB  . HIS A 1 45  ? -8.585  28.369 -5.209 1.00 107.16 ? 153 HIS A CB  1 
ATOM   194  C  CG  . HIS A 1 45  ? -8.473  27.151 -4.333 1.00 109.57 ? 153 HIS A CG  1 
ATOM   195  N  ND1 . HIS A 1 45  ? -8.376  27.256 -2.950 1.00 108.12 ? 153 HIS A ND1 1 
ATOM   196  C  CD2 . HIS A 1 45  ? -8.412  25.841 -4.670 1.00 113.16 ? 153 HIS A CD2 1 
ATOM   197  C  CE1 . HIS A 1 45  ? -8.278  26.015 -2.498 1.00 107.74 ? 153 HIS A CE1 1 
ATOM   198  N  NE2 . HIS A 1 45  ? -8.294  25.129 -3.493 1.00 111.17 ? 153 HIS A NE2 1 
ATOM   199  N  N   . PRO A 1 46  ? -5.536  27.096 -5.958 1.00 114.10 ? 154 PRO A N   1 
ATOM   200  C  CA  . PRO A 1 46  ? -5.029  27.150 -4.574 1.00 110.42 ? 154 PRO A CA  1 
ATOM   201  C  C   . PRO A 1 46  ? -3.838  28.101 -4.382 1.00 111.75 ? 154 PRO A C   1 
ATOM   202  O  O   . PRO A 1 46  ? -3.137  28.040 -3.371 1.00 109.76 ? 154 PRO A O   1 
ATOM   203  C  CB  . PRO A 1 46  ? -4.704  25.678 -4.299 1.00 113.88 ? 154 PRO A CB  1 
ATOM   204  C  CG  . PRO A 1 46  ? -4.246  25.137 -5.662 1.00 122.59 ? 154 PRO A CG  1 
ATOM   205  C  CD  . PRO A 1 46  ? -4.848  26.037 -6.728 1.00 118.81 ? 154 PRO A CD  1 
ATOM   206  N  N   . PHE A 1 47  ? -3.633  29.001 -5.343 1.00 108.58 ? 155 PHE A N   1 
ATOM   207  C  CA  . PHE A 1 47  ? -2.512  29.929 -5.347 1.00 108.25 ? 155 PHE A CA  1 
ATOM   208  C  C   . PHE A 1 47  ? -2.818  31.312 -4.734 1.00 107.61 ? 155 PHE A C   1 
ATOM   209  O  O   . PHE A 1 47  ? -2.541  32.356 -5.338 1.00 108.63 ? 155 PHE A O   1 
ATOM   210  C  CB  . PHE A 1 47  ? -1.888  29.974 -6.751 1.00 113.93 ? 155 PHE A CB  1 
ATOM   211  C  CG  . PHE A 1 47  ? -1.527  28.598 -7.277 1.00 118.23 ? 155 PHE A CG  1 
ATOM   212  C  CD1 . PHE A 1 47  ? -2.238  28.028 -8.327 1.00 123.17 ? 155 PHE A CD1 1 
ATOM   213  C  CD2 . PHE A 1 47  ? -0.494  27.861 -6.704 1.00 120.50 ? 155 PHE A CD2 1 
ATOM   214  C  CE1 . PHE A 1 47  ? -1.917  26.750 -8.797 1.00 126.35 ? 155 PHE A CE1 1 
ATOM   215  C  CE2 . PHE A 1 47  ? -0.181  26.582 -7.173 1.00 125.61 ? 155 PHE A CE2 1 
ATOM   216  C  CZ  . PHE A 1 47  ? -0.900  26.033 -8.209 1.00 125.68 ? 155 PHE A CZ  1 
ATOM   217  N  N   . VAL A 1 48  ? -3.384  31.295 -3.509 1.00 98.81  ? 156 VAL A N   1 
ATOM   218  C  CA  . VAL A 1 48  ? -3.775  32.466 -2.703 1.00 95.37  ? 156 VAL A CA  1 
ATOM   219  C  C   . VAL A 1 48  ? -3.603  32.137 -1.214 1.00 95.44  ? 156 VAL A C   1 
ATOM   220  O  O   . VAL A 1 48  ? -3.388  30.972 -0.866 1.00 96.93  ? 156 VAL A O   1 
ATOM   221  C  CB  . VAL A 1 48  ? -5.247  32.931 -2.960 1.00 97.44  ? 156 VAL A CB  1 
ATOM   222  C  CG1 . VAL A 1 48  ? -5.474  33.392 -4.399 1.00 99.68  ? 156 VAL A CG1 1 
ATOM   223  C  CG2 . VAL A 1 48  ? -6.264  31.868 -2.544 1.00 95.51  ? 156 VAL A CG2 1 
ATOM   224  N  N   . GLN A 1 49  ? -3.766  33.143 -0.335 1.00 86.07  ? 157 GLN A N   1 
ATOM   225  C  CA  . GLN A 1 49  ? -3.729  32.934 1.109  1.00 81.64  ? 157 GLN A CA  1 
ATOM   226  C  C   . GLN A 1 49  ? -5.130  33.145 1.668  1.00 81.99  ? 157 GLN A C   1 
ATOM   227  O  O   . GLN A 1 49  ? -5.864  34.022 1.213  1.00 81.82  ? 157 GLN A O   1 
ATOM   228  C  CB  . GLN A 1 49  ? -2.734  33.867 1.795  1.00 82.13  ? 157 GLN A CB  1 
ATOM   229  C  CG  . GLN A 1 49  ? -1.303  33.371 1.715  1.00 88.95  ? 157 GLN A CG  1 
ATOM   230  C  CD  . GLN A 1 49  ? -0.294  34.362 2.256  1.00 93.53  ? 157 GLN A CD  1 
ATOM   231  O  OE1 . GLN A 1 49  ? -0.120  35.464 1.717  1.00 90.34  ? 157 GLN A OE1 1 
ATOM   232  N  NE2 . GLN A 1 49  ? 0.454   33.957 3.290  1.00 67.41  ? 157 GLN A NE2 1 
ATOM   233  N  N   . TYR A 1 50  ? -5.509  32.314 2.626  1.00 75.09  ? 158 TYR A N   1 
ATOM   234  C  CA  . TYR A 1 50  ? -6.787  32.405 3.304  1.00 71.65  ? 158 TYR A CA  1 
ATOM   235  C  C   . TYR A 1 50  ? -6.514  32.621 4.764  1.00 73.23  ? 158 TYR A C   1 
ATOM   236  O  O   . TYR A 1 50  ? -5.580  32.047 5.298  1.00 76.91  ? 158 TYR A O   1 
ATOM   237  C  CB  . TYR A 1 50  ? -7.593  31.099 3.162  1.00 72.49  ? 158 TYR A CB  1 
ATOM   238  C  CG  . TYR A 1 50  ? -8.006  30.750 1.751  1.00 75.69  ? 158 TYR A CG  1 
ATOM   239  C  CD1 . TYR A 1 50  ? -9.146  31.312 1.178  1.00 76.97  ? 158 TYR A CD1 1 
ATOM   240  C  CD2 . TYR A 1 50  ? -7.308  29.798 1.016  1.00 78.39  ? 158 TYR A CD2 1 
ATOM   241  C  CE1 . TYR A 1 50  ? -9.549  30.972 -0.111 1.00 78.58  ? 158 TYR A CE1 1 
ATOM   242  C  CE2 . TYR A 1 50  ? -7.712  29.435 -0.264 1.00 81.53  ? 158 TYR A CE2 1 
ATOM   243  C  CZ  . TYR A 1 50  ? -8.827  30.035 -0.830 1.00 89.62  ? 158 TYR A CZ  1 
ATOM   244  O  OH  . TYR A 1 50  ? -9.207  29.711 -2.108 1.00 95.18  ? 158 TYR A OH  1 
ATOM   245  N  N   . GLN A 1 51  ? -7.319  33.435 5.414  1.00 64.46  ? 159 GLN A N   1 
ATOM   246  C  CA  . GLN A 1 51  ? -7.269  33.639 6.841  1.00 61.33  ? 159 GLN A CA  1 
ATOM   247  C  C   . GLN A 1 51  ? -8.684  33.916 7.296  1.00 65.35  ? 159 GLN A C   1 
ATOM   248  O  O   . GLN A 1 51  ? -9.308  34.870 6.820  1.00 64.85  ? 159 GLN A O   1 
ATOM   249  C  CB  . GLN A 1 51  ? -6.295  34.751 7.275  1.00 61.82  ? 159 GLN A CB  1 
ATOM   250  C  CG  . GLN A 1 51  ? -6.304  34.965 8.810  1.00 66.23  ? 159 GLN A CG  1 
ATOM   251  C  CD  . GLN A 1 51  ? -5.854  33.751 9.634  1.00 78.43  ? 159 GLN A CD  1 
ATOM   252  O  OE1 . GLN A 1 51  ? -4.696  33.317 9.586  1.00 77.04  ? 159 GLN A OE1 1 
ATOM   253  N  NE2 . GLN A 1 51  ? -6.747  33.204 10.449 1.00 64.65  ? 159 GLN A NE2 1 
ATOM   254  N  N   . TRP A 1 52  ? -9.186  33.064 8.196  1.00 63.59  ? 160 TRP A N   1 
ATOM   255  C  CA  . TRP A 1 52  ? -10.522 33.169 8.786  1.00 63.56  ? 160 TRP A CA  1 
ATOM   256  C  C   . TRP A 1 52  ? -10.518 33.950 10.080 1.00 68.04  ? 160 TRP A C   1 
ATOM   257  O  O   . TRP A 1 52  ? -9.532  33.953 10.854 1.00 68.65  ? 160 TRP A O   1 
ATOM   258  C  CB  . TRP A 1 52  ? -11.112 31.789 9.032  1.00 62.79  ? 160 TRP A CB  1 
ATOM   259  C  CG  . TRP A 1 52  ? -11.565 31.100 7.785  1.00 65.67  ? 160 TRP A CG  1 
ATOM   260  C  CD1 . TRP A 1 52  ? -10.802 30.356 6.929  1.00 70.57  ? 160 TRP A CD1 1 
ATOM   261  C  CD2 . TRP A 1 52  ? -12.894 31.104 7.243  1.00 65.17  ? 160 TRP A CD2 1 
ATOM   262  N  NE1 . TRP A 1 52  ? -11.577 29.891 5.887  1.00 70.69  ? 160 TRP A NE1 1 
ATOM   263  C  CE2 . TRP A 1 52  ? -12.870 30.317 6.068  1.00 71.14  ? 160 TRP A CE2 1 
ATOM   264  C  CE3 . TRP A 1 52  ? -14.099 31.719 7.624  1.00 64.88  ? 160 TRP A CE3 1 
ATOM   265  C  CZ2 . TRP A 1 52  ? -14.016 30.104 5.286  1.00 70.74  ? 160 TRP A CZ2 1 
ATOM   266  C  CZ3 . TRP A 1 52  ? -15.226 31.507 6.851  1.00 66.70  ? 160 TRP A CZ3 1 
ATOM   267  C  CH2 . TRP A 1 52  ? -15.187 30.681 5.716  1.00 69.05  ? 160 TRP A CH2 1 
ATOM   268  N  N   . PHE A 1 53  ? -11.652 34.588 10.335 1.00 62.92  ? 161 PHE A N   1 
ATOM   269  C  CA  . PHE A 1 53  ? -11.835 35.389 11.538 1.00 61.70  ? 161 PHE A CA  1 
ATOM   270  C  C   . PHE A 1 53  ? -13.160 35.129 12.160 1.00 64.13  ? 161 PHE A C   1 
ATOM   271  O  O   . PHE A 1 53  ? -14.145 35.030 11.439 1.00 64.02  ? 161 PHE A O   1 
ATOM   272  C  CB  . PHE A 1 53  ? -11.790 36.894 11.195 1.00 62.79  ? 161 PHE A CB  1 
ATOM   273  C  CG  . PHE A 1 53  ? -10.469 37.452 10.775 1.00 64.49  ? 161 PHE A CG  1 
ATOM   274  C  CD1 . PHE A 1 53  ? -9.682  38.163 11.674 1.00 67.81  ? 161 PHE A CD1 1 
ATOM   275  C  CD2 . PHE A 1 53  ? -10.030 37.327 9.463  1.00 67.94  ? 161 PHE A CD2 1 
ATOM   276  C  CE1 . PHE A 1 53  ? -8.463  38.723 11.279 1.00 69.52  ? 161 PHE A CE1 1 
ATOM   277  C  CE2 . PHE A 1 53  ? -8.782  37.850 9.073  1.00 73.25  ? 161 PHE A CE2 1 
ATOM   278  C  CZ  . PHE A 1 53  ? -7.994  38.518 9.998  1.00 70.84  ? 161 PHE A CZ  1 
ATOM   279  N  N   . LYS A 1 54  ? -13.212 35.079 13.489 1.00 62.25  ? 162 LYS A N   1 
ATOM   280  C  CA  . LYS A 1 54  ? -14.510 35.062 14.189 1.00 62.47  ? 162 LYS A CA  1 
ATOM   281  C  C   . LYS A 1 54  ? -14.552 36.497 14.660 1.00 68.71  ? 162 LYS A C   1 
ATOM   282  O  O   . LYS A 1 54  ? -13.753 36.917 15.524 1.00 69.55  ? 162 LYS A O   1 
ATOM   283  C  CB  . LYS A 1 54  ? -14.602 34.078 15.366 1.00 63.68  ? 162 LYS A CB  1 
ATOM   284  C  CG  . LYS A 1 54  ? -16.022 34.003 15.866 1.00 60.94  ? 162 LYS A CG  1 
ATOM   285  C  CD  . LYS A 1 54  ? -16.162 32.991 16.940 1.00 68.40  ? 162 LYS A CD  1 
ATOM   286  C  CE  . LYS A 1 54  ? -17.530 33.004 17.547 1.00 68.32  ? 162 LYS A CE  1 
ATOM   287  N  NZ  . LYS A 1 54  ? -17.545 32.158 18.765 1.00 67.83  ? 162 LYS A NZ  1 
ATOM   288  N  N   . MET A 1 55  ? -15.344 37.292 13.945 1.00 64.19  ? 163 MET A N   1 
ATOM   289  C  CA  . MET A 1 55  ? -15.374 38.734 14.138 1.00 63.74  ? 163 MET A CA  1 
ATOM   290  C  C   . MET A 1 55  ? -13.986 39.343 13.910 1.00 69.79  ? 163 MET A C   1 
ATOM   291  O  O   . MET A 1 55  ? -13.403 39.114 12.857 1.00 72.55  ? 163 MET A O   1 
ATOM   292  C  CB  . MET A 1 55  ? -15.923 39.070 15.509 1.00 64.33  ? 163 MET A CB  1 
ATOM   293  C  CG  . MET A 1 55  ? -16.763 40.235 15.445 1.00 65.13  ? 163 MET A CG  1 
ATOM   294  S  SD  . MET A 1 55  ? -18.338 40.011 16.198 1.00 63.53  ? 163 MET A SD  1 
ATOM   295  C  CE  . MET A 1 55  ? -18.647 41.715 16.444 1.00 59.71  ? 163 MET A CE  1 
ATOM   296  N  N   . ASN A 1 56  ? -13.415 40.026 14.905 1.00 64.81  ? 164 ASN A N   1 
ATOM   297  C  CA  . ASN A 1 56  ? -12.077 40.621 14.769 1.00 65.03  ? 164 ASN A CA  1 
ATOM   298  C  C   . ASN A 1 56  ? -10.985 39.697 15.318 1.00 69.29  ? 164 ASN A C   1 
ATOM   299  O  O   . ASN A 1 56  ? -9.827  40.075 15.295 1.00 71.49  ? 164 ASN A O   1 
ATOM   300  C  CB  . ASN A 1 56  ? -12.009 42.015 15.430 1.00 63.40  ? 164 ASN A CB  1 
ATOM   301  C  CG  . ASN A 1 56  ? -12.444 42.100 16.916 1.00 93.20  ? 164 ASN A CG  1 
ATOM   302  O  OD1 . ASN A 1 56  ? -13.266 41.316 17.449 1.00 73.29  ? 164 ASN A OD1 1 
ATOM   303  N  ND2 . ASN A 1 56  ? -11.964 43.138 17.608 1.00 93.22  ? 164 ASN A ND2 1 
ATOM   304  N  N   . LYS A 1 57  ? -11.338 38.488 15.794 1.00 63.65  ? 165 LYS A N   1 
ATOM   305  C  CA  . LYS A 1 57  ? -10.372 37.517 16.328 1.00 63.20  ? 165 LYS A CA  1 
ATOM   306  C  C   . LYS A 1 57  ? -9.830  36.674 15.152 1.00 69.80  ? 165 LYS A C   1 
ATOM   307  O  O   . LYS A 1 57  ? -10.599 36.032 14.430 1.00 69.28  ? 165 LYS A O   1 
ATOM   308  C  CB  . LYS A 1 57  ? -11.039 36.616 17.394 1.00 62.39  ? 165 LYS A CB  1 
ATOM   309  C  CG  . LYS A 1 57  ? -10.089 35.797 18.236 1.00 71.40  ? 165 LYS A CG  1 
ATOM   310  C  CD  . LYS A 1 57  ? -10.607 34.422 18.598 1.00 74.45  ? 165 LYS A CD  1 
ATOM   311  N  N   . GLU A 1 58  ? -8.515  36.706 14.948 1.00 68.74  ? 166 GLU A N   1 
ATOM   312  C  CA  . GLU A 1 58  ? -7.876  35.935 13.897 1.00 69.16  ? 166 GLU A CA  1 
ATOM   313  C  C   . GLU A 1 58  ? -7.831  34.491 14.380 1.00 76.72  ? 166 GLU A C   1 
ATOM   314  O  O   . GLU A 1 58  ? -7.133  34.209 15.345 1.00 79.35  ? 166 GLU A O   1 
ATOM   315  C  CB  . GLU A 1 58  ? -6.474  36.484 13.635 1.00 71.62  ? 166 GLU A CB  1 
ATOM   316  C  CG  . GLU A 1 58  ? -6.017  36.360 12.193 1.00 73.85  ? 166 GLU A CG  1 
ATOM   317  C  CD  . GLU A 1 58  ? -4.595  36.823 11.964 1.00 91.52  ? 166 GLU A CD  1 
ATOM   318  O  OE1 . GLU A 1 58  ? -3.703  36.401 12.737 1.00 79.83  ? 166 GLU A OE1 1 
ATOM   319  O  OE2 . GLU A 1 58  ? -4.366  37.617 11.022 1.00 102.18 ? 166 GLU A OE2 1 
ATOM   320  N  N   . ILE A 1 59  ? -8.680  33.606 13.810 1.00 72.05  ? 167 ILE A N   1 
ATOM   321  C  CA  . ILE A 1 59  ? -8.719  32.190 14.209 1.00 70.55  ? 167 ILE A CA  1 
ATOM   322  C  C   . ILE A 1 59  ? -7.335  31.577 13.930 1.00 76.32  ? 167 ILE A C   1 
ATOM   323  O  O   . ILE A 1 59  ? -6.887  31.625 12.781 1.00 75.94  ? 167 ILE A O   1 
ATOM   324  C  CB  . ILE A 1 59  ? -9.821  31.416 13.439 1.00 70.80  ? 167 ILE A CB  1 
ATOM   325  C  CG1 . ILE A 1 59  ? -11.215 31.817 13.894 1.00 67.30  ? 167 ILE A CG1 1 
ATOM   326  C  CG2 . ILE A 1 59  ? -9.606  29.905 13.566 1.00 73.60  ? 167 ILE A CG2 1 
ATOM   327  C  CD1 . ILE A 1 59  ? -12.216 31.565 12.945 1.00 69.74  ? 167 ILE A CD1 1 
ATOM   328  N  N   . PRO A 1 60  ? -6.617  31.038 14.942 1.00 75.25  ? 168 PRO A N   1 
ATOM   329  C  CA  . PRO A 1 60  ? -5.317  30.407 14.638 1.00 77.28  ? 168 PRO A CA  1 
ATOM   330  C  C   . PRO A 1 60  ? -5.556  29.116 13.853 1.00 84.11  ? 168 PRO A C   1 
ATOM   331  O  O   . PRO A 1 60  ? -6.586  28.432 14.046 1.00 83.72  ? 168 PRO A O   1 
ATOM   332  C  CB  . PRO A 1 60  ? -4.695  30.144 16.014 1.00 79.61  ? 168 PRO A CB  1 
ATOM   333  C  CG  . PRO A 1 60  ? -5.777  30.235 16.985 1.00 81.57  ? 168 PRO A CG  1 
ATOM   334  C  CD  . PRO A 1 60  ? -6.977  30.884 16.366 1.00 75.82  ? 168 PRO A CD  1 
ATOM   335  N  N   . ASN A 1 61  ? -4.646  28.839 12.912 1.00 82.20  ? 169 ASN A N   1 
ATOM   336  C  CA  . ASN A 1 61  ? -4.678  27.668 12.031 1.00 83.36  ? 169 ASN A CA  1 
ATOM   337  C  C   . ASN A 1 61  ? -5.878  27.601 11.063 1.00 85.77  ? 169 ASN A C   1 
ATOM   338  O  O   . ASN A 1 61  ? -6.087  26.567 10.425 1.00 89.14  ? 169 ASN A O   1 
ATOM   339  C  CB  . ASN A 1 61  ? -4.417  26.350 12.802 1.00 88.56  ? 169 ASN A CB  1 
ATOM   340  C  CG  . ASN A 1 61  ? -3.161  26.368 13.663 1.00 116.03 ? 169 ASN A CG  1 
ATOM   341  O  OD1 . ASN A 1 61  ? -2.032  26.607 13.196 1.00 115.67 ? 169 ASN A OD1 1 
ATOM   342  N  ND2 . ASN A 1 61  ? -3.333  26.111 14.946 1.00 105.04 ? 169 ASN A ND2 1 
ATOM   343  N  N   . GLY A 1 62  ? -6.608  28.718 10.926 1.00 76.88  ? 170 GLY A N   1 
ATOM   344  C  CA  . GLY A 1 62  ? -7.718  28.884 9.996  1.00 73.54  ? 170 GLY A CA  1 
ATOM   345  C  C   . GLY A 1 62  ? -7.239  29.637 8.776  1.00 75.92  ? 170 GLY A C   1 
ATOM   346  O  O   . GLY A 1 62  ? -7.822  30.638 8.374  1.00 74.72  ? 170 GLY A O   1 
ATOM   347  N  N   . ASN A 1 63  ? -6.175  29.114 8.183  1.00 74.58  ? 171 ASN A N   1 
ATOM   348  C  CA  . ASN A 1 63  ? -5.362  29.591 7.070  1.00 75.70  ? 171 ASN A CA  1 
ATOM   349  C  C   . ASN A 1 63  ? -5.576  28.755 5.779  1.00 84.78  ? 171 ASN A C   1 
ATOM   350  O  O   . ASN A 1 63  ? -4.727  28.719 4.867  1.00 86.11  ? 171 ASN A O   1 
ATOM   351  C  CB  . ASN A 1 63  ? -3.877  29.593 7.511  1.00 73.47  ? 171 ASN A CB  1 
ATOM   352  C  CG  . ASN A 1 63  ? -3.315  28.290 8.093  1.00 99.26  ? 171 ASN A CG  1 
ATOM   353  O  OD1 . ASN A 1 63  ? -2.187  28.269 8.582  1.00 105.94 ? 171 ASN A OD1 1 
ATOM   354  N  ND2 . ASN A 1 63  ? -4.044  27.161 8.061  1.00 83.83  ? 171 ASN A ND2 1 
ATOM   355  N  N   . THR A 1 64  ? -6.752  28.128 5.705  1.00 82.93  ? 172 THR A N   1 
ATOM   356  C  CA  . THR A 1 64  ? -7.194  27.272 4.612  1.00 84.61  ? 172 THR A CA  1 
ATOM   357  C  C   . THR A 1 64  ? -8.561  27.746 4.076  1.00 86.34  ? 172 THR A C   1 
ATOM   358  O  O   . THR A 1 64  ? -9.276  28.481 4.758  1.00 83.34  ? 172 THR A O   1 
ATOM   359  C  CB  . THR A 1 64  ? -7.243  25.813 5.105  1.00 99.89  ? 172 THR A CB  1 
ATOM   360  O  OG1 . THR A 1 64  ? -7.729  24.995 4.038  1.00 109.07 ? 172 THR A OG1 1 
ATOM   361  C  CG2 . THR A 1 64  ? -8.138  25.630 6.356  1.00 96.19  ? 172 THR A CG2 1 
ATOM   362  N  N   . SER A 1 65  ? -8.924  27.272 2.872  1.00 83.87  ? 173 SER A N   1 
ATOM   363  C  CA  . SER A 1 65  ? -10.162 27.562 2.139  1.00 82.08  ? 173 SER A CA  1 
ATOM   364  C  C   . SER A 1 65  ? -11.409 27.298 2.966  1.00 84.49  ? 173 SER A C   1 
ATOM   365  O  O   . SER A 1 65  ? -12.342 28.101 2.960  1.00 83.53  ? 173 SER A O   1 
ATOM   366  C  CB  . SER A 1 65  ? -10.204 26.718 0.868  1.00 86.85  ? 173 SER A CB  1 
ATOM   367  O  OG  . SER A 1 65  ? -11.402 26.891 0.135  1.00 95.81  ? 173 SER A OG  1 
ATOM   368  N  N   . GLU A 1 66  ? -11.445 26.160 3.657  1.00 80.53  ? 174 GLU A N   1 
ATOM   369  C  CA  . GLU A 1 66  ? -12.612 25.804 4.435  1.00 77.47  ? 174 GLU A CA  1 
ATOM   370  C  C   . GLU A 1 66  ? -12.335 25.643 5.926  1.00 80.70  ? 174 GLU A C   1 
ATOM   371  O  O   . GLU A 1 66  ? -11.367 24.993 6.307  1.00 84.44  ? 174 GLU A O   1 
ATOM   372  C  CB  . GLU A 1 66  ? -13.398 24.650 3.792  1.00 79.95  ? 174 GLU A CB  1 
ATOM   373  C  CG  . GLU A 1 66  ? -12.681 23.323 3.679  1.00 91.45  ? 174 GLU A CG  1 
ATOM   374  C  CD  . GLU A 1 66  ? -13.329 22.326 2.737  1.00 115.54 ? 174 GLU A CD  1 
ATOM   375  O  OE1 . GLU A 1 66  ? -14.065 22.760 1.819  1.00 102.36 ? 174 GLU A OE1 1 
ATOM   376  O  OE2 . GLU A 1 66  ? -13.080 21.107 2.901  1.00 110.60 ? 174 GLU A OE2 1 
ATOM   377  N  N   . LEU A 1 67  ? -13.125 26.328 6.753  1.00 72.78  ? 175 LEU A N   1 
ATOM   378  C  CA  . LEU A 1 67  ? -13.034 26.332 8.209  1.00 71.08  ? 175 LEU A CA  1 
ATOM   379  C  C   . LEU A 1 67  ? -13.889 25.161 8.737  1.00 75.55  ? 175 LEU A C   1 
ATOM   380  O  O   . LEU A 1 67  ? -15.108 25.156 8.563  1.00 73.69  ? 175 LEU A O   1 
ATOM   381  C  CB  . LEU A 1 67  ? -13.537 27.697 8.727  1.00 68.29  ? 175 LEU A CB  1 
ATOM   382  C  CG  . LEU A 1 67  ? -13.476 27.964 10.225 1.00 69.99  ? 175 LEU A CG  1 
ATOM   383  C  CD1 . LEU A 1 67  ? -12.025 28.152 10.716 1.00 69.34  ? 175 LEU A CD1 1 
ATOM   384  C  CD2 . LEU A 1 67  ? -14.306 29.176 10.567 1.00 69.24  ? 175 LEU A CD2 1 
ATOM   385  N  N   . ILE A 1 68  ? -13.223 24.155 9.338  1.00 73.62  ? 176 ILE A N   1 
ATOM   386  C  CA  . ILE A 1 68  ? -13.821 22.902 9.804  1.00 73.66  ? 176 ILE A CA  1 
ATOM   387  C  C   . ILE A 1 68  ? -13.952 22.776 11.321 1.00 77.28  ? 176 ILE A C   1 
ATOM   388  O  O   . ILE A 1 68  ? -12.955 22.855 12.046 1.00 79.33  ? 176 ILE A O   1 
ATOM   389  C  CB  . ILE A 1 68  ? -13.044 21.701 9.185  1.00 79.29  ? 176 ILE A CB  1 
ATOM   390  C  CG1 . ILE A 1 68  ? -13.089 21.758 7.633  1.00 80.56  ? 176 ILE A CG1 1 
ATOM   391  C  CG2 . ILE A 1 68  ? -13.554 20.356 9.721  1.00 80.80  ? 176 ILE A CG2 1 
ATOM   392  C  CD1 . ILE A 1 68  ? -12.075 20.940 6.869  1.00 83.46  ? 176 ILE A CD1 1 
ATOM   393  N  N   . PHE A 1 69  ? -15.182 22.514 11.788 1.00 70.78  ? 177 PHE A N   1 
ATOM   394  C  CA  . PHE A 1 69  ? -15.491 22.242 13.191 1.00 69.16  ? 177 PHE A CA  1 
ATOM   395  C  C   . PHE A 1 69  ? -15.856 20.773 13.190 1.00 76.20  ? 177 PHE A C   1 
ATOM   396  O  O   . PHE A 1 69  ? -16.945 20.419 12.732 1.00 76.05  ? 177 PHE A O   1 
ATOM   397  C  CB  . PHE A 1 69  ? -16.662 23.109 13.680 1.00 67.19  ? 177 PHE A CB  1 
ATOM   398  C  CG  . PHE A 1 69  ? -16.434 24.596 13.517 1.00 64.73  ? 177 PHE A CG  1 
ATOM   399  C  CD1 . PHE A 1 69  ? -15.863 25.346 14.544 1.00 65.22  ? 177 PHE A CD1 1 
ATOM   400  C  CD2 . PHE A 1 69  ? -16.790 25.247 12.335 1.00 63.13  ? 177 PHE A CD2 1 
ATOM   401  C  CE1 . PHE A 1 69  ? -15.617 26.710 14.379 1.00 63.93  ? 177 PHE A CE1 1 
ATOM   402  C  CE2 . PHE A 1 69  ? -16.564 26.614 12.175 1.00 63.53  ? 177 PHE A CE2 1 
ATOM   403  C  CZ  . PHE A 1 69  ? -15.969 27.334 13.193 1.00 62.09  ? 177 PHE A CZ  1 
ATOM   404  N  N   . ASN A 1 70  ? -14.916 19.906 13.609 1.00 75.59  ? 178 ASN A N   1 
ATOM   405  C  CA  . ASN A 1 70  ? -15.120 18.455 13.582 1.00 78.53  ? 178 ASN A CA  1 
ATOM   406  C  C   . ASN A 1 70  ? -16.327 17.962 14.366 1.00 82.96  ? 178 ASN A C   1 
ATOM   407  O  O   . ASN A 1 70  ? -16.980 16.987 13.953 1.00 84.67  ? 178 ASN A O   1 
ATOM   408  C  CB  . ASN A 1 70  ? -13.856 17.706 13.944 1.00 80.84  ? 178 ASN A CB  1 
ATOM   409  C  CG  . ASN A 1 70  ? -13.287 16.989 12.752 1.00 106.49 ? 178 ASN A CG  1 
ATOM   410  O  OD1 . ASN A 1 70  ? -13.684 15.855 12.429 1.00 105.97 ? 178 ASN A OD1 1 
ATOM   411  N  ND2 . ASN A 1 70  ? -12.395 17.665 12.033 1.00 91.70  ? 178 ASN A ND2 1 
ATOM   412  N  N   . ALA A 1 71  ? -16.636 18.673 15.477 1.00 76.88  ? 179 ALA A N   1 
ATOM   413  C  CA  . ALA A 1 71  ? -17.762 18.418 16.366 1.00 76.48  ? 179 ALA A CA  1 
ATOM   414  C  C   . ALA A 1 71  ? -18.114 19.722 17.113 1.00 80.11  ? 179 ALA A C   1 
ATOM   415  O  O   . ALA A 1 71  ? -17.736 19.890 18.269 1.00 81.97  ? 179 ALA A O   1 
ATOM   416  C  CB  . ALA A 1 71  ? -17.427 17.295 17.343 1.00 79.85  ? 179 ALA A CB  1 
ATOM   417  N  N   . VAL A 1 72  ? -18.831 20.644 16.441 1.00 74.02  ? 180 VAL A N   1 
ATOM   418  C  CA  . VAL A 1 72  ? -19.226 21.938 16.996 1.00 71.49  ? 180 VAL A CA  1 
ATOM   419  C  C   . VAL A 1 72  ? -19.725 21.921 18.389 1.00 76.99  ? 180 VAL A C   1 
ATOM   420  O  O   . VAL A 1 72  ? -20.479 21.025 18.785 1.00 77.96  ? 180 VAL A O   1 
ATOM   421  C  CB  . VAL A 1 72  ? -20.244 22.753 16.178 1.00 73.68  ? 180 VAL A CB  1 
ATOM   422  C  CG1 . VAL A 1 72  ? -19.564 23.709 15.215 1.00 73.32  ? 180 VAL A CG1 1 
ATOM   423  C  CG2 . VAL A 1 72  ? -21.328 21.892 15.538 1.00 73.50  ? 180 VAL A CG2 1 
ATOM   424  N  N   . HIS A 1 73  ? -19.389 23.010 19.086 1.00 72.25  ? 181 HIS A N   1 
ATOM   425  C  CA  . HIS A 1 73  ? -19.841 23.332 20.412 1.00 71.87  ? 181 HIS A CA  1 
ATOM   426  C  C   . HIS A 1 73  ? -20.587 24.637 20.275 1.00 71.87  ? 181 HIS A C   1 
ATOM   427  O  O   . HIS A 1 73  ? -20.357 25.385 19.338 1.00 68.35  ? 181 HIS A O   1 
ATOM   428  C  CB  . HIS A 1 73  ? -18.668 23.461 21.368 1.00 74.64  ? 181 HIS A CB  1 
ATOM   429  C  CG  . HIS A 1 73  ? -17.863 22.203 21.485 1.00 81.89  ? 181 HIS A CG  1 
ATOM   430  N  ND1 . HIS A 1 73  ? -16.841 21.912 20.591 1.00 84.91  ? 181 HIS A ND1 1 
ATOM   431  C  CD2 . HIS A 1 73  ? -17.949 21.200 22.392 1.00 86.45  ? 181 HIS A CD2 1 
ATOM   432  C  CE1 . HIS A 1 73  ? -16.337 20.752 20.991 1.00 87.34  ? 181 HIS A CE1 1 
ATOM   433  N  NE2 . HIS A 1 73  ? -16.988 20.274 22.054 1.00 88.78  ? 181 HIS A NE2 1 
ATOM   434  N  N   . VAL A 1 74  ? -21.524 24.886 21.184 1.00 69.11  ? 182 VAL A N   1 
ATOM   435  C  CA  . VAL A 1 74  ? -22.312 26.107 21.239 1.00 65.50  ? 182 VAL A CA  1 
ATOM   436  C  C   . VAL A 1 74  ? -21.357 27.308 21.248 1.00 67.75  ? 182 VAL A C   1 
ATOM   437  O  O   . VAL A 1 74  ? -21.629 28.289 20.558 1.00 65.82  ? 182 VAL A O   1 
ATOM   438  C  CB  . VAL A 1 74  ? -23.236 26.068 22.477 1.00 68.89  ? 182 VAL A CB  1 
ATOM   439  C  CG1 . VAL A 1 74  ? -23.866 27.429 22.753 1.00 66.98  ? 182 VAL A CG1 1 
ATOM   440  C  CG2 . VAL A 1 74  ? -24.309 24.994 22.312 1.00 69.21  ? 182 VAL A CG2 1 
ATOM   441  N  N   . LYS A 1 75  ? -20.201 27.197 21.969 1.00 65.02  ? 183 LYS A N   1 
ATOM   442  C  CA  . LYS A 1 75  ? -19.200 28.266 22.061 1.00 64.24  ? 183 LYS A CA  1 
ATOM   443  C  C   . LYS A 1 75  ? -18.764 28.804 20.676 1.00 69.17  ? 183 LYS A C   1 
ATOM   444  O  O   . LYS A 1 75  ? -18.541 30.007 20.533 1.00 69.42  ? 183 LYS A O   1 
ATOM   445  C  CB  . LYS A 1 75  ? -18.028 27.893 22.988 1.00 68.37  ? 183 LYS A CB  1 
ATOM   446  C  CG  . LYS A 1 75  ? -17.107 26.780 22.464 1.00 95.24  ? 183 LYS A CG  1 
ATOM   447  C  CD  . LYS A 1 75  ? -15.998 26.362 23.456 1.00 103.43 ? 183 LYS A CD  1 
ATOM   448  C  CE  . LYS A 1 75  ? -15.299 25.092 23.018 1.00 108.99 ? 183 LYS A CE  1 
ATOM   449  N  NZ  . LYS A 1 75  ? -14.746 24.323 24.168 1.00 116.93 ? 183 LYS A NZ  1 
ATOM   450  N  N   . ASP A 1 76  ? -18.791 27.916 19.642 1.00 65.13  ? 184 ASP A N   1 
ATOM   451  C  CA  . ASP A 1 76  ? -18.422 28.128 18.239 1.00 62.19  ? 184 ASP A CA  1 
ATOM   452  C  C   . ASP A 1 76  ? -19.376 29.024 17.477 1.00 62.79  ? 184 ASP A C   1 
ATOM   453  O  O   . ASP A 1 76  ? -18.984 29.616 16.479 1.00 61.70  ? 184 ASP A O   1 
ATOM   454  C  CB  . ASP A 1 76  ? -18.225 26.780 17.520 1.00 64.91  ? 184 ASP A CB  1 
ATOM   455  C  CG  . ASP A 1 76  ? -17.015 26.008 18.018 1.00 80.63  ? 184 ASP A CG  1 
ATOM   456  O  OD1 . ASP A 1 76  ? -15.960 26.636 18.239 1.00 82.86  ? 184 ASP A OD1 1 
ATOM   457  O  OD2 . ASP A 1 76  ? -17.121 24.770 18.179 1.00 89.65  ? 184 ASP A OD2 1 
ATOM   458  N  N   . ALA A 1 77  ? -20.618 29.155 17.943 1.00 58.96  ? 185 ALA A N   1 
ATOM   459  C  CA  . ALA A 1 77  ? -21.612 30.020 17.288 1.00 56.01  ? 185 ALA A CA  1 
ATOM   460  C  C   . ALA A 1 77  ? -21.086 31.451 17.223 1.00 61.74  ? 185 ALA A C   1 
ATOM   461  O  O   . ALA A 1 77  ? -20.289 31.872 18.082 1.00 62.68  ? 185 ALA A O   1 
ATOM   462  C  CB  . ALA A 1 77  ? -22.911 29.982 18.046 1.00 55.09  ? 185 ALA A CB  1 
ATOM   463  N  N   . GLY A 1 78  ? -21.441 32.144 16.150 1.00 56.84  ? 186 GLY A N   1 
ATOM   464  C  CA  . GLY A 1 78  ? -21.010 33.519 15.950 1.00 55.46  ? 186 GLY A CA  1 
ATOM   465  C  C   . GLY A 1 78  ? -20.893 33.867 14.495 1.00 59.61  ? 186 GLY A C   1 
ATOM   466  O  O   . GLY A 1 78  ? -21.292 33.065 13.644 1.00 59.71  ? 186 GLY A O   1 
ATOM   467  N  N   . PHE A 1 79  ? -20.248 35.044 14.216 1.00 56.18  ? 187 PHE A N   1 
ATOM   468  C  CA  . PHE A 1 79  ? -19.992 35.626 12.894 1.00 54.92  ? 187 PHE A CA  1 
ATOM   469  C  C   . PHE A 1 79  ? -18.573 35.455 12.374 1.00 63.16  ? 187 PHE A C   1 
ATOM   470  O  O   . PHE A 1 79  ? -17.604 35.877 13.008 1.00 65.96  ? 187 PHE A O   1 
ATOM   471  C  CB  . PHE A 1 79  ? -20.417 37.091 12.876 1.00 55.81  ? 187 PHE A CB  1 
ATOM   472  C  CG  . PHE A 1 79  ? -21.912 37.270 12.813 1.00 57.31  ? 187 PHE A CG  1 
ATOM   473  C  CD1 . PHE A 1 79  ? -22.561 37.407 11.590 1.00 60.10  ? 187 PHE A CD1 1 
ATOM   474  C  CD2 . PHE A 1 79  ? -22.689 37.231 13.978 1.00 58.57  ? 187 PHE A CD2 1 
ATOM   475  C  CE1 . PHE A 1 79  ? -23.949 37.584 11.537 1.00 60.99  ? 187 PHE A CE1 1 
ATOM   476  C  CE2 . PHE A 1 79  ? -24.071 37.405 13.925 1.00 59.81  ? 187 PHE A CE2 1 
ATOM   477  C  CZ  . PHE A 1 79  ? -24.697 37.564 12.703 1.00 59.42  ? 187 PHE A CZ  1 
ATOM   478  N  N   . TYR A 1 80  ? -18.459 34.862 11.186 1.00 60.67  ? 188 TYR A N   1 
ATOM   479  C  CA  . TYR A 1 80  ? -17.185 34.594 10.526 1.00 60.46  ? 188 TYR A CA  1 
ATOM   480  C  C   . TYR A 1 80  ? -17.012 35.254 9.170  1.00 63.76  ? 188 TYR A C   1 
ATOM   481  O  O   . TYR A 1 80  ? -17.950 35.366 8.378  1.00 59.97  ? 188 TYR A O   1 
ATOM   482  C  CB  . TYR A 1 80  ? -16.992 33.102 10.347 1.00 61.77  ? 188 TYR A CB  1 
ATOM   483  C  CG  . TYR A 1 80  ? -16.976 32.341 11.641 1.00 61.74  ? 188 TYR A CG  1 
ATOM   484  C  CD1 . TYR A 1 80  ? -15.774 31.965 12.236 1.00 64.78  ? 188 TYR A CD1 1 
ATOM   485  C  CD2 . TYR A 1 80  ? -18.164 31.967 12.265 1.00 60.63  ? 188 TYR A CD2 1 
ATOM   486  C  CE1 . TYR A 1 80  ? -15.754 31.220 13.416 1.00 66.07  ? 188 TYR A CE1 1 
ATOM   487  C  CE2 . TYR A 1 80  ? -18.158 31.232 13.450 1.00 61.69  ? 188 TYR A CE2 1 
ATOM   488  C  CZ  . TYR A 1 80  ? -16.950 30.873 14.028 1.00 68.41  ? 188 TYR A CZ  1 
ATOM   489  O  OH  . TYR A 1 80  ? -16.935 30.147 15.180 1.00 65.12  ? 188 TYR A OH  1 
ATOM   490  N  N   . VAL A 1 81  ? -15.758 35.605 8.875  1.00 62.88  ? 189 VAL A N   1 
ATOM   491  C  CA  . VAL A 1 81  ? -15.396 36.220 7.612  1.00 63.53  ? 189 VAL A CA  1 
ATOM   492  C  C   . VAL A 1 81  ? -14.068 35.616 7.215  1.00 71.52  ? 189 VAL A C   1 
ATOM   493  O  O   . VAL A 1 81  ? -13.306 35.159 8.081  1.00 73.04  ? 189 VAL A O   1 
ATOM   494  C  CB  . VAL A 1 81  ? -15.365 37.770 7.728  1.00 66.23  ? 189 VAL A CB  1 
ATOM   495  C  CG1 . VAL A 1 81  ? -14.226 38.256 8.617  1.00 65.85  ? 189 VAL A CG1 1 
ATOM   496  C  CG2 . VAL A 1 81  ? -15.328 38.448 6.365  1.00 67.20  ? 189 VAL A CG2 1 
ATOM   497  N  N   . CYS A 1 82  ? -13.814 35.557 5.910  1.00 68.34  ? 190 CYS A N   1 
ATOM   498  C  CA  . CYS A 1 82  ? -12.558 35.054 5.396  1.00 68.15  ? 190 CYS A CA  1 
ATOM   499  C  C   . CYS A 1 82  ? -11.918 36.107 4.542  1.00 70.12  ? 190 CYS A C   1 
ATOM   500  O  O   . CYS A 1 82  ? -12.554 36.733 3.685  1.00 67.08  ? 190 CYS A O   1 
ATOM   501  C  CB  . CYS A 1 82  ? -12.744 33.748 4.633  1.00 69.55  ? 190 CYS A CB  1 
ATOM   502  S  SG  . CYS A 1 82  ? -11.195 32.922 4.202  1.00 75.55  ? 190 CYS A SG  1 
ATOM   503  N  N   . ARG A 1 83  ? -10.638 36.309 4.809  1.00 68.76  ? 191 ARG A N   1 
ATOM   504  C  CA  . ARG A 1 83  ? -9.815  37.235 4.073  1.00 69.60  ? 191 ARG A CA  1 
ATOM   505  C  C   . ARG A 1 83  ? -8.963  36.422 3.122  1.00 77.12  ? 191 ARG A C   1 
ATOM   506  O  O   . ARG A 1 83  ? -8.332  35.448 3.525  1.00 77.47  ? 191 ARG A O   1 
ATOM   507  C  CB  . ARG A 1 83  ? -8.950  38.046 5.027  1.00 64.53  ? 191 ARG A CB  1 
ATOM   508  C  CG  . ARG A 1 83  ? -8.213  39.167 4.322  1.00 65.53  ? 191 ARG A CG  1 
ATOM   509  C  CD  . ARG A 1 83  ? -7.048  39.625 5.159  1.00 72.17  ? 191 ARG A CD  1 
ATOM   510  N  NE  . ARG A 1 83  ? -6.031  38.580 5.312  1.00 75.73  ? 191 ARG A NE  1 
ATOM   511  C  CZ  . ARG A 1 83  ? -5.171  38.539 6.318  1.00 87.49  ? 191 ARG A CZ  1 
ATOM   512  N  NH1 . ARG A 1 83  ? -4.289  37.556 6.404  1.00 82.67  ? 191 ARG A NH1 1 
ATOM   513  N  NH2 . ARG A 1 83  ? -5.188  39.481 7.252  1.00 73.75  ? 191 ARG A NH2 1 
ATOM   514  N  N   . VAL A 1 84  ? -8.996  36.786 1.848  1.00 77.05  ? 192 VAL A N   1 
ATOM   515  C  CA  . VAL A 1 84  ? -8.194  36.150 0.799  1.00 79.21  ? 192 VAL A CA  1 
ATOM   516  C  C   . VAL A 1 84  ? -7.279  37.195 0.167  1.00 86.12  ? 192 VAL A C   1 
ATOM   517  O  O   . VAL A 1 84  ? -7.742  38.268 -0.224 1.00 86.38  ? 192 VAL A O   1 
ATOM   518  C  CB  . VAL A 1 84  ? -8.965  35.259 -0.230 1.00 82.98  ? 192 VAL A CB  1 
ATOM   519  C  CG1 . VAL A 1 84  ? -10.449 35.153 0.083  1.00 80.58  ? 192 VAL A CG1 1 
ATOM   520  C  CG2 . VAL A 1 84  ? -8.757  35.722 -1.662 1.00 85.70  ? 192 VAL A CG2 1 
ATOM   521  N  N   . ASN A 1 85  ? -5.986  36.910 0.126  1.00 85.68  ? 193 ASN A N   1 
ATOM   522  C  CA  . ASN A 1 85  ? -5.025  37.811 -0.501 1.00 89.64  ? 193 ASN A CA  1 
ATOM   523  C  C   . ASN A 1 85  ? -4.266  37.098 -1.653 1.00 102.74 ? 193 ASN A C   1 
ATOM   524  O  O   . ASN A 1 85  ? -4.196  35.864 -1.681 1.00 102.89 ? 193 ASN A O   1 
ATOM   525  C  CB  . ASN A 1 85  ? -4.088  38.461 0.531  1.00 83.32  ? 193 ASN A CB  1 
ATOM   526  C  CG  . ASN A 1 85  ? -3.277  37.471 1.328  1.00 116.13 ? 193 ASN A CG  1 
ATOM   527  O  OD1 . ASN A 1 85  ? -3.579  37.168 2.490  1.00 119.47 ? 193 ASN A OD1 1 
ATOM   528  N  ND2 . ASN A 1 85  ? -2.218  36.950 0.726  1.00 107.29 ? 193 ASN A ND2 1 
ATOM   529  N  N   . ASN A 1 86  ? -3.745  37.879 -2.619 1.00 105.00 ? 194 ASN A N   1 
ATOM   530  C  CA  . ASN A 1 86  ? -2.981  37.364 -3.754 1.00 108.51 ? 194 ASN A CA  1 
ATOM   531  C  C   . ASN A 1 86  ? -1.945  38.391 -4.157 1.00 114.07 ? 194 ASN A C   1 
ATOM   532  O  O   . ASN A 1 86  ? -2.246  39.311 -4.931 1.00 115.23 ? 194 ASN A O   1 
ATOM   533  C  CB  . ASN A 1 86  ? -3.896  36.990 -4.938 1.00 113.44 ? 194 ASN A CB  1 
ATOM   534  N  N   . ASN A 1 87  ? -0.730  38.254 -3.577 1.00 110.55 ? 195 ASN A N   1 
ATOM   535  C  CA  . ASN A 1 87  ? 0.476   39.088 -3.800 1.00 111.92 ? 195 ASN A CA  1 
ATOM   536  C  C   . ASN A 1 87  ? 0.275   40.601 -3.512 1.00 115.02 ? 195 ASN A C   1 
ATOM   537  O  O   . ASN A 1 87  ? 0.865   41.138 -2.563 1.00 114.18 ? 195 ASN A O   1 
ATOM   538  C  CB  . ASN A 1 87  ? 1.074   38.873 -5.211 1.00 110.65 ? 195 ASN A CB  1 
ATOM   539  C  CG  . ASN A 1 87  ? 1.046   37.454 -5.739 1.00 110.67 ? 195 ASN A CG  1 
ATOM   540  O  OD1 . ASN A 1 87  ? 1.777   36.564 -5.268 1.00 97.48  ? 195 ASN A OD1 1 
ATOM   541  N  ND2 . ASN A 1 87  ? 0.260   37.238 -6.793 1.00 96.93  ? 195 ASN A ND2 1 
ATOM   542  N  N   . PHE A 1 88  ? -0.592  41.267 -4.327 1.00 110.13 ? 196 PHE A N   1 
ATOM   543  C  CA  . PHE A 1 88  ? -0.904  42.697 -4.271 1.00 108.83 ? 196 PHE A CA  1 
ATOM   544  C  C   . PHE A 1 88  ? -2.200  43.012 -3.498 1.00 110.38 ? 196 PHE A C   1 
ATOM   545  O  O   . PHE A 1 88  ? -2.165  43.754 -2.508 1.00 108.23 ? 196 PHE A O   1 
ATOM   546  C  CB  . PHE A 1 88  ? -0.912  43.281 -5.700 1.00 112.71 ? 196 PHE A CB  1 
ATOM   547  C  CG  . PHE A 1 88  ? 0.320   42.903 -6.509 1.00 115.15 ? 196 PHE A CG  1 
ATOM   548  C  CD1 . PHE A 1 88  ? 1.471   43.676 -6.454 1.00 118.69 ? 196 PHE A CD1 1 
ATOM   549  C  CD2 . PHE A 1 88  ? 0.341   41.744 -7.278 1.00 115.94 ? 196 PHE A CD2 1 
ATOM   550  C  CE1 . PHE A 1 88  ? 2.613   43.303 -7.162 1.00 121.97 ? 196 PHE A CE1 1 
ATOM   551  C  CE2 . PHE A 1 88  ? 1.493   41.357 -7.957 1.00 120.68 ? 196 PHE A CE2 1 
ATOM   552  C  CZ  . PHE A 1 88  ? 2.618   42.147 -7.907 1.00 120.87 ? 196 PHE A CZ  1 
ATOM   553  N  N   . THR A 1 89  ? -3.320  42.387 -3.917 1.00 106.24 ? 197 THR A N   1 
ATOM   554  C  CA  . THR A 1 89  ? -4.692  42.568 -3.398 1.00 102.97 ? 197 THR A CA  1 
ATOM   555  C  C   . THR A 1 89  ? -4.962  42.116 -1.915 1.00 104.07 ? 197 THR A C   1 
ATOM   556  O  O   . THR A 1 89  ? -4.028  41.870 -1.147 1.00 103.98 ? 197 THR A O   1 
ATOM   557  C  CB  . THR A 1 89  ? -5.717  41.951 -4.388 1.00 102.68 ? 197 THR A CB  1 
ATOM   558  O  OG1 . THR A 1 89  ? -6.049  40.632 -3.940 1.00 106.29 ? 197 THR A OG1 1 
ATOM   559  C  CG2 . THR A 1 89  ? -5.235  41.936 -5.868 1.00 92.73  ? 197 THR A CG2 1 
ATOM   560  N  N   . PHE A 1 90  ? -6.276  42.033 -1.551 1.00 97.35  ? 198 PHE A N   1 
ATOM   561  C  CA  . PHE A 1 90  ? -6.936  41.644 -0.283 1.00 92.01  ? 198 PHE A CA  1 
ATOM   562  C  C   . PHE A 1 90  ? -8.429  41.756 -0.554 1.00 93.12  ? 198 PHE A C   1 
ATOM   563  O  O   . PHE A 1 90  ? -8.885  42.736 -1.163 1.00 95.11  ? 198 PHE A O   1 
ATOM   564  C  CB  . PHE A 1 90  ? -6.595  42.592 0.885  1.00 92.64  ? 198 PHE A CB  1 
ATOM   565  N  N   . GLU A 1 91  ? -9.186  40.740 -0.154 1.00 84.74  ? 199 GLU A N   1 
ATOM   566  C  CA  . GLU A 1 91  ? -10.639 40.733 -0.279 1.00 81.53  ? 199 GLU A CA  1 
ATOM   567  C  C   . GLU A 1 91  ? -11.240 40.041 0.925  1.00 77.86  ? 199 GLU A C   1 
ATOM   568  O  O   . GLU A 1 91  ? -10.751 38.994 1.335  1.00 77.02  ? 199 GLU A O   1 
ATOM   569  C  CB  . GLU A 1 91  ? -11.110 40.061 -1.573 1.00 84.43  ? 199 GLU A CB  1 
ATOM   570  C  CG  . GLU A 1 91  ? -11.912 40.979 -2.487 1.00 99.48  ? 199 GLU A CG  1 
ATOM   571  C  CD  . GLU A 1 91  ? -13.353 40.569 -2.745 1.00 124.42 ? 199 GLU A CD  1 
ATOM   572  O  OE1 . GLU A 1 91  ? -14.232 40.979 -1.954 1.00 125.34 ? 199 GLU A OE1 1 
ATOM   573  O  OE2 . GLU A 1 91  ? -13.615 39.888 -3.765 1.00 119.15 ? 199 GLU A OE2 1 
ATOM   574  N  N   . PHE A 1 92  ? -12.294 40.624 1.497  1.00 69.23  ? 200 PHE A N   1 
ATOM   575  C  CA  . PHE A 1 92  ? -12.995 40.003 2.612  1.00 63.99  ? 200 PHE A CA  1 
ATOM   576  C  C   . PHE A 1 92  ? -14.281 39.397 2.066  1.00 69.22  ? 200 PHE A C   1 
ATOM   577  O  O   . PHE A 1 92  ? -15.033 40.042 1.320  1.00 69.39  ? 200 PHE A O   1 
ATOM   578  C  CB  . PHE A 1 92  ? -13.273 41.004 3.761  1.00 62.70  ? 200 PHE A CB  1 
ATOM   579  C  CG  . PHE A 1 92  ? -12.094 41.239 4.677  1.00 63.02  ? 200 PHE A CG  1 
ATOM   580  C  CD1 . PHE A 1 92  ? -11.846 40.392 5.757  1.00 63.16  ? 200 PHE A CD1 1 
ATOM   581  C  CD2 . PHE A 1 92  ? -11.207 42.284 4.442  1.00 65.82  ? 200 PHE A CD2 1 
ATOM   582  C  CE1 . PHE A 1 92  ? -10.746 40.606 6.598  1.00 63.16  ? 200 PHE A CE1 1 
ATOM   583  C  CE2 . PHE A 1 92  ? -10.083 42.468 5.256  1.00 68.03  ? 200 PHE A CE2 1 
ATOM   584  C  CZ  . PHE A 1 92  ? -9.880  41.643 6.341  1.00 64.42  ? 200 PHE A CZ  1 
ATOM   585  N  N   . SER A 1 93  ? -14.542 38.152 2.448  1.00 65.93  ? 201 SER A N   1 
ATOM   586  C  CA  . SER A 1 93  ? -15.775 37.498 2.061  1.00 65.19  ? 201 SER A CA  1 
ATOM   587  C  C   . SER A 1 93  ? -16.962 38.143 2.793  1.00 68.80  ? 201 SER A C   1 
ATOM   588  O  O   . SER A 1 93  ? -16.831 39.074 3.609  1.00 67.18  ? 201 SER A O   1 
ATOM   589  C  CB  . SER A 1 93  ? -15.711 36.009 2.391  1.00 66.32  ? 201 SER A CB  1 
ATOM   590  O  OG  . SER A 1 93  ? -15.916 35.800 3.777  1.00 73.05  ? 201 SER A OG  1 
ATOM   591  N  N   . GLN A 1 94  ? -18.131 37.629 2.482  1.00 65.26  ? 202 GLN A N   1 
ATOM   592  C  CA  . GLN A 1 94  ? -19.340 38.029 3.127  1.00 63.21  ? 202 GLN A CA  1 
ATOM   593  C  C   . GLN A 1 94  ? -19.277 37.405 4.489  1.00 65.26  ? 202 GLN A C   1 
ATOM   594  O  O   . GLN A 1 94  ? -18.584 36.402 4.663  1.00 64.40  ? 202 GLN A O   1 
ATOM   595  C  CB  . GLN A 1 94  ? -20.494 37.405 2.384  1.00 65.22  ? 202 GLN A CB  1 
ATOM   596  C  CG  . GLN A 1 94  ? -20.774 38.065 1.055  1.00 74.46  ? 202 GLN A CG  1 
ATOM   597  C  CD  . GLN A 1 94  ? -21.836 37.292 0.347  1.00 82.58  ? 202 GLN A CD  1 
ATOM   598  O  OE1 . GLN A 1 94  ? -21.939 37.347 -0.878 1.00 79.14  ? 202 GLN A OE1 1 
ATOM   599  N  NE2 . GLN A 1 94  ? -22.575 36.465 1.098  1.00 69.31  ? 202 GLN A NE2 1 
ATOM   600  N  N   . TRP A 1 95  ? -19.990 37.993 5.456  1.00 61.73  ? 203 TRP A N   1 
ATOM   601  C  CA  . TRP A 1 95  ? -20.123 37.466 6.808  1.00 59.70  ? 203 TRP A CA  1 
ATOM   602  C  C   . TRP A 1 95  ? -20.979 36.203 6.749  1.00 66.16  ? 203 TRP A C   1 
ATOM   603  O  O   . TRP A 1 95  ? -21.933 36.120 5.966  1.00 68.06  ? 203 TRP A O   1 
ATOM   604  C  CB  . TRP A 1 95  ? -20.808 38.483 7.726  1.00 57.22  ? 203 TRP A CB  1 
ATOM   605  C  CG  . TRP A 1 95  ? -19.916 39.588 8.152  1.00 58.70  ? 203 TRP A CG  1 
ATOM   606  C  CD1 . TRP A 1 95  ? -19.969 40.889 7.752  1.00 62.78  ? 203 TRP A CD1 1 
ATOM   607  C  CD2 . TRP A 1 95  ? -18.857 39.502 9.122  1.00 58.33  ? 203 TRP A CD2 1 
ATOM   608  N  NE1 . TRP A 1 95  ? -18.932 41.599 8.322  1.00 62.87  ? 203 TRP A NE1 1 
ATOM   609  C  CE2 . TRP A 1 95  ? -18.268 40.787 9.211  1.00 63.22  ? 203 TRP A CE2 1 
ATOM   610  C  CE3 . TRP A 1 95  ? -18.351 38.464 9.922  1.00 58.30  ? 203 TRP A CE3 1 
ATOM   611  C  CZ2 . TRP A 1 95  ? -17.186 41.053 10.050 1.00 62.23  ? 203 TRP A CZ2 1 
ATOM   612  C  CZ3 . TRP A 1 95  ? -17.286 38.728 10.755 1.00 60.45  ? 203 TRP A CZ3 1 
ATOM   613  C  CH2 . TRP A 1 95  ? -16.685 39.999 10.786 1.00 62.35  ? 203 TRP A CH2 1 
ATOM   614  N  N   . SER A 1 96  ? -20.646 35.237 7.589  1.00 63.06  ? 204 SER A N   1 
ATOM   615  C  CA  . SER A 1 96  ? -21.392 34.001 7.717  1.00 63.27  ? 204 SER A CA  1 
ATOM   616  C  C   . SER A 1 96  ? -21.815 33.902 9.174  1.00 67.40  ? 204 SER A C   1 
ATOM   617  O  O   . SER A 1 96  ? -21.013 34.163 10.096 1.00 65.77  ? 204 SER A O   1 
ATOM   618  C  CB  . SER A 1 96  ? -20.527 32.810 7.315  1.00 67.68  ? 204 SER A CB  1 
ATOM   619  O  OG  . SER A 1 96  ? -21.069 31.558 7.706  1.00 75.38  ? 204 SER A OG  1 
ATOM   620  N  N   . GLN A 1 97  ? -23.096 33.607 9.388  1.00 64.44  ? 205 GLN A N   1 
ATOM   621  C  CA  . GLN A 1 97  ? -23.540 33.421 10.763 1.00 62.77  ? 205 GLN A CA  1 
ATOM   622  C  C   . GLN A 1 97  ? -23.675 31.956 11.055 1.00 66.25  ? 205 GLN A C   1 
ATOM   623  O  O   . GLN A 1 97  ? -24.391 31.222 10.356 1.00 66.46  ? 205 GLN A O   1 
ATOM   624  C  CB  . GLN A 1 97  ? -24.840 34.117 11.077 1.00 62.96  ? 205 GLN A CB  1 
ATOM   625  C  CG  . GLN A 1 97  ? -25.072 34.087 12.564 1.00 63.45  ? 205 GLN A CG  1 
ATOM   626  C  CD  . GLN A 1 97  ? -26.503 34.244 12.919 1.00 71.23  ? 205 GLN A CD  1 
ATOM   627  O  OE1 . GLN A 1 97  ? -27.278 34.848 12.183 1.00 66.65  ? 205 GLN A OE1 1 
ATOM   628  N  NE2 . GLN A 1 97  ? -26.884 33.690 14.064 1.00 61.04  ? 205 GLN A NE2 1 
ATOM   629  N  N   . LEU A 1 98  ? -22.967 31.526 12.076 1.00 61.42  ? 206 LEU A N   1 
ATOM   630  C  CA  . LEU A 1 98  ? -23.065 30.156 12.492 1.00 61.57  ? 206 LEU A CA  1 
ATOM   631  C  C   . LEU A 1 98  ? -23.892 30.106 13.753 1.00 64.55  ? 206 LEU A C   1 
ATOM   632  O  O   . LEU A 1 98  ? -23.572 30.761 14.762 1.00 63.09  ? 206 LEU A O   1 
ATOM   633  C  CB  . LEU A 1 98  ? -21.679 29.507 12.683 1.00 62.54  ? 206 LEU A CB  1 
ATOM   634  C  CG  . LEU A 1 98  ? -21.662 28.043 13.197 1.00 67.56  ? 206 LEU A CG  1 
ATOM   635  C  CD1 . LEU A 1 98  ? -22.466 27.118 12.299 1.00 67.73  ? 206 LEU A CD1 1 
ATOM   636  C  CD2 . LEU A 1 98  ? -20.239 27.552 13.355 1.00 72.60  ? 206 LEU A CD2 1 
ATOM   637  N  N   . ASP A 1 99  ? -25.003 29.368 13.674 1.00 62.41  ? 207 ASP A N   1 
ATOM   638  C  CA  . ASP A 1 99  ? -25.819 29.161 14.855 1.00 62.37  ? 207 ASP A CA  1 
ATOM   639  C  C   . ASP A 1 99  ? -25.780 27.704 15.243 1.00 64.57  ? 207 ASP A C   1 
ATOM   640  O  O   . ASP A 1 99  ? -25.875 26.833 14.382 1.00 64.45  ? 207 ASP A O   1 
ATOM   641  C  CB  . ASP A 1 99  ? -27.235 29.721 14.742 1.00 65.04  ? 207 ASP A CB  1 
ATOM   642  C  CG  . ASP A 1 99  ? -27.927 29.707 16.093 1.00 88.73  ? 207 ASP A CG  1 
ATOM   643  O  OD1 . ASP A 1 99  ? -27.203 29.816 17.153 1.00 92.17  ? 207 ASP A OD1 1 
ATOM   644  O  OD2 . ASP A 1 99  ? -29.176 29.551 16.117 1.00 94.28  ? 207 ASP A OD2 1 
ATOM   645  N  N   . VAL A 1 100 ? -25.511 27.450 16.524 1.00 61.65  ? 208 VAL A N   1 
ATOM   646  C  CA  . VAL A 1 100 ? -25.375 26.094 17.077 1.00 62.94  ? 208 VAL A CA  1 
ATOM   647  C  C   . VAL A 1 100 ? -26.455 25.884 18.126 1.00 69.97  ? 208 VAL A C   1 
ATOM   648  O  O   . VAL A 1 100 ? -26.508 26.629 19.107 1.00 69.85  ? 208 VAL A O   1 
ATOM   649  C  CB  . VAL A 1 100 ? -23.947 25.796 17.634 1.00 65.10  ? 208 VAL A CB  1 
ATOM   650  C  CG1 . VAL A 1 100 ? -23.791 24.327 17.992 1.00 66.58  ? 208 VAL A CG1 1 
ATOM   651  C  CG2 . VAL A 1 100 ? -22.870 26.210 16.646 1.00 63.97  ? 208 VAL A CG2 1 
ATOM   652  N  N   . CYS A 1 101 ? -27.325 24.901 17.910 1.00 69.14  ? 209 CYS A N   1 
ATOM   653  C  CA  . CYS A 1 101 ? -28.394 24.616 18.859 1.00 71.01  ? 209 CYS A CA  1 
ATOM   654  C  C   . CYS A 1 101 ? -28.061 23.359 19.645 1.00 77.41  ? 209 CYS A C   1 
ATOM   655  O  O   . CYS A 1 101 ? -27.652 22.366 19.050 1.00 77.24  ? 209 CYS A O   1 
ATOM   656  C  CB  . CYS A 1 101 ? -29.745 24.485 18.160 1.00 72.77  ? 209 CYS A CB  1 
ATOM   657  S  SG  . CYS A 1 101 ? -29.965 25.568 16.722 1.00 76.17  ? 209 CYS A SG  1 
ATOM   658  N  N   . ASP A 1 102 ? -28.243 23.397 20.982 1.00 76.51  ? 210 ASP A N   1 
ATOM   659  C  CA  . ASP A 1 102 ? -28.050 22.221 21.828 1.00 79.42  ? 210 ASP A CA  1 
ATOM   660  C  C   . ASP A 1 102 ? -29.442 21.654 22.152 1.00 82.89  ? 210 ASP A C   1 
ATOM   661  O  O   . ASP A 1 102 ? -30.252 22.332 22.796 1.00 82.89  ? 210 ASP A O   1 
ATOM   662  C  CB  . ASP A 1 102 ? -27.253 22.558 23.109 1.00 82.61  ? 210 ASP A CB  1 
ATOM   663  C  CG  . ASP A 1 102 ? -26.528 21.393 23.801 1.00 104.04 ? 210 ASP A CG  1 
ATOM   664  O  OD1 . ASP A 1 102 ? -26.602 20.239 23.291 1.00 107.11 ? 210 ASP A OD1 1 
ATOM   665  O  OD2 . ASP A 1 102 ? -25.880 21.634 24.845 1.00 113.85 ? 210 ASP A OD2 1 
ATOM   666  N  N   . ILE A 1 103 ? -29.757 20.452 21.627 1.00 78.57  ? 211 ILE A N   1 
ATOM   667  C  CA  . ILE A 1 103 ? -31.048 19.781 21.867 1.00 78.33  ? 211 ILE A CA  1 
ATOM   668  C  C   . ILE A 1 103 ? -30.812 18.319 22.285 1.00 83.74  ? 211 ILE A C   1 
ATOM   669  O  O   . ILE A 1 103 ? -29.788 17.750 21.894 1.00 83.25  ? 211 ILE A O   1 
ATOM   670  C  CB  . ILE A 1 103 ? -32.069 19.914 20.681 1.00 80.78  ? 211 ILE A CB  1 
ATOM   671  C  CG1 . ILE A 1 103 ? -31.594 19.206 19.388 1.00 82.32  ? 211 ILE A CG1 1 
ATOM   672  C  CG2 . ILE A 1 103 ? -32.455 21.370 20.423 1.00 79.64  ? 211 ILE A CG2 1 
ATOM   673  C  CD1 . ILE A 1 103 ? -32.578 19.077 18.311 1.00 84.64  ? 211 ILE A CD1 1 
ATOM   674  N  N   . PRO A 1 104 ? -31.725 17.679 23.065 1.00 83.01  ? 212 PRO A N   1 
ATOM   675  C  CA  . PRO A 1 104 ? -31.527 16.251 23.394 1.00 86.63  ? 212 PRO A CA  1 
ATOM   676  C  C   . PRO A 1 104 ? -31.504 15.330 22.165 1.00 92.54  ? 212 PRO A C   1 
ATOM   677  O  O   . PRO A 1 104 ? -32.127 15.636 21.141 1.00 90.61  ? 212 PRO A O   1 
ATOM   678  C  CB  . PRO A 1 104 ? -32.737 15.914 24.293 1.00 89.55  ? 212 PRO A CB  1 
ATOM   679  C  CG  . PRO A 1 104 ? -33.273 17.222 24.754 1.00 90.07  ? 212 PRO A CG  1 
ATOM   680  C  CD  . PRO A 1 104 ? -32.989 18.186 23.648 1.00 82.86  ? 212 PRO A CD  1 
ATOM   681  N  N   . GLU A 1 105 ? -30.803 14.186 22.292 1.00 93.72  ? 213 GLU A N   1 
ATOM   682  C  CA  . GLU A 1 105 ? -30.665 13.118 21.285 1.00 96.61  ? 213 GLU A CA  1 
ATOM   683  C  C   . GLU A 1 105 ? -32.002 12.679 20.714 1.00 102.16 ? 213 GLU A C   1 
ATOM   684  O  O   . GLU A 1 105 ? -32.080 12.412 19.516 1.00 102.01 ? 213 GLU A O   1 
ATOM   685  C  CB  . GLU A 1 105 ? -29.954 11.885 21.882 1.00 102.25 ? 213 GLU A CB  1 
ATOM   686  C  CG  . GLU A 1 105 ? -28.458 12.046 22.082 1.00 115.59 ? 213 GLU A CG  1 
ATOM   687  C  CD  . GLU A 1 105 ? -27.717 12.580 20.874 1.00 144.29 ? 213 GLU A CD  1 
ATOM   688  O  OE1 . GLU A 1 105 ? -27.150 13.694 20.975 1.00 135.71 ? 213 GLU A OE1 1 
ATOM   689  O  OE2 . GLU A 1 105 ? -27.770 11.923 19.808 1.00 144.57 ? 213 GLU A OE2 1 
ATOM   690  N  N   . SER A 1 106 ? -33.046 12.615 21.578 1.00 100.24 ? 214 SER A N   1 
ATOM   691  C  CA  . SER A 1 106 ? -34.426 12.233 21.264 1.00 102.50 ? 214 SER A CA  1 
ATOM   692  C  C   . SER A 1 106 ? -35.084 13.032 20.113 1.00 107.54 ? 214 SER A C   1 
ATOM   693  O  O   . SER A 1 106 ? -36.093 12.583 19.559 1.00 109.46 ? 214 SER A O   1 
ATOM   694  C  CB  . SER A 1 106 ? -35.289 12.282 22.522 1.00 105.96 ? 214 SER A CB  1 
ATOM   695  O  OG  . SER A 1 106 ? -35.156 13.504 23.227 1.00 110.85 ? 214 SER A OG  1 
ATOM   696  N  N   . PHE A 1 107 ? -34.495 14.188 19.746 1.00 102.20 ? 215 PHE A N   1 
ATOM   697  C  CA  . PHE A 1 107 ? -34.950 15.081 18.674 1.00 100.94 ? 215 PHE A CA  1 
ATOM   698  C  C   . PHE A 1 107 ? -34.027 14.987 17.438 1.00 109.89 ? 215 PHE A C   1 
ATOM   699  O  O   . PHE A 1 107 ? -34.358 15.511 16.363 1.00 108.41 ? 215 PHE A O   1 
ATOM   700  C  CB  . PHE A 1 107 ? -34.998 16.531 19.190 1.00 98.52  ? 215 PHE A CB  1 
ATOM   701  C  CG  . PHE A 1 107 ? -35.923 16.771 20.356 1.00 99.28  ? 215 PHE A CG  1 
ATOM   702  C  CD1 . PHE A 1 107 ? -35.489 16.576 21.661 1.00 102.39 ? 215 PHE A CD1 1 
ATOM   703  C  CD2 . PHE A 1 107 ? -37.228 17.203 20.151 1.00 100.62 ? 215 PHE A CD2 1 
ATOM   704  C  CE1 . PHE A 1 107 ? -36.354 16.777 22.742 1.00 103.64 ? 215 PHE A CE1 1 
ATOM   705  C  CE2 . PHE A 1 107 ? -38.092 17.415 21.234 1.00 103.59 ? 215 PHE A CE2 1 
ATOM   706  C  CZ  . PHE A 1 107 ? -37.649 17.200 22.523 1.00 102.18 ? 215 PHE A CZ  1 
ATOM   707  N  N   . GLN A 1 108 ? -32.873 14.301 17.597 1.00 111.30 ? 216 GLN A N   1 
ATOM   708  C  CA  . GLN A 1 108 ? -31.874 14.112 16.542 1.00 112.48 ? 216 GLN A CA  1 
ATOM   709  C  C   . GLN A 1 108 ? -32.171 12.981 15.540 1.00 123.10 ? 216 GLN A C   1 
ATOM   710  O  O   . GLN A 1 108 ? -31.290 12.593 14.766 1.00 123.27 ? 216 GLN A O   1 
ATOM   711  C  CB  . GLN A 1 108 ? -30.454 14.043 17.122 1.00 113.22 ? 216 GLN A CB  1 
ATOM   712  C  CG  . GLN A 1 108 ? -29.749 15.380 17.080 1.00 109.89 ? 216 GLN A CG  1 
ATOM   713  C  CD  . GLN A 1 108 ? -29.016 15.645 18.357 1.00 119.67 ? 216 GLN A CD  1 
ATOM   714  O  OE1 . GLN A 1 108 ? -27.846 15.292 18.509 1.00 118.46 ? 216 GLN A OE1 1 
ATOM   715  N  NE2 . GLN A 1 108 ? -29.687 16.282 19.299 1.00 105.42 ? 216 GLN A NE2 1 
ATOM   716  N  N   . ARG A 1 109 ? -33.426 12.486 15.528 1.00 125.04 ? 217 ARG A N   1 
ATOM   717  C  CA  . ARG A 1 109 ? -33.901 11.491 14.567 1.00 130.08 ? 217 ARG A CA  1 
ATOM   718  C  C   . ARG A 1 109 ? -33.912 12.202 13.200 1.00 136.57 ? 217 ARG A C   1 
ATOM   719  O  O   . ARG A 1 109 ? -34.243 13.395 13.133 1.00 133.66 ? 217 ARG A O   1 
ATOM   720  C  CB  . ARG A 1 109 ? -35.309 11.006 14.945 1.00 131.51 ? 217 ARG A CB  1 
ATOM   721  N  N   . SER A 1 110 ? -33.480 11.499 12.133 1.00 137.66 ? 218 SER A N   1 
ATOM   722  C  CA  . SER A 1 110 ? -33.340 12.027 10.761 1.00 137.51 ? 218 SER A CA  1 
ATOM   723  C  C   . SER A 1 110 ? -32.288 13.168 10.641 1.00 135.68 ? 218 SER A C   1 
ATOM   724  O  O   . SER A 1 110 ? -32.407 14.043 9.779  1.00 133.25 ? 218 SER A O   1 
ATOM   725  C  CB  . SER A 1 110 ? -34.693 12.371 10.123 1.00 143.06 ? 218 SER A CB  1 
ATOM   726  O  OG  . SER A 1 110 ? -35.216 13.607 10.585 1.00 149.52 ? 218 SER A OG  1 
ATOM   727  N  N   . VAL A 1 111 ? -31.258 13.130 11.530 1.00 130.08 ? 219 VAL A N   1 
ATOM   728  C  CA  . VAL A 1 111 ? -30.088 14.023 11.588 1.00 126.22 ? 219 VAL A CA  1 
ATOM   729  C  C   . VAL A 1 111 ? -28.867 13.276 12.140 1.00 131.05 ? 219 VAL A C   1 
ATOM   730  O  O   . VAL A 1 111 ? -28.805 13.001 13.340 1.00 131.42 ? 219 VAL A O   1 
ATOM   731  C  CB  . VAL A 1 111 ? -30.265 15.421 12.259 1.00 125.41 ? 219 VAL A CB  1 
ATOM   732  C  CG1 . VAL A 1 111 ? -30.107 16.543 11.242 1.00 122.75 ? 219 VAL A CG1 1 
ATOM   733  C  CG2 . VAL A 1 111 ? -31.576 15.549 13.027 1.00 125.05 ? 219 VAL A CG2 1 
ATOM   734  N  N   . ASP A 1 112 ? -27.898 12.948 11.259 1.00 127.57 ? 220 ASP A N   1 
ATOM   735  C  CA  . ASP A 1 112 ? -26.658 12.258 11.625 1.00 128.09 ? 220 ASP A CA  1 
ATOM   736  C  C   . ASP A 1 112 ? -25.603 13.252 12.180 1.00 125.92 ? 220 ASP A C   1 
ATOM   737  O  O   . ASP A 1 112 ? -25.929 14.420 12.432 1.00 121.35 ? 220 ASP A O   1 
ATOM   738  C  CB  . ASP A 1 112 ? -26.131 11.379 10.451 1.00 133.72 ? 220 ASP A CB  1 
ATOM   739  C  CG  . ASP A 1 112 ? -25.600 12.094 9.209  1.00 144.10 ? 220 ASP A CG  1 
ATOM   740  O  OD1 . ASP A 1 112 ? -26.027 13.242 8.950  1.00 142.07 ? 220 ASP A OD1 1 
ATOM   741  O  OD2 . ASP A 1 112 ? -24.794 11.480 8.468  1.00 151.94 ? 220 ASP A OD2 1 
ATOM   742  N  N   . GLY A 1 113 ? -24.370 12.771 12.388 1.00 122.05 ? 221 GLY A N   1 
ATOM   743  C  CA  . GLY A 1 113 ? -23.257 13.560 12.919 1.00 118.17 ? 221 GLY A CA  1 
ATOM   744  C  C   . GLY A 1 113 ? -22.585 14.512 11.944 1.00 116.11 ? 221 GLY A C   1 
ATOM   745  O  O   . GLY A 1 113 ? -21.548 15.101 12.267 1.00 113.12 ? 221 GLY A O   1 
ATOM   746  N  N   . VAL A 1 114 ? -23.154 14.641 10.731 1.00 111.16 ? 222 VAL A N   1 
ATOM   747  C  CA  . VAL A 1 114 ? -22.671 15.521 9.669  1.00 108.47 ? 222 VAL A CA  1 
ATOM   748  C  C   . VAL A 1 114 ? -23.796 16.489 9.350  1.00 110.63 ? 222 VAL A C   1 
ATOM   749  O  O   . VAL A 1 114 ? -24.927 16.070 9.072  1.00 111.25 ? 222 VAL A O   1 
ATOM   750  C  CB  . VAL A 1 114 ? -22.161 14.771 8.402  1.00 114.17 ? 222 VAL A CB  1 
ATOM   751  C  CG1 . VAL A 1 114 ? -21.605 15.747 7.363  1.00 112.06 ? 222 VAL A CG1 1 
ATOM   752  C  CG2 . VAL A 1 114 ? -21.110 13.729 8.762  1.00 116.49 ? 222 VAL A CG2 1 
ATOM   753  N  N   . SER A 1 115 ? -23.486 17.788 9.437  1.00 104.73 ? 223 SER A N   1 
ATOM   754  C  CA  . SER A 1 115 ? -24.441 18.844 9.156  1.00 102.58 ? 223 SER A CA  1 
ATOM   755  C  C   . SER A 1 115 ? -24.793 18.834 7.678  1.00 107.25 ? 223 SER A C   1 
ATOM   756  O  O   . SER A 1 115 ? -23.898 18.829 6.818  1.00 108.35 ? 223 SER A O   1 
ATOM   757  C  CB  . SER A 1 115 ? -23.889 20.203 9.588  1.00 104.31 ? 223 SER A CB  1 
ATOM   758  O  OG  . SER A 1 115 ? -24.391 21.292 8.826  1.00 115.58 ? 223 SER A OG  1 
ATOM   759  N  N   . GLU A 1 116 ? -26.101 18.783 7.400  1.00 103.61 ? 224 GLU A N   1 
ATOM   760  C  CA  . GLU A 1 116 ? -26.661 18.849 6.048  1.00 105.46 ? 224 GLU A CA  1 
ATOM   761  C  C   . GLU A 1 116 ? -27.415 20.176 5.874  1.00 107.43 ? 224 GLU A C   1 
ATOM   762  O  O   . GLU A 1 116 ? -27.976 20.712 6.839  1.00 106.08 ? 224 GLU A O   1 
ATOM   763  C  CB  . GLU A 1 116 ? -27.525 17.617 5.683  1.00 110.22 ? 224 GLU A CB  1 
ATOM   764  C  CG  . GLU A 1 116 ? -26.778 16.284 5.700  1.00 121.72 ? 224 GLU A CG  1 
ATOM   765  C  CD  . GLU A 1 116 ? -25.547 16.109 4.821  1.00 142.39 ? 224 GLU A CD  1 
ATOM   766  O  OE1 . GLU A 1 116 ? -25.417 16.822 3.798  1.00 129.39 ? 224 GLU A OE1 1 
ATOM   767  O  OE2 . GLU A 1 116 ? -24.722 15.222 5.146  1.00 139.02 ? 224 GLU A OE2 1 
ATOM   768  N  N   . SER A 1 117 ? -27.366 20.721 4.657  1.00 103.11 ? 225 SER A N   1 
ATOM   769  C  CA  . SER A 1 117 ? -27.945 22.004 4.276  1.00 100.61 ? 225 SER A CA  1 
ATOM   770  C  C   . SER A 1 117 ? -29.497 22.064 4.336  1.00 101.31 ? 225 SER A C   1 
ATOM   771  O  O   . SER A 1 117 ? -30.049 23.156 4.475  1.00 98.92  ? 225 SER A O   1 
ATOM   772  C  CB  . SER A 1 117 ? -27.428 22.383 2.890  1.00 108.27 ? 225 SER A CB  1 
ATOM   773  O  OG  . SER A 1 117 ? -27.743 23.712 2.514  1.00 123.70 ? 225 SER A OG  1 
ATOM   774  N  N   . LYS A 1 118 ? -30.191 20.910 4.228  1.00 98.27  ? 226 LYS A N   1 
ATOM   775  C  CA  . LYS A 1 118 ? -31.660 20.840 4.192  1.00 98.10  ? 226 LYS A CA  1 
ATOM   776  C  C   . LYS A 1 118 ? -32.314 21.450 5.406  1.00 97.54  ? 226 LYS A C   1 
ATOM   777  O  O   . LYS A 1 118 ? -31.917 21.128 6.534  1.00 97.66  ? 226 LYS A O   1 
ATOM   778  C  CB  . LYS A 1 118 ? -32.150 19.395 3.999  1.00 103.63 ? 226 LYS A CB  1 
ATOM   779  C  CG  . LYS A 1 118 ? -33.608 19.312 3.572  1.00 114.66 ? 226 LYS A CG  1 
ATOM   780  C  CD  . LYS A 1 118 ? -34.252 17.984 3.935  1.00 126.08 ? 226 LYS A CD  1 
ATOM   781  C  CE  . LYS A 1 118 ? -35.665 17.870 3.401  1.00 139.68 ? 226 LYS A CE  1 
ATOM   782  N  NZ  . LYS A 1 118 ? -36.608 18.832 4.049  1.00 147.34 ? 226 LYS A NZ  1 
ATOM   783  N  N   . LEU A 1 119 ? -33.315 22.334 5.173  1.00 89.65  ? 227 LEU A N   1 
ATOM   784  C  CA  . LEU A 1 119 ? -34.099 22.990 6.228  1.00 85.55  ? 227 LEU A CA  1 
ATOM   785  C  C   . LEU A 1 119 ? -35.039 21.959 6.842  1.00 89.28  ? 227 LEU A C   1 
ATOM   786  O  O   . LEU A 1 119 ? -35.823 21.328 6.120  1.00 92.25  ? 227 LEU A O   1 
ATOM   787  C  CB  . LEU A 1 119 ? -34.893 24.176 5.665  1.00 85.34  ? 227 LEU A CB  1 
ATOM   788  C  CG  . LEU A 1 119 ? -35.806 24.912 6.633  1.00 87.90  ? 227 LEU A CG  1 
ATOM   789  C  CD1 . LEU A 1 119 ? -35.369 26.317 6.794  1.00 85.67  ? 227 LEU A CD1 1 
ATOM   790  C  CD2 . LEU A 1 119 ? -37.224 24.925 6.120  1.00 92.76  ? 227 LEU A CD2 1 
ATOM   791  N  N   . GLN A 1 120 ? -34.923 21.756 8.164  1.00 82.22  ? 228 GLN A N   1 
ATOM   792  C  CA  . GLN A 1 120 ? -35.725 20.785 8.899  1.00 82.61  ? 228 GLN A CA  1 
ATOM   793  C  C   . GLN A 1 120 ? -35.866 21.108 10.356 1.00 80.99  ? 228 GLN A C   1 
ATOM   794  O  O   . GLN A 1 120 ? -34.889 21.449 11.011 1.00 77.12  ? 228 GLN A O   1 
ATOM   795  C  CB  . GLN A 1 120 ? -35.259 19.325 8.681  1.00 87.22  ? 228 GLN A CB  1 
ATOM   796  C  CG  . GLN A 1 120 ? -33.855 18.972 9.176  1.00 106.98 ? 228 GLN A CG  1 
ATOM   797  C  CD  . GLN A 1 120 ? -33.654 17.479 9.286  1.00 133.11 ? 228 GLN A CD  1 
ATOM   798  O  OE1 . GLN A 1 120 ? -32.763 16.908 8.649  1.00 131.07 ? 228 GLN A OE1 1 
ATOM   799  N  NE2 . GLN A 1 120 ? -34.471 16.810 10.104 1.00 126.76 ? 228 GLN A NE2 1 
ATOM   800  N  N   . ILE A 1 121 ? -37.111 21.022 10.841 1.00 78.43  ? 229 ILE A N   1 
ATOM   801  C  CA  . ILE A 1 121 ? -37.544 21.260 12.214 1.00 76.48  ? 229 ILE A CA  1 
ATOM   802  C  C   . ILE A 1 121 ? -37.186 20.027 13.031 1.00 82.70  ? 229 ILE A C   1 
ATOM   803  O  O   . ILE A 1 121 ? -37.507 18.907 12.644 1.00 84.69  ? 229 ILE A O   1 
ATOM   804  C  CB  . ILE A 1 121 ? -39.068 21.602 12.251 1.00 80.11  ? 229 ILE A CB  1 
ATOM   805  C  CG1 . ILE A 1 121 ? -39.330 22.992 11.630 1.00 79.52  ? 229 ILE A CG1 1 
ATOM   806  C  CG2 . ILE A 1 121 ? -39.639 21.532 13.661 1.00 79.45  ? 229 ILE A CG2 1 
ATOM   807  C  CD1 . ILE A 1 121 ? -40.845 23.292 11.254 1.00 88.94  ? 229 ILE A CD1 1 
ATOM   808  N  N   . CYS A 1 122 ? -36.502 20.247 14.146 1.00 80.30  ? 230 CYS A N   1 
ATOM   809  C  CA  . CYS A 1 122 ? -36.049 19.220 15.072 1.00 82.62  ? 230 CYS A CA  1 
ATOM   810  C  C   . CYS A 1 122 ? -36.869 19.173 16.328 1.00 86.24  ? 230 CYS A C   1 
ATOM   811  O  O   . CYS A 1 122 ? -37.087 18.090 16.856 1.00 88.86  ? 230 CYS A O   1 
ATOM   812  C  CB  . CYS A 1 122 ? -34.578 19.426 15.385 1.00 82.38  ? 230 CYS A CB  1 
ATOM   813  S  SG  . CYS A 1 122 ? -33.510 19.200 13.952 1.00 87.77  ? 230 CYS A SG  1 
ATOM   814  N  N   . VAL A 1 123 ? -37.270 20.350 16.833 1.00 80.09  ? 231 VAL A N   1 
ATOM   815  C  CA  . VAL A 1 123 ? -38.087 20.544 18.030 1.00 79.43  ? 231 VAL A CA  1 
ATOM   816  C  C   . VAL A 1 123 ? -39.349 21.264 17.588 1.00 82.94  ? 231 VAL A C   1 
ATOM   817  O  O   . VAL A 1 123 ? -39.288 22.305 16.936 1.00 81.80  ? 231 VAL A O   1 
ATOM   818  C  CB  . VAL A 1 123 ? -37.335 21.319 19.140 1.00 80.76  ? 231 VAL A CB  1 
ATOM   819  C  CG1 . VAL A 1 123 ? -38.154 21.390 20.427 1.00 80.34  ? 231 VAL A CG1 1 
ATOM   820  C  CG2 . VAL A 1 123 ? -35.970 20.703 19.412 1.00 81.09  ? 231 VAL A CG2 1 
ATOM   821  N  N   . GLU A 1 124 ? -40.485 20.681 17.925 1.00 81.70  ? 232 GLU A N   1 
ATOM   822  C  CA  . GLU A 1 124 ? -41.824 21.151 17.579 1.00 81.56  ? 232 GLU A CA  1 
ATOM   823  C  C   . GLU A 1 124 ? -42.543 21.744 18.800 1.00 84.72  ? 232 GLU A C   1 
ATOM   824  O  O   . GLU A 1 124 ? -42.254 21.353 19.938 1.00 84.35  ? 232 GLU A O   1 
ATOM   825  C  CB  . GLU A 1 124 ? -42.638 19.973 17.015 1.00 85.93  ? 232 GLU A CB  1 
ATOM   826  C  CG  . GLU A 1 124 ? -42.153 19.465 15.660 1.00 93.81  ? 232 GLU A CG  1 
ATOM   827  C  CD  . GLU A 1 124 ? -42.843 20.054 14.442 1.00 111.94 ? 232 GLU A CD  1 
ATOM   828  O  OE1 . GLU A 1 124 ? -43.555 21.071 14.603 1.00 100.39 ? 232 GLU A OE1 1 
ATOM   829  O  OE2 . GLU A 1 124 ? -42.720 19.469 13.339 1.00 104.99 ? 232 GLU A OE2 1 
ATOM   830  N  N   . PRO A 1 125 ? -43.493 22.680 18.603 1.00 81.02  ? 233 PRO A N   1 
ATOM   831  C  CA  . PRO A 1 125 ? -44.249 23.196 19.749 1.00 80.06  ? 233 PRO A CA  1 
ATOM   832  C  C   . PRO A 1 125 ? -45.156 22.096 20.304 1.00 87.60  ? 233 PRO A C   1 
ATOM   833  O  O   . PRO A 1 125 ? -45.336 21.030 19.699 1.00 90.04  ? 233 PRO A O   1 
ATOM   834  C  CB  . PRO A 1 125 ? -45.047 24.369 19.171 1.00 81.24  ? 233 PRO A CB  1 
ATOM   835  C  CG  . PRO A 1 125 ? -44.494 24.598 17.804 1.00 86.62  ? 233 PRO A CG  1 
ATOM   836  C  CD  . PRO A 1 125 ? -43.975 23.278 17.347 1.00 83.96  ? 233 PRO A CD  1 
ATOM   837  N  N   . THR A 1 126 ? -45.729 22.361 21.469 1.00 83.04  ? 234 THR A N   1 
ATOM   838  C  CA  . THR A 1 126 ? -46.496 21.399 22.220 1.00 84.18  ? 234 THR A CA  1 
ATOM   839  C  C   . THR A 1 126 ? -47.909 21.952 22.553 1.00 88.45  ? 234 THR A C   1 
ATOM   840  O  O   . THR A 1 126 ? -48.130 23.165 22.535 1.00 87.42  ? 234 THR A O   1 
ATOM   841  C  CB  . THR A 1 126 ? -45.584 21.077 23.398 1.00 88.56  ? 234 THR A CB  1 
ATOM   842  O  OG1 . THR A 1 126 ? -45.314 19.694 23.522 1.00 91.86  ? 234 THR A OG1 1 
ATOM   843  C  CG2 . THR A 1 126 ? -45.968 21.756 24.666 1.00 86.96  ? 234 THR A CG2 1 
ATOM   844  N  N   . SER A 1 127 ? -48.867 21.068 22.824 1.00 86.56  ? 235 SER A N   1 
ATOM   845  C  CA  . SER A 1 127 ? -50.221 21.502 23.178 1.00 86.48  ? 235 SER A CA  1 
ATOM   846  C  C   . SER A 1 127 ? -50.303 21.529 24.695 1.00 91.32  ? 235 SER A C   1 
ATOM   847  O  O   . SER A 1 127 ? -49.702 20.672 25.361 1.00 91.79  ? 235 SER A O   1 
ATOM   848  C  CB  . SER A 1 127 ? -51.284 20.626 22.525 1.00 88.95  ? 235 SER A CB  1 
ATOM   849  O  OG  . SER A 1 127 ? -51.216 20.754 21.112 1.00 89.39  ? 235 SER A OG  1 
ATOM   850  N  N   . GLN A 1 128 ? -50.924 22.592 25.244 1.00 86.44  ? 236 GLN A N   1 
ATOM   851  C  CA  . GLN A 1 128 ? -50.942 22.835 26.684 1.00 85.22  ? 236 GLN A CA  1 
ATOM   852  C  C   . GLN A 1 128 ? -52.244 23.396 27.176 1.00 89.13  ? 236 GLN A C   1 
ATOM   853  O  O   . GLN A 1 128 ? -52.886 24.186 26.485 1.00 87.92  ? 236 GLN A O   1 
ATOM   854  C  CB  . GLN A 1 128 ? -49.852 23.863 27.045 1.00 83.37  ? 236 GLN A CB  1 
ATOM   855  C  CG  . GLN A 1 128 ? -48.440 23.548 26.593 1.00 89.04  ? 236 GLN A CG  1 
ATOM   856  C  CD  . GLN A 1 128 ? -47.603 24.786 26.563 1.00 106.15 ? 236 GLN A CD  1 
ATOM   857  O  OE1 . GLN A 1 128 ? -47.810 25.703 27.355 1.00 106.13 ? 236 GLN A OE1 1 
ATOM   858  N  NE2 . GLN A 1 128 ? -46.623 24.840 25.657 1.00 89.90  ? 236 GLN A NE2 1 
ATOM   859  N  N   . LYS A 1 129 ? -52.591 23.040 28.414 1.00 87.87  ? 237 LYS A N   1 
ATOM   860  C  CA  . LYS A 1 129 ? -53.757 23.543 29.134 1.00 89.46  ? 237 LYS A CA  1 
ATOM   861  C  C   . LYS A 1 129 ? -53.148 24.215 30.367 1.00 93.77  ? 237 LYS A C   1 
ATOM   862  O  O   . LYS A 1 129 ? -52.627 23.547 31.263 1.00 94.82  ? 237 LYS A O   1 
ATOM   863  C  CB  . LYS A 1 129 ? -54.765 22.425 29.481 1.00 95.30  ? 237 LYS A CB  1 
ATOM   864  N  N   . LEU A 1 130 ? -53.071 25.544 30.316 1.00 88.66  ? 238 LEU A N   1 
ATOM   865  C  CA  . LEU A 1 130 ? -52.455 26.374 31.352 1.00 87.25  ? 238 LEU A CA  1 
ATOM   866  C  C   . LEU A 1 130 ? -53.514 27.167 32.077 1.00 95.63  ? 238 LEU A C   1 
ATOM   867  O  O   . LEU A 1 130 ? -54.658 27.220 31.613 1.00 98.40  ? 238 LEU A O   1 
ATOM   868  C  CB  . LEU A 1 130 ? -51.466 27.367 30.707 1.00 83.19  ? 238 LEU A CB  1 
ATOM   869  C  CG  . LEU A 1 130 ? -50.314 26.817 29.877 1.00 83.63  ? 238 LEU A CG  1 
ATOM   870  C  CD1 . LEU A 1 130 ? -49.697 27.910 29.108 1.00 80.39  ? 238 LEU A CD1 1 
ATOM   871  C  CD2 . LEU A 1 130 ? -49.258 26.138 30.750 1.00 83.30  ? 238 LEU A CD2 1 
ATOM   872  N  N   . MET A 1 131 ? -53.147 27.793 33.210 1.00 91.87  ? 239 MET A N   1 
ATOM   873  C  CA  . MET A 1 131 ? -54.092 28.638 33.919 1.00 93.37  ? 239 MET A CA  1 
ATOM   874  C  C   . MET A 1 131 ? -53.632 30.102 33.955 1.00 95.34  ? 239 MET A C   1 
ATOM   875  O  O   . MET A 1 131 ? -52.428 30.350 33.797 1.00 91.24  ? 239 MET A O   1 
ATOM   876  C  CB  . MET A 1 131 ? -54.590 28.031 35.249 1.00 99.14  ? 239 MET A CB  1 
ATOM   877  C  CG  . MET A 1 131 ? -53.651 28.091 36.415 1.00 103.75 ? 239 MET A CG  1 
ATOM   878  S  SD  . MET A 1 131 ? -54.343 26.959 37.652 1.00 113.27 ? 239 MET A SD  1 
ATOM   879  C  CE  . MET A 1 131 ? -53.922 27.783 39.191 1.00 111.20 ? 239 MET A CE  1 
ATOM   880  N  N   . PRO A 1 132 ? -54.555 31.100 34.034 1.00 92.82  ? 240 PRO A N   1 
ATOM   881  C  CA  . PRO A 1 132 ? -54.102 32.506 34.022 1.00 90.76  ? 240 PRO A CA  1 
ATOM   882  C  C   . PRO A 1 132 ? -52.993 32.747 35.029 1.00 93.95  ? 240 PRO A C   1 
ATOM   883  O  O   . PRO A 1 132 ? -53.123 32.352 36.192 1.00 96.93  ? 240 PRO A O   1 
ATOM   884  C  CB  . PRO A 1 132 ? -55.367 33.305 34.354 1.00 94.38  ? 240 PRO A CB  1 
ATOM   885  C  CG  . PRO A 1 132 ? -56.355 32.305 34.814 1.00 101.61 ? 240 PRO A CG  1 
ATOM   886  C  CD  . PRO A 1 132 ? -56.021 31.019 34.162 1.00 96.28  ? 240 PRO A CD  1 
ATOM   887  N  N   . GLY A 1 133 ? -51.893 33.316 34.553 1.00 85.72  ? 241 GLY A N   1 
ATOM   888  C  CA  . GLY A 1 133 ? -50.726 33.589 35.378 1.00 84.42  ? 241 GLY A CA  1 
ATOM   889  C  C   . GLY A 1 133 ? -49.561 32.660 35.099 1.00 86.73  ? 241 GLY A C   1 
ATOM   890  O  O   . GLY A 1 133 ? -48.461 32.915 35.591 1.00 86.65  ? 241 GLY A O   1 
ATOM   891  N  N   . SER A 1 134 ? -49.781 31.575 34.302 1.00 82.17  ? 242 SER A N   1 
ATOM   892  C  CA  . SER A 1 134 ? -48.758 30.589 33.906 1.00 79.36  ? 242 SER A CA  1 
ATOM   893  C  C   . SER A 1 134 ? -47.799 31.231 32.962 1.00 82.40  ? 242 SER A C   1 
ATOM   894  O  O   . SER A 1 134 ? -48.140 32.247 32.349 1.00 82.12  ? 242 SER A O   1 
ATOM   895  C  CB  . SER A 1 134 ? -49.372 29.420 33.133 1.00 79.44  ? 242 SER A CB  1 
ATOM   896  O  OG  . SER A 1 134 ? -50.465 28.806 33.787 1.00 87.92  ? 242 SER A OG  1 
ATOM   897  N  N   . THR A 1 135 ? -46.614 30.604 32.788 1.00 77.44  ? 243 THR A N   1 
ATOM   898  C  CA  . THR A 1 135 ? -45.657 31.001 31.767 1.00 73.72  ? 243 THR A CA  1 
ATOM   899  C  C   . THR A 1 135 ? -45.916 30.020 30.635 1.00 78.40  ? 243 THR A C   1 
ATOM   900  O  O   . THR A 1 135 ? -46.000 28.798 30.876 1.00 79.23  ? 243 THR A O   1 
ATOM   901  C  CB  . THR A 1 135 ? -44.235 30.971 32.308 1.00 73.29  ? 243 THR A CB  1 
ATOM   902  O  OG1 . THR A 1 135 ? -44.102 32.044 33.224 1.00 77.02  ? 243 THR A OG1 1 
ATOM   903  C  CG2 . THR A 1 135 ? -43.160 31.066 31.217 1.00 63.19  ? 243 THR A CG2 1 
ATOM   904  N  N   . LEU A 1 136 ? -46.139 30.560 29.428 1.00 74.04  ? 244 LEU A N   1 
ATOM   905  C  CA  . LEU A 1 136 ? -46.362 29.773 28.227 1.00 73.60  ? 244 LEU A CA  1 
ATOM   906  C  C   . LEU A 1 136 ? -45.055 29.798 27.481 1.00 77.11  ? 244 LEU A C   1 
ATOM   907  O  O   . LEU A 1 136 ? -44.542 30.880 27.167 1.00 76.16  ? 244 LEU A O   1 
ATOM   908  C  CB  . LEU A 1 136 ? -47.470 30.413 27.382 1.00 73.94  ? 244 LEU A CB  1 
ATOM   909  C  CG  . LEU A 1 136 ? -47.563 29.995 25.918 1.00 78.02  ? 244 LEU A CG  1 
ATOM   910  C  CD1 . LEU A 1 136 ? -48.133 28.619 25.787 1.00 79.61  ? 244 LEU A CD1 1 
ATOM   911  C  CD2 . LEU A 1 136 ? -48.399 30.988 25.124 1.00 80.47  ? 244 LEU A CD2 1 
ATOM   912  N  N   . VAL A 1 137 ? -44.488 28.614 27.226 1.00 72.99  ? 245 VAL A N   1 
ATOM   913  C  CA  . VAL A 1 137 ? -43.224 28.494 26.476 1.00 69.23  ? 245 VAL A CA  1 
ATOM   914  C  C   . VAL A 1 137 ? -43.498 27.640 25.245 1.00 75.39  ? 245 VAL A C   1 
ATOM   915  O  O   . VAL A 1 137 ? -43.965 26.489 25.360 1.00 76.72  ? 245 VAL A O   1 
ATOM   916  C  CB  . VAL A 1 137 ? -42.065 27.923 27.338 1.00 70.93  ? 245 VAL A CB  1 
ATOM   917  C  CG1 . VAL A 1 137 ? -40.893 27.474 26.490 1.00 68.30  ? 245 VAL A CG1 1 
ATOM   918  C  CG2 . VAL A 1 137 ? -41.618 28.910 28.401 1.00 70.62  ? 245 VAL A CG2 1 
ATOM   919  N  N   . LEU A 1 138 ? -43.230 28.231 24.063 1.00 72.12  ? 246 LEU A N   1 
ATOM   920  C  CA  . LEU A 1 138 ? -43.376 27.590 22.750 1.00 71.92  ? 246 LEU A CA  1 
ATOM   921  C  C   . LEU A 1 138 ? -42.029 27.583 22.048 1.00 74.80  ? 246 LEU A C   1 
ATOM   922  O  O   . LEU A 1 138 ? -41.355 28.614 21.967 1.00 72.54  ? 246 LEU A O   1 
ATOM   923  C  CB  . LEU A 1 138 ? -44.466 28.259 21.905 1.00 72.04  ? 246 LEU A CB  1 
ATOM   924  C  CG  . LEU A 1 138 ? -45.937 28.015 22.337 1.00 77.73  ? 246 LEU A CG  1 
ATOM   925  C  CD1 . LEU A 1 138 ? -46.884 28.765 21.434 1.00 77.92  ? 246 LEU A CD1 1 
ATOM   926  C  CD2 . LEU A 1 138 ? -46.312 26.530 22.291 1.00 81.36  ? 246 LEU A CD2 1 
ATOM   927  N  N   . GLN A 1 139 ? -41.604 26.399 21.613 1.00 73.11  ? 247 GLN A N   1 
ATOM   928  C  CA  . GLN A 1 139 ? -40.301 26.201 20.990 1.00 71.52  ? 247 GLN A CA  1 
ATOM   929  C  C   . GLN A 1 139 ? -40.377 25.585 19.633 1.00 76.46  ? 247 GLN A C   1 
ATOM   930  O  O   . GLN A 1 139 ? -41.163 24.672 19.398 1.00 78.48  ? 247 GLN A O   1 
ATOM   931  C  CB  . GLN A 1 139 ? -39.392 25.355 21.886 1.00 73.02  ? 247 GLN A CB  1 
ATOM   932  C  CG  . GLN A 1 139 ? -38.189 26.136 22.382 1.00 95.87  ? 247 GLN A CG  1 
ATOM   933  C  CD  . GLN A 1 139 ? -37.431 25.347 23.405 1.00 122.33 ? 247 GLN A CD  1 
ATOM   934  O  OE1 . GLN A 1 139 ? -36.924 24.253 23.127 1.00 121.21 ? 247 GLN A OE1 1 
ATOM   935  N  NE2 . GLN A 1 139 ? -37.351 25.884 24.623 1.00 113.69 ? 247 GLN A NE2 1 
ATOM   936  N  N   . CYS A 1 140 ? -39.550 26.093 18.734 1.00 73.66  ? 248 CYS A N   1 
ATOM   937  C  CA  . CYS A 1 140 ? -39.418 25.588 17.382 1.00 75.89  ? 248 CYS A CA  1 
ATOM   938  C  C   . CYS A 1 140 ? -37.995 25.718 16.968 1.00 79.52  ? 248 CYS A C   1 
ATOM   939  O  O   . CYS A 1 140 ? -37.505 26.830 16.783 1.00 77.64  ? 248 CYS A O   1 
ATOM   940  C  CB  . CYS A 1 140 ? -40.342 26.293 16.405 1.00 77.25  ? 248 CYS A CB  1 
ATOM   941  S  SG  . CYS A 1 140 ? -40.402 25.493 14.793 1.00 83.66  ? 248 CYS A SG  1 
ATOM   942  N  N   . VAL A 1 141 ? -37.306 24.581 16.865 1.00 76.52  ? 249 VAL A N   1 
ATOM   943  C  CA  . VAL A 1 141 ? -35.894 24.581 16.517 1.00 73.90  ? 249 VAL A CA  1 
ATOM   944  C  C   . VAL A 1 141 ? -35.677 23.897 15.179 1.00 74.71  ? 249 VAL A C   1 
ATOM   945  O  O   . VAL A 1 141 ? -36.032 22.731 15.004 1.00 74.59  ? 249 VAL A O   1 
ATOM   946  C  CB  . VAL A 1 141 ? -35.037 23.973 17.660 1.00 77.45  ? 249 VAL A CB  1 
ATOM   947  C  CG1 . VAL A 1 141 ? -33.542 23.990 17.327 1.00 76.15  ? 249 VAL A CG1 1 
ATOM   948  C  CG2 . VAL A 1 141 ? -35.317 24.676 18.987 1.00 76.00  ? 249 VAL A CG2 1 
ATOM   949  N  N   . ALA A 1 142 ? -35.087 24.637 14.239 1.00 69.25  ? 250 ALA A N   1 
ATOM   950  C  CA  . ALA A 1 142 ? -34.750 24.100 12.930 1.00 70.36  ? 250 ALA A CA  1 
ATOM   951  C  C   . ALA A 1 142 ? -33.261 24.238 12.608 1.00 72.69  ? 250 ALA A C   1 
ATOM   952  O  O   . ALA A 1 142 ? -32.563 25.094 13.165 1.00 71.16  ? 250 ALA A O   1 
ATOM   953  C  CB  . ALA A 1 142 ? -35.576 24.773 11.860 1.00 71.62  ? 250 ALA A CB  1 
ATOM   954  N  N   . VAL A 1 143 ? -32.793 23.407 11.684 1.00 69.71  ? 251 VAL A N   1 
ATOM   955  C  CA  . VAL A 1 143 ? -31.434 23.433 11.156 1.00 68.31  ? 251 VAL A CA  1 
ATOM   956  C  C   . VAL A 1 143 ? -31.547 23.601 9.652  1.00 76.66  ? 251 VAL A C   1 
ATOM   957  O  O   . VAL A 1 143 ? -32.570 23.231 9.062  1.00 76.47  ? 251 VAL A O   1 
ATOM   958  C  CB  . VAL A 1 143 ? -30.565 22.210 11.547 1.00 71.61  ? 251 VAL A CB  1 
ATOM   959  C  CG1 . VAL A 1 143 ? -30.292 22.190 13.038 1.00 70.32  ? 251 VAL A CG1 1 
ATOM   960  C  CG2 . VAL A 1 143 ? -31.181 20.895 11.093 1.00 74.25  ? 251 VAL A CG2 1 
ATOM   961  N  N   . GLY A 1 144 ? -30.498 24.157 9.052  1.00 75.85  ? 252 GLY A N   1 
ATOM   962  C  CA  . GLY A 1 144 ? -30.432 24.366 7.612  1.00 76.81  ? 252 GLY A CA  1 
ATOM   963  C  C   . GLY A 1 144 ? -29.468 25.440 7.159  1.00 79.37  ? 252 GLY A C   1 
ATOM   964  O  O   . GLY A 1 144 ? -28.998 26.276 7.949  1.00 76.41  ? 252 GLY A O   1 
ATOM   965  N  N   . SER A 1 145 ? -29.186 25.400 5.854  1.00 77.40  ? 253 SER A N   1 
ATOM   966  C  CA  . SER A 1 145 ? -28.319 26.322 5.153  1.00 76.17  ? 253 SER A CA  1 
ATOM   967  C  C   . SER A 1 145 ? -29.008 26.719 3.849  1.00 82.28  ? 253 SER A C   1 
ATOM   968  O  O   . SER A 1 145 ? -29.380 25.849 3.060  1.00 84.34  ? 253 SER A O   1 
ATOM   969  C  CB  . SER A 1 145 ? -26.937 25.731 4.923  1.00 79.02  ? 253 SER A CB  1 
ATOM   970  O  OG  . SER A 1 145 ? -26.009 26.794 4.798  1.00 85.15  ? 253 SER A OG  1 
ATOM   971  N  N   . PRO A 1 146 ? -29.302 28.019 3.648  1.00 79.13  ? 254 PRO A N   1 
ATOM   972  C  CA  . PRO A 1 146 ? -28.958 29.174 4.508  1.00 76.33  ? 254 PRO A CA  1 
ATOM   973  C  C   . PRO A 1 146 ? -29.670 29.121 5.846  1.00 75.12  ? 254 PRO A C   1 
ATOM   974  O  O   . PRO A 1 146 ? -30.643 28.382 5.971  1.00 76.77  ? 254 PRO A O   1 
ATOM   975  C  CB  . PRO A 1 146 ? -29.388 30.387 3.665  1.00 79.65  ? 254 PRO A CB  1 
ATOM   976  C  CG  . PRO A 1 146 ? -29.537 29.867 2.255  1.00 86.97  ? 254 PRO A CG  1 
ATOM   977  C  CD  . PRO A 1 146 ? -30.005 28.456 2.430  1.00 83.27  ? 254 PRO A CD  1 
ATOM   978  N  N   . ILE A 1 147 ? -29.173 29.866 6.847  1.00 67.24  ? 255 ILE A N   1 
ATOM   979  C  CA  . ILE A 1 147 ? -29.752 29.891 8.194  1.00 64.85  ? 255 ILE A CA  1 
ATOM   980  C  C   . ILE A 1 147 ? -31.314 30.036 8.155  1.00 71.86  ? 255 ILE A C   1 
ATOM   981  O  O   . ILE A 1 147 ? -31.833 30.816 7.334  1.00 72.41  ? 255 ILE A O   1 
ATOM   982  C  CB  . ILE A 1 147 ? -29.046 30.936 9.106  1.00 64.41  ? 255 ILE A CB  1 
ATOM   983  C  CG1 . ILE A 1 147 ? -29.163 30.565 10.587 1.00 63.08  ? 255 ILE A CG1 1 
ATOM   984  C  CG2 . ILE A 1 147 ? -29.515 32.371 8.844  1.00 63.64  ? 255 ILE A CG2 1 
ATOM   985  C  CD1 . ILE A 1 147 ? -28.344 31.434 11.516 1.00 69.91  ? 255 ILE A CD1 1 
ATOM   986  N  N   . PRO A 1 148 ? -32.066 29.226 8.952  1.00 69.08  ? 256 PRO A N   1 
ATOM   987  C  CA  . PRO A 1 148 ? -33.523 29.346 8.945  1.00 69.47  ? 256 PRO A CA  1 
ATOM   988  C  C   . PRO A 1 148 ? -33.949 30.597 9.693  1.00 70.44  ? 256 PRO A C   1 
ATOM   989  O  O   . PRO A 1 148 ? -33.228 31.079 10.578 1.00 67.07  ? 256 PRO A O   1 
ATOM   990  C  CB  . PRO A 1 148 ? -33.982 28.098 9.723  1.00 71.51  ? 256 PRO A CB  1 
ATOM   991  C  CG  . PRO A 1 148 ? -32.769 27.218 9.840  1.00 75.98  ? 256 PRO A CG  1 
ATOM   992  C  CD  . PRO A 1 148 ? -31.654 28.200 9.928  1.00 70.10  ? 256 PRO A CD  1 
ATOM   993  N  N   . HIS A 1 149 ? -35.126 31.114 9.323  1.00 67.37  ? 257 HIS A N   1 
ATOM   994  C  CA  . HIS A 1 149 ? -35.776 32.248 9.967  1.00 66.41  ? 257 HIS A CA  1 
ATOM   995  C  C   . HIS A 1 149 ? -37.105 31.751 10.515 1.00 70.95  ? 257 HIS A C   1 
ATOM   996  O  O   . HIS A 1 149 ? -37.704 30.824 9.961  1.00 74.60  ? 257 HIS A O   1 
ATOM   997  C  CB  . HIS A 1 149 ? -35.984 33.397 8.989  1.00 68.67  ? 257 HIS A CB  1 
ATOM   998  C  CG  . HIS A 1 149 ? -34.720 34.102 8.649  1.00 71.14  ? 257 HIS A CG  1 
ATOM   999  N  ND1 . HIS A 1 149 ? -33.891 33.643 7.645  1.00 73.86  ? 257 HIS A ND1 1 
ATOM   1000 C  CD2 . HIS A 1 149 ? -34.180 35.213 9.191  1.00 71.63  ? 257 HIS A CD2 1 
ATOM   1001 C  CE1 . HIS A 1 149 ? -32.851 34.463 7.622  1.00 72.21  ? 257 HIS A CE1 1 
ATOM   1002 N  NE2 . HIS A 1 149 ? -32.980 35.429 8.528  1.00 71.58  ? 257 HIS A NE2 1 
ATOM   1003 N  N   . TYR A 1 150 ? -37.542 32.342 11.615 1.00 63.83  ? 258 TYR A N   1 
ATOM   1004 C  CA  . TYR A 1 150 ? -38.771 31.981 12.299 1.00 63.31  ? 258 TYR A CA  1 
ATOM   1005 C  C   . TYR A 1 150 ? -39.770 33.128 12.285 1.00 66.83  ? 258 TYR A C   1 
ATOM   1006 O  O   . TYR A 1 150 ? -39.378 34.300 12.241 1.00 63.39  ? 258 TYR A O   1 
ATOM   1007 C  CB  . TYR A 1 150 ? -38.462 31.613 13.764 1.00 63.24  ? 258 TYR A CB  1 
ATOM   1008 C  CG  . TYR A 1 150 ? -37.420 30.530 13.900 1.00 64.63  ? 258 TYR A CG  1 
ATOM   1009 C  CD1 . TYR A 1 150 ? -37.786 29.190 13.957 1.00 68.30  ? 258 TYR A CD1 1 
ATOM   1010 C  CD2 . TYR A 1 150 ? -36.056 30.838 13.918 1.00 63.02  ? 258 TYR A CD2 1 
ATOM   1011 C  CE1 . TYR A 1 150 ? -36.824 28.180 14.027 1.00 70.08  ? 258 TYR A CE1 1 
ATOM   1012 C  CE2 . TYR A 1 150 ? -35.090 29.838 14.001 1.00 62.71  ? 258 TYR A CE2 1 
ATOM   1013 C  CZ  . TYR A 1 150 ? -35.482 28.511 14.074 1.00 71.56  ? 258 TYR A CZ  1 
ATOM   1014 O  OH  . TYR A 1 150 ? -34.556 27.511 14.176 1.00 76.33  ? 258 TYR A OH  1 
ATOM   1015 N  N   . GLN A 1 151 ? -41.073 32.772 12.322 1.00 66.00  ? 259 GLN A N   1 
ATOM   1016 C  CA  . GLN A 1 151 ? -42.191 33.689 12.447 1.00 67.16  ? 259 GLN A CA  1 
ATOM   1017 C  C   . GLN A 1 151 ? -43.350 32.902 13.052 1.00 75.38  ? 259 GLN A C   1 
ATOM   1018 O  O   . GLN A 1 151 ? -43.873 31.966 12.430 1.00 78.39  ? 259 GLN A O   1 
ATOM   1019 C  CB  . GLN A 1 151 ? -42.556 34.387 11.114 1.00 70.47  ? 259 GLN A CB  1 
ATOM   1020 C  CG  . GLN A 1 151 ? -43.798 35.316 11.185 1.00 84.70  ? 259 GLN A CG  1 
ATOM   1021 C  CD  . GLN A 1 151 ? -43.733 36.428 12.224 1.00 95.81  ? 259 GLN A CD  1 
ATOM   1022 O  OE1 . GLN A 1 151 ? -43.091 37.478 12.047 1.00 78.95  ? 259 GLN A OE1 1 
ATOM   1023 N  NE2 . GLN A 1 151 ? -44.461 36.243 13.314 1.00 95.13  ? 259 GLN A NE2 1 
ATOM   1024 N  N   . TRP A 1 152 ? -43.726 33.267 14.285 1.00 71.44  ? 260 TRP A N   1 
ATOM   1025 C  CA  . TRP A 1 152 ? -44.826 32.612 15.002 1.00 72.01  ? 260 TRP A CA  1 
ATOM   1026 C  C   . TRP A 1 152 ? -46.142 33.172 14.574 1.00 78.73  ? 260 TRP A C   1 
ATOM   1027 O  O   . TRP A 1 152 ? -46.246 34.376 14.335 1.00 77.86  ? 260 TRP A O   1 
ATOM   1028 C  CB  . TRP A 1 152 ? -44.668 32.774 16.515 1.00 68.67  ? 260 TRP A CB  1 
ATOM   1029 C  CG  . TRP A 1 152 ? -43.549 31.942 17.047 1.00 67.34  ? 260 TRP A CG  1 
ATOM   1030 C  CD1 . TRP A 1 152 ? -42.221 32.254 17.045 1.00 67.93  ? 260 TRP A CD1 1 
ATOM   1031 C  CD2 . TRP A 1 152 ? -43.643 30.581 17.487 1.00 67.36  ? 260 TRP A CD2 1 
ATOM   1032 N  NE1 . TRP A 1 152 ? -41.485 31.183 17.494 1.00 66.35  ? 260 TRP A NE1 1 
ATOM   1033 C  CE2 . TRP A 1 152 ? -42.335 30.152 17.801 1.00 69.42  ? 260 TRP A CE2 1 
ATOM   1034 C  CE3 . TRP A 1 152 ? -44.703 29.664 17.603 1.00 69.59  ? 260 TRP A CE3 1 
ATOM   1035 C  CZ2 . TRP A 1 152 ? -42.068 28.859 18.266 1.00 68.88  ? 260 TRP A CZ2 1 
ATOM   1036 C  CZ3 . TRP A 1 152 ? -44.439 28.393 18.091 1.00 70.46  ? 260 TRP A CZ3 1 
ATOM   1037 C  CH2 . TRP A 1 152 ? -43.141 28.002 18.418 1.00 69.55  ? 260 TRP A CH2 1 
ATOM   1038 N  N   . PHE A 1 153 ? -47.151 32.290 14.476 1.00 78.52  ? 261 PHE A N   1 
ATOM   1039 C  CA  . PHE A 1 153 ? -48.531 32.628 14.142 1.00 81.01  ? 261 PHE A CA  1 
ATOM   1040 C  C   . PHE A 1 153 ? -49.474 32.089 15.195 1.00 84.93  ? 261 PHE A C   1 
ATOM   1041 O  O   . PHE A 1 153 ? -49.204 31.061 15.820 1.00 81.86  ? 261 PHE A O   1 
ATOM   1042 C  CB  . PHE A 1 153 ? -48.942 32.037 12.796 1.00 85.73  ? 261 PHE A CB  1 
ATOM   1043 C  CG  . PHE A 1 153 ? -48.306 32.612 11.558 1.00 87.61  ? 261 PHE A CG  1 
ATOM   1044 C  CD1 . PHE A 1 153 ? -49.081 33.231 10.587 1.00 93.25  ? 261 PHE A CD1 1 
ATOM   1045 C  CD2 . PHE A 1 153 ? -46.950 32.439 11.308 1.00 87.76  ? 261 PHE A CD2 1 
ATOM   1046 C  CE1 . PHE A 1 153 ? -48.501 33.729 9.423  1.00 94.40  ? 261 PHE A CE1 1 
ATOM   1047 C  CE2 . PHE A 1 153 ? -46.373 32.942 10.145 1.00 91.02  ? 261 PHE A CE2 1 
ATOM   1048 C  CZ  . PHE A 1 153 ? -47.155 33.578 9.205  1.00 91.01  ? 261 PHE A CZ  1 
ATOM   1049 N  N   . LYS A 1 154 ? -50.603 32.785 15.351 1.00 85.68  ? 262 LYS A N   1 
ATOM   1050 C  CA  . LYS A 1 154 ? -51.735 32.462 16.219 1.00 87.86  ? 262 LYS A CA  1 
ATOM   1051 C  C   . LYS A 1 154 ? -53.004 32.727 15.397 1.00 97.13  ? 262 LYS A C   1 
ATOM   1052 O  O   . LYS A 1 154 ? -53.174 33.835 14.874 1.00 97.66  ? 262 LYS A O   1 
ATOM   1053 C  CB  . LYS A 1 154 ? -51.693 33.308 17.510 1.00 89.22  ? 262 LYS A CB  1 
ATOM   1054 C  CG  . LYS A 1 154 ? -53.053 33.648 18.109 1.00 93.99  ? 262 LYS A CG  1 
ATOM   1055 C  CD  . LYS A 1 154 ? -53.222 33.053 19.472 1.00 95.77  ? 262 LYS A CD  1 
ATOM   1056 C  CE  . LYS A 1 154 ? -53.722 34.071 20.456 1.00 97.59  ? 262 LYS A CE  1 
ATOM   1057 N  NZ  . LYS A 1 154 ? -55.157 34.370 20.242 1.00 110.51 ? 262 LYS A NZ  1 
ATOM   1058 N  N   . ASN A 1 155 ? -53.866 31.706 15.245 1.00 97.31  ? 263 ASN A N   1 
ATOM   1059 C  CA  . ASN A 1 155 ? -55.131 31.813 14.511 1.00 101.67 ? 263 ASN A CA  1 
ATOM   1060 C  C   . ASN A 1 155 ? -54.998 32.549 13.154 1.00 110.98 ? 263 ASN A C   1 
ATOM   1061 O  O   . ASN A 1 155 ? -55.633 33.586 12.938 1.00 113.53 ? 263 ASN A O   1 
ATOM   1062 C  CB  . ASN A 1 155 ? -56.241 32.454 15.379 1.00 99.13  ? 263 ASN A CB  1 
ATOM   1063 C  CG  . ASN A 1 155 ? -56.352 31.950 16.796 1.00 106.51 ? 263 ASN A CG  1 
ATOM   1064 O  OD1 . ASN A 1 155 ? -56.504 30.755 17.065 1.00 93.49  ? 263 ASN A OD1 1 
ATOM   1065 N  ND2 . ASN A 1 155 ? -56.360 32.877 17.732 1.00 100.43 ? 263 ASN A ND2 1 
ATOM   1066 N  N   . GLU A 1 156 ? -54.138 32.022 12.263 1.00 107.98 ? 264 GLU A N   1 
ATOM   1067 C  CA  . GLU A 1 156 ? -53.879 32.507 10.894 1.00 109.48 ? 264 GLU A CA  1 
ATOM   1068 C  C   . GLU A 1 156 ? -53.157 33.860 10.738 1.00 109.90 ? 264 GLU A C   1 
ATOM   1069 O  O   . GLU A 1 156 ? -52.804 34.227 9.620  1.00 111.35 ? 264 GLU A O   1 
ATOM   1070 C  CB  . GLU A 1 156 ? -55.124 32.388 9.979  1.00 116.01 ? 264 GLU A CB  1 
ATOM   1071 C  CG  . GLU A 1 156 ? -55.829 31.030 9.973  1.00 136.02 ? 264 GLU A CG  1 
ATOM   1072 C  CD  . GLU A 1 156 ? -54.990 29.774 9.781  1.00 170.47 ? 264 GLU A CD  1 
ATOM   1073 O  OE1 . GLU A 1 156 ? -54.115 29.755 8.882  1.00 165.38 ? 264 GLU A OE1 1 
ATOM   1074 O  OE2 . GLU A 1 156 ? -55.203 28.806 10.549 1.00 169.96 ? 264 GLU A OE2 1 
ATOM   1075 N  N   . LEU A 1 157 ? -52.907 34.572 11.841 1.00 101.32 ? 265 LEU A N   1 
ATOM   1076 C  CA  . LEU A 1 157 ? -52.242 35.869 11.813 1.00 98.82  ? 265 LEU A CA  1 
ATOM   1077 C  C   . LEU A 1 157 ? -50.825 35.793 12.366 1.00 99.16  ? 265 LEU A C   1 
ATOM   1078 O  O   . LEU A 1 157 ? -50.584 35.087 13.346 1.00 96.58  ? 265 LEU A O   1 
ATOM   1079 C  CB  . LEU A 1 157 ? -53.033 36.883 12.633 1.00 99.21  ? 265 LEU A CB  1 
ATOM   1080 C  CG  . LEU A 1 157 ? -54.390 37.276 12.103 1.00 106.44 ? 265 LEU A CG  1 
ATOM   1081 C  CD1 . LEU A 1 157 ? -55.303 37.653 13.240 1.00 105.99 ? 265 LEU A CD1 1 
ATOM   1082 C  CD2 . LEU A 1 157 ? -54.267 38.409 11.111 1.00 110.76 ? 265 LEU A CD2 1 
ATOM   1083 N  N   . PRO A 1 158 ? -49.863 36.537 11.790 1.00 94.41  ? 266 PRO A N   1 
ATOM   1084 C  CA  . PRO A 1 158 ? -48.506 36.477 12.323 1.00 90.87  ? 266 PRO A CA  1 
ATOM   1085 C  C   . PRO A 1 158 ? -48.424 37.287 13.601 1.00 94.86  ? 266 PRO A C   1 
ATOM   1086 O  O   . PRO A 1 158 ? -49.107 38.314 13.720 1.00 96.54  ? 266 PRO A O   1 
ATOM   1087 C  CB  . PRO A 1 158 ? -47.652 37.086 11.208 1.00 92.76  ? 266 PRO A CB  1 
ATOM   1088 C  CG  . PRO A 1 158 ? -48.594 37.336 10.053 1.00 100.65 ? 266 PRO A CG  1 
ATOM   1089 C  CD  . PRO A 1 158 ? -49.939 37.452 10.641 1.00 98.00  ? 266 PRO A CD  1 
ATOM   1090 N  N   . LEU A 1 159 ? -47.628 36.793 14.574 1.00 88.67  ? 267 LEU A N   1 
ATOM   1091 C  CA  . LEU A 1 159 ? -47.439 37.460 15.855 1.00 87.06  ? 267 LEU A CA  1 
ATOM   1092 C  C   . LEU A 1 159 ? -46.362 38.475 15.658 1.00 89.65  ? 267 LEU A C   1 
ATOM   1093 O  O   . LEU A 1 159 ? -45.195 38.120 15.481 1.00 88.19  ? 267 LEU A O   1 
ATOM   1094 C  CB  . LEU A 1 159 ? -47.128 36.479 16.998 1.00 85.27  ? 267 LEU A CB  1 
ATOM   1095 C  CG  . LEU A 1 159 ? -48.292 35.589 17.454 1.00 91.91  ? 267 LEU A CG  1 
ATOM   1096 C  CD1 . LEU A 1 159 ? -47.795 34.466 18.330 1.00 90.97  ? 267 LEU A CD1 1 
ATOM   1097 C  CD2 . LEU A 1 159 ? -49.382 36.392 18.161 1.00 94.40  ? 267 LEU A CD2 1 
ATOM   1098 N  N   . THR A 1 160 ? -46.782 39.737 15.553 1.00 87.74  ? 268 THR A N   1 
ATOM   1099 C  CA  . THR A 1 160 ? -45.912 40.875 15.289 1.00 87.80  ? 268 THR A CA  1 
ATOM   1100 C  C   . THR A 1 160 ? -44.624 40.818 16.075 1.00 89.40  ? 268 THR A C   1 
ATOM   1101 O  O   . THR A 1 160 ? -44.675 40.727 17.294 1.00 89.20  ? 268 THR A O   1 
ATOM   1102 C  CB  . THR A 1 160 ? -46.668 42.229 15.243 1.00 100.50 ? 268 THR A CB  1 
ATOM   1103 O  OG1 . THR A 1 160 ? -45.924 43.230 15.944 1.00 98.82  ? 268 THR A OG1 1 
ATOM   1104 C  CG2 . THR A 1 160 ? -48.118 42.146 15.766 1.00 102.55 ? 268 THR A CG2 1 
ATOM   1105 N  N   . HIS A 1 161 ? -43.477 40.759 15.370 1.00 84.67  ? 269 HIS A N   1 
ATOM   1106 C  CA  . HIS A 1 161 ? -42.140 40.712 15.975 1.00 82.17  ? 269 HIS A CA  1 
ATOM   1107 C  C   . HIS A 1 161 ? -41.752 39.408 16.696 1.00 84.64  ? 269 HIS A C   1 
ATOM   1108 O  O   . HIS A 1 161 ? -40.773 39.404 17.426 1.00 84.75  ? 269 HIS A O   1 
ATOM   1109 C  CB  . HIS A 1 161 ? -41.863 41.960 16.849 1.00 82.85  ? 269 HIS A CB  1 
ATOM   1110 C  CG  . HIS A 1 161 ? -42.070 43.254 16.131 1.00 88.46  ? 269 HIS A CG  1 
ATOM   1111 N  ND1 . HIS A 1 161 ? -41.487 43.499 14.901 1.00 90.81  ? 269 HIS A ND1 1 
ATOM   1112 C  CD2 . HIS A 1 161 ? -42.791 44.337 16.496 1.00 93.09  ? 269 HIS A CD2 1 
ATOM   1113 C  CE1 . HIS A 1 161 ? -41.876 44.713 14.549 1.00 93.20  ? 269 HIS A CE1 1 
ATOM   1114 N  NE2 . HIS A 1 161 ? -42.667 45.258 15.474 1.00 94.96  ? 269 HIS A NE2 1 
ATOM   1115 N  N   . GLU A 1 162 ? -42.464 38.302 16.473 1.00 80.29  ? 270 GLU A N   1 
ATOM   1116 C  CA  . GLU A 1 162 ? -42.109 37.021 17.100 1.00 77.77  ? 270 GLU A CA  1 
ATOM   1117 C  C   . GLU A 1 162 ? -41.316 36.207 16.087 1.00 79.57  ? 270 GLU A C   1 
ATOM   1118 O  O   . GLU A 1 162 ? -41.893 35.362 15.390 1.00 81.40  ? 270 GLU A O   1 
ATOM   1119 C  CB  . GLU A 1 162 ? -43.363 36.250 17.578 1.00 79.71  ? 270 GLU A CB  1 
ATOM   1120 C  CG  . GLU A 1 162 ? -44.068 36.885 18.760 1.00 84.53  ? 270 GLU A CG  1 
ATOM   1121 C  CD  . GLU A 1 162 ? -43.273 37.140 20.024 1.00 100.39 ? 270 GLU A CD  1 
ATOM   1122 O  OE1 . GLU A 1 162 ? -42.362 36.345 20.355 1.00 104.07 ? 270 GLU A OE1 1 
ATOM   1123 O  OE2 . GLU A 1 162 ? -43.613 38.125 20.716 1.00 89.71  ? 270 GLU A OE2 1 
ATOM   1124 N  N   . THR A 1 163 ? -39.995 36.468 16.015 1.00 71.83  ? 271 THR A N   1 
ATOM   1125 C  CA  . THR A 1 163 ? -39.059 35.900 15.047 1.00 69.92  ? 271 THR A CA  1 
ATOM   1126 C  C   . THR A 1 163 ? -37.878 35.085 15.620 1.00 73.59  ? 271 THR A C   1 
ATOM   1127 O  O   . THR A 1 163 ? -36.796 35.036 15.013 1.00 73.46  ? 271 THR A O   1 
ATOM   1128 C  CB  . THR A 1 163 ? -38.586 37.020 14.108 1.00 69.19  ? 271 THR A CB  1 
ATOM   1129 O  OG1 . THR A 1 163 ? -38.137 38.125 14.896 1.00 68.28  ? 271 THR A OG1 1 
ATOM   1130 C  CG2 . THR A 1 163 ? -39.673 37.469 13.119 1.00 63.96  ? 271 THR A CG2 1 
ATOM   1131 N  N   . LYS A 1 164 ? -38.091 34.413 16.752 1.00 68.98  ? 272 LYS A N   1 
ATOM   1132 C  CA  . LYS A 1 164 ? -37.074 33.571 17.392 1.00 66.83  ? 272 LYS A CA  1 
ATOM   1133 C  C   . LYS A 1 164 ? -37.603 32.132 17.554 1.00 71.89  ? 272 LYS A C   1 
ATOM   1134 O  O   . LYS A 1 164 ? -38.798 31.894 17.397 1.00 71.77  ? 272 LYS A O   1 
ATOM   1135 C  CB  . LYS A 1 164 ? -36.695 34.131 18.778 1.00 67.01  ? 272 LYS A CB  1 
ATOM   1136 C  CG  . LYS A 1 164 ? -36.309 35.585 18.747 1.00 68.62  ? 272 LYS A CG  1 
ATOM   1137 C  CD  . LYS A 1 164 ? -35.881 36.073 20.088 1.00 69.19  ? 272 LYS A CD  1 
ATOM   1138 C  CE  . LYS A 1 164 ? -34.930 37.248 20.019 1.00 76.25  ? 272 LYS A CE  1 
ATOM   1139 N  NZ  . LYS A 1 164 ? -35.365 38.294 19.055 1.00 87.26  ? 272 LYS A NZ  1 
ATOM   1140 N  N   . LYS A 1 165 ? -36.714 31.187 17.935 1.00 68.25  ? 273 LYS A N   1 
ATOM   1141 C  CA  . LYS A 1 165 ? -37.054 29.783 18.190 1.00 67.70  ? 273 LYS A CA  1 
ATOM   1142 C  C   . LYS A 1 165 ? -38.102 29.736 19.309 1.00 71.48  ? 273 LYS A C   1 
ATOM   1143 O  O   . LYS A 1 165 ? -39.052 28.960 19.237 1.00 74.33  ? 273 LYS A O   1 
ATOM   1144 C  CB  . LYS A 1 165 ? -35.801 28.964 18.586 1.00 67.74  ? 273 LYS A CB  1 
ATOM   1145 C  CG  . LYS A 1 165 ? -34.601 29.122 17.643 1.00 71.98  ? 273 LYS A CG  1 
ATOM   1146 C  CD  . LYS A 1 165 ? -33.448 28.178 18.014 1.00 76.89  ? 273 LYS A CD  1 
ATOM   1147 C  CE  . LYS A 1 165 ? -32.096 28.682 17.558 1.00 76.92  ? 273 LYS A CE  1 
ATOM   1148 N  NZ  . LYS A 1 165 ? -30.968 27.950 18.209 1.00 83.07  ? 273 LYS A NZ  1 
ATOM   1149 N  N   . LEU A 1 166 ? -37.977 30.645 20.281 1.00 64.81  ? 274 LEU A N   1 
ATOM   1150 C  CA  . LEU A 1 166 ? -38.851 30.750 21.433 1.00 65.03  ? 274 LEU A CA  1 
ATOM   1151 C  C   . LEU A 1 166 ? -39.925 31.790 21.326 1.00 69.30  ? 274 LEU A C   1 
ATOM   1152 O  O   . LEU A 1 166 ? -39.656 32.952 21.030 1.00 69.14  ? 274 LEU A O   1 
ATOM   1153 C  CB  . LEU A 1 166 ? -38.045 31.049 22.690 1.00 64.76  ? 274 LEU A CB  1 
ATOM   1154 C  CG  . LEU A 1 166 ? -38.121 30.006 23.768 1.00 72.99  ? 274 LEU A CG  1 
ATOM   1155 C  CD1 . LEU A 1 166 ? -36.821 29.940 24.526 1.00 73.68  ? 274 LEU A CD1 1 
ATOM   1156 C  CD2 . LEU A 1 166 ? -39.279 30.298 24.740 1.00 78.24  ? 274 LEU A CD2 1 
ATOM   1157 N  N   . TYR A 1 167 ? -41.140 31.383 21.650 1.00 66.64  ? 275 TYR A N   1 
ATOM   1158 C  CA  . TYR A 1 167 ? -42.257 32.292 21.798 1.00 67.55  ? 275 TYR A CA  1 
ATOM   1159 C  C   . TYR A 1 167 ? -42.639 32.095 23.221 1.00 74.03  ? 275 TYR A C   1 
ATOM   1160 O  O   . TYR A 1 167 ? -43.099 31.009 23.570 1.00 73.51  ? 275 TYR A O   1 
ATOM   1161 C  CB  . TYR A 1 167 ? -43.450 31.977 20.884 1.00 69.26  ? 275 TYR A CB  1 
ATOM   1162 C  CG  . TYR A 1 167 ? -44.676 32.786 21.261 1.00 71.04  ? 275 TYR A CG  1 
ATOM   1163 C  CD1 . TYR A 1 167 ? -44.724 34.160 21.047 1.00 71.76  ? 275 TYR A CD1 1 
ATOM   1164 C  CD2 . TYR A 1 167 ? -45.797 32.175 21.817 1.00 74.06  ? 275 TYR A CD2 1 
ATOM   1165 C  CE1 . TYR A 1 167 ? -45.849 34.911 21.396 1.00 72.75  ? 275 TYR A CE1 1 
ATOM   1166 C  CE2 . TYR A 1 167 ? -46.930 32.914 22.166 1.00 76.33  ? 275 TYR A CE2 1 
ATOM   1167 C  CZ  . TYR A 1 167 ? -46.952 34.283 21.947 1.00 83.30  ? 275 TYR A CZ  1 
ATOM   1168 O  OH  . TYR A 1 167 ? -48.068 35.017 22.274 1.00 89.83  ? 275 TYR A OH  1 
ATOM   1169 N  N   . MET A 1 168 ? -42.379 33.103 24.059 1.00 74.17  ? 276 MET A N   1 
ATOM   1170 C  CA  . MET A 1 168 ? -42.698 33.030 25.472 1.00 77.03  ? 276 MET A CA  1 
ATOM   1171 C  C   . MET A 1 168 ? -43.657 34.126 25.955 1.00 80.30  ? 276 MET A C   1 
ATOM   1172 O  O   . MET A 1 168 ? -43.571 35.267 25.511 1.00 79.03  ? 276 MET A O   1 
ATOM   1173 C  CB  . MET A 1 168 ? -41.414 32.993 26.299 1.00 80.49  ? 276 MET A CB  1 
ATOM   1174 C  CG  . MET A 1 168 ? -41.673 32.661 27.763 1.00 88.87  ? 276 MET A CG  1 
ATOM   1175 S  SD  . MET A 1 168 ? -40.742 33.609 29.001 1.00 96.19  ? 276 MET A SD  1 
ATOM   1176 C  CE  . MET A 1 168 ? -40.707 35.332 28.236 1.00 92.61  ? 276 MET A CE  1 
ATOM   1177 N  N   . VAL A 1 169 ? -44.600 33.762 26.837 1.00 79.01  ? 277 VAL A N   1 
ATOM   1178 C  CA  . VAL A 1 169 ? -45.541 34.704 27.468 1.00 79.75  ? 277 VAL A CA  1 
ATOM   1179 C  C   . VAL A 1 169 ? -45.375 34.561 28.989 1.00 85.65  ? 277 VAL A C   1 
ATOM   1180 O  O   . VAL A 1 169 ? -45.745 33.522 29.540 1.00 87.26  ? 277 VAL A O   1 
ATOM   1181 C  CB  . VAL A 1 169 ? -47.021 34.614 27.010 1.00 83.90  ? 277 VAL A CB  1 
ATOM   1182 C  CG1 . VAL A 1 169 ? -47.808 35.802 27.537 1.00 85.23  ? 277 VAL A CG1 1 
ATOM   1183 C  CG2 . VAL A 1 169 ? -47.133 34.567 25.499 1.00 82.76  ? 277 VAL A CG2 1 
ATOM   1184 N  N   . PRO A 1 170 ? -44.781 35.560 29.678 1.00 82.39  ? 278 PRO A N   1 
ATOM   1185 C  CA  . PRO A 1 170 ? -44.516 35.403 31.117 1.00 83.08  ? 278 PRO A CA  1 
ATOM   1186 C  C   . PRO A 1 170 ? -45.732 35.125 31.972 1.00 88.41  ? 278 PRO A C   1 
ATOM   1187 O  O   . PRO A 1 170 ? -45.660 34.261 32.844 1.00 89.54  ? 278 PRO A O   1 
ATOM   1188 C  CB  . PRO A 1 170 ? -43.822 36.712 31.498 1.00 84.52  ? 278 PRO A CB  1 
ATOM   1189 C  CG  . PRO A 1 170 ? -43.232 37.208 30.240 1.00 86.88  ? 278 PRO A CG  1 
ATOM   1190 C  CD  . PRO A 1 170 ? -44.219 36.833 29.180 1.00 83.00  ? 278 PRO A CD  1 
ATOM   1191 N  N   . TYR A 1 171 ? -46.835 35.855 31.746 1.00 84.86  ? 279 TYR A N   1 
ATOM   1192 C  CA  . TYR A 1 171 ? -48.048 35.663 32.540 1.00 86.51  ? 279 TYR A CA  1 
ATOM   1193 C  C   . TYR A 1 171 ? -49.235 35.691 31.614 1.00 92.36  ? 279 TYR A C   1 
ATOM   1194 O  O   . TYR A 1 171 ? -49.569 36.732 31.051 1.00 93.07  ? 279 TYR A O   1 
ATOM   1195 C  CB  . TYR A 1 171 ? -48.164 36.690 33.689 1.00 88.53  ? 279 TYR A CB  1 
ATOM   1196 C  CG  . TYR A 1 171 ? -46.941 36.746 34.585 1.00 89.86  ? 279 TYR A CG  1 
ATOM   1197 C  CD1 . TYR A 1 171 ? -46.775 35.840 35.630 1.00 93.32  ? 279 TYR A CD1 1 
ATOM   1198 C  CD2 . TYR A 1 171 ? -45.937 37.689 34.374 1.00 89.14  ? 279 TYR A CD2 1 
ATOM   1199 C  CE1 . TYR A 1 171 ? -45.655 35.894 36.464 1.00 94.33  ? 279 TYR A CE1 1 
ATOM   1200 C  CE2 . TYR A 1 171 ? -44.801 37.733 35.183 1.00 89.84  ? 279 TYR A CE2 1 
ATOM   1201 C  CZ  . TYR A 1 171 ? -44.670 36.844 36.236 1.00 97.07  ? 279 TYR A CZ  1 
ATOM   1202 O  OH  . TYR A 1 171 ? -43.542 36.885 37.025 1.00 96.16  ? 279 TYR A OH  1 
ATOM   1203 N  N   . VAL A 1 172 ? -49.828 34.524 31.400 1.00 89.78  ? 280 VAL A N   1 
ATOM   1204 C  CA  . VAL A 1 172 ? -50.941 34.373 30.482 1.00 90.78  ? 280 VAL A CA  1 
ATOM   1205 C  C   . VAL A 1 172 ? -52.273 34.836 31.027 1.00 100.39 ? 280 VAL A C   1 
ATOM   1206 O  O   . VAL A 1 172 ? -52.575 34.627 32.203 1.00 102.68 ? 280 VAL A O   1 
ATOM   1207 C  CB  . VAL A 1 172 ? -51.019 32.978 29.802 1.00 94.12  ? 280 VAL A CB  1 
ATOM   1208 C  CG1 . VAL A 1 172 ? -49.856 32.775 28.850 1.00 91.63  ? 280 VAL A CG1 1 
ATOM   1209 C  CG2 . VAL A 1 172 ? -51.092 31.842 30.820 1.00 95.29  ? 280 VAL A CG2 1 
ATOM   1210 N  N   . ASP A 1 173 ? -53.058 35.485 30.153 1.00 98.97  ? 281 ASP A N   1 
ATOM   1211 C  CA  . ASP A 1 173 ? -54.428 35.938 30.383 1.00 101.81 ? 281 ASP A CA  1 
ATOM   1212 C  C   . ASP A 1 173 ? -55.263 34.930 29.601 1.00 104.09 ? 281 ASP A C   1 
ATOM   1213 O  O   . ASP A 1 173 ? -54.687 34.048 28.962 1.00 99.97  ? 281 ASP A O   1 
ATOM   1214 C  CB  . ASP A 1 173 ? -54.644 37.355 29.797 1.00 105.41 ? 281 ASP A CB  1 
ATOM   1215 C  CG  . ASP A 1 173 ? -53.783 38.474 30.380 1.00 127.16 ? 281 ASP A CG  1 
ATOM   1216 O  OD1 . ASP A 1 173 ? -54.173 39.043 31.439 1.00 131.73 ? 281 ASP A OD1 1 
ATOM   1217 O  OD2 . ASP A 1 173 ? -52.775 38.846 29.734 1.00 132.91 ? 281 ASP A OD2 1 
ATOM   1218 N  N   . LEU A 1 174 ? -56.606 35.049 29.626 1.00 104.69 ? 282 LEU A N   1 
ATOM   1219 C  CA  . LEU A 1 174 ? -57.469 34.146 28.850 1.00 105.90 ? 282 LEU A CA  1 
ATOM   1220 C  C   . LEU A 1 174 ? -57.312 34.438 27.349 1.00 108.26 ? 282 LEU A C   1 
ATOM   1221 O  O   . LEU A 1 174 ? -57.416 33.524 26.533 1.00 107.92 ? 282 LEU A O   1 
ATOM   1222 C  CB  . LEU A 1 174 ? -58.929 34.285 29.265 1.00 109.57 ? 282 LEU A CB  1 
ATOM   1223 C  CG  . LEU A 1 174 ? -59.293 33.746 30.641 1.00 116.41 ? 282 LEU A CG  1 
ATOM   1224 C  CD1 . LEU A 1 174 ? -60.226 34.700 31.360 1.00 119.01 ? 282 LEU A CD1 1 
ATOM   1225 C  CD2 . LEU A 1 174 ? -59.925 32.365 30.537 1.00 120.68 ? 282 LEU A CD2 1 
ATOM   1226 N  N   . GLU A 1 175 ? -57.001 35.703 27.010 1.00 103.63 ? 283 GLU A N   1 
ATOM   1227 C  CA  . GLU A 1 175 ? -56.787 36.212 25.663 1.00 103.42 ? 283 GLU A CA  1 
ATOM   1228 C  C   . GLU A 1 175 ? -55.679 35.456 24.889 1.00 105.67 ? 283 GLU A C   1 
ATOM   1229 O  O   . GLU A 1 175 ? -55.640 35.525 23.657 1.00 106.46 ? 283 GLU A O   1 
ATOM   1230 C  CB  . GLU A 1 175 ? -56.478 37.727 25.730 1.00 105.28 ? 283 GLU A CB  1 
ATOM   1231 C  CG  . GLU A 1 175 ? -55.031 38.078 26.100 1.00 117.78 ? 283 GLU A CG  1 
ATOM   1232 C  CD  . GLU A 1 175 ? -54.781 39.329 26.928 1.00 142.93 ? 283 GLU A CD  1 
ATOM   1233 O  OE1 . GLU A 1 175 ? -53.623 39.810 26.927 1.00 114.10 ? 283 GLU A OE1 1 
ATOM   1234 O  OE2 . GLU A 1 175 ? -55.719 39.795 27.619 1.00 147.60 ? 283 GLU A OE2 1 
ATOM   1235 N  N   . HIS A 1 176 ? -54.766 34.766 25.608 1.00 98.42  ? 284 HIS A N   1 
ATOM   1236 C  CA  . HIS A 1 176 ? -53.655 34.033 24.992 1.00 94.37  ? 284 HIS A CA  1 
ATOM   1237 C  C   . HIS A 1 176 ? -54.028 32.652 24.451 1.00 97.98  ? 284 HIS A C   1 
ATOM   1238 O  O   . HIS A 1 176 ? -53.184 31.989 23.835 1.00 96.71  ? 284 HIS A O   1 
ATOM   1239 C  CB  . HIS A 1 176 ? -52.472 33.953 25.946 1.00 92.39  ? 284 HIS A CB  1 
ATOM   1240 C  CG  . HIS A 1 176 ? -51.868 35.281 26.189 1.00 94.45  ? 284 HIS A CG  1 
ATOM   1241 N  ND1 . HIS A 1 176 ? -51.025 35.863 25.266 1.00 94.48  ? 284 HIS A ND1 1 
ATOM   1242 C  CD2 . HIS A 1 176 ? -52.040 36.124 27.226 1.00 97.14  ? 284 HIS A CD2 1 
ATOM   1243 C  CE1 . HIS A 1 176 ? -50.694 37.034 25.776 1.00 94.00  ? 284 HIS A CE1 1 
ATOM   1244 N  NE2 . HIS A 1 176 ? -51.269 37.228 26.964 1.00 96.01  ? 284 HIS A NE2 1 
ATOM   1245 N  N   . GLN A 1 177 ? -55.288 32.217 24.677 1.00 94.58  ? 285 GLN A N   1 
ATOM   1246 C  CA  . GLN A 1 177 ? -55.801 30.946 24.185 1.00 94.96  ? 285 GLN A CA  1 
ATOM   1247 C  C   . GLN A 1 177 ? -55.793 30.959 22.638 1.00 98.61  ? 285 GLN A C   1 
ATOM   1248 O  O   . GLN A 1 177 ? -55.858 32.031 22.032 1.00 98.91  ? 285 GLN A O   1 
ATOM   1249 C  CB  . GLN A 1 177 ? -57.225 30.719 24.719 1.00 98.71  ? 285 GLN A CB  1 
ATOM   1250 C  CG  . GLN A 1 177 ? -57.667 29.265 24.685 1.00 95.83  ? 285 GLN A CG  1 
ATOM   1251 C  CD  . GLN A 1 177 ? -59.007 29.059 25.319 1.00 110.44 ? 285 GLN A CD  1 
ATOM   1252 O  OE1 . GLN A 1 177 ? -59.121 28.690 26.497 1.00 106.72 ? 285 GLN A OE1 1 
ATOM   1253 N  NE2 . GLN A 1 177 ? -60.052 29.264 24.534 1.00 100.38 ? 285 GLN A NE2 1 
ATOM   1254 N  N   . GLY A 1 178 ? -55.681 29.786 22.020 1.00 93.50  ? 286 GLY A N   1 
ATOM   1255 C  CA  . GLY A 1 178 ? -55.684 29.694 20.569 1.00 92.70  ? 286 GLY A CA  1 
ATOM   1256 C  C   . GLY A 1 178 ? -54.795 28.642 19.951 1.00 94.88  ? 286 GLY A C   1 
ATOM   1257 O  O   . GLY A 1 178 ? -54.157 27.850 20.650 1.00 93.86  ? 286 GLY A O   1 
ATOM   1258 N  N   . THR A 1 179 ? -54.774 28.626 18.614 1.00 91.96  ? 287 THR A N   1 
ATOM   1259 C  CA  . THR A 1 179 ? -53.963 27.697 17.851 1.00 91.35  ? 287 THR A CA  1 
ATOM   1260 C  C   . THR A 1 179 ? -52.714 28.414 17.389 1.00 92.94  ? 287 THR A C   1 
ATOM   1261 O  O   . THR A 1 179 ? -52.798 29.480 16.771 1.00 93.58  ? 287 THR A O   1 
ATOM   1262 C  CB  . THR A 1 179 ? -54.767 27.025 16.743 1.00 98.81  ? 287 THR A CB  1 
ATOM   1263 O  OG1 . THR A 1 179 ? -55.990 26.507 17.296 1.00 101.39 ? 287 THR A OG1 1 
ATOM   1264 C  CG2 . THR A 1 179 ? -53.970 25.921 16.038 1.00 94.29  ? 287 THR A CG2 1 
ATOM   1265 N  N   . TYR A 1 180 ? -51.560 27.835 17.717 1.00 85.62  ? 288 TYR A N   1 
ATOM   1266 C  CA  . TYR A 1 180 ? -50.264 28.403 17.401 1.00 82.19  ? 288 TYR A CA  1 
ATOM   1267 C  C   . TYR A 1 180 ? -49.438 27.498 16.523 1.00 85.41  ? 288 TYR A C   1 
ATOM   1268 O  O   . TYR A 1 180 ? -49.542 26.280 16.609 1.00 85.68  ? 288 TYR A O   1 
ATOM   1269 C  CB  . TYR A 1 180 ? -49.482 28.600 18.701 1.00 81.21  ? 288 TYR A CB  1 
ATOM   1270 C  CG  . TYR A 1 180 ? -49.991 29.685 19.624 1.00 82.15  ? 288 TYR A CG  1 
ATOM   1271 C  CD1 . TYR A 1 180 ? -49.390 30.940 19.649 1.00 82.09  ? 288 TYR A CD1 1 
ATOM   1272 C  CD2 . TYR A 1 180 ? -51.014 29.432 20.538 1.00 83.83  ? 288 TYR A CD2 1 
ATOM   1273 C  CE1 . TYR A 1 180 ? -49.818 31.928 20.530 1.00 82.91  ? 288 TYR A CE1 1 
ATOM   1274 C  CE2 . TYR A 1 180 ? -51.454 30.417 21.420 1.00 84.11  ? 288 TYR A CE2 1 
ATOM   1275 C  CZ  . TYR A 1 180 ? -50.833 31.656 21.430 1.00 89.58  ? 288 TYR A CZ  1 
ATOM   1276 O  OH  . TYR A 1 180 ? -51.229 32.646 22.292 1.00 90.26  ? 288 TYR A OH  1 
ATOM   1277 N  N   . TRP A 1 181 ? -48.565 28.100 15.718 1.00 81.82  ? 289 TRP A N   1 
ATOM   1278 C  CA  . TRP A 1 181 ? -47.568 27.408 14.898 1.00 81.57  ? 289 TRP A CA  1 
ATOM   1279 C  C   . TRP A 1 181 ? -46.450 28.377 14.525 1.00 81.54  ? 289 TRP A C   1 
ATOM   1280 O  O   . TRP A 1 181 ? -46.641 29.590 14.624 1.00 80.32  ? 289 TRP A O   1 
ATOM   1281 C  CB  . TRP A 1 181 ? -48.175 26.699 13.671 1.00 83.58  ? 289 TRP A CB  1 
ATOM   1282 C  CG  . TRP A 1 181 ? -48.621 27.628 12.588 1.00 85.99  ? 289 TRP A CG  1 
ATOM   1283 C  CD1 . TRP A 1 181 ? -47.871 28.112 11.551 1.00 88.43  ? 289 TRP A CD1 1 
ATOM   1284 C  CD2 . TRP A 1 181 ? -49.929 28.176 12.430 1.00 88.31  ? 289 TRP A CD2 1 
ATOM   1285 N  NE1 . TRP A 1 181 ? -48.628 28.962 10.779 1.00 89.65  ? 289 TRP A NE1 1 
ATOM   1286 C  CE2 . TRP A 1 181 ? -49.906 28.991 11.276 1.00 93.17  ? 289 TRP A CE2 1 
ATOM   1287 C  CE3 . TRP A 1 181 ? -51.131 28.047 13.146 1.00 91.52  ? 289 TRP A CE3 1 
ATOM   1288 C  CZ2 . TRP A 1 181 ? -51.037 29.682 10.833 1.00 95.54  ? 289 TRP A CZ2 1 
ATOM   1289 C  CZ3 . TRP A 1 181 ? -52.249 28.732 12.706 1.00 95.47  ? 289 TRP A CZ3 1 
ATOM   1290 C  CH2 . TRP A 1 181 ? -52.199 29.524 11.553 1.00 97.25  ? 289 TRP A CH2 1 
ATOM   1291 N  N   . CYS A 1 182 ? -45.289 27.843 14.109 1.00 76.66  ? 290 CYS A N   1 
ATOM   1292 C  CA  . CYS A 1 182 ? -44.120 28.612 13.668 1.00 73.60  ? 290 CYS A CA  1 
ATOM   1293 C  C   . CYS A 1 182 ? -43.864 28.332 12.197 1.00 77.98  ? 290 CYS A C   1 
ATOM   1294 O  O   . CYS A 1 182 ? -43.856 27.162 11.764 1.00 77.99  ? 290 CYS A O   1 
ATOM   1295 C  CB  . CYS A 1 182 ? -42.901 28.252 14.506 1.00 72.09  ? 290 CYS A CB  1 
ATOM   1296 S  SG  . CYS A 1 182 ? -41.472 29.343 14.269 1.00 74.10  ? 290 CYS A SG  1 
ATOM   1297 N  N   . HIS A 1 183 ? -43.685 29.408 11.416 1.00 74.13  ? 291 HIS A N   1 
ATOM   1298 C  CA  . HIS A 1 183 ? -43.294 29.301 10.016 1.00 73.62  ? 291 HIS A CA  1 
ATOM   1299 C  C   . HIS A 1 183 ? -41.747 29.445 9.976  1.00 74.89  ? 291 HIS A C   1 
ATOM   1300 O  O   . HIS A 1 183 ? -41.186 30.482 10.376 1.00 70.99  ? 291 HIS A O   1 
ATOM   1301 C  CB  . HIS A 1 183 ? -43.974 30.347 9.145  1.00 75.17  ? 291 HIS A CB  1 
ATOM   1302 C  CG  . HIS A 1 183 ? -43.647 30.180 7.687  1.00 80.30  ? 291 HIS A CG  1 
ATOM   1303 N  ND1 . HIS A 1 183 ? -44.120 29.089 6.955  1.00 84.49  ? 291 HIS A ND1 1 
ATOM   1304 C  CD2 . HIS A 1 183 ? -42.899 30.962 6.870  1.00 81.22  ? 291 HIS A CD2 1 
ATOM   1305 C  CE1 . HIS A 1 183 ? -43.645 29.248 5.730  1.00 84.99  ? 291 HIS A CE1 1 
ATOM   1306 N  NE2 . HIS A 1 183 ? -42.919 30.365 5.622  1.00 83.65  ? 291 HIS A NE2 1 
ATOM   1307 N  N   . VAL A 1 184 ? -41.072 28.358 9.588  1.00 72.83  ? 292 VAL A N   1 
ATOM   1308 C  CA  . VAL A 1 184 ? -39.610 28.310 9.485  1.00 70.93  ? 292 VAL A CA  1 
ATOM   1309 C  C   . VAL A 1 184 ? -39.277 28.474 8.004  1.00 76.43  ? 292 VAL A C   1 
ATOM   1310 O  O   . VAL A 1 184 ? -39.974 27.883 7.165  1.00 78.87  ? 292 VAL A O   1 
ATOM   1311 C  CB  . VAL A 1 184 ? -39.015 27.025 10.108 1.00 73.79  ? 292 VAL A CB  1 
ATOM   1312 C  CG1 . VAL A 1 184 ? -37.502 27.003 9.972  1.00 72.24  ? 292 VAL A CG1 1 
ATOM   1313 C  CG2 . VAL A 1 184 ? -39.426 26.878 11.576 1.00 71.71  ? 292 VAL A CG2 1 
ATOM   1314 N  N   . TYR A 1 185 ? -38.284 29.326 7.663  1.00 70.65  ? 293 TYR A N   1 
ATOM   1315 C  CA  . TYR A 1 185 ? -38.012 29.555 6.235  1.00 72.45  ? 293 TYR A CA  1 
ATOM   1316 C  C   . TYR A 1 185 ? -36.632 30.162 5.924  1.00 76.24  ? 293 TYR A C   1 
ATOM   1317 O  O   . TYR A 1 185 ? -36.034 30.857 6.748  1.00 73.25  ? 293 TYR A O   1 
ATOM   1318 C  CB  . TYR A 1 185 ? -39.132 30.470 5.640  1.00 73.75  ? 293 TYR A CB  1 
ATOM   1319 C  CG  . TYR A 1 185 ? -39.051 31.914 6.102  1.00 71.94  ? 293 TYR A CG  1 
ATOM   1320 C  CD1 . TYR A 1 185 ? -38.487 32.894 5.291  1.00 74.22  ? 293 TYR A CD1 1 
ATOM   1321 C  CD2 . TYR A 1 185 ? -39.462 32.284 7.378  1.00 70.69  ? 293 TYR A CD2 1 
ATOM   1322 C  CE1 . TYR A 1 185 ? -38.338 34.211 5.737  1.00 73.72  ? 293 TYR A CE1 1 
ATOM   1323 C  CE2 . TYR A 1 185 ? -39.312 33.595 7.838  1.00 70.59  ? 293 TYR A CE2 1 
ATOM   1324 C  CZ  . TYR A 1 185 ? -38.758 34.561 7.010  1.00 75.30  ? 293 TYR A CZ  1 
ATOM   1325 O  OH  . TYR A 1 185 ? -38.569 35.856 7.452  1.00 66.55  ? 293 TYR A OH  1 
ATOM   1326 N  N   . ASN A 1 186 ? -36.171 29.945 4.702  1.00 75.72  ? 294 ASN A N   1 
ATOM   1327 C  CA  . ASN A 1 186 ? -34.993 30.586 4.142  1.00 75.71  ? 294 ASN A CA  1 
ATOM   1328 C  C   . ASN A 1 186 ? -35.385 31.075 2.716  1.00 90.54  ? 294 ASN A C   1 
ATOM   1329 O  O   . ASN A 1 186 ? -36.427 31.727 2.585  1.00 93.35  ? 294 ASN A O   1 
ATOM   1330 C  CB  . ASN A 1 186 ? -33.722 29.724 4.247  1.00 68.76  ? 294 ASN A CB  1 
ATOM   1331 C  CG  . ASN A 1 186 ? -33.783 28.324 3.703  1.00 86.64  ? 294 ASN A CG  1 
ATOM   1332 O  OD1 . ASN A 1 186 ? -34.513 28.018 2.756  1.00 81.91  ? 294 ASN A OD1 1 
ATOM   1333 N  ND2 . ASN A 1 186 ? -32.907 27.465 4.210  1.00 77.44  ? 294 ASN A ND2 1 
ATOM   1334 N  N   . ASP A 1 187 ? -34.612 30.763 1.662  1.00 91.99  ? 295 ASP A N   1 
ATOM   1335 C  CA  . ASP A 1 187 ? -34.964 31.165 0.291  1.00 95.81  ? 295 ASP A CA  1 
ATOM   1336 C  C   . ASP A 1 187 ? -34.846 29.985 -0.677 1.00 103.84 ? 295 ASP A C   1 
ATOM   1337 O  O   . ASP A 1 187 ? -34.850 30.159 -1.902 1.00 107.70 ? 295 ASP A O   1 
ATOM   1338 C  CB  . ASP A 1 187 ? -34.188 32.424 -0.183 1.00 97.54  ? 295 ASP A CB  1 
ATOM   1339 C  CG  . ASP A 1 187 ? -32.656 32.426 -0.070 1.00 101.92 ? 295 ASP A CG  1 
ATOM   1340 O  OD1 . ASP A 1 187 ? -32.013 31.389 -0.452 1.00 100.43 ? 295 ASP A OD1 1 
ATOM   1341 O  OD2 . ASP A 1 187 ? -32.090 33.507 0.253  1.00 103.86 ? 295 ASP A OD2 1 
ATOM   1342 N  N   . ARG A 1 188 ? -34.749 28.777 -0.109 1.00 98.73  ? 296 ARG A N   1 
ATOM   1343 C  CA  . ARG A 1 188 ? -34.677 27.513 -0.833 1.00 100.33 ? 296 ARG A CA  1 
ATOM   1344 C  C   . ARG A 1 188 ? -35.892 26.636 -0.428 1.00 103.06 ? 296 ARG A C   1 
ATOM   1345 O  O   . ARG A 1 188 ? -36.373 25.829 -1.242 1.00 106.75 ? 296 ARG A O   1 
ATOM   1346 C  CB  . ARG A 1 188 ? -33.343 26.802 -0.509 1.00 98.40  ? 296 ARG A CB  1 
ATOM   1347 N  N   . ASP A 1 189 ? -36.391 26.826 0.830  1.00 93.48  ? 297 ASP A N   1 
ATOM   1348 C  CA  . ASP A 1 189 ? -37.456 26.052 1.453  1.00 93.03  ? 297 ASP A CA  1 
ATOM   1349 C  C   . ASP A 1 189 ? -38.087 26.796 2.624  1.00 93.00  ? 297 ASP A C   1 
ATOM   1350 O  O   . ASP A 1 189 ? -37.578 27.822 3.079  1.00 89.08  ? 297 ASP A O   1 
ATOM   1351 C  CB  . ASP A 1 189 ? -36.866 24.708 1.959  1.00 95.02  ? 297 ASP A CB  1 
ATOM   1352 C  CG  . ASP A 1 189 ? -37.838 23.551 2.227  1.00 111.67 ? 297 ASP A CG  1 
ATOM   1353 O  OD1 . ASP A 1 189 ? -38.875 23.450 1.512  1.00 113.87 ? 297 ASP A OD1 1 
ATOM   1354 O  OD2 . ASP A 1 189 ? -37.518 22.696 3.092  1.00 120.69 ? 297 ASP A OD2 1 
ATOM   1355 N  N   . SER A 1 190 ? -39.223 26.255 3.097  1.00 91.84  ? 298 SER A N   1 
ATOM   1356 C  CA  . SER A 1 190 ? -40.035 26.656 4.263  1.00 90.09  ? 298 SER A CA  1 
ATOM   1357 C  C   . SER A 1 190 ? -40.791 25.425 4.777  1.00 94.77  ? 298 SER A C   1 
ATOM   1358 O  O   . SER A 1 190 ? -41.043 24.488 4.013  1.00 98.19  ? 298 SER A O   1 
ATOM   1359 C  CB  . SER A 1 190 ? -41.007 27.792 3.936  1.00 94.13  ? 298 SER A CB  1 
ATOM   1360 O  OG  . SER A 1 190 ? -41.648 27.653 2.683  1.00 103.36 ? 298 SER A OG  1 
ATOM   1361 N  N   . GLN A 1 191 ? -41.129 25.413 6.068  1.00 88.44  ? 299 GLN A N   1 
ATOM   1362 C  CA  . GLN A 1 191 ? -41.810 24.292 6.722  1.00 88.91  ? 299 GLN A CA  1 
ATOM   1363 C  C   . GLN A 1 191 ? -42.563 24.851 7.921  1.00 88.48  ? 299 GLN A C   1 
ATOM   1364 O  O   . GLN A 1 191 ? -41.960 25.487 8.790  1.00 84.67  ? 299 GLN A O   1 
ATOM   1365 C  CB  . GLN A 1 191 ? -40.745 23.256 7.172  1.00 90.08  ? 299 GLN A CB  1 
ATOM   1366 C  CG  . GLN A 1 191 ? -41.211 21.832 7.520  1.00 114.75 ? 299 GLN A CG  1 
ATOM   1367 C  CD  . GLN A 1 191 ? -40.030 20.927 7.916  1.00 136.49 ? 299 GLN A CD  1 
ATOM   1368 O  OE1 . GLN A 1 191 ? -40.024 20.287 8.984  1.00 129.99 ? 299 GLN A OE1 1 
ATOM   1369 N  NE2 . GLN A 1 191 ? -39.007 20.825 7.057  1.00 125.44 ? 299 GLN A NE2 1 
ATOM   1370 N  N   . ASP A 1 192 ? -43.885 24.675 7.941  1.00 86.13  ? 300 ASP A N   1 
ATOM   1371 C  CA  . ASP A 1 192 ? -44.670 25.104 9.084  1.00 83.98  ? 300 ASP A CA  1 
ATOM   1372 C  C   . ASP A 1 192 ? -44.555 23.992 10.135 1.00 86.87  ? 300 ASP A C   1 
ATOM   1373 O  O   . ASP A 1 192 ? -44.514 22.806 9.800  1.00 87.85  ? 300 ASP A O   1 
ATOM   1374 C  CB  . ASP A 1 192 ? -46.143 25.340 8.725  1.00 88.24  ? 300 ASP A CB  1 
ATOM   1375 C  CG  . ASP A 1 192 ? -46.443 26.581 7.896  1.00 105.40 ? 300 ASP A CG  1 
ATOM   1376 O  OD1 . ASP A 1 192 ? -46.545 27.679 8.485  1.00 102.64 ? 300 ASP A OD1 1 
ATOM   1377 O  OD2 . ASP A 1 192 ? -46.712 26.433 6.680  1.00 121.44 ? 300 ASP A OD2 1 
ATOM   1378 N  N   . SER A 1 193 ? -44.460 24.383 11.402 1.00 80.56  ? 301 SER A N   1 
ATOM   1379 C  CA  . SER A 1 193 ? -44.430 23.447 12.509 1.00 79.46  ? 301 SER A CA  1 
ATOM   1380 C  C   . SER A 1 193 ? -45.852 22.883 12.728 1.00 86.51  ? 301 SER A C   1 
ATOM   1381 O  O   . SER A 1 193 ? -46.826 23.399 12.162 1.00 88.80  ? 301 SER A O   1 
ATOM   1382 C  CB  . SER A 1 193 ? -44.014 24.196 13.769 1.00 77.84  ? 301 SER A CB  1 
ATOM   1383 O  OG  . SER A 1 193 ? -45.108 24.942 14.284 1.00 83.78  ? 301 SER A OG  1 
ATOM   1384 N  N   . LYS A 1 194 ? -45.983 21.893 13.629 1.00 81.83  ? 302 LYS A N   1 
ATOM   1385 C  CA  . LYS A 1 194 ? -47.262 21.354 14.080 1.00 82.35  ? 302 LYS A CA  1 
ATOM   1386 C  C   . LYS A 1 194 ? -48.101 22.560 14.552 1.00 83.96  ? 302 LYS A C   1 
ATOM   1387 O  O   . LYS A 1 194 ? -47.555 23.506 15.125 1.00 81.39  ? 302 LYS A O   1 
ATOM   1388 C  CB  . LYS A 1 194 ? -47.025 20.442 15.317 1.00 84.45  ? 302 LYS A CB  1 
ATOM   1389 C  CG  . LYS A 1 194 ? -47.050 18.944 15.053 1.00 106.37 ? 302 LYS A CG  1 
ATOM   1390 C  CD  . LYS A 1 194 ? -45.698 18.356 14.629 1.00 120.67 ? 302 LYS A CD  1 
ATOM   1391 C  CE  . LYS A 1 194 ? -45.740 17.572 13.323 1.00 129.55 ? 302 LYS A CE  1 
ATOM   1392 N  NZ  . LYS A 1 194 ? -44.389 17.076 12.923 1.00 128.67 ? 302 LYS A NZ  1 
ATOM   1393 N  N   . LYS A 1 195 ? -49.403 22.543 14.290 1.00 82.10  ? 303 LYS A N   1 
ATOM   1394 C  CA  . LYS A 1 195 ? -50.310 23.574 14.782 1.00 79.98  ? 303 LYS A CA  1 
ATOM   1395 C  C   . LYS A 1 195 ? -50.733 23.048 16.160 1.00 83.55  ? 303 LYS A C   1 
ATOM   1396 O  O   . LYS A 1 195 ? -51.294 21.956 16.268 1.00 86.54  ? 303 LYS A O   1 
ATOM   1397 C  CB  . LYS A 1 195 ? -51.511 23.807 13.826 1.00 83.27  ? 303 LYS A CB  1 
ATOM   1398 C  CG  . LYS A 1 195 ? -51.106 24.355 12.458 1.00 88.75  ? 303 LYS A CG  1 
ATOM   1399 C  CD  . LYS A 1 195 ? -52.267 24.926 11.652 1.00 100.22 ? 303 LYS A CD  1 
ATOM   1400 C  CE  . LYS A 1 195 ? -51.772 25.656 10.424 1.00 112.08 ? 303 LYS A CE  1 
ATOM   1401 N  N   . VAL A 1 196 ? -50.358 23.762 17.213 1.00 76.30  ? 304 VAL A N   1 
ATOM   1402 C  CA  . VAL A 1 196 ? -50.647 23.350 18.597 1.00 75.50  ? 304 VAL A CA  1 
ATOM   1403 C  C   . VAL A 1 196 ? -51.841 24.096 19.195 1.00 81.22  ? 304 VAL A C   1 
ATOM   1404 O  O   . VAL A 1 196 ? -52.112 25.228 18.784 1.00 80.31  ? 304 VAL A O   1 
ATOM   1405 C  CB  . VAL A 1 196 ? -49.388 23.473 19.500 1.00 74.42  ? 304 VAL A CB  1 
ATOM   1406 C  CG1 . VAL A 1 196 ? -48.285 22.545 19.022 1.00 73.35  ? 304 VAL A CG1 1 
ATOM   1407 C  CG2 . VAL A 1 196 ? -48.894 24.915 19.588 1.00 70.71  ? 304 VAL A CG2 1 
ATOM   1408 N  N   . GLU A 1 197 ? -52.525 23.487 20.191 1.00 80.02  ? 305 GLU A N   1 
ATOM   1409 C  CA  . GLU A 1 197 ? -53.651 24.140 20.864 1.00 81.45  ? 305 GLU A CA  1 
ATOM   1410 C  C   . GLU A 1 197 ? -53.271 24.528 22.271 1.00 86.17  ? 305 GLU A C   1 
ATOM   1411 O  O   . GLU A 1 197 ? -52.814 23.674 23.043 1.00 87.29  ? 305 GLU A O   1 
ATOM   1412 C  CB  . GLU A 1 197 ? -54.917 23.261 20.866 1.00 86.72  ? 305 GLU A CB  1 
ATOM   1413 C  CG  . GLU A 1 197 ? -56.096 23.906 20.151 1.00 98.31  ? 305 GLU A CG  1 
ATOM   1414 C  CD  . GLU A 1 197 ? -56.242 23.618 18.664 1.00 131.31 ? 305 GLU A CD  1 
ATOM   1415 O  OE1 . GLU A 1 197 ? -55.212 23.406 17.978 1.00 97.60  ? 305 GLU A OE1 1 
ATOM   1416 O  OE2 . GLU A 1 197 ? -57.401 23.612 18.181 1.00 146.62 ? 305 GLU A OE2 1 
ATOM   1417 N  N   . ILE A 1 198 ? -53.424 25.827 22.598 1.00 81.16  ? 306 ILE A N   1 
ATOM   1418 C  CA  . ILE A 1 198 ? -53.148 26.358 23.940 1.00 78.84  ? 306 ILE A CA  1 
ATOM   1419 C  C   . ILE A 1 198 ? -54.484 26.722 24.593 1.00 86.88  ? 306 ILE A C   1 
ATOM   1420 O  O   . ILE A 1 198 ? -55.126 27.672 24.156 1.00 86.68  ? 306 ILE A O   1 
ATOM   1421 C  CB  . ILE A 1 198 ? -52.127 27.533 23.957 1.00 77.32  ? 306 ILE A CB  1 
ATOM   1422 C  CG1 . ILE A 1 198 ? -50.779 27.160 23.292 1.00 74.73  ? 306 ILE A CG1 1 
ATOM   1423 C  CG2 . ILE A 1 198 ? -51.927 28.112 25.381 1.00 76.13  ? 306 ILE A CG2 1 
ATOM   1424 C  CD1 . ILE A 1 198 ? -49.976 25.958 23.896 1.00 79.89  ? 306 ILE A CD1 1 
ATOM   1425 N  N   . ILE A 1 199 ? -54.914 25.931 25.601 1.00 86.32  ? 307 ILE A N   1 
ATOM   1426 C  CA  . ILE A 1 199 ? -56.144 26.160 26.360 1.00 88.99  ? 307 ILE A CA  1 
ATOM   1427 C  C   . ILE A 1 199 ? -55.774 26.913 27.645 1.00 95.99  ? 307 ILE A C   1 
ATOM   1428 O  O   . ILE A 1 199 ? -54.848 26.509 28.346 1.00 94.10  ? 307 ILE A O   1 
ATOM   1429 C  CB  . ILE A 1 199 ? -56.926 24.823 26.672 1.00 94.30  ? 307 ILE A CB  1 
ATOM   1430 C  CG1 . ILE A 1 199 ? -57.507 24.158 25.420 1.00 95.82  ? 307 ILE A CG1 1 
ATOM   1431 C  CG2 . ILE A 1 199 ? -57.995 24.993 27.738 1.00 94.69  ? 307 ILE A CG2 1 
ATOM   1432 C  CD1 . ILE A 1 199 ? -56.644 22.980 24.943 1.00 106.27 ? 307 ILE A CD1 1 
ATOM   1433 N  N   . ILE A 1 200 ? -56.507 27.990 27.957 1.00 97.25  ? 308 ILE A N   1 
ATOM   1434 C  CA  . ILE A 1 200 ? -56.336 28.737 29.201 1.00 98.51  ? 308 ILE A CA  1 
ATOM   1435 C  C   . ILE A 1 200 ? -57.660 28.735 29.940 1.00 109.46 ? 308 ILE A C   1 
ATOM   1436 O  O   . ILE A 1 200 ? -58.622 29.353 29.479 1.00 111.12 ? 308 ILE A O   1 
ATOM   1437 C  CB  . ILE A 1 200 ? -55.718 30.139 29.020 1.00 99.12  ? 308 ILE A CB  1 
ATOM   1438 C  CG1 . ILE A 1 200 ? -54.274 29.995 28.562 1.00 97.11  ? 308 ILE A CG1 1 
ATOM   1439 C  CG2 . ILE A 1 200 ? -55.785 30.935 30.327 1.00 99.61  ? 308 ILE A CG2 1 
ATOM   1440 C  CD1 . ILE A 1 200 ? -53.826 31.031 27.658 1.00 109.08 ? 308 ILE A CD1 1 
ATOM   1441 N  N   . ASP A 1 201 ? -57.719 27.981 31.052 1.00 110.13 ? 309 ASP A N   1 
ATOM   1442 C  CA  . ASP A 1 201 ? -58.910 27.827 31.893 1.00 114.54 ? 309 ASP A CA  1 
ATOM   1443 C  C   . ASP A 1 201 ? -58.457 27.543 33.342 1.00 120.22 ? 309 ASP A C   1 
ATOM   1444 O  O   . ASP A 1 201 ? -57.363 27.966 33.705 1.00 117.60 ? 309 ASP A O   1 
ATOM   1445 C  CB  . ASP A 1 201 ? -59.798 26.699 31.327 1.00 119.74 ? 309 ASP A CB  1 
ATOM   1446 C  CG  . ASP A 1 201 ? -61.251 26.782 31.737 1.00 146.68 ? 309 ASP A CG  1 
ATOM   1447 O  OD1 . ASP A 1 201 ? -61.861 27.864 31.551 1.00 150.72 ? 309 ASP A OD1 1 
ATOM   1448 O  OD2 . ASP A 1 201 ? -61.784 25.764 32.248 1.00 158.05 ? 309 ASP A OD2 1 
ATOM   1449 N  N   . GLU A 1 202 ? -59.299 26.871 34.170 1.00 120.90 ? 310 GLU A N   1 
ATOM   1450 C  CA  . GLU A 1 202 ? -59.020 26.469 35.560 1.00 149.62 ? 310 GLU A CA  1 
ATOM   1451 C  C   . GLU A 1 202 ? -59.932 25.335 36.023 1.00 183.94 ? 310 GLU A C   1 
ATOM   1452 O  O   . GLU A 1 202 ? -59.878 24.238 35.468 1.00 146.36 ? 310 GLU A O   1 
ATOM   1453 C  CB  . GLU A 1 202 ? -59.019 27.650 36.563 1.00 151.08 ? 310 GLU A CB  1 
ATOM   1454 C  CG  . GLU A 1 202 ? -60.195 28.613 36.485 1.00 159.89 ? 310 GLU A CG  1 
ATOM   1455 C  CD  . GLU A 1 202 ? -59.848 30.042 36.104 1.00 173.52 ? 310 GLU A CD  1 
ATOM   1456 O  OE1 . GLU A 1 202 ? -58.793 30.556 36.549 1.00 155.63 ? 310 GLU A OE1 1 
ATOM   1457 O  OE2 . GLU A 1 202 ? -60.656 30.660 35.375 1.00 167.68 ? 310 GLU A OE2 1 
HETATM 1458 CL CL  . CL  B 2 .   ? -20.231 27.626 3.662  1.00 79.41  ? 401 CL  A CL  1 
HETATM 1459 O  O   . HOH C 3 .   ? -19.416 36.432 16.989 1.00 36.38  ? 403 HOH A O   1 
HETATM 1460 O  O   . HOH C 3 .   ? -15.305 21.588 17.340 1.00 80.83  ? 404 HOH A O   1 
HETATM 1461 O  O   . HOH C 3 .   ? -29.549 29.169 -1.128 1.00 68.04  ? 405 HOH A O   1 
HETATM 1462 O  O   . HOH C 3 .   ? -39.537 20.420 3.677  1.00 91.77  ? 408 HOH A O   1 
HETATM 1463 O  O   . HOH C 3 .   ? -52.243 28.543 7.411  1.00 101.15 ? 410 HOH A O   1 
HETATM 1464 O  O   . HOH C 3 .   ? -1.992  30.269 12.637 1.00 74.77  ? 411 HOH A O   1 
HETATM 1465 O  O   . HOH C 3 .   ? -31.630 25.581 20.483 1.00 66.96  ? 415 HOH A O   1 
HETATM 1466 O  O   . HOH C 3 .   ? -7.208  25.131 0.909  1.00 67.24  ? 417 HOH A O   1 
HETATM 1467 O  O   . HOH C 3 .   ? -11.667 45.852 17.604 1.00 52.68  ? 421 HOH A O   1 
HETATM 1468 O  O   . HOH C 3 .   ? -43.337 20.198 10.738 1.00 75.24  ? 423 HOH A O   1 
HETATM 1469 O  O   . HOH C 3 .   ? -44.784 23.050 5.485  1.00 69.64  ? 425 HOH A O   1 
HETATM 1470 O  O   . HOH C 3 .   ? -47.246 30.149 6.083  1.00 70.65  ? 426 HOH A O   1 
HETATM 1471 O  O   . HOH C 3 .   ? -25.271 12.669 5.780  1.00 95.56  ? 427 HOH A O   1 
HETATM 1472 O  O   . HOH C 3 .   ? -21.034 22.020 6.748  1.00 71.63  ? 428 HOH A O   1 
# 
loop_
_atom_site_anisotrop.id 
_atom_site_anisotrop.type_symbol 
_atom_site_anisotrop.pdbx_label_atom_id 
_atom_site_anisotrop.pdbx_label_alt_id 
_atom_site_anisotrop.pdbx_label_comp_id 
_atom_site_anisotrop.pdbx_label_asym_id 
_atom_site_anisotrop.pdbx_label_seq_id 
_atom_site_anisotrop.pdbx_PDB_ins_code 
_atom_site_anisotrop.U[1][1] 
_atom_site_anisotrop.U[2][2] 
_atom_site_anisotrop.U[3][3] 
_atom_site_anisotrop.U[1][2] 
_atom_site_anisotrop.U[1][3] 
_atom_site_anisotrop.U[2][3] 
_atom_site_anisotrop.pdbx_auth_seq_id 
_atom_site_anisotrop.pdbx_auth_comp_id 
_atom_site_anisotrop.pdbx_auth_asym_id 
_atom_site_anisotrop.pdbx_auth_atom_id 
1    N N   . SER A 19  ? 0.9603 1.9118 1.1304 0.1072  0.2812  0.1635  127 SER A N   
2    C CA  . SER A 19  ? 0.9907 1.9616 1.1077 0.1158  0.2857  0.1846  127 SER A CA  
3    C C   . SER A 19  ? 1.0218 1.9769 1.1104 0.1147  0.2555  0.1812  127 SER A C   
4    O O   . SER A 19  ? 0.9613 1.8860 1.0781 0.1054  0.2360  0.1702  127 SER A O   
5    C CB  . SER A 19  ? 1.0548 2.0606 1.1289 0.1279  0.3008  0.1706  127 SER A CB  
6    O OG  . SER A 19  ? 1.0995 2.0990 1.1715 0.1309  0.2907  0.1270  127 SER A OG  
7    N N   . LYS A 20  ? 1.0107 1.9923 1.0446 0.1237  0.2522  0.1919  128 LYS A N   
8    C CA  . LYS A 20  ? 0.9854 1.9641 0.9900 0.1237  0.2246  0.1900  128 LYS A CA  
9    C C   . LYS A 20  ? 0.9855 1.9446 0.9828 0.1184  0.1991  0.1421  128 LYS A C   
10   O O   . LYS A 20  ? 0.9898 1.9481 0.9873 0.1200  0.2050  0.1114  128 LYS A O   
11   C CB  . LYS A 20  ? 1.0535 2.0795 1.0004 0.1353  0.2288  0.2102  128 LYS A CB  
12   C CG  . LYS A 20  ? 1.1798 2.2152 1.1016 0.1370  0.2037  0.2206  128 LYS A CG  
13   C CD  . LYS A 20  ? 1.2733 2.3043 1.2195 0.1414  0.2116  0.2741  128 LYS A CD  
14   C CE  . LYS A 20  ? 1.2054 2.2527 1.1288 0.1458  0.1867  0.2854  128 LYS A CE  
15   N NZ  . LYS A 20  ? 1.1832 2.2589 1.1003 0.1604  0.2006  0.3443  128 LYS A NZ  
16   N N   . ILE A 21  ? 0.8906 1.8325 0.8857 0.1127  0.1734  0.1378  129 ILE A N   
17   C CA  . ILE A 21  ? 0.8556 1.7743 0.8485 0.1060  0.1499  0.0985  129 ILE A CA  
18   C C   . ILE A 21  ? 0.9180 1.8631 0.8597 0.1076  0.1344  0.0810  129 ILE A C   
19   O O   . ILE A 21  ? 0.9220 1.8891 0.8450 0.1098  0.1259  0.1048  129 ILE A O   
20   C CB  . ILE A 21  ? 0.8447 1.7250 0.8786 0.0954  0.1338  0.1034  129 ILE A CB  
21   C CG1 . ILE A 21  ? 0.8268 1.6896 0.9118 0.0910  0.1490  0.1158  129 ILE A CG1 
22   C CG2 . ILE A 21  ? 0.8237 1.6795 0.8559 0.0885  0.1116  0.0675  129 ILE A CG2 
23   C CD1 . ILE A 21  ? 0.8517 1.6856 0.9763 0.0794  0.1386  0.1234  129 ILE A CD1 
24   N N   . THR A 22  ? 0.8802 1.8236 0.8036 0.1062  0.1312  0.0383  130 THR A N   
25   C CA  . THR A 22  ? 0.9043 1.8735 0.7821 0.1037  0.1180  0.0089  130 THR A CA  
26   C C   . THR A 22  ? 0.9250 1.8661 0.8141 0.0922  0.0920  -0.0100 130 THR A C   
27   O O   . THR A 22  ? 0.9348 1.9019 0.7973 0.0883  0.0753  -0.0121 130 THR A O   
28   C CB  . THR A 22  ? 1.0038 1.9811 0.8628 0.1064  0.1330  -0.0317 130 THR A CB  
29   O OG1 . THR A 22  ? 1.0734 2.0701 0.9332 0.1167  0.1600  -0.0131 130 THR A OG1 
30   C CG2 . THR A 22  ? 0.9673 1.9825 0.7749 0.1021  0.1244  -0.0653 130 THR A CG2 
31   N N   . VAL A 23  ? 0.8516 1.7444 0.7796 0.0870  0.0891  -0.0239 131 VAL A N   
32   C CA  . VAL A 23  ? 0.8205 1.6820 0.7634 0.0757  0.0678  -0.0405 131 VAL A CA  
33   C C   . VAL A 23  ? 0.8156 1.6469 0.8004 0.0728  0.0632  -0.0132 131 VAL A C   
34   O O   . VAL A 23  ? 0.8231 1.6365 0.8376 0.0762  0.0749  -0.0067 131 VAL A O   
35   C CB  . VAL A 23  ? 0.8720 1.7035 0.8216 0.0718  0.0691  -0.0841 131 VAL A CB  
36   C CG1 . VAL A 23  ? 0.8425 1.6401 0.8094 0.0595  0.0497  -0.0968 131 VAL A CG1 
37   C CG2 . VAL A 23  ? 0.9187 1.7793 0.8290 0.0723  0.0770  -0.1191 131 VAL A CG2 
38   N N   . ASN A 24  ? 0.7208 1.5501 0.7093 0.0659  0.0464  0.0000  132 ASN A N   
39   C CA  . ASN A 24  ? 0.6632 1.4654 0.6888 0.0600  0.0402  0.0197  132 ASN A CA  
40   C C   . ASN A 24  ? 0.6796 1.4499 0.7169 0.0491  0.0242  -0.0047 132 ASN A C   
41   O O   . ASN A 24  ? 0.6952 1.4706 0.7108 0.0442  0.0143  -0.0294 132 ASN A O   
42   C CB  . ASN A 24  ? 0.6083 1.4299 0.6323 0.0609  0.0348  0.0503  132 ASN A CB  
43   C CG  . ASN A 24  ? 0.8345 1.6684 0.8709 0.0693  0.0537  0.0862  132 ASN A CG  
44   O OD1 . ASN A 24  ? 0.7398 1.5517 0.8121 0.0661  0.0636  0.0974  132 ASN A OD1 
45   N ND2 . ASN A 24  ? 0.7538 1.6255 0.7624 0.0793  0.0597  0.1058  132 ASN A ND2 
46   N N   . PRO A 25  ? 0.5870 1.3273 0.6582 0.0439  0.0219  0.0009  133 PRO A N   
47   C CA  . PRO A 25  ? 0.5707 1.2828 0.6511 0.0341  0.0081  -0.0173 133 PRO A CA  
48   C C   . PRO A 25  ? 0.6297 1.3459 0.7059 0.0246  -0.0072 -0.0138 133 PRO A C   
49   O O   . PRO A 25  ? 0.6010 1.3329 0.6816 0.0256  -0.0079 0.0094  133 PRO A O   
50   C CB  . PRO A 25  ? 0.5654 1.2555 0.6794 0.0330  0.0111  -0.0084 133 PRO A CB  
51   C CG  . PRO A 25  ? 0.6062 1.3132 0.7336 0.0376  0.0235  0.0142  133 PRO A CG  
52   C CD  . PRO A 25  ? 0.5792 1.3143 0.6814 0.0450  0.0319  0.0232  133 PRO A CD  
53   N N   . GLU A 26  ? 0.6259 1.3278 0.6968 0.0159  -0.0176 -0.0373 134 GLU A N   
54   C CA  . GLU A 26  ? 0.6231 1.3292 0.6934 0.0051  -0.0325 -0.0396 134 GLU A CA  
55   C C   . GLU A 26  ? 0.6492 1.3257 0.7475 -0.0033 -0.0369 -0.0320 134 GLU A C   
56   O O   . GLU A 26  ? 0.6331 1.2837 0.7451 -0.0031 -0.0323 -0.0356 134 GLU A O   
57   C CB  . GLU A 26  ? 0.6719 1.3785 0.7250 -0.0031 -0.0389 -0.0731 134 GLU A CB  
58   C CG  . GLU A 26  ? 0.8865 1.6387 0.9133 -0.0045 -0.0478 -0.0797 134 GLU A CG  
59   C CD  . GLU A 26  ? 1.3264 2.0848 1.3379 -0.0164 -0.0534 -0.1197 134 GLU A CD  
60   O OE1 . GLU A 26  ? 1.2217 2.0273 1.2085 -0.0179 -0.0614 -0.1286 134 GLU A OE1 
61   O OE2 . GLU A 26  ? 1.3329 2.0514 1.3582 -0.0244 -0.0489 -0.1423 134 GLU A OE2 
62   N N   . SER A 27  ? 0.6039 1.2881 0.7111 -0.0096 -0.0450 -0.0204 135 SER A N   
63   C CA  . SER A 27  ? 0.5648 1.2265 0.6945 -0.0198 -0.0493 -0.0167 135 SER A CA  
64   C C   . SER A 27  ? 0.6204 1.2670 0.7456 -0.0308 -0.0575 -0.0397 135 SER A C   
65   O O   . SER A 27  ? 0.6137 1.2782 0.7236 -0.0337 -0.0633 -0.0548 135 SER A O   
66   C CB  . SER A 27  ? 0.5485 1.2250 0.6913 -0.0221 -0.0521 0.0009  135 SER A CB  
67   O OG  . SER A 27  ? 0.6225 1.3097 0.7725 -0.0125 -0.0410 0.0215  135 SER A OG  
68   N N   . LYS A 28  ? 0.5770 1.1935 0.7158 -0.0372 -0.0567 -0.0427 136 LYS A N   
69   C CA  . LYS A 28  ? 0.5799 1.1753 0.7195 -0.0479 -0.0600 -0.0624 136 LYS A CA  
70   C C   . LYS A 28  ? 0.6281 1.1995 0.7848 -0.0570 -0.0609 -0.0545 136 LYS A C   
71   O O   . LYS A 28  ? 0.6078 1.1756 0.7739 -0.0533 -0.0582 -0.0375 136 LYS A O   
72   C CB  . LYS A 28  ? 0.6267 1.2050 0.7591 -0.0417 -0.0516 -0.0805 136 LYS A CB  
73   C CG  . LYS A 28  ? 0.6483 1.2127 0.7896 -0.0282 -0.0421 -0.0674 136 LYS A CG  
74   C CD  . LYS A 28  ? 0.6947 1.2470 0.8316 -0.0186 -0.0311 -0.0848 136 LYS A CD  
75   C CE  . LYS A 28  ? 0.7466 1.3286 0.8636 -0.0100 -0.0267 -0.0911 136 LYS A CE  
76   N NZ  . LYS A 28  ? 0.9398 1.5096 1.0524 -0.0030 -0.0142 -0.1147 136 LYS A NZ  
77   N N   . ALA A 29  ? 0.6200 1.1789 0.7809 -0.0704 -0.0642 -0.0679 137 ALA A N   
78   C CA  . ALA A 29  ? 0.6074 1.1432 0.7823 -0.0803 -0.0631 -0.0607 137 ALA A CA  
79   C C   . ALA A 29  ? 0.6612 1.1619 0.8412 -0.0817 -0.0552 -0.0728 137 ALA A C   
80   O O   . ALA A 29  ? 0.6777 1.1746 0.8540 -0.0865 -0.0535 -0.0970 137 ALA A O   
81   C CB  . ALA A 29  ? 0.6083 1.1571 0.7896 -0.0953 -0.0697 -0.0646 137 ALA A CB  
82   N N   . VAL A 30  ? 0.6113 1.0892 0.8006 -0.0763 -0.0493 -0.0558 138 VAL A N   
83   C CA  . VAL A 30  ? 0.6413 1.0815 0.8420 -0.0728 -0.0384 -0.0578 138 VAL A CA  
84   C C   . VAL A 30  ? 0.6814 1.1047 0.8935 -0.0783 -0.0361 -0.0355 138 VAL A C   
85   O O   . VAL A 30  ? 0.6341 1.0791 0.8422 -0.0818 -0.0429 -0.0193 138 VAL A O   
86   C CB  . VAL A 30  ? 0.7002 1.1365 0.9020 -0.0518 -0.0317 -0.0511 138 VAL A CB  
87   C CG1 . VAL A 30  ? 0.6955 1.1513 0.8834 -0.0458 -0.0315 -0.0712 138 VAL A CG1 
88   C CG2 . VAL A 30  ? 0.6677 1.1234 0.8716 -0.0422 -0.0361 -0.0226 138 VAL A CG2 
89   N N   . LEU A 31  ? 0.6788 1.0636 0.9057 -0.0784 -0.0243 -0.0343 139 LEU A N   
90   C CA  . LEU A 31  ? 0.6802 1.0472 0.9176 -0.0800 -0.0191 -0.0076 139 LEU A CA  
91   C C   . LEU A 31  ? 0.7335 1.0993 0.9757 -0.0575 -0.0159 0.0184  139 LEU A C   
92   O O   . LEU A 31  ? 0.7233 1.0813 0.9705 -0.0426 -0.0106 0.0103  139 LEU A O   
93   C CB  . LEU A 31  ? 0.7267 1.0496 0.9831 -0.0909 -0.0046 -0.0166 139 LEU A CB  
94   C CG  . LEU A 31  ? 0.8047 1.1273 1.0648 -0.1166 -0.0055 -0.0368 139 LEU A CG  
95   C CD1 . LEU A 31  ? 0.7606 1.1287 1.0049 -0.1257 -0.0214 -0.0367 139 LEU A CD1 
96   C CD2 . LEU A 31  ? 0.8728 1.1783 1.1419 -0.1263 0.0009  -0.0757 139 LEU A CD2 
97   N N   . ALA A 32  ? 0.7023 1.0805 0.9435 -0.0549 -0.0188 0.0493  140 ALA A N   
98   C CA  . ALA A 32  ? 0.6992 1.0858 0.9469 -0.0337 -0.0179 0.0782  140 ALA A CA  
99   C C   . ALA A 32  ? 0.7944 1.1342 1.0657 -0.0200 -0.0007 0.0865  140 ALA A C   
100  O O   . ALA A 32  ? 0.8124 1.1129 1.0948 -0.0316 0.0111  0.0785  140 ALA A O   
101  C CB  . ALA A 32  ? 0.6924 1.1070 0.9314 -0.0374 -0.0247 0.1071  140 ALA A CB  
102  N N   . GLY A 33  ? 0.7564 1.1006 1.0393 0.0037  0.0021  0.0985  141 GLY A N   
103  C CA  . GLY A 33  ? 0.7929 1.0944 1.1038 0.0219  0.0205  0.1069  141 GLY A CA  
104  C C   . GLY A 33  ? 0.8654 1.1429 1.1837 0.0240  0.0309  0.0686  141 GLY A C   
105  O O   . GLY A 33  ? 0.9083 1.1611 1.2507 0.0441  0.0458  0.0717  141 GLY A O   
106  N N   . GLN A 34  ? 0.7800 1.0678 1.0784 0.0041  0.0239  0.0324  142 GLN A N   
107  C CA  . GLN A 34  ? 0.7833 1.0595 1.0804 0.0021  0.0314  -0.0077 142 GLN A CA  
108  C C   . GLN A 34  ? 0.8296 1.1326 1.1237 0.0221  0.0303  -0.0103 142 GLN A C   
109  O O   . GLN A 34  ? 0.7906 1.1323 1.0775 0.0308  0.0182  0.0123  142 GLN A O   
110  C CB  . GLN A 34  ? 0.7732 1.0674 1.0474 -0.0230 0.0206  -0.0381 142 GLN A CB  
111  C CG  . GLN A 34  ? 0.9585 1.2166 1.2439 -0.0438 0.0306  -0.0619 142 GLN A CG  
112  C CD  . GLN A 34  ? 1.2249 1.5100 1.4905 -0.0658 0.0189  -0.0939 142 GLN A CD  
113  O OE1 . GLN A 34  ? 1.0987 1.4223 1.3458 -0.0720 0.0021  -0.0849 142 GLN A OE1 
114  N NE2 . GLN A 34  ? 1.2705 1.5371 1.5429 -0.0789 0.0284  -0.1324 142 GLN A NE2 
115  N N   . PHE A 35  ? 0.8099 1.0940 1.1103 0.0274  0.0446  -0.0410 143 PHE A N   
116  C CA  . PHE A 35  ? 0.7918 1.1001 1.0890 0.0444  0.0473  -0.0490 143 PHE A CA  
117  C C   . PHE A 35  ? 0.8372 1.1851 1.1009 0.0302  0.0338  -0.0703 143 PHE A C   
118  O O   . PHE A 35  ? 0.8681 1.2107 1.1176 0.0125  0.0336  -0.1007 143 PHE A O   
119  C CB  . PHE A 35  ? 0.8529 1.1243 1.1707 0.0552  0.0712  -0.0754 143 PHE A CB  
120  C CG  . PHE A 35  ? 0.8554 1.1534 1.1699 0.0721  0.0766  -0.0855 143 PHE A CG  
121  C CD1 . PHE A 35  ? 0.8894 1.1938 1.2295 0.0988  0.0832  -0.0588 143 PHE A CD1 
122  C CD2 . PHE A 35  ? 0.8594 1.1816 1.1453 0.0619  0.0750  -0.1196 143 PHE A CD2 
123  C CE1 . PHE A 35  ? 0.8841 1.2154 1.2239 0.1136  0.0899  -0.0687 143 PHE A CE1 
124  C CE2 . PHE A 35  ? 0.8793 1.2281 1.1610 0.0771  0.0821  -0.1269 143 PHE A CE2 
125  C CZ  . PHE A 35  ? 0.8537 1.2053 1.1635 0.1021  0.0903  -0.1027 143 PHE A CZ  
126  N N   . VAL A 36  ? 0.7361 1.1258 0.9897 0.0379  0.0234  -0.0537 144 VAL A N   
127  C CA  . VAL A 36  ? 0.6833 1.1103 0.9093 0.0278  0.0128  -0.0654 144 VAL A CA  
128  C C   . VAL A 36  ? 0.7027 1.1583 0.9271 0.0432  0.0175  -0.0631 144 VAL A C   
129  O O   . VAL A 36  ? 0.6901 1.1552 0.9334 0.0582  0.0193  -0.0412 144 VAL A O   
130  C CB  . VAL A 36  ? 0.6914 1.1414 0.9070 0.0144  -0.0043 -0.0468 144 VAL A CB  
131  C CG1 . VAL A 36  ? 0.6714 1.1482 0.8625 0.0023  -0.0122 -0.0619 144 VAL A CG1 
132  C CG2 . VAL A 36  ? 0.7035 1.1274 0.9274 0.0029  -0.0072 -0.0386 144 VAL A CG2 
133  N N   . LYS A 37  ? 0.6445 1.1205 0.8457 0.0385  0.0184  -0.0838 145 LYS A N   
134  C CA  . LYS A 37  ? 0.6217 1.1292 0.8159 0.0493  0.0238  -0.0825 145 LYS A CA  
135  C C   . LYS A 37  ? 0.6712 1.2117 0.8419 0.0383  0.0127  -0.0774 145 LYS A C   
136  O O   . LYS A 37  ? 0.6511 1.1920 0.8054 0.0239  0.0037  -0.0871 145 LYS A O   
137  C CB  . LYS A 37  ? 0.6829 1.1846 0.8684 0.0555  0.0400  -0.1133 145 LYS A CB  
138  C CG  . LYS A 37  ? 0.8944 1.3686 1.1085 0.0729  0.0577  -0.1183 145 LYS A CG  
139  C CD  . LYS A 37  ? 0.9442 1.4050 1.1483 0.0726  0.0750  -0.1593 145 LYS A CD  
140  C CE  . LYS A 37  ? 0.8394 1.3410 1.0067 0.0672  0.0747  -0.1765 145 LYS A CE  
141  N NZ  . LYS A 37  ? 0.9411 1.4348 1.0950 0.0630  0.0898  -0.2209 145 LYS A NZ  
142  N N   . LEU A 38  ? 0.6590 1.2284 0.8314 0.0459  0.0155  -0.0625 146 LEU A N   
143  C CA  . LEU A 38  ? 0.6504 1.2511 0.8060 0.0406  0.0118  -0.0539 146 LEU A CA  
144  C C   . LEU A 38  ? 0.7297 1.3502 0.8774 0.0531  0.0273  -0.0605 146 LEU A C   
145  O O   . LEU A 38  ? 0.7132 1.3302 0.8809 0.0654  0.0376  -0.0592 146 LEU A O   
146  C CB  . LEU A 38  ? 0.6149 1.2279 0.7891 0.0371  0.0055  -0.0287 146 LEU A CB  
147  C CG  . LEU A 38  ? 0.6443 1.2591 0.8135 0.0222  -0.0071 -0.0208 146 LEU A CG  
148  C CD1 . LEU A 38  ? 0.6435 1.2345 0.8055 0.0128  -0.0160 -0.0332 146 LEU A CD1 
149  C CD2 . LEU A 38  ? 0.6338 1.2577 0.8250 0.0178  -0.0105 -0.0029 146 LEU A CD2 
150  N N   . CYS A 39  ? 0.7229 1.3663 0.8417 0.0510  0.0297  -0.0680 147 CYS A N   
151  C CA  . CYS A 39  ? 0.7596 1.4250 0.8659 0.0621  0.0462  -0.0748 147 CYS A CA  
152  C C   . CYS A 39  ? 0.7648 1.4642 0.8598 0.0636  0.0505  -0.0533 147 CYS A C   
153  O O   . CYS A 39  ? 0.7217 1.4330 0.8037 0.0561  0.0407  -0.0415 147 CYS A O   
154  C CB  . CYS A 39  ? 0.8293 1.4937 0.9097 0.0615  0.0518  -0.1089 147 CYS A CB  
155  S SG  . CYS A 39  ? 0.9194 1.5355 1.0202 0.0602  0.0543  -0.1367 147 CYS A SG  
156  N N   . CYS A 40  ? 0.7346 1.4501 0.8374 0.0743  0.0674  -0.0473 148 CYS A N   
157  C CA  . CYS A 40  ? 0.7262 1.4736 0.8194 0.0775  0.0783  -0.0270 148 CYS A CA  
158  C C   . CYS A 40  ? 0.8121 1.5770 0.8940 0.0890  0.0983  -0.0400 148 CYS A C   
159  O O   . CYS A 40  ? 0.8043 1.5584 0.9101 0.0969  0.1074  -0.0499 148 CYS A O   
160  C CB  . CYS A 40  ? 0.6935 1.4434 0.8207 0.0747  0.0805  0.0002  148 CYS A CB  
161  S SG  . CYS A 40  ? 0.7494 1.5319 0.8701 0.0770  0.0977  0.0290  148 CYS A SG  
162  N N   . ARG A 41  ? 0.8171 1.6120 0.8624 0.0911  0.1054  -0.0401 149 ARG A N   
163  C CA  . ARG A 41  ? 0.8553 1.6721 0.8843 0.1013  0.1266  -0.0545 149 ARG A CA  
164  C C   . ARG A 41  ? 0.9354 1.7909 0.9447 0.1049  0.1392  -0.0267 149 ARG A C   
165  O O   . ARG A 41  ? 0.9503 1.8228 0.9347 0.1008  0.1295  -0.0109 149 ARG A O   
166  C CB  . ARG A 41  ? 0.8907 1.7073 0.8871 0.0996  0.1247  -0.0945 149 ARG A CB  
167  C CG  . ARG A 41  ? 1.1205 1.9329 1.1240 0.1099  0.1461  -0.1231 149 ARG A CG  
168  C CD  . ARG A 41  ? 1.3106 2.1266 1.2804 0.1054  0.1480  -0.1671 149 ARG A CD  
169  N NE  . ARG A 41  ? 1.3831 2.2086 1.3496 0.1159  0.1743  -0.1945 149 ARG A NE  
170  C CZ  . ARG A 41  ? 1.5127 2.3039 1.5053 0.1210  0.1856  -0.2260 149 ARG A CZ  
171  N NH1 . ARG A 41  ? 1.3257 2.1282 1.3161 0.1312  0.2120  -0.2517 149 ARG A NH1 
172  N NH2 . ARG A 41  ? 1.2801 2.0253 1.3028 0.1167  0.1725  -0.2308 149 ARG A NH2 
173  N N   . ALA A 42  ? 0.9057 1.7754 0.9309 0.1131  0.1616  -0.0172 150 ALA A N   
174  C CA  . ALA A 42  ? 0.9412 1.8466 0.9524 0.1176  0.1803  0.0115  150 ALA A CA  
175  C C   . ALA A 42  ? 1.0622 2.0031 1.0282 0.1255  0.1969  -0.0072 150 ALA A C   
176  O O   . ALA A 42  ? 1.0731 2.0069 1.0295 0.1278  0.1984  -0.0461 150 ALA A O   
177  C CB  . ALA A 42  ? 0.9331 1.8369 0.9915 0.1195  0.1975  0.0306  150 ALA A CB  
178  N N   . THR A 43  ? 1.0573 2.0366 0.9976 0.1298  0.2118  0.0211  151 THR A N   
179  C CA  . THR A 43  ? 1.1157 2.1387 1.0084 0.1371  0.2297  0.0083  151 THR A CA  
180  C C   . THR A 43  ? 1.1862 2.2099 1.1010 0.1446  0.2562  -0.0108 151 THR A C   
181  O O   . THR A 43  ? 1.2210 2.2609 1.1082 0.1489  0.2670  -0.0468 151 THR A O   
182  C CB  . THR A 43  ? 1.2215 2.2875 1.0818 0.1413  0.2387  0.0522  151 THR A CB  
183  O OG1 . THR A 43  ? 1.1969 2.2675 1.0879 0.1455  0.2651  0.0862  151 THR A OG1 
184  C CG2 . THR A 43  ? 1.1667 2.2285 1.0213 0.1367  0.2144  0.0788  151 THR A CG2 
185  N N   . GLY A 44  ? 1.1083 2.1156 1.0760 0.1453  0.2661  0.0107  152 GLY A N   
186  C CA  . GLY A 44  ? 1.1045 2.1151 1.1058 0.1529  0.2898  -0.0013 152 GLY A CA  
187  C C   . GLY A 44  ? 1.1442 2.1245 1.1726 0.1570  0.2837  -0.0404 152 GLY A C   
188  O O   . GLY A 44  ? 1.1693 2.1580 1.2204 0.1667  0.3052  -0.0550 152 GLY A O   
189  N N   . HIS A 45  ? 1.0689 2.0143 1.0978 0.1508  0.2564  -0.0558 153 HIS A N   
190  C CA  . HIS A 45  ? 1.0556 1.9657 1.1117 0.1549  0.2496  -0.0879 153 HIS A CA  
191  C C   . HIS A 45  ? 1.1790 2.0980 1.2287 0.1666  0.2741  -0.1246 153 HIS A C   
192  O O   . HIS A 45  ? 1.2422 2.1881 1.2427 0.1658  0.2847  -0.1428 153 HIS A O   
193  C CB  . HIS A 45  ? 1.0513 1.9312 1.0893 0.1450  0.2222  -0.1036 153 HIS A CB  
194  C CG  . HIS A 45  ? 1.0843 1.9227 1.1562 0.1489  0.2161  -0.1280 153 HIS A CG  
195  N ND1 . HIS A 45  ? 1.0601 1.8721 1.1757 0.1478  0.2008  -0.1092 153 HIS A ND1 
196  C CD2 . HIS A 45  ? 1.1363 1.9572 1.2059 0.1546  0.2261  -0.1676 153 HIS A CD2 
197  C CE1 . HIS A 45  ? 1.0588 1.8387 1.1959 0.1545  0.2010  -0.1328 153 HIS A CE1 
198  N NE2 . HIS A 45  ? 1.1100 1.8903 1.2237 0.1587  0.2172  -0.1688 153 HIS A NE2 
199  N N   . PRO A 46  ? 1.1117 2.0126 1.2108 0.1783  0.2843  -0.1362 154 PRO A N   
200  C CA  . PRO A 46  ? 1.0531 1.9316 1.2107 0.1813  0.2720  -0.1168 154 PRO A CA  
201  C C   . PRO A 46  ? 1.0469 1.9563 1.2429 0.1850  0.2856  -0.0874 154 PRO A C   
202  O O   . PRO A 46  ? 1.0057 1.9103 1.2543 0.1901  0.2808  -0.0767 154 PRO A O   
203  C CB  . PRO A 46  ? 1.0980 1.9466 1.2823 0.1945  0.2786  -0.1483 154 PRO A CB  
204  C CG  . PRO A 46  ? 1.2090 2.0795 1.3695 0.2034  0.3095  -0.1793 154 PRO A CG  
205  C CD  . PRO A 46  ? 1.1696 2.0753 1.2694 0.1913  0.3110  -0.1731 154 PRO A CD  
206  N N   . PHE A 47  ? 1.0037 1.9481 1.1738 0.1815  0.3026  -0.0733 155 PHE A N   
207  C CA  . PHE A 47  ? 0.9774 1.9533 1.1823 0.1825  0.3210  -0.0475 155 PHE A CA  
208  C C   . PHE A 47  ? 0.9646 1.9425 1.1814 0.1669  0.3084  -0.0109 155 PHE A C   
209  O O   . PHE A 47  ? 0.9711 1.9747 1.1816 0.1619  0.3256  0.0129  155 PHE A O   
210  C CB  . PHE A 47  ? 1.0459 2.0589 1.2238 0.1899  0.3542  -0.0545 155 PHE A CB  
211  C CG  . PHE A 47  ? 1.1032 2.1124 1.2765 0.2047  0.3697  -0.0956 155 PHE A CG  
212  C CD1 . PHE A 47  ? 1.1843 2.1974 1.2982 0.2044  0.3755  -0.1243 155 PHE A CD1 
213  C CD2 . PHE A 47  ? 1.1146 2.1183 1.3456 0.2189  0.3787  -0.1069 155 PHE A CD2 
214  C CE1 . PHE A 47  ? 1.2270 2.2332 1.3404 0.2162  0.3927  -0.1675 155 PHE A CE1 
215  C CE2 . PHE A 47  ? 1.1817 2.1766 1.4144 0.2339  0.3961  -0.1451 155 PHE A CE2 
216  C CZ  . PHE A 47  ? 1.2026 2.1956 1.3771 0.2315  0.4040  -0.1772 155 PHE A CZ  
217  N N   . VAL A 48  ? 0.8562 1.8053 1.0926 0.1594  0.2804  -0.0068 156 VAL A N   
218  C CA  . VAL A 48  ? 0.8090 1.7527 1.0618 0.1436  0.2662  0.0206  156 VAL A CA  
219  C C   . VAL A 48  ? 0.8003 1.7277 1.0982 0.1407  0.2447  0.0180  156 VAL A C   
220  O O   . VAL A 48  ? 0.8189 1.7349 1.1290 0.1525  0.2390  -0.0009 156 VAL A O   
221  C CB  . VAL A 48  ? 0.8568 1.7839 1.0614 0.1343  0.2504  0.0291  156 VAL A CB  
222  C CG1 . VAL A 48  ? 0.8923 1.8448 1.0504 0.1372  0.2694  0.0392  156 VAL A CG1 
223  C CG2 . VAL A 48  ? 0.8502 1.7462 1.0326 0.1354  0.2263  0.0051  156 VAL A CG2 
224  N N   . GLN A 49  ? 0.6745 1.6002 0.9956 0.1253  0.2333  0.0368  157 GLN A N   
225  C CA  . GLN A 49  ? 0.6097 1.5260 0.9662 0.1201  0.2109  0.0352  157 GLN A CA  
226  C C   . GLN A 49  ? 0.6334 1.5184 0.9634 0.1085  0.1874  0.0379  157 GLN A C   
227  O O   . GLN A 49  ? 0.6408 1.5207 0.9472 0.0994  0.1900  0.0505  157 GLN A O   
228  C CB  . GLN A 49  ? 0.5879 1.5342 0.9983 0.1093  0.2170  0.0477  157 GLN A CB  
229  C CG  . GLN A 49  ? 0.6493 1.6296 1.1007 0.1221  0.2317  0.0417  157 GLN A CG  
230  C CD  . GLN A 49  ? 0.6763 1.6945 1.1827 0.1086  0.2401  0.0516  157 GLN A CD  
231  O OE1 . GLN A 49  ? 0.6309 1.6592 1.1422 0.0960  0.2596  0.0638  157 GLN A OE1 
232  N NE2 . GLN A 49  ? 0.3219 1.3656 0.8736 0.1115  0.2273  0.0470  157 GLN A NE2 
233  N N   . TYR A 50  ? 0.5510 1.4163 0.8859 0.1106  0.1660  0.0281  158 TYR A N   
234  C CA  . TYR A 50  ? 0.5232 1.3608 0.8385 0.0997  0.1437  0.0291  158 TYR A CA  
235  C C   . TYR A 50  ? 0.5285 1.3724 0.8813 0.0909  0.1281  0.0343  158 TYR A C   
236  O O   . TYR A 50  ? 0.5590 1.4199 0.9433 0.0997  0.1270  0.0319  158 TYR A O   
237  C CB  . TYR A 50  ? 0.5537 1.3615 0.8389 0.1085  0.1329  0.0113  158 TYR A CB  
238  C CG  . TYR A 50  ? 0.6091 1.4144 0.8524 0.1151  0.1454  -0.0011 158 TYR A CG  
239  C CD1 . TYR A 50  ? 0.6397 1.4407 0.8443 0.1064  0.1405  0.0031  158 TYR A CD1 
240  C CD2 . TYR A 50  ? 0.6422 1.4520 0.8844 0.1304  0.1615  -0.0188 158 TYR A CD2 
241  C CE1 . TYR A 50  ? 0.6715 1.4800 0.8344 0.1116  0.1497  -0.0095 158 TYR A CE1 
242  C CE2 . TYR A 50  ? 0.6951 1.5073 0.8956 0.1344  0.1729  -0.0355 158 TYR A CE2 
243  C CZ  . TYR A 50  ? 0.8105 1.6253 0.9696 0.1244  0.1659  -0.0307 158 TYR A CZ  
244  O OH  . TYR A 50  ? 0.8911 1.7190 1.0064 0.1276  0.1757  -0.0473 158 TYR A OH  
245  N N   . GLN A 51  ? 0.4216 1.2559 0.7717 0.0742  0.1164  0.0413  159 GLN A N   
246  C CA  . GLN A 51  ? 0.3705 1.2118 0.7478 0.0630  0.0999  0.0427  159 GLN A CA  
247  C C   . GLN A 51  ? 0.4392 1.2522 0.7916 0.0511  0.0849  0.0431  159 GLN A C   
248  O O   . GLN A 51  ? 0.4391 1.2445 0.7803 0.0420  0.0919  0.0499  159 GLN A O   
249  C CB  . GLN A 51  ? 0.3509 1.2270 0.7711 0.0497  0.1092  0.0479  159 GLN A CB  
250  C CG  . GLN A 51  ? 0.3939 1.2842 0.8382 0.0354  0.0904  0.0448  159 GLN A CG  
251  C CD  . GLN A 51  ? 0.5400 1.4448 0.9952 0.0486  0.0739  0.0429  159 GLN A CD  
252  O OE1 . GLN A 51  ? 0.5021 1.4389 0.9862 0.0602  0.0792  0.0440  159 GLN A OE1 
253  N NE2 . GLN A 51  ? 0.3788 1.2630 0.8147 0.0479  0.0547  0.0426  159 GLN A NE2 
254  N N   . TRP A 52  ? 0.4238 1.2223 0.7700 0.0527  0.0661  0.0382  160 TRP A N   
255  C CA  . TRP A 52  ? 0.4385 1.2121 0.7642 0.0416  0.0510  0.0373  160 TRP A CA  
256  C C   . TRP A 52  ? 0.4827 1.2712 0.8315 0.0244  0.0420  0.0393  160 TRP A C   
257  O O   . TRP A 52  ? 0.4705 1.2892 0.8488 0.0230  0.0388  0.0393  160 TRP A O   
258  C CB  . TRP A 52  ? 0.4432 1.1919 0.7505 0.0511  0.0386  0.0309  160 TRP A CB  
259  C CG  . TRP A 52  ? 0.4964 1.2246 0.7740 0.0615  0.0460  0.0217  160 TRP A CG  
260  C CD1 . TRP A 52  ? 0.5576 1.2887 0.8352 0.0773  0.0589  0.0143  160 TRP A CD1 
261  C CD2 . TRP A 52  ? 0.5080 1.2154 0.7526 0.0557  0.0414  0.0160  160 TRP A CD2 
262  N NE1 . TRP A 52  ? 0.5762 1.2897 0.8199 0.0801  0.0627  0.0015  160 TRP A NE1 
263  C CE2 . TRP A 52  ? 0.5929 1.2938 0.8162 0.0670  0.0507  0.0029  160 TRP A CE2 
264  C CE3 . TRP A 52  ? 0.5116 1.2092 0.7445 0.0421  0.0310  0.0196  160 TRP A CE3 
265  C CZ2 . TRP A 52  ? 0.6030 1.2925 0.7923 0.0635  0.0473  -0.0076 160 TRP A CZ2 
266  C CZ3 . TRP A 52  ? 0.5488 1.2343 0.7512 0.0409  0.0278  0.0125  160 TRP A CZ3 
267  C CH2 . TRP A 52  ? 0.5867 1.2699 0.7670 0.0508  0.0346  -0.0015 160 TRP A CH2 
268  N N   . PHE A 53  ? 0.4279 1.1989 0.7638 0.0114  0.0374  0.0394  161 PHE A N   
269  C CA  . PHE A 53  ? 0.4025 1.1846 0.7573 -0.0072 0.0311  0.0366  161 PHE A CA  
270  C C   . PHE A 53  ? 0.4483 1.2067 0.7815 -0.0135 0.0174  0.0340  161 PHE A C   
271  O O   . PHE A 53  ? 0.4632 1.1968 0.7725 -0.0098 0.0182  0.0359  161 PHE A O   
272  C CB  . PHE A 53  ? 0.4083 1.1949 0.7827 -0.0204 0.0483  0.0387  161 PHE A CB  
273  C CG  . PHE A 53  ? 0.4106 1.2242 0.8157 -0.0211 0.0652  0.0406  161 PHE A CG  
274  C CD1 . PHE A 53  ? 0.4297 1.2737 0.8731 -0.0380 0.0677  0.0317  161 PHE A CD1 
275  C CD2 . PHE A 53  ? 0.4574 1.2696 0.8543 -0.0070 0.0802  0.0494  161 PHE A CD2 
276  C CE1 . PHE A 53  ? 0.4310 1.3022 0.9081 -0.0414 0.0850  0.0320  161 PHE A CE1 
277  C CE2 . PHE A 53  ? 0.5054 1.3443 0.9334 -0.0085 0.0982  0.0518  161 PHE A CE2 
278  C CZ  . PHE A 53  ? 0.4512 1.3193 0.9213 -0.0257 0.1001  0.0432  161 PHE A CZ  
279  N N   . LYS A 54  ? 0.4174 1.1886 0.7593 -0.0239 0.0052  0.0297  162 LYS A N   
280  C CA  . LYS A 54  ? 0.4320 1.1844 0.7573 -0.0337 -0.0048 0.0267  162 LYS A CA  
281  C C   . LYS A 54  ? 0.4992 1.2643 0.8471 -0.0530 0.0039  0.0194  162 LYS A C   
282  O O   . LYS A 54  ? 0.4913 1.2886 0.8626 -0.0644 0.0032  0.0116  162 LYS A O   
283  C CB  . LYS A 54  ? 0.4473 1.2067 0.7655 -0.0332 -0.0211 0.0279  162 LYS A CB  
284  C CG  . LYS A 54  ? 0.4266 1.1632 0.7257 -0.0422 -0.0281 0.0256  162 LYS A CG  
285  C CD  . LYS A 54  ? 0.5226 1.2636 0.8127 -0.0408 -0.0413 0.0311  162 LYS A CD  
286  C CE  . LYS A 54  ? 0.5334 1.2555 0.8071 -0.0520 -0.0461 0.0282  162 LYS A CE  
287  N NZ  . LYS A 54  ? 0.5257 1.2592 0.7923 -0.0526 -0.0570 0.0367  162 LYS A NZ  
288  N N   . MET A 55  ? 0.4502 1.1934 0.7955 -0.0553 0.0149  0.0220  163 MET A N   
289  C CA  . MET A 55  ? 0.4342 1.1806 0.8072 -0.0709 0.0300  0.0170  163 MET A CA  
290  C C   . MET A 55  ? 0.4920 1.2634 0.8964 -0.0751 0.0437  0.0150  163 MET A C   
291  O O   . MET A 55  ? 0.5278 1.2994 0.9293 -0.0616 0.0514  0.0257  163 MET A O   
292  C CB  . MET A 55  ? 0.4373 1.1899 0.8171 -0.0891 0.0237  0.0025  163 MET A CB  
293  C CG  . MET A 55  ? 0.4489 1.1825 0.8433 -0.0984 0.0380  0.0002  163 MET A CG  
294  S SD  . MET A 55  ? 0.4405 1.1572 0.8162 -0.1038 0.0275  -0.0053 163 MET A SD  
295  C CE  . MET A 55  ? 0.3815 1.0900 0.7972 -0.1202 0.0516  -0.0157 163 MET A CE  
296  N N   . ASN A 56  ? 0.4105 1.2076 0.8444 -0.0944 0.0465  -0.0008 164 ASN A N   
297  C CA  . ASN A 56  ? 0.3917 1.2178 0.8613 -0.1020 0.0598  -0.0060 164 ASN A CA  
298  C C   . ASN A 56  ? 0.4309 1.2986 0.9031 -0.0972 0.0441  -0.0096 164 ASN A C   
299  O O   . ASN A 56  ? 0.4373 1.3377 0.9413 -0.1036 0.0523  -0.0153 164 ASN A O   
300  C CB  . ASN A 56  ? 0.3557 1.1892 0.8640 -0.1284 0.0759  -0.0248 164 ASN A CB  
301  C CG  . ASN A 56  ? 0.7274 1.5784 1.2355 -0.1474 0.0633  -0.0473 164 ASN A CG  
302  O OD1 . ASN A 56  ? 0.4886 1.3325 0.9638 -0.1414 0.0451  -0.0448 164 ASN A OD1 
303  N ND2 . ASN A 56  ? 0.7072 1.5811 1.2537 -0.1731 0.0759  -0.0716 164 ASN A ND2 
304  N N   . LYS A 57  ? 0.3692 1.2370 0.8121 -0.0853 0.0230  -0.0043 165 LYS A N   
305  C CA  . LYS A 57  ? 0.3496 1.2557 0.7961 -0.0759 0.0081  -0.0014 165 LYS A CA  
306  C C   . LYS A 57  ? 0.4394 1.3337 0.8789 -0.0511 0.0128  0.0135  165 LYS A C   
307  O O   . LYS A 57  ? 0.4556 1.3112 0.8657 -0.0370 0.0124  0.0221  165 LYS A O   
308  C CB  . LYS A 57  ? 0.3473 1.2551 0.7680 -0.0734 -0.0131 0.0015  165 LYS A CB  
309  C CG  . LYS A 57  ? 0.4429 1.3983 0.8718 -0.0655 -0.0290 0.0075  165 LYS A CG  
310  C CD  . LYS A 57  ? 0.4965 1.4355 0.8968 -0.0482 -0.0441 0.0243  165 LYS A CD  
311  N N   . GLU A 58  ? 0.4043 1.3349 0.8727 -0.0472 0.0185  0.0136  166 GLU A N   
312  C CA  . GLU A 58  ? 0.4119 1.3377 0.8783 -0.0242 0.0256  0.0245  166 GLU A CA  
313  C C   . GLU A 58  ? 0.5113 1.4398 0.9639 -0.0048 0.0080  0.0335  166 GLU A C   
314  O O   . GLU A 58  ? 0.5238 1.4955 0.9957 -0.0049 -0.0043 0.0350  166 GLU A O   
315  C CB  . GLU A 58  ? 0.4149 1.3835 0.9228 -0.0279 0.0388  0.0211  166 GLU A CB  
316  C CG  . GLU A 58  ? 0.4480 1.4028 0.9551 -0.0122 0.0584  0.0291  166 GLU A CG  
317  C CD  . GLU A 58  ? 0.6421 1.6420 1.1933 -0.0156 0.0727  0.0264  166 GLU A CD  
318  O OE1 . GLU A 58  ? 0.4689 1.5167 1.0475 -0.0140 0.0611  0.0235  166 GLU A OE1 
319  O OE2 . GLU A 58  ? 0.7770 1.7683 1.3372 -0.0198 0.0960  0.0290  166 GLU A OE2 
320  N N   . ILE A 59  ? 0.4782 1.3616 0.8979 0.0099  0.0063  0.0395  167 ILE A N   
321  C CA  . ILE A 59  ? 0.4651 1.3406 0.8750 0.0286  -0.0057 0.0491  167 ILE A CA  
322  C C   . ILE A 59  ? 0.5182 1.4248 0.9569 0.0481  -0.0006 0.0556  167 ILE A C   
323  O O   . ILE A 59  ? 0.5146 1.4138 0.9571 0.0568  0.0159  0.0523  167 ILE A O   
324  C CB  . ILE A 59  ? 0.4982 1.3184 0.8735 0.0382  -0.0031 0.0486  167 ILE A CB  
325  C CG1 . ILE A 59  ? 0.4706 1.2652 0.8214 0.0215  -0.0108 0.0447  167 ILE A CG1 
326  C CG2 . ILE A 59  ? 0.5380 1.3452 0.9132 0.0602  -0.0072 0.0573  167 ILE A CG2 
327  C CD1 . ILE A 59  ? 0.5242 1.2781 0.8474 0.0245  -0.0055 0.0399  167 ILE A CD1 
328  N N   . PRO A 60  ? 0.4841 1.4307 0.9444 0.0560  -0.0136 0.0659  168 PRO A N   
329  C CA  . PRO A 60  ? 0.4886 1.4664 0.9811 0.0780  -0.0079 0.0740  168 PRO A CA  
330  C C   . PRO A 60  ? 0.5951 1.5260 1.0745 0.1035  0.0007  0.0795  168 PRO A C   
331  O O   . PRO A 60  ? 0.6138 1.5012 1.0660 0.1058  -0.0050 0.0826  168 PRO A O   
332  C CB  . PRO A 60  ? 0.4916 1.5264 1.0071 0.0803  -0.0271 0.0870  168 PRO A CB  
333  C CG  . PRO A 60  ? 0.5307 1.5510 1.0175 0.0661  -0.0421 0.0888  168 PRO A CG  
334  C CD  . PRO A 60  ? 0.4859 1.4534 0.9414 0.0482  -0.0335 0.0732  168 PRO A CD  
335  N N   . ASN A 61  ? 0.5618 1.5002 1.0613 0.1200  0.0172  0.0772  169 ASN A N   
336  C CA  . ASN A 61  ? 0.5920 1.4901 1.0851 0.1436  0.0308  0.0758  169 ASN A CA  
337  C C   . ASN A 61  ? 0.6562 1.4966 1.1062 0.1361  0.0396  0.0601  169 ASN A C   
338  O O   . ASN A 61  ? 0.7136 1.5182 1.1552 0.1519  0.0502  0.0536  169 ASN A O   
339  C CB  . ASN A 61  ? 0.6527 1.5482 1.1640 0.1675  0.0230  0.0945  169 ASN A CB  
340  C CG  . ASN A 61  ? 0.9633 1.9261 1.5193 0.1791  0.0142  0.1124  169 ASN A CG  
341  O OD1 . ASN A 61  ? 0.9352 1.9359 1.5239 0.1881  0.0251  0.1100  169 ASN A OD1 
342  N ND2 . ASN A 61  ? 0.8159 1.8004 1.3746 0.1791  -0.0060 0.1315  169 ASN A ND2 
343  N N   . GLY A 62  ? 0.5528 1.3885 0.9796 0.1125  0.0365  0.0530  170 GLY A N   
344  C CA  . GLY A 62  ? 0.5370 1.3323 0.9250 0.1041  0.0428  0.0405  170 GLY A CA  
345  C C   . GLY A 62  ? 0.5637 1.3715 0.9496 0.1031  0.0618  0.0336  170 GLY A C   
346  O O   . GLY A 62  ? 0.5557 1.3597 0.9235 0.0880  0.0647  0.0320  170 GLY A O   
347  N N   . ASN A 63  ? 0.5349 1.3578 0.9409 0.1210  0.0765  0.0315  171 ASN A N   
348  C CA  . ASN A 63  ? 0.5399 1.3836 0.9526 0.1253  0.0983  0.0272  171 ASN A CA  
349  C C   . ASN A 63  ? 0.6727 1.4901 1.0583 0.1391  0.1145  0.0117  171 ASN A C   
350  O O   . ASN A 63  ? 0.6808 1.5162 1.0747 0.1494  0.1352  0.0064  171 ASN A O   
351  C CB  . ASN A 63  ? 0.4794 1.3698 0.9424 0.1354  0.1030  0.0348  171 ASN A CB  
352  C CG  . ASN A 63  ? 0.7968 1.6889 1.2857 0.1583  0.0976  0.0396  171 ASN A CG  
353  O OD1 . ASN A 63  ? 0.8525 1.7884 1.3842 0.1671  0.0966  0.0490  171 ASN A OD1 
354  N ND2 . ASN A 63  ? 0.6231 1.4703 1.0916 0.1694  0.0953  0.0344  171 ASN A ND2 
355  N N   . THR A 64  ? 0.6733 1.4511 1.0266 0.1369  0.1059  0.0023  172 THR A N   
356  C CA  . THR A 64  ? 0.7130 1.4643 1.0374 0.1450  0.1179  -0.0185 172 THR A CA  
357  C C   . THR A 64  ? 0.7557 1.4906 1.0341 0.1287  0.1109  -0.0252 172 THR A C   
358  O O   . THR A 64  ? 0.7201 1.4532 0.9933 0.1139  0.0951  -0.0133 172 THR A O   
359  C CB  . THR A 64  ? 0.9122 1.6321 1.2513 0.1592  0.1156  -0.0259 172 THR A CB  
360  O OG1 . THR A 64  ? 1.0461 1.7391 1.3588 0.1633  0.1288  -0.0526 172 THR A OG1 
361  C CG2 . THR A 64  ? 0.8729 1.5708 1.2111 0.1495  0.0927  -0.0146 172 THR A CG2 
362  N N   . SER A 65  ? 0.7377 1.4643 0.9846 0.1321  0.1227  -0.0458 173 SER A N   
363  C CA  . SER A 65  ? 0.7320 1.4528 0.9339 0.1199  0.1173  -0.0550 173 SER A CA  
364  C C   . SER A 65  ? 0.7749 1.4670 0.9684 0.1080  0.0959  -0.0560 173 SER A C   
365  O O   . SER A 65  ? 0.7681 1.4647 0.9411 0.0951  0.0846  -0.0477 173 SER A O   
366  C CB  . SER A 65  ? 0.8018 1.5212 0.9769 0.1271  0.1333  -0.0841 173 SER A CB  
367  O OG  . SER A 65  ? 0.9292 1.6506 1.0606 0.1156  0.1260  -0.0956 173 SER A OG  
368  N N   . GLU A 66  ? 0.7286 1.3912 0.9402 0.1133  0.0921  -0.0645 174 GLU A N   
369  C CA  . GLU A 66  ? 0.7012 1.3355 0.9066 0.1018  0.0747  -0.0657 174 GLU A CA  
370  C C   . GLU A 66  ? 0.7345 1.3592 0.9725 0.1036  0.0636  -0.0452 174 GLU A C   
371  O O   . GLU A 66  ? 0.7725 1.3955 1.0403 0.1189  0.0708  -0.0401 174 GLU A O   
372  C CB  . GLU A 66  ? 0.7483 1.3544 0.9349 0.0997  0.0793  -0.0966 174 GLU A CB  
373  C CG  . GLU A 66  ? 0.8944 1.4763 1.1042 0.1153  0.0964  -0.1135 174 GLU A CG  
374  C CD  . GLU A 66  ? 1.2133 1.7727 1.4039 0.1107  0.1068  -0.1523 174 GLU A CD  
375  O OE1 . GLU A 66  ? 1.0522 1.6320 1.2050 0.0987  0.1038  -0.1688 174 GLU A OE1 
376  O OE2 . GLU A 66  ? 1.1542 1.6781 1.3699 0.1194  0.1190  -0.1664 174 GLU A OE2 
377  N N   . LEU A 67  ? 0.6357 1.2612 0.8686 0.0889  0.0467  -0.0318 175 LEU A N   
378  C CA  . LEU A 67  ? 0.6071 1.2311 0.8627 0.0868  0.0341  -0.0128 175 LEU A CA  
379  C C   . LEU A 67  ? 0.6773 1.2623 0.9309 0.0851  0.0288  -0.0186 175 LEU A C   
380  O O   . LEU A 67  ? 0.6667 1.2353 0.8980 0.0712  0.0224  -0.0292 175 LEU A O   
381  C CB  . LEU A 67  ? 0.5672 1.2108 0.8166 0.0698  0.0225  -0.0006 175 LEU A CB  
382  C CG  . LEU A 67  ? 0.5797 1.2323 0.8475 0.0633  0.0093  0.0159  175 LEU A CG  
383  C CD1 . LEU A 67  ? 0.5495 1.2361 0.8490 0.0727  0.0121  0.0280  175 LEU A CD1 
384  C CD2 . LEU A 67  ? 0.5710 1.2315 0.8283 0.0444  0.0010  0.0191  175 LEU A CD2 
385  N N   . ILE A 68  ? 0.6484 1.2201 0.9287 0.1003  0.0333  -0.0103 176 ILE A N   
386  C CA  . ILE A 68  ? 0.6606 1.1907 0.9474 0.1025  0.0345  -0.0125 176 ILE A CA  
387  C C   . ILE A 68  ? 0.7017 1.2321 1.0025 0.1011  0.0215  0.0149  176 ILE A C   
388  O O   . ILE A 68  ? 0.7110 1.2685 1.0347 0.1133  0.0182  0.0371  176 ILE A O   
389  C CB  . ILE A 68  ? 0.7321 1.2398 1.0406 0.1233  0.0548  -0.0238 176 ILE A CB  
390  C CG1 . ILE A 68  ? 0.7553 1.2633 1.0424 0.1212  0.0687  -0.0570 176 ILE A CG1 
391  C CG2 . ILE A 68  ? 0.7618 1.2215 1.0867 0.1274  0.0605  -0.0222 176 ILE A CG2 
392  C CD1 . ILE A 68  ? 0.7875 1.2890 1.0948 0.1417  0.0914  -0.0711 176 ILE A CD1 
393  N N   . PHE A 69  ? 0.6327 1.1365 0.9202 0.0864  0.0147  0.0130  177 PHE A N   
394  C CA  . PHE A 69  ? 0.6107 1.1103 0.9067 0.0838  0.0049  0.0379  177 PHE A CA  
395  C C   . PHE A 69  ? 0.7122 1.1615 1.0217 0.0908  0.0177  0.0352  177 PHE A C   
396  O O   . PHE A 69  ? 0.7251 1.1435 1.0211 0.0761  0.0212  0.0136  177 PHE A O   
397  C CB  . PHE A 69  ? 0.5906 1.0988 0.8633 0.0599  -0.0092 0.0367  177 PHE A CB  
398  C CG  . PHE A 69  ? 0.5493 1.0984 0.8117 0.0511  -0.0170 0.0346  177 PHE A CG  
399  C CD1 . PHE A 69  ? 0.5402 1.1263 0.8114 0.0491  -0.0266 0.0528  177 PHE A CD1 
400  C CD2 . PHE A 69  ? 0.5337 1.0860 0.7790 0.0443  -0.0136 0.0145  177 PHE A CD2 
401  C CE1 . PHE A 69  ? 0.5140 1.1330 0.7821 0.0395  -0.0299 0.0483  177 PHE A CE1 
402  C CE2 . PHE A 69  ? 0.5292 1.1143 0.7701 0.0375  -0.0171 0.0163  177 PHE A CE2 
403  C CZ  . PHE A 69  ? 0.4966 1.1114 0.7512 0.0344  -0.0239 0.0318  177 PHE A CZ  
404  N N   . ASN A 70  ? 0.6968 1.1387 1.0367 0.1139  0.0266  0.0556  178 ASN A N   
405  C CA  . ASN A 70  ? 0.7444 1.1330 1.1062 0.1242  0.0442  0.0554  178 ASN A CA  
406  C C   . ASN A 70  ? 0.8130 1.1692 1.1699 0.1091  0.0419  0.0644  178 ASN A C   
407  O O   . ASN A 70  ? 0.8485 1.1543 1.2144 0.1043  0.0576  0.0466  178 ASN A O   
408  C CB  . ASN A 70  ? 0.7602 1.1509 1.1603 0.1552  0.0548  0.0811  178 ASN A CB  
409  C CG  . ASN A 70  ? 1.0878 1.4521 1.5061 0.1696  0.0779  0.0542  178 ASN A CG  
410  O OD1 . ASN A 70  ? 1.0940 1.4039 1.5286 0.1721  0.0975  0.0400  178 ASN A OD1 
411  N ND2 . ASN A 70  ? 0.8887 1.2907 1.3048 0.1768  0.0781  0.0431  178 ASN A ND2 
412  N N   . ALA A 71  ? 0.7303 1.1173 1.0734 0.0994  0.0238  0.0888  179 ALA A N   
413  C CA  . ALA A 71  ? 0.7344 1.1023 1.0694 0.0835  0.0200  0.1009  179 ALA A CA  
414  C C   . ALA A 71  ? 0.7729 1.1887 1.0821 0.0668  -0.0010 0.1086  179 ALA A C   
415  O O   . ALA A 71  ? 0.7860 1.2315 1.0970 0.0722  -0.0101 0.1397  179 ALA A O   
416  C CB  . ALA A 71  ? 0.7751 1.1215 1.1373 0.1022  0.0294  0.1393  179 ALA A CB  
417  N N   . VAL A 72  ? 0.7001 1.1258 0.9864 0.0472  -0.0078 0.0802  180 VAL A N   
418  C CA  . VAL A 72  ? 0.6615 1.1270 0.9278 0.0309  -0.0237 0.0821  180 VAL A CA  
419  C C   . VAL A 72  ? 0.7295 1.2043 0.9913 0.0228  -0.0305 0.1060  180 VAL A C   
420  O O   . VAL A 72  ? 0.7520 1.1928 1.0173 0.0183  -0.0234 0.1135  180 VAL A O   
421  C CB  . VAL A 72  ? 0.6956 1.1617 0.9420 0.0111  -0.0276 0.0532  180 VAL A CB  
422  C CG1 . VAL A 72  ? 0.6840 1.1769 0.9251 0.0154  -0.0290 0.0392  180 VAL A CG1 
423  C CG2 . VAL A 72  ? 0.7078 1.1322 0.9528 0.0008  -0.0193 0.0326  180 VAL A CG2 
424  N N   . HIS A 73  ? 0.6564 1.1791 0.9095 0.0174  -0.0430 0.1139  181 HIS A N   
425  C CA  . HIS A 73  ? 0.6474 1.1937 0.8897 0.0058  -0.0511 0.1307  181 HIS A CA  
426  C C   . HIS A 73  ? 0.6466 1.2109 0.8734 -0.0156 -0.0573 0.1080  181 HIS A C   
427  O O   . HIS A 73  ? 0.5997 1.1707 0.8267 -0.0165 -0.0574 0.0888  181 HIS A O   
428  C CB  . HIS A 73  ? 0.6643 1.2584 0.9132 0.0183  -0.0593 0.1565  181 HIS A CB  
429  C CG  . HIS A 73  ? 0.7538 1.3344 1.0234 0.0440  -0.0527 0.1836  181 HIS A CG  
430  N ND1 . HIS A 73  ? 0.7871 1.3620 1.0770 0.0633  -0.0465 0.1785  181 HIS A ND1 
431  C CD2 . HIS A 73  ? 0.8120 1.3852 1.0874 0.0545  -0.0496 0.2176  181 HIS A CD2 
432  C CE1 . HIS A 73  ? 0.8153 1.3780 1.1253 0.0857  -0.0398 0.2085  181 HIS A CE1 
433  N NE2 . HIS A 73  ? 0.8371 1.3967 1.1394 0.0817  -0.0412 0.2345  181 HIS A NE2 
434  N N   . VAL A 74  ? 0.6134 1.1841 0.8283 -0.0320 -0.0602 0.1116  182 VAL A N   
435  C CA  . VAL A 74  ? 0.5654 1.1532 0.7702 -0.0514 -0.0639 0.0926  182 VAL A CA  
436  C C   . VAL A 74  ? 0.5787 1.2085 0.7872 -0.0512 -0.0693 0.0857  182 VAL A C   
437  O O   . VAL A 74  ? 0.5532 1.1852 0.7626 -0.0589 -0.0678 0.0666  182 VAL A O   
438  C CB  . VAL A 74  ? 0.6094 1.2049 0.8032 -0.0663 -0.0644 0.1019  182 VAL A CB  
439  C CG1 . VAL A 74  ? 0.5790 1.1992 0.7668 -0.0847 -0.0666 0.0831  182 VAL A CG1 
440  C CG2 . VAL A 74  ? 0.6278 1.1792 0.8226 -0.0705 -0.0564 0.1045  182 VAL A CG2 
441  N N   . LYS A 75  ? 0.5308 1.1950 0.7445 -0.0417 -0.0746 0.1023  183 LYS A N   
442  C CA  . LYS A 75  ? 0.5033 1.2119 0.7256 -0.0436 -0.0790 0.0942  183 LYS A CA  
443  C C   . LYS A 75  ? 0.5660 1.2625 0.7994 -0.0382 -0.0732 0.0777  183 LYS A C   
444  O O   . LYS A 75  ? 0.5602 1.2777 0.7997 -0.0485 -0.0718 0.0629  183 LYS A O   
445  C CB  . LYS A 75  ? 0.5386 1.2917 0.7674 -0.0325 -0.0871 0.1156  183 LYS A CB  
446  C CG  . LYS A 75  ? 0.8782 1.6180 1.1224 -0.0062 -0.0850 0.1347  183 LYS A CG  
447  C CD  . LYS A 75  ? 0.9620 1.7526 1.2152 0.0075  -0.0944 0.1618  183 LYS A CD  
448  C CE  . LYS A 75  ? 1.0330 1.8027 1.3055 0.0363  -0.0892 0.1847  183 LYS A CE  
449  N NZ  . LYS A 75  ? 1.1207 1.9245 1.3975 0.0520  -0.0965 0.2226  183 LYS A NZ  
450  N N   . ASP A 76  ? 0.5267 1.1860 0.7620 -0.0239 -0.0675 0.0788  184 ASP A N   
451  C CA  . ASP A 76  ? 0.4920 1.1383 0.7327 -0.0161 -0.0606 0.0657  184 ASP A CA  
452  C C   . ASP A 76  ? 0.5065 1.1410 0.7384 -0.0289 -0.0574 0.0479  184 ASP A C   
453  O O   . ASP A 76  ? 0.4901 1.1287 0.7256 -0.0253 -0.0520 0.0396  184 ASP A O   
454  C CB  . ASP A 76  ? 0.5365 1.1491 0.7808 0.0015  -0.0541 0.0695  184 ASP A CB  
455  C CG  . ASP A 76  ? 0.7246 1.3529 0.9860 0.0203  -0.0547 0.0899  184 ASP A CG  
456  O OD1 . ASP A 76  ? 0.7350 1.4049 1.0085 0.0238  -0.0585 0.0940  184 ASP A OD1 
457  O OD2 . ASP A 76  ? 0.8467 1.4468 1.1130 0.0316  -0.0505 0.1026  184 ASP A OD2 
458  N N   . ALA A 77  ? 0.4650 1.0883 0.6869 -0.0428 -0.0597 0.0443  185 ALA A N   
459  C CA  . ALA A 77  ? 0.4313 1.0480 0.6487 -0.0530 -0.0572 0.0307  185 ALA A CA  
460  C C   . ALA A 77  ? 0.4915 1.1343 0.7200 -0.0578 -0.0535 0.0262  185 ALA A C   
461  O O   . ALA A 77  ? 0.4913 1.1610 0.7294 -0.0617 -0.0548 0.0288  185 ALA A O   
462  C CB  . ALA A 77  ? 0.4244 1.0333 0.6354 -0.0673 -0.0597 0.0290  185 ALA A CB  
463  N N   . GLY A 78  ? 0.4312 1.0683 0.6601 -0.0567 -0.0480 0.0200  186 GLY A N   
464  C CA  . GLY A 78  ? 0.4029 1.0574 0.6468 -0.0606 -0.0402 0.0179  186 GLY A CA  
465  C C   . GLY A 78  ? 0.4577 1.1074 0.6999 -0.0505 -0.0330 0.0194  186 GLY A C   
466  O O   . GLY A 78  ? 0.4689 1.1048 0.6950 -0.0422 -0.0357 0.0181  186 GLY A O   
467  N N   . PHE A 79  ? 0.4037 1.0673 0.6634 -0.0519 -0.0222 0.0215  187 PHE A N   
468  C CA  . PHE A 79  ? 0.3871 1.0517 0.6480 -0.0426 -0.0117 0.0279  187 PHE A CA  
469  C C   . PHE A 79  ? 0.4853 1.1622 0.7521 -0.0334 -0.0049 0.0307  187 PHE A C   
470  O O   . PHE A 79  ? 0.5080 1.2019 0.7962 -0.0391 -0.0006 0.0291  187 PHE A O   
471  C CB  . PHE A 79  ? 0.3911 1.0576 0.6719 -0.0499 0.0000  0.0320  187 PHE A CB  
472  C CG  . PHE A 79  ? 0.4158 1.0718 0.6900 -0.0516 -0.0040 0.0336  187 PHE A CG  
473  C CD1 . PHE A 79  ? 0.4548 1.1107 0.7180 -0.0404 -0.0025 0.0441  187 PHE A CD1 
474  C CD2 . PHE A 79  ? 0.4316 1.0838 0.7098 -0.0640 -0.0099 0.0247  187 PHE A CD2 
475  C CE1 . PHE A 79  ? 0.4674 1.1212 0.7289 -0.0412 -0.0074 0.0464  187 PHE A CE1 
476  C CE2 . PHE A 79  ? 0.4498 1.0958 0.7267 -0.0654 -0.0124 0.0258  187 PHE A CE2 
477  C CZ  . PHE A 79  ? 0.4466 1.0943 0.7167 -0.0537 -0.0120 0.0367  187 PHE A CZ  
478  N N   . TYR A 80  ? 0.4613 1.1337 0.7102 -0.0200 -0.0032 0.0328  188 TYR A N   
479  C CA  . TYR A 80  ? 0.4538 1.1375 0.7061 -0.0090 0.0051  0.0346  188 TYR A CA  
480  C C   . TYR A 80  ? 0.4950 1.1860 0.7417 -0.0011 0.0190  0.0432  188 TYR A C   
481  O O   . TYR A 80  ? 0.4550 1.1417 0.6821 0.0022  0.0181  0.0469  188 TYR A O   
482  C CB  . TYR A 80  ? 0.4788 1.1524 0.7158 0.0015  -0.0016 0.0271  188 TYR A CB  
483  C CG  . TYR A 80  ? 0.4780 1.1461 0.7219 -0.0025 -0.0129 0.0251  188 TYR A CG  
484  C CD1 . TYR A 80  ? 0.5053 1.1890 0.7672 0.0032  -0.0130 0.0284  188 TYR A CD1 
485  C CD2 . TYR A 80  ? 0.4731 1.1243 0.7061 -0.0109 -0.0231 0.0221  188 TYR A CD2 
486  C CE1 . TYR A 80  ? 0.5201 1.2036 0.7866 0.0022  -0.0235 0.0320  188 TYR A CE1 
487  C CE2 . TYR A 80  ? 0.4864 1.1339 0.7236 -0.0138 -0.0317 0.0243  188 TYR A CE2 
488  C CZ  . TYR A 80  ? 0.5607 1.2250 0.8134 -0.0065 -0.0322 0.0308  188 TYR A CZ  
489  O OH  . TYR A 80  ? 0.5177 1.1832 0.7732 -0.0069 -0.0408 0.0383  188 TYR A OH  
490  N N   . VAL A 81  ? 0.4730 1.1798 0.7364 0.0027  0.0318  0.0474  189 VAL A N   
491  C CA  . VAL A 81  ? 0.4791 1.1961 0.7386 0.0106  0.0484  0.0587  189 VAL A CA  
492  C C   . VAL A 81  ? 0.5739 1.3049 0.8386 0.0202  0.0563  0.0546  189 VAL A C   
493  O O   . VAL A 81  ? 0.5844 1.3220 0.8686 0.0185  0.0512  0.0476  189 VAL A O   
494  C CB  . VAL A 81  ? 0.5030 1.2237 0.7898 0.0012  0.0631  0.0724  189 VAL A CB  
495  C CG1 . VAL A 81  ? 0.4810 1.2148 0.8061 -0.0100 0.0702  0.0668  189 VAL A CG1 
496  C CG2 . VAL A 81  ? 0.5158 1.2438 0.7937 0.0109  0.0805  0.0915  189 VAL A CG2 
497  N N   . CYS A 82  ? 0.5369 1.2763 0.7834 0.0316  0.0683  0.0594  190 CYS A N   
498  C CA  . CYS A 82  ? 0.5274 1.2821 0.7799 0.0418  0.0799  0.0553  190 CYS A CA  
499  C C   . CYS A 82  ? 0.5430 1.3159 0.8053 0.0430  0.1021  0.0715  190 CYS A C   
500  O O   . CYS A 82  ? 0.5105 1.2845 0.7536 0.0451  0.1094  0.0857  190 CYS A O   
501  C CB  . CYS A 82  ? 0.5577 1.3062 0.7785 0.0545  0.0768  0.0407  190 CYS A CB  
502  S SG  . CYS A 82  ? 0.6241 1.3877 0.8588 0.0690  0.0913  0.0312  190 CYS A SG  
503  N N   . ARG A 83  ? 0.5089 1.2994 0.8041 0.0420  0.1135  0.0714  191 ARG A N   
504  C CA  . ARG A 83  ? 0.5077 1.3168 0.8198 0.0418  0.1380  0.0859  191 ARG A CA  
505  C C   . ARG A 83  ? 0.6017 1.4276 0.9011 0.0572  0.1497  0.0803  191 ARG A C   
506  O O   . ARG A 83  ? 0.6010 1.4318 0.9106 0.0638  0.1435  0.0653  191 ARG A O   
507  C CB  . ARG A 83  ? 0.4223 1.2443 0.7853 0.0268  0.1443  0.0861  191 ARG A CB  
508  C CG  . ARG A 83  ? 0.4221 1.2583 0.8093 0.0224  0.1728  0.1026  191 ARG A CG  
509  C CD  . ARG A 83  ? 0.4807 1.3400 0.9215 0.0082  0.1798  0.0944  191 ARG A CD  
510  N NE  . ARG A 83  ? 0.5141 1.3989 0.9644 0.0180  0.1741  0.0814  191 ARG A NE  
511  C CZ  . ARG A 83  ? 0.6407 1.5523 1.1314 0.0089  0.1676  0.0697  191 ARG A CZ  
512  N NH1 . ARG A 83  ? 0.5681 1.5043 1.0688 0.0220  0.1625  0.0621  191 ARG A NH1 
513  N NH2 . ARG A 83  ? 0.4541 1.3710 0.9771 -0.0132 0.1663  0.0645  191 ARG A NH2 
514  N N   . VAL A 84  ? 0.6055 1.4410 0.8809 0.0644  0.1671  0.0931  192 VAL A N   
515  C CA  . VAL A 84  ? 0.6313 1.4867 0.8915 0.0783  0.1832  0.0874  192 VAL A CA  
516  C C   . VAL A 84  ? 0.7042 1.5823 0.9858 0.0763  0.2119  0.1082  192 VAL A C   
517  O O   . VAL A 84  ? 0.7093 1.5852 0.9874 0.0713  0.2219  0.1320  192 VAL A O   
518  C CB  . VAL A 84  ? 0.6979 1.5516 0.9033 0.0898  0.1783  0.0760  192 VAL A CB  
519  C CG1 . VAL A 84  ? 0.6831 1.5157 0.8630 0.0845  0.1553  0.0740  192 VAL A CG1 
520  C CG2 . VAL A 84  ? 0.7330 1.6126 0.9105 0.0974  0.2011  0.0909  192 VAL A CG2 
521  N N   . ASN A 85  ? 0.6823 1.5818 0.9915 0.0803  0.2263  0.1011  193 ASN A N   
522  C CA  . ASN A 85  ? 0.7164 1.6399 1.0495 0.0777  0.2566  0.1193  193 ASN A CA  
523  C C   . ASN A 85  ? 0.8806 1.8291 1.1939 0.0936  0.2763  0.1128  193 ASN A C   
524  O O   . ASN A 85  ? 0.8878 1.8351 1.1864 0.1053  0.2667  0.0889  193 ASN A O   
525  C CB  . ASN A 85  ? 0.6115 1.5457 1.0086 0.0623  0.2610  0.1188  193 ASN A CB  
526  C CG  . ASN A 85  ? 1.0127 1.9619 1.4376 0.0668  0.2481  0.0962  193 ASN A CG  
527  O OD1 . ASN A 85  ? 1.0529 1.9934 1.4932 0.0601  0.2246  0.0856  193 ASN A OD1 
528  N ND2 . ASN A 85  ? 0.8892 1.8643 1.3230 0.0793  0.2646  0.0904  193 ASN A ND2 
529  N N   . ASN A 86  ? 0.9021 1.8718 1.2155 0.0941  0.3061  0.1342  194 ASN A N   
530  C CA  . ASN A 86  ? 0.9431 1.9414 1.2384 0.1077  0.3294  0.1294  194 ASN A CA  
531  C C   . ASN A 86  ? 0.9932 2.0164 1.3245 0.1014  0.3629  0.1522  194 ASN A C   
532  O O   . ASN A 86  ? 1.0126 2.0403 1.3253 0.0998  0.3818  0.1820  194 ASN A O   
533  C CB  . ASN A 86  ? 1.0279 2.0297 1.2529 0.1192  0.3292  0.1300  194 ASN A CB  
534  N N   . ASN A 87  ? 0.9240 1.9653 1.3110 0.0977  0.3703  0.1400  195 ASN A N   
535  C CA  . ASN A 87  ? 0.9153 1.9856 1.3515 0.0893  0.4025  0.1543  195 ASN A CA  
536  C C   . ASN A 87  ? 0.9485 2.0063 1.4154 0.0689  0.4146  0.1823  195 ASN A C   
537  O O   . ASN A 87  ? 0.9162 1.9786 1.4436 0.0515  0.4145  0.1770  195 ASN A O   
538  C CB  . ASN A 87  ? 0.8984 1.9985 1.3073 0.1031  0.4346  0.1607  195 ASN A CB  
539  C CG  . ASN A 87  ? 0.9107 2.0169 1.2774 0.1234  0.4274  0.1327  195 ASN A CG  
540  O OD1 . ASN A 87  ? 0.7302 1.8468 1.1267 0.1314  0.4227  0.1075  195 ASN A OD1 
541  N ND2 . ASN A 87  ? 0.7596 1.8642 1.0590 0.1326  0.4300  0.1371  195 ASN A ND2 
542  N N   . PHE A 88  ? 0.9054 1.9482 1.3310 0.0715  0.4246  0.2111  196 PHE A N   
543  C CA  . PHE A 88  ? 0.8865 1.9118 1.3366 0.0569  0.4414  0.2432  196 PHE A CA  
544  C C   . PHE A 88  ? 0.9222 1.9092 1.3626 0.0508  0.4139  0.2449  196 PHE A C   
545  O O   . PHE A 88  ? 0.8838 1.8540 1.3746 0.0319  0.4119  0.2418  196 PHE A O   
546  C CB  . PHE A 88  ? 0.9418 1.9812 1.3596 0.0665  0.4751  0.2812  196 PHE A CB  
547  C CG  . PHE A 88  ? 0.9577 2.0374 1.3801 0.0733  0.5035  0.2777  196 PHE A CG  
548  C CD1 . PHE A 88  ? 0.9766 2.0725 1.4606 0.0591  0.5368  0.2891  196 PHE A CD1 
549  C CD2 . PHE A 88  ? 0.9777 2.0797 1.3476 0.0923  0.4979  0.2586  196 PHE A CD2 
550  C CE1 . PHE A 88  ? 1.0020 2.1378 1.4944 0.0652  0.5633  0.2842  196 PHE A CE1 
551  C CE2 . PHE A 88  ? 1.0225 2.1618 1.4010 0.0988  0.5249  0.2512  196 PHE A CE2 
552  C CZ  . PHE A 88  ? 0.9988 2.1560 1.4377 0.0860  0.5575  0.2657  196 PHE A CZ  
553  N N   . THR A 89  ? 0.8941 1.8710 1.2716 0.0658  0.3924  0.2449  197 THR A N   
554  C CA  . THR A 89  ? 0.8696 1.8151 1.2278 0.0642  0.3666  0.2484  197 THR A CA  
555  C C   . THR A 89  ? 0.8824 1.8075 1.2644 0.0533  0.3342  0.2160  197 THR A C   
556  O O   . THR A 89  ? 0.8642 1.8003 1.2862 0.0449  0.3316  0.1938  197 THR A O   
557  C CB  . THR A 89  ? 0.8882 1.8407 1.1726 0.0830  0.3543  0.2552  197 THR A CB  
558  O OG1 . THR A 89  ? 0.9433 1.8918 1.2032 0.0878  0.3237  0.2176  197 THR A OG1 
559  C CG2 . THR A 89  ? 0.7622 1.7498 1.0111 0.0965  0.3823  0.2754  197 THR A CG2 
560  N N   . PHE A 90  ? 0.8143 1.7144 1.1702 0.0544  0.3098  0.2161  198 PHE A N   
561  C CA  . PHE A 90  ? 0.7515 1.6296 1.1150 0.0462  0.2783  0.1922  198 PHE A CA  
562  C C   . PHE A 90  ? 0.7850 1.6450 1.1080 0.0531  0.2637  0.2056  198 PHE A C   
563  O O   . PHE A 90  ? 0.8126 1.6696 1.1316 0.0563  0.2803  0.2380  198 PHE A O   
564  C CB  . PHE A 90  ? 0.7431 1.6092 1.1676 0.0244  0.2829  0.1885  198 PHE A CB  
565  N N   . GLU A 91  ? 0.6915 1.5419 0.9862 0.0566  0.2339  0.1831  199 GLU A N   
566  C CA  . GLU A 91  ? 0.6665 1.5039 0.9274 0.0614  0.2165  0.1908  199 GLU A CA  
567  C C   . GLU A 91  ? 0.6256 1.4428 0.8900 0.0536  0.1876  0.1642  199 GLU A C   
568  O O   . GLU A 91  ? 0.6145 1.4338 0.8780 0.0542  0.1761  0.1387  199 GLU A O   
569  C CB  . GLU A 91  ? 0.7157 1.5744 0.9179 0.0779  0.2137  0.1943  199 GLU A CB  
570  C CG  . GLU A 91  ? 0.9098 1.7791 1.0910 0.0864  0.2240  0.2321  199 GLU A CG  
571  C CD  . GLU A 91  ? 1.2381 2.1115 1.3779 0.0930  0.1993  0.2307  199 GLU A CD  
572  O OE1 . GLU A 91  ? 1.2509 2.1021 1.4094 0.0867  0.1859  0.2334  199 GLU A OE1 
573  O OE2 . GLU A 91  ? 1.1781 2.0806 1.2683 0.1037  0.1946  0.2261  199 GLU A OE2 
574  N N   . PHE A 92  ? 0.5205 1.3185 0.7914 0.0473  0.1777  0.1718  200 PHE A N   
575  C CA  . PHE A 92  ? 0.4601 1.2404 0.7309 0.0397  0.1514  0.1489  200 PHE A CA  
576  C C   . PHE A 92  ? 0.5415 1.3216 0.7669 0.0490  0.1333  0.1480  200 PHE A C   
577  O O   . PHE A 92  ? 0.5465 1.3336 0.7564 0.0562  0.1382  0.1716  200 PHE A O   
578  C CB  . PHE A 92  ? 0.4359 1.1973 0.7491 0.0235  0.1529  0.1507  200 PHE A CB  
579  C CG  . PHE A 92  ? 0.4237 1.1899 0.7810 0.0091  0.1604  0.1364  200 PHE A CG  
580  C CD1 . PHE A 92  ? 0.4229 1.1911 0.7857 0.0023  0.1404  0.1109  200 PHE A CD1 
581  C CD2 . PHE A 92  ? 0.4443 1.2176 0.8389 0.0023  0.1878  0.1494  200 PHE A CD2 
582  C CE1 . PHE A 92  ? 0.4043 1.1881 0.8074 -0.0105 0.1449  0.0982  200 PHE A CE1 
583  C CE2 . PHE A 92  ? 0.4537 1.2400 0.8911 -0.0129 0.1936  0.1328  200 PHE A CE2 
584  C CZ  . PHE A 92  ? 0.4042 1.1986 0.8448 -0.0191 0.1706  0.1070  200 PHE A CZ  
585  N N   . SER A 93  ? 0.5080 1.2822 0.7149 0.0489  0.1127  0.1216  201 SER A N   
586  C CA  . SER A 93  ? 0.5110 1.2854 0.6805 0.0533  0.0946  0.1141  201 SER A CA  
587  C C   . SER A 93  ? 0.5574 1.3171 0.7394 0.0456  0.0835  0.1224  201 SER A C   
588  O O   . SER A 93  ? 0.5291 1.2759 0.7477 0.0367  0.0909  0.1314  201 SER A O   
589  C CB  . SER A 93  ? 0.5331 1.2986 0.6882 0.0531  0.0794  0.0830  201 SER A CB  
590  O OG  . SER A 93  ? 0.6180 1.3613 0.7962 0.0424  0.0659  0.0722  201 SER A OG  
591  N N   . GLN A 94  ? 0.5206 1.2849 0.6739 0.0483  0.0670  0.1166  202 GLN A N   
592  C CA  . GLN A 94  ? 0.4948 1.2486 0.6582 0.0423  0.0551  0.1209  202 GLN A CA  
593  C C   . GLN A 94  ? 0.5231 1.2528 0.7035 0.0296  0.0434  0.0977  202 GLN A C   
594  O O   . GLN A 94  ? 0.5160 1.2412 0.6897 0.0293  0.0398  0.0787  202 GLN A O   
595  C CB  . GLN A 94  ? 0.5260 1.2985 0.6535 0.0476  0.0391  0.1158  202 GLN A CB  
596  C CG  . GLN A 94  ? 0.6388 1.4449 0.7453 0.0615  0.0473  0.1430  202 GLN A CG  
597  C CD  . GLN A 94  ? 0.7448 1.5788 0.8139 0.0644  0.0287  0.1307  202 GLN A CD  
598  O OE1 . GLN A 94  ? 0.6993 1.5708 0.7370 0.0752  0.0313  0.1420  202 GLN A OE1 
599  N NE2 . GLN A 94  ? 0.5813 1.4005 0.6517 0.0534  0.0103  0.1045  202 GLN A NE2 
600  N N   . TRP A 95  ? 0.4754 1.1912 0.6791 0.0203  0.0392  0.1004  203 TRP A N   
601  C CA  . TRP A 95  ? 0.4514 1.1490 0.6678 0.0076  0.0275  0.0813  203 TRP A CA  
602  C C   . TRP A 95  ? 0.5434 1.2379 0.7324 0.0074  0.0090  0.0642  203 TRP A C   
603  O O   . TRP A 95  ? 0.5701 1.2772 0.7388 0.0125  0.0026  0.0672  203 TRP A O   
604  C CB  . TRP A 95  ? 0.4139 1.1014 0.6588 -0.0023 0.0300  0.0873  203 TRP A CB  
605  C CG  . TRP A 95  ? 0.4219 1.1065 0.7020 -0.0086 0.0486  0.0943  203 TRP A CG  
606  C CD1 . TRP A 95  ? 0.4661 1.1498 0.7695 -0.0061 0.0676  0.1148  203 TRP A CD1 
607  C CD2 . TRP A 95  ? 0.4106 1.0947 0.7110 -0.0199 0.0509  0.0799  203 TRP A CD2 
608  N NE1 . TRP A 95  ? 0.4569 1.1371 0.7945 -0.0169 0.0837  0.1110  203 TRP A NE1 
609  C CE2 . TRP A 95  ? 0.4607 1.1448 0.7966 -0.0264 0.0720  0.0883  203 TRP A CE2 
610  C CE3 . TRP A 95  ? 0.4116 1.0978 0.7056 -0.0247 0.0376  0.0622  203 TRP A CE3 
611  C CZ2 . TRP A 95  ? 0.4363 1.1278 0.8004 -0.0398 0.0785  0.0750  203 TRP A CZ2 
612  C CZ3 . TRP A 95  ? 0.4269 1.1233 0.7467 -0.0347 0.0425  0.0539  203 TRP A CZ3 
613  C CH2 . TRP A 95  ? 0.4379 1.1395 0.7917 -0.0431 0.0620  0.0582  203 TRP A CH2 
614  N N   . SER A 96  ? 0.5082 1.1886 0.6990 0.0013  0.0010  0.0472  204 SER A N   
615  C CA  . SER A 96  ? 0.5204 1.1907 0.6931 -0.0014 -0.0131 0.0302  204 SER A CA  
616  C C   . SER A 96  ? 0.5724 1.2271 0.7615 -0.0138 -0.0207 0.0258  204 SER A C   
617  O O   . SER A 96  ? 0.5462 1.1987 0.7542 -0.0179 -0.0171 0.0279  204 SER A O   
618  C CB  . SER A 96  ? 0.5818 1.2472 0.7425 0.0057  -0.0111 0.0166  204 SER A CB  
619  O OG  . SER A 96  ? 0.6880 1.3353 0.8407 0.0013  -0.0209 -0.0007 204 SER A OG  
620  N N   . GLN A 97  ? 0.5386 1.1884 0.7214 -0.0205 -0.0308 0.0201  205 GLN A N   
621  C CA  . GLN A 97  ? 0.5178 1.1545 0.7128 -0.0325 -0.0368 0.0160  205 GLN A CA  
622  C C   . GLN A 97  ? 0.5711 1.1908 0.7553 -0.0348 -0.0441 0.0033  205 GLN A C   
623  O O   . GLN A 97  ? 0.5794 1.1962 0.7494 -0.0351 -0.0491 -0.0076 205 GLN A O   
624  C CB  . GLN A 97  ? 0.5161 1.1568 0.7193 -0.0402 -0.0399 0.0191  205 GLN A CB  
625  C CG  . GLN A 97  ? 0.5214 1.1524 0.7372 -0.0529 -0.0421 0.0152  205 GLN A CG  
626  C CD  . GLN A 97  ? 0.6182 1.2499 0.8385 -0.0612 -0.0469 0.0125  205 GLN A CD  
627  O OE1 . GLN A 97  ? 0.5551 1.1989 0.7785 -0.0568 -0.0467 0.0178  205 GLN A OE1 
628  N NE2 . GLN A 97  ? 0.4917 1.1140 0.7136 -0.0725 -0.0507 0.0062  205 GLN A NE2 
629  N N   . LEU A 98  ? 0.5100 1.1207 0.7030 -0.0366 -0.0440 0.0048  206 LEU A N   
630  C CA  . LEU A 98  ? 0.5202 1.1108 0.7086 -0.0375 -0.0480 -0.0018 206 LEU A CA  
631  C C   . LEU A 98  ? 0.5581 1.1425 0.7521 -0.0505 -0.0532 0.0009  206 LEU A C   
632  O O   . LEU A 98  ? 0.5325 1.1281 0.7364 -0.0555 -0.0529 0.0088  206 LEU A O   
633  C CB  . LEU A 98  ? 0.5316 1.1184 0.7261 -0.0263 -0.0436 0.0024  206 LEU A CB  
634  C CG  . LEU A 98  ? 0.6030 1.1648 0.7993 -0.0238 -0.0444 0.0014  206 LEU A CG  
635  C CD1 . LEU A 98  ? 0.6157 1.1558 0.8017 -0.0259 -0.0430 -0.0160 206 LEU A CD1 
636  C CD2 . LEU A 98  ? 0.6621 1.2264 0.8699 -0.0089 -0.0393 0.0095  206 LEU A CD2 
637  N N   . ASP A 99  ? 0.5376 1.1079 0.7259 -0.0578 -0.0571 -0.0078 207 ASP A N   
638  C CA  . ASP A 99  ? 0.5378 1.1011 0.7310 -0.0704 -0.0599 -0.0048 207 ASP A CA  
639  C C   . ASP A 99  ? 0.5744 1.1115 0.7673 -0.0704 -0.0584 -0.0048 207 ASP A C   
640  O O   . ASP A 99  ? 0.5796 1.1000 0.7693 -0.0671 -0.0561 -0.0168 207 ASP A O   
641  C CB  . ASP A 99  ? 0.5679 1.1400 0.7633 -0.0814 -0.0631 -0.0110 207 ASP A CB  
642  C CG  . ASP A 99  ? 0.8665 1.4364 1.0685 -0.0945 -0.0631 -0.0066 207 ASP A CG  
643  O OD1 . ASP A 99  ? 0.9085 1.4818 1.1119 -0.0949 -0.0611 0.0033  207 ASP A OD1 
644  O OD2 . ASP A 99  ? 0.9357 1.5051 1.1414 -0.1047 -0.0649 -0.0133 207 ASP A OD2 
645  N N   . VAL A 100 ? 0.5368 1.0718 0.7338 -0.0730 -0.0581 0.0092  208 VAL A N   
646  C CA  . VAL A 100 ? 0.5606 1.0700 0.7610 -0.0705 -0.0542 0.0179  208 VAL A CA  
647  C C   . VAL A 100 ? 0.6511 1.1556 0.8520 -0.0857 -0.0541 0.0237  208 VAL A C   
648  O O   . VAL A 100 ? 0.6428 1.1698 0.8412 -0.0919 -0.0566 0.0327  208 VAL A O   
649  C CB  . VAL A 100 ? 0.5841 1.1000 0.7894 -0.0552 -0.0531 0.0362  208 VAL A CB  
650  C CG1 . VAL A 100 ? 0.6105 1.0954 0.8237 -0.0478 -0.0463 0.0483  208 VAL A CG1 
651  C CG2 . VAL A 100 ? 0.5653 1.0930 0.7724 -0.0418 -0.0520 0.0300  208 VAL A CG2 
652  N N   . CYS A 101 ? 0.6482 1.1254 0.8535 -0.0934 -0.0495 0.0160  209 CYS A N   
653  C CA  . CYS A 101 ? 0.6728 1.1443 0.8811 -0.1088 -0.0467 0.0219  209 CYS A CA  
654  C C   . CYS A 101 ? 0.7610 1.2050 0.9752 -0.1045 -0.0380 0.0421  209 CYS A C   
655  O O   . CYS A 101 ? 0.7657 1.1799 0.9890 -0.0958 -0.0311 0.0393  209 CYS A O   
656  C CB  . CYS A 101 ? 0.6951 1.1607 0.9092 -0.1237 -0.0467 -0.0001 209 CYS A CB  
657  S SG  . CYS A 101 ? 0.7307 1.2235 0.9400 -0.1208 -0.0559 -0.0216 209 CYS A SG  
658  N N   . ASP A 102 ? 0.7474 1.2022 0.9574 -0.1102 -0.0365 0.0631  210 ASP A N   
659  C CA  . ASP A 102 ? 0.7901 1.2218 1.0056 -0.1059 -0.0268 0.0895  210 ASP A CA  
660  C C   . ASP A 102 ? 0.8384 1.2495 1.0616 -0.1256 -0.0174 0.0863  210 ASP A C   
661  O O   . ASP A 102 ? 0.8329 1.2678 1.0488 -0.1401 -0.0195 0.0847  210 ASP A O   
662  C CB  . ASP A 102 ? 0.8233 1.2888 1.0265 -0.0979 -0.0314 0.1185  210 ASP A CB  
663  C CG  . ASP A 102 ? 1.0978 1.5482 1.3070 -0.0824 -0.0240 0.1543  210 ASP A CG  
664  O OD1 . ASP A 102 ? 1.1460 1.5502 1.3735 -0.0763 -0.0119 0.1570  210 ASP A OD1 
665  O OD2 . ASP A 102 ? 1.2140 1.7006 1.4113 -0.0761 -0.0293 0.1794  210 ASP A OD2 
666  N N   . ILE A 103 ? 0.7922 1.1594 1.0336 -0.1277 -0.0054 0.0807  211 ILE A N   
667  C CA  . ILE A 103 ? 0.7922 1.1364 1.0476 -0.1482 0.0063  0.0760  211 ILE A CA  
668  C C   . ILE A 103 ? 0.8702 1.1675 1.1441 -0.1425 0.0252  0.1001  211 ILE A C   
669  O O   . ILE A 103 ? 0.8685 1.1449 1.1499 -0.1232 0.0290  0.1074  211 ILE A O   
670  C CB  . ILE A 103 ? 0.8204 1.1625 1.0863 -0.1650 0.0035  0.0352  211 ILE A CB  
671  C CG1 . ILE A 103 ? 0.8458 1.1590 1.1232 -0.1580 0.0072  0.0120  211 ILE A CG1 
672  C CG2 . ILE A 103 ? 0.7951 1.1838 1.0469 -0.1688 -0.0125 0.0198  211 ILE A CG2 
673  C CD1 . ILE A 103 ? 0.8714 1.1852 1.1594 -0.1757 0.0058  -0.0266 211 ILE A CD1 
674  N N   . PRO A 104 ? 0.8633 1.1425 1.1481 -0.1579 0.0396  0.1145  212 PRO A N   
675  C CA  . PRO A 104 ? 0.9185 1.1465 1.2267 -0.1520 0.0616  0.1397  212 PRO A CA  
676  C C   . PRO A 104 ? 0.9999 1.1793 1.3368 -0.1531 0.0734  0.1097  212 PRO A C   
677  O O   . PRO A 104 ? 0.9724 1.1582 1.3123 -0.1683 0.0667  0.0665  212 PRO A O   
678  C CB  . PRO A 104 ? 0.9551 1.1765 1.2709 -0.1744 0.0754  0.1523  212 PRO A CB  
679  C CG  . PRO A 104 ? 0.9517 1.2283 1.2421 -0.1855 0.0594  0.1439  212 PRO A CG  
680  C CD  . PRO A 104 ? 0.8552 1.1571 1.1360 -0.1811 0.0396  0.1087  212 PRO A CD  
681  N N   . GLU A 105 ? 1.0228 1.1559 1.3821 -0.1371 0.0922  0.1331  213 GLU A N   
682  C CA  . GLU A 105 ? 1.0665 1.1453 1.4587 -0.1368 0.1101  0.1070  213 GLU A CA  
683  C C   . GLU A 105 ? 1.1370 1.1933 1.5511 -0.1696 0.1209  0.0666  213 GLU A C   
684  O O   . GLU A 105 ? 1.1359 1.1772 1.5628 -0.1770 0.1232  0.0221  213 GLU A O   
685  C CB  . GLU A 105 ? 1.1457 1.1733 1.5662 -0.1163 0.1350  0.1487  213 GLU A CB  
686  C CG  . GLU A 105 ? 1.3123 1.3558 1.7239 -0.0804 0.1272  0.1793  213 GLU A CG  
687  C CD  . GLU A 105 ? 1.6731 1.7332 2.0761 -0.0706 0.1136  0.1414  213 GLU A CD  
688  O OE1 . GLU A 105 ? 1.5564 1.6712 1.9287 -0.0610 0.0898  0.1456  213 GLU A OE1 
689  O OE2 . GLU A 105 ? 1.6819 1.7023 2.1087 -0.0752 0.1277  0.1046  213 GLU A OE2 
690  N N   . SER A 106 ? 1.1103 1.1698 1.5285 -0.1900 0.1277  0.0810  214 SER A N   
691  C CA  . SER A 106 ? 1.1353 1.1818 1.5775 -0.2241 0.1382  0.0479  214 SER A CA  
692  C C   . SER A 106 ? 1.1887 1.2760 1.6213 -0.2414 0.1174  -0.0073 214 SER A C   
693  O O   . SER A 106 ? 1.2078 1.2850 1.6660 -0.2687 0.1255  -0.0445 214 SER A O   
694  C CB  . SER A 106 ? 1.1758 1.2330 1.6171 -0.2386 0.1459  0.0797  214 SER A CB  
695  O OG  . SER A 106 ? 1.2318 1.3463 1.6337 -0.2292 0.1244  0.1014  214 SER A OG  
696  N N   . PHE A 107 ? 1.1166 1.2514 1.5150 -0.2256 0.0915  -0.0114 215 PHE A N   
697  C CA  . PHE A 107 ? 1.0903 1.2702 1.4749 -0.2347 0.0701  -0.0532 215 PHE A CA  
698  C C   . PHE A 107 ? 1.2076 1.3814 1.5863 -0.2196 0.0655  -0.0792 215 PHE A C   
699  O O   . PHE A 107 ? 1.1810 1.3881 1.5501 -0.2268 0.0509  -0.1160 215 PHE A O   
700  C CB  . PHE A 107 ? 1.0513 1.2877 1.4044 -0.2278 0.0482  -0.0364 215 PHE A CB  
701  C CG  . PHE A 107 ? 1.0555 1.3059 1.4109 -0.2425 0.0526  -0.0153 215 PHE A CG  
702  C CD1 . PHE A 107 ? 1.1012 1.3397 1.4494 -0.2327 0.0625  0.0294  215 PHE A CD1 
703  C CD2 . PHE A 107 ? 1.0590 1.3401 1.4240 -0.2655 0.0470  -0.0394 215 PHE A CD2 
704  C CE1 . PHE A 107 ? 1.1120 1.3659 1.4600 -0.2473 0.0689  0.0478  215 PHE A CE1 
705  C CE2 . PHE A 107 ? 1.0906 1.3854 1.4598 -0.2794 0.0537  -0.0213 215 PHE A CE2 
706  C CZ  . PHE A 107 ? 1.0809 1.3612 1.4400 -0.2707 0.0654  0.0215  215 PHE A CZ  
707  N N   . GLN A 108 ? 1.2364 1.3705 1.6220 -0.1978 0.0790  -0.0582 216 GLN A N   
708  C CA  . GLN A 108 ? 1.2554 1.3799 1.6384 -0.1811 0.0792  -0.0791 216 GLN A CA  
709  C C   . GLN A 108 ? 1.3934 1.4779 1.8059 -0.1962 0.0982  -0.1240 216 GLN A C   
710  O O   . GLN A 108 ? 1.4003 1.4678 1.8156 -0.1817 0.1049  -0.1407 216 GLN A O   
711  C CB  . GLN A 108 ? 1.2708 1.3826 1.6484 -0.1484 0.0825  -0.0379 216 GLN A CB  
712  C CG  . GLN A 108 ? 1.2221 1.3885 1.5647 -0.1322 0.0579  -0.0263 216 GLN A CG  
713  C CD  . GLN A 108 ? 1.3458 1.5204 1.6808 -0.1126 0.0559  0.0245  216 GLN A CD  
714  O OE1 . GLN A 108 ? 1.3327 1.4937 1.6744 -0.0881 0.0619  0.0456  216 GLN A OE1 
715  N NE2 . GLN A 108 ? 1.1607 1.3628 1.4820 -0.1229 0.0474  0.0442  216 GLN A NE2 
716  N N   . ARG A 109 ? 1.4138 1.4876 1.8495 -0.2270 0.1073  -0.1476 217 ARG A N   
717  C CA  . ARG A 109 ? 1.4774 1.5218 1.9430 -0.2490 0.1244  -0.1994 217 ARG A CA  
718  C C   . ARG A 109 ? 1.5509 1.6488 1.9893 -0.2519 0.1025  -0.2448 217 ARG A C   
719  O O   . ARG A 109 ? 1.5043 1.6619 1.9122 -0.2507 0.0760  -0.2392 217 ARG A O   
720  C CB  . ARG A 109 ? 1.4888 1.5239 1.9842 -0.2839 0.1351  -0.2131 217 ARG A CB  
721  N N   . SER A 110 ? 1.5683 1.6451 2.0172 -0.2533 0.1151  -0.2866 218 SER A N   
722  C CA  . SER A 110 ? 1.5593 1.6850 1.9806 -0.2540 0.0985  -0.3298 218 SER A CA  
723  C C   . SER A 110 ? 1.5372 1.7006 1.9174 -0.2219 0.0782  -0.3010 218 SER A C   
724  O O   . SER A 110 ? 1.4975 1.7185 1.8469 -0.2220 0.0572  -0.3201 218 SER A O   
725  C CB  . SER A 110 ? 1.6125 1.7928 2.0301 -0.2856 0.0818  -0.3706 218 SER A CB  
726  O OG  . SER A 110 ? 1.6841 1.9190 2.0777 -0.2826 0.0556  -0.3417 218 SER A OG  
727  N N   . VAL A 111 ? 1.4759 1.6081 1.8583 -0.1947 0.0858  -0.2534 219 VAL A N   
728  C CA  . VAL A 111 ? 1.4281 1.5857 1.7818 -0.1641 0.0726  -0.2233 219 VAL A CA  
729  C C   . VAL A 111 ? 1.4993 1.6066 1.8734 -0.1381 0.0928  -0.1931 219 VAL A C   
730  O O   . VAL A 111 ? 1.5074 1.5895 1.8963 -0.1316 0.0996  -0.1512 219 VAL A O   
731  C CB  . VAL A 111 ? 1.4106 1.6184 1.7358 -0.1584 0.0472  -0.1885 219 VAL A CB  
732  C CG1 . VAL A 111 ? 1.3689 1.6344 1.6607 -0.1535 0.0265  -0.2054 219 VAL A CG1 
733  C CG2 . VAL A 111 ? 1.4007 1.6158 1.7350 -0.1812 0.0427  -0.1809 219 VAL A CG2 
734  N N   . ASP A 112 ? 1.4583 1.5550 1.8337 -0.1223 0.1030  -0.2133 220 ASP A N   
735  C CA  . ASP A 112 ? 1.4712 1.5257 1.8699 -0.0940 0.1226  -0.1871 220 ASP A CA  
736  C C   . ASP A 112 ? 1.4389 1.5303 1.8151 -0.0659 0.1052  -0.1420 220 ASP A C   
737  O O   . ASP A 112 ? 1.3746 1.5155 1.7204 -0.0708 0.0808  -0.1301 220 ASP A O   
738  C CB  . ASP A 112 ? 1.5464 1.5719 1.9624 -0.0907 0.1452  -0.2326 220 ASP A CB  
739  C CG  . ASP A 112 ? 1.6730 1.7471 2.0551 -0.0847 0.1329  -0.2634 220 ASP A CG  
740  O OD1 . ASP A 112 ? 1.6404 1.7722 1.9855 -0.0928 0.1064  -0.2641 220 ASP A OD1 
741  O OD2 . ASP A 112 ? 1.7749 1.8287 2.1693 -0.0721 0.1521  -0.2874 220 ASP A OD2 
742  N N   . GLY A 113 ? 1.3913 1.4592 1.7869 -0.0373 0.1191  -0.1184 221 GLY A N   
743  C CA  . GLY A 113 ? 1.3348 1.4380 1.7171 -0.0108 0.1053  -0.0780 221 GLY A CA  
744  C C   . GLY A 113 ? 1.3023 1.4530 1.6565 -0.0030 0.0919  -0.0971 221 GLY A C   
745  O O   . GLY A 113 ? 1.2566 1.4360 1.6054 0.0183  0.0835  -0.0686 221 GLY A O   
746  N N   . VAL A 114 ? 1.2413 1.4037 1.5787 -0.0205 0.0909  -0.1451 222 VAL A N   
747  C CA  . VAL A 114 ? 1.2017 1.4103 1.5094 -0.0157 0.0804  -0.1648 222 VAL A CA  
748  C C   . VAL A 114 ? 1.2255 1.4763 1.5015 -0.0387 0.0587  -0.1788 222 VAL A C   
749  O O   . VAL A 114 ? 1.2359 1.4775 1.5136 -0.0622 0.0597  -0.2071 222 VAL A O   
750  C CB  . VAL A 114 ? 1.2769 1.4697 1.5916 -0.0107 0.1008  -0.2076 222 VAL A CB  
751  C CG1 . VAL A 114 ? 1.2437 1.4892 1.5249 -0.0037 0.0907  -0.2203 222 VAL A CG1 
752  C CG2 . VAL A 114 ? 1.3086 1.4542 1.6634 0.0136  0.1257  -0.1929 222 VAL A CG2 
753  N N   . SER A 115 ? 1.1434 1.4410 1.3949 -0.0317 0.0401  -0.1577 223 SER A N   
754  C CA  . SER A 115 ? 1.1109 1.4513 1.3356 -0.0478 0.0204  -0.1639 223 SER A CA  
755  C C   . SER A 115 ? 1.1688 1.5322 1.3740 -0.0570 0.0208  -0.2063 223 SER A C   
756  O O   . SER A 115 ? 1.1826 1.5553 1.3791 -0.0437 0.0290  -0.2188 223 SER A O   
757  C CB  . SER A 115 ? 1.1249 1.5035 1.3348 -0.0362 0.0060  -0.1313 223 SER A CB  
758  O OG  . SER A 115 ? 1.2614 1.6847 1.4453 -0.0420 -0.0070 -0.1404 223 SER A OG  
759  N N   . GLU A 116 ? 1.1205 1.4963 1.3200 -0.0801 0.0127  -0.2291 224 GLU A N   
760  C CA  . GLU A 116 ? 1.1392 1.5510 1.3168 -0.0923 0.0081  -0.2690 224 GLU A CA  
761  C C   . GLU A 116 ? 1.1532 1.6214 1.3070 -0.0971 -0.0150 -0.2551 224 GLU A C   
762  O O   . GLU A 116 ? 1.1332 1.6024 1.2952 -0.1016 -0.0250 -0.2289 224 GLU A O   
763  C CB  . GLU A 116 ? 1.2018 1.5897 1.3964 -0.1158 0.0187  -0.3135 224 GLU A CB  
764  C CG  . GLU A 116 ? 1.3577 1.6865 1.5806 -0.1102 0.0462  -0.3310 224 GLU A CG  
765  C CD  . GLU A 116 ? 1.6223 1.9514 1.8363 -0.0912 0.0603  -0.3461 224 GLU A CD  
766  O OE1 . GLU A 116 ? 1.4518 1.8326 1.6318 -0.0889 0.0509  -0.3601 224 GLU A OE1 
767  O OE2 . GLU A 116 ? 1.5870 1.8652 1.8300 -0.0781 0.0826  -0.3433 224 GLU A OE2 
768  N N   . SER A 117 ? 1.0923 1.6078 1.2174 -0.0941 -0.0214 -0.2702 225 SER A N   
769  C CA  . SER A 117 ? 1.0492 1.6213 1.1520 -0.0935 -0.0404 -0.2545 225 SER A CA  
770  C C   . SER A 117 ? 1.0479 1.6459 1.1555 -0.1149 -0.0552 -0.2666 225 SER A C   
771  O O   . SER A 117 ? 1.0078 1.6409 1.1097 -0.1125 -0.0698 -0.2423 225 SER A O   
772  C CB  . SER A 117 ? 1.1424 1.7579 1.2133 -0.0837 -0.0399 -0.2673 225 SER A CB  
773  O OG  . SER A 117 ? 1.3268 1.9962 1.3771 -0.0779 -0.0553 -0.2444 225 SER A OG  
774  N N   . LYS A 118 ? 1.0102 1.5912 1.1324 -0.1359 -0.0498 -0.3043 226 LYS A N   
775  C CA  . LYS A 118 ? 0.9955 1.6055 1.1263 -0.1589 -0.0626 -0.3222 226 LYS A CA  
776  C C   . LYS A 118 ? 0.9843 1.5880 1.1337 -0.1612 -0.0708 -0.2880 226 LYS A C   
777  O O   . LYS A 118 ? 0.9965 1.5491 1.1649 -0.1579 -0.0601 -0.2674 226 LYS A O   
778  C CB  . LYS A 118 ? 1.0682 1.6492 1.2202 -0.1831 -0.0499 -0.3695 226 LYS A CB  
779  C CG  . LYS A 118 ? 1.1901 1.8192 1.3471 -0.2091 -0.0642 -0.3993 226 LYS A CG  
780  C CD  . LYS A 118 ? 1.3369 1.9233 1.5304 -0.2366 -0.0496 -0.4338 226 LYS A CD  
781  C CE  . LYS A 118 ? 1.4880 2.1306 1.6885 -0.2651 -0.0637 -0.4708 226 LYS A CE  
782  N NZ  . LYS A 118 ? 1.5696 2.2526 1.7760 -0.2655 -0.0838 -0.4386 226 LYS A NZ  
783  N N   . LEU A 119 ? 0.8677 1.5268 1.0117 -0.1657 -0.0892 -0.2811 227 LEU A N   
784  C CA  . LEU A 119 ? 0.8086 1.4703 0.9716 -0.1690 -0.0966 -0.2532 227 LEU A CA  
785  C C   . LEU A 119 ? 0.8545 1.4908 1.0471 -0.1947 -0.0910 -0.2751 227 LEU A C   
786  O O   . LEU A 119 ? 0.8820 1.5434 1.0798 -0.2144 -0.0947 -0.3132 227 LEU A O   
787  C CB  . LEU A 119 ? 0.7862 1.5167 0.9395 -0.1641 -0.1156 -0.2410 227 LEU A CB  
788  C CG  . LEU A 119 ? 0.8080 1.5480 0.9838 -0.1670 -0.1222 -0.2160 227 LEU A CG  
789  C CD1 . LEU A 119 ? 0.7775 1.5324 0.9453 -0.1444 -0.1253 -0.1771 227 LEU A CD1 
790  C CD2 . LEU A 119 ? 0.8468 1.6436 1.0342 -0.1827 -0.1370 -0.2349 227 LEU A CD2 
791  N N   . GLN A 120 ? 0.7746 1.3628 0.9867 -0.1955 -0.0806 -0.2521 228 GLN A N   
792  C CA  . GLN A 120 ? 0.7799 1.3366 1.0221 -0.2185 -0.0709 -0.2651 228 GLN A CA  
793  C C   . GLN A 120 ? 0.7632 1.2947 1.0194 -0.2167 -0.0662 -0.2293 228 GLN A C   
794  O O   . GLN A 120 ? 0.7254 1.2322 0.9725 -0.1986 -0.0612 -0.1996 228 GLN A O   
795  C CB  . GLN A 120 ? 0.8514 1.3568 1.1056 -0.2279 -0.0514 -0.2940 228 GLN A CB  
796  C CG  . GLN A 120 ? 1.1209 1.5711 1.3726 -0.2075 -0.0356 -0.2712 228 GLN A CG  
797  C CD  . GLN A 120 ? 1.4631 1.8542 1.7404 -0.2183 -0.0123 -0.2929 228 GLN A CD  
798  O OE1 . GLN A 120 ? 1.4456 1.8155 1.7191 -0.2094 -0.0009 -0.3110 228 GLN A OE1 
799  N NE2 . GLN A 120 ? 1.3827 1.7441 1.6896 -0.2371 -0.0020 -0.2907 228 GLN A NE2 
800  N N   . ILE A 121 ? 0.7189 1.2637 0.9974 -0.2366 -0.0682 -0.2341 229 ILE A N   
801  C CA  . ILE A 121 ? 0.6944 1.2236 0.9880 -0.2406 -0.0627 -0.2063 229 ILE A CA  
802  C C   . ILE A 121 ? 0.7892 1.2545 1.0985 -0.2480 -0.0415 -0.2016 229 ILE A C   
803  O O   . ILE A 121 ? 0.8162 1.2583 1.1433 -0.2649 -0.0308 -0.2301 229 ILE A O   
804  C CB  . ILE A 121 ? 0.7184 1.2928 1.0327 -0.2594 -0.0718 -0.2170 229 ILE A CB  
805  C CG1 . ILE A 121 ? 0.6947 1.3308 0.9958 -0.2450 -0.0913 -0.2088 229 ILE A CG1 
806  C CG2 . ILE A 121 ? 0.7101 1.2644 1.0442 -0.2696 -0.0610 -0.1959 229 ILE A CG2 
807  C CD1 . ILE A 121 ? 0.7864 1.4828 1.1103 -0.2606 -0.1040 -0.2244 229 ILE A CD1 
808  N N   . CYS A 122 ? 0.7693 1.2085 1.0731 -0.2350 -0.0346 -0.1655 230 CYS A N   
809  C CA  . CYS A 122 ? 0.8132 1.1965 1.1295 -0.2360 -0.0149 -0.1485 230 CYS A CA  
810  C C   . CYS A 122 ? 0.8560 1.2341 1.1869 -0.2493 -0.0072 -0.1281 230 CYS A C   
811  O O   . CYS A 122 ? 0.8958 1.2329 1.2475 -0.2610 0.0111  -0.1242 230 CYS A O   
812  C CB  . CYS A 122 ? 0.8226 1.1873 1.1202 -0.2095 -0.0132 -0.1216 230 CYS A CB  
813  S SG  . CYS A 122 ? 0.8958 1.2591 1.1798 -0.1940 -0.0158 -0.1459 230 CYS A SG  
814  N N   . VAL A 123 ? 0.7682 1.1856 1.0893 -0.2466 -0.0184 -0.1133 231 VAL A N   
815  C CA  . VAL A 123 ? 0.7544 1.1781 1.0856 -0.2585 -0.0119 -0.0953 231 VAL A CA  
816  C C   . VAL A 123 ? 0.7784 1.2509 1.1222 -0.2719 -0.0232 -0.1155 231 VAL A C   
817  O O   . VAL A 123 ? 0.7550 1.2657 1.0874 -0.2604 -0.0390 -0.1209 231 VAL A O   
818  C CB  . VAL A 123 ? 0.7767 1.2052 1.0865 -0.2420 -0.0126 -0.0606 231 VAL A CB  
819  C CG1 . VAL A 123 ? 0.7666 1.2017 1.0842 -0.2555 -0.0027 -0.0434 231 VAL A CG1 
820  C CG2 . VAL A 123 ? 0.7972 1.1890 1.0950 -0.2247 -0.0056 -0.0401 231 VAL A CG2 
821  N N   . GLU A 124 ? 0.7540 1.2257 1.1246 -0.2954 -0.0138 -0.1251 232 GLU A N   
822  C CA  . GLU A 124 ? 0.7290 1.2490 1.1209 -0.3111 -0.0223 -0.1450 232 GLU A CA  
823  C C   . GLU A 124 ? 0.7605 1.2975 1.1612 -0.3170 -0.0154 -0.1249 232 GLU A C   
824  O O   . GLU A 124 ? 0.7679 1.2733 1.1636 -0.3184 0.0004  -0.1007 232 GLU A O   
825  C CB  . GLU A 124 ? 0.7771 1.2884 1.1993 -0.3377 -0.0151 -0.1774 232 GLU A CB  
826  C CG  . GLU A 124 ? 0.8797 1.3890 1.2956 -0.3357 -0.0231 -0.2081 232 GLU A CG  
827  C CD  . GLU A 124 ? 1.0864 1.6614 1.5053 -0.3396 -0.0447 -0.2371 232 GLU A CD  
828  O OE1 . GLU A 124 ? 0.9223 1.5458 1.3464 -0.3363 -0.0560 -0.2273 232 GLU A OE1 
829  O OE2 . GLU A 124 ? 0.9966 1.5775 1.4150 -0.3464 -0.0493 -0.2701 232 GLU A OE2 
830  N N   . PRO A 125 ? 0.6915 1.2809 1.1061 -0.3195 -0.0257 -0.1332 233 PRO A N   
831  C CA  . PRO A 125 ? 0.6697 1.2756 1.0966 -0.3264 -0.0159 -0.1182 233 PRO A CA  
832  C C   . PRO A 125 ? 0.7609 1.3508 1.2165 -0.3542 0.0020  -0.1240 233 PRO A C   
833  O O   . PRO A 125 ? 0.7933 1.3630 1.2649 -0.3697 0.0058  -0.1435 233 PRO A O   
834  C CB  . PRO A 125 ? 0.6599 1.3253 1.1014 -0.3200 -0.0309 -0.1279 233 PRO A CB  
835  C CG  . PRO A 125 ? 0.7278 1.4074 1.1560 -0.3057 -0.0497 -0.1408 233 PRO A CG  
836  C CD  . PRO A 125 ? 0.7095 1.3490 1.1316 -0.3158 -0.0454 -0.1551 233 PRO A CD  
837  N N   . THR A 126 ? 0.6975 1.2964 1.1614 -0.3618 0.0153  -0.1084 234 THR A N   
838  C CA  . THR A 126 ? 0.7098 1.2909 1.1979 -0.3868 0.0367  -0.1058 234 THR A CA  
839  C C   . THR A 126 ? 0.7364 1.3671 1.2573 -0.4017 0.0406  -0.1147 234 THR A C   
840  O O   . THR A 126 ? 0.7103 1.3818 1.2296 -0.3883 0.0308  -0.1138 234 THR A O   
841  C CB  . THR A 126 ? 0.7892 1.3279 1.2479 -0.3785 0.0524  -0.0713 234 THR A CB  
842  O OG1 . THR A 126 ? 0.8463 1.3327 1.3114 -0.3883 0.0676  -0.0652 234 THR A OG1 
843  C CG2 . THR A 126 ? 0.7641 1.3229 1.2172 -0.3810 0.0649  -0.0514 234 THR A CG2 
844  N N   . SER A 127 ? 0.7022 1.3292 1.2574 -0.4291 0.0565  -0.1237 235 SER A N   
845  C CA  . SER A 127 ? 0.6733 1.3484 1.2642 -0.4444 0.0627  -0.1319 235 SER A CA  
846  C C   . SER A 127 ? 0.7432 1.4033 1.3232 -0.4484 0.0871  -0.1031 235 SER A C   
847  O O   . SER A 127 ? 0.7717 1.3822 1.3335 -0.4521 0.1037  -0.0815 235 SER A O   
848  C CB  . SER A 127 ? 0.6836 1.3740 1.3221 -0.4740 0.0655  -0.1618 235 SER A CB  
849  O OG  . SER A 127 ? 0.6790 1.3955 1.3219 -0.4688 0.0404  -0.1899 235 SER A OG  
850  N N   . GLN A 128 ? 0.6642 1.3684 1.2515 -0.4439 0.0893  -0.1005 236 GLN A N   
851  C CA  . GLN A 128 ? 0.6557 1.3561 1.2261 -0.4454 0.1112  -0.0762 236 GLN A CA  
852  C C   . GLN A 128 ? 0.6770 1.4264 1.2831 -0.4577 0.1233  -0.0849 236 GLN A C   
853  O O   . GLN A 128 ? 0.6369 1.4323 1.2715 -0.4516 0.1092  -0.1044 236 GLN A O   
854  C CB  . GLN A 128 ? 0.6479 1.3464 1.1734 -0.4183 0.1025  -0.0616 236 GLN A CB  
855  C CG  . GLN A 128 ? 0.7454 1.4033 1.2345 -0.4013 0.0890  -0.0520 236 GLN A CG  
856  C CD  . GLN A 128 ? 0.9672 1.6385 1.4274 -0.3764 0.0755  -0.0489 236 GLN A CD  
857  O OE1 . GLN A 128 ? 0.9607 1.6568 1.4148 -0.3729 0.0838  -0.0452 236 GLN A OE1 
858  N NE2 . GLN A 128 ? 0.7727 1.4272 1.2158 -0.3597 0.0568  -0.0519 236 GLN A NE2 
859  N N   . LYS A 129 ? 0.6642 1.4068 1.2677 -0.4724 0.1503  -0.0674 237 LYS A N   
860  C CA  . LYS A 129 ? 0.6598 1.4465 1.2927 -0.4845 0.1684  -0.0721 237 LYS A CA  
861  C C   . LYS A 129 ? 0.7299 1.5149 1.3181 -0.4725 0.1815  -0.0511 237 LYS A C   
862  O O   . LYS A 129 ? 0.7641 1.5187 1.3200 -0.4782 0.1979  -0.0254 237 LYS A O   
863  C CB  . LYS A 129 ? 0.7222 1.5055 1.3933 -0.5168 0.1920  -0.0722 237 LYS A CB  
864  N N   . LEU A 130 ? 0.6563 1.4723 1.2402 -0.4535 0.1722  -0.0618 238 LEU A N   
865  C CA  . LEU A 130 ? 0.6499 1.4711 1.1940 -0.4420 0.1820  -0.0516 238 LEU A CA  
866  C C   . LEU A 130 ? 0.7317 1.5986 1.3031 -0.4487 0.2026  -0.0635 238 LEU A C   
867  O O   . LEU A 130 ? 0.7393 1.6363 1.3633 -0.4571 0.2043  -0.0791 238 LEU A O   
868  C CB  . LEU A 130 ? 0.6067 1.4244 1.1296 -0.4153 0.1589  -0.0585 238 LEU A CB  
869  C CG  . LEU A 130 ? 0.6344 1.4121 1.1310 -0.4039 0.1367  -0.0502 238 LEU A CG  
870  C CD1 . LEU A 130 ? 0.5930 1.3781 1.0835 -0.3802 0.1170  -0.0606 238 LEU A CD1 
871  C CD2 . LEU A 130 ? 0.6580 1.4015 1.1056 -0.4047 0.1444  -0.0237 238 LEU A CD2 
872  N N   . MET A 131 ? 0.6919 1.5688 1.2298 -0.4454 0.2186  -0.0583 239 MET A N   
873  C CA  . MET A 131 ? 0.6879 1.6082 1.2513 -0.4503 0.2407  -0.0735 239 MET A CA  
874  C C   . MET A 131 ? 0.7098 1.6460 1.2667 -0.4295 0.2368  -0.0907 239 MET A C   
875  O O   . MET A 131 ? 0.6785 1.5912 1.1968 -0.4156 0.2213  -0.0859 239 MET A O   
876  C CB  . MET A 131 ? 0.7625 1.6930 1.3116 -0.4726 0.2727  -0.0595 239 MET A CB  
877  C CG  . MET A 131 ? 0.8443 1.7685 1.3293 -0.4716 0.2833  -0.0431 239 MET A CG  
878  S SD  . MET A 131 ? 0.9666 1.8971 1.4400 -0.4992 0.3179  -0.0164 239 MET A SD  
879  C CE  . MET A 131 ? 0.9463 1.9136 1.3650 -0.4991 0.3398  -0.0181 239 MET A CE  
880  N N   . PRO A 132 ? 0.6506 1.6248 1.2513 -0.4258 0.2502  -0.1117 240 PRO A N   
881  C CA  . PRO A 132 ? 0.6219 1.6041 1.2226 -0.4058 0.2498  -0.1287 240 PRO A CA  
882  C C   . PRO A 132 ? 0.6867 1.6565 1.2263 -0.4070 0.2574  -0.1265 240 PRO A C   
883  O O   . PRO A 132 ? 0.7299 1.7116 1.2414 -0.4239 0.2790  -0.1212 240 PRO A O   
884  C CB  . PRO A 132 ? 0.6355 1.6601 1.2906 -0.4071 0.2740  -0.1483 240 PRO A CB  
885  C CG  . PRO A 132 ? 0.7161 1.7574 1.3872 -0.4307 0.2898  -0.1408 240 PRO A CG  
886  C CD  . PRO A 132 ? 0.6638 1.6749 1.3196 -0.4389 0.2686  -0.1210 240 PRO A CD  
887  N N   . GLY A 133 ? 0.5965 1.5456 1.1148 -0.3900 0.2391  -0.1288 241 GLY A N   
888  C CA  . GLY A 133 ? 0.6008 1.5432 1.0637 -0.3905 0.2418  -0.1291 241 GLY A CA  
889  C C   . GLY A 133 ? 0.6561 1.5664 1.0728 -0.3880 0.2190  -0.1044 241 GLY A C   
890  O O   . GLY A 133 ? 0.6702 1.5777 1.0443 -0.3850 0.2153  -0.1038 241 GLY A O   
891  N N   . SER A 134 ? 0.6021 1.4900 1.0298 -0.3894 0.2042  -0.0858 242 SER A N   
892  C CA  . SER A 134 ? 0.5898 1.4424 0.9830 -0.3855 0.1843  -0.0623 242 SER A CA  
893  C C   . SER A 134 ? 0.6348 1.4711 1.0251 -0.3652 0.1614  -0.0691 242 SER A C   
894  O O   . SER A 134 ? 0.6160 1.4636 1.0406 -0.3543 0.1587  -0.0877 242 SER A O   
895  C CB  . SER A 134 ? 0.5887 1.4217 1.0078 -0.3927 0.1769  -0.0506 242 SER A CB  
896  O OG  . SER A 134 ? 0.6858 1.5326 1.1223 -0.4131 0.1988  -0.0454 242 SER A OG  
897  N N   . THR A 135 ? 0.5932 1.4026 0.9465 -0.3588 0.1455  -0.0512 243 THR A N   
898  C CA  . THR A 135 ? 0.5533 1.3439 0.9038 -0.3402 0.1231  -0.0541 243 THR A CA  
899  C C   . THR A 135 ? 0.6146 1.3806 0.9837 -0.3388 0.1084  -0.0455 243 THR A C   
900  O O   . THR A 135 ? 0.6342 1.3828 0.9936 -0.3497 0.1121  -0.0284 243 THR A O   
901  C CB  . THR A 135 ? 0.5660 1.3495 0.8691 -0.3346 0.1165  -0.0432 243 THR A CB  
902  O OG1 . THR A 135 ? 0.6069 1.4196 0.8999 -0.3380 0.1300  -0.0605 243 THR A OG1 
903  C CG2 . THR A 135 ? 0.4478 1.2072 0.7459 -0.3167 0.0935  -0.0407 243 THR A CG2 
904  N N   . LEU A 136 ? 0.5488 1.3165 0.9478 -0.3265 0.0942  -0.0580 244 LEU A N   
905  C CA  . LEU A 136 ? 0.5426 1.2952 0.9588 -0.3250 0.0783  -0.0565 244 LEU A CA  
906  C C   . LEU A 136 ? 0.6034 1.3320 0.9945 -0.3082 0.0596  -0.0511 244 LEU A C   
907  O O   . LEU A 136 ? 0.5891 1.3252 0.9795 -0.2932 0.0538  -0.0575 244 LEU A O   
908  C CB  . LEU A 136 ? 0.5211 1.3031 0.9851 -0.3213 0.0741  -0.0725 244 LEU A CB  
909  C CG  . LEU A 136 ? 0.5683 1.3476 1.0484 -0.3151 0.0528  -0.0766 244 LEU A CG  
910  C CD1 . LEU A 136 ? 0.5882 1.3580 1.0786 -0.3350 0.0543  -0.0770 244 LEU A CD1 
911  C CD2 . LEU A 136 ? 0.5730 1.3903 1.0941 -0.3030 0.0461  -0.0873 244 LEU A CD2 
912  N N   . VAL A 137 ? 0.5675 1.2656 0.9403 -0.3106 0.0528  -0.0389 245 VAL A N   
913  C CA  . VAL A 137 ? 0.5351 1.2098 0.8855 -0.2947 0.0364  -0.0335 245 VAL A CA  
914  C C   . VAL A 137 ? 0.6126 1.2724 0.9793 -0.2960 0.0248  -0.0400 245 VAL A C   
915  O O   . VAL A 137 ? 0.6324 1.2757 1.0072 -0.3110 0.0318  -0.0370 245 VAL A O   
916  C CB  . VAL A 137 ? 0.5764 1.2305 0.8883 -0.2929 0.0401  -0.0130 245 VAL A CB  
917  C CG1 . VAL A 137 ? 0.5573 1.1845 0.8534 -0.2783 0.0251  -0.0065 245 VAL A CG1 
918  C CG2 . VAL A 137 ? 0.5712 1.2487 0.8636 -0.2911 0.0477  -0.0126 245 VAL A CG2 
919  N N   . LEU A 138 ? 0.5663 1.2344 0.9394 -0.2814 0.0087  -0.0500 246 LEU A N   
920  C CA  . LEU A 138 ? 0.5618 1.2247 0.9460 -0.2809 -0.0049 -0.0608 246 LEU A CA  
921  C C   . LEU A 138 ? 0.6142 1.2559 0.9721 -0.2636 -0.0167 -0.0564 246 LEU A C   
922  O O   . LEU A 138 ? 0.5866 1.2363 0.9332 -0.2480 -0.0208 -0.0519 246 LEU A O   
923  C CB  . LEU A 138 ? 0.5385 1.2425 0.9560 -0.2798 -0.0133 -0.0760 246 LEU A CB  
924  C CG  . LEU A 138 ? 0.5905 1.3200 1.0431 -0.2990 -0.0031 -0.0843 246 LEU A CG  
925  C CD1 . LEU A 138 ? 0.5656 1.3431 1.0521 -0.2924 -0.0140 -0.0956 246 LEU A CD1 
926  C CD2 . LEU A 138 ? 0.6403 1.3499 1.1012 -0.3208 0.0014  -0.0912 246 LEU A CD2 
927  N N   . GLN A 139 ? 0.6051 1.2173 0.9555 -0.2673 -0.0189 -0.0576 247 GLN A N   
928  C CA  . GLN A 139 ? 0.6003 1.1899 0.9274 -0.2517 -0.0272 -0.0536 247 GLN A CA  
929  C C   . GLN A 139 ? 0.6617 1.2480 0.9953 -0.2520 -0.0372 -0.0718 247 GLN A C   
930  O O   . GLN A 139 ? 0.6827 1.2641 1.0350 -0.2691 -0.0337 -0.0856 247 GLN A O   
931  C CB  . GLN A 139 ? 0.6378 1.1913 0.9453 -0.2513 -0.0172 -0.0342 247 GLN A CB  
932  C CG  . GLN A 139 ? 0.9345 1.4909 1.2174 -0.2346 -0.0201 -0.0195 247 GLN A CG  
933  C CD  . GLN A 139 ? 1.2829 1.8161 1.5489 -0.2342 -0.0110 0.0033  247 GLN A CD  
934  O OE1 . GLN A 139 ? 1.2798 1.7808 1.5447 -0.2315 -0.0085 0.0099  247 GLN A OE1 
935  N NE2 . GLN A 139 ? 1.1715 1.7228 1.4253 -0.2368 -0.0045 0.0159  247 GLN A NE2 
936  N N   . CYS A 140 ? 0.6296 1.2209 0.9483 -0.2345 -0.0485 -0.0736 248 CYS A N   
937  C CA  . CYS A 140 ? 0.6580 1.2502 0.9754 -0.2323 -0.0582 -0.0918 248 CYS A CA  
938  C C   . CYS A 140 ? 0.7180 1.2928 1.0106 -0.2133 -0.0615 -0.0838 248 CYS A C   
939  O O   . CYS A 140 ? 0.6914 1.2841 0.9746 -0.1980 -0.0668 -0.0742 248 CYS A O   
940  C CB  . CYS A 140 ? 0.6542 1.2950 0.9860 -0.2318 -0.0712 -0.1060 248 CYS A CB  
941  S SG  . CYS A 140 ? 0.7323 1.3850 1.0615 -0.2358 -0.0828 -0.1346 248 CYS A SG  
942  N N   . VAL A 141 ? 0.6946 1.2325 0.9804 -0.2140 -0.0557 -0.0869 249 VAL A N   
943  C CA  . VAL A 141 ? 0.6738 1.1945 0.9394 -0.1955 -0.0569 -0.0791 249 VAL A CA  
944  C C   . VAL A 141 ? 0.6868 1.2024 0.9495 -0.1942 -0.0604 -0.1025 249 VAL A C   
945  O O   . VAL A 141 ? 0.6891 1.1812 0.9640 -0.2077 -0.0531 -0.1190 249 VAL A O   
946  C CB  . VAL A 141 ? 0.7324 1.2180 0.9921 -0.1915 -0.0455 -0.0564 249 VAL A CB  
947  C CG1 . VAL A 141 ? 0.7254 1.1992 0.9688 -0.1712 -0.0470 -0.0475 249 VAL A CG1 
948  C CG2 . VAL A 141 ? 0.7097 1.2096 0.9685 -0.1953 -0.0421 -0.0374 249 VAL A CG2 
949  N N   . ALA A 142 ? 0.6152 1.1534 0.8626 -0.1789 -0.0698 -0.1048 250 ALA A N   
950  C CA  . ALA A 142 ? 0.6315 1.1717 0.8701 -0.1759 -0.0728 -0.1275 250 ALA A CA  
951  C C   . ALA A 142 ? 0.6718 1.1981 0.8922 -0.1555 -0.0701 -0.1175 250 ALA A C   
952  O O   . ALA A 142 ? 0.6536 1.1830 0.8674 -0.1428 -0.0704 -0.0940 250 ALA A O   
953  C CB  . ALA A 142 ? 0.6310 1.2228 0.8675 -0.1774 -0.0868 -0.1416 250 ALA A CB  
954  N N   . VAL A 143 ? 0.6401 1.1543 0.8545 -0.1537 -0.0666 -0.1385 251 VAL A N   
955  C CA  . VAL A 143 ? 0.6302 1.1358 0.8294 -0.1348 -0.0628 -0.1344 251 VAL A CA  
956  C C   . VAL A 143 ? 0.7300 1.2696 0.9132 -0.1330 -0.0697 -0.1583 251 VAL A C   
957  O O   . VAL A 143 ? 0.7195 1.2797 0.9063 -0.1486 -0.0753 -0.1833 251 VAL A O   
958  C CB  . VAL A 143 ? 0.6857 1.1412 0.8940 -0.1304 -0.0475 -0.1340 251 VAL A CB  
959  C CG1 . VAL A 143 ? 0.6735 1.1064 0.8920 -0.1278 -0.0425 -0.1027 251 VAL A CG1 
960  C CG2 . VAL A 143 ? 0.7226 1.1534 0.9452 -0.1468 -0.0382 -0.1659 251 VAL A CG2 
961  N N   . GLY A 144 ? 0.7220 1.2721 0.8879 -0.1148 -0.0692 -0.1503 252 GLY A N   
962  C CA  . GLY A 144 ? 0.7291 1.3150 0.8743 -0.1101 -0.0740 -0.1685 252 GLY A CA  
963  C C   . GLY A 144 ? 0.7600 1.3674 0.8884 -0.0899 -0.0746 -0.1469 252 GLY A C   
964  O O   . GLY A 144 ? 0.7222 1.3239 0.8570 -0.0811 -0.0737 -0.1182 252 GLY A O   
965  N N   . SER A 145 ? 0.7332 1.3677 0.8400 -0.0843 -0.0748 -0.1631 253 SER A N   
966  C CA  . SER A 145 ? 0.7153 1.3749 0.8039 -0.0663 -0.0730 -0.1457 253 SER A CA  
967  C C   . SER A 145 ? 0.7815 1.4977 0.8470 -0.0667 -0.0831 -0.1559 253 SER A C   
968  O O   . SER A 145 ? 0.8069 1.5366 0.8610 -0.0770 -0.0845 -0.1902 253 SER A O   
969  C CB  . SER A 145 ? 0.7614 1.3953 0.8458 -0.0551 -0.0581 -0.1519 253 SER A CB  
970  O OG  . SER A 145 ? 0.8362 1.4848 0.9143 -0.0386 -0.0544 -0.1248 253 SER A OG  
971  N N   . PRO A 146 ? 0.7310 1.4835 0.7920 -0.0569 -0.0902 -0.1271 254 PRO A N   
972  C CA  . PRO A 146 ? 0.6940 1.4344 0.7717 -0.0470 -0.0869 -0.0903 254 PRO A CA  
973  C C   . PRO A 146 ? 0.6783 1.3930 0.7829 -0.0590 -0.0904 -0.0863 254 PRO A C   
974  O O   . PRO A 146 ? 0.6968 1.4128 0.8073 -0.0739 -0.0973 -0.1068 254 PRO A O   
975  C CB  . PRO A 146 ? 0.7226 1.5136 0.7901 -0.0356 -0.0928 -0.0672 254 PRO A CB  
976  C CG  . PRO A 146 ? 0.8117 1.6446 0.8483 -0.0353 -0.0980 -0.0888 254 PRO A CG  
977  C CD  . PRO A 146 ? 0.7702 1.5843 0.8095 -0.0545 -0.1013 -0.1296 254 PRO A CD  
978  N N   . ILE A 147 ? 0.5802 1.2734 0.7013 -0.0542 -0.0842 -0.0628 255 ILE A N   
979  C CA  . ILE A 147 ? 0.5495 1.2213 0.6932 -0.0650 -0.0854 -0.0578 255 ILE A CA  
980  C C   . ILE A 147 ? 0.6262 1.3246 0.7795 -0.0752 -0.0963 -0.0628 255 ILE A C   
981  O O   . ILE A 147 ? 0.6211 1.3593 0.7708 -0.0677 -0.1024 -0.0535 255 ILE A O   
982  C CB  . ILE A 147 ? 0.5432 1.2029 0.7011 -0.0586 -0.0775 -0.0336 255 ILE A CB  
983  C CG1 . ILE A 147 ? 0.5304 1.1624 0.7039 -0.0699 -0.0757 -0.0334 255 ILE A CG1 
984  C CG2 . ILE A 147 ? 0.5213 1.2085 0.6883 -0.0510 -0.0773 -0.0133 255 ILE A CG2 
985  C CD1 . ILE A 147 ? 0.6159 1.2396 0.8007 -0.0663 -0.0681 -0.0170 255 ILE A CD1 
986  N N   . PRO A 148 ? 0.5927 1.2729 0.7590 -0.0917 -0.0981 -0.0767 256 PRO A N   
987  C CA  . PRO A 148 ? 0.5838 1.2920 0.7637 -0.1023 -0.1074 -0.0824 256 PRO A CA  
988  C C   . PRO A 148 ? 0.5865 1.3036 0.7862 -0.0976 -0.1056 -0.0585 256 PRO A C   
989  O O   . PRO A 148 ? 0.5505 1.2421 0.7558 -0.0939 -0.0963 -0.0444 256 PRO A O   
990  C CB  . PRO A 148 ? 0.6162 1.2936 0.8072 -0.1217 -0.1046 -0.1019 256 PRO A CB  
991  C CG  . PRO A 148 ? 0.6902 1.3264 0.8705 -0.1185 -0.0948 -0.1073 256 PRO A CG  
992  C CD  . PRO A 148 ? 0.6184 1.2542 0.7909 -0.1005 -0.0906 -0.0840 256 PRO A CD  
993  N N   . HIS A 149 ? 0.5303 1.2870 0.7427 -0.0980 -0.1141 -0.0559 257 HIS A N   
994  C CA  . HIS A 149 ? 0.5057 1.2740 0.7436 -0.0938 -0.1111 -0.0367 257 HIS A CA  
995  C C   . HIS A 149 ? 0.5525 1.3318 0.8114 -0.1108 -0.1159 -0.0502 257 HIS A C   
996  O O   . HIS A 149 ? 0.5942 1.3911 0.8493 -0.1223 -0.1253 -0.0714 257 HIS A O   
997  C CB  . HIS A 149 ? 0.5196 1.3292 0.7605 -0.0747 -0.1147 -0.0154 257 HIS A CB  
998  C CG  . HIS A 149 ? 0.5596 1.3559 0.7876 -0.0588 -0.1052 0.0026  257 HIS A CG  
999  N ND1 . HIS A 149 ? 0.6018 1.4044 0.8002 -0.0527 -0.1079 -0.0026 257 HIS A ND1 
1000 C CD2 . HIS A 149 ? 0.5664 1.3453 0.8100 -0.0497 -0.0915 0.0231  257 HIS A CD2 
1001 C CE1 . HIS A 149 ? 0.5862 1.3742 0.7831 -0.0400 -0.0959 0.0169  257 HIS A CE1 
1002 N NE2 . HIS A 149 ? 0.5739 1.3472 0.7986 -0.0385 -0.0859 0.0321  257 HIS A NE2 
1003 N N   . TYR A 150 ? 0.4575 1.2279 0.7397 -0.1140 -0.1078 -0.0408 258 TYR A N   
1004 C CA  . TYR A 150 ? 0.4401 1.2201 0.7454 -0.1301 -0.1087 -0.0511 258 TYR A CA  
1005 C C   . TYR A 150 ? 0.4621 1.2794 0.7977 -0.1208 -0.1089 -0.0368 258 TYR A C   
1006 O O   . TYR A 150 ? 0.4158 1.2339 0.7586 -0.1038 -0.1017 -0.0165 258 TYR A O   
1007 C CB  . TYR A 150 ? 0.4527 1.1903 0.7600 -0.1431 -0.0959 -0.0531 258 TYR A CB  
1008 C CG  . TYR A 150 ? 0.4913 1.1904 0.7740 -0.1482 -0.0935 -0.0608 258 TYR A CG  
1009 C CD1 . TYR A 150 ? 0.5430 1.2277 0.8245 -0.1648 -0.0945 -0.0785 258 TYR A CD1 
1010 C CD2 . TYR A 150 ? 0.4839 1.1618 0.7488 -0.1359 -0.0889 -0.0502 258 TYR A CD2 
1011 C CE1 . TYR A 150 ? 0.5839 1.2310 0.8479 -0.1665 -0.0901 -0.0835 258 TYR A CE1 
1012 C CE2 . TYR A 150 ? 0.4967 1.1428 0.7433 -0.1376 -0.0865 -0.0553 258 TYR A CE2 
1013 C CZ  . TYR A 150 ? 0.6143 1.2435 0.8611 -0.1517 -0.0865 -0.0708 258 TYR A CZ  
1014 O OH  . TYR A 150 ? 0.6903 1.2853 0.9248 -0.1512 -0.0815 -0.0737 258 TYR A OH  
1015 N N   . GLN A 151 ? 0.4337 1.2822 0.7916 -0.1322 -0.1155 -0.0477 259 GLN A N   
1016 C CA  . GLN A 151 ? 0.4237 1.3099 0.8181 -0.1251 -0.1147 -0.0361 259 GLN A CA  
1017 C C   . GLN A 151 ? 0.5163 1.4147 0.9329 -0.1474 -0.1156 -0.0550 259 GLN A C   
1018 O O   . GLN A 151 ? 0.5469 1.4700 0.9614 -0.1603 -0.1284 -0.0739 259 GLN A O   
1019 C CB  . GLN A 151 ? 0.4455 1.3863 0.8458 -0.1040 -0.1276 -0.0199 259 GLN A CB  
1020 C CG  . GLN A 151 ? 0.5957 1.5815 1.0409 -0.0932 -0.1271 -0.0046 259 GLN A CG  
1021 C CD  . GLN A 151 ? 0.7367 1.6941 1.2098 -0.0851 -0.1054 0.0104  259 GLN A CD  
1022 O OE1 . GLN A 151 ? 0.5268 1.4699 1.0030 -0.0657 -0.0948 0.0322  259 GLN A OE1 
1023 N NE2 . GLN A 151 ? 0.7215 1.6737 1.2192 -0.1006 -0.0966 -0.0023 259 GLN A NE2 
1024 N N   . TRP A 152 ? 0.4650 1.3464 0.9030 -0.1539 -0.1003 -0.0523 260 TRP A N   
1025 C CA  . TRP A 152 ? 0.4611 1.3521 0.9226 -0.1754 -0.0966 -0.0674 260 TRP A CA  
1026 C C   . TRP A 152 ? 0.5131 1.4636 1.0148 -0.1695 -0.1033 -0.0642 260 TRP A C   
1027 O O   . TRP A 152 ? 0.4891 1.4600 1.0093 -0.1472 -0.1008 -0.0443 260 TRP A O   
1028 C CB  . TRP A 152 ? 0.4304 1.2838 0.8947 -0.1848 -0.0762 -0.0656 260 TRP A CB  
1029 C CG  . TRP A 152 ? 0.4425 1.2452 0.8708 -0.1943 -0.0712 -0.0692 260 TRP A CG  
1030 C CD1 . TRP A 152 ? 0.4692 1.2419 0.8699 -0.1826 -0.0691 -0.0598 260 TRP A CD1 
1031 C CD2 . TRP A 152 ? 0.4537 1.2330 0.8728 -0.2161 -0.0687 -0.0818 260 TRP A CD2 
1032 N NE1 . TRP A 152 ? 0.4703 1.2056 0.8453 -0.1939 -0.0665 -0.0646 260 TRP A NE1 
1033 C CE2 . TRP A 152 ? 0.5054 1.2408 0.8913 -0.2139 -0.0648 -0.0764 260 TRP A CE2 
1034 C CE3 . TRP A 152 ? 0.4711 1.2629 0.9102 -0.2373 -0.0683 -0.0965 260 TRP A CE3 
1035 C CZ2 . TRP A 152 ? 0.5142 1.2157 0.8872 -0.2295 -0.0595 -0.0816 260 TRP A CZ2 
1036 C CZ3 . TRP A 152 ? 0.4988 1.2529 0.9254 -0.2554 -0.0610 -0.1032 260 TRP A CZ3 
1037 C CH2 . TRP A 152 ? 0.5132 1.2219 0.9073 -0.2501 -0.0564 -0.0941 260 TRP A CH2 
1038 N N   . PHE A 153 ? 0.4949 1.4743 1.0142 -0.1895 -0.1106 -0.0833 261 PHE A N   
1039 C CA  . PHE A 153 ? 0.4902 1.5347 1.0530 -0.1879 -0.1183 -0.0838 261 PHE A CA  
1040 C C   . PHE A 153 ? 0.5305 1.5741 1.1224 -0.2121 -0.1058 -0.0983 261 PHE A C   
1041 O O   . PHE A 153 ? 0.5107 1.5136 1.0862 -0.2352 -0.0977 -0.1132 261 PHE A O   
1042 C CB  . PHE A 153 ? 0.5329 1.6317 1.0929 -0.1912 -0.1426 -0.0972 261 PHE A CB  
1043 C CG  . PHE A 153 ? 0.5564 1.6796 1.0929 -0.1661 -0.1575 -0.0811 261 PHE A CG  
1044 C CD1 . PHE A 153 ? 0.5948 1.7948 1.1534 -0.1492 -0.1746 -0.0690 261 PHE A CD1 
1045 C CD2 . PHE A 153 ? 0.5892 1.6643 1.0811 -0.1600 -0.1552 -0.0781 261 PHE A CD2 
1046 C CE1 . PHE A 153 ? 0.6089 1.8352 1.1426 -0.1259 -0.1875 -0.0509 261 PHE A CE1 
1047 C CE2 . PHE A 153 ? 0.6298 1.7295 1.0991 -0.1379 -0.1670 -0.0629 261 PHE A CE2 
1048 C CZ  . PHE A 153 ? 0.5982 1.7731 1.0867 -0.1212 -0.1828 -0.0486 261 PHE A CZ  
1049 N N   . LYS A 154 ? 0.5087 1.6001 1.1467 -0.2054 -0.1033 -0.0917 262 LYS A N   
1050 C CA  . LYS A 154 ? 0.5175 1.6267 1.1943 -0.2251 -0.0915 -0.1035 262 LYS A CA  
1051 C C   . LYS A 154 ? 0.5912 1.7849 1.3143 -0.2190 -0.1080 -0.1045 262 LYS A C   
1052 O O   . LYS A 154 ? 0.5795 1.8096 1.3214 -0.1899 -0.1138 -0.0826 262 LYS A O   
1053 C CB  . LYS A 154 ? 0.5405 1.6198 1.2297 -0.2189 -0.0654 -0.0920 262 LYS A CB  
1054 C CG  . LYS A 154 ? 0.5683 1.6902 1.3125 -0.2240 -0.0536 -0.0952 262 LYS A CG  
1055 C CD  . LYS A 154 ? 0.6035 1.6907 1.3447 -0.2498 -0.0306 -0.1067 262 LYS A CD  
1056 C CE  . LYS A 154 ? 0.6139 1.7070 1.3868 -0.2412 -0.0065 -0.1007 262 LYS A CE  
1057 N NZ  . LYS A 154 ? 0.7347 1.8949 1.5694 -0.2387 -0.0073 -0.1030 262 LYS A NZ  
1058 N N   . ASN A 155 ? 0.5755 1.8026 1.3190 -0.2462 -0.1153 -0.1289 263 ASN A N   
1059 C CA  . ASN A 155 ? 0.5853 1.9019 1.3758 -0.2456 -0.1325 -0.1345 263 ASN A CA  
1060 C C   . ASN A 155 ? 0.6869 2.0583 1.4717 -0.2153 -0.1572 -0.1165 263 ASN A C   
1061 O O   . ASN A 155 ? 0.6897 2.1123 1.5115 -0.1891 -0.1600 -0.0932 263 ASN A O   
1062 C CB  . ASN A 155 ? 0.5240 1.8711 1.3715 -0.2427 -0.1159 -0.1270 263 ASN A CB  
1063 C CG  . ASN A 155 ? 0.6340 1.9288 1.4841 -0.2676 -0.0879 -0.1379 263 ASN A CG  
1064 O OD1 . ASN A 155 ? 0.4774 1.7538 1.3211 -0.3000 -0.0843 -0.1603 263 ASN A OD1 
1065 N ND2 . ASN A 155 ? 0.5593 1.8335 1.4230 -0.2531 -0.0656 -0.1222 263 ASN A ND2 
1066 N N   . GLU A 156 ? 0.6691 2.0270 1.4068 -0.2174 -0.1725 -0.1250 264 GLU A N   
1067 C CA  . GLU A 156 ? 0.6771 2.0857 1.3970 -0.1930 -0.1963 -0.1107 264 GLU A CA  
1068 C C   . GLU A 156 ? 0.6921 2.0827 1.4008 -0.1534 -0.1903 -0.0698 264 GLU A C   
1069 O O   . GLU A 156 ? 0.7063 2.1308 1.3936 -0.1329 -0.2072 -0.0543 264 GLU A O   
1070 C CB  . GLU A 156 ? 0.7111 2.2284 1.4682 -0.1955 -0.2214 -0.1198 264 GLU A CB  
1071 C CG  . GLU A 156 ? 0.9517 2.4925 1.7239 -0.2378 -0.2275 -0.1648 264 GLU A CG  
1072 C CD  . GLU A 156 ? 1.4208 2.9090 2.1472 -0.2660 -0.2275 -0.1986 264 GLU A CD  
1073 O OE1 . GLU A 156 ? 1.3725 2.8572 2.0538 -0.2540 -0.2398 -0.1967 264 GLU A OE1 
1074 O OE2 . GLU A 156 ? 1.4239 2.8724 2.1615 -0.2994 -0.2128 -0.2258 264 GLU A OE2 
1075 N N   . LEU A 157 ? 0.5969 1.9339 1.3187 -0.1444 -0.1649 -0.0541 265 LEU A N   
1076 C CA  . LEU A 157 ? 0.5741 1.8874 1.2933 -0.1106 -0.1541 -0.0192 265 LEU A CA  
1077 C C   . LEU A 157 ? 0.6233 1.8489 1.2953 -0.1141 -0.1388 -0.0204 265 LEU A C   
1078 O O   . LEU A 157 ? 0.6120 1.7869 1.2707 -0.1386 -0.1258 -0.0410 265 LEU A O   
1079 C CB  . LEU A 157 ? 0.5575 1.8795 1.3326 -0.0964 -0.1341 -0.0031 265 LEU A CB  
1080 C CG  . LEU A 157 ? 0.6001 2.0130 1.4313 -0.0828 -0.1468 0.0083  265 LEU A CG  
1081 C CD1 . LEU A 157 ? 0.5761 1.9896 1.4614 -0.0866 -0.1242 0.0049  265 LEU A CD1 
1082 C CD2 . LEU A 157 ? 0.6382 2.0904 1.4799 -0.0420 -0.1554 0.0489  265 LEU A CD2 
1083 N N   . PRO A 158 ? 0.5770 1.7851 1.2251 -0.0896 -0.1388 0.0035  266 PRO A N   
1084 C CA  . PRO A 158 ? 0.5713 1.7022 1.1789 -0.0938 -0.1247 0.0011  266 PRO A CA  
1085 C C   . PRO A 158 ? 0.6286 1.7160 1.2595 -0.0913 -0.0973 0.0069  266 PRO A C   
1086 O O   . PRO A 158 ? 0.6267 1.7389 1.3025 -0.0729 -0.0875 0.0244  266 PRO A O   
1087 C CB  . PRO A 158 ? 0.6012 1.7388 1.1843 -0.0680 -0.1326 0.0259  266 PRO A CB  
1088 C CG  . PRO A 158 ? 0.6656 1.8879 1.2706 -0.0515 -0.1533 0.0409  266 PRO A CG  
1089 C CD  . PRO A 158 ? 0.6022 1.8617 1.2598 -0.0569 -0.1505 0.0358  266 PRO A CD  
1090 N N   . LEU A 159 ? 0.5800 1.6067 1.1823 -0.1102 -0.0845 -0.0091 267 LEU A N   
1091 C CA  . LEU A 159 ? 0.5684 1.5553 1.1842 -0.1123 -0.0587 -0.0095 267 LEU A CA  
1092 C C   . LEU A 159 ? 0.6146 1.5714 1.2203 -0.0920 -0.0490 0.0086  267 LEU A C   
1093 O O   . LEU A 159 ? 0.6208 1.5448 1.1852 -0.0947 -0.0532 0.0072  267 LEU A O   
1094 C CB  . LEU A 159 ? 0.5680 1.5140 1.1579 -0.1411 -0.0502 -0.0318 267 LEU A CB  
1095 C CG  . LEU A 159 ? 0.6376 1.6082 1.2464 -0.1638 -0.0522 -0.0490 267 LEU A CG  
1096 C CD1 . LEU A 159 ? 0.6507 1.5778 1.2278 -0.1895 -0.0447 -0.0642 267 LEU A CD1 
1097 C CD2 . LEU A 159 ? 0.6425 1.6420 1.3023 -0.1598 -0.0367 -0.0471 267 LEU A CD2 
1098 N N   . THR A 160 ? 0.5713 1.5433 1.2193 -0.0698 -0.0362 0.0276  268 THR A N   
1099 C CA  . THR A 160 ? 0.5792 1.5258 1.2311 -0.0484 -0.0229 0.0480  268 THR A CA  
1100 C C   . THR A 160 ? 0.6299 1.5189 1.2480 -0.0619 -0.0104 0.0346  268 THR A C   
1101 O O   . THR A 160 ? 0.6344 1.5007 1.2540 -0.0797 0.0042  0.0148  268 THR A O   
1102 C CB  . THR A 160 ? 0.7132 1.6795 1.4257 -0.0234 -0.0053 0.0694  268 THR A CB  
1103 O OG1 . THR A 160 ? 0.7042 1.6218 1.4287 -0.0197 0.0228  0.0692  268 THR A OG1 
1104 C CG2 . THR A 160 ? 0.7120 1.7158 1.4685 -0.0283 -0.0017 0.0603  268 THR A CG2 
1105 N N   . HIS A 161 ? 0.5870 1.4585 1.1716 -0.0550 -0.0179 0.0443  269 HIS A N   
1106 C CA  . HIS A 161 ? 0.5816 1.4053 1.1353 -0.0658 -0.0085 0.0338  269 HIS A CA  
1107 C C   . HIS A 161 ? 0.6323 1.4371 1.1467 -0.0915 -0.0166 0.0102  269 HIS A C   
1108 O O   . HIS A 161 ? 0.6511 1.4231 1.1458 -0.1011 -0.0076 0.0012  269 HIS A O   
1109 C CB  . HIS A 161 ? 0.5889 1.3853 1.1739 -0.0629 0.0205  0.0321  269 HIS A CB  
1110 C CG  . HIS A 161 ? 0.6434 1.4479 1.2699 -0.0360 0.0331  0.0587  269 HIS A CG  
1111 N ND1 . HIS A 161 ? 0.6747 1.4858 1.2897 -0.0170 0.0243  0.0847  269 HIS A ND1 
1112 C CD2 . HIS A 161 ? 0.6834 1.4897 1.3638 -0.0246 0.0558  0.0645  269 HIS A CD2 
1113 C CE1 . HIS A 161 ? 0.6876 1.5041 1.3494 0.0061  0.0414  0.1091  269 HIS A CE1 
1114 N NE2 . HIS A 161 ? 0.6971 1.5093 1.4018 0.0030  0.0611  0.0976  269 HIS A NE2 
1115 N N   . GLU A 162 ? 0.5735 1.3995 1.0778 -0.1025 -0.0330 0.0014  270 GLU A N   
1116 C CA  . GLU A 162 ? 0.5601 1.3639 1.0310 -0.1251 -0.0380 -0.0165 270 GLU A CA  
1117 C C   . GLU A 162 ? 0.5967 1.3948 1.0316 -0.1227 -0.0553 -0.0153 270 GLU A C   
1118 O O   . GLU A 162 ? 0.6140 1.4347 1.0442 -0.1277 -0.0706 -0.0218 270 GLU A O   
1119 C CB  . GLU A 162 ? 0.5728 1.3966 1.0592 -0.1422 -0.0401 -0.0295 270 GLU A CB  
1120 C CG  . GLU A 162 ? 0.6227 1.4490 1.1400 -0.1480 -0.0200 -0.0346 270 GLU A CG  
1121 C CD  . GLU A 162 ? 0.8402 1.6328 1.3414 -0.1586 -0.0024 -0.0426 270 GLU A CD  
1122 O OE1 . GLU A 162 ? 0.9079 1.6749 1.3712 -0.1690 -0.0068 -0.0463 270 GLU A OE1 
1123 O OE2 . GLU A 162 ? 0.6948 1.4904 1.2236 -0.1567 0.0167  -0.0463 270 GLU A OE2 
1124 N N   . THR A 163 ? 0.5155 1.2859 0.9277 -0.1164 -0.0515 -0.0098 271 THR A N   
1125 C CA  . THR A 163 ? 0.5042 1.2679 0.8845 -0.1105 -0.0636 -0.0074 271 THR A CA  
1126 C C   . THR A 163 ? 0.5734 1.3004 0.9222 -0.1209 -0.0621 -0.0159 271 THR A C   
1127 O O   . THR A 163 ? 0.5824 1.2982 0.9104 -0.1122 -0.0650 -0.0111 271 THR A O   
1128 C CB  . THR A 163 ? 0.4893 1.2636 0.8761 -0.0880 -0.0612 0.0129  271 THR A CB  
1129 O OG1 . THR A 163 ? 0.4785 1.2320 0.8837 -0.0847 -0.0419 0.0186  271 THR A OG1 
1130 C CG2 . THR A 163 ? 0.4001 1.2203 0.8099 -0.0735 -0.0695 0.0263  271 THR A CG2 
1131 N N   . LYS A 164 ? 0.5210 1.2326 0.8671 -0.1382 -0.0573 -0.0263 272 LYS A N   
1132 C CA  . LYS A 164 ? 0.5128 1.1943 0.8321 -0.1462 -0.0561 -0.0298 272 LYS A CA  
1133 C C   . LYS A 164 ? 0.5823 1.2553 0.8939 -0.1612 -0.0612 -0.0395 272 LYS A C   
1134 O O   . LYS A 164 ? 0.5687 1.2604 0.8980 -0.1692 -0.0639 -0.0464 272 LYS A O   
1135 C CB  . LYS A 164 ? 0.5180 1.1889 0.8391 -0.1529 -0.0424 -0.0293 272 LYS A CB  
1136 C CG  . LYS A 164 ? 0.5307 1.2079 0.8687 -0.1423 -0.0327 -0.0246 272 LYS A CG  
1137 C CD  . LYS A 164 ? 0.5396 1.2109 0.8786 -0.1522 -0.0192 -0.0310 272 LYS A CD  
1138 C CE  . LYS A 164 ? 0.6274 1.2949 0.9749 -0.1443 -0.0101 -0.0295 272 LYS A CE  
1139 N NZ  . LYS A 164 ? 0.7548 1.4297 1.1309 -0.1291 -0.0049 -0.0207 272 LYS A NZ  
1140 N N   . LYS A 165 ? 0.5529 1.1979 0.8425 -0.1653 -0.0606 -0.0390 273 LYS A N   
1141 C CA  . LYS A 165 ? 0.5534 1.1804 0.8386 -0.1791 -0.0606 -0.0452 273 LYS A CA  
1142 C C   . LYS A 165 ? 0.5939 1.2273 0.8946 -0.1949 -0.0515 -0.0459 273 LYS A C   
1143 O O   . LYS A 165 ? 0.6249 1.2607 0.9384 -0.2081 -0.0515 -0.0546 273 LYS A O   
1144 C CB  . LYS A 165 ? 0.5715 1.1670 0.8352 -0.1762 -0.0577 -0.0374 273 LYS A CB  
1145 C CG  . LYS A 165 ? 0.6319 1.2220 0.8811 -0.1598 -0.0636 -0.0359 273 LYS A CG  
1146 C CD  . LYS A 165 ? 0.7085 1.2702 0.9428 -0.1557 -0.0604 -0.0277 273 LYS A CD  
1147 C CE  . LYS A 165 ? 0.7119 1.2754 0.9351 -0.1393 -0.0628 -0.0219 273 LYS A CE  
1148 N NZ  . LYS A 165 ? 0.7995 1.3435 1.0131 -0.1337 -0.0595 -0.0101 273 LYS A NZ  
1149 N N   . LEU A 166 ? 0.5066 1.1471 0.8089 -0.1945 -0.0427 -0.0395 274 LEU A N   
1150 C CA  . LEU A 166 ? 0.5023 1.1523 0.8164 -0.2084 -0.0312 -0.0405 274 LEU A CA  
1151 C C   . LEU A 166 ? 0.5367 1.2160 0.8802 -0.2074 -0.0275 -0.0470 274 LEU A C   
1152 O O   . LEU A 166 ? 0.5283 1.2181 0.8806 -0.1947 -0.0266 -0.0458 274 LEU A O   
1153 C CB  . LEU A 166 ? 0.5067 1.1511 0.8028 -0.2105 -0.0220 -0.0329 274 LEU A CB  
1154 C CG  . LEU A 166 ? 0.6194 1.2519 0.9020 -0.2239 -0.0146 -0.0243 274 LEU A CG  
1155 C CD1 . LEU A 166 ? 0.6392 1.2654 0.8949 -0.2192 -0.0140 -0.0121 274 LEU A CD1 
1156 C CD2 . LEU A 166 ? 0.6747 1.3264 0.9716 -0.2388 -0.0011 -0.0289 274 LEU A CD2 
1157 N N   . TYR A 167 ? 0.4926 1.1844 0.8552 -0.2210 -0.0226 -0.0528 275 TYR A N   
1158 C CA  . TYR A 167 ? 0.4832 1.2050 0.8786 -0.2212 -0.0156 -0.0581 275 TYR A CA  
1159 C C   . TYR A 167 ? 0.5662 1.2864 0.9600 -0.2375 0.0010  -0.0593 275 TYR A C   
1160 O O   . TYR A 167 ? 0.5631 1.2758 0.9540 -0.2527 0.0036  -0.0589 275 TYR A O   
1161 C CB  . TYR A 167 ? 0.4864 1.2352 0.9100 -0.2238 -0.0248 -0.0651 275 TYR A CB  
1162 C CG  . TYR A 167 ? 0.4851 1.2670 0.9472 -0.2250 -0.0150 -0.0687 275 TYR A CG  
1163 C CD1 . TYR A 167 ? 0.4820 1.2801 0.9646 -0.2072 -0.0106 -0.0641 275 TYR A CD1 
1164 C CD2 . TYR A 167 ? 0.5117 1.3082 0.9942 -0.2434 -0.0076 -0.0762 275 TYR A CD2 
1165 C CE1 . TYR A 167 ? 0.4711 1.2987 0.9945 -0.2059 0.0009  -0.0670 275 TYR A CE1 
1166 C CE2 . TYR A 167 ? 0.5163 1.3460 1.0378 -0.2435 0.0028  -0.0800 275 TYR A CE2 
1167 C CZ  . TYR A 167 ? 0.5923 1.4378 1.1348 -0.2236 0.0068  -0.0755 275 TYR A CZ  
1168 O OH  . TYR A 167 ? 0.6498 1.5273 1.2359 -0.2212 0.0191  -0.0787 275 TYR A OH  
1169 N N   . MET A 168 ? 0.5661 1.2921 0.9600 -0.2353 0.0139  -0.0611 276 MET A N   
1170 C CA  . MET A 168 ? 0.6026 1.3337 0.9905 -0.2508 0.0311  -0.0638 276 MET A CA  
1171 C C   . MET A 168 ? 0.6242 1.3814 1.0454 -0.2520 0.0477  -0.0757 276 MET A C   
1172 O O   . MET A 168 ? 0.5990 1.3629 1.0411 -0.2381 0.0495  -0.0802 276 MET A O   
1173 C CB  . MET A 168 ? 0.6636 1.3810 1.0136 -0.2522 0.0334  -0.0582 276 MET A CB  
1174 C CG  . MET A 168 ? 0.7716 1.4989 1.1061 -0.2691 0.0493  -0.0574 276 MET A CG  
1175 S SD  . MET A 168 ? 0.8673 1.6101 1.1776 -0.2720 0.0605  -0.0661 276 MET A SD  
1176 C CE  . MET A 168 ? 0.8077 1.5558 1.1553 -0.2579 0.0644  -0.0856 276 MET A CE  
1177 N N   . VAL A 169 ? 0.6005 1.3713 1.0302 -0.2681 0.0617  -0.0797 277 VAL A N   
1178 C CA  . VAL A 169 ? 0.5906 1.3871 1.0524 -0.2711 0.0816  -0.0929 277 VAL A CA  
1179 C C   . VAL A 169 ? 0.6729 1.4736 1.1077 -0.2880 0.1001  -0.0973 277 VAL A C   
1180 O O   . VAL A 169 ? 0.6979 1.4987 1.1190 -0.3031 0.1040  -0.0892 277 VAL A O   
1181 C CB  . VAL A 169 ? 0.6195 1.4415 1.1269 -0.2729 0.0831  -0.0961 277 VAL A CB  
1182 C CG1 . VAL A 169 ? 0.6154 1.4624 1.1607 -0.2702 0.1050  -0.1094 277 VAL A CG1 
1183 C CG2 . VAL A 169 ? 0.5973 1.4235 1.1237 -0.2572 0.0615  -0.0901 277 VAL A CG2 
1184 N N   . PRO A 170 ? 0.6332 1.4385 1.0588 -0.2866 0.1121  -0.1098 278 PRO A N   
1185 C CA  . PRO A 170 ? 0.6490 1.4663 1.0415 -0.3033 0.1274  -0.1149 278 PRO A CA  
1186 C C   . PRO A 170 ? 0.7049 1.5447 1.1096 -0.3191 0.1474  -0.1196 278 PRO A C   
1187 O O   . PRO A 170 ? 0.7286 1.5733 1.1002 -0.3334 0.1527  -0.1087 278 PRO A O   
1188 C CB  . PRO A 170 ? 0.6647 1.4884 1.0582 -0.2996 0.1378  -0.1359 278 PRO A CB  
1189 C CG  . PRO A 170 ? 0.6960 1.4991 1.1059 -0.2805 0.1223  -0.1315 278 PRO A CG  
1190 C CD  . PRO A 170 ? 0.6370 1.4373 1.0795 -0.2712 0.1125  -0.1198 278 PRO A CD  
1191 N N   . TYR A 171 ? 0.6383 1.4940 1.0919 -0.3155 0.1599  -0.1334 279 TYR A N   
1192 C CA  . TYR A 171 ? 0.6450 1.5258 1.1162 -0.3303 0.1813  -0.1396 279 TYR A CA  
1193 C C   . TYR A 171 ? 0.6971 1.5885 1.2237 -0.3227 0.1780  -0.1390 279 TYR A C   
1194 O O   . TYR A 171 ? 0.6893 1.5890 1.2577 -0.3072 0.1815  -0.1494 279 TYR A O   
1195 C CB  . TYR A 171 ? 0.6630 1.5665 1.1345 -0.3380 0.2094  -0.1648 279 TYR A CB  
1196 C CG  . TYR A 171 ? 0.6980 1.6014 1.1148 -0.3459 0.2102  -0.1692 279 TYR A CG  
1197 C CD1 . TYR A 171 ? 0.7531 1.6696 1.1228 -0.3629 0.2150  -0.1570 279 TYR A CD1 
1198 C CD2 . TYR A 171 ? 0.6929 1.5871 1.1068 -0.3366 0.2065  -0.1839 279 TYR A CD2 
1199 C CE1 . TYR A 171 ? 0.7791 1.7063 1.0985 -0.3693 0.2138  -0.1596 279 TYR A CE1 
1200 C CE2 . TYR A 171 ? 0.7149 1.6174 1.0813 -0.3454 0.2055  -0.1901 279 TYR A CE2 
1201 C CZ  . TYR A 171 ? 0.8157 1.7382 1.1341 -0.3613 0.2081  -0.1782 279 TYR A CZ  
1202 O OH  . TYR A 171 ? 0.8140 1.7542 1.0855 -0.3687 0.2047  -0.1827 279 TYR A OH  
1203 N N   . VAL A 172 ? 0.6634 1.5553 1.1924 -0.3331 0.1707  -0.1255 280 VAL A N   
1204 C CA  . VAL A 172 ? 0.6534 1.5627 1.2332 -0.3292 0.1637  -0.1253 280 VAL A CA  
1205 C C   . VAL A 172 ? 0.7477 1.6935 1.3733 -0.3356 0.1879  -0.1385 280 VAL A C   
1206 O O   . VAL A 172 ? 0.7781 1.7339 1.3895 -0.3527 0.2107  -0.1432 280 VAL A O   
1207 C CB  . VAL A 172 ? 0.7029 1.5985 1.2747 -0.3386 0.1451  -0.1110 280 VAL A CB  
1208 C CG1 . VAL A 172 ? 0.6910 1.5560 1.2344 -0.3252 0.1196  -0.1016 280 VAL A CG1 
1209 C CG2 . VAL A 172 ? 0.7302 1.6169 1.2737 -0.3621 0.1591  -0.1012 280 VAL A CG2 
1210 N N   . ASP A 173 ? 0.7033 1.6727 1.3844 -0.3202 0.1831  -0.1429 281 ASP A N   
1211 C CA  . ASP A 173 ? 0.7066 1.7164 1.4454 -0.3211 0.2023  -0.1535 281 ASP A CA  
1212 C C   . ASP A 173 ? 0.7198 1.7499 1.4852 -0.3298 0.1857  -0.1457 281 ASP A C   
1213 O O   . ASP A 173 ? 0.6846 1.6924 1.4213 -0.3339 0.1630  -0.1356 281 ASP A O   
1214 C CB  . ASP A 173 ? 0.7315 1.7553 1.5181 -0.2935 0.2052  -0.1591 281 ASP A CB  
1215 C CG  . ASP A 173 ? 1.0204 2.0213 1.7900 -0.2844 0.2219  -0.1709 281 ASP A CG  
1216 O OD1 . ASP A 173 ? 1.0703 2.0831 1.8517 -0.2917 0.2525  -0.1895 281 ASP A OD1 
1217 O OD2 . ASP A 173 ? 1.1089 2.0828 1.8583 -0.2702 0.2059  -0.1639 281 ASP A OD2 
1218 N N   . LEU A 174 ? 0.6936 1.7678 1.5164 -0.3333 0.1975  -0.1528 282 LEU A N   
1219 C CA  . LEU A 174 ? 0.6887 1.7909 1.5441 -0.3437 0.1815  -0.1499 282 LEU A CA  
1220 C C   . LEU A 174 ? 0.7085 1.8230 1.5820 -0.3211 0.1496  -0.1433 282 LEU A C   
1221 O O   . LEU A 174 ? 0.7027 1.8229 1.5748 -0.3302 0.1274  -0.1414 282 LEU A O   
1222 C CB  . LEU A 174 ? 0.6976 1.8512 1.6143 -0.3523 0.2022  -0.1597 282 LEU A CB  
1223 C CG  . LEU A 174 ? 0.7898 1.9409 1.6925 -0.3796 0.2334  -0.1648 282 LEU A CG  
1224 C CD1 . LEU A 174 ? 0.7936 1.9838 1.7446 -0.3744 0.2638  -0.1779 282 LEU A CD1 
1225 C CD2 . LEU A 174 ? 0.8374 1.9976 1.7502 -0.4077 0.2299  -0.1620 282 LEU A CD2 
1226 N N   . GLU A 175 ? 0.6443 1.7608 1.5324 -0.2923 0.1492  -0.1400 283 GLU A N   
1227 C CA  . GLU A 175 ? 0.6321 1.7617 1.5357 -0.2659 0.1231  -0.1287 283 GLU A CA  
1228 C C   . GLU A 175 ? 0.6903 1.7850 1.5397 -0.2682 0.0958  -0.1212 283 GLU A C   
1229 O O   . GLU A 175 ? 0.6905 1.8049 1.5494 -0.2530 0.0708  -0.1131 283 GLU A O   
1230 C CB  . GLU A 175 ? 0.6514 1.7741 1.5745 -0.2369 0.1369  -0.1245 283 GLU A CB  
1231 C CG  . GLU A 175 ? 0.8472 1.9129 1.7150 -0.2336 0.1412  -0.1242 283 GLU A CG  
1232 C CD  . GLU A 175 ? 1.1668 2.2164 2.0473 -0.2231 0.1710  -0.1339 283 GLU A CD  
1233 O OE1 . GLU A 175 ? 0.8252 1.8368 1.6732 -0.2153 0.1706  -0.1327 283 GLU A OE1 
1234 O OE2 . GLU A 175 ? 1.2034 2.2783 2.1265 -0.2249 0.1966  -0.1455 283 GLU A OE2 
1235 N N   . HIS A 176 ? 0.6332 1.6797 1.4265 -0.2857 0.1014  -0.1230 284 HIS A N   
1236 C CA  . HIS A 176 ? 0.6111 1.6204 1.3542 -0.2875 0.0799  -0.1165 284 HIS A CA  
1237 C C   . HIS A 176 ? 0.6551 1.6708 1.3970 -0.3080 0.0645  -0.1206 284 HIS A C   
1238 O O   . HIS A 176 ? 0.6601 1.6476 1.3667 -0.3088 0.0470  -0.1177 284 HIS A O   
1239 C CB  . HIS A 176 ? 0.6206 1.5806 1.3092 -0.2936 0.0919  -0.1142 284 HIS A CB  
1240 C CG  . HIS A 176 ? 0.6507 1.6008 1.3370 -0.2738 0.1017  -0.1141 284 HIS A CG  
1241 N ND1 . HIS A 176 ? 0.6587 1.5956 1.3357 -0.2520 0.0856  -0.1058 284 HIS A ND1 
1242 C CD2 . HIS A 176 ? 0.6803 1.6336 1.3768 -0.2742 0.1280  -0.1234 284 HIS A CD2 
1243 C CE1 . HIS A 176 ? 0.6528 1.5816 1.3370 -0.2406 0.1031  -0.1098 284 HIS A CE1 
1244 N NE2 . HIS A 176 ? 0.6716 1.6097 1.3668 -0.2537 0.1288  -0.1225 284 HIS A NE2 
1245 N N   . GLN A 177 ? 0.5857 1.6385 1.3695 -0.3255 0.0728  -0.1296 285 GLN A N   
1246 C CA  . GLN A 177 ? 0.5833 1.6471 1.3776 -0.3488 0.0620  -0.1385 285 GLN A CA  
1247 C C   . GLN A 177 ? 0.6164 1.7094 1.4211 -0.3355 0.0304  -0.1414 285 GLN A C   
1248 O O   . GLN A 177 ? 0.6043 1.7270 1.4268 -0.3087 0.0205  -0.1339 285 GLN A O   
1249 C CB  . GLN A 177 ? 0.5981 1.7066 1.4457 -0.3677 0.0786  -0.1483 285 GLN A CB  
1250 C CG  . GLN A 177 ? 0.5615 1.6645 1.4153 -0.4012 0.0804  -0.1585 285 GLN A CG  
1251 C CD  . GLN A 177 ? 0.7153 1.8599 1.6211 -0.4216 0.1006  -0.1673 285 GLN A CD  
1252 O OE1 . GLN A 177 ? 0.6787 1.8011 1.5751 -0.4391 0.1283  -0.1630 285 GLN A OE1 
1253 N NE2 . GLN A 177 ? 0.5472 1.7576 1.5093 -0.4201 0.0872  -0.1787 285 GLN A NE2 
1254 N N   . GLY A 178 ? 0.5586 1.6424 1.3515 -0.3539 0.0166  -0.1519 286 GLY A N   
1255 C CA  . GLY A 178 ? 0.5356 1.6527 1.3340 -0.3451 -0.0128 -0.1589 286 GLY A CA  
1256 C C   . GLY A 178 ? 0.5901 1.6671 1.3478 -0.3555 -0.0255 -0.1672 286 GLY A C   
1257 O O   . GLY A 178 ? 0.6073 1.6252 1.3337 -0.3697 -0.0115 -0.1653 286 GLY A O   
1258 N N   . THR A 179 ? 0.5404 1.6536 1.3000 -0.3476 -0.0517 -0.1760 287 THR A N   
1259 C CA  . THR A 179 ? 0.5547 1.6372 1.2789 -0.3557 -0.0645 -0.1884 287 THR A CA  
1260 C C   . THR A 179 ? 0.5985 1.6541 1.2787 -0.3259 -0.0740 -0.1705 287 THR A C   
1261 O O   . THR A 179 ? 0.5910 1.6856 1.2792 -0.2998 -0.0858 -0.1574 287 THR A O   
1262 C CB  . THR A 179 ? 0.6205 1.7614 1.3724 -0.3725 -0.0844 -0.2158 287 THR A CB  
1263 O OG1 . THR A 179 ? 0.6274 1.7969 1.4279 -0.4004 -0.0724 -0.2309 287 THR A OG1 
1264 C CG2 . THR A 179 ? 0.5866 1.6909 1.3050 -0.3860 -0.0923 -0.2356 287 THR A CG2 
1265 N N   . TYR A 180 ? 0.5422 1.5313 1.1795 -0.3291 -0.0669 -0.1677 288 TYR A N   
1266 C CA  . TYR A 180 ? 0.5232 1.4812 1.1186 -0.3040 -0.0729 -0.1519 288 TYR A CA  
1267 C C   . TYR A 180 ? 0.5825 1.5157 1.1468 -0.3084 -0.0843 -0.1650 288 TYR A C   
1268 O O   . TYR A 180 ? 0.5931 1.5029 1.1596 -0.3328 -0.0785 -0.1829 288 TYR A O   
1269 C CB  . TYR A 180 ? 0.5376 1.4393 1.1085 -0.3011 -0.0521 -0.1346 288 TYR A CB  
1270 C CG  . TYR A 180 ? 0.5369 1.4550 1.1293 -0.2926 -0.0377 -0.1222 288 TYR A CG  
1271 C CD1 . TYR A 180 ? 0.5405 1.4557 1.1228 -0.2670 -0.0367 -0.1066 288 TYR A CD1 
1272 C CD2 . TYR A 180 ? 0.5432 1.4755 1.1665 -0.3115 -0.0213 -0.1274 288 TYR A CD2 
1273 C CE1 . TYR A 180 ? 0.5403 1.4659 1.1442 -0.2605 -0.0198 -0.0997 288 TYR A CE1 
1274 C CE2 . TYR A 180 ? 0.5355 1.4820 1.1781 -0.3041 -0.0050 -0.1193 288 TYR A CE2 
1275 C CZ  . TYR A 180 ? 0.6100 1.5512 1.2424 -0.2788 -0.0039 -0.1068 288 TYR A CZ  
1276 O OH  . TYR A 180 ? 0.6079 1.5600 1.2616 -0.2719 0.0149  -0.1031 288 TYR A OH  
1277 N N   . TRP A 181 ? 0.5462 1.4799 1.0826 -0.2846 -0.0970 -0.1554 289 TRP A N   
1278 C CA  . TRP A 181 ? 0.5635 1.4706 1.0653 -0.2837 -0.1054 -0.1655 289 TRP A CA  
1279 C C   . TRP A 181 ? 0.5768 1.4733 1.0479 -0.2539 -0.1106 -0.1441 289 TRP A C   
1280 O O   . TRP A 181 ? 0.5494 1.4702 1.0321 -0.2351 -0.1109 -0.1250 289 TRP A O   
1281 C CB  . TRP A 181 ? 0.5699 1.5227 1.0829 -0.2976 -0.1225 -0.1949 289 TRP A CB  
1282 C CG  . TRP A 181 ? 0.5738 1.5993 1.0941 -0.2786 -0.1438 -0.1900 289 TRP A CG  
1283 C CD1 . TRP A 181 ? 0.6097 1.6504 1.0999 -0.2566 -0.1576 -0.1819 289 TRP A CD1 
1284 C CD2 . TRP A 181 ? 0.5655 1.6623 1.1274 -0.2784 -0.1528 -0.1892 289 TRP A CD2 
1285 N NE1 . TRP A 181 ? 0.5937 1.7102 1.1026 -0.2412 -0.1745 -0.1725 289 TRP A NE1 
1286 C CE2 . TRP A 181 ? 0.6106 1.7646 1.1651 -0.2539 -0.1730 -0.1775 289 TRP A CE2 
1287 C CE3 . TRP A 181 ? 0.5831 1.7042 1.1900 -0.2959 -0.1450 -0.1959 289 TRP A CE3 
1288 C CZ2 . TRP A 181 ? 0.6010 1.8365 1.1927 -0.2443 -0.1866 -0.1700 289 TRP A CZ2 
1289 C CZ3 . TRP A 181 ? 0.5935 1.7951 1.2389 -0.2877 -0.1582 -0.1919 289 TRP A CZ3 
1290 C CH2 . TRP A 181 ? 0.5993 1.8582 1.2377 -0.2615 -0.1796 -0.1785 289 TRP A CH2 
1291 N N   . CYS A 182 ? 0.5393 1.3980 0.9754 -0.2501 -0.1120 -0.1474 290 CYS A N   
1292 C CA  . CYS A 182 ? 0.5145 1.3611 0.9208 -0.2246 -0.1157 -0.1295 290 CYS A CA  
1293 C C   . CYS A 182 ? 0.5664 1.4417 0.9548 -0.2190 -0.1323 -0.1431 290 CYS A C   
1294 O O   . CYS A 182 ? 0.5715 1.4378 0.9538 -0.2364 -0.1345 -0.1695 290 CYS A O   
1295 C CB  . CYS A 182 ? 0.5253 1.3076 0.9061 -0.2236 -0.1017 -0.1204 290 CYS A CB  
1296 S SG  . CYS A 182 ? 0.5654 1.3324 0.9175 -0.1950 -0.1020 -0.0974 290 CYS A SG  
1297 N N   . HIS A 183 ? 0.5080 1.4193 0.8894 -0.1951 -0.1423 -0.1257 291 HIS A N   
1298 C CA  . HIS A 183 ? 0.4994 1.4413 0.8566 -0.1860 -0.1569 -0.1333 291 HIS A CA  
1299 C C   . HIS A 183 ? 0.5429 1.4369 0.8655 -0.1711 -0.1489 -0.1210 291 HIS A C   
1300 O O   . HIS A 183 ? 0.4989 1.3787 0.8198 -0.1526 -0.1417 -0.0939 291 HIS A O   
1301 C CB  . HIS A 183 ? 0.4911 1.5045 0.8603 -0.1674 -0.1717 -0.1169 291 HIS A CB  
1302 C CG  . HIS A 183 ? 0.5522 1.6064 0.8926 -0.1599 -0.1873 -0.1253 291 HIS A CG  
1303 N ND1 . HIS A 183 ? 0.5953 1.6834 0.9315 -0.1809 -0.1995 -0.1618 291 HIS A ND1 
1304 C CD2 . HIS A 183 ? 0.5683 1.6348 0.8829 -0.1354 -0.1904 -0.1032 291 HIS A CD2 
1305 C CE1 . HIS A 183 ? 0.6004 1.7234 0.9054 -0.1681 -0.2105 -0.1619 291 HIS A CE1 
1306 N NE2 . HIS A 183 ? 0.5918 1.7042 0.8825 -0.1399 -0.2055 -0.1249 291 HIS A NE2 
1307 N N   . VAL A 184 ? 0.5335 1.3997 0.8339 -0.1812 -0.1475 -0.1432 292 VAL A N   
1308 C CA  . VAL A 184 ? 0.5334 1.3576 0.8040 -0.1687 -0.1399 -0.1358 292 VAL A CA  
1309 C C   . VAL A 184 ? 0.5977 1.4627 0.8436 -0.1568 -0.1516 -0.1415 292 VAL A C   
1310 O O   . VAL A 184 ? 0.6151 1.5208 0.8608 -0.1690 -0.1629 -0.1675 292 VAL A O   
1311 C CB  . VAL A 184 ? 0.5911 1.3558 0.8570 -0.1840 -0.1274 -0.1525 292 VAL A CB  
1312 C CG1 . VAL A 184 ? 0.5922 1.3211 0.8315 -0.1688 -0.1202 -0.1440 292 VAL A CG1 
1313 C CG2 . VAL A 184 ? 0.5684 1.3007 0.8557 -0.1952 -0.1158 -0.1426 292 VAL A CG2 
1314 N N   . TYR A 185 ? 0.5322 1.3935 0.7588 -0.1341 -0.1487 -0.1175 293 TYR A N   
1315 C CA  . TYR A 185 ? 0.5486 1.4546 0.7494 -0.1213 -0.1584 -0.1181 293 TYR A CA  
1316 C C   . TYR A 185 ? 0.6115 1.4964 0.7888 -0.1006 -0.1493 -0.0966 293 TYR A C   
1317 O O   . TYR A 185 ? 0.5822 1.4323 0.7686 -0.0915 -0.1380 -0.0733 293 TYR A O   
1318 C CB  . TYR A 185 ? 0.5367 1.5142 0.7513 -0.1116 -0.1730 -0.1018 293 TYR A CB  
1319 C CG  . TYR A 185 ? 0.5088 1.4838 0.7407 -0.0902 -0.1660 -0.0605 293 TYR A CG  
1320 C CD1 . TYR A 185 ? 0.5354 1.5318 0.7528 -0.0659 -0.1650 -0.0315 293 TYR A CD1 
1321 C CD2 . TYR A 185 ? 0.4921 1.4383 0.7555 -0.0951 -0.1566 -0.0516 293 TYR A CD2 
1322 C CE1 . TYR A 185 ? 0.5258 1.5111 0.7642 -0.0475 -0.1538 0.0047  293 TYR A CE1 
1323 C CE2 . TYR A 185 ? 0.4875 1.4251 0.7693 -0.0774 -0.1462 -0.0192 293 TYR A CE2 
1324 C CZ  . TYR A 185 ? 0.5446 1.5000 0.8163 -0.0538 -0.1443 0.0085  293 TYR A CZ  
1325 O OH  . TYR A 185 ? 0.4307 1.3723 0.7255 -0.0374 -0.1302 0.0389  293 TYR A OH  
1326 N N   . ASN A 186 ? 0.6054 1.5180 0.7535 -0.0942 -0.1539 -0.1059 294 ASN A N   
1327 C CA  . ASN A 186 ? 0.6143 1.5227 0.7396 -0.0739 -0.1461 -0.0849 294 ASN A CA  
1328 C C   . ASN A 186 ? 0.7850 1.7663 0.8888 -0.0623 -0.1587 -0.0781 294 ASN A C   
1329 O O   . ASN A 186 ? 0.7996 1.8281 0.9192 -0.0589 -0.1705 -0.0647 294 ASN A O   
1330 C CB  . ASN A 186 ? 0.5485 1.4067 0.6572 -0.0771 -0.1335 -0.1022 294 ASN A CB  
1331 C CG  . ASN A 186 ? 0.7801 1.6360 0.8757 -0.0937 -0.1352 -0.1451 294 ASN A CG  
1332 O OD1 . ASN A 186 ? 0.7071 1.6133 0.7916 -0.1014 -0.1471 -0.1667 294 ASN A OD1 
1333 N ND2 . ASN A 186 ? 0.6819 1.4819 0.7787 -0.0984 -0.1220 -0.1585 294 ASN A ND2 
1334 N N   . ASP A 187 ? 0.8097 1.8064 0.8791 -0.0556 -0.1566 -0.0863 295 ASP A N   
1335 C CA  . ASP A 187 ? 0.8412 1.9143 0.8848 -0.0447 -0.1687 -0.0789 295 ASP A CA  
1336 C C   . ASP A 187 ? 0.9450 2.0439 0.9566 -0.0589 -0.1738 -0.1244 295 ASP A C   
1337 O O   . ASP A 187 ? 0.9838 2.1448 0.9633 -0.0504 -0.1810 -0.1235 295 ASP A O   
1338 C CB  . ASP A 187 ? 0.8636 1.9470 0.8954 -0.0176 -0.1591 -0.0330 295 ASP A CB  
1339 C CG  . ASP A 187 ? 0.9408 1.9716 0.9600 -0.0110 -0.1391 -0.0288 295 ASP A CG  
1340 O OD1 . ASP A 187 ? 0.9339 1.9521 0.9298 -0.0204 -0.1351 -0.0631 295 ASP A OD1 
1341 O OD2 . ASP A 187 ? 0.9679 1.9771 1.0012 0.0045  -0.1265 0.0087  295 ASP A OD2 
1342 N N   . ARG A 188 ? 0.8929 1.9441 0.9141 -0.0805 -0.1682 -0.1643 296 ARG A N   
1343 C CA  . ARG A 188 ? 0.9165 1.9788 0.9169 -0.0983 -0.1684 -0.2156 296 ARG A CA  
1344 C C   . ARG A 188 ? 0.9405 2.0081 0.9672 -0.1261 -0.1780 -0.2518 296 ARG A C   
1345 O O   . ARG A 188 ? 0.9772 2.0875 0.9914 -0.1437 -0.1860 -0.2948 296 ARG A O   
1346 C CB  . ARG A 188 ? 0.9175 1.9088 0.9123 -0.0979 -0.1469 -0.2298 296 ARG A CB  
1347 N N   . ASP A 189 ? 0.8202 1.8475 0.8841 -0.1309 -0.1761 -0.2352 297 ASP A N   
1348 C CA  . ASP A 189 ? 0.8066 1.8261 0.9021 -0.1568 -0.1803 -0.2627 297 ASP A CA  
1349 C C   . ASP A 189 ? 0.8001 1.8040 0.9296 -0.1530 -0.1816 -0.2288 297 ASP A C   
1350 O O   . ASP A 189 ? 0.7557 1.7429 0.8861 -0.1317 -0.1765 -0.1878 297 ASP A O   
1351 C CB  . ASP A 189 ? 0.8535 1.7995 0.9573 -0.1745 -0.1619 -0.2969 297 ASP A CB  
1352 C CG  . ASP A 189 ? 1.0572 1.9972 1.1884 -0.2067 -0.1619 -0.3399 297 ASP A CG  
1353 O OD1 . ASP A 189 ? 1.0616 2.0708 1.1942 -0.2211 -0.1783 -0.3645 297 ASP A OD1 
1354 O OD2 . ASP A 189 ? 1.1884 2.0571 1.3403 -0.2178 -0.1446 -0.3498 297 ASP A OD2 
1355 N N   . SER A 190 ? 0.7728 1.7844 0.9324 -0.1755 -0.1868 -0.2494 298 SER A N   
1356 C CA  . SER A 190 ? 0.7427 1.7410 0.9393 -0.1798 -0.1861 -0.2297 298 SER A CA  
1357 C C   . SER A 190 ? 0.7998 1.7776 1.0234 -0.2119 -0.1818 -0.2675 298 SER A C   
1358 O O   . SER A 190 ? 0.8379 1.8366 1.0562 -0.2311 -0.1855 -0.3096 298 SER A O   
1359 C CB  . SER A 190 ? 0.7654 1.8366 0.9747 -0.1667 -0.2027 -0.2036 298 SER A CB  
1360 O OG  . SER A 190 ? 0.8594 2.0127 1.0549 -0.1693 -0.2217 -0.2218 298 SER A OG  
1361 N N   . GLN A 191 ? 0.7237 1.6603 0.9764 -0.2190 -0.1720 -0.2539 299 GLN A N   
1362 C CA  . GLN A 191 ? 0.7291 1.6379 1.0110 -0.2488 -0.1634 -0.2823 299 GLN A CA  
1363 C C   . GLN A 191 ? 0.7152 1.6183 1.0282 -0.2502 -0.1599 -0.2569 299 GLN A C   
1364 O O   . GLN A 191 ? 0.6809 1.5461 0.9900 -0.2340 -0.1506 -0.2239 299 GLN A O   
1365 C CB  . GLN A 191 ? 0.7737 1.6010 1.0477 -0.2542 -0.1427 -0.2928 299 GLN A CB  
1366 C CG  . GLN A 191 ? 1.0895 1.8803 1.3901 -0.2853 -0.1292 -0.3281 299 GLN A CG  
1367 C CD  . GLN A 191 ? 1.3941 2.1048 1.6873 -0.2827 -0.1077 -0.3301 299 GLN A CD  
1368 O OE1 . GLN A 191 ? 1.3235 1.9775 1.6381 -0.2922 -0.0904 -0.3220 299 GLN A OE1 
1369 N NE2 . GLN A 191 ? 1.2651 1.9717 1.5295 -0.2688 -0.1070 -0.3393 299 GLN A NE2 
1370 N N   . ASP A 192 ? 0.6605 1.6072 1.0050 -0.2697 -0.1673 -0.2736 300 ASP A N   
1371 C CA  . ASP A 192 ? 0.6238 1.5663 1.0006 -0.2736 -0.1613 -0.2538 300 ASP A CA  
1372 C C   . ASP A 192 ? 0.6791 1.5518 1.0698 -0.2956 -0.1400 -0.2646 300 ASP A C   
1373 O O   . ASP A 192 ? 0.6972 1.5495 1.0912 -0.3167 -0.1341 -0.2977 300 ASP A O   
1374 C CB  . ASP A 192 ? 0.6408 1.6613 1.0507 -0.2850 -0.1764 -0.2656 300 ASP A CB  
1375 C CG  . ASP A 192 ? 0.8350 1.9293 1.2403 -0.2593 -0.1960 -0.2431 300 ASP A CG  
1376 O OD1 . ASP A 192 ? 0.7958 1.8909 1.2132 -0.2396 -0.1925 -0.2079 300 ASP A OD1 
1377 O OD2 . ASP A 192 ? 1.0208 2.1781 1.4154 -0.2607 -0.2142 -0.2621 300 ASP A OD2 
1378 N N   . SER A 193 ? 0.6087 1.4447 1.0077 -0.2903 -0.1269 -0.2361 301 SER A N   
1379 C CA  . SER A 193 ? 0.6102 1.3864 1.0226 -0.3084 -0.1061 -0.2368 301 SER A CA  
1380 C C   . SER A 193 ? 0.6764 1.4805 1.1303 -0.3377 -0.1037 -0.2585 301 SER A C   
1381 O O   . SER A 193 ? 0.6762 1.5491 1.1488 -0.3401 -0.1194 -0.2678 301 SER A O   
1382 C CB  . SER A 193 ? 0.6016 1.3480 1.0080 -0.2936 -0.0953 -0.1998 301 SER A CB  
1383 O OG  . SER A 193 ? 0.6546 1.4407 1.0880 -0.2966 -0.0967 -0.1908 301 SER A OG  
1384 N N   . LYS A 194 ? 0.6284 1.3815 1.0993 -0.3583 -0.0829 -0.2618 302 LYS A N   
1385 C CA  . LYS A 194 ? 0.6156 1.3844 1.1287 -0.3874 -0.0743 -0.2769 302 LYS A CA  
1386 C C   . LYS A 194 ? 0.6136 1.4339 1.1424 -0.3777 -0.0815 -0.2561 302 LYS A C   
1387 O O   . LYS A 194 ? 0.5917 1.3995 1.1011 -0.3545 -0.0796 -0.2245 302 LYS A O   
1388 C CB  . LYS A 194 ? 0.6640 1.3599 1.1849 -0.4007 -0.0463 -0.2632 302 LYS A CB  
1389 C CG  . LYS A 194 ? 0.9489 1.6034 1.4892 -0.4274 -0.0307 -0.2927 302 LYS A CG  
1390 C CD  . LYS A 194 ? 1.1575 1.7579 1.6694 -0.4145 -0.0257 -0.2954 302 LYS A CD  
1391 C CE  . LYS A 194 ? 1.2629 1.8762 1.7831 -0.4308 -0.0312 -0.3439 302 LYS A CE  
1392 N NZ  . LYS A 194 ? 1.2778 1.8397 1.7712 -0.4154 -0.0245 -0.3462 302 LYS A NZ  
1393 N N   . LYS A 195 ? 0.5574 1.4378 1.1241 -0.3952 -0.0891 -0.2756 303 LYS A N   
1394 C CA  . LYS A 195 ? 0.5057 1.4354 1.0976 -0.3879 -0.0923 -0.2584 303 LYS A CA  
1395 C C   . LYS A 195 ? 0.5570 1.4469 1.1705 -0.4080 -0.0660 -0.2501 303 LYS A C   
1396 O O   . LYS A 195 ? 0.5893 1.4690 1.2298 -0.4384 -0.0550 -0.2726 303 LYS A O   
1397 C CB  . LYS A 195 ? 0.5061 1.5257 1.1322 -0.3964 -0.1130 -0.2816 303 LYS A CB  
1398 C CG  . LYS A 195 ? 0.5683 1.6344 1.1695 -0.3757 -0.1389 -0.2862 303 LYS A CG  
1399 C CD  . LYS A 195 ? 0.6693 1.8361 1.3024 -0.3742 -0.1613 -0.2950 303 LYS A CD  
1400 C CE  . LYS A 195 ? 0.8144 2.0269 1.4171 -0.3465 -0.1849 -0.2864 303 LYS A CE  
1401 N N   . VAL A 196 ? 0.4789 1.3423 1.0779 -0.3922 -0.0539 -0.2184 304 VAL A N   
1402 C CA  . VAL A 196 ? 0.4766 1.3044 1.0875 -0.4081 -0.0280 -0.2053 304 VAL A CA  
1403 C C   . VAL A 196 ? 0.5203 1.3982 1.1674 -0.4118 -0.0228 -0.2005 304 VAL A C   
1404 O O   . VAL A 196 ? 0.4896 1.4172 1.1445 -0.3920 -0.0373 -0.1961 304 VAL A O   
1405 C CB  . VAL A 196 ? 0.4977 1.2638 1.0661 -0.3918 -0.0153 -0.1757 304 VAL A CB  
1406 C CG1 . VAL A 196 ? 0.5105 1.2246 1.0517 -0.3902 -0.0160 -0.1802 304 VAL A CG1 
1407 C CG2 . VAL A 196 ? 0.4514 1.2362 0.9989 -0.3620 -0.0242 -0.1562 304 VAL A CG2 
1408 N N   . GLU A 197 ? 0.5019 1.3659 1.1727 -0.4355 0.0003  -0.1988 305 GLU A N   
1409 C CA  . GLU A 197 ? 0.4928 1.4023 1.1996 -0.4401 0.0096  -0.1948 305 GLU A CA  
1410 C C   . GLU A 197 ? 0.5711 1.4471 1.2558 -0.4331 0.0317  -0.1676 305 GLU A C   
1411 O O   . GLU A 197 ? 0.6094 1.4327 1.2747 -0.4451 0.0502  -0.1559 305 GLU A O   
1412 C CB  . GLU A 197 ? 0.5337 1.4697 1.2917 -0.4749 0.0193  -0.2172 305 GLU A CB  
1413 C CG  . GLU A 197 ? 0.6359 1.6584 1.4410 -0.4749 0.0023  -0.2347 305 GLU A CG  
1414 C CD  . GLU A 197 ? 1.0364 2.1014 1.8514 -0.4782 -0.0255 -0.2628 305 GLU A CD  
1415 O OE1 . GLU A 197 ? 0.6332 1.6673 1.4081 -0.4664 -0.0381 -0.2647 305 GLU A OE1 
1416 O OE2 . GLU A 197 ? 1.1908 2.3256 2.0544 -0.4932 -0.0346 -0.2839 305 GLU A OE2 
1417 N N   . ILE A 198 ? 0.4962 1.4039 1.1837 -0.4127 0.0308  -0.1571 306 ILE A N   
1418 C CA  . ILE A 198 ? 0.4800 1.3676 1.1480 -0.4069 0.0520  -0.1370 306 ILE A CA  
1419 C C   . ILE A 198 ? 0.5518 1.4845 1.2649 -0.4186 0.0687  -0.1417 306 ILE A C   
1420 O O   . ILE A 198 ? 0.5221 1.5048 1.2664 -0.4049 0.0603  -0.1477 306 ILE A O   
1421 C CB  . ILE A 198 ? 0.4759 1.3531 1.1089 -0.3764 0.0441  -0.1238 306 ILE A CB  
1422 C CG1 . ILE A 198 ? 0.4712 1.3062 1.0618 -0.3650 0.0288  -0.1190 306 ILE A CG1 
1423 C CG2 . ILE A 198 ? 0.4705 1.3360 1.0860 -0.3742 0.0671  -0.1100 306 ILE A CG2 
1424 C CD1 . ILE A 198 ? 0.5668 1.3434 1.1251 -0.3780 0.0404  -0.1082 306 ILE A CD1 
1425 N N   . ILE A 199 ? 0.5482 1.4642 1.2673 -0.4433 0.0936  -0.1373 307 ILE A N   
1426 C CA  . ILE A 199 ? 0.5553 1.5107 1.3154 -0.4575 0.1146  -0.1409 307 ILE A CA  
1427 C C   . ILE A 199 ? 0.6576 1.6013 1.3881 -0.4477 0.1354  -0.1246 307 ILE A C   
1428 O O   . ILE A 199 ? 0.6647 1.5628 1.3478 -0.4484 0.1443  -0.1077 307 ILE A O   
1429 C CB  . ILE A 199 ? 0.6156 1.5635 1.4039 -0.4934 0.1326  -0.1464 307 ILE A CB  
1430 C CG1 . ILE A 199 ? 0.6137 1.5857 1.4412 -0.5082 0.1140  -0.1714 307 ILE A CG1 
1431 C CG2 . ILE A 199 ? 0.5996 1.5786 1.4198 -0.5089 0.1610  -0.1444 307 ILE A CG2 
1432 C CD1 . ILE A 199 ? 0.7749 1.6882 1.5748 -0.5178 0.1088  -0.1728 307 ILE A CD1 
1433 N N   . ILE A 200 ? 0.6488 1.6371 1.4092 -0.4385 0.1440  -0.1306 308 ILE A N   
1434 C CA  . ILE A 200 ? 0.6724 1.6586 1.4120 -0.4332 0.1674  -0.1229 308 ILE A CA  
1435 C C   . ILE A 200 ? 0.7829 1.8092 1.5669 -0.4511 0.1934  -0.1299 308 ILE A C   
1436 O O   . ILE A 200 ? 0.7695 1.8452 1.6075 -0.4450 0.1905  -0.1430 308 ILE A O   
1437 C CB  . ILE A 200 ? 0.6826 1.6735 1.4101 -0.4032 0.1590  -0.1246 308 ILE A CB  
1438 C CG1 . ILE A 200 ? 0.6895 1.6351 1.3653 -0.3900 0.1391  -0.1147 308 ILE A CG1 
1439 C CG2 . ILE A 200 ? 0.6897 1.6883 1.4068 -0.4025 0.1872  -0.1256 308 ILE A CG2 
1440 C CD1 . ILE A 200 ? 0.8366 1.7903 1.5177 -0.3631 0.1202  -0.1179 308 ILE A CD1 
1441 N N   . ASP A 201 ? 0.8046 1.8122 1.5678 -0.4730 0.2190  -0.1187 309 ASP A N   
1442 C CA  . ASP A 201 ? 0.8372 1.8784 1.6363 -0.4939 0.2487  -0.1224 309 ASP A CA  
1443 C C   . ASP A 201 ? 0.9339 1.9513 1.6826 -0.5045 0.2770  -0.1042 309 ASP A C   
1444 O O   . ASP A 201 ? 0.9264 1.9195 1.6223 -0.4894 0.2725  -0.0958 309 ASP A O   
1445 C CB  . ASP A 201 ? 0.8845 1.9358 1.7293 -0.5196 0.2474  -0.1283 309 ASP A CB  
1446 C CG  . ASP A 201 ? 1.1881 2.2922 2.0927 -0.5377 0.2709  -0.1393 309 ASP A CG  
1447 O OD1 . ASP A 201 ? 1.2105 2.3634 2.1529 -0.5221 0.2702  -0.1527 309 ASP A OD1 
1448 O OD2 . ASP A 201 ? 1.3304 2.4269 2.2478 -0.5670 0.2920  -0.1334 309 ASP A OD2 
1449 N N   . GLU A 202 ? 0.9329 1.9626 1.6981 -0.5303 0.3063  -0.0979 310 GLU A N   
1450 C CA  . GLU A 202 ? 1.3168 2.3323 2.0359 -0.5429 0.3357  -0.0765 310 GLU A CA  
1451 C C   . GLU A 202 ? 1.7413 2.7594 2.4883 -0.5742 0.3622  -0.0652 310 GLU A C   
1452 O O   . GLU A 202 ? 1.2713 2.2585 2.0312 -0.5874 0.3548  -0.0573 310 GLU A O   
1453 C CB  . GLU A 202 ? 1.3309 2.3783 2.0310 -0.5329 0.3548  -0.0857 310 GLU A CB  
1454 C CG  . GLU A 202 ? 1.4038 2.5050 2.1663 -0.5296 0.3659  -0.1124 310 GLU A CG  
1455 C CD  . GLU A 202 ? 1.5699 2.6847 2.3385 -0.5010 0.3530  -0.1324 310 GLU A CD  
1456 O OE1 . GLU A 202 ? 1.3679 2.4624 2.0829 -0.4889 0.3506  -0.1304 310 GLU A OE1 
1457 O OE2 . GLU A 202 ? 1.4640 2.6126 2.2946 -0.4909 0.3466  -0.1495 310 GLU A OE2 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   109 ?   ?   ?   A . n 
A 1 2   GLY 2   110 ?   ?   ?   A . n 
A 1 3   SER 3   111 ?   ?   ?   A . n 
A 1 4   SER 4   112 ?   ?   ?   A . n 
A 1 5   HIS 5   113 ?   ?   ?   A . n 
A 1 6   HIS 6   114 ?   ?   ?   A . n 
A 1 7   HIS 7   115 ?   ?   ?   A . n 
A 1 8   HIS 8   116 ?   ?   ?   A . n 
A 1 9   HIS 9   117 ?   ?   ?   A . n 
A 1 10  HIS 10  118 ?   ?   ?   A . n 
A 1 11  SER 11  119 ?   ?   ?   A . n 
A 1 12  SER 12  120 ?   ?   ?   A . n 
A 1 13  GLY 13  121 ?   ?   ?   A . n 
A 1 14  LEU 14  122 ?   ?   ?   A . n 
A 1 15  VAL 15  123 ?   ?   ?   A . n 
A 1 16  PRO 16  124 ?   ?   ?   A . n 
A 1 17  ARG 17  125 ?   ?   ?   A . n 
A 1 18  GLY 18  126 ?   ?   ?   A . n 
A 1 19  SER 19  127 127 SER SER A . n 
A 1 20  LYS 20  128 128 LYS LYS A . n 
A 1 21  ILE 21  129 129 ILE ILE A . n 
A 1 22  THR 22  130 130 THR THR A . n 
A 1 23  VAL 23  131 131 VAL VAL A . n 
A 1 24  ASN 24  132 132 ASN ASN A . n 
A 1 25  PRO 25  133 133 PRO PRO A . n 
A 1 26  GLU 26  134 134 GLU GLU A . n 
A 1 27  SER 27  135 135 SER SER A . n 
A 1 28  LYS 28  136 136 LYS LYS A . n 
A 1 29  ALA 29  137 137 ALA ALA A . n 
A 1 30  VAL 30  138 138 VAL VAL A . n 
A 1 31  LEU 31  139 139 LEU LEU A . n 
A 1 32  ALA 32  140 140 ALA ALA A . n 
A 1 33  GLY 33  141 141 GLY GLY A . n 
A 1 34  GLN 34  142 142 GLN GLN A . n 
A 1 35  PHE 35  143 143 PHE PHE A . n 
A 1 36  VAL 36  144 144 VAL VAL A . n 
A 1 37  LYS 37  145 145 LYS LYS A . n 
A 1 38  LEU 38  146 146 LEU LEU A . n 
A 1 39  CYS 39  147 147 CYS CYS A . n 
A 1 40  CYS 40  148 148 CYS CYS A . n 
A 1 41  ARG 41  149 149 ARG ARG A . n 
A 1 42  ALA 42  150 150 ALA ALA A . n 
A 1 43  THR 43  151 151 THR THR A . n 
A 1 44  GLY 44  152 152 GLY GLY A . n 
A 1 45  HIS 45  153 153 HIS HIS A . n 
A 1 46  PRO 46  154 154 PRO PRO A . n 
A 1 47  PHE 47  155 155 PHE PHE A . n 
A 1 48  VAL 48  156 156 VAL VAL A . n 
A 1 49  GLN 49  157 157 GLN GLN A . n 
A 1 50  TYR 50  158 158 TYR TYR A . n 
A 1 51  GLN 51  159 159 GLN GLN A . n 
A 1 52  TRP 52  160 160 TRP TRP A . n 
A 1 53  PHE 53  161 161 PHE PHE A . n 
A 1 54  LYS 54  162 162 LYS LYS A . n 
A 1 55  MET 55  163 163 MET MET A . n 
A 1 56  ASN 56  164 164 ASN ASN A . n 
A 1 57  LYS 57  165 165 LYS LYS A . n 
A 1 58  GLU 58  166 166 GLU GLU A . n 
A 1 59  ILE 59  167 167 ILE ILE A . n 
A 1 60  PRO 60  168 168 PRO PRO A . n 
A 1 61  ASN 61  169 169 ASN ASN A . n 
A 1 62  GLY 62  170 170 GLY GLY A . n 
A 1 63  ASN 63  171 171 ASN ASN A . n 
A 1 64  THR 64  172 172 THR THR A . n 
A 1 65  SER 65  173 173 SER SER A . n 
A 1 66  GLU 66  174 174 GLU GLU A . n 
A 1 67  LEU 67  175 175 LEU LEU A . n 
A 1 68  ILE 68  176 176 ILE ILE A . n 
A 1 69  PHE 69  177 177 PHE PHE A . n 
A 1 70  ASN 70  178 178 ASN ASN A . n 
A 1 71  ALA 71  179 179 ALA ALA A . n 
A 1 72  VAL 72  180 180 VAL VAL A . n 
A 1 73  HIS 73  181 181 HIS HIS A . n 
A 1 74  VAL 74  182 182 VAL VAL A . n 
A 1 75  LYS 75  183 183 LYS LYS A . n 
A 1 76  ASP 76  184 184 ASP ASP A . n 
A 1 77  ALA 77  185 185 ALA ALA A . n 
A 1 78  GLY 78  186 186 GLY GLY A . n 
A 1 79  PHE 79  187 187 PHE PHE A . n 
A 1 80  TYR 80  188 188 TYR TYR A . n 
A 1 81  VAL 81  189 189 VAL VAL A . n 
A 1 82  CYS 82  190 190 CYS CYS A . n 
A 1 83  ARG 83  191 191 ARG ARG A . n 
A 1 84  VAL 84  192 192 VAL VAL A . n 
A 1 85  ASN 85  193 193 ASN ASN A . n 
A 1 86  ASN 86  194 194 ASN ASN A . n 
A 1 87  ASN 87  195 195 ASN ASN A . n 
A 1 88  PHE 88  196 196 PHE PHE A . n 
A 1 89  THR 89  197 197 THR THR A . n 
A 1 90  PHE 90  198 198 PHE PHE A . n 
A 1 91  GLU 91  199 199 GLU GLU A . n 
A 1 92  PHE 92  200 200 PHE PHE A . n 
A 1 93  SER 93  201 201 SER SER A . n 
A 1 94  GLN 94  202 202 GLN GLN A . n 
A 1 95  TRP 95  203 203 TRP TRP A . n 
A 1 96  SER 96  204 204 SER SER A . n 
A 1 97  GLN 97  205 205 GLN GLN A . n 
A 1 98  LEU 98  206 206 LEU LEU A . n 
A 1 99  ASP 99  207 207 ASP ASP A . n 
A 1 100 VAL 100 208 208 VAL VAL A . n 
A 1 101 CYS 101 209 209 CYS CYS A . n 
A 1 102 ASP 102 210 210 ASP ASP A . n 
A 1 103 ILE 103 211 211 ILE ILE A . n 
A 1 104 PRO 104 212 212 PRO PRO A . n 
A 1 105 GLU 105 213 213 GLU GLU A . n 
A 1 106 SER 106 214 214 SER SER A . n 
A 1 107 PHE 107 215 215 PHE PHE A . n 
A 1 108 GLN 108 216 216 GLN GLN A . n 
A 1 109 ARG 109 217 217 ARG ARG A . n 
A 1 110 SER 110 218 218 SER SER A . n 
A 1 111 VAL 111 219 219 VAL VAL A . n 
A 1 112 ASP 112 220 220 ASP ASP A . n 
A 1 113 GLY 113 221 221 GLY GLY A . n 
A 1 114 VAL 114 222 222 VAL VAL A . n 
A 1 115 SER 115 223 223 SER SER A . n 
A 1 116 GLU 116 224 224 GLU GLU A . n 
A 1 117 SER 117 225 225 SER SER A . n 
A 1 118 LYS 118 226 226 LYS LYS A . n 
A 1 119 LEU 119 227 227 LEU LEU A . n 
A 1 120 GLN 120 228 228 GLN GLN A . n 
A 1 121 ILE 121 229 229 ILE ILE A . n 
A 1 122 CYS 122 230 230 CYS CYS A . n 
A 1 123 VAL 123 231 231 VAL VAL A . n 
A 1 124 GLU 124 232 232 GLU GLU A . n 
A 1 125 PRO 125 233 233 PRO PRO A . n 
A 1 126 THR 126 234 234 THR THR A . n 
A 1 127 SER 127 235 235 SER SER A . n 
A 1 128 GLN 128 236 236 GLN GLN A . n 
A 1 129 LYS 129 237 237 LYS LYS A . n 
A 1 130 LEU 130 238 238 LEU LEU A . n 
A 1 131 MET 131 239 239 MET MET A . n 
A 1 132 PRO 132 240 240 PRO PRO A . n 
A 1 133 GLY 133 241 241 GLY GLY A . n 
A 1 134 SER 134 242 242 SER SER A . n 
A 1 135 THR 135 243 243 THR THR A . n 
A 1 136 LEU 136 244 244 LEU LEU A . n 
A 1 137 VAL 137 245 245 VAL VAL A . n 
A 1 138 LEU 138 246 246 LEU LEU A . n 
A 1 139 GLN 139 247 247 GLN GLN A . n 
A 1 140 CYS 140 248 248 CYS CYS A . n 
A 1 141 VAL 141 249 249 VAL VAL A . n 
A 1 142 ALA 142 250 250 ALA ALA A . n 
A 1 143 VAL 143 251 251 VAL VAL A . n 
A 1 144 GLY 144 252 252 GLY GLY A . n 
A 1 145 SER 145 253 253 SER SER A . n 
A 1 146 PRO 146 254 254 PRO PRO A . n 
A 1 147 ILE 147 255 255 ILE ILE A . n 
A 1 148 PRO 148 256 256 PRO PRO A . n 
A 1 149 HIS 149 257 257 HIS HIS A . n 
A 1 150 TYR 150 258 258 TYR TYR A . n 
A 1 151 GLN 151 259 259 GLN GLN A . n 
A 1 152 TRP 152 260 260 TRP TRP A . n 
A 1 153 PHE 153 261 261 PHE PHE A . n 
A 1 154 LYS 154 262 262 LYS LYS A . n 
A 1 155 ASN 155 263 263 ASN ASN A . n 
A 1 156 GLU 156 264 264 GLU GLU A . n 
A 1 157 LEU 157 265 265 LEU LEU A . n 
A 1 158 PRO 158 266 266 PRO PRO A . n 
A 1 159 LEU 159 267 267 LEU LEU A . n 
A 1 160 THR 160 268 268 THR THR A . n 
A 1 161 HIS 161 269 269 HIS HIS A . n 
A 1 162 GLU 162 270 270 GLU GLU A . n 
A 1 163 THR 163 271 271 THR THR A . n 
A 1 164 LYS 164 272 272 LYS LYS A . n 
A 1 165 LYS 165 273 273 LYS LYS A . n 
A 1 166 LEU 166 274 274 LEU LEU A . n 
A 1 167 TYR 167 275 275 TYR TYR A . n 
A 1 168 MET 168 276 276 MET MET A . n 
A 1 169 VAL 169 277 277 VAL VAL A . n 
A 1 170 PRO 170 278 278 PRO PRO A . n 
A 1 171 TYR 171 279 279 TYR TYR A . n 
A 1 172 VAL 172 280 280 VAL VAL A . n 
A 1 173 ASP 173 281 281 ASP ASP A . n 
A 1 174 LEU 174 282 282 LEU LEU A . n 
A 1 175 GLU 175 283 283 GLU GLU A . n 
A 1 176 HIS 176 284 284 HIS HIS A . n 
A 1 177 GLN 177 285 285 GLN GLN A . n 
A 1 178 GLY 178 286 286 GLY GLY A . n 
A 1 179 THR 179 287 287 THR THR A . n 
A 1 180 TYR 180 288 288 TYR TYR A . n 
A 1 181 TRP 181 289 289 TRP TRP A . n 
A 1 182 CYS 182 290 290 CYS CYS A . n 
A 1 183 HIS 183 291 291 HIS HIS A . n 
A 1 184 VAL 184 292 292 VAL VAL A . n 
A 1 185 TYR 185 293 293 TYR TYR A . n 
A 1 186 ASN 186 294 294 ASN ASN A . n 
A 1 187 ASP 187 295 295 ASP ASP A . n 
A 1 188 ARG 188 296 296 ARG ARG A . n 
A 1 189 ASP 189 297 297 ASP ASP A . n 
A 1 190 SER 190 298 298 SER SER A . n 
A 1 191 GLN 191 299 299 GLN GLN A . n 
A 1 192 ASP 192 300 300 ASP ASP A . n 
A 1 193 SER 193 301 301 SER SER A . n 
A 1 194 LYS 194 302 302 LYS LYS A . n 
A 1 195 LYS 195 303 303 LYS LYS A . n 
A 1 196 VAL 196 304 304 VAL VAL A . n 
A 1 197 GLU 197 305 305 GLU GLU A . n 
A 1 198 ILE 198 306 306 ILE ILE A . n 
A 1 199 ILE 199 307 307 ILE ILE A . n 
A 1 200 ILE 200 308 308 ILE ILE A . n 
A 1 201 ASP 201 309 309 ASP ASP A . n 
A 1 202 GLU 202 310 310 GLU GLU A . n 
A 1 203 LEU 203 311 ?   ?   ?   A . n 
A 1 204 ASN 204 312 ?   ?   ?   A . n 
A 1 205 ASN 205 313 ?   ?   ?   A . n 
A 1 206 LEU 206 314 ?   ?   ?   A . n 
A 1 207 GLY 207 315 ?   ?   ?   A . n 
A 1 208 HIS 208 316 ?   ?   ?   A . n 
A 1 209 PRO 209 317 ?   ?   ?   A . n 
A 1 210 ASP 210 318 ?   ?   ?   A . n 
A 1 211 ASN 211 319 ?   ?   ?   A . n 
A 1 212 LYS 212 320 ?   ?   ?   A . n 
A 1 213 GLU 213 321 ?   ?   ?   A . n 
A 1 214 GLN 214 322 ?   ?   ?   A . n 
A 1 215 THR 215 323 ?   ?   ?   A . n 
A 1 216 THR 216 324 ?   ?   ?   A . n 
A 1 217 ASP 217 325 ?   ?   ?   A . n 
A 1 218 GLN 218 326 ?   ?   ?   A . n 
# 
_pdbx_SG_project.id                    1 
_pdbx_SG_project.project_name          ? 
_pdbx_SG_project.full_name_of_center   'Structural Genomics Consortium' 
_pdbx_SG_project.initial_of_center     SGC 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric    2 
2 software_defined_assembly            PISA tetrameric 4 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1,2     A,B,C 
2 1,2,3,4 A,B,C 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 2250  ? 
1 MORE         -7.3  ? 
1 'SSA (A^2)'  18570 ? 
2 'ABSA (A^2)' 7190  ? 
2 MORE         -35.6 ? 
2 'SSA (A^2)'  34460 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555  x,y,z          1.0000000000  0.0000000000  0.0000000000 0.0000000000   0.0000000000  
1.0000000000  0.0000000000 0.0000000000  0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 4_565  -x,-y+1,z      -1.0000000000 0.0000000000  0.0000000000 -45.1775000000 0.0000000000  
-1.0000000000 0.0000000000 78.2497253589 0.0000000000 0.0000000000 1.0000000000  0.0000000000  
3 'crystal symmetry operation' 9_555  -x,-x+y,-z+1/3 -0.5000000000 -0.8660254038 0.0000000000 0.0000000000   -0.8660254038 
0.5000000000  0.0000000000 0.0000000000  0.0000000000 0.0000000000 -1.0000000000 60.7243333333 
4 'crystal symmetry operation' 12_565 x,x-y+1,-z+1/3 0.5000000000  0.8660254038  0.0000000000 -45.1775000000 0.8660254038  
-0.5000000000 0.0000000000 78.2497253589 0.0000000000 0.0000000000 -1.0000000000 60.7243333333 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-10-27 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
HKL-2000 'data collection' .     ? 1 
PHASER   phasing           .     ? 2 
BUSTER   refinement        2.8.0 ? 3 
HKL-2000 'data reduction'  .     ? 4 
HKL-2000 'data scaling'    .     ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 PHE A 155 ? ? -94.40  51.13   
2 1 MET A 163 ? ? 58.68   -121.33 
3 1 ALA A 179 ? ? -156.34 78.96   
4 1 ASN A 195 ? ? 57.52   -65.47  
5 1 THR A 197 ? ? -65.66  -166.97 
6 1 PHE A 198 ? ? -179.52 133.51  
7 1 GLU A 264 ? ? 68.93   -5.58   
8 1 ASN A 294 ? ? -133.47 -129.04 
9 1 ASP A 309 ? ? -151.41 -154.73 
# 
loop_
_pdbx_unobs_or_zero_occ_atoms.id 
_pdbx_unobs_or_zero_occ_atoms.PDB_model_num 
_pdbx_unobs_or_zero_occ_atoms.polymer_flag 
_pdbx_unobs_or_zero_occ_atoms.occupancy_flag 
_pdbx_unobs_or_zero_occ_atoms.auth_asym_id 
_pdbx_unobs_or_zero_occ_atoms.auth_comp_id 
_pdbx_unobs_or_zero_occ_atoms.auth_seq_id 
_pdbx_unobs_or_zero_occ_atoms.PDB_ins_code 
_pdbx_unobs_or_zero_occ_atoms.auth_atom_id 
_pdbx_unobs_or_zero_occ_atoms.label_alt_id 
_pdbx_unobs_or_zero_occ_atoms.label_asym_id 
_pdbx_unobs_or_zero_occ_atoms.label_comp_id 
_pdbx_unobs_or_zero_occ_atoms.label_seq_id 
_pdbx_unobs_or_zero_occ_atoms.label_atom_id 
1  1 Y 1 A LYS 165 ? CE  ? A LYS 57  CE  
2  1 Y 1 A LYS 165 ? NZ  ? A LYS 57  NZ  
3  1 Y 1 A ASN 194 ? CG  ? A ASN 86  CG  
4  1 Y 1 A ASN 194 ? OD1 ? A ASN 86  OD1 
5  1 Y 1 A ASN 194 ? ND2 ? A ASN 86  ND2 
6  1 Y 1 A PHE 198 ? CG  ? A PHE 90  CG  
7  1 Y 1 A PHE 198 ? CD1 ? A PHE 90  CD1 
8  1 Y 1 A PHE 198 ? CD2 ? A PHE 90  CD2 
9  1 Y 1 A PHE 198 ? CE1 ? A PHE 90  CE1 
10 1 Y 1 A PHE 198 ? CE2 ? A PHE 90  CE2 
11 1 Y 1 A PHE 198 ? CZ  ? A PHE 90  CZ  
12 1 Y 1 A ARG 217 ? CG  ? A ARG 109 CG  
13 1 Y 1 A ARG 217 ? CD  ? A ARG 109 CD  
14 1 Y 1 A ARG 217 ? NE  ? A ARG 109 NE  
15 1 Y 1 A ARG 217 ? CZ  ? A ARG 109 CZ  
16 1 Y 1 A ARG 217 ? NH1 ? A ARG 109 NH1 
17 1 Y 1 A ARG 217 ? NH2 ? A ARG 109 NH2 
18 1 Y 1 A LYS 237 ? CG  ? A LYS 129 CG  
19 1 Y 1 A LYS 237 ? CD  ? A LYS 129 CD  
20 1 Y 1 A LYS 237 ? CE  ? A LYS 129 CE  
21 1 Y 1 A LYS 237 ? NZ  ? A LYS 129 NZ  
22 1 Y 1 A ARG 296 ? CG  ? A ARG 188 CG  
23 1 Y 1 A ARG 296 ? CD  ? A ARG 188 CD  
24 1 Y 1 A ARG 296 ? NE  ? A ARG 188 NE  
25 1 Y 1 A ARG 296 ? CZ  ? A ARG 188 CZ  
26 1 Y 1 A ARG 296 ? NH1 ? A ARG 188 NH1 
27 1 Y 1 A ARG 296 ? NH2 ? A ARG 188 NH2 
28 1 Y 1 A LYS 303 ? NZ  ? A LYS 195 NZ  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET 109 ? A MET 1   
2  1 Y 1 A GLY 110 ? A GLY 2   
3  1 Y 1 A SER 111 ? A SER 3   
4  1 Y 1 A SER 112 ? A SER 4   
5  1 Y 1 A HIS 113 ? A HIS 5   
6  1 Y 1 A HIS 114 ? A HIS 6   
7  1 Y 1 A HIS 115 ? A HIS 7   
8  1 Y 1 A HIS 116 ? A HIS 8   
9  1 Y 1 A HIS 117 ? A HIS 9   
10 1 Y 1 A HIS 118 ? A HIS 10  
11 1 Y 1 A SER 119 ? A SER 11  
12 1 Y 1 A SER 120 ? A SER 12  
13 1 Y 1 A GLY 121 ? A GLY 13  
14 1 Y 1 A LEU 122 ? A LEU 14  
15 1 Y 1 A VAL 123 ? A VAL 15  
16 1 Y 1 A PRO 124 ? A PRO 16  
17 1 Y 1 A ARG 125 ? A ARG 17  
18 1 Y 1 A GLY 126 ? A GLY 18  
19 1 Y 1 A LEU 311 ? A LEU 203 
20 1 Y 1 A ASN 312 ? A ASN 204 
21 1 Y 1 A ASN 313 ? A ASN 205 
22 1 Y 1 A LEU 314 ? A LEU 206 
23 1 Y 1 A GLY 315 ? A GLY 207 
24 1 Y 1 A HIS 316 ? A HIS 208 
25 1 Y 1 A PRO 317 ? A PRO 209 
26 1 Y 1 A ASP 318 ? A ASP 210 
27 1 Y 1 A ASN 319 ? A ASN 211 
28 1 Y 1 A LYS 320 ? A LYS 212 
29 1 Y 1 A GLU 321 ? A GLU 213 
30 1 Y 1 A GLN 322 ? A GLN 214 
31 1 Y 1 A THR 323 ? A THR 215 
32 1 Y 1 A THR 324 ? A THR 216 
33 1 Y 1 A ASP 325 ? A ASP 217 
34 1 Y 1 A GLN 326 ? A GLN 218 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'CHLORIDE ION' CL  
3 water          HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 CL  1  401 1  CL  CL  A . 
C 3 HOH 1  403 3  HOH HOH A . 
C 3 HOH 2  404 4  HOH HOH A . 
C 3 HOH 3  405 5  HOH HOH A . 
C 3 HOH 4  408 8  HOH HOH A . 
C 3 HOH 5  410 10 HOH HOH A . 
C 3 HOH 6  411 11 HOH HOH A . 
C 3 HOH 7  415 15 HOH HOH A . 
C 3 HOH 8  417 17 HOH HOH A . 
C 3 HOH 9  421 21 HOH HOH A . 
C 3 HOH 10 423 23 HOH HOH A . 
C 3 HOH 11 425 25 HOH HOH A . 
C 3 HOH 12 426 26 HOH HOH A . 
C 3 HOH 13 427 27 HOH HOH A . 
C 3 HOH 14 428 28 HOH HOH A . 
#