data_3K3K
# 
_entry.id   3K3K 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3K3K         
RCSB  RCSB055501   
WWPDB D_1000055501 
# 
_pdbx_database_status.entry_id                        3K3K 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    RCSB 
_pdbx_database_status.recvd_initial_deposition_date   2009-10-02 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_cs                  ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Arvai, A.S.'   1 
'Hitomi, K.'    2 
'Getzoff, E.D.' 3 
# 
_citation.id                        primary 
_citation.title                     'Structural mechanism of abscisic acid binding and signaling by dimeric PYR1.' 
_citation.journal_abbrev            Science 
_citation.journal_volume            326 
_citation.page_first                1373 
_citation.page_last                 1379 
_citation.year                      2009 
_citation.journal_id_ASTM           SCIEAS 
_citation.country                   US 
_citation.journal_id_ISSN           0036-8075 
_citation.journal_id_CSD            0038 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   19933100 
_citation.pdbx_database_id_DOI      10.1126/science.1181829 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'Nishimura, N.'   1 
primary 'Hitomi, K.'      2 
primary 'Arvai, A.S.'     3 
primary 'Rambo, R.P.'     4 
primary 'Hitomi, C.'      5 
primary 'Cutler, S.R.'    6 
primary 'Schroeder, J.I.' 7 
primary 'Getzoff, E.D.'   8 
# 
_cell.length_a           50.208 
_cell.length_b           61.407 
_cell.length_c           82.844 
_cell.angle_alpha        90.000 
_cell.angle_beta         98.970 
_cell.angle_gamma        90.000 
_cell.entry_id           3K3K 
_cell.pdbx_unique_axis   ? 
_cell.Z_PDB              4 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.space_group_name_H-M             'P 1 2 1' 
_symmetry.entry_id                         3K3K 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.Int_Tables_number                3 
_symmetry.cell_setting                     ? 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Abscisic acid receptor PYR1'                                                                       23774.613 2 
? ? ? ? 
2 non-polymer syn '(2Z,4E)-5-[(1S)-1-hydroxy-2,6,6-trimethyl-4-oxocyclohex-2-en-1-yl]-3-methylpenta-2,4-dienoic acid' 264.317   1 
? ? ? ? 
3 water       nat water                                                                                               18.015    
380 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        
'PYRABACTIN RESISTANCE 1, GENE PRODUCT AT4G17870, REGULATORY COMPONENT OF ABA RECEPTOR 11, RCAR11, GENE PRODUCT T6K21.50' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MGSSHHHHHHSSGLVPRGSHMPSELTPEERSELKNSIAEFHTYQLDPGSCSSLHAQRIHAPPELVWSIVRRFDKPQTYKH
FIKSCSVEQNFEMRVGCTRDVIVISGLPANTSTERLDILDDERRVTGFSIIGGEHRLTNYKSVTTVHRFEKENRIWTVVL
ESYVVDMPEGNSEDDTRMFADTVVKLNLQKLATVAEAMARNSGDGSGSQVT
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MGSSHHHHHHSSGLVPRGSHMPSELTPEERSELKNSIAEFHTYQLDPGSCSSLHAQRIHAPPELVWSIVRRFDKPQTYKH
FIKSCSVEQNFEMRVGCTRDVIVISGLPANTSTERLDILDDERRVTGFSIIGGEHRLTNYKSVTTVHRFEKENRIWTVVL
ESYVVDMPEGNSEDDTRMFADTVVKLNLQKLATVAEAMARNSGDGSGSQVT
;
_entity_poly.pdbx_strand_id                 A,B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   GLY n 
1 3   SER n 
1 4   SER n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  SER n 
1 12  SER n 
1 13  GLY n 
1 14  LEU n 
1 15  VAL n 
1 16  PRO n 
1 17  ARG n 
1 18  GLY n 
1 19  SER n 
1 20  HIS n 
1 21  MET n 
1 22  PRO n 
1 23  SER n 
1 24  GLU n 
1 25  LEU n 
1 26  THR n 
1 27  PRO n 
1 28  GLU n 
1 29  GLU n 
1 30  ARG n 
1 31  SER n 
1 32  GLU n 
1 33  LEU n 
1 34  LYS n 
1 35  ASN n 
1 36  SER n 
1 37  ILE n 
1 38  ALA n 
1 39  GLU n 
1 40  PHE n 
1 41  HIS n 
1 42  THR n 
1 43  TYR n 
1 44  GLN n 
1 45  LEU n 
1 46  ASP n 
1 47  PRO n 
1 48  GLY n 
1 49  SER n 
1 50  CYS n 
1 51  SER n 
1 52  SER n 
1 53  LEU n 
1 54  HIS n 
1 55  ALA n 
1 56  GLN n 
1 57  ARG n 
1 58  ILE n 
1 59  HIS n 
1 60  ALA n 
1 61  PRO n 
1 62  PRO n 
1 63  GLU n 
1 64  LEU n 
1 65  VAL n 
1 66  TRP n 
1 67  SER n 
1 68  ILE n 
1 69  VAL n 
1 70  ARG n 
1 71  ARG n 
1 72  PHE n 
1 73  ASP n 
1 74  LYS n 
1 75  PRO n 
1 76  GLN n 
1 77  THR n 
1 78  TYR n 
1 79  LYS n 
1 80  HIS n 
1 81  PHE n 
1 82  ILE n 
1 83  LYS n 
1 84  SER n 
1 85  CYS n 
1 86  SER n 
1 87  VAL n 
1 88  GLU n 
1 89  GLN n 
1 90  ASN n 
1 91  PHE n 
1 92  GLU n 
1 93  MET n 
1 94  ARG n 
1 95  VAL n 
1 96  GLY n 
1 97  CYS n 
1 98  THR n 
1 99  ARG n 
1 100 ASP n 
1 101 VAL n 
1 102 ILE n 
1 103 VAL n 
1 104 ILE n 
1 105 SER n 
1 106 GLY n 
1 107 LEU n 
1 108 PRO n 
1 109 ALA n 
1 110 ASN n 
1 111 THR n 
1 112 SER n 
1 113 THR n 
1 114 GLU n 
1 115 ARG n 
1 116 LEU n 
1 117 ASP n 
1 118 ILE n 
1 119 LEU n 
1 120 ASP n 
1 121 ASP n 
1 122 GLU n 
1 123 ARG n 
1 124 ARG n 
1 125 VAL n 
1 126 THR n 
1 127 GLY n 
1 128 PHE n 
1 129 SER n 
1 130 ILE n 
1 131 ILE n 
1 132 GLY n 
1 133 GLY n 
1 134 GLU n 
1 135 HIS n 
1 136 ARG n 
1 137 LEU n 
1 138 THR n 
1 139 ASN n 
1 140 TYR n 
1 141 LYS n 
1 142 SER n 
1 143 VAL n 
1 144 THR n 
1 145 THR n 
1 146 VAL n 
1 147 HIS n 
1 148 ARG n 
1 149 PHE n 
1 150 GLU n 
1 151 LYS n 
1 152 GLU n 
1 153 ASN n 
1 154 ARG n 
1 155 ILE n 
1 156 TRP n 
1 157 THR n 
1 158 VAL n 
1 159 VAL n 
1 160 LEU n 
1 161 GLU n 
1 162 SER n 
1 163 TYR n 
1 164 VAL n 
1 165 VAL n 
1 166 ASP n 
1 167 MET n 
1 168 PRO n 
1 169 GLU n 
1 170 GLY n 
1 171 ASN n 
1 172 SER n 
1 173 GLU n 
1 174 ASP n 
1 175 ASP n 
1 176 THR n 
1 177 ARG n 
1 178 MET n 
1 179 PHE n 
1 180 ALA n 
1 181 ASP n 
1 182 THR n 
1 183 VAL n 
1 184 VAL n 
1 185 LYS n 
1 186 LEU n 
1 187 ASN n 
1 188 LEU n 
1 189 GLN n 
1 190 LYS n 
1 191 LEU n 
1 192 ALA n 
1 193 THR n 
1 194 VAL n 
1 195 ALA n 
1 196 GLU n 
1 197 ALA n 
1 198 MET n 
1 199 ALA n 
1 200 ARG n 
1 201 ASN n 
1 202 SER n 
1 203 GLY n 
1 204 ASP n 
1 205 GLY n 
1 206 SER n 
1 207 GLY n 
1 208 SER n 
1 209 GLN n 
1 210 VAL n 
1 211 THR n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               'mouse-ear cress' 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 'AT4g17870, PYR1, T6K21.50' 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Arabidopsis thaliana' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     3702 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'BL21(DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    O49686_ARATH 
_struct_ref.pdbx_db_accession          O49686 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;MPSELTPEERSELKNSIAEFHTYQLDPGSCSSLHAQRIHAPPELVWSIVRRFDKPQTYKHFIKSCSVEQNFEMRVGCTRD
VIVISGLPANTSTERLDILDDERRVTGFSIIGGEHRLTNYKSVTTVHRFEKENRIWTVVLESYVVDMPEGNSEDDTRMFA
DTVVKLNLQKLATVAEAMARNSGDGSGSQVT
;
_struct_ref.pdbx_align_begin           1 
_struct_ref.pdbx_db_isoform            ? 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 3K3K A 21 ? 211 ? O49686 1 ? 191 ? 1 191 
2 1 3K3K B 21 ? 211 ? O49686 1 ? 191 ? 1 191 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3K3K MET A 1  ? UNP O49686 ? ? 'EXPRESSION TAG' -19 1  
1 3K3K GLY A 2  ? UNP O49686 ? ? 'EXPRESSION TAG' -18 2  
1 3K3K SER A 3  ? UNP O49686 ? ? 'EXPRESSION TAG' -17 3  
1 3K3K SER A 4  ? UNP O49686 ? ? 'EXPRESSION TAG' -16 4  
1 3K3K HIS A 5  ? UNP O49686 ? ? 'EXPRESSION TAG' -15 5  
1 3K3K HIS A 6  ? UNP O49686 ? ? 'EXPRESSION TAG' -14 6  
1 3K3K HIS A 7  ? UNP O49686 ? ? 'EXPRESSION TAG' -13 7  
1 3K3K HIS A 8  ? UNP O49686 ? ? 'EXPRESSION TAG' -12 8  
1 3K3K HIS A 9  ? UNP O49686 ? ? 'EXPRESSION TAG' -11 9  
1 3K3K HIS A 10 ? UNP O49686 ? ? 'EXPRESSION TAG' -10 10 
1 3K3K SER A 11 ? UNP O49686 ? ? 'EXPRESSION TAG' -9  11 
1 3K3K SER A 12 ? UNP O49686 ? ? 'EXPRESSION TAG' -8  12 
1 3K3K GLY A 13 ? UNP O49686 ? ? 'EXPRESSION TAG' -7  13 
1 3K3K LEU A 14 ? UNP O49686 ? ? 'EXPRESSION TAG' -6  14 
1 3K3K VAL A 15 ? UNP O49686 ? ? 'EXPRESSION TAG' -5  15 
1 3K3K PRO A 16 ? UNP O49686 ? ? 'EXPRESSION TAG' -4  16 
1 3K3K ARG A 17 ? UNP O49686 ? ? 'EXPRESSION TAG' -3  17 
1 3K3K GLY A 18 ? UNP O49686 ? ? 'EXPRESSION TAG' -2  18 
1 3K3K SER A 19 ? UNP O49686 ? ? 'EXPRESSION TAG' -1  19 
1 3K3K HIS A 20 ? UNP O49686 ? ? 'EXPRESSION TAG' 0   20 
2 3K3K MET B 1  ? UNP O49686 ? ? 'EXPRESSION TAG' -19 21 
2 3K3K GLY B 2  ? UNP O49686 ? ? 'EXPRESSION TAG' -18 22 
2 3K3K SER B 3  ? UNP O49686 ? ? 'EXPRESSION TAG' -17 23 
2 3K3K SER B 4  ? UNP O49686 ? ? 'EXPRESSION TAG' -16 24 
2 3K3K HIS B 5  ? UNP O49686 ? ? 'EXPRESSION TAG' -15 25 
2 3K3K HIS B 6  ? UNP O49686 ? ? 'EXPRESSION TAG' -14 26 
2 3K3K HIS B 7  ? UNP O49686 ? ? 'EXPRESSION TAG' -13 27 
2 3K3K HIS B 8  ? UNP O49686 ? ? 'EXPRESSION TAG' -12 28 
2 3K3K HIS B 9  ? UNP O49686 ? ? 'EXPRESSION TAG' -11 29 
2 3K3K HIS B 10 ? UNP O49686 ? ? 'EXPRESSION TAG' -10 30 
2 3K3K SER B 11 ? UNP O49686 ? ? 'EXPRESSION TAG' -9  31 
2 3K3K SER B 12 ? UNP O49686 ? ? 'EXPRESSION TAG' -8  32 
2 3K3K GLY B 13 ? UNP O49686 ? ? 'EXPRESSION TAG' -7  33 
2 3K3K LEU B 14 ? UNP O49686 ? ? 'EXPRESSION TAG' -6  34 
2 3K3K VAL B 15 ? UNP O49686 ? ? 'EXPRESSION TAG' -5  35 
2 3K3K PRO B 16 ? UNP O49686 ? ? 'EXPRESSION TAG' -4  36 
2 3K3K ARG B 17 ? UNP O49686 ? ? 'EXPRESSION TAG' -3  37 
2 3K3K GLY B 18 ? UNP O49686 ? ? 'EXPRESSION TAG' -2  38 
2 3K3K SER B 19 ? UNP O49686 ? ? 'EXPRESSION TAG' -1  39 
2 3K3K HIS B 20 ? UNP O49686 ? ? 'EXPRESSION TAG' 0   40 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
A8S non-polymer         . '(2Z,4E)-5-[(1S)-1-hydroxy-2,6,6-trimethyl-4-oxocyclohex-2-en-1-yl]-3-methylpenta-2,4-dienoic acid' 
'(+)-abscisic acid, (2Z,4E)-5-[(1S)-1-hydroxy-2,6,6-trimethyl-4-oxo-2-cyclohexen-1-yl]-3-methyl-2,4-pentadienoic acid' 
'C15 H20 O4'     264.317 
ALA 'L-peptide linking' y ALANINE                                                                                             ? 
'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE                                                                                            ? 
'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                                                          ? 
'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                                                     ? 
'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE                                                                                            ? 
'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                                                           ? 
'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                                                     ? 
'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE                                                                                             ? 
'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE                                                                                           ? 
'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER                                                                                               ? 
'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                                                          ? 
'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE                                                                                             ? 
'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE                                                                                              ? 
'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE                                                                                          ? 
'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE                                                                                       ? 
'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE                                                                                             ? 
'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE                                                                                              ? 
'C3 H7 N O3'     105.093 
THR 'L-peptide linking' y THREONINE                                                                                           ? 
'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                                                          ? 
'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE                                                                                            ? 
'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE                                                                                              ? 
'C5 H11 N O2'    117.146 
# 
_exptl.crystals_number   1 
_exptl.entry_id          3K3K 
_exptl.method            'X-RAY DIFFRACTION' 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_Matthews      2.65 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_percent_sol   53.64 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION' 
_exptl_crystal_grow.pH              6.2 
_exptl_crystal_grow.temp            293 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pdbx_details    '20% PEG MME 2000, 5% Ammonium sulfate, 5% NaCl, pH 6.2, VAPOR DIFFUSION, temperature 293K' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               CCD 
_diffrn_detector.type                   'ADSC QUANTUM 315r' 
_diffrn_detector.pdbx_collection_date   2009-05-29 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.115932 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.type                        'ALS BEAMLINE 12.3.1' 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.115932 
_diffrn_source.pdbx_synchrotron_site       ALS 
_diffrn_source.pdbx_synchrotron_beamline   12.3.1 
# 
_reflns.entry_id                     3K3K 
_reflns.observed_criterion_sigma_F   ? 
_reflns.observed_criterion_sigma_I   0.0 
_reflns.d_resolution_high            1.70 
_reflns.d_resolution_low             50.0 
_reflns.number_all                   53191 
_reflns.number_obs                   53191 
_reflns.percent_possible_obs         96.6 
_reflns.pdbx_Rmerge_I_obs            0.054 
_reflns.pdbx_Rsym_value              0.054 
_reflns.pdbx_netI_over_sigmaI        22.8 
_reflns.B_iso_Wilson_estimate        30.7 
_reflns.pdbx_redundancy              3.9 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_ordinal                 1 
_reflns.pdbx_diffrn_id               1 
# 
_reflns_shell.d_res_high             1.70 
_reflns_shell.d_res_low              1.76 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.percent_possible_all   76.6 
_reflns_shell.Rmerge_I_obs           0.391 
_reflns_shell.meanI_over_sigI_obs    2.5 
_reflns_shell.pdbx_Rsym_value        0.391 
_reflns_shell.pdbx_redundancy        2.8 
_reflns_shell.number_unique_all      4195 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_ordinal           1 
_reflns_shell.pdbx_diffrn_id         1 
# 
_refine.entry_id                                 3K3K 
_refine.ls_d_res_high                            1.70 
_refine.ls_d_res_low                             50.0 
_refine.pdbx_ls_sigma_F                          0.00 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.ls_percent_reflns_obs                    96.720 
_refine.ls_number_reflns_obs                     53122 
_refine.ls_number_reflns_all                     53122 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.details                                  'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' 
_refine.ls_R_factor_all                          0.191 
_refine.ls_R_factor_obs                          0.191 
_refine.ls_R_factor_R_work                       0.189 
_refine.ls_wR_factor_R_work                      ? 
_refine.ls_R_factor_R_free                       0.237 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_percent_reflns_R_free                 5.100 
_refine.ls_number_reflns_R_free                  2685 
_refine.ls_R_factor_R_free_error                 ? 
_refine.B_iso_mean                               53.873 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.aniso_B[1][1]                            2.290 
_refine.aniso_B[2][2]                            -2.570 
_refine.aniso_B[3][3]                            0.690 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            1.300 
_refine.aniso_B[2][3]                            0.000 
_refine.correlation_coeff_Fo_to_Fc               0.971 
_refine.correlation_coeff_Fo_to_Fc_free          0.954 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.pdbx_overall_ESU_R                       0.101 
_refine.pdbx_overall_ESU_R_Free                  0.108 
_refine.overall_SU_ML                            0.086 
_refine.overall_SU_B                             2.644 
_refine.solvent_model_details                    'BABINET MODEL WITH MASK' 
_refine.pdbx_solvent_vdw_probe_radii             0.900 
_refine.pdbx_solvent_ion_probe_radii             0.900 
_refine.pdbx_solvent_shrinkage_radii             0.700 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.pdbx_starting_model                      'PDB entry 3F08' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_stereochemistry_target_values       'MAXIMUM LIKELIHOOD' 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.overall_FOM_work_R_set                   ? 
_refine.B_iso_max                                316.53 
_refine.B_iso_min                                9.71 
_refine.occupancy_max                            1.00 
_refine.occupancy_min                            0.50 
_refine.pdbx_ls_sigma_I                          0.0 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.pdbx_overall_phase_error                 ? 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        2924 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         19 
_refine_hist.number_atoms_solvent             380 
_refine_hist.number_atoms_total               3323 
_refine_hist.d_res_high                       1.70 
_refine_hist.d_res_low                        50.0 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.number 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
r_bond_refined_d         3134 0.014  0.022  ? 'X-RAY DIFFRACTION' ? 
r_angle_refined_deg      4271 1.512  1.955  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_1_deg   400  6.108  5.000  ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_2_deg   156  31.363 23.333 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_3_deg   564  13.995 15.000 ? 'X-RAY DIFFRACTION' ? 
r_dihedral_angle_4_deg   32   18.665 15.000 ? 'X-RAY DIFFRACTION' ? 
r_chiral_restr           480  0.114  0.200  ? 'X-RAY DIFFRACTION' ? 
r_gen_planes_refined     2406 0.007  0.020  ? 'X-RAY DIFFRACTION' ? 
r_nbd_refined            1469 0.214  0.200  ? 'X-RAY DIFFRACTION' ? 
r_nbtor_refined          2154 0.308  0.200  ? 'X-RAY DIFFRACTION' ? 
r_xyhbond_nbd_refined    304  0.169  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_vdw_refined   53   0.225  0.200  ? 'X-RAY DIFFRACTION' ? 
r_symmetry_hbond_refined 30   0.214  0.200  ? 'X-RAY DIFFRACTION' ? 
r_mcbond_it              1954 16.864 1.500  ? 'X-RAY DIFFRACTION' ? 
r_mcangle_it             3112 19.835 2.000  ? 'X-RAY DIFFRACTION' ? 
r_scbond_it              1314 40.101 3.000  ? 'X-RAY DIFFRACTION' ? 
r_scangle_it             1143 42.347 4.500  ? 'X-RAY DIFFRACTION' ? 
# 
_refine_ls_shell.d_res_high                       1.700 
_refine_ls_shell.d_res_low                        1.744 
_refine_ls_shell.pdbx_total_number_of_bins_used   20 
_refine_ls_shell.percent_reflns_obs               75.430 
_refine_ls_shell.number_reflns_R_work             2873 
_refine_ls_shell.R_factor_all                     ? 
_refine_ls_shell.R_factor_R_work                  0.301 
_refine_ls_shell.R_factor_R_free                  0.343 
_refine_ls_shell.percent_reflns_R_free            ? 
_refine_ls_shell.number_reflns_R_free             172 
_refine_ls_shell.R_factor_R_free_error            ? 
_refine_ls_shell.number_reflns_all                3045 
_refine_ls_shell.number_reflns_obs                ? 
_refine_ls_shell.redundancy_reflns_obs            ? 
_refine_ls_shell.pdbx_refine_id                   'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3K3K 
_struct.title                     
;Crystal structure of dimeric abscisic acid (ABA) receptor pyrabactin resistance 1 (PYR1) with ABA-bound closed-lid and ABA-free open-lid subunits
;
_struct.pdbx_descriptor           'Abscisic acid receptor PYR1' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3K3K 
_struct_keywords.pdbx_keywords   'HORMONE RECEPTOR, SIGNALING PROTEIN' 
_struct_keywords.text            
;PYR1, ABSCISIC ACID, ABA RECEPTOR, PLANT HORMONE RECEPTOR, ABA, ABA SENSOR, DROUGHT TOLERANCE, PLANT DEVELOPMENT, SEED DORMANCY, ALPHA/BETA HELIX-GRIP FOLD, START PROTEIN, CLUSTER A TYPE 2C PROTEIN PHOSPHATASE (PP2C) INHIBITOR, PYRABACTIN RESISTANCE 1, PYRABACTIN, PYL, PHYTOHORMONE, HORMONE RECEPTOR, SIGNALING PROTEIN
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 1 ? 
C N N 2 ? 
D N N 3 ? 
E N N 3 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 THR A 26  ? HIS A 41  ? THR A 6   HIS A 21  1 ? 16 
HELX_P HELX_P2 2 PRO A 61  ? ARG A 70  ? PRO A 41  ARG A 50  1 ? 10 
HELX_P HELX_P3 3 LYS A 74  ? TYR A 78  ? LYS A 54  TYR A 58  5 ? 5  
HELX_P HELX_P4 4 HIS A 135 ? ASN A 139 ? HIS A 115 ASN A 119 5 ? 5  
HELX_P HELX_P5 5 THR A 176 ? ARG A 200 ? THR A 156 ARG A 180 1 ? 25 
HELX_P HELX_P6 6 THR B 26  ? HIS B 41  ? THR B 6   HIS B 21  1 ? 16 
HELX_P HELX_P7 7 PRO B 61  ? ARG B 70  ? PRO B 41  ARG B 50  1 ? 10 
HELX_P HELX_P8 8 LYS B 74  ? TYR B 78  ? LYS B 54  TYR B 58  5 ? 5  
HELX_P HELX_P9 9 SER B 172 ? ASP B 204 ? SER B 152 ASP B 184 1 ? 33 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_mon_prot_cis.pdbx_id 
_struct_mon_prot_cis.label_comp_id 
_struct_mon_prot_cis.label_seq_id 
_struct_mon_prot_cis.label_asym_id 
_struct_mon_prot_cis.label_alt_id 
_struct_mon_prot_cis.pdbx_PDB_ins_code 
_struct_mon_prot_cis.auth_comp_id 
_struct_mon_prot_cis.auth_seq_id 
_struct_mon_prot_cis.auth_asym_id 
_struct_mon_prot_cis.pdbx_label_comp_id_2 
_struct_mon_prot_cis.pdbx_label_seq_id_2 
_struct_mon_prot_cis.pdbx_label_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2 
_struct_mon_prot_cis.pdbx_auth_comp_id_2 
_struct_mon_prot_cis.pdbx_auth_seq_id_2 
_struct_mon_prot_cis.pdbx_auth_asym_id_2 
_struct_mon_prot_cis.pdbx_PDB_model_num 
_struct_mon_prot_cis.pdbx_omega_angle 
1 LEU 107 A . ? LEU 87 A PRO 108 A ? PRO 88 A 1 8.59 
2 PRO 22  B . ? PRO 2  B SER 23  B ? SER 3  B 1 9.69 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 7 ? 
B ? 7 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? anti-parallel 
A 6 7 ? anti-parallel 
B 1 2 ? anti-parallel 
B 2 3 ? anti-parallel 
B 3 4 ? anti-parallel 
B 4 5 ? anti-parallel 
B 5 6 ? anti-parallel 
B 6 7 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 SER A 49  ? ILE A 58  ? SER A 29  ILE A 38  
A 2 ARG A 154 ? ASP A 166 ? ARG A 134 ASP A 146 
A 3 LYS A 141 ? LYS A 151 ? LYS A 121 LYS A 131 
A 4 VAL A 125 ? GLY A 133 ? VAL A 105 GLY A 113 
A 5 ASN A 110 ? ASP A 120 ? ASN A 90  ASP A 100 
A 6 THR A 98  ? VAL A 103 ? THR A 78  VAL A 83  
A 7 ILE A 82  ? SER A 86  ? ILE A 62  SER A 66  
B 1 SER B 49  ? ILE B 58  ? SER B 29  ILE B 38  
B 2 ARG B 154 ? ASP B 166 ? ARG B 134 ASP B 146 
B 3 LYS B 141 ? LYS B 151 ? LYS B 121 LYS B 131 
B 4 VAL B 125 ? GLY B 132 ? VAL B 105 GLY B 112 
B 5 THR B 111 ? ASP B 120 ? THR B 91  ASP B 100 
B 6 THR B 98  ? VAL B 103 ? THR B 78  VAL B 83  
B 7 ILE B 82  ? VAL B 87  ? ILE B 62  VAL B 67  
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N ILE A 58  ? N ILE A 38  O THR A 157 ? O THR A 137 
A 2 3 O SER A 162 ? O SER A 142 N VAL A 143 ? N VAL A 123 
A 3 4 O SER A 142 ? O SER A 122 N PHE A 128 ? N PHE A 108 
A 4 5 O VAL A 125 ? O VAL A 105 N ASP A 120 ? N ASP A 100 
A 5 6 O ASN A 110 ? O ASN A 90  N VAL A 103 ? N VAL A 83  
A 6 7 O ILE A 102 ? O ILE A 82  N LYS A 83  ? N LYS A 63  
B 1 2 N ILE B 58  ? N ILE B 38  O THR B 157 ? O THR B 137 
B 2 3 O LEU B 160 ? O LEU B 140 N THR B 145 ? N THR B 125 
B 3 4 O THR B 144 ? O THR B 124 N THR B 126 ? N THR B 106 
B 4 5 O ILE B 131 ? O ILE B 111 N THR B 113 ? N THR B 93  
B 5 6 O SER B 112 ? O SER B 92  N VAL B 101 ? N VAL B 81  
B 6 7 O ILE B 102 ? O ILE B 82  N SER B 84  ? N SER B 64  
# 
_struct_site.id                   AC1 
_struct_site.pdbx_evidence_code   Software 
_struct_site.pdbx_auth_asym_id    ? 
_struct_site.pdbx_auth_comp_id    ? 
_struct_site.pdbx_auth_seq_id     ? 
_struct_site.pdbx_auth_ins_code   ? 
_struct_site.pdbx_num_residues    16 
_struct_site.details              'BINDING SITE FOR RESIDUE A8S B 1001' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 16 LYS B 79  ? LYS B 59  . ? 1_555 ? 
2  AC1 16 VAL B 103 ? VAL B 83  . ? 1_555 ? 
3  AC1 16 PRO B 108 ? PRO B 88  . ? 1_555 ? 
4  AC1 16 ALA B 109 ? ALA B 89  . ? 1_555 ? 
5  AC1 16 SER B 112 ? SER B 92  . ? 1_555 ? 
6  AC1 16 PHE B 128 ? PHE B 108 . ? 1_555 ? 
7  AC1 16 ILE B 130 ? ILE B 110 . ? 1_555 ? 
8  AC1 16 LEU B 137 ? LEU B 117 . ? 1_555 ? 
9  AC1 16 TYR B 140 ? TYR B 120 . ? 1_555 ? 
10 AC1 16 PHE B 179 ? PHE B 159 . ? 1_555 ? 
11 AC1 16 VAL B 183 ? VAL B 163 . ? 1_555 ? 
12 AC1 16 HOH E .   ? HOH B 200 . ? 1_555 ? 
13 AC1 16 HOH E .   ? HOH B 214 . ? 1_555 ? 
14 AC1 16 HOH E .   ? HOH B 220 . ? 1_555 ? 
15 AC1 16 HOH E .   ? HOH B 221 . ? 1_555 ? 
16 AC1 16 HOH E .   ? HOH B 297 . ? 1_555 ? 
# 
_atom_sites.entry_id                    3K3K 
_atom_sites.fract_transf_matrix[1][1]   0.019917 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.003142 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.016285 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.012220 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C 
N 
O 
S 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N N   . MET A 1 21  ? 26.943  36.153 15.066 1.00 107.84 ? 1    MET A N   1 
ATOM   2    C CA  . MET A 1 21  ? 26.157  34.884 15.175 1.00 136.87 ? 1    MET A CA  1 
ATOM   3    C C   . MET A 1 21  ? 25.955  34.376 16.625 1.00 51.18  ? 1    MET A C   1 
ATOM   4    O O   . MET A 1 21  ? 24.899  33.802 16.921 1.00 144.68 ? 1    MET A O   1 
ATOM   5    C CB  . MET A 1 21  ? 26.766  33.786 14.293 1.00 96.67  ? 1    MET A CB  1 
ATOM   6    C CG  . MET A 1 21  ? 25.805  32.651 13.959 1.00 171.94 ? 1    MET A CG  1 
ATOM   7    S SD  . MET A 1 21  ? 26.520  31.015 14.217 1.00 167.04 ? 1    MET A SD  1 
ATOM   8    C CE  . MET A 1 21  ? 26.431  30.868 16.006 1.00 76.51  ? 1    MET A CE  1 
ATOM   9    N N   . PRO A 1 22  ? 26.958  34.564 17.518 1.00 80.90  ? 2    PRO A N   1 
ATOM   10   C CA  . PRO A 1 22  ? 26.703  34.294 18.936 1.00 61.82  ? 2    PRO A CA  1 
ATOM   11   C C   . PRO A 1 22  ? 25.447  35.012 19.409 1.00 104.15 ? 2    PRO A C   1 
ATOM   12   O O   . PRO A 1 22  ? 25.252  36.194 19.104 1.00 54.30  ? 2    PRO A O   1 
ATOM   13   C CB  . PRO A 1 22  ? 27.919  34.900 19.632 1.00 46.66  ? 2    PRO A CB  1 
ATOM   14   C CG  . PRO A 1 22  ? 29.006  34.779 18.634 1.00 159.99 ? 2    PRO A CG  1 
ATOM   15   C CD  . PRO A 1 22  ? 28.356  34.983 17.292 1.00 58.49  ? 2    PRO A CD  1 
ATOM   16   N N   . SER A 1 23  ? 24.614  34.286 20.147 1.00 55.98  ? 3    SER A N   1 
ATOM   17   C CA  A SER A 1 23  ? 23.350  34.819 20.639 0.50 81.93  ? 3    SER A CA  1 
ATOM   18   C CA  B SER A 1 23  ? 23.357  34.805 20.682 0.50 24.41  ? 3    SER A CA  1 
ATOM   19   C C   . SER A 1 23  ? 23.556  35.913 21.691 1.00 71.85  ? 3    SER A C   1 
ATOM   20   O O   . SER A 1 23  ? 22.648  36.705 21.952 1.00 51.47  ? 3    SER A O   1 
ATOM   21   C CB  A SER A 1 23  ? 22.479  33.685 21.188 0.50 117.79 ? 3    SER A CB  1 
ATOM   22   C CB  B SER A 1 23  ? 22.595  33.664 21.361 0.50 30.94  ? 3    SER A CB  1 
ATOM   23   O OG  A SER A 1 23  ? 22.178  32.745 20.167 0.50 59.08  ? 3    SER A OG  1 
ATOM   24   O OG  B SER A 1 23  ? 23.317  33.155 22.476 0.50 45.61  ? 3    SER A OG  1 
ATOM   25   N N   . GLU A 1 24  ? 24.744  35.949 22.280 1.00 46.64  ? 4    GLU A N   1 
ATOM   26   C CA  . GLU A 1 24  ? 25.064  36.958 23.284 1.00 60.95  ? 4    GLU A CA  1 
ATOM   27   C C   . GLU A 1 24  ? 25.066  38.354 22.655 1.00 66.94  ? 4    GLU A C   1 
ATOM   28   O O   . GLU A 1 24  ? 25.460  38.527 21.505 1.00 41.97  ? 4    GLU A O   1 
ATOM   29   C CB  . GLU A 1 24  ? 26.410  36.651 23.947 1.00 61.03  ? 4    GLU A CB  1 
ATOM   30   C CG  . GLU A 1 24  ? 26.354  35.517 24.964 1.00 88.22  ? 4    GLU A CG  1 
ATOM   31   C CD  . GLU A 1 24  ? 27.730  34.995 25.350 1.00 165.07 ? 4    GLU A CD  1 
ATOM   32   O OE1 . GLU A 1 24  ? 27.960  34.764 26.556 1.00 242.13 ? 4    GLU A OE1 1 
ATOM   33   O OE2 . GLU A 1 24  ? 28.582  34.815 24.452 1.00 228.67 ? 4    GLU A OE2 1 
ATOM   34   N N   . LEU A 1 25  ? 24.597  39.346 23.398 1.00 38.26  ? 5    LEU A N   1 
ATOM   35   C CA  . LEU A 1 25  ? 24.659  40.728 22.920 1.00 33.72  ? 5    LEU A CA  1 
ATOM   36   C C   . LEU A 1 25  ? 26.097  41.196 22.682 1.00 36.94  ? 5    LEU A C   1 
ATOM   37   O O   . LEU A 1 25  ? 27.036  40.883 23.448 1.00 45.59  ? 5    LEU A O   1 
ATOM   38   C CB  . LEU A 1 25  ? 23.987  41.699 23.906 1.00 36.90  ? 5    LEU A CB  1 
ATOM   39   C CG  . LEU A 1 25  ? 22.591  41.263 24.332 1.00 42.08  ? 5    LEU A CG  1 
ATOM   40   C CD1 . LEU A 1 25  ? 22.024  42.311 25.208 1.00 35.07  ? 5    LEU A CD1 1 
ATOM   41   C CD2 . LEU A 1 25  ? 21.711  41.077 23.133 1.00 34.08  ? 5    LEU A CD2 1 
ATOM   42   N N   . THR A 1 26  ? 26.250  41.979 21.621 1.00 36.25  ? 6    THR A N   1 
ATOM   43   C CA  . THR A 1 26  ? 27.468  42.722 21.370 1.00 38.91  ? 6    THR A CA  1 
ATOM   44   C C   . THR A 1 26  ? 27.671  43.897 22.323 1.00 53.17  ? 6    THR A C   1 
ATOM   45   O O   . THR A 1 26  ? 26.719  44.394 22.976 1.00 38.77  ? 6    THR A O   1 
ATOM   46   C CB  . THR A 1 26  ? 27.452  43.269 19.944 1.00 37.71  ? 6    THR A CB  1 
ATOM   47   O OG1 . THR A 1 26  ? 26.473  44.319 19.836 1.00 45.07  ? 6    THR A OG1 1 
ATOM   48   C CG2 . THR A 1 26  ? 27.099  42.181 18.983 1.00 40.64  ? 6    THR A CG2 1 
ATOM   49   N N   . PRO A 1 27  ? 28.925  44.362 22.420 1.00 47.03  ? 7    PRO A N   1 
ATOM   50   C CA  . PRO A 1 27  ? 29.217  45.573 23.180 1.00 48.90  ? 7    PRO A CA  1 
ATOM   51   C C   . PRO A 1 27  ? 28.371  46.803 22.777 1.00 44.82  ? 7    PRO A C   1 
ATOM   52   O O   . PRO A 1 27  ? 27.959  47.563 23.647 1.00 45.68  ? 7    PRO A O   1 
ATOM   53   C CB  . PRO A 1 27  ? 30.701  45.792 22.896 1.00 58.52  ? 7    PRO A CB  1 
ATOM   54   C CG  . PRO A 1 27  ? 31.211  44.403 22.688 1.00 46.21  ? 7    PRO A CG  1 
ATOM   55   C CD  . PRO A 1 27  ? 30.153  43.750 21.876 1.00 48.76  ? 7    PRO A CD  1 
ATOM   56   N N   . GLU A 1 28  ? 28.090  46.977 21.485 1.00 37.71  ? 8    GLU A N   1 
ATOM   57   C CA  . GLU A 1 28  ? 27.255  48.087 21.015 1.00 40.11  ? 8    GLU A CA  1 
ATOM   58   C C   . GLU A 1 28  ? 25.797  47.913 21.492 1.00 39.41  ? 8    GLU A C   1 
ATOM   59   O O   . GLU A 1 28  ? 25.162  48.870 21.981 1.00 40.63  ? 8    GLU A O   1 
ATOM   60   C CB  . GLU A 1 28  ? 27.264  48.166 19.483 1.00 47.13  ? 8    GLU A CB  1 
ATOM   61   C CG  . GLU A 1 28  ? 28.647  48.030 18.815 1.00 116.42 ? 8    GLU A CG  1 
ATOM   62   C CD  . GLU A 1 28  ? 29.066  46.576 18.569 1.00 203.23 ? 8    GLU A CD  1 
ATOM   63   O OE1 . GLU A 1 28  ? 28.814  46.064 17.455 1.00 87.95  ? 8    GLU A OE1 1 
ATOM   64   O OE2 . GLU A 1 28  ? 29.648  45.944 19.483 1.00 59.31  ? 8    GLU A OE2 1 
ATOM   65   N N   . GLU A 1 29  ? 25.283  46.690 21.360 1.00 38.17  ? 9    GLU A N   1 
ATOM   66   C CA  . GLU A 1 29  ? 23.948  46.398 21.881 1.00 34.93  ? 9    GLU A CA  1 
ATOM   67   C C   . GLU A 1 29  ? 23.941  46.670 23.382 1.00 34.79  ? 9    GLU A C   1 
ATOM   68   O O   . GLU A 1 29  ? 23.042  47.347 23.920 1.00 34.09  ? 9    GLU A O   1 
ATOM   69   C CB  . GLU A 1 29  ? 23.539  44.951 21.550 1.00 33.23  ? 9    GLU A CB  1 
ATOM   70   C CG  . GLU A 1 29  ? 23.071  44.764 20.083 1.00 34.29  ? 9    GLU A CG  1 
ATOM   71   C CD  . GLU A 1 29  ? 23.026  43.315 19.646 1.00 37.96  ? 9    GLU A CD  1 
ATOM   72   O OE1 . GLU A 1 29  ? 23.674  42.458 20.292 1.00 43.01  ? 9    GLU A OE1 1 
ATOM   73   O OE2 . GLU A 1 29  ? 22.337  43.024 18.645 1.00 37.39  ? 9    GLU A OE2 1 
ATOM   74   N N   . ARG A 1 30  ? 24.949  46.169 24.073 1.00 36.90  ? 10   ARG A N   1 
ATOM   75   C CA  . ARG A 1 30  ? 24.959  46.309 25.513 1.00 36.18  ? 10   ARG A CA  1 
ATOM   76   C C   . ARG A 1 30  ? 24.996  47.779 25.938 1.00 40.10  ? 10   ARG A C   1 
ATOM   77   O O   . ARG A 1 30  ? 24.314  48.170 26.881 1.00 37.55  ? 10   ARG A O   1 
ATOM   78   C CB  . ARG A 1 30  ? 26.078  45.498 26.157 1.00 57.87  ? 10   ARG A CB  1 
ATOM   79   C CG  . ARG A 1 30  ? 25.766  44.014 26.236 1.00 40.19  ? 10   ARG A CG  1 
ATOM   80   C CD  . ARG A 1 30  ? 26.941  43.287 26.900 1.00 72.72  ? 10   ARG A CD  1 
ATOM   81   N NE  . ARG A 1 30  ? 27.068  41.914 26.421 1.00 72.15  ? 10   ARG A NE  1 
ATOM   82   C CZ  . ARG A 1 30  ? 26.458  40.864 26.971 1.00 192.32 ? 10   ARG A CZ  1 
ATOM   83   N NH1 . ARG A 1 30  ? 25.676  41.013 28.039 1.00 55.65  ? 10   ARG A NH1 1 
ATOM   84   N NH2 . ARG A 1 30  ? 26.632  39.655 26.450 1.00 95.68  ? 10   ARG A NH2 1 
ATOM   85   N N   . SER A 1 31  ? 25.755  48.600 25.222 1.00 35.72  ? 11   SER A N   1 
ATOM   86   C CA  . SER A 1 31  ? 25.822  49.998 25.574 1.00 45.09  ? 11   SER A CA  1 
ATOM   87   C C   . SER A 1 31  ? 24.486  50.691 25.379 1.00 37.87  ? 11   SER A C   1 
ATOM   88   O O   . SER A 1 31  ? 24.045  51.448 26.254 1.00 39.59  ? 11   SER A O   1 
ATOM   89   C CB  . SER A 1 31  ? 26.935  50.701 24.809 1.00 56.03  ? 11   SER A CB  1 
ATOM   90   O OG  . SER A 1 31  ? 28.168  50.395 25.436 1.00 55.29  ? 11   SER A OG  1 
ATOM   91   N N   . GLU A 1 32  ? 23.857  50.367 24.265 1.00 29.45  ? 12   GLU A N   1 
ATOM   92   C CA  . GLU A 1 32  ? 22.590  50.971 23.862 1.00 26.05  ? 12   GLU A CA  1 
ATOM   93   C C   . GLU A 1 32  ? 21.441  50.598 24.828 1.00 34.96  ? 12   GLU A C   1 
ATOM   94   O O   . GLU A 1 32  ? 20.482  51.370 24.986 1.00 35.94  ? 12   GLU A O   1 
ATOM   95   C CB  . GLU A 1 32  ? 22.225  50.599 22.432 1.00 35.28  ? 12   GLU A CB  1 
ATOM   96   C CG  . GLU A 1 32  ? 21.320  51.632 21.749 1.00 84.04  ? 12   GLU A CG  1 
ATOM   97   C CD  . GLU A 1 32  ? 21.971  53.013 21.653 1.00 193.66 ? 12   GLU A CD  1 
ATOM   98   O OE1 . GLU A 1 32  ? 22.888  53.175 20.820 1.00 267.78 ? 12   GLU A OE1 1 
ATOM   99   O OE2 . GLU A 1 32  ? 21.569  53.934 22.407 1.00 73.42  ? 12   GLU A OE2 1 
ATOM   100  N N   . LEU A 1 33  ? 21.544  49.431 25.469 1.00 31.22  ? 13   LEU A N   1 
ATOM   101  C CA  . LEU A 1 33  ? 20.490  48.961 26.439 1.00 26.42  ? 13   LEU A CA  1 
ATOM   102  C C   . LEU A 1 33  ? 20.723  49.363 27.876 1.00 30.79  ? 13   LEU A C   1 
ATOM   103  O O   . LEU A 1 33  ? 19.848  49.178 28.712 1.00 28.38  ? 13   LEU A O   1 
ATOM   104  C CB  . LEU A 1 33  ? 20.385  47.451 26.399 1.00 31.40  ? 13   LEU A CB  1 
ATOM   105  C CG  . LEU A 1 33  ? 20.101  47.018 24.974 1.00 29.87  ? 13   LEU A CG  1 
ATOM   106  C CD1 . LEU A 1 33  ? 20.275  45.557 24.870 1.00 36.56  ? 13   LEU A CD1 1 
ATOM   107  C CD2 . LEU A 1 33  ? 18.703  47.500 24.553 1.00 35.31  ? 13   LEU A CD2 1 
ATOM   108  N N   . LYS A 1 34  ? 21.874  49.963 28.191 1.00 28.84  ? 14   LYS A N   1 
ATOM   109  C CA  . LYS A 1 34  ? 22.102  50.295 29.591 1.00 29.21  ? 14   LYS A CA  1 
ATOM   110  C C   . LYS A 1 34  ? 21.027  51.118 30.274 1.00 30.04  ? 14   LYS A C   1 
ATOM   111  O O   . LYS A 1 34  ? 20.620  50.851 31.401 1.00 30.10  ? 14   LYS A O   1 
ATOM   112  C CB  . LYS A 1 34  ? 23.422  51.062 29.726 1.00 43.54  ? 14   LYS A CB  1 
ATOM   113  C CG  . LYS A 1 34  ? 24.615  50.211 30.040 1.00 46.19  ? 14   LYS A CG  1 
ATOM   114  C CD  . LYS A 1 34  ? 25.865  51.100 30.184 1.00 48.86  ? 14   LYS A CD  1 
ATOM   115  C CE  . LYS A 1 34  ? 26.359  51.583 28.817 1.00 147.19 ? 14   LYS A CE  1 
ATOM   116  N NZ  . LYS A 1 34  ? 27.385  52.655 28.895 1.00 105.96 ? 14   LYS A NZ  1 
ATOM   117  N N   . ASN A 1 35  ? 20.642  52.237 29.653 1.00 28.38  ? 15   ASN A N   1 
ATOM   118  C CA  . ASN A 1 35  ? 19.605  53.106 30.192 1.00 29.93  ? 15   ASN A CA  1 
ATOM   119  C C   . ASN A 1 35  ? 18.240  52.427 30.371 1.00 28.34  ? 15   ASN A C   1 
ATOM   120  O O   . ASN A 1 35  ? 17.582  52.655 31.393 1.00 30.65  ? 15   ASN A O   1 
ATOM   121  C CB  . ASN A 1 35  ? 19.465  54.367 29.342 1.00 28.10  ? 15   ASN A CB  1 
ATOM   122  C CG  . ASN A 1 35  ? 20.660  55.297 29.515 1.00 34.91  ? 15   ASN A CG  1 
ATOM   123  O OD1 . ASN A 1 35  ? 21.311  55.267 30.537 1.00 33.60  ? 15   ASN A OD1 1 
ATOM   124  N ND2 . ASN A 1 35  ? 20.903  56.154 28.539 1.00 29.74  ? 15   ASN A ND2 1 
ATOM   125  N N   . SER A 1 36  ? 17.875  51.566 29.414 1.00 31.24  ? 16   SER A N   1 
ATOM   126  C CA  . SER A 1 36  ? 16.649  50.738 29.515 1.00 28.89  ? 16   SER A CA  1 
ATOM   127  C C   . SER A 1 36  ? 16.679  49.752 30.686 1.00 26.88  ? 16   SER A C   1 
ATOM   128  O O   . SER A 1 36  ? 15.685  49.610 31.403 1.00 31.42  ? 16   SER A O   1 
ATOM   129  C CB  . SER A 1 36  ? 16.384  49.953 28.223 1.00 31.79  ? 16   SER A CB  1 
ATOM   130  O OG  . SER A 1 36  ? 16.090  50.887 27.211 1.00 42.80  ? 16   SER A OG  1 
ATOM   131  N N   . ILE A 1 37  ? 17.840  49.137 30.884 1.00 28.70  ? 17   ILE A N   1 
ATOM   132  C CA  . ILE A 1 37  ? 17.992  48.189 31.993 1.00 30.97  ? 17   ILE A CA  1 
ATOM   133  C C   . ILE A 1 37  ? 17.870  48.940 33.327 1.00 30.10  ? 17   ILE A C   1 
ATOM   134  O O   . ILE A 1 37  ? 17.153  48.526 34.251 1.00 29.50  ? 17   ILE A O   1 
ATOM   135  C CB  . ILE A 1 37  ? 19.310  47.426 31.871 1.00 30.23  ? 17   ILE A CB  1 
ATOM   136  C CG1 . ILE A 1 37  ? 19.257  46.456 30.676 1.00 25.19  ? 17   ILE A CG1 1 
ATOM   137  C CG2 . ILE A 1 37  ? 19.554  46.626 33.169 1.00 29.21  ? 17   ILE A CG2 1 
ATOM   138  C CD1 . ILE A 1 37  ? 20.547  45.907 30.223 1.00 31.46  ? 17   ILE A CD1 1 
ATOM   139  N N   . ALA A 1 38  ? 18.533  50.095 33.419 1.00 29.80  ? 18   ALA A N   1 
ATOM   140  C CA  . ALA A 1 38  ? 18.408  50.951 34.591 1.00 34.68  ? 18   ALA A CA  1 
ATOM   141  C C   . ALA A 1 38  ? 16.955  51.354 34.895 1.00 32.93  ? 18   ALA A C   1 
ATOM   142  O O   . ALA A 1 38  ? 16.486  51.300 36.042 1.00 33.98  ? 18   ALA A O   1 
ATOM   143  C CB  . ALA A 1 38  ? 19.288  52.205 34.363 1.00 33.95  ? 18   ALA A CB  1 
ATOM   144  N N   . GLU A 1 39  ? 16.221  51.743 33.861 1.00 29.26  ? 19   GLU A N   1 
ATOM   145  C CA  . GLU A 1 39  ? 14.881  52.263 34.019 1.00 26.89  ? 19   GLU A CA  1 
ATOM   146  C C   . GLU A 1 39  ? 13.849  51.157 34.277 1.00 35.39  ? 19   GLU A C   1 
ATOM   147  O O   . GLU A 1 39  ? 12.913  51.368 35.062 1.00 36.83  ? 19   GLU A O   1 
ATOM   148  C CB  . GLU A 1 39  ? 14.463  53.105 32.801 1.00 32.16  ? 19   GLU A CB  1 
ATOM   149  C CG  . GLU A 1 39  ? 13.135  53.733 32.970 1.00 31.37  ? 19   GLU A CG  1 
ATOM   150  C CD  . GLU A 1 39  ? 12.744  54.697 31.858 1.00 53.97  ? 19   GLU A CD  1 
ATOM   151  O OE1 . GLU A 1 39  ? 13.528  54.914 30.882 1.00 42.92  ? 19   GLU A OE1 1 
ATOM   152  O OE2 . GLU A 1 39  ? 11.626  55.244 31.984 1.00 39.95  ? 19   GLU A OE2 1 
ATOM   153  N N   . PHE A 1 40  ? 14.007  50.005 33.607 1.00 31.87  ? 20   PHE A N   1 
ATOM   154  C CA  . PHE A 1 40  ? 12.918  49.011 33.585 1.00 33.51  ? 20   PHE A CA  1 
ATOM   155  C C   . PHE A 1 40  ? 13.234  47.629 34.198 1.00 32.09  ? 20   PHE A C   1 
ATOM   156  O O   . PHE A 1 40  ? 12.310  46.867 34.511 1.00 34.82  ? 20   PHE A O   1 
ATOM   157  C CB  . PHE A 1 40  ? 12.358  48.813 32.164 1.00 27.13  ? 20   PHE A CB  1 
ATOM   158  C CG  . PHE A 1 40  ? 11.697  50.074 31.564 1.00 31.10  ? 20   PHE A CG  1 
ATOM   159  C CD1 . PHE A 1 40  ? 10.529  50.594 32.106 1.00 34.52  ? 20   PHE A CD1 1 
ATOM   160  C CD2 . PHE A 1 40  ? 12.271  50.723 30.481 1.00 41.93  ? 20   PHE A CD2 1 
ATOM   161  C CE1 . PHE A 1 40  ? 9.933   51.738 31.563 1.00 37.17  ? 20   PHE A CE1 1 
ATOM   162  C CE2 . PHE A 1 40  ? 11.671  51.884 29.945 1.00 36.60  ? 20   PHE A CE2 1 
ATOM   163  C CZ  . PHE A 1 40  ? 10.503  52.372 30.494 1.00 41.23  ? 20   PHE A CZ  1 
ATOM   164  N N   . HIS A 1 41  ? 14.504  47.300 34.367 1.00 28.44  ? 21   HIS A N   1 
ATOM   165  C CA  . HIS A 1 41  ? 14.859  45.942 34.688 1.00 27.15  ? 21   HIS A CA  1 
ATOM   166  C C   . HIS A 1 41  ? 15.764  45.911 35.906 1.00 39.11  ? 21   HIS A C   1 
ATOM   167  O O   . HIS A 1 41  ? 16.603  45.025 36.029 1.00 40.92  ? 21   HIS A O   1 
ATOM   168  C CB  . HIS A 1 41  ? 15.562  45.288 33.505 1.00 29.46  ? 21   HIS A CB  1 
ATOM   169  C CG  . HIS A 1 41  ? 14.716  45.151 32.277 1.00 27.85  ? 21   HIS A CG  1 
ATOM   170  N ND1 . HIS A 1 41  ? 13.717  44.197 32.185 1.00 24.75  ? 21   HIS A ND1 1 
ATOM   171  C CD2 . HIS A 1 41  ? 14.744  45.798 31.083 1.00 27.41  ? 21   HIS A CD2 1 
ATOM   172  C CE1 . HIS A 1 41  ? 13.165  44.263 30.976 1.00 22.23  ? 21   HIS A CE1 1 
ATOM   173  N NE2 . HIS A 1 41  ? 13.757  45.240 30.302 1.00 21.97  ? 21   HIS A NE2 1 
ATOM   174  N N   . THR A 1 42  ? 15.625  46.922 36.762 1.00 33.88  ? 22   THR A N   1 
ATOM   175  C CA  . THR A 1 42  ? 16.439  47.040 37.974 1.00 44.16  ? 22   THR A CA  1 
ATOM   176  C C   . THR A 1 42  ? 15.465  47.031 39.124 1.00 39.78  ? 22   THR A C   1 
ATOM   177  O O   . THR A 1 42  ? 14.511  47.823 39.165 1.00 38.30  ? 22   THR A O   1 
ATOM   178  C CB  . THR A 1 42  ? 17.285  48.334 37.961 1.00 41.45  ? 22   THR A CB  1 
ATOM   179  O OG1 . THR A 1 42  ? 18.205  48.274 36.869 1.00 42.45  ? 22   THR A OG1 1 
ATOM   180  C CG2 . THR A 1 42  ? 18.061  48.483 39.285 1.00 37.56  ? 22   THR A CG2 1 
ATOM   181  N N   . TYR A 1 43  ? 15.650  46.093 40.054 1.00 42.36  ? 23   TYR A N   1 
ATOM   182  C CA  . TYR A 1 43  ? 14.636  45.878 41.059 1.00 43.53  ? 23   TYR A CA  1 
ATOM   183  C C   . TYR A 1 43  ? 15.183  46.199 42.433 1.00 41.53  ? 23   TYR A C   1 
ATOM   184  O O   . TYR A 1 43  ? 16.387  46.090 42.672 1.00 43.64  ? 23   TYR A O   1 
ATOM   185  C CB  . TYR A 1 43  ? 14.098  44.434 41.031 1.00 34.87  ? 23   TYR A CB  1 
ATOM   186  C CG  . TYR A 1 43  ? 13.413  44.036 39.752 1.00 42.23  ? 23   TYR A CG  1 
ATOM   187  C CD1 . TYR A 1 43  ? 12.039  44.090 39.639 1.00 42.80  ? 23   TYR A CD1 1 
ATOM   188  C CD2 . TYR A 1 43  ? 14.156  43.570 38.667 1.00 43.61  ? 23   TYR A CD2 1 
ATOM   189  C CE1 . TYR A 1 43  ? 11.401  43.717 38.475 1.00 80.03  ? 23   TYR A CE1 1 
ATOM   190  C CE2 . TYR A 1 43  ? 13.532  43.211 37.510 1.00 28.90  ? 23   TYR A CE2 1 
ATOM   191  C CZ  . TYR A 1 43  ? 12.162  43.294 37.404 1.00 35.35  ? 23   TYR A CZ  1 
ATOM   192  O OH  . TYR A 1 43  ? 11.516  42.893 36.259 1.00 35.81  ? 23   TYR A OH  1 
ATOM   193  N N   . GLN A 1 44  ? 14.279  46.603 43.311 1.00 49.87  ? 24   GLN A N   1 
ATOM   194  C CA  . GLN A 1 44  ? 14.601  46.806 44.720 1.00 50.66  ? 24   GLN A CA  1 
ATOM   195  C C   . GLN A 1 44  ? 14.327  45.507 45.370 1.00 54.84  ? 24   GLN A C   1 
ATOM   196  O O   . GLN A 1 44  ? 13.164  45.095 45.479 1.00 39.59  ? 24   GLN A O   1 
ATOM   197  C CB  . GLN A 1 44  ? 13.729  47.914 45.327 1.00 63.10  ? 24   GLN A CB  1 
ATOM   198  C CG  . GLN A 1 44  ? 14.183  49.281 44.880 1.00 83.27  ? 24   GLN A CG  1 
ATOM   199  C CD  . GLN A 1 44  ? 15.661  49.447 45.105 1.00 45.92  ? 24   GLN A CD  1 
ATOM   200  O OE1 . GLN A 1 44  ? 16.133  49.288 46.226 1.00 60.92  ? 24   GLN A OE1 1 
ATOM   201  N NE2 . GLN A 1 44  ? 16.405  49.763 44.042 1.00 47.77  ? 24   GLN A NE2 1 
ATOM   202  N N   . LEU A 1 45  ? 15.385  44.793 45.739 1.00 34.33  ? 25   LEU A N   1 
ATOM   203  C CA  . LEU A 1 45  ? 15.115  43.535 46.280 1.00 25.16  ? 25   LEU A CA  1 
ATOM   204  C C   . LEU A 1 45  ? 14.633  43.622 47.710 1.00 29.79  ? 25   LEU A C   1 
ATOM   205  O O   . LEU A 1 45  ? 15.202  44.328 48.515 1.00 32.21  ? 25   LEU A O   1 
ATOM   206  C CB  . LEU A 1 45  ? 16.309  42.573 46.167 1.00 28.77  ? 25   LEU A CB  1 
ATOM   207  C CG  . LEU A 1 45  ? 16.791  42.286 44.727 1.00 28.08  ? 25   LEU A CG  1 
ATOM   208  C CD1 . LEU A 1 45  ? 17.873  41.316 44.812 1.00 29.79  ? 25   LEU A CD1 1 
ATOM   209  C CD2 . LEU A 1 45  ? 15.709  41.682 43.881 1.00 28.76  ? 25   LEU A CD2 1 
ATOM   210  N N   . ASP A 1 46  ? 13.601  42.854 48.002 1.00 39.86  ? 26   ASP A N   1 
ATOM   211  C CA  . ASP A 1 46  ? 13.269  42.526 49.363 1.00 38.35  ? 26   ASP A CA  1 
ATOM   212  C C   . ASP A 1 46  ? 14.216  41.437 49.768 1.00 30.55  ? 26   ASP A C   1 
ATOM   213  O O   . ASP A 1 46  ? 14.563  40.559 48.969 1.00 36.57  ? 26   ASP A O   1 
ATOM   214  C CB  . ASP A 1 46  ? 11.851  41.956 49.459 1.00 47.15  ? 26   ASP A CB  1 
ATOM   215  C CG  . ASP A 1 46  ? 10.772  42.998 49.218 1.00 92.90  ? 26   ASP A CG  1 
ATOM   216  O OD1 . ASP A 1 46  ? 10.909  44.139 49.712 1.00 224.37 ? 26   ASP A OD1 1 
ATOM   217  O OD2 . ASP A 1 46  ? 9.775   42.668 48.535 1.00 99.98  ? 26   ASP A OD2 1 
ATOM   218  N N   . PRO A 1 47  ? 14.672  41.472 51.030 1.00 36.17  ? 27   PRO A N   1 
ATOM   219  C CA  . PRO A 1 47  ? 15.343  40.299 51.563 1.00 36.44  ? 27   PRO A CA  1 
ATOM   220  C C   . PRO A 1 47  ? 14.679  38.962 51.253 1.00 43.49  ? 27   PRO A C   1 
ATOM   221  O O   . PRO A 1 47  ? 13.466  38.783 51.441 1.00 46.97  ? 27   PRO A O   1 
ATOM   222  C CB  . PRO A 1 47  ? 15.358  40.579 53.063 1.00 39.98  ? 27   PRO A CB  1 
ATOM   223  C CG  . PRO A 1 47  ? 15.481  42.041 53.143 1.00 47.07  ? 27   PRO A CG  1 
ATOM   224  C CD  . PRO A 1 47  ? 14.624  42.573 52.013 1.00 56.18  ? 27   PRO A CD  1 
ATOM   225  N N   . GLY A 1 48  ? 15.496  38.047 50.767 1.00 25.83  ? 28   GLY A N   1 
ATOM   226  C CA  . GLY A 1 48  ? 15.190  36.706 50.386 1.00 28.45  ? 28   GLY A CA  1 
ATOM   227  C C   . GLY A 1 48  ? 14.439  36.717 49.042 1.00 46.64  ? 28   GLY A C   1 
ATOM   228  O O   . GLY A 1 48  ? 13.686  35.812 48.751 1.00 40.16  ? 28   GLY A O   1 
ATOM   229  N N   . SER A 1 49  ? 14.651  37.746 48.220 1.00 31.81  ? 29   SER A N   1 
ATOM   230  C CA  . SER A 1 49  ? 14.283  37.665 46.797 1.00 23.94  ? 29   SER A CA  1 
ATOM   231  C C   . SER A 1 49  ? 15.450  37.659 45.836 1.00 34.44  ? 29   SER A C   1 
ATOM   232  O O   . SER A 1 49  ? 16.588  37.859 46.262 1.00 25.21  ? 29   SER A O   1 
ATOM   233  C CB  . SER A 1 49  ? 13.309  38.749 46.378 1.00 29.12  ? 29   SER A CB  1 
ATOM   234  O OG  . SER A 1 49  ? 13.839  40.027 46.417 1.00 34.50  ? 29   SER A OG  1 
ATOM   235  N N   . CYS A 1 50  ? 15.169  37.335 44.583 1.00 25.72  ? 30   CYS A N   1 
ATOM   236  C CA  . CYS A 1 50  ? 16.237  37.338 43.570 1.00 22.48  ? 30   CYS A CA  1 
ATOM   237  C C   . CYS A 1 50  ? 15.696  37.848 42.242 1.00 29.45  ? 30   CYS A C   1 
ATOM   238  O O   . CYS A 1 50  ? 14.460  37.919 42.011 1.00 24.04  ? 30   CYS A O   1 
ATOM   239  C CB  . CYS A 1 50  ? 16.824  35.979 43.423 1.00 26.38  ? 30   CYS A CB  1 
ATOM   240  S SG  . CYS A 1 50  ? 15.602  34.830 42.721 1.00 35.59  ? 30   CYS A SG  1 
ATOM   241  N N   . SER A 1 51  ? 16.588  38.282 41.366 1.00 20.93  ? 31   SER A N   1 
ATOM   242  C CA  A SER A 1 51  ? 16.136  38.753 40.038 0.50 17.27  ? 31   SER A CA  1 
ATOM   243  C CA  B SER A 1 51  ? 16.175  38.856 40.070 0.50 19.78  ? 31   SER A CA  1 
ATOM   244  C C   . SER A 1 51  ? 17.044  38.284 38.960 1.00 26.58  ? 31   SER A C   1 
ATOM   245  O O   . SER A 1 51  ? 18.210  38.014 39.208 1.00 28.92  ? 31   SER A O   1 
ATOM   246  C CB  A SER A 1 51  ? 16.103  40.268 39.966 0.50 9.71   ? 31   SER A CB  1 
ATOM   247  C CB  B SER A 1 51  ? 16.324  40.375 40.131 0.50 57.02  ? 31   SER A CB  1 
ATOM   248  O OG  A SER A 1 51  ? 17.420  40.881 40.199 0.50 24.91  ? 31   SER A OG  1 
ATOM   249  O OG  B SER A 1 51  ? 15.957  40.994 38.909 0.50 28.90  ? 31   SER A OG  1 
ATOM   250  N N   . SER A 1 52  ? 16.517  38.215 37.737 1.00 19.29  ? 32   SER A N   1 
ATOM   251  C CA  A SER A 1 52  ? 17.314  37.758 36.610 0.50 23.67  ? 32   SER A CA  1 
ATOM   252  C CA  B SER A 1 52  ? 17.239  37.685 36.602 0.50 11.73  ? 32   SER A CA  1 
ATOM   253  C C   . SER A 1 52  ? 16.931  38.539 35.370 1.00 27.17  ? 32   SER A C   1 
ATOM   254  O O   . SER A 1 52  ? 15.768  38.988 35.234 1.00 22.40  ? 32   SER A O   1 
ATOM   255  C CB  A SER A 1 52  ? 17.122  36.249 36.380 0.50 16.12  ? 32   SER A CB  1 
ATOM   256  C CB  B SER A 1 52  ? 16.756  36.257 36.372 0.50 35.12  ? 32   SER A CB  1 
ATOM   257  O OG  A SER A 1 52  ? 17.450  35.442 37.533 0.50 28.07  ? 32   SER A OG  1 
ATOM   258  O OG  B SER A 1 52  ? 17.586  35.600 35.458 0.50 32.91  ? 32   SER A OG  1 
ATOM   259  N N   . LEU A 1 53  ? 17.910  38.713 34.444 1.00 20.68  ? 33   LEU A N   1 
ATOM   260  C CA  . LEU A 1 53  ? 17.684  39.453 33.235 1.00 19.00  ? 33   LEU A CA  1 
ATOM   261  C C   . LEU A 1 53  ? 18.104  38.606 32.053 1.00 29.77  ? 33   LEU A C   1 
ATOM   262  O O   . LEU A 1 53  ? 19.252  38.142 32.017 1.00 26.79  ? 33   LEU A O   1 
ATOM   263  C CB  . LEU A 1 53  ? 18.443  40.787 33.202 1.00 22.72  ? 33   LEU A CB  1 
ATOM   264  C CG  . LEU A 1 53  ? 18.432  41.532 31.869 1.00 26.71  ? 33   LEU A CG  1 
ATOM   265  C CD1 . LEU A 1 53  ? 17.037  42.020 31.651 1.00 23.42  ? 33   LEU A CD1 1 
ATOM   266  C CD2 . LEU A 1 53  ? 19.344  42.738 31.880 1.00 29.28  ? 33   LEU A CD2 1 
ATOM   267  N N   . HIS A 1 54  ? 17.190  38.400 31.094 1.00 21.22  ? 34   HIS A N   1 
ATOM   268  C CA  . HIS A 1 54  ? 17.483  37.636 29.855 1.00 20.10  ? 34   HIS A CA  1 
ATOM   269  C C   . HIS A 1 54  ? 17.351  38.520 28.622 1.00 25.45  ? 34   HIS A C   1 
ATOM   270  O O   . HIS A 1 54  ? 16.576  39.488 28.625 1.00 23.81  ? 34   HIS A O   1 
ATOM   271  C CB  . HIS A 1 54  ? 16.546  36.452 29.668 1.00 25.00  ? 34   HIS A CB  1 
ATOM   272  C CG  . HIS A 1 54  ? 16.622  35.432 30.768 1.00 30.27  ? 34   HIS A CG  1 
ATOM   273  N ND1 . HIS A 1 54  ? 17.388  34.287 30.693 1.00 37.96  ? 34   HIS A ND1 1 
ATOM   274  C CD2 . HIS A 1 54  ? 16.056  35.430 31.992 1.00 29.38  ? 34   HIS A CD2 1 
ATOM   275  C CE1 . HIS A 1 54  ? 17.241  33.592 31.808 1.00 37.34  ? 34   HIS A CE1 1 
ATOM   276  N NE2 . HIS A 1 54  ? 16.447  34.268 32.621 1.00 30.18  ? 34   HIS A NE2 1 
ATOM   277  N N   . ALA A 1 55  ? 18.118  38.217 27.566 1.00 26.53  ? 35   ALA A N   1 
ATOM   278  C CA  . ALA A 1 55  ? 18.056  39.000 26.334 1.00 23.43  ? 35   ALA A CA  1 
ATOM   279  C C   . ALA A 1 55  ? 17.966  38.026 25.131 1.00 23.19  ? 35   ALA A C   1 
ATOM   280  O O   . ALA A 1 55  ? 18.495  36.874 25.207 1.00 24.74  ? 35   ALA A O   1 
ATOM   281  C CB  . ALA A 1 55  ? 19.366  39.848 26.184 1.00 21.43  ? 35   ALA A CB  1 
ATOM   282  N N   . GLN A 1 56  ? 17.276  38.450 24.056 1.00 27.21  ? 36   GLN A N   1 
ATOM   283  C CA  . GLN A 1 56  ? 17.089  37.642 22.882 1.00 27.84  ? 36   GLN A CA  1 
ATOM   284  C C   . GLN A 1 56  ? 17.184  38.551 21.662 1.00 24.05  ? 36   GLN A C   1 
ATOM   285  O O   . GLN A 1 56  ? 16.458  39.513 21.568 1.00 24.64  ? 36   GLN A O   1 
ATOM   286  C CB  . GLN A 1 56  ? 15.740  36.940 22.883 1.00 25.26  ? 36   GLN A CB  1 
ATOM   287  C CG  . GLN A 1 56  ? 15.440  36.173 21.579 1.00 31.76  ? 36   GLN A CG  1 
ATOM   288  C CD  . GLN A 1 56  ? 16.325  34.953 21.422 1.00 43.34  ? 36   GLN A CD  1 
ATOM   289  O OE1 . GLN A 1 56  ? 16.403  34.100 22.324 1.00 32.21  ? 36   GLN A OE1 1 
ATOM   290  N NE2 . GLN A 1 56  ? 16.998  34.851 20.260 1.00 37.32  ? 36   GLN A NE2 1 
ATOM   291  N N   . ARG A 1 57  ? 18.142  38.278 20.775 1.00 27.01  ? 37   ARG A N   1 
ATOM   292  C CA  . ARG A 1 57  ? 18.178  39.021 19.503 1.00 27.17  ? 37   ARG A CA  1 
ATOM   293  C C   . ARG A 1 57  ? 17.161  38.408 18.560 1.00 27.06  ? 37   ARG A C   1 
ATOM   294  O O   . ARG A 1 57  ? 17.051  37.151 18.487 1.00 31.41  ? 37   ARG A O   1 
ATOM   295  C CB  . ARG A 1 57  ? 19.564  38.915 18.857 1.00 28.16  ? 37   ARG A CB  1 
ATOM   296  C CG  . ARG A 1 57  ? 19.787  40.005 17.810 1.00 33.74  ? 37   ARG A CG  1 
ATOM   297  C CD  . ARG A 1 57  ? 21.213  39.974 17.231 1.00 32.96  ? 37   ARG A CD  1 
ATOM   298  N NE  . ARG A 1 57  ? 22.252  40.270 18.218 1.00 30.57  ? 37   ARG A NE  1 
ATOM   299  C CZ  . ARG A 1 57  ? 23.071  39.379 18.751 1.00 28.03  ? 37   ARG A CZ  1 
ATOM   300  N NH1 . ARG A 1 57  ? 23.003  38.073 18.429 1.00 33.92  ? 37   ARG A NH1 1 
ATOM   301  N NH2 . ARG A 1 57  ? 23.958  39.793 19.652 1.00 38.70  ? 37   ARG A NH2 1 
ATOM   302  N N   . ILE A 1 58  ? 16.447  39.264 17.813 1.00 29.62  ? 38   ILE A N   1 
ATOM   303  C CA  . ILE A 1 58  ? 15.420  38.785 16.888 1.00 29.85  ? 38   ILE A CA  1 
ATOM   304  C C   . ILE A 1 58  ? 15.571  39.498 15.529 1.00 30.01  ? 38   ILE A C   1 
ATOM   305  O O   . ILE A 1 58  ? 15.564  40.704 15.476 1.00 33.36  ? 38   ILE A O   1 
ATOM   306  C CB  . ILE A 1 58  ? 14.016  39.009 17.423 1.00 31.58  ? 38   ILE A CB  1 
ATOM   307  C CG1 . ILE A 1 58  ? 13.857  38.313 18.804 1.00 29.81  ? 38   ILE A CG1 1 
ATOM   308  C CG2 . ILE A 1 58  ? 12.976  38.500 16.441 1.00 33.71  ? 38   ILE A CG2 1 
ATOM   309  C CD1 . ILE A 1 58  ? 12.451  38.363 19.395 1.00 27.83  ? 38   ILE A CD1 1 
ATOM   310  N N   . HIS A 1 59  ? 15.717  38.714 14.461 1.00 32.54  ? 39   HIS A N   1 
ATOM   311  C CA  . HIS A 1 59  ? 15.802  39.307 13.103 1.00 35.70  ? 39   HIS A CA  1 
ATOM   312  C C   . HIS A 1 59  ? 14.435  39.540 12.481 1.00 42.06  ? 39   HIS A C   1 
ATOM   313  O O   . HIS A 1 59  ? 13.967  38.807 11.595 1.00 41.98  ? 39   HIS A O   1 
ATOM   314  C CB  . HIS A 1 59  ? 16.781  38.493 12.239 1.00 40.71  ? 39   HIS A CB  1 
ATOM   315  C CG  . HIS A 1 59  ? 18.127  38.351 12.881 1.00 44.79  ? 39   HIS A CG  1 
ATOM   316  N ND1 . HIS A 1 59  ? 19.065  39.358 12.869 1.00 51.31  ? 39   HIS A ND1 1 
ATOM   317  C CD2 . HIS A 1 59  ? 18.661  37.347 13.619 1.00 41.12  ? 39   HIS A CD2 1 
ATOM   318  C CE1 . HIS A 1 59  ? 20.134  38.969 13.539 1.00 46.28  ? 39   HIS A CE1 1 
ATOM   319  N NE2 . HIS A 1 59  ? 19.918  37.750 14.000 1.00 52.16  ? 39   HIS A NE2 1 
ATOM   320  N N   . ALA A 1 60  ? 13.789  40.587 12.978 1.00 34.93  ? 40   ALA A N   1 
ATOM   321  C CA  . ALA A 1 60  ? 12.469  41.018 12.540 1.00 34.84  ? 40   ALA A CA  1 
ATOM   322  C C   . ALA A 1 60  ? 12.291  42.444 13.068 1.00 42.03  ? 40   ALA A C   1 
ATOM   323  O O   . ALA A 1 60  ? 13.063  42.880 13.965 1.00 37.32  ? 40   ALA A O   1 
ATOM   324  C CB  . ALA A 1 60  ? 11.404  40.067 13.085 1.00 35.55  ? 40   ALA A CB  1 
ATOM   325  N N   . PRO A 1 61  ? 11.317  43.194 12.500 1.00 51.79  ? 41   PRO A N   1 
ATOM   326  C CA  . PRO A 1 61  ? 11.105  44.591 12.882 1.00 49.85  ? 41   PRO A CA  1 
ATOM   327  C C   . PRO A 1 61  ? 10.574  44.652 14.305 1.00 35.40  ? 41   PRO A C   1 
ATOM   328  O O   . PRO A 1 61  ? 9.762   43.804 14.664 1.00 36.27  ? 41   PRO A O   1 
ATOM   329  C CB  . PRO A 1 61  ? 9.993   45.062 11.936 1.00 44.89  ? 41   PRO A CB  1 
ATOM   330  C CG  . PRO A 1 61  ? 9.916   44.041 10.841 1.00 53.13  ? 41   PRO A CG  1 
ATOM   331  C CD  . PRO A 1 61  ? 10.356  42.752 11.466 1.00 46.21  ? 41   PRO A CD  1 
ATOM   332  N N   . PRO A 1 62  ? 11.030  45.631 15.105 1.00 34.41  ? 42   PRO A N   1 
ATOM   333  C CA  . PRO A 1 62  ? 10.554  45.747 16.506 1.00 32.41  ? 42   PRO A CA  1 
ATOM   334  C C   . PRO A 1 62  ? 9.040   45.955 16.621 1.00 37.19  ? 42   PRO A C   1 
ATOM   335  O O   . PRO A 1 62  ? 8.420   45.502 17.584 1.00 32.89  ? 42   PRO A O   1 
ATOM   336  C CB  . PRO A 1 62  ? 11.344  46.948 17.031 1.00 30.46  ? 42   PRO A CB  1 
ATOM   337  C CG  . PRO A 1 62  ? 11.772  47.691 15.806 1.00 34.86  ? 42   PRO A CG  1 
ATOM   338  C CD  . PRO A 1 62  ? 12.039  46.654 14.793 1.00 33.88  ? 42   PRO A CD  1 
ATOM   339  N N   . GLU A 1 63  ? 8.422   46.583 15.622 1.00 39.57  ? 43   GLU A N   1 
ATOM   340  C CA  . GLU A 1 63  ? 6.959   46.759 15.622 1.00 38.51  ? 43   GLU A CA  1 
ATOM   341  C C   . GLU A 1 63  ? 6.269   45.400 15.592 1.00 34.97  ? 43   GLU A C   1 
ATOM   342  O O   . GLU A 1 63  ? 5.289   45.184 16.300 1.00 37.20  ? 43   GLU A O   1 
ATOM   343  C CB  . GLU A 1 63  ? 6.498   47.565 14.387 1.00 42.27  ? 43   GLU A CB  1 
ATOM   344  C CG  . GLU A 1 63  ? 7.123   48.949 14.259 1.00 68.23  ? 43   GLU A CG  1 
ATOM   345  C CD  . GLU A 1 63  ? 8.227   49.014 13.216 1.00 182.74 ? 43   GLU A CD  1 
ATOM   346  O OE1 . GLU A 1 63  ? 8.082   49.793 12.243 1.00 260.60 ? 43   GLU A OE1 1 
ATOM   347  O OE2 . GLU A 1 63  ? 9.238   48.293 13.362 1.00 40.60  ? 43   GLU A OE2 1 
ATOM   348  N N   . LEU A 1 64  ? 6.743   44.507 14.721 1.00 33.61  ? 44   LEU A N   1 
ATOM   349  C CA  . LEU A 1 64  ? 6.214   43.149 14.643 1.00 27.78  ? 44   LEU A CA  1 
ATOM   350  C C   . LEU A 1 64  ? 6.433   42.438 16.012 1.00 31.16  ? 44   LEU A C   1 
ATOM   351  O O   . LEU A 1 64  ? 5.521   41.864 16.583 1.00 35.79  ? 44   LEU A O   1 
ATOM   352  C CB  . LEU A 1 64  ? 6.934   42.381 13.558 1.00 35.05  ? 44   LEU A CB  1 
ATOM   353  C CG  . LEU A 1 64  ? 6.539   40.920 13.449 1.00 40.22  ? 44   LEU A CG  1 
ATOM   354  C CD1 . LEU A 1 64  ? 5.026   40.840 13.198 1.00 40.36  ? 44   LEU A CD1 1 
ATOM   355  C CD2 . LEU A 1 64  ? 7.318   40.265 12.319 1.00 60.21  ? 44   LEU A CD2 1 
ATOM   356  N N   . VAL A 1 65  ? 7.655   42.499 16.518 1.00 30.85  ? 45   VAL A N   1 
ATOM   357  C CA  . VAL A 1 65  ? 7.912   41.813 17.797 1.00 28.09  ? 45   VAL A CA  1 
ATOM   358  C C   . VAL A 1 65  ? 6.912   42.356 18.832 1.00 28.81  ? 45   VAL A C   1 
ATOM   359  O O   . VAL A 1 65  ? 6.267   41.591 19.535 1.00 30.22  ? 45   VAL A O   1 
ATOM   360  C CB  . VAL A 1 65  ? 9.406   41.956 18.217 1.00 27.03  ? 45   VAL A CB  1 
ATOM   361  C CG1 . VAL A 1 65  ? 9.688   41.270 19.598 1.00 27.28  ? 45   VAL A CG1 1 
ATOM   362  C CG2 . VAL A 1 65  ? 10.335  41.288 17.187 1.00 33.50  ? 45   VAL A CG2 1 
ATOM   363  N N   . TRP A 1 66  ? 6.818   43.670 18.955 1.00 29.58  ? 46   TRP A N   1 
ATOM   364  C CA  . TRP A 1 66  ? 5.998   44.298 19.990 1.00 27.05  ? 46   TRP A CA  1 
ATOM   365  C C   . TRP A 1 66  ? 4.548   43.926 19.858 1.00 30.08  ? 46   TRP A C   1 
ATOM   366  O O   . TRP A 1 66  ? 3.875   43.701 20.840 1.00 30.96  ? 46   TRP A O   1 
ATOM   367  C CB  . TRP A 1 66  ? 6.206   45.813 19.965 1.00 27.16  ? 46   TRP A CB  1 
ATOM   368  C CG  . TRP A 1 66  ? 5.292   46.577 20.867 1.00 29.26  ? 46   TRP A CG  1 
ATOM   369  C CD1 . TRP A 1 66  ? 4.322   47.466 20.485 1.00 36.01  ? 46   TRP A CD1 1 
ATOM   370  C CD2 . TRP A 1 66  ? 5.221   46.489 22.288 1.00 30.59  ? 46   TRP A CD2 1 
ATOM   371  N NE1 . TRP A 1 66  ? 3.672   47.978 21.587 1.00 31.42  ? 46   TRP A NE1 1 
ATOM   372  C CE2 . TRP A 1 66  ? 4.197   47.388 22.718 1.00 26.26  ? 46   TRP A CE2 1 
ATOM   373  C CE3 . TRP A 1 66  ? 5.937   45.761 23.259 1.00 36.31  ? 46   TRP A CE3 1 
ATOM   374  C CZ2 . TRP A 1 66  ? 3.842   47.544 24.053 1.00 32.38  ? 46   TRP A CZ2 1 
ATOM   375  C CZ3 . TRP A 1 66  ? 5.586   45.931 24.589 1.00 33.14  ? 46   TRP A CZ3 1 
ATOM   376  C CH2 . TRP A 1 66  ? 4.540   46.802 24.973 1.00 31.73  ? 46   TRP A CH2 1 
ATOM   377  N N   . SER A 1 67  ? 4.071   43.797 18.625 1.00 30.65  ? 47   SER A N   1 
ATOM   378  C CA  . SER A 1 67  ? 2.661   43.387 18.408 1.00 32.47  ? 47   SER A CA  1 
ATOM   379  C C   . SER A 1 67  ? 2.350   42.019 18.983 1.00 27.92  ? 47   SER A C   1 
ATOM   380  O O   . SER A 1 67  ? 1.243   41.799 19.445 1.00 34.21  ? 47   SER A O   1 
ATOM   381  C CB  . SER A 1 67  ? 2.292   43.434 16.909 1.00 36.64  ? 47   SER A CB  1 
ATOM   382  O OG  . SER A 1 67  ? 2.866   42.342 16.201 1.00 40.32  ? 47   SER A OG  1 
ATOM   383  N N   . ILE A 1 68  ? 3.361   41.154 19.061 1.00 33.23  ? 48   ILE A N   1 
ATOM   384  C CA  . ILE A 1 68  ? 3.222   39.865 19.762 1.00 28.23  ? 48   ILE A CA  1 
ATOM   385  C C   . ILE A 1 68  ? 3.298   39.998 21.292 1.00 31.82  ? 48   ILE A C   1 
ATOM   386  O O   . ILE A 1 68  ? 2.398   39.572 22.022 1.00 31.52  ? 48   ILE A O   1 
ATOM   387  C CB  . ILE A 1 68  ? 4.266   38.876 19.258 1.00 25.14  ? 48   ILE A CB  1 
ATOM   388  C CG1 . ILE A 1 68  ? 4.083   38.615 17.746 1.00 31.96  ? 48   ILE A CG1 1 
ATOM   389  C CG2 . ILE A 1 68  ? 4.168   37.557 20.059 1.00 33.11  ? 48   ILE A CG2 1 
ATOM   390  C CD1 . ILE A 1 68  ? 5.391   38.078 17.064 1.00 41.66  ? 48   ILE A CD1 1 
ATOM   391  N N   . VAL A 1 69  ? 4.391   40.593 21.760 1.00 29.57  ? 49   VAL A N   1 
ATOM   392  C CA  . VAL A 1 69  ? 4.704   40.761 23.179 1.00 34.62  ? 49   VAL A CA  1 
ATOM   393  C C   . VAL A 1 69  ? 3.590   41.488 23.960 1.00 28.75  ? 49   VAL A C   1 
ATOM   394  O O   . VAL A 1 69  ? 3.322   41.188 25.150 1.00 30.45  ? 49   VAL A O   1 
ATOM   395  C CB  . VAL A 1 69  ? 6.053   41.535 23.248 1.00 29.84  ? 49   VAL A CB  1 
ATOM   396  C CG1 . VAL A 1 69  ? 6.306   42.215 24.623 1.00 41.74  ? 49   VAL A CG1 1 
ATOM   397  C CG2 . VAL A 1 69  ? 7.187   40.582 22.829 1.00 36.28  ? 49   VAL A CG2 1 
ATOM   398  N N   . ARG A 1 70  ? 2.955   42.457 23.299 1.00 28.55  ? 50   ARG A N   1 
ATOM   399  C CA  . ARG A 1 70  ? 1.976   43.330 23.994 1.00 26.83  ? 50   ARG A CA  1 
ATOM   400  C C   . ARG A 1 70  ? 0.613   42.699 24.237 1.00 30.81  ? 50   ARG A C   1 
ATOM   401  O O   . ARG A 1 70  ? -0.208  43.269 24.960 1.00 34.05  ? 50   ARG A O   1 
ATOM   402  C CB  . ARG A 1 70  ? 1.743   44.626 23.179 1.00 27.54  ? 50   ARG A CB  1 
ATOM   403  C CG  . ARG A 1 70  ? 0.842   44.426 21.920 1.00 31.70  ? 50   ARG A CG  1 
ATOM   404  C CD  . ARG A 1 70  ? 0.790   45.752 21.091 1.00 34.92  ? 50   ARG A CD  1 
ATOM   405  N NE  . ARG A 1 70  ? 0.008   46.787 21.786 1.00 34.41  ? 50   ARG A NE  1 
ATOM   406  C CZ  . ARG A 1 70  ? -1.318  46.777 21.895 1.00 38.54  ? 50   ARG A CZ  1 
ATOM   407  N NH1 . ARG A 1 70  ? -2.028  45.791 21.354 1.00 35.41  ? 50   ARG A NH1 1 
ATOM   408  N NH2 . ARG A 1 70  ? -1.933  47.748 22.560 1.00 42.63  ? 50   ARG A NH2 1 
ATOM   409  N N   . ARG A 1 71  ? 0.342   41.576 23.563 1.00 29.85  ? 51   ARG A N   1 
ATOM   410  C CA  . ARG A 1 71  ? -0.973  40.936 23.677 1.00 32.23  ? 51   ARG A CA  1 
ATOM   411  C C   . ARG A 1 71  ? -1.090  40.144 24.950 1.00 26.50  ? 51   ARG A C   1 
ATOM   412  O O   . ARG A 1 71  ? -0.825  38.936 24.972 1.00 28.54  ? 51   ARG A O   1 
ATOM   413  C CB  . ARG A 1 71  ? -1.240  40.009 22.486 1.00 34.36  ? 51   ARG A CB  1 
ATOM   414  C CG  . ARG A 1 71  ? -1.415  40.700 21.129 1.00 44.22  ? 51   ARG A CG  1 
ATOM   415  C CD  . ARG A 1 71  ? -2.776  41.382 21.018 1.00 108.36 ? 51   ARG A CD  1 
ATOM   416  N NE  . ARG A 1 71  ? -3.883  40.456 21.257 1.00 81.51  ? 51   ARG A NE  1 
ATOM   417  C CZ  . ARG A 1 71  ? -4.533  39.791 20.305 1.00 152.97 ? 51   ARG A CZ  1 
ATOM   418  N NH1 . ARG A 1 71  ? -4.195  39.939 19.030 1.00 110.51 ? 51   ARG A NH1 1 
ATOM   419  N NH2 . ARG A 1 71  ? -5.529  38.975 20.628 1.00 64.78  ? 51   ARG A NH2 1 
ATOM   420  N N   . PHE A 1 72  ? -1.491  40.838 26.011 1.00 32.78  ? 52   PHE A N   1 
ATOM   421  C CA  . PHE A 1 72  ? -1.696  40.288 27.343 1.00 38.26  ? 52   PHE A CA  1 
ATOM   422  C C   . PHE A 1 72  ? -2.672  39.113 27.336 1.00 34.36  ? 52   PHE A C   1 
ATOM   423  O O   . PHE A 1 72  ? -2.558  38.200 28.127 1.00 28.76  ? 52   PHE A O   1 
ATOM   424  C CB  . PHE A 1 72  ? -2.195  41.399 28.275 1.00 32.55  ? 52   PHE A CB  1 
ATOM   425  C CG  . PHE A 1 72  ? -2.283  41.000 29.697 1.00 27.82  ? 52   PHE A CG  1 
ATOM   426  C CD1 . PHE A 1 72  ? -1.104  40.782 30.425 1.00 29.36  ? 52   PHE A CD1 1 
ATOM   427  C CD2 . PHE A 1 72  ? -3.515  40.831 30.347 1.00 27.22  ? 52   PHE A CD2 1 
ATOM   428  C CE1 . PHE A 1 72  ? -1.167  40.394 31.764 1.00 32.03  ? 52   PHE A CE1 1 
ATOM   429  C CE2 . PHE A 1 72  ? -3.567  40.441 31.692 1.00 32.17  ? 52   PHE A CE2 1 
ATOM   430  C CZ  . PHE A 1 72  ? -2.383  40.246 32.387 1.00 35.23  ? 52   PHE A CZ  1 
ATOM   431  N N   . ASP A 1 73  ? -3.651  39.144 26.440 1.00 32.75  ? 53   ASP A N   1 
ATOM   432  C CA  . ASP A 1 73  ? -4.614  38.016 26.348 1.00 34.04  ? 53   ASP A CA  1 
ATOM   433  C C   . ASP A 1 73  ? -4.125  36.764 25.587 1.00 32.70  ? 53   ASP A C   1 
ATOM   434  O O   . ASP A 1 73  ? -4.786  35.744 25.611 1.00 32.86  ? 53   ASP A O   1 
ATOM   435  C CB  . ASP A 1 73  ? -5.960  38.482 25.755 1.00 37.95  ? 53   ASP A CB  1 
ATOM   436  C CG  . ASP A 1 73  ? -5.808  39.167 24.404 1.00 43.91  ? 53   ASP A CG  1 
ATOM   437  O OD1 . ASP A 1 73  ? -4.892  40.004 24.250 1.00 55.57  ? 53   ASP A OD1 1 
ATOM   438  O OD2 . ASP A 1 73  ? -6.618  38.881 23.489 1.00 60.01  ? 53   ASP A OD2 1 
ATOM   439  N N   . LYS A 1 74  ? -2.975  36.833 24.924 1.00 29.02  ? 54   LYS A N   1 
ATOM   440  C CA  . LYS A 1 74  ? -2.485  35.700 24.129 1.00 28.71  ? 54   LYS A CA  1 
ATOM   441  C C   . LYS A 1 74  ? -1.005  35.364 24.408 1.00 26.24  ? 54   LYS A C   1 
ATOM   442  O O   . LYS A 1 74  ? -0.202  35.360 23.468 1.00 29.67  ? 54   LYS A O   1 
ATOM   443  C CB  . LYS A 1 74  ? -2.606  36.041 22.643 1.00 31.86  ? 54   LYS A CB  1 
ATOM   444  C CG  . LYS A 1 74  ? -4.046  36.243 22.153 1.00 53.20  ? 54   LYS A CG  1 
ATOM   445  C CD  . LYS A 1 74  ? -4.832  34.935 22.164 1.00 77.96  ? 54   LYS A CD  1 
ATOM   446  C CE  . LYS A 1 74  ? -6.275  35.145 21.727 1.00 90.13  ? 54   LYS A CE  1 
ATOM   447  N NZ  . LYS A 1 74  ? -7.111  33.948 22.018 1.00 92.88  ? 54   LYS A NZ  1 
ATOM   448  N N   . PRO A 1 75  ? -0.665  35.068 25.665 1.00 31.39  ? 55   PRO A N   1 
ATOM   449  C CA  . PRO A 1 75  ? 0.750   34.674 25.964 1.00 27.34  ? 55   PRO A CA  1 
ATOM   450  C C   . PRO A 1 75  ? 1.172   33.395 25.218 1.00 30.44  ? 55   PRO A C   1 
ATOM   451  O O   . PRO A 1 75  ? 2.356   33.258 24.891 1.00 34.87  ? 55   PRO A O   1 
ATOM   452  C CB  . PRO A 1 75  ? 0.738   34.475 27.498 1.00 28.21  ? 55   PRO A CB  1 
ATOM   453  C CG  . PRO A 1 75  ? -0.736  34.088 27.774 1.00 32.07  ? 55   PRO A CG  1 
ATOM   454  C CD  . PRO A 1 75  ? -1.520  34.991 26.859 1.00 35.84  ? 55   PRO A CD  1 
ATOM   455  N N   . GLN A 1 76  ? 0.222   32.515 24.907 1.00 31.46  ? 56   GLN A N   1 
ATOM   456  C CA  . GLN A 1 76  ? 0.545   31.243 24.286 1.00 34.94  ? 56   GLN A CA  1 
ATOM   457  C C   . GLN A 1 76  ? 1.132   31.383 22.891 1.00 35.31  ? 56   GLN A C   1 
ATOM   458  O O   . GLN A 1 76  ? 1.726   30.427 22.370 1.00 39.78  ? 56   GLN A O   1 
ATOM   459  C CB  . GLN A 1 76  ? -0.649  30.293 24.261 1.00 39.94  ? 56   GLN A CB  1 
ATOM   460  C CG  . GLN A 1 76  ? -1.844  30.810 23.451 1.00 36.35  ? 56   GLN A CG  1 
ATOM   461  C CD  . GLN A 1 76  ? -2.830  31.614 24.294 1.00 46.37  ? 56   GLN A CD  1 
ATOM   462  O OE1 . GLN A 1 76  ? -2.441  32.517 25.032 1.00 40.01  ? 56   GLN A OE1 1 
ATOM   463  N NE2 . GLN A 1 76  ? -4.114  31.285 24.185 1.00 47.77  ? 56   GLN A NE2 1 
ATOM   464  N N   . THR A 1 77  ? 1.023   32.575 22.311 1.00 29.50  ? 57   THR A N   1 
ATOM   465  C CA  . THR A 1 77  ? 1.589   32.807 20.980 1.00 30.32  ? 57   THR A CA  1 
ATOM   466  C C   . THR A 1 77  ? 3.117   32.686 21.054 1.00 35.01  ? 57   THR A C   1 
ATOM   467  O O   . THR A 1 77  ? 3.753   32.272 20.093 1.00 39.88  ? 57   THR A O   1 
ATOM   468  C CB  . THR A 1 77  ? 1.143   34.172 20.363 1.00 42.12  ? 57   THR A CB  1 
ATOM   469  O OG1 . THR A 1 77  ? -0.292  34.176 20.199 1.00 43.03  ? 57   THR A OG1 1 
ATOM   470  C CG2 . THR A 1 77  ? 1.801   34.430 18.976 1.00 40.31  ? 57   THR A CG2 1 
ATOM   471  N N   . TYR A 1 78  ? 3.713   33.037 22.193 1.00 31.13  ? 58   TYR A N   1 
ATOM   472  C CA  A TYR A 1 78  ? 5.175   32.881 22.255 0.50 58.11  ? 58   TYR A CA  1 
ATOM   473  C CA  B TYR A 1 78  ? 5.183   33.030 22.318 0.50 22.27  ? 58   TYR A CA  1 
ATOM   474  C C   . TYR A 1 78  ? 5.708   32.186 23.513 1.00 33.73  ? 58   TYR A C   1 
ATOM   475  O O   . TYR A 1 78  ? 6.896   31.951 23.647 1.00 41.54  ? 58   TYR A O   1 
ATOM   476  C CB  A TYR A 1 78  ? 5.883   34.211 21.984 0.50 34.80  ? 58   TYR A CB  1 
ATOM   477  C CB  B TYR A 1 78  ? 5.690   34.487 22.344 0.50 27.93  ? 58   TYR A CB  1 
ATOM   478  C CG  A TYR A 1 78  ? 5.956   35.086 23.199 0.50 37.12  ? 58   TYR A CG  1 
ATOM   479  C CG  B TYR A 1 78  ? 5.094   35.351 23.436 0.50 29.57  ? 58   TYR A CG  1 
ATOM   480  C CD1 A TYR A 1 78  ? 6.988   34.926 24.135 0.50 27.25  ? 58   TYR A CD1 1 
ATOM   481  C CD1 B TYR A 1 78  ? 5.834   35.702 24.555 0.50 33.93  ? 58   TYR A CD1 1 
ATOM   482  C CD2 A TYR A 1 78  ? 4.999   36.069 23.419 0.50 27.89  ? 58   TYR A CD2 1 
ATOM   483  C CD2 B TYR A 1 78  ? 3.783   35.816 23.351 0.50 29.49  ? 58   TYR A CD2 1 
ATOM   484  C CE1 A TYR A 1 78  ? 7.038   35.722 25.276 0.50 28.07  ? 58   TYR A CE1 1 
ATOM   485  C CE1 B TYR A 1 78  ? 5.293   36.500 25.551 0.50 22.80  ? 58   TYR A CE1 1 
ATOM   486  C CE2 A TYR A 1 78  ? 5.036   36.864 24.540 0.50 56.32  ? 58   TYR A CE2 1 
ATOM   487  C CE2 B TYR A 1 78  ? 3.228   36.592 24.335 0.50 36.32  ? 58   TYR A CE2 1 
ATOM   488  C CZ  A TYR A 1 78  ? 6.051   36.706 25.461 0.50 44.32  ? 58   TYR A CZ  1 
ATOM   489  C CZ  B TYR A 1 78  ? 3.975   36.931 25.452 0.50 22.12  ? 58   TYR A CZ  1 
ATOM   490  O OH  A TYR A 1 78  ? 6.046   37.527 26.569 0.50 42.88  ? 58   TYR A OH  1 
ATOM   491  O OH  B TYR A 1 78  ? 3.425   37.715 26.442 0.50 31.73  ? 58   TYR A OH  1 
ATOM   492  N N   . LYS A 1 79  ? 4.816   31.749 24.390 1.00 26.85  ? 59   LYS A N   1 
ATOM   493  C CA  . LYS A 1 79  ? 5.227   31.065 25.583 1.00 27.34  ? 59   LYS A CA  1 
ATOM   494  C C   . LYS A 1 79  ? 4.882   29.593 25.557 1.00 34.88  ? 59   LYS A C   1 
ATOM   495  O O   . LYS A 1 79  ? 3.877   29.195 24.966 1.00 33.69  ? 59   LYS A O   1 
ATOM   496  C CB  . LYS A 1 79  ? 4.531   31.680 26.797 1.00 29.47  ? 59   LYS A CB  1 
ATOM   497  C CG  . LYS A 1 79  ? 4.951   33.089 27.026 1.00 25.93  ? 59   LYS A CG  1 
ATOM   498  C CD  . LYS A 1 79  ? 4.520   33.425 28.444 1.00 36.50  ? 59   LYS A CD  1 
ATOM   499  C CE  . LYS A 1 79  ? 4.622   34.889 28.676 1.00 36.87  ? 59   LYS A CE  1 
ATOM   500  N NZ  . LYS A 1 79  ? 4.341   35.206 30.124 1.00 36.60  ? 59   LYS A NZ  1 
ATOM   501  N N   . HIS A 1 80  ? 5.693   28.800 26.253 1.00 31.53  ? 60   HIS A N   1 
ATOM   502  C CA  . HIS A 1 80  ? 5.483   27.357 26.323 1.00 31.86  ? 60   HIS A CA  1 
ATOM   503  C C   . HIS A 1 80  ? 4.607   26.929 27.506 1.00 29.04  ? 60   HIS A C   1 
ATOM   504  O O   . HIS A 1 80  ? 4.543   27.629 28.518 1.00 32.31  ? 60   HIS A O   1 
ATOM   505  C CB  . HIS A 1 80  ? 6.838   26.642 26.412 1.00 31.29  ? 60   HIS A CB  1 
ATOM   506  C CG  . HIS A 1 80  ? 7.596   26.671 25.128 1.00 29.73  ? 60   HIS A CG  1 
ATOM   507  N ND1 . HIS A 1 80  ? 8.678   27.498 24.904 1.00 38.22  ? 60   HIS A ND1 1 
ATOM   508  C CD2 . HIS A 1 80  ? 7.399   25.984 23.976 1.00 29.31  ? 60   HIS A CD2 1 
ATOM   509  C CE1 . HIS A 1 80  ? 9.136   27.283 23.681 1.00 25.52  ? 60   HIS A CE1 1 
ATOM   510  N NE2 . HIS A 1 80  ? 8.357   26.402 23.087 1.00 36.91  ? 60   HIS A NE2 1 
ATOM   511  N N   . PHE A 1 81  ? 3.952   25.775 27.321 1.00 30.21  ? 61   PHE A N   1 
ATOM   512  C CA  . PHE A 1 81  ? 3.227   25.044 28.399 1.00 29.91  ? 61   PHE A CA  1 
ATOM   513  C C   . PHE A 1 81  ? 1.881   25.648 28.786 1.00 35.09  ? 61   PHE A C   1 
ATOM   514  O O   . PHE A 1 81  ? 1.316   25.295 29.834 1.00 37.60  ? 61   PHE A O   1 
ATOM   515  C CB  . PHE A 1 81  ? 4.053   24.889 29.652 1.00 29.80  ? 61   PHE A CB  1 
ATOM   516  C CG  . PHE A 1 81  ? 5.286   24.028 29.465 1.00 37.18  ? 61   PHE A CG  1 
ATOM   517  C CD1 . PHE A 1 81  ? 5.160   22.647 29.309 1.00 41.50  ? 61   PHE A CD1 1 
ATOM   518  C CD2 . PHE A 1 81  ? 6.554   24.603 29.466 1.00 35.07  ? 61   PHE A CD2 1 
ATOM   519  C CE1 . PHE A 1 81  ? 6.276   21.835 29.147 1.00 46.98  ? 61   PHE A CE1 1 
ATOM   520  C CE2 . PHE A 1 81  ? 7.698   23.805 29.285 1.00 32.01  ? 61   PHE A CE2 1 
ATOM   521  C CZ  . PHE A 1 81  ? 7.534   22.396 29.142 1.00 31.77  ? 61   PHE A CZ  1 
ATOM   522  N N   . ILE A 1 82  ? 1.364   26.517 27.929 1.00 35.52  ? 62   ILE A N   1 
ATOM   523  C CA  . ILE A 1 82  ? 0.108   27.191 28.213 1.00 32.66  ? 62   ILE A CA  1 
ATOM   524  C C   . ILE A 1 82  ? -1.008  26.374 27.589 1.00 38.09  ? 62   ILE A C   1 
ATOM   525  O O   . ILE A 1 82  ? -1.003  26.095 26.384 1.00 38.01  ? 62   ILE A O   1 
ATOM   526  C CB  . ILE A 1 82  ? 0.129   28.672 27.780 1.00 33.16  ? 62   ILE A CB  1 
ATOM   527  C CG1 . ILE A 1 82  ? 1.113   29.436 28.678 1.00 33.46  ? 62   ILE A CG1 1 
ATOM   528  C CG2 . ILE A 1 82  ? -1.287  29.295 27.925 1.00 37.96  ? 62   ILE A CG2 1 
ATOM   529  C CD1 . ILE A 1 82  ? 1.230   30.936 28.388 1.00 38.58  ? 62   ILE A CD1 1 
ATOM   530  N N   . LYS A 1 83  ? -1.916  25.928 28.443 1.00 32.37  ? 63   LYS A N   1 
ATOM   531  C CA  . LYS A 1 83  ? -3.096  25.194 28.010 1.00 38.52  ? 63   LYS A CA  1 
ATOM   532  C C   . LYS A 1 83  ? -4.135  26.172 27.490 1.00 47.93  ? 63   LYS A C   1 
ATOM   533  O O   . LYS A 1 83  ? -4.712  25.971 26.411 1.00 41.90  ? 63   LYS A O   1 
ATOM   534  C CB  . LYS A 1 83  ? -3.682  24.365 29.168 1.00 32.85  ? 63   LYS A CB  1 
ATOM   535  C CG  . LYS A 1 83  ? -4.942  23.583 28.746 1.00 47.22  ? 63   LYS A CG  1 
ATOM   536  C CD  . LYS A 1 83  ? -5.457  22.760 29.890 1.00 42.76  ? 63   LYS A CD  1 
ATOM   537  C CE  . LYS A 1 83  ? -6.817  22.183 29.576 1.00 107.43 ? 63   LYS A CE  1 
ATOM   538  N NZ  . LYS A 1 83  ? -7.209  21.222 30.638 1.00 50.62  ? 63   LYS A NZ  1 
ATOM   539  N N   . SER A 1 84  ? -4.377  27.233 28.262 1.00 41.69  ? 64   SER A N   1 
ATOM   540  C CA  . SER A 1 84  ? -5.297  28.279 27.842 1.00 39.49  ? 64   SER A CA  1 
ATOM   541  C C   . SER A 1 84  ? -5.040  29.568 28.600 1.00 35.35  ? 64   SER A C   1 
ATOM   542  O O   . SER A 1 84  ? -4.402  29.564 29.650 1.00 35.53  ? 64   SER A O   1 
ATOM   543  C CB  . SER A 1 84  ? -6.751  27.835 28.062 1.00 40.90  ? 64   SER A CB  1 
ATOM   544  O OG  . SER A 1 84  ? -6.974  27.572 29.428 1.00 42.12  ? 64   SER A OG  1 
ATOM   545  N N   . CYS A 1 85  ? -5.514  30.667 28.044 1.00 34.12  ? 65   CYS A N   1 
ATOM   546  C CA  . CYS A 1 85  ? -5.494  31.960 28.720 1.00 30.68  ? 65   CYS A CA  1 
ATOM   547  C C   . CYS A 1 85  ? -6.880  32.567 28.520 1.00 39.43  ? 65   CYS A C   1 
ATOM   548  O O   . CYS A 1 85  ? -7.348  32.702 27.380 1.00 43.88  ? 65   CYS A O   1 
ATOM   549  C CB  . CYS A 1 85  ? -4.441  32.869 28.099 1.00 35.63  ? 65   CYS A CB  1 
ATOM   550  S SG  . CYS A 1 85  ? -4.328  34.442 28.949 1.00 37.33  ? 65   CYS A SG  1 
ATOM   551  N N   . SER A 1 86  ? -7.508  32.925 29.625 1.00 34.54  ? 66   SER A N   1 
ATOM   552  C CA  . SER A 1 86  ? -8.846  33.491 29.583 1.00 40.62  ? 66   SER A CA  1 
ATOM   553  C C   . SER A 1 86  ? -8.845  34.876 30.203 1.00 50.39  ? 66   SER A C   1 
ATOM   554  O O   . SER A 1 86  ? -8.153  35.151 31.188 1.00 35.57  ? 66   SER A O   1 
ATOM   555  C CB  . SER A 1 86  ? -9.838  32.546 30.263 1.00 46.19  ? 66   SER A CB  1 
ATOM   556  O OG  . SER A 1 86  ? -9.795  32.666 31.664 1.00 52.79  ? 66   SER A OG  1 
ATOM   557  N N   . VAL A 1 87  ? -9.587  35.779 29.585 1.00 32.74  ? 67   VAL A N   1 
ATOM   558  C CA  . VAL A 1 87  ? -9.693  37.114 30.093 1.00 30.61  ? 67   VAL A CA  1 
ATOM   559  C C   . VAL A 1 87  ? -11.207 37.419 30.174 1.00 33.85  ? 67   VAL A C   1 
ATOM   560  O O   . VAL A 1 87  ? -12.039 36.602 29.763 1.00 40.56  ? 67   VAL A O   1 
ATOM   561  C CB  . VAL A 1 87  ? -8.932  38.141 29.226 1.00 38.72  ? 67   VAL A CB  1 
ATOM   562  C CG1 . VAL A 1 87  ? -7.379  37.934 29.348 1.00 34.90  ? 67   VAL A CG1 1 
ATOM   563  C CG2 . VAL A 1 87  ? -9.366  38.080 27.752 1.00 43.29  ? 67   VAL A CG2 1 
ATOM   564  N N   . GLU A 1 88  ? -11.511 38.580 30.702 1.00 38.72  ? 68   GLU A N   1 
ATOM   565  C CA  . GLU A 1 88  ? -12.904 38.953 30.839 1.00 83.19  ? 68   GLU A CA  1 
ATOM   566  C C   . GLU A 1 88  ? -13.608 39.064 29.487 1.00 46.01  ? 68   GLU A C   1 
ATOM   567  O O   . GLU A 1 88  ? -12.991 39.368 28.444 1.00 51.81  ? 68   GLU A O   1 
ATOM   568  C CB  . GLU A 1 88  ? -13.051 40.213 31.664 1.00 42.73  ? 68   GLU A CB  1 
ATOM   569  C CG  . GLU A 1 88  ? -12.567 41.489 31.004 1.00 75.80  ? 68   GLU A CG  1 
ATOM   570  C CD  . GLU A 1 88  ? -13.033 42.717 31.765 1.00 203.31 ? 68   GLU A CD  1 
ATOM   571  O OE1 . GLU A 1 88  ? -13.169 42.633 33.006 1.00 94.75  ? 68   GLU A OE1 1 
ATOM   572  O OE2 . GLU A 1 88  ? -13.268 43.763 31.125 1.00 97.14  ? 68   GLU A OE2 1 
ATOM   573  N N   . GLN A 1 89  ? -14.914 38.792 29.534 1.00 59.64  ? 69   GLN A N   1 
ATOM   574  C CA  . GLN A 1 89  ? -15.789 38.668 28.369 1.00 59.85  ? 69   GLN A CA  1 
ATOM   575  C C   . GLN A 1 89  ? -15.529 39.702 27.281 1.00 47.42  ? 69   GLN A C   1 
ATOM   576  O O   . GLN A 1 89  ? -15.269 39.338 26.129 1.00 108.27 ? 69   GLN A O   1 
ATOM   577  C CB  . GLN A 1 89  ? -17.273 38.675 28.806 1.00 63.99  ? 69   GLN A CB  1 
ATOM   578  C CG  . GLN A 1 89  ? -17.759 37.395 29.517 1.00 99.35  ? 69   GLN A CG  1 
ATOM   579  C CD  . GLN A 1 89  ? -17.070 37.120 30.860 1.00 203.99 ? 69   GLN A CD  1 
ATOM   580  O OE1 . GLN A 1 89  ? -16.431 37.993 31.443 1.00 58.99  ? 69   GLN A OE1 1 
ATOM   581  N NE2 . GLN A 1 89  ? -17.202 35.896 31.349 1.00 73.81  ? 69   GLN A NE2 1 
ATOM   582  N N   A ASN A 1 90  ? -15.521 40.971 27.698 0.50 38.26  ? 70   ASN A N   1 
ATOM   583  N N   B ASN A 1 90  ? -15.655 40.987 27.581 0.50 80.97  ? 70   ASN A N   1 
ATOM   584  C CA  A ASN A 1 90  ? -15.417 42.112 26.786 0.50 100.91 ? 70   ASN A CA  1 
ATOM   585  C CA  B ASN A 1 90  ? -15.335 41.969 26.547 0.50 83.58  ? 70   ASN A CA  1 
ATOM   586  C C   A ASN A 1 90  ? -14.026 42.752 26.781 0.50 86.72  ? 70   ASN A C   1 
ATOM   587  C C   B ASN A 1 90  ? -14.073 42.742 26.907 0.50 118.76 ? 70   ASN A C   1 
ATOM   588  O O   A ASN A 1 90  ? -13.876 43.930 26.446 0.50 51.24  ? 70   ASN A O   1 
ATOM   589  O O   B ASN A 1 90  ? -14.058 43.973 26.985 0.50 148.89 ? 70   ASN A O   1 
ATOM   590  C CB  A ASN A 1 90  ? -16.462 43.164 27.173 0.50 147.94 ? 70   ASN A CB  1 
ATOM   591  C CB  B ASN A 1 90  ? -16.545 42.833 26.160 0.50 118.27 ? 70   ASN A CB  1 
ATOM   592  C CG  A ASN A 1 90  ? -16.266 43.689 28.592 0.50 138.15 ? 70   ASN A CG  1 
ATOM   593  C CG  B ASN A 1 90  ? -17.525 42.087 25.246 0.50 62.19  ? 70   ASN A CG  1 
ATOM   594  O OD1 A ASN A 1 90  ? -15.534 43.098 29.396 0.50 63.44  ? 70   ASN A OD1 1 
ATOM   595  O OD1 B ASN A 1 90  ? -17.233 41.818 24.074 0.50 41.07  ? 70   ASN A OD1 1 
ATOM   596  N ND2 A ASN A 1 90  ? -16.934 44.807 28.925 0.50 138.60 ? 70   ASN A ND2 1 
ATOM   597  N ND2 B ASN A 1 90  ? -18.687 41.746 25.786 0.50 54.30  ? 70   ASN A ND2 1 
ATOM   598  N N   . PHE A 1 91  ? -13.024 41.954 27.144 1.00 126.22 ? 71   PHE A N   1 
ATOM   599  C CA  . PHE A 1 91  ? -11.650 42.410 27.393 1.00 55.90  ? 71   PHE A CA  1 
ATOM   600  C C   . PHE A 1 91  ? -11.178 43.727 26.765 1.00 51.01  ? 71   PHE A C   1 
ATOM   601  O O   . PHE A 1 91  ? -11.028 43.839 25.543 1.00 59.22  ? 71   PHE A O   1 
ATOM   602  C CB  . PHE A 1 91  ? -10.690 41.270 27.013 1.00 71.87  ? 71   PHE A CB  1 
ATOM   603  C CG  . PHE A 1 91  ? -9.235  41.576 27.250 1.00 53.83  ? 71   PHE A CG  1 
ATOM   604  C CD1 . PHE A 1 91  ? -8.732  41.691 28.540 1.00 46.58  ? 71   PHE A CD1 1 
ATOM   605  C CD2 . PHE A 1 91  ? -8.362  41.713 26.174 1.00 41.06  ? 71   PHE A CD2 1 
ATOM   606  C CE1 . PHE A 1 91  ? -7.376  41.955 28.755 1.00 42.07  ? 71   PHE A CE1 1 
ATOM   607  C CE2 . PHE A 1 91  ? -7.003  41.979 26.382 1.00 46.14  ? 71   PHE A CE2 1 
ATOM   608  C CZ  . PHE A 1 91  ? -6.525  42.115 27.676 1.00 37.96  ? 71   PHE A CZ  1 
ATOM   609  N N   . GLU A 1 92  ? -10.929 44.703 27.638 1.00 54.70  ? 72   GLU A N   1 
ATOM   610  C CA  . GLU A 1 92  ? -10.163 45.892 27.281 1.00 61.49  ? 72   GLU A CA  1 
ATOM   611  C C   . GLU A 1 92  ? -8.803  45.847 27.973 1.00 50.54  ? 72   GLU A C   1 
ATOM   612  O O   . GLU A 1 92  ? -8.693  45.831 29.223 1.00 44.42  ? 72   GLU A O   1 
ATOM   613  C CB  . GLU A 1 92  ? -10.909 47.183 27.634 1.00 66.53  ? 72   GLU A CB  1 
ATOM   614  C CG  . GLU A 1 92  ? -10.249 48.463 27.105 1.00 110.64 ? 72   GLU A CG  1 
ATOM   615  C CD  . GLU A 1 92  ? -10.241 48.556 25.585 1.00 211.15 ? 72   GLU A CD  1 
ATOM   616  O OE1 . GLU A 1 92  ? -9.154  48.781 25.011 1.00 123.39 ? 72   GLU A OE1 1 
ATOM   617  O OE2 . GLU A 1 92  ? -11.317 48.404 24.965 1.00 228.39 ? 72   GLU A OE2 1 
ATOM   618  N N   . MET A 1 93  ? -7.759  45.820 27.156 1.00 54.22  ? 73   MET A N   1 
ATOM   619  C CA  . MET A 1 93  ? -6.407  45.763 27.696 1.00 46.54  ? 73   MET A CA  1 
ATOM   620  C C   . MET A 1 93  ? -5.973  47.077 28.305 1.00 34.79  ? 73   MET A C   1 
ATOM   621  O O   . MET A 1 93  ? -5.724  48.056 27.590 1.00 55.32  ? 73   MET A O   1 
ATOM   622  C CB  . MET A 1 93  ? -5.407  45.331 26.633 1.00 42.44  ? 73   MET A CB  1 
ATOM   623  C CG  . MET A 1 93  ? -4.046  45.083 27.233 1.00 51.16  ? 73   MET A CG  1 
ATOM   624  S SD  . MET A 1 93  ? -2.944  44.239 26.109 1.00 45.52  ? 73   MET A SD  1 
ATOM   625  C CE  . MET A 1 93  ? -2.744  45.447 24.797 1.00 47.75  ? 73   MET A CE  1 
ATOM   626  N N   . ARG A 1 94  ? -5.857  47.089 29.628 1.00 39.61  ? 74   ARG A N   1 
ATOM   627  C CA  . ARG A 1 94  ? -5.362  48.255 30.328 1.00 39.56  ? 74   ARG A CA  1 
ATOM   628  C C   . ARG A 1 94  ? -4.657  47.817 31.596 1.00 33.00  ? 74   ARG A C   1 
ATOM   629  O O   . ARG A 1 94  ? -4.994  46.761 32.146 1.00 36.20  ? 74   ARG A O   1 
ATOM   630  C CB  . ARG A 1 94  ? -6.520  49.219 30.668 1.00 46.73  ? 74   ARG A CB  1 
ATOM   631  C CG  . ARG A 1 94  ? -7.561  48.648 31.632 1.00 59.64  ? 74   ARG A CG  1 
ATOM   632  C CD  . ARG A 1 94  ? -8.595  49.694 32.024 1.00 79.15  ? 74   ARG A CD  1 
ATOM   633  N NE  . ARG A 1 94  ? -9.907  49.092 32.255 1.00 154.20 ? 74   ARG A NE  1 
ATOM   634  C CZ  . ARG A 1 94  ? -10.889 49.056 31.356 1.00 198.53 ? 74   ARG A CZ  1 
ATOM   635  N NH1 . ARG A 1 94  ? -10.721 49.594 30.153 1.00 91.14  ? 74   ARG A NH1 1 
ATOM   636  N NH2 . ARG A 1 94  ? -12.047 48.482 31.663 1.00 98.23  ? 74   ARG A NH2 1 
ATOM   637  N N   . VAL A 1 95  ? -3.704  48.629 32.076 1.00 36.61  ? 75   VAL A N   1 
ATOM   638  C CA  . VAL A 1 95  ? -3.104  48.386 33.382 1.00 34.98  ? 75   VAL A CA  1 
ATOM   639  C C   . VAL A 1 95  ? -4.154  48.065 34.427 1.00 51.14  ? 75   VAL A C   1 
ATOM   640  O O   . VAL A 1 95  ? -5.168  48.774 34.562 1.00 42.13  ? 75   VAL A O   1 
ATOM   641  C CB  . VAL A 1 95  ? -2.201  49.559 33.837 1.00 36.99  ? 75   VAL A CB  1 
ATOM   642  C CG1 . VAL A 1 95  ? -1.718  49.369 35.263 1.00 37.81  ? 75   VAL A CG1 1 
ATOM   643  C CG2 . VAL A 1 95  ? -1.046  49.722 32.877 1.00 38.22  ? 75   VAL A CG2 1 
ATOM   644  N N   . GLY A 1 96  ? -3.912  46.995 35.170 1.00 34.58  ? 76   GLY A N   1 
ATOM   645  C CA  . GLY A 1 96  ? -4.874  46.509 36.168 1.00 36.08  ? 76   GLY A CA  1 
ATOM   646  C C   . GLY A 1 96  ? -5.782  45.382 35.736 1.00 31.08  ? 76   GLY A C   1 
ATOM   647  O O   . GLY A 1 96  ? -6.381  44.711 36.582 1.00 33.45  ? 76   GLY A O   1 
ATOM   648  N N   . CYS A 1 97  ? -5.878  45.130 34.439 1.00 30.28  ? 77   CYS A N   1 
ATOM   649  C CA  . CYS A 1 97  ? -6.672  44.013 33.991 1.00 30.06  ? 77   CYS A CA  1 
ATOM   650  C C   . CYS A 1 97  ? -5.968  42.701 34.349 1.00 47.27  ? 77   CYS A C   1 
ATOM   651  O O   . CYS A 1 97  ? -4.764  42.688 34.632 1.00 33.08  ? 77   CYS A O   1 
ATOM   652  C CB  . CYS A 1 97  ? -6.968  44.108 32.502 1.00 38.00  ? 77   CYS A CB  1 
ATOM   653  S SG  . CYS A 1 97  ? -5.564  43.750 31.441 1.00 44.24  ? 77   CYS A SG  1 
ATOM   654  N N   . THR A 1 98  ? -6.730  41.623 34.414 1.00 36.12  ? 78   THR A N   1 
ATOM   655  C CA  . THR A 1 98  ? -6.165  40.323 34.802 1.00 27.18  ? 78   THR A CA  1 
ATOM   656  C C   . THR A 1 98  ? -6.419  39.258 33.739 1.00 41.69  ? 78   THR A C   1 
ATOM   657  O O   . THR A 1 98  ? -7.268  39.405 32.836 1.00 34.64  ? 78   THR A O   1 
ATOM   658  C CB  . THR A 1 98  ? -6.696  39.806 36.161 1.00 35.08  ? 78   THR A CB  1 
ATOM   659  O OG1 . THR A 1 98  ? -8.112  39.656 36.069 1.00 47.99  ? 78   THR A OG1 1 
ATOM   660  C CG2 . THR A 1 98  ? -6.366  40.758 37.306 1.00 38.66  ? 78   THR A CG2 1 
ATOM   661  N N   . ARG A 1 99  ? -5.671  38.171 33.835 1.00 30.75  ? 79   ARG A N   1 
ATOM   662  C CA  . ARG A 1 99  ? -5.900  37.012 32.975 1.00 23.46  ? 79   ARG A CA  1 
ATOM   663  C C   . ARG A 1 99  ? -5.647  35.789 33.839 1.00 28.62  ? 79   ARG A C   1 
ATOM   664  O O   . ARG A 1 99  ? -4.912  35.842 34.837 1.00 30.31  ? 79   ARG A O   1 
ATOM   665  C CB  . ARG A 1 99  ? -4.909  37.000 31.802 1.00 30.20  ? 79   ARG A CB  1 
ATOM   666  C CG  . ARG A 1 99  ? -3.428  36.824 32.304 1.00 29.62  ? 79   ARG A CG  1 
ATOM   667  C CD  . ARG A 1 99  ? -2.467  36.910 31.107 1.00 31.47  ? 79   ARG A CD  1 
ATOM   668  N NE  . ARG A 1 99  ? -1.051  36.874 31.530 1.00 25.72  ? 79   ARG A NE  1 
ATOM   669  C CZ  . ARG A 1 99  ? -0.023  37.218 30.747 1.00 28.67  ? 79   ARG A CZ  1 
ATOM   670  N NH1 . ARG A 1 99  ? -0.232  37.688 29.515 1.00 28.13  ? 79   ARG A NH1 1 
ATOM   671  N NH2 . ARG A 1 99  ? 1.261   37.097 31.216 1.00 27.29  ? 79   ARG A NH2 1 
ATOM   672  N N   . ASP A 1 100 ? -6.253  34.682 33.443 1.00 31.40  ? 80   ASP A N   1 
ATOM   673  C CA  . ASP A 1 100 ? -6.056  33.395 34.085 1.00 27.07  ? 80   ASP A CA  1 
ATOM   674  C C   . ASP A 1 100 ? -5.341  32.529 33.075 1.00 36.12  ? 80   ASP A C   1 
ATOM   675  O O   . ASP A 1 100 ? -5.825  32.282 31.978 1.00 34.60  ? 80   ASP A O   1 
ATOM   676  C CB  . ASP A 1 100 ? -7.390  32.766 34.460 1.00 38.16  ? 80   ASP A CB  1 
ATOM   677  C CG  . ASP A 1 100 ? -7.781  33.047 35.918 1.00 37.92  ? 80   ASP A CG  1 
ATOM   678  O OD1 . ASP A 1 100 ? -7.365  34.077 36.498 1.00 33.17  ? 80   ASP A OD1 1 
ATOM   679  O OD2 . ASP A 1 100 ? -8.514  32.219 36.498 1.00 37.84  ? 80   ASP A OD2 1 
ATOM   680  N N   . VAL A 1 101 ? -4.147  32.113 33.443 1.00 30.21  ? 81   VAL A N   1 
ATOM   681  C CA  . VAL A 1 101 ? -3.352  31.219 32.593 1.00 26.52  ? 81   VAL A CA  1 
ATOM   682  C C   . VAL A 1 101 ? -3.299  29.825 33.231 1.00 28.99  ? 81   VAL A C   1 
ATOM   683  O O   . VAL A 1 101 ? -2.951  29.649 34.416 1.00 30.65  ? 81   VAL A O   1 
ATOM   684  C CB  . VAL A 1 101 ? -1.923  31.774 32.375 1.00 34.66  ? 81   VAL A CB  1 
ATOM   685  C CG1 . VAL A 1 101 ? -1.201  30.978 31.326 1.00 32.89  ? 81   VAL A CG1 1 
ATOM   686  C CG2 . VAL A 1 101 ? -1.980  33.225 31.937 1.00 33.08  ? 81   VAL A CG2 1 
ATOM   687  N N   . ILE A 1 102 ? -3.637  28.841 32.420 1.00 33.09  ? 82   ILE A N   1 
ATOM   688  C CA  . ILE A 1 102 ? -3.661  27.458 32.851 1.00 33.29  ? 82   ILE A CA  1 
ATOM   689  C C   . ILE A 1 102 ? -2.437  26.819 32.222 1.00 31.26  ? 82   ILE A C   1 
ATOM   690  O O   . ILE A 1 102 ? -2.284  26.832 30.992 1.00 36.78  ? 82   ILE A O   1 
ATOM   691  C CB  . ILE A 1 102 ? -4.938  26.752 32.387 1.00 37.83  ? 82   ILE A CB  1 
ATOM   692  C CG1 . ILE A 1 102 ? -6.144  27.363 33.126 1.00 45.33  ? 82   ILE A CG1 1 
ATOM   693  C CG2 . ILE A 1 102 ? -4.860  25.260 32.678 1.00 42.88  ? 82   ILE A CG2 1 
ATOM   694  C CD1 . ILE A 1 102 ? -7.494  26.803 32.722 1.00 57.74  ? 82   ILE A CD1 1 
ATOM   695  N N   . VAL A 1 103 ? -1.547  26.318 33.057 1.00 34.60  ? 83   VAL A N   1 
ATOM   696  C CA  . VAL A 1 103 ? -0.288  25.766 32.529 1.00 38.99  ? 83   VAL A CA  1 
ATOM   697  C C   . VAL A 1 103 ? -0.241  24.271 32.759 1.00 41.27  ? 83   VAL A C   1 
ATOM   698  O O   . VAL A 1 103 ? -0.709  23.763 33.795 1.00 39.60  ? 83   VAL A O   1 
ATOM   699  C CB  . VAL A 1 103 ? 0.954   26.376 33.179 1.00 40.99  ? 83   VAL A CB  1 
ATOM   700  C CG1 . VAL A 1 103 ? 1.063   27.883 32.866 1.00 49.09  ? 83   VAL A CG1 1 
ATOM   701  C CG2 . VAL A 1 103 ? 0.943   26.132 34.661 1.00 41.72  ? 83   VAL A CG2 1 
ATOM   702  N N   . ILE A 1 104 ? 0.347   23.576 31.797 1.00 38.75  ? 84   ILE A N   1 
ATOM   703  C CA  . ILE A 1 104 ? 0.380   22.118 31.812 1.00 35.58  ? 84   ILE A CA  1 
ATOM   704  C C   . ILE A 1 104 ? 1.810   21.621 31.974 1.00 49.33  ? 84   ILE A C   1 
ATOM   705  O O   . ILE A 1 104 ? 2.140   20.494 31.625 1.00 43.68  ? 84   ILE A O   1 
ATOM   706  C CB  . ILE A 1 104 ? -0.360  21.466 30.615 1.00 51.10  ? 84   ILE A CB  1 
ATOM   707  C CG1 . ILE A 1 104 ? 0.038   22.088 29.265 1.00 55.85  ? 84   ILE A CG1 1 
ATOM   708  C CG2 . ILE A 1 104 ? -1.866  21.559 30.844 1.00 47.59  ? 84   ILE A CG2 1 
ATOM   709  C CD1 . ILE A 1 104 ? 1.415   21.659 28.730 1.00 50.02  ? 84   ILE A CD1 1 
ATOM   710  N N   . SER A 1 105 ? 2.637   22.490 32.530 1.00 36.22  ? 85   SER A N   1 
ATOM   711  C CA  . SER A 1 105 ? 3.952   22.108 32.984 1.00 42.10  ? 85   SER A CA  1 
ATOM   712  C C   . SER A 1 105 ? 3.825   21.395 34.337 1.00 54.59  ? 85   SER A C   1 
ATOM   713  O O   . SER A 1 105 ? 4.768   20.743 34.789 1.00 64.43  ? 85   SER A O   1 
ATOM   714  C CB  . SER A 1 105 ? 4.865   23.334 33.053 1.00 45.05  ? 85   SER A CB  1 
ATOM   715  O OG  . SER A 1 105 ? 4.328   24.323 33.920 1.00 54.03  ? 85   SER A OG  1 
ATOM   716  N N   . GLY A 1 106 ? 2.641   21.524 34.949 1.00 54.94  ? 86   GLY A N   1 
ATOM   717  C CA  . GLY A 1 106 ? 2.202   20.704 36.090 1.00 53.44  ? 86   GLY A CA  1 
ATOM   718  C C   . GLY A 1 106 ? 1.070   19.777 35.674 1.00 82.02  ? 86   GLY A C   1 
ATOM   719  O O   . GLY A 1 106 ? 0.177   20.174 34.929 1.00 53.71  ? 86   GLY A O   1 
ATOM   720  N N   . LEU A 1 107 ? 1.115   18.532 36.141 1.00 85.45  ? 87   LEU A N   1 
ATOM   721  C CA  . LEU A 1 107 ? 0.032   17.578 35.903 1.00 64.42  ? 87   LEU A CA  1 
ATOM   722  C C   . LEU A 1 107 ? -0.517  17.126 37.262 1.00 71.54  ? 87   LEU A C   1 
ATOM   723  O O   . LEU A 1 107 ? 0.181   16.432 38.006 1.00 69.37  ? 87   LEU A O   1 
ATOM   724  C CB  . LEU A 1 107 ? 0.523   16.381 35.069 1.00 129.70 ? 87   LEU A CB  1 
ATOM   725  C CG  . LEU A 1 107 ? 1.094   16.602 33.657 1.00 111.35 ? 87   LEU A CG  1 
ATOM   726  C CD1 . LEU A 1 107 ? 2.065   15.479 33.257 1.00 63.67  ? 87   LEU A CD1 1 
ATOM   727  C CD2 . LEU A 1 107 ? -0.012  16.775 32.606 1.00 49.08  ? 87   LEU A CD2 1 
ATOM   728  N N   . PRO A 1 108 ? -1.763  17.524 37.598 1.00 69.43  ? 88   PRO A N   1 
ATOM   729  C CA  . PRO A 1 108 ? -2.673  18.196 36.684 1.00 56.12  ? 88   PRO A CA  1 
ATOM   730  C C   . PRO A 1 108 ? -2.390  19.687 36.542 1.00 63.46  ? 88   PRO A C   1 
ATOM   731  O O   . PRO A 1 108 ? -1.610  20.272 37.308 1.00 59.18  ? 88   PRO A O   1 
ATOM   732  C CB  . PRO A 1 108 ? -4.058  17.975 37.309 1.00 53.95  ? 88   PRO A CB  1 
ATOM   733  C CG  . PRO A 1 108 ? -3.829  17.549 38.709 1.00 46.51  ? 88   PRO A CG  1 
ATOM   734  C CD  . PRO A 1 108 ? -2.344  17.386 38.944 1.00 75.08  ? 88   PRO A CD  1 
ATOM   735  N N   . ALA A 1 109 ? -3.038  20.272 35.545 1.00 51.45  ? 89   ALA A N   1 
ATOM   736  C CA  . ALA A 1 109 ? -2.874  21.664 35.182 1.00 46.22  ? 89   ALA A CA  1 
ATOM   737  C C   . ALA A 1 109 ? -3.091  22.595 36.353 1.00 62.91  ? 89   ALA A C   1 
ATOM   738  O O   . ALA A 1 109 ? -3.978  22.374 37.187 1.00 55.37  ? 89   ALA A O   1 
ATOM   739  C CB  . ALA A 1 109 ? -3.825  21.993 34.081 1.00 39.08  ? 89   ALA A CB  1 
ATOM   740  N N   . ASN A 1 110 ? -2.259  23.631 36.407 1.00 43.96  ? 90   ASN A N   1 
ATOM   741  C CA  . ASN A 1 110 ? -2.363  24.684 37.406 1.00 38.29  ? 90   ASN A CA  1 
ATOM   742  C C   . ASN A 1 110 ? -2.924  26.001 36.840 1.00 42.69  ? 90   ASN A C   1 
ATOM   743  O O   . ASN A 1 110 ? -2.651  26.357 35.684 1.00 43.64  ? 90   ASN A O   1 
ATOM   744  C CB  . ASN A 1 110 ? -0.985  24.979 37.983 1.00 44.06  ? 90   ASN A CB  1 
ATOM   745  C CG  . ASN A 1 110 ? -0.229  23.727 38.384 1.00 141.01 ? 90   ASN A CG  1 
ATOM   746  O OD1 . ASN A 1 110 ? 0.936   23.567 38.033 1.00 57.40  ? 90   ASN A OD1 1 
ATOM   747  N ND2 . ASN A 1 110 ? -0.886  22.836 39.120 1.00 59.10  ? 90   ASN A ND2 1 
ATOM   748  N N   . THR A 1 111 ? -3.707  26.719 37.645 1.00 39.08  ? 91   THR A N   1 
ATOM   749  C CA  . THR A 1 111 ? -4.173  28.056 37.252 1.00 36.61  ? 91   THR A CA  1 
ATOM   750  C C   . THR A 1 111 ? -3.472  29.157 38.021 1.00 34.38  ? 91   THR A C   1 
ATOM   751  O O   . THR A 1 111 ? -3.348  29.081 39.244 1.00 40.07  ? 91   THR A O   1 
ATOM   752  C CB  . THR A 1 111 ? -5.735  28.239 37.393 1.00 45.27  ? 91   THR A CB  1 
ATOM   753  O OG1 . THR A 1 111 ? -6.409  27.326 36.515 1.00 48.66  ? 91   THR A OG1 1 
ATOM   754  C CG2 . THR A 1 111 ? -6.139  29.667 37.016 1.00 40.56  ? 91   THR A CG2 1 
ATOM   755  N N   . SER A 1 112 ? -2.974  30.148 37.294 1.00 33.03  ? 92   SER A N   1 
ATOM   756  C CA  . SER A 1 112 ? -2.404  31.350 37.895 1.00 35.10  ? 92   SER A CA  1 
ATOM   757  C C   . SER A 1 112 ? -3.161  32.590 37.404 1.00 32.01  ? 92   SER A C   1 
ATOM   758  O O   . SER A 1 112 ? -3.414  32.731 36.237 1.00 33.72  ? 92   SER A O   1 
ATOM   759  C CB  . SER A 1 112 ? -0.939  31.507 37.484 1.00 41.58  ? 92   SER A CB  1 
ATOM   760  O OG  . SER A 1 112 ? -0.151  30.593 38.219 1.00 89.99  ? 92   SER A OG  1 
ATOM   761  N N   . THR A 1 113 ? -3.495  33.472 38.316 1.00 26.22  ? 93   THR A N   1 
ATOM   762  C CA  . THR A 1 113 ? -4.064  34.749 37.933 1.00 26.71  ? 93   THR A CA  1 
ATOM   763  C C   . THR A 1 113 ? -2.985  35.814 37.949 1.00 28.97  ? 93   THR A C   1 
ATOM   764  O O   . THR A 1 113 ? -2.308  35.994 38.976 1.00 26.35  ? 93   THR A O   1 
ATOM   765  C CB  . THR A 1 113 ? -5.191  35.165 38.932 1.00 35.13  ? 93   THR A CB  1 
ATOM   766  O OG1 . THR A 1 113 ? -6.130  34.086 39.037 1.00 32.37  ? 93   THR A OG1 1 
ATOM   767  C CG2 . THR A 1 113 ? -5.911  36.392 38.438 1.00 30.73  ? 93   THR A CG2 1 
ATOM   768  N N   . GLU A 1 114 ? -2.897  36.535 36.842 1.00 28.41  ? 94   GLU A N   1 
ATOM   769  C CA  . GLU A 1 114 ? -1.870  37.565 36.563 1.00 24.85  ? 94   GLU A CA  1 
ATOM   770  C C   . GLU A 1 114 ? -2.472  38.904 36.262 1.00 31.04  ? 94   GLU A C   1 
ATOM   771  O O   . GLU A 1 114 ? -3.559  38.978 35.628 1.00 29.55  ? 94   GLU A O   1 
ATOM   772  C CB  . GLU A 1 114 ? -1.011  37.089 35.390 1.00 26.21  ? 94   GLU A CB  1 
ATOM   773  C CG  . GLU A 1 114 ? -0.360  35.737 35.756 1.00 31.62  ? 94   GLU A CG  1 
ATOM   774  C CD  . GLU A 1 114 ? 0.463   35.048 34.633 1.00 40.45  ? 94   GLU A CD  1 
ATOM   775  O OE1 . GLU A 1 114 ? 0.446   35.463 33.446 1.00 33.62  ? 94   GLU A OE1 1 
ATOM   776  O OE2 . GLU A 1 114 ? 1.114   34.033 34.967 1.00 44.47  ? 94   GLU A OE2 1 
ATOM   777  N N   . ARG A 1 115 ? -1.816  39.950 36.743 1.00 24.06  ? 95   ARG A N   1 
ATOM   778  C CA  A ARG A 1 115 ? -2.273  41.316 36.605 0.50 21.94  ? 95   ARG A CA  1 
ATOM   779  C CA  B ARG A 1 115 ? -2.291  41.312 36.549 0.50 29.79  ? 95   ARG A CA  1 
ATOM   780  C C   . ARG A 1 115 ? -1.377  42.046 35.630 1.00 41.70  ? 95   ARG A C   1 
ATOM   781  O O   . ARG A 1 115 ? -0.160  41.944 35.746 1.00 26.97  ? 95   ARG A O   1 
ATOM   782  C CB  A ARG A 1 115 ? -2.214  41.984 37.977 0.50 36.80  ? 95   ARG A CB  1 
ATOM   783  C CB  B ARG A 1 115 ? -2.362  42.073 37.866 0.50 28.70  ? 95   ARG A CB  1 
ATOM   784  C CG  A ARG A 1 115 ? -2.634  43.436 38.050 0.50 59.12  ? 95   ARG A CG  1 
ATOM   785  C CG  B ARG A 1 115 ? -2.726  43.545 37.737 0.50 25.82  ? 95   ARG A CG  1 
ATOM   786  C CD  A ARG A 1 115 ? -2.338  43.976 39.443 0.50 41.57  ? 95   ARG A CD  1 
ATOM   787  C CD  B ARG A 1 115 ? -2.531  44.236 39.095 0.50 33.90  ? 95   ARG A CD  1 
ATOM   788  N NE  A ARG A 1 115 ? -0.898  43.996 39.720 0.50 41.00  ? 95   ARG A NE  1 
ATOM   789  N NE  B ARG A 1 115 ? -2.955  45.634 39.094 0.50 35.44  ? 95   ARG A NE  1 
ATOM   790  C CZ  A ARG A 1 115 ? -0.352  44.014 40.935 0.50 54.01  ? 95   ARG A CZ  1 
ATOM   791  C CZ  B ARG A 1 115 ? -2.159  46.675 38.864 0.50 52.46  ? 95   ARG A CZ  1 
ATOM   792  N NH1 A ARG A 1 115 ? -1.103  44.004 42.035 0.50 35.62  ? 95   ARG A NH1 1 
ATOM   793  N NH1 B ARG A 1 115 ? -2.663  47.901 38.899 0.50 49.57  ? 95   ARG A NH1 1 
ATOM   794  N NH2 A ARG A 1 115 ? 0.965   44.037 41.050 0.50 35.28  ? 95   ARG A NH2 1 
ATOM   795  N NH2 B ARG A 1 115 ? -0.867  46.499 38.599 0.50 37.20  ? 95   ARG A NH2 1 
ATOM   796  N N   . LEU A 1 116 ? -1.963  42.778 34.691 1.00 24.55  ? 96   LEU A N   1 
ATOM   797  C CA  . LEU A 1 116 ? -1.168  43.650 33.866 1.00 26.40  ? 96   LEU A CA  1 
ATOM   798  C C   . LEU A 1 116 ? -0.663  44.903 34.600 1.00 39.33  ? 96   LEU A C   1 
ATOM   799  O O   . LEU A 1 116 ? -1.434  45.769 34.997 1.00 29.48  ? 96   LEU A O   1 
ATOM   800  C CB  . LEU A 1 116 ? -1.886  44.007 32.561 1.00 28.05  ? 96   LEU A CB  1 
ATOM   801  C CG  . LEU A 1 116 ? -1.194  44.951 31.579 1.00 33.87  ? 96   LEU A CG  1 
ATOM   802  C CD1 . LEU A 1 116 ? 0.073   44.308 30.950 1.00 30.25  ? 96   LEU A CD1 1 
ATOM   803  C CD2 . LEU A 1 116 ? -2.197  45.290 30.437 1.00 30.56  ? 96   LEU A CD2 1 
ATOM   804  N N   . ASP A 1 117 ? 0.656   45.020 34.786 1.00 27.65  ? 97   ASP A N   1 
ATOM   805  C CA  . ASP A 1 117 ? 1.243   46.108 35.590 1.00 29.23  ? 97   ASP A CA  1 
ATOM   806  C C   . ASP A 1 117 ? 1.648   47.345 34.817 1.00 31.20  ? 97   ASP A C   1 
ATOM   807  O O   . ASP A 1 117 ? 1.653   48.454 35.376 1.00 31.71  ? 97   ASP A O   1 
ATOM   808  C CB  . ASP A 1 117 ? 2.559   45.618 36.249 1.00 31.31  ? 97   ASP A CB  1 
ATOM   809  C CG  . ASP A 1 117 ? 2.329   44.581 37.323 1.00 71.39  ? 97   ASP A CG  1 
ATOM   810  O OD1 . ASP A 1 117 ? 1.228   44.550 37.929 1.00 39.67  ? 97   ASP A OD1 1 
ATOM   811  O OD2 . ASP A 1 117 ? 3.276   43.800 37.571 1.00 36.94  ? 97   ASP A OD2 1 
ATOM   812  N N   . ILE A 1 118 ? 2.057   47.148 33.568 1.00 28.62  ? 98   ILE A N   1 
ATOM   813  C CA  . ILE A 1 118 ? 2.640   48.224 32.747 1.00 30.33  ? 98   ILE A CA  1 
ATOM   814  C C   . ILE A 1 118 ? 2.313   47.903 31.338 1.00 30.52  ? 98   ILE A C   1 
ATOM   815  O O   . ILE A 1 118 ? 2.413   46.734 30.922 1.00 31.59  ? 98   ILE A O   1 
ATOM   816  C CB  . ILE A 1 118 ? 4.209   48.229 32.781 1.00 31.34  ? 98   ILE A CB  1 
ATOM   817  C CG1 . ILE A 1 118 ? 4.762   48.336 34.187 1.00 38.00  ? 98   ILE A CG1 1 
ATOM   818  C CG2 . ILE A 1 118 ? 4.800   49.360 31.911 1.00 34.93  ? 98   ILE A CG2 1 
ATOM   819  C CD1 . ILE A 1 118 ? 6.243   47.919 34.190 1.00 44.76  ? 98   ILE A CD1 1 
ATOM   820  N N   . LEU A 1 119 ? 1.847   48.916 30.590 1.00 31.95  ? 99   LEU A N   1 
ATOM   821  C CA  . LEU A 1 119 ? 1.746   48.838 29.152 1.00 29.81  ? 99   LEU A CA  1 
ATOM   822  C C   . LEU A 1 119 ? 2.013   50.181 28.542 1.00 50.02  ? 99   LEU A C   1 
ATOM   823  O O   . LEU A 1 119 ? 1.167   51.092 28.635 1.00 38.08  ? 99   LEU A O   1 
ATOM   824  C CB  . LEU A 1 119 ? 0.344   48.385 28.686 1.00 28.69  ? 99   LEU A CB  1 
ATOM   825  C CG  . LEU A 1 119 ? 0.120   48.158 27.198 1.00 46.26  ? 99   LEU A CG  1 
ATOM   826  C CD1 . LEU A 1 119 ? 1.120   47.132 26.712 1.00 42.31  ? 99   LEU A CD1 1 
ATOM   827  C CD2 . LEU A 1 119 ? -1.281  47.643 27.003 1.00 56.50  ? 99   LEU A CD2 1 
ATOM   828  N N   . ASP A 1 120 ? 3.176   50.318 27.916 1.00 31.46  ? 100  ASP A N   1 
ATOM   829  C CA  . ASP A 1 120 ? 3.491   51.568 27.258 1.00 31.71  ? 100  ASP A CA  1 
ATOM   830  C C   . ASP A 1 120 ? 3.769   51.297 25.810 1.00 35.69  ? 100  ASP A C   1 
ATOM   831  O O   . ASP A 1 120 ? 4.842   50.786 25.444 1.00 36.74  ? 100  ASP A O   1 
ATOM   832  C CB  . ASP A 1 120 ? 4.675   52.235 27.945 1.00 30.14  ? 100  ASP A CB  1 
ATOM   833  C CG  . ASP A 1 120 ? 5.033   53.580 27.325 1.00 52.65  ? 100  ASP A CG  1 
ATOM   834  O OD1 . ASP A 1 120 ? 4.766   53.783 26.124 1.00 40.71  ? 100  ASP A OD1 1 
ATOM   835  O OD2 . ASP A 1 120 ? 5.587   54.442 28.036 1.00 51.00  ? 100  ASP A OD2 1 
ATOM   836  N N   . ASP A 1 121 ? 2.809   51.647 24.956 1.00 32.19  ? 101  ASP A N   1 
ATOM   837  C CA  . ASP A 1 121 ? 2.972   51.339 23.534 1.00 30.23  ? 101  ASP A CA  1 
ATOM   838  C C   . ASP A 1 121 ? 3.978   52.232 22.827 1.00 35.38  ? 101  ASP A C   1 
ATOM   839  O O   . ASP A 1 121 ? 4.516   51.860 21.800 1.00 43.21  ? 101  ASP A O   1 
ATOM   840  C CB  . ASP A 1 121 ? 1.601   51.392 22.814 1.00 37.59  ? 101  ASP A CB  1 
ATOM   841  C CG  . ASP A 1 121 ? 0.805   50.117 22.979 1.00 46.59  ? 101  ASP A CG  1 
ATOM   842  O OD1 . ASP A 1 121 ? 1.383   49.014 22.873 1.00 40.41  ? 101  ASP A OD1 1 
ATOM   843  O OD2 . ASP A 1 121 ? -0.419  50.200 23.216 1.00 43.86  ? 101  ASP A OD2 1 
ATOM   844  N N   . GLU A 1 122 ? 4.236   53.420 23.362 1.00 36.52  ? 102  GLU A N   1 
ATOM   845  C CA  . GLU A 1 122 ? 5.172   54.332 22.725 1.00 34.93  ? 102  GLU A CA  1 
ATOM   846  C C   . GLU A 1 122 ? 6.590   53.854 22.972 1.00 36.34  ? 102  GLU A C   1 
ATOM   847  O O   . GLU A 1 122 ? 7.458   53.884 22.100 1.00 42.96  ? 102  GLU A O   1 
ATOM   848  C CB  . GLU A 1 122 ? 5.029   55.749 23.303 1.00 35.76  ? 102  GLU A CB  1 
ATOM   849  C CG  . GLU A 1 122 ? 3.621   56.350 23.117 1.00 74.05  ? 102  GLU A CG  1 
ATOM   850  C CD  . GLU A 1 122 ? 3.070   56.188 21.698 1.00 203.35 ? 102  GLU A CD  1 
ATOM   851  O OE1 . GLU A 1 122 ? 3.700   56.692 20.738 1.00 111.36 ? 102  GLU A OE1 1 
ATOM   852  O OE2 . GLU A 1 122 ? 1.998   55.558 21.546 1.00 121.93 ? 102  GLU A OE2 1 
ATOM   853  N N   . ARG A 1 123 ? 6.805   53.369 24.178 1.00 32.66  ? 103  ARG A N   1 
ATOM   854  C CA  . ARG A 1 123 ? 8.142   52.991 24.584 1.00 32.17  ? 103  ARG A CA  1 
ATOM   855  C C   . ARG A 1 123 ? 8.379   51.474 24.539 1.00 34.88  ? 103  ARG A C   1 
ATOM   856  O O   . ARG A 1 123 ? 9.500   51.019 24.746 1.00 33.79  ? 103  ARG A O   1 
ATOM   857  C CB  . ARG A 1 123 ? 8.370   53.552 25.948 1.00 32.16  ? 103  ARG A CB  1 
ATOM   858  C CG  . ARG A 1 123 ? 8.303   55.073 25.921 1.00 37.42  ? 103  ARG A CG  1 
ATOM   859  C CD  . ARG A 1 123 ? 8.836   55.661 27.200 1.00 37.80  ? 103  ARG A CD  1 
ATOM   860  N NE  . ARG A 1 123 ? 10.291  55.589 27.269 1.00 34.83  ? 103  ARG A NE  1 
ATOM   861  C CZ  . ARG A 1 123 ? 10.949  55.573 28.422 1.00 35.73  ? 103  ARG A CZ  1 
ATOM   862  N NH1 . ARG A 1 123 ? 10.261  55.627 29.558 1.00 41.99  ? 103  ARG A NH1 1 
ATOM   863  N NH2 . ARG A 1 123 ? 12.278  55.490 28.448 1.00 38.71  ? 103  ARG A NH2 1 
ATOM   864  N N   . ARG A 1 124 ? 7.321   50.720 24.241 1.00 24.88  ? 104  ARG A N   1 
ATOM   865  C CA  . ARG A 1 124 ? 7.374   49.256 24.033 1.00 24.09  ? 104  ARG A CA  1 
ATOM   866  C C   . ARG A 1 124 ? 7.859   48.523 25.285 1.00 31.84  ? 104  ARG A C   1 
ATOM   867  O O   . ARG A 1 124 ? 8.862   47.785 25.247 1.00 31.35  ? 104  ARG A O   1 
ATOM   868  C CB  . ARG A 1 124 ? 8.276   48.914 22.845 1.00 27.29  ? 104  ARG A CB  1 
ATOM   869  C CG  . ARG A 1 124 ? 7.625   49.321 21.478 1.00 32.97  ? 104  ARG A CG  1 
ATOM   870  C CD  . ARG A 1 124 ? 8.455   48.808 20.358 1.00 34.22  ? 104  ARG A CD  1 
ATOM   871  N NE  . ARG A 1 124 ? 7.936   49.316 19.091 1.00 43.15  ? 104  ARG A NE  1 
ATOM   872  C CZ  . ARG A 1 124 ? 8.664   49.907 18.148 1.00 48.38  ? 104  ARG A CZ  1 
ATOM   873  N NH1 . ARG A 1 124 ? 9.972   50.083 18.286 1.00 40.19  ? 104  ARG A NH1 1 
ATOM   874  N NH2 . ARG A 1 124 ? 8.065   50.332 17.045 1.00 45.86  ? 104  ARG A NH2 1 
ATOM   875  N N   . VAL A 1 125 ? 7.133   48.735 26.369 1.00 27.76  ? 105  VAL A N   1 
ATOM   876  C CA  . VAL A 1 125 ? 7.367   48.107 27.678 1.00 23.99  ? 105  VAL A CA  1 
ATOM   877  C C   . VAL A 1 125 ? 6.064   47.516 28.138 1.00 26.00  ? 105  VAL A C   1 
ATOM   878  O O   . VAL A 1 125 ? 5.015   48.181 28.126 1.00 26.66  ? 105  VAL A O   1 
ATOM   879  C CB  . VAL A 1 125 ? 7.868   49.123 28.733 1.00 30.04  ? 105  VAL A CB  1 
ATOM   880  C CG1 . VAL A 1 125 ? 8.211   48.428 30.093 1.00 29.75  ? 105  VAL A CG1 1 
ATOM   881  C CG2 . VAL A 1 125 ? 9.056   49.917 28.170 1.00 36.32  ? 105  VAL A CG2 1 
ATOM   882  N N   . THR A 1 126 ? 6.103   46.266 28.580 1.00 22.39  ? 106  THR A N   1 
ATOM   883  C CA  . THR A 1 126 ? 4.980   45.687 29.257 1.00 26.32  ? 106  THR A CA  1 
ATOM   884  C C   . THR A 1 126 ? 5.482   44.882 30.480 1.00 29.31  ? 106  THR A C   1 
ATOM   885  O O   . THR A 1 126 ? 6.679   44.598 30.603 1.00 25.43  ? 106  THR A O   1 
ATOM   886  C CB  . THR A 1 126 ? 4.106   44.843 28.309 1.00 32.64  ? 106  THR A CB  1 
ATOM   887  O OG1 . THR A 1 126 ? 2.905   44.483 29.023 1.00 30.67  ? 106  THR A OG1 1 
ATOM   888  C CG2 . THR A 1 126 ? 4.854   43.536 27.748 1.00 28.64  ? 106  THR A CG2 1 
ATOM   889  N N   . GLY A 1 127 ? 4.592   44.536 31.381 1.00 24.07  ? 107  GLY A N   1 
ATOM   890  C CA  . GLY A 1 127 ? 4.981   43.795 32.564 1.00 25.16  ? 107  GLY A CA  1 
ATOM   891  C C   . GLY A 1 127 ? 3.804   43.272 33.320 1.00 27.65  ? 107  GLY A C   1 
ATOM   892  O O   . GLY A 1 127 ? 2.666   43.824 33.217 1.00 25.30  ? 107  GLY A O   1 
ATOM   893  N N   . PHE A 1 128 ? 4.023   42.203 34.060 1.00 21.58  ? 108  PHE A N   1 
ATOM   894  C CA  . PHE A 1 128 ? 2.910   41.595 34.860 1.00 25.46  ? 108  PHE A CA  1 
ATOM   895  C C   . PHE A 1 128 ? 3.365   41.050 36.183 1.00 29.57  ? 108  PHE A C   1 
ATOM   896  O O   . PHE A 1 128 ? 4.576   40.860 36.426 1.00 25.53  ? 108  PHE A O   1 
ATOM   897  C CB  . PHE A 1 128 ? 2.162   40.490 34.062 1.00 23.58  ? 108  PHE A CB  1 
ATOM   898  C CG  . PHE A 1 128 ? 2.955   39.212 33.890 1.00 21.22  ? 108  PHE A CG  1 
ATOM   899  C CD1 . PHE A 1 128 ? 2.769   38.132 34.732 1.00 27.04  ? 108  PHE A CD1 1 
ATOM   900  C CD2 . PHE A 1 128 ? 3.911   39.118 32.862 1.00 24.65  ? 108  PHE A CD2 1 
ATOM   901  C CE1 . PHE A 1 128 ? 3.474   36.930 34.568 1.00 28.44  ? 108  PHE A CE1 1 
ATOM   902  C CE2 . PHE A 1 128 ? 4.665   37.942 32.731 1.00 25.18  ? 108  PHE A CE2 1 
ATOM   903  C CZ  . PHE A 1 128 ? 4.449   36.856 33.543 1.00 26.84  ? 108  PHE A CZ  1 
ATOM   904  N N   . SER A 1 129 ? 2.390   40.797 37.067 1.00 23.70  ? 109  SER A N   1 
ATOM   905  C CA  A SER A 1 129 ? 2.611   40.215 38.384 0.50 24.63  ? 109  SER A CA  1 
ATOM   906  C CA  B SER A 1 129 ? 2.665   40.105 38.304 0.50 23.24  ? 109  SER A CA  1 
ATOM   907  C C   . SER A 1 129 ? 1.719   38.985 38.557 1.00 34.83  ? 109  SER A C   1 
ATOM   908  O O   . SER A 1 129 ? 0.576   38.978 38.066 1.00 28.11  ? 109  SER A O   1 
ATOM   909  C CB  A SER A 1 129 ? 2.277   41.229 39.499 0.50 44.51  ? 109  SER A CB  1 
ATOM   910  C CB  B SER A 1 129 ? 2.609   41.037 39.516 0.50 18.89  ? 109  SER A CB  1 
ATOM   911  O OG  A SER A 1 129 ? 3.257   42.255 39.674 0.50 24.65  ? 109  SER A OG  1 
ATOM   912  O OG  B SER A 1 129 ? 1.402   41.766 39.554 0.50 38.38  ? 109  SER A OG  1 
ATOM   913  N N   . ILE A 1 130 ? 2.185   38.010 39.307 1.00 24.95  ? 110  ILE A N   1 
ATOM   914  C CA  . ILE A 1 130 ? 1.313   36.811 39.555 1.00 27.84  ? 110  ILE A CA  1 
ATOM   915  C C   . ILE A 1 130 ? 0.610   37.153 40.816 1.00 37.92  ? 110  ILE A C   1 
ATOM   916  O O   . ILE A 1 130 ? 1.268   37.397 41.778 1.00 28.01  ? 110  ILE A O   1 
ATOM   917  C CB  . ILE A 1 130 ? 2.073   35.436 39.596 1.00 23.16  ? 110  ILE A CB  1 
ATOM   918  C CG1 . ILE A 1 130 ? 2.579   35.072 38.211 1.00 26.35  ? 110  ILE A CG1 1 
ATOM   919  C CG2 . ILE A 1 130 ? 1.142   34.342 40.200 1.00 27.96  ? 110  ILE A CG2 1 
ATOM   920  C CD1 . ILE A 1 130 ? 3.407   33.772 38.165 1.00 39.19  ? 110  ILE A CD1 1 
ATOM   921  N N   . ILE A 1 131 ? -0.734  37.291 40.813 1.00 26.75  ? 111  ILE A N   1 
ATOM   922  C CA  . ILE A 1 131 ? -1.412  37.765 42.040 1.00 27.63  ? 111  ILE A CA  1 
ATOM   923  C C   . ILE A 1 131 ? -2.299  36.686 42.718 1.00 25.44  ? 111  ILE A C   1 
ATOM   924  O O   . ILE A 1 131 ? -2.781  36.894 43.855 1.00 31.51  ? 111  ILE A O   1 
ATOM   925  C CB  . ILE A 1 131 ? -2.286  39.033 41.799 1.00 29.82  ? 111  ILE A CB  1 
ATOM   926  C CG1 . ILE A 1 131 ? -3.437  38.677 40.832 1.00 32.80  ? 111  ILE A CG1 1 
ATOM   927  C CG2 . ILE A 1 131 ? -1.451  40.195 41.241 1.00 38.69  ? 111  ILE A CG2 1 
ATOM   928  C CD1 . ILE A 1 131 ? -4.501  39.806 40.681 1.00 38.00  ? 111  ILE A CD1 1 
ATOM   929  N N   . GLY A 1 132 ? -2.501  35.566 42.057 1.00 26.90  ? 112  GLY A N   1 
ATOM   930  C CA  . GLY A 1 132 ? -3.163  34.442 42.715 1.00 34.63  ? 112  GLY A CA  1 
ATOM   931  C C   . GLY A 1 132 ? -2.980  33.127 42.023 1.00 27.61  ? 112  GLY A C   1 
ATOM   932  O O   . GLY A 1 132 ? -2.443  33.047 40.901 1.00 31.54  ? 112  GLY A O   1 
ATOM   933  N N   . GLY A 1 133 ? -3.421  32.076 42.718 1.00 29.11  ? 113  GLY A N   1 
ATOM   934  C CA  . GLY A 1 133 ? -3.392  30.737 42.222 1.00 31.46  ? 113  GLY A CA  1 
ATOM   935  C C   . GLY A 1 133 ? -2.043  30.114 42.551 1.00 49.26  ? 113  GLY A C   1 
ATOM   936  O O   . GLY A 1 133 ? -1.423  30.380 43.605 1.00 43.81  ? 113  GLY A O   1 
ATOM   937  N N   . GLU A 1 134 ? -1.589  29.279 41.635 1.00 52.51  ? 114  GLU A N   1 
ATOM   938  C CA  . GLU A 1 134 ? -0.267  28.699 41.739 1.00 69.59  ? 114  GLU A CA  1 
ATOM   939  C C   . GLU A 1 134 ? 0.817   29.785 41.685 1.00 58.82  ? 114  GLU A C   1 
ATOM   940  O O   . GLU A 1 134 ? 0.770   30.728 40.873 1.00 55.20  ? 114  GLU A O   1 
ATOM   941  C CB  . GLU A 1 134 ? -0.068  27.613 40.681 1.00 85.81  ? 114  GLU A CB  1 
ATOM   942  C CG  . GLU A 1 134 ? -1.012  26.427 40.861 1.00 110.09 ? 114  GLU A CG  1 
ATOM   943  C CD  . GLU A 1 134 ? -0.984  25.850 42.267 1.00 171.15 ? 114  GLU A CD  1 
ATOM   944  O OE1 . GLU A 1 134 ? 0.109   25.466 42.736 1.00 163.64 ? 114  GLU A OE1 1 
ATOM   945  O OE2 . GLU A 1 134 ? -2.060  25.781 42.900 1.00 147.26 ? 114  GLU A OE2 1 
ATOM   946  N N   . HIS A 1 135 ? 1.749   29.665 42.616 1.00 54.22  ? 115  HIS A N   1 
ATOM   947  C CA  . HIS A 1 135 ? 2.905   30.557 42.749 1.00 58.21  ? 115  HIS A CA  1 
ATOM   948  C C   . HIS A 1 135 ? 2.605   31.976 43.216 1.00 56.52  ? 115  HIS A C   1 
ATOM   949  O O   . HIS A 1 135 ? 3.496   32.832 43.149 1.00 42.71  ? 115  HIS A O   1 
ATOM   950  C CB  . HIS A 1 135 ? 3.775   30.553 41.478 1.00 67.97  ? 115  HIS A CB  1 
ATOM   951  C CG  . HIS A 1 135 ? 4.117   29.177 40.996 1.00 121.00 ? 115  HIS A CG  1 
ATOM   952  N ND1 . HIS A 1 135 ? 3.649   28.668 39.804 1.00 81.04  ? 115  HIS A ND1 1 
ATOM   953  C CD2 . HIS A 1 135 ? 4.860   28.195 41.558 1.00 72.99  ? 115  HIS A CD2 1 
ATOM   954  C CE1 . HIS A 1 135 ? 4.094   27.435 39.649 1.00 85.43  ? 115  HIS A CE1 1 
ATOM   955  N NE2 . HIS A 1 135 ? 4.832   27.124 40.700 1.00 107.15 ? 115  HIS A NE2 1 
ATOM   956  N N   . ARG A 1 136 ? 1.384   32.227 43.716 1.00 45.13  ? 116  ARG A N   1 
ATOM   957  C CA  A ARG A 1 136 ? 1.018   33.517 44.339 0.50 80.49  ? 116  ARG A CA  1 
ATOM   958  C CA  B ARG A 1 136 ? 1.090   33.556 44.252 0.50 42.81  ? 116  ARG A CA  1 
ATOM   959  C C   . ARG A 1 136 ? 2.074   33.894 45.381 1.00 93.51  ? 116  ARG A C   1 
ATOM   960  O O   . ARG A 1 136 ? 2.502   35.057 45.502 1.00 49.91  ? 116  ARG A O   1 
ATOM   961  C CB  A ARG A 1 136 ? -0.383  33.428 45.002 0.50 33.51  ? 116  ARG A CB  1 
ATOM   962  C CB  B ARG A 1 136 ? -0.352  33.633 44.741 0.50 86.50  ? 116  ARG A CB  1 
ATOM   963  C CG  A ARG A 1 136 ? -0.695  34.550 46.046 0.50 40.87  ? 116  ARG A CG  1 
ATOM   964  C CG  B ARG A 1 136 ? -0.738  34.945 45.426 0.50 50.43  ? 116  ARG A CG  1 
ATOM   965  C CD  A ARG A 1 136 ? -2.165  34.548 46.525 0.50 103.29 ? 116  ARG A CD  1 
ATOM   966  C CD  B ARG A 1 136 ? -1.837  34.662 46.422 0.50 151.23 ? 116  ARG A CD  1 
ATOM   967  N NE  A ARG A 1 136 ? -2.490  35.721 47.347 0.50 37.79  ? 116  ARG A NE  1 
ATOM   968  N NE  B ARG A 1 136 ? -1.393  33.585 47.296 0.50 44.34  ? 116  ARG A NE  1 
ATOM   969  C CZ  A ARG A 1 136 ? -3.454  36.614 47.091 0.50 71.84  ? 116  ARG A CZ  1 
ATOM   970  C CZ  B ARG A 1 136 ? -1.230  33.687 48.611 0.50 48.44  ? 116  ARG A CZ  1 
ATOM   971  N NH1 A ARG A 1 136 ? -4.283  36.504 46.040 0.50 25.68  ? 116  ARG A NH1 1 
ATOM   972  N NH1 B ARG A 1 136 ? -1.538  34.813 49.248 0.50 37.72  ? 116  ARG A NH1 1 
ATOM   973  N NH2 A ARG A 1 136 ? -3.606  37.631 47.923 0.50 76.78  ? 116  ARG A NH2 1 
ATOM   974  N NH2 B ARG A 1 136 ? -0.794  32.638 49.294 0.50 101.39 ? 116  ARG A NH2 1 
ATOM   975  N N   . LEU A 1 137 ? 2.466   32.873 46.147 1.00 50.06  ? 117  LEU A N   1 
ATOM   976  C CA  . LEU A 1 137 ? 3.372   32.963 47.299 1.00 55.43  ? 117  LEU A CA  1 
ATOM   977  C C   . LEU A 1 137 ? 4.775   33.407 46.892 1.00 45.68  ? 117  LEU A C   1 
ATOM   978  O O   . LEU A 1 137 ? 5.542   33.964 47.688 1.00 62.76  ? 117  LEU A O   1 
ATOM   979  C CB  . LEU A 1 137 ? 3.445   31.584 47.965 1.00 68.59  ? 117  LEU A CB  1 
ATOM   980  C CG  . LEU A 1 137 ? 3.676   31.448 49.469 1.00 137.75 ? 117  LEU A CG  1 
ATOM   981  C CD1 . LEU A 1 137 ? 2.514   32.046 50.263 1.00 69.84  ? 117  LEU A CD1 1 
ATOM   982  C CD2 . LEU A 1 137 ? 3.879   29.968 49.816 1.00 81.68  ? 117  LEU A CD2 1 
ATOM   983  N N   . THR A 1 138 ? 5.095   33.192 45.625 1.00 45.90  ? 118  THR A N   1 
ATOM   984  C CA  . THR A 1 138 ? 6.362   33.643 45.104 1.00 40.55  ? 118  THR A CA  1 
ATOM   985  C C   . THR A 1 138 ? 6.530   35.151 44.888 1.00 36.32  ? 118  THR A C   1 
ATOM   986  O O   . THR A 1 138 ? 7.668   35.586 44.781 1.00 42.91  ? 118  THR A O   1 
ATOM   987  C CB  . THR A 1 138 ? 6.767   32.900 43.853 1.00 45.37  ? 118  THR A CB  1 
ATOM   988  O OG1 . THR A 1 138 ? 6.020   33.404 42.734 1.00 38.52  ? 118  THR A OG1 1 
ATOM   989  C CG2 . THR A 1 138 ? 6.553   31.400 44.011 1.00 59.68  ? 118  THR A CG2 1 
ATOM   990  N N   . ASN A 1 139 ? 5.451   35.953 44.826 1.00 30.06  ? 119  ASN A N   1 
ATOM   991  C CA  . ASN A 1 139 ? 5.518   37.383 44.476 1.00 30.31  ? 119  ASN A CA  1 
ATOM   992  C C   . ASN A 1 139 ? 6.314   37.598 43.174 1.00 34.02  ? 119  ASN A C   1 
ATOM   993  O O   . ASN A 1 139 ? 7.196   38.469 43.123 1.00 35.59  ? 119  ASN A O   1 
ATOM   994  C CB  . ASN A 1 139 ? 6.150   38.216 45.563 1.00 34.12  ? 119  ASN A CB  1 
ATOM   995  C CG  . ASN A 1 139 ? 5.188   38.447 46.726 1.00 48.60  ? 119  ASN A CG  1 
ATOM   996  O OD1 . ASN A 1 139 ? 4.014   38.728 46.518 1.00 55.28  ? 119  ASN A OD1 1 
ATOM   997  N ND2 . ASN A 1 139 ? 5.672   38.273 47.934 1.00 50.08  ? 119  ASN A ND2 1 
ATOM   998  N N   . TYR A 1 140 ? 6.060   36.735 42.214 1.00 26.55  ? 120  TYR A N   1 
ATOM   999  C CA  . TYR A 1 140 ? 6.654   36.850 40.845 1.00 27.41  ? 120  TYR A CA  1 
ATOM   1000 C C   . TYR A 1 140 ? 6.198   38.096 40.096 1.00 33.83  ? 120  TYR A C   1 
ATOM   1001 O O   . TYR A 1 140 ? 4.987   38.352 39.928 1.00 27.75  ? 120  TYR A O   1 
ATOM   1002 C CB  . TYR A 1 140 ? 6.302   35.625 40.024 1.00 25.45  ? 120  TYR A CB  1 
ATOM   1003 C CG  . TYR A 1 140 ? 7.025   35.519 38.724 1.00 29.68  ? 120  TYR A CG  1 
ATOM   1004 C CD1 . TYR A 1 140 ? 8.262   34.827 38.654 1.00 26.01  ? 120  TYR A CD1 1 
ATOM   1005 C CD2 . TYR A 1 140 ? 6.476   36.063 37.534 1.00 26.14  ? 120  TYR A CD2 1 
ATOM   1006 C CE1 . TYR A 1 140 ? 8.930   34.700 37.414 1.00 27.55  ? 120  TYR A CE1 1 
ATOM   1007 C CE2 . TYR A 1 140 ? 7.132   35.938 36.295 1.00 26.07  ? 120  TYR A CE2 1 
ATOM   1008 C CZ  . TYR A 1 140 ? 8.377   35.293 36.272 1.00 27.63  ? 120  TYR A CZ  1 
ATOM   1009 O OH  . TYR A 1 140 ? 8.981   35.162 35.070 1.00 35.60  ? 120  TYR A OH  1 
ATOM   1010 N N   . LYS A 1 141 ? 7.152   38.876 39.583 1.00 24.09  ? 121  LYS A N   1 
ATOM   1011 C CA  . LYS A 1 141 ? 6.807   40.064 38.789 1.00 20.41  ? 121  LYS A CA  1 
ATOM   1012 C C   . LYS A 1 141 ? 7.780   40.111 37.632 1.00 32.20  ? 121  LYS A C   1 
ATOM   1013 O O   . LYS A 1 141 ? 8.965   39.879 37.841 1.00 25.20  ? 121  LYS A O   1 
ATOM   1014 C CB  . LYS A 1 141 ? 6.931   41.324 39.590 1.00 25.86  ? 121  LYS A CB  1 
ATOM   1015 C CG  . LYS A 1 141 ? 6.604   42.615 38.850 1.00 32.78  ? 121  LYS A CG  1 
ATOM   1016 C CD  . LYS A 1 141 ? 6.680   43.832 39.820 1.00 44.01  ? 121  LYS A CD  1 
ATOM   1017 C CE  . LYS A 1 141 ? 5.876   45.030 39.315 1.00 142.62 ? 121  LYS A CE  1 
ATOM   1018 N NZ  . LYS A 1 141 ? 6.425   45.647 38.067 1.00 59.54  ? 121  LYS A NZ  1 
ATOM   1019 N N   . SER A 1 142 ? 7.303   40.455 36.452 1.00 20.50  ? 122  SER A N   1 
ATOM   1020 C CA  . SER A 1 142 ? 8.162   40.429 35.229 1.00 21.39  ? 122  SER A CA  1 
ATOM   1021 C C   . SER A 1 142 ? 7.963   41.641 34.350 1.00 32.25  ? 122  SER A C   1 
ATOM   1022 O O   . SER A 1 142 ? 6.828   42.176 34.260 1.00 22.56  ? 122  SER A O   1 
ATOM   1023 C CB  . SER A 1 142 ? 7.877   39.166 34.464 1.00 24.57  ? 122  SER A CB  1 
ATOM   1024 O OG  . SER A 1 142 ? 8.600   39.065 33.242 1.00 32.44  ? 122  SER A OG  1 
ATOM   1025 N N   . VAL A 1 143 ? 9.033   42.059 33.673 1.00 20.65  ? 123  VAL A N   1 
ATOM   1026 C CA  . VAL A 1 143 ? 8.972   43.186 32.746 1.00 21.73  ? 123  VAL A CA  1 
ATOM   1027 C C   . VAL A 1 143 ? 9.667   42.775 31.454 1.00 24.65  ? 123  VAL A C   1 
ATOM   1028 O O   . VAL A 1 143 ? 10.777  42.155 31.509 1.00 22.32  ? 123  VAL A O   1 
ATOM   1029 C CB  . VAL A 1 143 ? 9.643   44.447 33.288 1.00 21.00  ? 123  VAL A CB  1 
ATOM   1030 C CG1 . VAL A 1 143 ? 9.555   45.631 32.250 1.00 25.66  ? 123  VAL A CG1 1 
ATOM   1031 C CG2 . VAL A 1 143 ? 8.990   44.863 34.638 1.00 25.01  ? 123  VAL A CG2 1 
ATOM   1032 N N   . THR A 1 144 ? 9.040   43.120 30.323 1.00 19.24  ? 124  THR A N   1 
ATOM   1033 C CA  . THR A 1 144 ? 9.612   42.862 29.003 1.00 20.32  ? 124  THR A CA  1 
ATOM   1034 C C   . THR A 1 144 ? 9.695   44.172 28.216 1.00 30.30  ? 124  THR A C   1 
ATOM   1035 O O   . THR A 1 144 ? 8.720   44.929 28.161 1.00 24.77  ? 124  THR A O   1 
ATOM   1036 C CB  . THR A 1 144 ? 8.750   41.834 28.274 1.00 24.36  ? 124  THR A CB  1 
ATOM   1037 O OG1 . THR A 1 144 ? 8.751   40.574 28.969 1.00 27.18  ? 124  THR A OG1 1 
ATOM   1038 C CG2 . THR A 1 144 ? 9.242   41.566 26.835 1.00 27.51  ? 124  THR A CG2 1 
ATOM   1039 N N   . THR A 1 145 ? 10.863  44.465 27.643 1.00 21.44  ? 125  THR A N   1 
ATOM   1040 C CA  . THR A 1 145 ? 11.029  45.693 26.800 1.00 22.48  ? 125  THR A CA  1 
ATOM   1041 C C   . THR A 1 145 ? 11.561  45.270 25.403 1.00 26.26  ? 125  THR A C   1 
ATOM   1042 O O   . THR A 1 145 ? 12.278  44.278 25.299 1.00 23.32  ? 125  THR A O   1 
ATOM   1043 C CB  . THR A 1 145 ? 11.949  46.716 27.467 1.00 27.58  ? 125  THR A CB  1 
ATOM   1044 O OG1 . THR A 1 145 ? 13.244  46.148 27.678 1.00 26.91  ? 125  THR A OG1 1 
ATOM   1045 C CG2 . THR A 1 145 ? 11.382  47.185 28.825 1.00 27.59  ? 125  THR A CG2 1 
ATOM   1046 N N   . VAL A 1 146 ? 11.154  45.989 24.338 1.00 24.08  ? 126  VAL A N   1 
ATOM   1047 C CA  . VAL A 1 146 ? 11.534  45.651 22.959 1.00 23.86  ? 126  VAL A CA  1 
ATOM   1048 C C   . VAL A 1 146 ? 12.355  46.829 22.402 1.00 27.14  ? 126  VAL A C   1 
ATOM   1049 O O   . VAL A 1 146 ? 11.959  48.002 22.548 1.00 28.24  ? 126  VAL A O   1 
ATOM   1050 C CB  . VAL A 1 146 ? 10.248  45.365 22.100 1.00 25.73  ? 126  VAL A CB  1 
ATOM   1051 C CG1 . VAL A 1 146 ? 10.563  45.122 20.609 1.00 29.03  ? 126  VAL A CG1 1 
ATOM   1052 C CG2 . VAL A 1 146 ? 9.511   44.143 22.627 1.00 27.24  ? 126  VAL A CG2 1 
ATOM   1053 N N   . HIS A 1 147 ? 13.498  46.494 21.789 1.00 27.46  ? 127  HIS A N   1 
ATOM   1054 C CA  . HIS A 1 147 ? 14.490  47.521 21.367 1.00 26.73  ? 127  HIS A CA  1 
ATOM   1055 C C   . HIS A 1 147 ? 14.842  47.403 19.879 1.00 31.02  ? 127  HIS A C   1 
ATOM   1056 O O   . HIS A 1 147 ? 15.028  46.299 19.364 1.00 30.20  ? 127  HIS A O   1 
ATOM   1057 C CB  . HIS A 1 147 ? 15.734  47.374 22.253 1.00 28.56  ? 127  HIS A CB  1 
ATOM   1058 C CG  . HIS A 1 147 ? 15.398  47.393 23.709 1.00 26.51  ? 127  HIS A CG  1 
ATOM   1059 N ND1 . HIS A 1 147 ? 15.270  48.561 24.415 1.00 27.61  ? 127  HIS A ND1 1 
ATOM   1060 C CD2 . HIS A 1 147 ? 15.109  46.388 24.574 1.00 31.41  ? 127  HIS A CD2 1 
ATOM   1061 C CE1 . HIS A 1 147 ? 14.931  48.278 25.669 1.00 29.99  ? 127  HIS A CE1 1 
ATOM   1062 N NE2 . HIS A 1 147 ? 14.816  46.968 25.788 1.00 26.46  ? 127  HIS A NE2 1 
ATOM   1063 N N   . ARG A 1 148 ? 14.919  48.556 19.215 1.00 34.84  ? 128  ARG A N   1 
ATOM   1064 C CA  A ARG A 1 148 ? 15.226  48.687 17.800 0.50 62.98  ? 128  ARG A CA  1 
ATOM   1065 C CA  B ARG A 1 148 ? 15.236  48.617 17.752 0.50 16.72  ? 128  ARG A CA  1 
ATOM   1066 C C   . ARG A 1 148 ? 16.731  48.866 17.594 1.00 27.49  ? 128  ARG A C   1 
ATOM   1067 O O   . ARG A 1 148 ? 17.338  49.675 18.319 1.00 36.56  ? 128  ARG A O   1 
ATOM   1068 C CB  A ARG A 1 148 ? 14.517  49.943 17.293 0.50 15.79  ? 128  ARG A CB  1 
ATOM   1069 C CB  B ARG A 1 148 ? 14.443  49.739 17.069 0.50 82.55  ? 128  ARG A CB  1 
ATOM   1070 C CG  A ARG A 1 148 ? 14.775  50.217 15.801 0.50 66.88  ? 128  ARG A CG  1 
ATOM   1071 C CG  B ARG A 1 148 ? 14.737  49.941 15.567 0.50 32.07  ? 128  ARG A CG  1 
ATOM   1072 C CD  A ARG A 1 148 ? 14.059  51.454 15.288 0.50 33.98  ? 128  ARG A CD  1 
ATOM   1073 C CD  B ARG A 1 148 ? 13.748  50.915 14.933 0.50 47.52  ? 128  ARG A CD  1 
ATOM   1074 N NE  A ARG A 1 148 ? 13.670  51.287 13.889 0.50 103.69 ? 128  ARG A NE  1 
ATOM   1075 N NE  B ARG A 1 148 ? 13.951  51.000 13.488 0.50 39.57  ? 128  ARG A NE  1 
ATOM   1076 C CZ  A ARG A 1 148 ? 12.435  51.022 13.469 0.50 42.43  ? 128  ARG A CZ  1 
ATOM   1077 C CZ  B ARG A 1 148 ? 14.934  51.682 12.909 0.50 62.92  ? 128  ARG A CZ  1 
ATOM   1078 N NH1 A ARG A 1 148 ? 11.429  50.910 14.333 0.50 72.01  ? 128  ARG A NH1 1 
ATOM   1079 N NH1 B ARG A 1 148 ? 15.806  52.348 13.650 0.50 40.38  ? 128  ARG A NH1 1 
ATOM   1080 N NH2 A ARG A 1 148 ? 12.200  50.880 12.173 0.50 60.48  ? 128  ARG A NH2 1 
ATOM   1081 N NH2 B ARG A 1 148 ? 15.049  51.690 11.587 0.50 39.65  ? 128  ARG A NH2 1 
ATOM   1082 N N   . PHE A 1 149 ? 17.320  48.125 16.677 1.00 29.83  ? 129  PHE A N   1 
ATOM   1083 C CA  . PHE A 1 149 ? 18.677  48.323 16.255 1.00 37.06  ? 129  PHE A CA  1 
ATOM   1084 C C   . PHE A 1 149 ? 18.691  48.484 14.731 1.00 37.75  ? 129  PHE A C   1 
ATOM   1085 O O   . PHE A 1 149 ? 17.851  47.895 14.030 1.00 39.60  ? 129  PHE A O   1 
ATOM   1086 C CB  . PHE A 1 149 ? 19.559  47.162 16.726 1.00 35.01  ? 129  PHE A CB  1 
ATOM   1087 C CG  . PHE A 1 149 ? 19.893  47.247 18.179 1.00 35.32  ? 129  PHE A CG  1 
ATOM   1088 C CD1 . PHE A 1 149 ? 19.048  46.660 19.132 1.00 35.62  ? 129  PHE A CD1 1 
ATOM   1089 C CD2 . PHE A 1 149 ? 21.002  47.985 18.607 1.00 32.20  ? 129  PHE A CD2 1 
ATOM   1090 C CE1 . PHE A 1 149 ? 19.321  46.785 20.474 1.00 31.21  ? 129  PHE A CE1 1 
ATOM   1091 C CE2 . PHE A 1 149 ? 21.307  48.120 19.967 1.00 35.19  ? 129  PHE A CE2 1 
ATOM   1092 C CZ  . PHE A 1 149 ? 20.445  47.516 20.921 1.00 36.63  ? 129  PHE A CZ  1 
ATOM   1093 N N   . GLU A 1 150 ? 19.585  49.344 14.252 1.00 47.68  ? 130  GLU A N   1 
ATOM   1094 C CA  . GLU A 1 150 ? 19.836  49.492 12.816 1.00 46.83  ? 130  GLU A CA  1 
ATOM   1095 C C   . GLU A 1 150 ? 21.330  49.704 12.537 1.00 52.24  ? 130  GLU A C   1 
ATOM   1096 O O   . GLU A 1 150 ? 22.015  50.472 13.230 1.00 54.11  ? 130  GLU A O   1 
ATOM   1097 C CB  . GLU A 1 150 ? 18.996  50.615 12.205 1.00 48.19  ? 130  GLU A CB  1 
ATOM   1098 C CG  . GLU A 1 150 ? 19.416  50.934 10.758 1.00 74.29  ? 130  GLU A CG  1 
ATOM   1099 C CD  . GLU A 1 150 ? 18.274  51.326 9.847  1.00 159.32 ? 130  GLU A CD  1 
ATOM   1100 O OE1 . GLU A 1 150 ? 17.299  51.940 10.327 1.00 77.16  ? 130  GLU A OE1 1 
ATOM   1101 O OE2 . GLU A 1 150 ? 18.369  51.027 8.635  1.00 92.35  ? 130  GLU A OE2 1 
ATOM   1102 N N   . LYS A 1 151 ? 21.833  48.981 11.544 1.00 58.52  ? 131  LYS A N   1 
ATOM   1103 C CA  . LYS A 1 151 ? 23.201  49.160 11.095 1.00 55.88  ? 131  LYS A CA  1 
ATOM   1104 C C   . LYS A 1 151 ? 23.217  48.775 9.638  1.00 55.51  ? 131  LYS A C   1 
ATOM   1105 O O   . LYS A 1 151 ? 22.503  47.853 9.229  1.00 66.81  ? 131  LYS A O   1 
ATOM   1106 C CB  . LYS A 1 151 ? 24.176  48.282 11.879 1.00 50.68  ? 131  LYS A CB  1 
ATOM   1107 C CG  . LYS A 1 151 ? 25.618  48.813 11.926 1.00 73.33  ? 131  LYS A CG  1 
ATOM   1108 C CD  . LYS A 1 151 ? 25.865  49.781 13.105 1.00 103.42 ? 131  LYS A CD  1 
ATOM   1109 C CE  . LYS A 1 151 ? 25.377  51.216 12.836 1.00 194.78 ? 131  LYS A CE  1 
ATOM   1110 N NZ  . LYS A 1 151 ? 26.103  51.935 11.736 1.00 96.77  ? 131  LYS A NZ  1 
ATOM   1111 N N   . GLU A 1 152 ? 24.047  49.480 8.869  1.00 104.68 ? 132  GLU A N   1 
ATOM   1112 C CA  . GLU A 1 152 ? 24.100  49.326 7.421  1.00 73.08  ? 132  GLU A CA  1 
ATOM   1113 C C   . GLU A 1 152 ? 22.668  49.411 6.911  1.00 95.50  ? 132  GLU A C   1 
ATOM   1114 O O   . GLU A 1 152 ? 21.930  50.333 7.267  1.00 53.92  ? 132  GLU A O   1 
ATOM   1115 C CB  . GLU A 1 152 ? 24.744  47.981 7.028  1.00 89.55  ? 132  GLU A CB  1 
ATOM   1116 C CG  . GLU A 1 152 ? 26.067  47.653 7.732  1.00 141.88 ? 132  GLU A CG  1 
ATOM   1117 C CD  . GLU A 1 152 ? 27.229  48.520 7.270  1.00 194.96 ? 132  GLU A CD  1 
ATOM   1118 O OE1 . GLU A 1 152 ? 27.287  48.871 6.071  1.00 182.51 ? 132  GLU A OE1 1 
ATOM   1119 O OE2 . GLU A 1 152 ? 28.095  48.843 8.110  1.00 208.67 ? 132  GLU A OE2 1 
ATOM   1120 N N   . ASN A 1 153 ? 22.267  48.435 6.109  1.00 72.57  ? 133  ASN A N   1 
ATOM   1121 C CA  . ASN A 1 153 ? 20.886  48.342 5.678  1.00 106.72 ? 133  ASN A CA  1 
ATOM   1122 C C   . ASN A 1 153 ? 19.950  47.837 6.770  1.00 120.87 ? 133  ASN A C   1 
ATOM   1123 O O   . ASN A 1 153 ? 18.770  48.199 6.787  1.00 86.06  ? 133  ASN A O   1 
ATOM   1124 C CB  . ASN A 1 153 ? 20.776  47.429 4.456  1.00 112.27 ? 133  ASN A CB  1 
ATOM   1125 C CG  . ASN A 1 153 ? 21.360  48.055 3.203  1.00 179.36 ? 133  ASN A CG  1 
ATOM   1126 O OD1 . ASN A 1 153 ? 22.216  48.942 3.271  1.00 178.50 ? 133  ASN A OD1 1 
ATOM   1127 N ND2 . ASN A 1 153 ? 20.897  47.592 2.045  1.00 96.18  ? 133  ASN A ND2 1 
ATOM   1128 N N   . ARG A 1 154 ? 20.475  47.027 7.691  1.00 56.66  ? 134  ARG A N   1 
ATOM   1129 C CA  . ARG A 1 154 ? 19.606  46.121 8.450  1.00 47.20  ? 134  ARG A CA  1 
ATOM   1130 C C   . ARG A 1 154 ? 19.029  46.643 9.773  1.00 43.02  ? 134  ARG A C   1 
ATOM   1131 O O   . ARG A 1 154 ? 19.713  47.334 10.530 1.00 49.21  ? 134  ARG A O   1 
ATOM   1132 C CB  . ARG A 1 154 ? 20.225  44.728 8.609  1.00 53.36  ? 134  ARG A CB  1 
ATOM   1133 C CG  . ARG A 1 154 ? 21.684  44.709 9.010  1.00 71.89  ? 134  ARG A CG  1 
ATOM   1134 C CD  . ARG A 1 154 ? 22.158  43.278 9.242  1.00 166.37 ? 134  ARG A CD  1 
ATOM   1135 N NE  . ARG A 1 154 ? 22.055  42.872 10.646 1.00 203.22 ? 134  ARG A NE  1 
ATOM   1136 C CZ  . ARG A 1 154 ? 21.105  42.088 11.157 1.00 148.14 ? 134  ARG A CZ  1 
ATOM   1137 N NH1 . ARG A 1 154 ? 20.131  41.591 10.399 1.00 80.96  ? 134  ARG A NH1 1 
ATOM   1138 N NH2 . ARG A 1 154 ? 21.134  41.793 12.450 1.00 120.75 ? 134  ARG A NH2 1 
ATOM   1139 N N   . ILE A 1 155 ? 17.754  46.315 9.989  1.00 49.62  ? 135  ILE A N   1 
ATOM   1140 C CA  . ILE A 1 155 ? 17.016  46.610 11.229 1.00 40.97  ? 135  ILE A CA  1 
ATOM   1141 C C   . ILE A 1 155 ? 16.826  45.282 11.971 1.00 40.16  ? 135  ILE A C   1 
ATOM   1142 O O   . ILE A 1 155 ? 16.534  44.261 11.367 1.00 38.41  ? 135  ILE A O   1 
ATOM   1143 C CB  . ILE A 1 155 ? 15.626  47.225 10.901 1.00 45.05  ? 135  ILE A CB  1 
ATOM   1144 C CG1 . ILE A 1 155 ? 15.802  48.526 10.102 1.00 50.43  ? 135  ILE A CG1 1 
ATOM   1145 C CG2 . ILE A 1 155 ? 14.820  47.495 12.165 1.00 44.61  ? 135  ILE A CG2 1 
ATOM   1146 C CD1 . ILE A 1 155 ? 14.544  49.005 9.384  1.00 57.98  ? 135  ILE A CD1 1 
ATOM   1147 N N   . TRP A 1 156 ? 17.011  45.271 13.289 1.00 32.66  ? 136  TRP A N   1 
ATOM   1148 C CA  . TRP A 1 156 ? 16.675  44.040 14.030 1.00 32.70  ? 136  TRP A CA  1 
ATOM   1149 C C   . TRP A 1 156 ? 16.241  44.491 15.427 1.00 36.55  ? 136  TRP A C   1 
ATOM   1150 O O   . TRP A 1 156 ? 16.214  45.705 15.726 1.00 30.32  ? 136  TRP A O   1 
ATOM   1151 C CB  . TRP A 1 156 ? 17.863  43.064 14.174 1.00 29.68  ? 136  TRP A CB  1 
ATOM   1152 C CG  . TRP A 1 156 ? 19.035  43.561 14.969 1.00 37.32  ? 136  TRP A CG  1 
ATOM   1153 C CD1 . TRP A 1 156 ? 19.335  43.254 16.269 1.00 35.85  ? 136  TRP A CD1 1 
ATOM   1154 C CD2 . TRP A 1 156 ? 20.116  44.366 14.488 1.00 36.94  ? 136  TRP A CD2 1 
ATOM   1155 N NE1 . TRP A 1 156 ? 20.513  43.863 16.651 1.00 33.59  ? 136  TRP A NE1 1 
ATOM   1156 C CE2 . TRP A 1 156 ? 21.018  44.552 15.569 1.00 32.16  ? 136  TRP A CE2 1 
ATOM   1157 C CE3 . TRP A 1 156 ? 20.399  44.980 13.248 1.00 40.35  ? 136  TRP A CE3 1 
ATOM   1158 C CZ2 . TRP A 1 156 ? 22.188  45.317 15.452 1.00 43.52  ? 136  TRP A CZ2 1 
ATOM   1159 C CZ3 . TRP A 1 156 ? 21.566  45.760 13.137 1.00 41.20  ? 136  TRP A CZ3 1 
ATOM   1160 C CH2 . TRP A 1 156 ? 22.449  45.907 14.224 1.00 40.80  ? 136  TRP A CH2 1 
ATOM   1161 N N   . THR A 1 157 ? 15.951  43.505 16.269 1.00 36.71  ? 137  THR A N   1 
ATOM   1162 C CA  . THR A 1 157 ? 15.301  43.767 17.563 1.00 26.40  ? 137  THR A CA  1 
ATOM   1163 C C   . THR A 1 157 ? 16.086  43.018 18.612 1.00 27.83  ? 137  THR A C   1 
ATOM   1164 O O   . THR A 1 157 ? 16.641  41.943 18.349 1.00 30.83  ? 137  THR A O   1 
ATOM   1165 C CB  . THR A 1 157 ? 13.859  43.185 17.551 1.00 34.45  ? 137  THR A CB  1 
ATOM   1166 O OG1 . THR A 1 157 ? 13.074  43.869 16.589 1.00 36.54  ? 137  THR A OG1 1 
ATOM   1167 C CG2 . THR A 1 157 ? 13.163  43.296 18.940 1.00 29.20  ? 137  THR A CG2 1 
ATOM   1168 N N   . VAL A 1 158 ? 16.091  43.579 19.818 1.00 30.82  ? 138  VAL A N   1 
ATOM   1169 C CA  . VAL A 1 158 ? 16.545  42.849 21.006 1.00 25.28  ? 138  VAL A CA  1 
ATOM   1170 C C   . VAL A 1 158 ? 15.417  42.958 22.015 1.00 20.85  ? 138  VAL A C   1 
ATOM   1171 O O   . VAL A 1 158 ? 14.925  44.050 22.273 1.00 25.68  ? 138  VAL A O   1 
ATOM   1172 C CB  . VAL A 1 158 ? 17.821  43.411 21.600 1.00 26.50  ? 138  VAL A CB  1 
ATOM   1173 C CG1 . VAL A 1 158 ? 18.134  42.730 22.943 1.00 28.88  ? 138  VAL A CG1 1 
ATOM   1174 C CG2 . VAL A 1 158 ? 19.009  43.204 20.606 1.00 29.59  ? 138  VAL A CG2 1 
ATOM   1175 N N   . VAL A 1 159 ? 15.029  41.798 22.540 1.00 20.39  ? 139  VAL A N   1 
ATOM   1176 C CA  . VAL A 1 159 ? 14.007  41.788 23.629 1.00 23.32  ? 139  VAL A CA  1 
ATOM   1177 C C   . VAL A 1 159 ? 14.755  41.530 24.912 1.00 27.24  ? 139  VAL A C   1 
ATOM   1178 O O   . VAL A 1 159 ? 15.660  40.683 24.945 1.00 24.57  ? 139  VAL A O   1 
ATOM   1179 C CB  . VAL A 1 159 ? 12.927  40.681 23.402 1.00 25.35  ? 139  VAL A CB  1 
ATOM   1180 C CG1 . VAL A 1 159 ? 11.935  40.638 24.538 1.00 28.43  ? 139  VAL A CG1 1 
ATOM   1181 C CG2 . VAL A 1 159 ? 12.217  40.838 22.028 1.00 33.46  ? 139  VAL A CG2 1 
ATOM   1182 N N   . LEU A 1 160 ? 14.433  42.311 25.934 1.00 22.36  ? 140  LEU A N   1 
ATOM   1183 C CA  . LEU A 1 160 ? 14.897  42.060 27.310 1.00 19.26  ? 140  LEU A CA  1 
ATOM   1184 C C   . LEU A 1 160 ? 13.706  41.621 28.145 1.00 24.01  ? 140  LEU A C   1 
ATOM   1185 O O   . LEU A 1 160 ? 12.689  42.266 28.088 1.00 24.65  ? 140  LEU A O   1 
ATOM   1186 C CB  . LEU A 1 160 ? 15.413  43.346 27.916 1.00 25.55  ? 140  LEU A CB  1 
ATOM   1187 C CG  . LEU A 1 160 ? 16.701  43.894 27.245 1.00 24.77  ? 140  LEU A CG  1 
ATOM   1188 C CD1 . LEU A 1 160 ? 17.168  45.151 27.985 1.00 28.54  ? 140  LEU A CD1 1 
ATOM   1189 C CD2 . LEU A 1 160 ? 17.786  42.838 27.153 1.00 25.39  ? 140  LEU A CD2 1 
ATOM   1190 N N   . GLU A 1 161 ? 13.873  40.573 28.916 1.00 21.60  ? 141  GLU A N   1 
ATOM   1191 C CA  . GLU A 1 161 ? 12.837  40.149 29.891 1.00 19.73  ? 141  GLU A CA  1 
ATOM   1192 C C   . GLU A 1 161 ? 13.527  39.944 31.253 1.00 20.76  ? 141  GLU A C   1 
ATOM   1193 O O   . GLU A 1 161 ? 14.550  39.223 31.343 1.00 22.85  ? 141  GLU A O   1 
ATOM   1194 C CB  . GLU A 1 161 ? 12.181  38.881 29.430 1.00 23.30  ? 141  GLU A CB  1 
ATOM   1195 C CG  . GLU A 1 161 ? 11.000  38.537 30.417 1.00 27.27  ? 141  GLU A CG  1 
ATOM   1196 C CD  . GLU A 1 161 ? 10.093  37.434 29.924 1.00 66.32  ? 141  GLU A CD  1 
ATOM   1197 O OE1 . GLU A 1 161 ? 10.180  37.082 28.729 1.00 40.97  ? 141  GLU A OE1 1 
ATOM   1198 O OE2 . GLU A 1 161 ? 9.275   36.936 30.731 1.00 53.67  ? 141  GLU A OE2 1 
ATOM   1199 N N   . SER A 1 162 ? 13.000  40.567 32.312 1.00 19.73  ? 142  SER A N   1 
ATOM   1200 C CA  . SER A 1 162 ? 13.585  40.344 33.636 1.00 18.69  ? 142  SER A CA  1 
ATOM   1201 C C   . SER A 1 162 ? 12.491  39.935 34.565 1.00 23.51  ? 142  SER A C   1 
ATOM   1202 O O   . SER A 1 162 ? 11.294  40.148 34.232 1.00 21.27  ? 142  SER A O   1 
ATOM   1203 C CB  . SER A 1 162 ? 14.216  41.599 34.199 1.00 21.00  ? 142  SER A CB  1 
ATOM   1204 O OG  . SER A 1 162 ? 13.300  42.700 34.341 1.00 24.89  ? 142  SER A OG  1 
ATOM   1205 N N   . TYR A 1 163 ? 12.831  39.321 35.669 1.00 19.08  ? 143  TYR A N   1 
ATOM   1206 C CA  . TYR A 1 163 ? 11.760  39.084 36.696 1.00 20.70  ? 143  TYR A CA  1 
ATOM   1207 C C   . TYR A 1 163 ? 12.376  39.125 38.076 1.00 26.98  ? 143  TYR A C   1 
ATOM   1208 O O   . TYR A 1 163 ? 13.621  39.126 38.214 1.00 22.46  ? 143  TYR A O   1 
ATOM   1209 C CB  . TYR A 1 163 ? 11.106  37.730 36.427 1.00 19.60  ? 143  TYR A CB  1 
ATOM   1210 C CG  . TYR A 1 163 ? 12.033  36.550 36.629 1.00 25.44  ? 143  TYR A CG  1 
ATOM   1211 C CD1 . TYR A 1 163 ? 12.284  36.078 37.916 1.00 26.04  ? 143  TYR A CD1 1 
ATOM   1212 C CD2 . TYR A 1 163 ? 12.696  35.967 35.554 1.00 33.47  ? 143  TYR A CD2 1 
ATOM   1213 C CE1 . TYR A 1 163 ? 13.114  34.996 38.137 1.00 34.11  ? 143  TYR A CE1 1 
ATOM   1214 C CE2 . TYR A 1 163 ? 13.570  34.880 35.756 1.00 29.76  ? 143  TYR A CE2 1 
ATOM   1215 C CZ  . TYR A 1 163 ? 13.776  34.414 37.052 1.00 33.32  ? 143  TYR A CZ  1 
ATOM   1216 O OH  . TYR A 1 163 ? 14.647  33.354 37.316 1.00 48.62  ? 143  TYR A OH  1 
ATOM   1217 N N   . VAL A 1 164 ? 11.538  39.237 39.102 1.00 20.69  ? 144  VAL A N   1 
ATOM   1218 C CA  A VAL A 1 164 ? 11.973  39.218 40.511 0.50 18.67  ? 144  VAL A CA  1 
ATOM   1219 C CA  B VAL A 1 164 ? 12.006  39.078 40.467 0.50 22.53  ? 144  VAL A CA  1 
ATOM   1220 C C   . VAL A 1 164 ? 11.068  38.123 41.118 1.00 30.20  ? 144  VAL A C   1 
ATOM   1221 O O   . VAL A 1 164 ? 9.893   38.024 40.737 1.00 24.02  ? 144  VAL A O   1 
ATOM   1222 C CB  A VAL A 1 164 ? 11.857  40.659 41.142 0.50 35.81  ? 144  VAL A CB  1 
ATOM   1223 C CB  B VAL A 1 164 ? 11.896  40.325 41.224 0.50 15.53  ? 144  VAL A CB  1 
ATOM   1224 C CG1 A VAL A 1 164 ? 10.439  41.189 41.158 0.50 15.88  ? 144  VAL A CG1 1 
ATOM   1225 C CG1 B VAL A 1 164 ? 12.221  40.041 42.675 0.50 18.58  ? 144  VAL A CG1 1 
ATOM   1226 C CG2 A VAL A 1 164 ? 12.435  40.748 42.542 0.50 17.02  ? 144  VAL A CG2 1 
ATOM   1227 C CG2 B VAL A 1 164 ? 12.880  41.308 40.732 0.50 32.14  ? 144  VAL A CG2 1 
ATOM   1228 N N   . VAL A 1 165 ? 11.588  37.345 42.036 1.00 25.04  ? 145  VAL A N   1 
ATOM   1229 C CA  . VAL A 1 165 ? 10.766  36.252 42.642 1.00 21.93  ? 145  VAL A CA  1 
ATOM   1230 C C   . VAL A 1 165 ? 11.302  36.027 44.029 1.00 41.14  ? 145  VAL A C   1 
ATOM   1231 O O   . VAL A 1 165 ? 12.498  36.249 44.287 1.00 27.67  ? 145  VAL A O   1 
ATOM   1232 C CB  . VAL A 1 165 ? 10.787  34.991 41.797 1.00 24.42  ? 145  VAL A CB  1 
ATOM   1233 C CG1 . VAL A 1 165 ? 12.168  34.268 41.840 1.00 27.13  ? 145  VAL A CG1 1 
ATOM   1234 C CG2 . VAL A 1 165 ? 9.721   34.002 42.265 1.00 37.52  ? 145  VAL A CG2 1 
ATOM   1235 N N   . ASP A 1 166 ? 10.442  35.621 44.950 1.00 31.49  ? 146  ASP A N   1 
ATOM   1236 C CA  . ASP A 1 166 ? 10.976  35.137 46.227 1.00 32.38  ? 146  ASP A CA  1 
ATOM   1237 C C   . ASP A 1 166 ? 11.729  33.844 46.092 1.00 34.36  ? 146  ASP A C   1 
ATOM   1238 O O   . ASP A 1 166 ? 11.396  32.979 45.282 1.00 43.78  ? 146  ASP A O   1 
ATOM   1239 C CB  . ASP A 1 166 ? 9.849   34.959 47.259 1.00 43.18  ? 146  ASP A CB  1 
ATOM   1240 C CG  . ASP A 1 166 ? 9.062   36.243 47.523 1.00 51.82  ? 146  ASP A CG  1 
ATOM   1241 O OD1 . ASP A 1 166 ? 9.517   37.377 47.204 1.00 45.18  ? 146  ASP A OD1 1 
ATOM   1242 O OD2 . ASP A 1 166 ? 7.950   36.122 48.089 1.00 85.09  ? 146  ASP A OD2 1 
ATOM   1243 N N   . MET A 1 167 ? 12.790  33.700 46.887 1.00 37.27  ? 147  MET A N   1 
ATOM   1244 C CA  . MET A 1 167 ? 13.594  32.493 46.907 1.00 39.75  ? 147  MET A CA  1 
ATOM   1245 C C   . MET A 1 167 ? 12.815  31.523 47.804 1.00 50.97  ? 147  MET A C   1 
ATOM   1246 O O   . MET A 1 167 ? 12.178  31.955 48.774 1.00 44.20  ? 147  MET A O   1 
ATOM   1247 C CB  . MET A 1 167 ? 14.999  32.790 47.496 1.00 43.76  ? 147  MET A CB  1 
ATOM   1248 C CG  . MET A 1 167 ? 15.818  33.886 46.705 1.00 45.62  ? 147  MET A CG  1 
ATOM   1249 S SD  . MET A 1 167 ? 17.563  34.164 47.195 1.00 51.46  ? 147  MET A SD  1 
ATOM   1250 C CE  . MET A 1 167 ? 17.455  35.253 48.611 1.00 39.77  ? 147  MET A CE  1 
ATOM   1251 N N   . PRO A 1 168 ? 12.858  30.218 47.499 1.00 75.46  ? 148  PRO A N   1 
ATOM   1252 C CA  . PRO A 1 168 ? 12.060  29.298 48.303 1.00 58.32  ? 148  PRO A CA  1 
ATOM   1253 C C   . PRO A 1 168 ? 12.756  29.104 49.634 1.00 75.91  ? 148  PRO A C   1 
ATOM   1254 O O   . PRO A 1 168 ? 13.996  29.062 49.676 1.00 59.28  ? 148  PRO A O   1 
ATOM   1255 C CB  . PRO A 1 168 ? 12.099  27.991 47.507 1.00 86.17  ? 148  PRO A CB  1 
ATOM   1256 C CG  . PRO A 1 168 ? 12.914  28.261 46.305 1.00 62.45  ? 148  PRO A CG  1 
ATOM   1257 C CD  . PRO A 1 168 ? 13.654  29.520 46.480 1.00 57.88  ? 148  PRO A CD  1 
ATOM   1258 N N   . GLU A 1 169 ? 11.984  29.010 50.713 1.00 71.33  ? 149  GLU A N   1 
ATOM   1259 C CA  . GLU A 1 169 ? 12.594  28.829 52.027 1.00 121.08 ? 149  GLU A CA  1 
ATOM   1260 C C   . GLU A 1 169 ? 12.833  27.347 52.303 1.00 129.11 ? 149  GLU A C   1 
ATOM   1261 O O   . GLU A 1 169 ? 12.143  26.731 53.122 1.00 155.84 ? 149  GLU A O   1 
ATOM   1262 C CB  . GLU A 1 169 ? 11.767  29.486 53.136 1.00 70.78  ? 149  GLU A CB  1 
ATOM   1263 C CG  . GLU A 1 169 ? 12.597  30.322 54.118 1.00 104.98 ? 149  GLU A CG  1 
ATOM   1264 C CD  . GLU A 1 169 ? 13.849  29.610 54.617 1.00 194.91 ? 149  GLU A CD  1 
ATOM   1265 O OE1 . GLU A 1 169 ? 14.961  30.142 54.402 1.00 191.32 ? 149  GLU A OE1 1 
ATOM   1266 O OE2 . GLU A 1 169 ? 13.725  28.519 55.215 1.00 230.84 ? 149  GLU A OE2 1 
ATOM   1267 N N   . GLY A 1 170 ? 13.818  26.787 51.601 1.00 96.25  ? 150  GLY A N   1 
ATOM   1268 C CA  . GLY A 1 170 ? 14.148  25.371 51.715 1.00 66.90  ? 150  GLY A CA  1 
ATOM   1269 C C   . GLY A 1 170 ? 15.376  24.900 50.956 1.00 155.33 ? 150  GLY A C   1 
ATOM   1270 O O   . GLY A 1 170 ? 15.964  25.645 50.165 1.00 125.80 ? 150  GLY A O   1 
ATOM   1271 N N   . ASN A 1 171 ? 15.759  23.651 51.215 1.00 164.65 ? 151  ASN A N   1 
ATOM   1272 C CA  . ASN A 1 171 ? 16.856  22.996 50.506 1.00 158.43 ? 151  ASN A CA  1 
ATOM   1273 C C   . ASN A 1 171 ? 16.417  22.471 49.136 1.00 144.22 ? 151  ASN A C   1 
ATOM   1274 O O   . ASN A 1 171 ? 17.248  22.255 48.252 1.00 92.69  ? 151  ASN A O   1 
ATOM   1275 C CB  . ASN A 1 171 ? 17.453  21.869 51.355 1.00 66.38  ? 151  ASN A CB  1 
ATOM   1276 C CG  . ASN A 1 171 ? 18.481  22.366 52.359 1.00 187.47 ? 151  ASN A CG  1 
ATOM   1277 O OD1 . ASN A 1 171 ? 19.650  22.612 52.016 1.00 58.03  ? 151  ASN A OD1 1 
ATOM   1278 N ND2 . ASN A 1 171 ? 18.057  22.494 53.615 1.00 46.78  ? 151  ASN A ND2 1 
ATOM   1279 N N   . SER A 1 172 ? 15.110  22.254 48.987 1.00 156.50 ? 152  SER A N   1 
ATOM   1280 C CA  . SER A 1 172 ? 14.472  21.960 47.699 1.00 170.53 ? 152  SER A CA  1 
ATOM   1281 C C   . SER A 1 172 ? 12.947  22.012 47.829 1.00 182.76 ? 152  SER A C   1 
ATOM   1282 O O   . SER A 1 172 ? 12.227  21.256 47.166 1.00 156.82 ? 152  SER A O   1 
ATOM   1283 C CB  . SER A 1 172 ? 14.923  20.609 47.133 1.00 173.96 ? 152  SER A CB  1 
ATOM   1284 O OG  . SER A 1 172 ? 14.377  20.390 45.843 1.00 178.63 ? 152  SER A OG  1 
ATOM   1285 N N   . GLU A 1 173 ? 12.468  22.910 48.691 1.00 189.65 ? 153  GLU A N   1 
ATOM   1286 C CA  . GLU A 1 173 ? 11.036  23.133 48.890 1.00 175.09 ? 153  GLU A CA  1 
ATOM   1287 C C   . GLU A 1 173 ? 10.436  23.836 47.677 1.00 172.16 ? 153  GLU A C   1 
ATOM   1288 O O   . GLU A 1 173 ? 10.226  25.054 47.690 1.00 149.11 ? 153  GLU A O   1 
ATOM   1289 C CB  . GLU A 1 173 ? 10.784  23.957 50.157 1.00 139.69 ? 153  GLU A CB  1 
ATOM   1290 C CG  . GLU A 1 173 ? 10.944  23.182 51.453 1.00 105.77 ? 153  GLU A CG  1 
ATOM   1291 C CD  . GLU A 1 173 ? 10.556  23.992 52.682 1.00 187.61 ? 153  GLU A CD  1 
ATOM   1292 O OE1 . GLU A 1 173 ? 9.931   25.100 52.521 1.00 240.62 ? 153  GLU A OE1 1 
ATOM   1293 O OE2 . GLU A 1 173 ? 10.874  23.516 53.818 1.00 210.71 ? 153  GLU A OE2 1 
ATOM   1294 N N   . ASP A 1 174 ? 10.166  23.050 46.633 1.00 153.08 ? 154  ASP A N   1 
ATOM   1295 C CA  . ASP A 1 174 ? 9.713   23.564 45.340 1.00 151.62 ? 154  ASP A CA  1 
ATOM   1296 C C   . ASP A 1 174 ? 10.530  24.777 44.903 1.00 130.14 ? 154  ASP A C   1 
ATOM   1297 O O   . ASP A 1 174 ? 9.985   25.846 44.590 1.00 87.98  ? 154  ASP A O   1 
ATOM   1298 C CB  . ASP A 1 174 ? 8.207   23.859 45.355 1.00 179.83 ? 154  ASP A CB  1 
ATOM   1299 C CG  . ASP A 1 174 ? 7.363   22.595 45.459 1.00 218.81 ? 154  ASP A CG  1 
ATOM   1300 O OD1 . ASP A 1 174 ? 6.312   22.639 46.142 1.00 257.11 ? 154  ASP A OD1 1 
ATOM   1301 O OD2 . ASP A 1 174 ? 7.747   21.559 44.863 1.00 220.53 ? 154  ASP A OD2 1 
ATOM   1302 N N   . ASP A 1 175 ? 11.848  24.600 44.915 1.00 112.85 ? 155  ASP A N   1 
ATOM   1303 C CA  . ASP A 1 175 ? 12.769  25.616 44.437 1.00 111.55 ? 155  ASP A CA  1 
ATOM   1304 C C   . ASP A 1 175 ? 12.798  25.530 42.920 1.00 89.01  ? 155  ASP A C   1 
ATOM   1305 O O   . ASP A 1 175 ? 13.578  24.771 42.353 1.00 57.69  ? 155  ASP A O   1 
ATOM   1306 C CB  . ASP A 1 175 ? 14.166  25.423 45.051 1.00 47.96  ? 155  ASP A CB  1 
ATOM   1307 C CG  . ASP A 1 175 ? 15.239  26.228 44.334 1.00 200.34 ? 155  ASP A CG  1 
ATOM   1308 O OD1 . ASP A 1 175 ? 15.191  27.475 44.382 1.00 71.39  ? 155  ASP A OD1 1 
ATOM   1309 O OD2 . ASP A 1 175 ? 16.126  25.607 43.712 1.00 227.44 ? 155  ASP A OD2 1 
ATOM   1310 N N   . THR A 1 176 ? 11.941  26.329 42.285 1.00 78.20  ? 156  THR A N   1 
ATOM   1311 C CA  . THR A 1 176 ? 11.590  26.190 40.867 1.00 52.00  ? 156  THR A CA  1 
ATOM   1312 C C   . THR A 1 176 ? 12.172  27.318 39.994 1.00 121.19 ? 156  THR A C   1 
ATOM   1313 O O   . THR A 1 176 ? 11.841  27.451 38.803 1.00 62.67  ? 156  THR A O   1 
ATOM   1314 C CB  . THR A 1 176 ? 10.024  26.087 40.718 1.00 76.67  ? 156  THR A CB  1 
ATOM   1315 O OG1 . THR A 1 176 ? 9.550   24.934 41.428 1.00 67.41  ? 156  THR A OG1 1 
ATOM   1316 C CG2 . THR A 1 176 ? 9.582   25.972 39.264 1.00 49.38  ? 156  THR A CG2 1 
ATOM   1317 N N   . ARG A 1 177 ? 13.062  28.113 40.578 1.00 66.23  ? 157  ARG A N   1 
ATOM   1318 C CA  . ARG A 1 177 ? 13.589  29.296 39.890 1.00 51.20  ? 157  ARG A CA  1 
ATOM   1319 C C   . ARG A 1 177 ? 14.531  28.990 38.718 1.00 83.09  ? 157  ARG A C   1 
ATOM   1320 O O   . ARG A 1 177 ? 14.677  29.808 37.811 1.00 56.13  ? 157  ARG A O   1 
ATOM   1321 C CB  . ARG A 1 177 ? 14.311  30.216 40.865 1.00 57.19  ? 157  ARG A CB  1 
ATOM   1322 C CG  . ARG A 1 177 ? 13.479  30.652 42.066 1.00 62.79  ? 157  ARG A CG  1 
ATOM   1323 C CD  . ARG A 1 177 ? 14.368  31.285 43.127 1.00 126.29 ? 157  ARG A CD  1 
ATOM   1324 N NE  . ARG A 1 177 ? 15.358  30.340 43.644 1.00 83.91  ? 157  ARG A NE  1 
ATOM   1325 C CZ  . ARG A 1 177 ? 16.498  30.686 44.235 1.00 143.59 ? 157  ARG A CZ  1 
ATOM   1326 N NH1 . ARG A 1 177 ? 16.815  31.964 44.377 1.00 47.09  ? 157  ARG A NH1 1 
ATOM   1327 N NH2 . ARG A 1 177 ? 17.330  29.752 44.674 1.00 58.84  ? 157  ARG A NH2 1 
ATOM   1328 N N   . MET A 1 178 ? 15.193  27.836 38.748 1.00 45.57  ? 158  MET A N   1 
ATOM   1329 C CA  . MET A 1 178 ? 15.986  27.387 37.594 1.00 38.86  ? 158  MET A CA  1 
ATOM   1330 C C   . MET A 1 178 ? 15.022  27.110 36.444 1.00 45.67  ? 158  MET A C   1 
ATOM   1331 O O   . MET A 1 178 ? 15.308  27.395 35.280 1.00 42.13  ? 158  MET A O   1 
ATOM   1332 C CB  . MET A 1 178 ? 16.767  26.098 37.910 1.00 44.24  ? 158  MET A CB  1 
ATOM   1333 C CG  . MET A 1 178 ? 18.214  26.099 37.427 1.00 69.16  ? 158  MET A CG  1 
ATOM   1334 S SD  . MET A 1 178 ? 18.423  25.857 35.651 1.00 182.78 ? 158  MET A SD  1 
ATOM   1335 C CE  . MET A 1 178 ? 18.491  27.541 35.038 1.00 84.49  ? 158  MET A CE  1 
ATOM   1336 N N   . PHE A 1 179 ? 13.874  26.536 36.787 1.00 41.65  ? 159  PHE A N   1 
ATOM   1337 C CA  . PHE A 1 179 ? 12.830  26.273 35.792 1.00 57.77  ? 159  PHE A CA  1 
ATOM   1338 C C   . PHE A 1 179 ? 12.282  27.595 35.208 1.00 40.35  ? 159  PHE A C   1 
ATOM   1339 O O   . PHE A 1 179 ? 12.111  27.691 33.984 1.00 43.17  ? 159  PHE A O   1 
ATOM   1340 C CB  . PHE A 1 179 ? 11.718  25.387 36.373 1.00 75.45  ? 159  PHE A CB  1 
ATOM   1341 C CG  . PHE A 1 179 ? 10.659  25.009 35.378 1.00 46.62  ? 159  PHE A CG  1 
ATOM   1342 C CD1 . PHE A 1 179 ? 9.380   25.545 35.474 1.00 63.96  ? 159  PHE A CD1 1 
ATOM   1343 C CD2 . PHE A 1 179 ? 10.952  24.135 34.320 1.00 47.91  ? 159  PHE A CD2 1 
ATOM   1344 C CE1 . PHE A 1 179 ? 8.391   25.213 34.539 1.00 50.30  ? 159  PHE A CE1 1 
ATOM   1345 C CE2 . PHE A 1 179 ? 9.975   23.786 33.382 1.00 52.47  ? 159  PHE A CE2 1 
ATOM   1346 C CZ  . PHE A 1 179 ? 8.685   24.320 33.497 1.00 59.51  ? 159  PHE A CZ  1 
ATOM   1347 N N   . ALA A 1 180 ? 12.032  28.585 36.069 1.00 50.46  ? 160  ALA A N   1 
ATOM   1348 C CA  . ALA A 1 180 ? 11.767  29.959 35.639 1.00 49.52  ? 160  ALA A CA  1 
ATOM   1349 C C   . ALA A 1 180 ? 12.824  30.516 34.703 1.00 46.16  ? 160  ALA A C   1 
ATOM   1350 O O   . ALA A 1 180 ? 12.469  31.051 33.647 1.00 40.94  ? 160  ALA A O   1 
ATOM   1351 C CB  . ALA A 1 180 ? 11.581  30.886 36.824 1.00 55.48  ? 160  ALA A CB  1 
ATOM   1352 N N   . ASP A 1 181 ? 14.116  30.416 35.060 1.00 29.29  ? 161  ASP A N   1 
ATOM   1353 C CA  . ASP A 1 181 ? 15.120  30.884 34.128 1.00 29.57  ? 161  ASP A CA  1 
ATOM   1354 C C   . ASP A 1 181 ? 14.977  30.110 32.844 1.00 32.97  ? 161  ASP A C   1 
ATOM   1355 O O   . ASP A 1 181 ? 15.009  30.692 31.769 1.00 34.80  ? 161  ASP A O   1 
ATOM   1356 C CB  . ASP A 1 181 ? 16.576  30.790 34.675 1.00 36.79  ? 161  ASP A CB  1 
ATOM   1357 C CG  . ASP A 1 181 ? 16.953  31.963 35.536 1.00 61.32  ? 161  ASP A CG  1 
ATOM   1358 O OD1 . ASP A 1 181 ? 16.336  33.049 35.385 1.00 40.28  ? 161  ASP A OD1 1 
ATOM   1359 O OD2 . ASP A 1 181 ? 17.884  31.797 36.360 1.00 49.54  ? 161  ASP A OD2 1 
ATOM   1360 N N   . THR A 1 182 ? 14.777  28.790 32.931 1.00 29.80  ? 162  THR A N   1 
ATOM   1361 C CA  . THR A 1 182 ? 14.864  27.974 31.731 1.00 28.01  ? 162  THR A CA  1 
ATOM   1362 C C   . THR A 1 182 ? 13.691  28.313 30.834 1.00 26.94  ? 162  THR A C   1 
ATOM   1363 O O   . THR A 1 182 ? 13.817  28.444 29.607 1.00 29.62  ? 162  THR A O   1 
ATOM   1364 C CB  . THR A 1 182 ? 14.831  26.460 32.104 1.00 34.43  ? 162  THR A CB  1 
ATOM   1365 O OG1 . THR A 1 182 ? 15.994  26.144 32.888 1.00 45.31  ? 162  THR A OG1 1 
ATOM   1366 C CG2 . THR A 1 182 ? 14.827  25.576 30.821 1.00 40.25  ? 162  THR A CG2 1 
ATOM   1367 N N   . VAL A 1 183 ? 12.525  28.477 31.443 1.00 26.93  ? 163  VAL A N   1 
ATOM   1368 C CA  A VAL A 1 183 ? 11.354  28.712 30.606 0.50 52.32  ? 163  VAL A CA  1 
ATOM   1369 C CA  B VAL A 1 183 ? 11.331  28.732 30.638 0.50 19.68  ? 163  VAL A CA  1 
ATOM   1370 C C   . VAL A 1 183 ? 11.332  30.128 30.033 1.00 33.31  ? 163  VAL A C   1 
ATOM   1371 O O   . VAL A 1 183 ? 10.901  30.291 28.915 1.00 29.42  ? 163  VAL A O   1 
ATOM   1372 C CB  A VAL A 1 183 ? 10.027  28.259 31.244 0.50 68.86  ? 163  VAL A CB  1 
ATOM   1373 C CB  B VAL A 1 183 ? 10.036  28.482 31.383 0.50 24.81  ? 163  VAL A CB  1 
ATOM   1374 C CG1 A VAL A 1 183 ? 8.824   28.787 30.446 0.50 33.14  ? 163  VAL A CG1 1 
ATOM   1375 C CG1 B VAL A 1 183 ? 9.938   27.013 31.788 0.50 45.19  ? 163  VAL A CG1 1 
ATOM   1376 C CG2 A VAL A 1 183 ? 9.994   26.733 31.290 0.50 37.50  ? 163  VAL A CG2 1 
ATOM   1377 C CG2 B VAL A 1 183 ? 9.858   29.416 32.562 0.50 31.16  ? 163  VAL A CG2 1 
ATOM   1378 N N   . VAL A 1 184 ? 11.823  31.131 30.780 1.00 25.07  ? 164  VAL A N   1 
ATOM   1379 C CA  . VAL A 1 184 ? 12.004  32.475 30.151 1.00 27.57  ? 164  VAL A CA  1 
ATOM   1380 C C   . VAL A 1 184 ? 12.861  32.349 28.887 1.00 25.72  ? 164  VAL A C   1 
ATOM   1381 O O   . VAL A 1 184 ? 12.536  32.857 27.827 1.00 25.32  ? 164  VAL A O   1 
ATOM   1382 C CB  . VAL A 1 184 ? 12.529  33.578 31.136 1.00 26.98  ? 164  VAL A CB  1 
ATOM   1383 C CG1 . VAL A 1 184 ? 12.936  34.859 30.385 1.00 26.59  ? 164  VAL A CG1 1 
ATOM   1384 C CG2 . VAL A 1 184 ? 11.544  33.867 32.215 1.00 30.27  ? 164  VAL A CG2 1 
ATOM   1385 N N   . LYS A 1 185 ? 13.977  31.632 28.980 1.00 26.15  ? 165  LYS A N   1 
ATOM   1386 C CA  A LYS A 1 185 ? 14.862  31.457 27.826 0.50 26.13  ? 165  LYS A CA  1 
ATOM   1387 C CA  B LYS A 1 185 ? 14.877  31.423 27.845 0.50 20.88  ? 165  LYS A CA  1 
ATOM   1388 C C   . LYS A 1 185 ? 14.170  30.793 26.613 1.00 24.65  ? 165  LYS A C   1 
ATOM   1389 O O   . LYS A 1 185 ? 14.303  31.265 25.506 1.00 27.62  ? 165  LYS A O   1 
ATOM   1390 C CB  A LYS A 1 185 ? 16.112  30.682 28.235 0.50 36.01  ? 165  LYS A CB  1 
ATOM   1391 C CB  B LYS A 1 185 ? 16.047  30.539 28.294 0.50 26.10  ? 165  LYS A CB  1 
ATOM   1392 C CG  A LYS A 1 185 ? 16.928  31.433 29.266 0.50 24.21  ? 165  LYS A CG  1 
ATOM   1393 C CG  B LYS A 1 185 ? 17.129  30.425 27.266 0.50 36.13  ? 165  LYS A CG  1 
ATOM   1394 C CD  A LYS A 1 185 ? 18.293  30.783 29.480 0.50 39.01  ? 165  LYS A CD  1 
ATOM   1395 C CD  B LYS A 1 185 ? 18.210  29.470 27.709 0.50 37.21  ? 165  LYS A CD  1 
ATOM   1396 C CE  A LYS A 1 185 ? 18.238  29.672 30.522 0.50 50.55  ? 165  LYS A CE  1 
ATOM   1397 C CE  B LYS A 1 185 ? 19.000  28.971 26.507 0.50 108.35 ? 165  LYS A CE  1 
ATOM   1398 N NZ  A LYS A 1 185 ? 18.546  30.179 31.892 0.50 67.57  ? 165  LYS A NZ  1 
ATOM   1399 N NZ  B LYS A 1 185 ? 19.896  27.830 26.842 0.50 126.07 ? 165  LYS A NZ  1 
ATOM   1400 N N   . LEU A 1 186 ? 13.447  29.711 26.848 1.00 26.85  ? 166  LEU A N   1 
ATOM   1401 C CA  . LEU A 1 186 ? 12.775  28.976 25.780 1.00 31.75  ? 166  LEU A CA  1 
ATOM   1402 C C   . LEU A 1 186 ? 11.675  29.838 25.203 1.00 35.96  ? 166  LEU A C   1 
ATOM   1403 O O   . LEU A 1 186 ? 11.459  29.851 23.979 1.00 26.21  ? 166  LEU A O   1 
ATOM   1404 C CB  . LEU A 1 186 ? 12.212  27.673 26.326 1.00 26.96  ? 166  LEU A CB  1 
ATOM   1405 C CG  . LEU A 1 186 ? 13.259  26.716 26.907 1.00 29.69  ? 166  LEU A CG  1 
ATOM   1406 C CD1 . LEU A 1 186 ? 12.595  25.486 27.495 1.00 32.63  ? 166  LEU A CD1 1 
ATOM   1407 C CD2 . LEU A 1 186 ? 14.263  26.323 25.786 1.00 34.12  ? 166  LEU A CD2 1 
ATOM   1408 N N   . ASN A 1 187 ? 10.993  30.602 26.060 1.00 29.56  ? 167  ASN A N   1 
ATOM   1409 C CA  . ASN A 1 187 ? 9.897   31.438 25.555 1.00 26.05  ? 167  ASN A CA  1 
ATOM   1410 C C   . ASN A 1 187 ? 10.425  32.523 24.624 1.00 25.59  ? 167  ASN A C   1 
ATOM   1411 O O   . ASN A 1 187 ? 9.818   32.793 23.580 1.00 30.61  ? 167  ASN A O   1 
ATOM   1412 C CB  . ASN A 1 187 ? 9.124   32.045 26.714 1.00 30.12  ? 167  ASN A CB  1 
ATOM   1413 C CG  . ASN A 1 187 ? 8.285   31.009 27.453 1.00 27.81  ? 167  ASN A CG  1 
ATOM   1414 O OD1 . ASN A 1 187 ? 8.057   29.898 26.953 1.00 28.71  ? 167  ASN A OD1 1 
ATOM   1415 N ND2 . ASN A 1 187 ? 7.761   31.402 28.627 1.00 28.05  ? 167  ASN A ND2 1 
ATOM   1416 N N   . LEU A 1 188 ? 11.588  33.121 24.982 1.00 25.90  ? 168  LEU A N   1 
ATOM   1417 C CA  . LEU A 1 188 ? 12.222  34.146 24.147 1.00 27.89  ? 168  LEU A CA  1 
ATOM   1418 C C   . LEU A 1 188 ? 12.707  33.536 22.829 1.00 23.30  ? 168  LEU A C   1 
ATOM   1419 O O   . LEU A 1 188 ? 12.595  34.172 21.772 1.00 26.06  ? 168  LEU A O   1 
ATOM   1420 C CB  . LEU A 1 188 ? 13.371  34.815 24.894 1.00 25.96  ? 168  LEU A CB  1 
ATOM   1421 C CG  . LEU A 1 188 ? 12.911  35.755 26.034 1.00 25.03  ? 168  LEU A CG  1 
ATOM   1422 C CD1 . LEU A 1 188 ? 14.203  36.231 26.731 1.00 29.12  ? 168  LEU A CD1 1 
ATOM   1423 C CD2 . LEU A 1 188 ? 12.133  36.944 25.501 1.00 32.95  ? 168  LEU A CD2 1 
ATOM   1424 N N   . GLN A 1 189 ? 13.135  32.268 22.875 1.00 26.40  ? 169  GLN A N   1 
ATOM   1425 C CA  . GLN A 1 189 ? 13.478  31.531 21.619 1.00 31.57  ? 169  GLN A CA  1 
ATOM   1426 C C   . GLN A 1 189 ? 12.261  31.331 20.738 1.00 30.87  ? 169  GLN A C   1 
ATOM   1427 O O   . GLN A 1 189 ? 12.353  31.485 19.525 1.00 33.13  ? 169  GLN A O   1 
ATOM   1428 C CB  . GLN A 1 189 ? 14.053  30.160 21.945 1.00 37.42  ? 169  GLN A CB  1 
ATOM   1429 C CG  . GLN A 1 189 ? 15.443  30.275 22.535 1.00 37.38  ? 169  GLN A CG  1 
ATOM   1430 C CD  . GLN A 1 189 ? 16.033  28.930 23.032 1.00 47.67  ? 169  GLN A CD  1 
ATOM   1431 O OE1 . GLN A 1 189 ? 15.387  27.882 22.993 1.00 59.68  ? 169  GLN A OE1 1 
ATOM   1432 N NE2 . GLN A 1 189 ? 17.264  28.990 23.520 1.00 54.72  ? 169  GLN A NE2 1 
ATOM   1433 N N   . LYS A 1 190 ? 11.149  30.979 21.366 1.00 25.50  ? 170  LYS A N   1 
ATOM   1434 C CA  . LYS A 1 190 ? 9.856   30.796 20.647 1.00 30.86  ? 170  LYS A CA  1 
ATOM   1435 C C   . LYS A 1 190 ? 9.418   32.129 20.064 1.00 37.00  ? 170  LYS A C   1 
ATOM   1436 O O   . LYS A 1 190 ? 9.017   32.205 18.902 1.00 31.31  ? 170  LYS A O   1 
ATOM   1437 C CB  . LYS A 1 190 ? 8.773   30.172 21.525 1.00 30.16  ? 170  LYS A CB  1 
ATOM   1438 C CG  . LYS A 1 190 ? 7.380   29.910 20.803 1.00 29.68  ? 170  LYS A CG  1 
ATOM   1439 C CD  . LYS A 1 190 ? 6.358   29.213 21.703 1.00 32.68  ? 170  LYS A CD  1 
ATOM   1440 C CE  . LYS A 1 190 ? 4.956   29.080 21.048 1.00 40.11  ? 170  LYS A CE  1 
ATOM   1441 N NZ  . LYS A 1 190 ? 3.883   28.639 22.050 1.00 38.67  ? 170  LYS A NZ  1 
ATOM   1442 N N   . LEU A 1 191 ? 9.525   33.202 20.835 1.00 29.02  ? 171  LEU A N   1 
ATOM   1443 C CA  . LEU A 1 191 ? 9.241   34.540 20.261 1.00 29.63  ? 171  LEU A CA  1 
ATOM   1444 C C   . LEU A 1 191 ? 10.076  34.854 19.039 1.00 30.03  ? 171  LEU A C   1 
ATOM   1445 O O   . LEU A 1 191 ? 9.552   35.377 18.036 1.00 32.03  ? 171  LEU A O   1 
ATOM   1446 C CB  . LEU A 1 191 ? 9.479   35.633 21.321 1.00 29.46  ? 171  LEU A CB  1 
ATOM   1447 C CG  . LEU A 1 191 ? 9.190   37.077 20.903 1.00 29.23  ? 171  LEU A CG  1 
ATOM   1448 C CD1 . LEU A 1 191 ? 7.684   37.295 20.640 1.00 28.57  ? 171  LEU A CD1 1 
ATOM   1449 C CD2 . LEU A 1 191 ? 9.680   37.934 22.090 1.00 29.39  ? 171  LEU A CD2 1 
ATOM   1450 N N   . ALA A 1 192 ? 11.380  34.572 19.122 1.00 29.13  ? 172  ALA A N   1 
ATOM   1451 C CA  . ALA A 1 192 ? 12.267  34.836 17.987 1.00 30.79  ? 172  ALA A CA  1 
ATOM   1452 C C   . ALA A 1 192 ? 11.807  34.027 16.765 1.00 37.28  ? 172  ALA A C   1 
ATOM   1453 O O   . ALA A 1 192 ? 11.647  34.599 15.678 1.00 32.32  ? 172  ALA A O   1 
ATOM   1454 C CB  . ALA A 1 192 ? 13.657  34.514 18.316 1.00 31.59  ? 172  ALA A CB  1 
ATOM   1455 N N   . THR A 1 193 ? 11.579  32.726 16.964 1.00 34.79  ? 173  THR A N   1 
ATOM   1456 C CA  . THR A 1 193 ? 11.141  31.836 15.876 1.00 34.51  ? 173  THR A CA  1 
ATOM   1457 C C   . THR A 1 193 ? 9.856   32.311 15.219 1.00 43.74  ? 173  THR A C   1 
ATOM   1458 O O   . THR A 1 193 ? 9.808   32.454 13.991 1.00 41.27  ? 173  THR A O   1 
ATOM   1459 C CB  . THR A 1 193 ? 11.064  30.406 16.354 1.00 34.09  ? 173  THR A CB  1 
ATOM   1460 O OG1 . THR A 1 193 ? 12.397  30.000 16.699 1.00 43.97  ? 173  THR A OG1 1 
ATOM   1461 C CG2 . THR A 1 193 ? 10.518  29.462 15.222 1.00 43.79  ? 173  THR A CG2 1 
ATOM   1462 N N   . VAL A 1 194 ? 8.843   32.579 16.034 1.00 34.10  ? 174  VAL A N   1 
ATOM   1463 C CA  . VAL A 1 194 ? 7.529   33.075 15.561 1.00 34.10  ? 174  VAL A CA  1 
ATOM   1464 C C   . VAL A 1 194 ? 7.646   34.412 14.810 1.00 39.40  ? 174  VAL A C   1 
ATOM   1465 O O   . VAL A 1 194 ? 7.109   34.583 13.698 1.00 38.79  ? 174  VAL A O   1 
ATOM   1466 C CB  . VAL A 1 194 ? 6.528   33.196 16.734 1.00 32.87  ? 174  VAL A CB  1 
ATOM   1467 C CG1 . VAL A 1 194 ? 5.277   34.032 16.370 1.00 40.82  ? 174  VAL A CG1 1 
ATOM   1468 C CG2 . VAL A 1 194 ? 6.141   31.805 17.244 1.00 36.36  ? 174  VAL A CG2 1 
ATOM   1469 N N   . ALA A 1 195 ? 8.338   35.375 15.420 1.00 35.68  ? 175  ALA A N   1 
ATOM   1470 C CA  . ALA A 1 195 ? 8.452   36.694 14.825 1.00 32.31  ? 175  ALA A CA  1 
ATOM   1471 C C   . ALA A 1 195 ? 9.243   36.639 13.528 1.00 44.47  ? 175  ALA A C   1 
ATOM   1472 O O   . ALA A 1 195 ? 8.863   37.290 12.556 1.00 43.63  ? 175  ALA A O   1 
ATOM   1473 C CB  . ALA A 1 195 ? 9.052   37.737 15.813 1.00 36.67  ? 175  ALA A CB  1 
ATOM   1474 N N   . GLU A 1 196 ? 10.337  35.888 13.518 1.00 39.61  ? 176  GLU A N   1 
ATOM   1475 C CA  . GLU A 1 196 ? 11.150  35.765 12.311 1.00 44.57  ? 176  GLU A CA  1 
ATOM   1476 C C   . GLU A 1 196 ? 10.359  35.078 11.188 1.00 50.98  ? 176  GLU A C   1 
ATOM   1477 O O   . GLU A 1 196 ? 10.457  35.490 10.030 1.00 48.65  ? 176  GLU A O   1 
ATOM   1478 C CB  . GLU A 1 196 ? 12.461  35.048 12.597 1.00 39.18  ? 176  GLU A CB  1 
ATOM   1479 C CG  . GLU A 1 196 ? 13.482  35.983 13.280 1.00 37.72  ? 176  GLU A CG  1 
ATOM   1480 C CD  . GLU A 1 196 ? 14.592  35.253 14.014 1.00 52.03  ? 176  GLU A CD  1 
ATOM   1481 O OE1 . GLU A 1 196 ? 14.642  34.010 13.976 1.00 55.74  ? 176  GLU A OE1 1 
ATOM   1482 O OE2 . GLU A 1 196 ? 15.443  35.923 14.629 1.00 40.07  ? 176  GLU A OE2 1 
ATOM   1483 N N   . ALA A 1 197 ? 9.552   34.071 11.530 1.00 51.32  ? 177  ALA A N   1 
ATOM   1484 C CA  . ALA A 1 197 ? 8.685   33.427 10.531 1.00 44.04  ? 177  ALA A CA  1 
ATOM   1485 C C   . ALA A 1 197 ? 7.750   34.465 9.895  1.00 59.15  ? 177  ALA A C   1 
ATOM   1486 O O   . ALA A 1 197 ? 7.755   34.639 8.685  1.00 56.71  ? 177  ALA A O   1 
ATOM   1487 C CB  . ALA A 1 197 ? 7.898   32.240 11.124 1.00 39.95  ? 177  ALA A CB  1 
ATOM   1488 N N   . MET A 1 198 ? 6.984   35.171 10.724 1.00 52.63  ? 178  MET A N   1 
ATOM   1489 C CA  . MET A 1 198 ? 6.120   36.278 10.274 1.00 49.09  ? 178  MET A CA  1 
ATOM   1490 C C   . MET A 1 198 ? 6.780   37.327 9.382  1.00 52.52  ? 178  MET A C   1 
ATOM   1491 O O   . MET A 1 198 ? 6.180   37.754 8.402  1.00 70.21  ? 178  MET A O   1 
ATOM   1492 C CB  . MET A 1 198 ? 5.464   36.958 11.471 1.00 51.47  ? 178  MET A CB  1 
ATOM   1493 C CG  . MET A 1 198 ? 4.446   36.093 12.157 1.00 50.81  ? 178  MET A CG  1 
ATOM   1494 S SD  . MET A 1 198 ? 3.859   36.778 13.734 1.00 57.16  ? 178  MET A SD  1 
ATOM   1495 C CE  . MET A 1 198 ? 2.833   38.151 13.190 1.00 71.22  ? 178  MET A CE  1 
ATOM   1496 N N   . ALA A 1 199 ? 7.993   37.753 9.715  1.00 51.70  ? 179  ALA A N   1 
ATOM   1497 C CA  . ALA A 1 199 ? 8.665   38.776 8.913  1.00 49.54  ? 179  ALA A CA  1 
ATOM   1498 C C   . ALA A 1 199 ? 9.034   38.278 7.520  1.00 64.85  ? 179  ALA A C   1 
ATOM   1499 O O   . ALA A 1 199 ? 9.195   39.090 6.605  1.00 79.87  ? 179  ALA A O   1 
ATOM   1500 C CB  . ALA A 1 199 ? 9.897   39.304 9.606  1.00 36.58  ? 179  ALA A CB  1 
ATOM   1501 N N   . ARG A 1 200 ? 9.184   36.961 7.364  1.00 60.90  ? 180  ARG A N   1 
ATOM   1502 C CA  . ARG A 1 200 ? 9.489   36.388 6.044  1.00 77.15  ? 180  ARG A CA  1 
ATOM   1503 C C   . ARG A 1 200 ? 8.238   36.200 5.181  1.00 65.89  ? 180  ARG A C   1 
ATOM   1504 O O   . ARG A 1 200 ? 8.334   35.841 4.007  1.00 141.86 ? 180  ARG A O   1 
ATOM   1505 C CB  . ARG A 1 200 ? 10.334  35.110 6.142  1.00 67.49  ? 180  ARG A CB  1 
ATOM   1506 C CG  . ARG A 1 200 ? 9.609   33.840 6.583  1.00 123.64 ? 180  ARG A CG  1 
ATOM   1507 C CD  . ARG A 1 200 ? 10.572  32.648 6.660  1.00 135.91 ? 180  ARG A CD  1 
ATOM   1508 N NE  . ARG A 1 200 ? 11.815  32.989 7.359  1.00 200.33 ? 180  ARG A NE  1 
ATOM   1509 C CZ  . ARG A 1 200 ? 12.165  32.561 8.572  1.00 109.53 ? 180  ARG A CZ  1 
ATOM   1510 N NH1 . ARG A 1 200 ? 11.387  31.742 9.270  1.00 58.97  ? 180  ARG A NH1 1 
ATOM   1511 N NH2 . ARG A 1 200 ? 13.315  32.954 9.093  1.00 55.81  ? 180  ARG A NH2 1 
ATOM   1512 N N   . ASN A 1 201 ? 7.072   36.454 5.770  1.00 66.80  ? 181  ASN A N   1 
ATOM   1513 C CA  . ASN A 1 201 ? 5.806   36.465 5.041  1.00 86.70  ? 181  ASN A CA  1 
ATOM   1514 C C   . ASN A 1 201 ? 5.370   37.887 4.678  1.00 121.94 ? 181  ASN A C   1 
ATOM   1515 O O   . ASN A 1 201 ? 4.293   38.087 4.107  1.00 151.19 ? 181  ASN A O   1 
ATOM   1516 C CB  . ASN A 1 201 ? 4.711   35.758 5.853  1.00 69.00  ? 181  ASN A CB  1 
ATOM   1517 C CG  . ASN A 1 201 ? 4.992   34.279 6.063  1.00 152.53 ? 181  ASN A CG  1 
ATOM   1518 O OD1 . ASN A 1 201 ? 5.871   33.697 5.421  1.00 113.98 ? 181  ASN A OD1 1 
ATOM   1519 N ND2 . ASN A 1 201 ? 4.238   33.661 6.967  1.00 102.88 ? 181  ASN A ND2 1 
ATOM   1520 N N   . SER A 1 202 ? 6.216   38.864 5.007  1.00 130.40 ? 182  SER A N   1 
ATOM   1521 C CA  . SER A 1 202 ? 5.923   40.281 4.773  1.00 142.26 ? 182  SER A CA  1 
ATOM   1522 C C   . SER A 1 202 ? 6.328   40.743 3.370  1.00 162.55 ? 182  SER A C   1 
ATOM   1523 O O   . SER A 1 202 ? 5.466   41.022 2.533  1.00 195.01 ? 182  SER A O   1 
ATOM   1524 C CB  . SER A 1 202 ? 6.584   41.160 5.845  1.00 76.02  ? 182  SER A CB  1 
ATOM   1525 O OG  . SER A 1 202 ? 5.991   40.957 7.117  1.00 146.93 ? 182  SER A OG  1 
ATOM   1526 N N   . GLY A 1 203 ? 7.634   40.820 3.121  1.00 163.69 ? 183  GLY A N   1 
ATOM   1527 C CA  . GLY A 1 203 ? 8.159   41.281 1.836  1.00 171.98 ? 183  GLY A CA  1 
ATOM   1528 C C   . GLY A 1 203 ? 8.051   42.786 1.670  1.00 181.00 ? 183  GLY A C   1 
ATOM   1529 O O   . GLY A 1 203 ? 8.502   43.348 0.669  1.00 87.61  ? 183  GLY A O   1 
ATOM   1530 N N   . PRO B 1 22  ? 9.557   21.739 13.506 1.00 68.11  ? 2    PRO B N   1 
ATOM   1531 C CA  . PRO B 1 22  ? 9.877   20.825 12.400 1.00 130.65 ? 2    PRO B CA  1 
ATOM   1532 C C   . PRO B 1 22  ? 10.726  21.405 11.228 1.00 47.40  ? 2    PRO B C   1 
ATOM   1533 O O   . PRO B 1 22  ? 11.868  20.961 11.074 1.00 45.05  ? 2    PRO B O   1 
ATOM   1534 C CB  . PRO B 1 22  ? 8.501   20.290 11.950 1.00 90.74  ? 2    PRO B CB  1 
ATOM   1535 C CG  . PRO B 1 22  ? 7.583   20.571 13.090 1.00 112.74 ? 2    PRO B CG  1 
ATOM   1536 C CD  . PRO B 1 22  ? 8.111   21.790 13.786 1.00 79.86  ? 2    PRO B CD  1 
ATOM   1537 N N   . SER B 1 23  ? 10.265  22.401 10.449 1.00 128.55 ? 3    SER B N   1 
ATOM   1538 C CA  . SER B 1 23  ? 9.057   23.220 10.657 1.00 154.44 ? 3    SER B CA  1 
ATOM   1539 C C   . SER B 1 23  ? 7.770   22.557 10.166 1.00 161.55 ? 3    SER B C   1 
ATOM   1540 O O   . SER B 1 23  ? 6.707   22.742 10.764 1.00 173.65 ? 3    SER B O   1 
ATOM   1541 C CB  . SER B 1 23  ? 9.225   24.593 9.996  1.00 137.70 ? 3    SER B CB  1 
ATOM   1542 O OG  . SER B 1 23  ? 9.647   24.470 8.647  1.00 86.74  ? 3    SER B OG  1 
ATOM   1543 N N   . GLU B 1 24  ? 7.885   21.799 9.076  1.00 140.61 ? 4    GLU B N   1 
ATOM   1544 C CA  . GLU B 1 24  ? 6.834   20.906 8.578  1.00 139.31 ? 4    GLU B CA  1 
ATOM   1545 C C   . GLU B 1 24  ? 7.388   20.069 7.439  1.00 117.12 ? 4    GLU B C   1 
ATOM   1546 O O   . GLU B 1 24  ? 8.151   20.578 6.613  1.00 94.11  ? 4    GLU B O   1 
ATOM   1547 C CB  . GLU B 1 24  ? 5.608   21.680 8.089  1.00 166.08 ? 4    GLU B CB  1 
ATOM   1548 C CG  . GLU B 1 24  ? 4.430   21.642 9.048  1.00 175.74 ? 4    GLU B CG  1 
ATOM   1549 C CD  . GLU B 1 24  ? 3.126   22.047 8.395  1.00 148.44 ? 4    GLU B CD  1 
ATOM   1550 O OE1 . GLU B 1 24  ? 2.126   21.326 8.591  1.00 148.72 ? 4    GLU B OE1 1 
ATOM   1551 O OE2 . GLU B 1 24  ? 3.099   23.077 7.685  1.00 157.47 ? 4    GLU B OE2 1 
ATOM   1552 N N   . LEU B 1 25  ? 7.003   18.791 7.396  1.00 88.28  ? 5    LEU B N   1 
ATOM   1553 C CA  . LEU B 1 25  ? 7.401   17.897 6.305  1.00 68.05  ? 5    LEU B CA  1 
ATOM   1554 C C   . LEU B 1 25  ? 6.882   18.418 4.970  1.00 58.24  ? 5    LEU B C   1 
ATOM   1555 O O   . LEU B 1 25  ? 5.691   18.711 4.830  1.00 100.96 ? 5    LEU B O   1 
ATOM   1556 C CB  . LEU B 1 25  ? 6.888   16.463 6.527  1.00 51.55  ? 5    LEU B CB  1 
ATOM   1557 C CG  . LEU B 1 25  ? 7.432   15.659 7.726  1.00 57.41  ? 5    LEU B CG  1 
ATOM   1558 C CD1 . LEU B 1 25  ? 6.845   14.249 7.739  1.00 67.85  ? 5    LEU B CD1 1 
ATOM   1559 C CD2 . LEU B 1 25  ? 8.951   15.615 7.747  1.00 48.86  ? 5    LEU B CD2 1 
ATOM   1560 N N   . THR B 1 26  ? 7.788   18.539 4.003  1.00 85.31  ? 6    THR B N   1 
ATOM   1561 C CA  . THR B 1 26  ? 7.402   18.796 2.621  1.00 67.59  ? 6    THR B CA  1 
ATOM   1562 C C   . THR B 1 26  ? 6.691   17.550 2.079  1.00 65.95  ? 6    THR B C   1 
ATOM   1563 O O   . THR B 1 26  ? 6.910   16.443 2.583  1.00 77.76  ? 6    THR B O   1 
ATOM   1564 C CB  . THR B 1 26  ? 8.619   19.119 1.723  1.00 62.64  ? 6    THR B CB  1 
ATOM   1565 O OG1 . THR B 1 26  ? 9.400   17.933 1.519  1.00 68.71  ? 6    THR B OG1 1 
ATOM   1566 C CG2 . THR B 1 26  ? 9.489   20.231 2.330  1.00 69.83  ? 6    THR B CG2 1 
ATOM   1567 N N   . PRO B 1 27  ? 5.812   17.730 1.074  1.00 110.12 ? 7    PRO B N   1 
ATOM   1568 C CA  . PRO B 1 27  ? 5.198   16.631 0.324  1.00 74.21  ? 7    PRO B CA  1 
ATOM   1569 C C   . PRO B 1 27  ? 6.178   15.518 -0.066 1.00 50.80  ? 7    PRO B C   1 
ATOM   1570 O O   . PRO B 1 27  ? 5.861   14.335 0.101  1.00 73.20  ? 7    PRO B O   1 
ATOM   1571 C CB  . PRO B 1 27  ? 4.653   17.330 -0.935 1.00 151.60 ? 7    PRO B CB  1 
ATOM   1572 C CG  . PRO B 1 27  ? 5.094   18.795 -0.823 1.00 67.04  ? 7    PRO B CG  1 
ATOM   1573 C CD  . PRO B 1 27  ? 5.307   19.034 0.613  1.00 96.76  ? 7    PRO B CD  1 
ATOM   1574 N N   . GLU B 1 28  ? 7.348   15.902 -0.582 1.00 56.01  ? 8    GLU B N   1 
ATOM   1575 C CA  . GLU B 1 28  ? 8.427   14.964 -0.922 1.00 66.46  ? 8    GLU B CA  1 
ATOM   1576 C C   . GLU B 1 28  ? 8.846   14.137 0.299  1.00 113.96 ? 8    GLU B C   1 
ATOM   1577 O O   . GLU B 1 28  ? 8.769   12.901 0.280  1.00 69.10  ? 8    GLU B O   1 
ATOM   1578 C CB  . GLU B 1 28  ? 9.643   15.728 -1.478 1.00 80.97  ? 8    GLU B CB  1 
ATOM   1579 C CG  . GLU B 1 28  ? 10.918  14.887 -1.689 1.00 111.24 ? 8    GLU B CG  1 
ATOM   1580 C CD  . GLU B 1 28  ? 12.207  15.710 -1.606 1.00 139.69 ? 8    GLU B CD  1 
ATOM   1581 O OE1 . GLU B 1 28  ? 12.132  16.954 -1.499 1.00 173.28 ? 8    GLU B OE1 1 
ATOM   1582 O OE2 . GLU B 1 28  ? 13.305  15.108 -1.644 1.00 104.31 ? 8    GLU B OE2 1 
ATOM   1583 N N   . GLU B 1 29  ? 9.286   14.833 1.351  1.00 90.61  ? 9    GLU B N   1 
ATOM   1584 C CA  . GLU B 1 29  ? 9.693   14.202 2.611  1.00 59.82  ? 9    GLU B CA  1 
ATOM   1585 C C   . GLU B 1 29  ? 8.631   13.228 3.103  1.00 55.29  ? 9    GLU B C   1 
ATOM   1586 O O   . GLU B 1 29  ? 8.929   12.051 3.328  1.00 59.49  ? 9    GLU B O   1 
ATOM   1587 C CB  . GLU B 1 29  ? 10.015  15.259 3.671  1.00 55.80  ? 9    GLU B CB  1 
ATOM   1588 C CG  . GLU B 1 29  ? 11.345  15.997 3.425  1.00 44.46  ? 9    GLU B CG  1 
ATOM   1589 C CD  . GLU B 1 29  ? 11.458  17.287 4.225  1.00 45.64  ? 9    GLU B CD  1 
ATOM   1590 O OE1 . GLU B 1 29  ? 10.410  17.773 4.735  1.00 48.60  ? 9    GLU B OE1 1 
ATOM   1591 O OE2 . GLU B 1 29  ? 12.586  17.827 4.335  1.00 48.68  ? 9    GLU B OE2 1 
ATOM   1592 N N   . ARG B 1 30  ? 7.395   13.720 3.221  1.00 46.89  ? 10   ARG B N   1 
ATOM   1593 C CA  . ARG B 1 30  ? 6.205   12.909 3.545  1.00 51.74  ? 10   ARG B CA  1 
ATOM   1594 C C   . ARG B 1 30  ? 6.161   11.557 2.851  1.00 75.49  ? 10   ARG B C   1 
ATOM   1595 O O   . ARG B 1 30  ? 6.004   10.527 3.505  1.00 77.11  ? 10   ARG B O   1 
ATOM   1596 C CB  . ARG B 1 30  ? 4.930   13.678 3.188  1.00 79.71  ? 10   ARG B CB  1 
ATOM   1597 C CG  . ARG B 1 30  ? 4.477   14.680 4.221  1.00 63.31  ? 10   ARG B CG  1 
ATOM   1598 C CD  . ARG B 1 30  ? 2.964   14.880 4.152  1.00 71.11  ? 10   ARG B CD  1 
ATOM   1599 N NE  . ARG B 1 30  ? 2.379   14.950 5.492  1.00 195.82 ? 10   ARG B NE  1 
ATOM   1600 C CZ  . ARG B 1 30  ? 2.066   13.891 6.240  1.00 192.64 ? 10   ARG B CZ  1 
ATOM   1601 N NH1 . ARG B 1 30  ? 2.276   12.659 5.791  1.00 184.07 ? 10   ARG B NH1 1 
ATOM   1602 N NH2 . ARG B 1 30  ? 1.543   14.063 7.445  1.00 81.07  ? 10   ARG B NH2 1 
ATOM   1603 N N   . SER B 1 31  ? 6.284   11.569 1.523  1.00 71.54  ? 11   SER B N   1 
ATOM   1604 C CA  . SER B 1 31  ? 6.160   10.346 0.727  1.00 58.15  ? 11   SER B CA  1 
ATOM   1605 C C   . SER B 1 31  ? 7.341   9.421  0.946  1.00 50.92  ? 11   SER B C   1 
ATOM   1606 O O   . SER B 1 31  ? 7.177   8.206  1.069  1.00 63.94  ? 11   SER B O   1 
ATOM   1607 C CB  . SER B 1 31  ? 6.033   10.678 -0.763 1.00 115.36 ? 11   SER B CB  1 
ATOM   1608 O OG  . SER B 1 31  ? 4.747   11.185 -1.069 1.00 115.57 ? 11   SER B OG  1 
ATOM   1609 N N   . GLU B 1 32  ? 8.536   9.999  0.995  1.00 52.65  ? 12   GLU B N   1 
ATOM   1610 C CA  . GLU B 1 32  ? 9.724   9.210  1.274  1.00 49.38  ? 12   GLU B CA  1 
ATOM   1611 C C   . GLU B 1 32  ? 9.681   8.553  2.661  1.00 49.08  ? 12   GLU B C   1 
ATOM   1612 O O   . GLU B 1 32  ? 10.308  7.521  2.863  1.00 59.31  ? 12   GLU B O   1 
ATOM   1613 C CB  . GLU B 1 32  ? 10.991  10.055 1.139  1.00 51.05  ? 12   GLU B CB  1 
ATOM   1614 C CG  . GLU B 1 32  ? 11.481  10.248 -0.287 1.00 122.52 ? 12   GLU B CG  1 
ATOM   1615 C CD  . GLU B 1 32  ? 12.923  10.724 -0.342 1.00 191.59 ? 12   GLU B CD  1 
ATOM   1616 O OE1 . GLU B 1 32  ? 13.816  10.004 0.163  1.00 151.11 ? 12   GLU B OE1 1 
ATOM   1617 O OE2 . GLU B 1 32  ? 13.165  11.818 -0.896 1.00 104.66 ? 12   GLU B OE2 1 
ATOM   1618 N N   . LEU B 1 33  ? 8.957   9.164  3.601  1.00 53.82  ? 13   LEU B N   1 
ATOM   1619 C CA  . LEU B 1 33  ? 8.905   8.664  4.985  1.00 82.83  ? 13   LEU B CA  1 
ATOM   1620 C C   . LEU B 1 33  ? 7.731   7.724  5.267  1.00 75.75  ? 13   LEU B C   1 
ATOM   1621 O O   . LEU B 1 33  ? 7.655   7.114  6.342  1.00 49.65  ? 13   LEU B O   1 
ATOM   1622 C CB  . LEU B 1 33  ? 8.958   9.829  5.999  1.00 50.43  ? 13   LEU B CB  1 
ATOM   1623 C CG  . LEU B 1 33  ? 10.291  10.609 6.007  1.00 47.16  ? 13   LEU B CG  1 
ATOM   1624 C CD1 . LEU B 1 33  ? 10.324  11.716 7.065  1.00 45.42  ? 13   LEU B CD1 1 
ATOM   1625 C CD2 . LEU B 1 33  ? 11.515  9.696  6.163  1.00 53.71  ? 13   LEU B CD2 1 
ATOM   1626 N N   . LYS B 1 34  ? 6.841   7.574  4.287  1.00 64.43  ? 14   LYS B N   1 
ATOM   1627 C CA  . LYS B 1 34  ? 5.633   6.748  4.438  1.00 75.79  ? 14   LYS B CA  1 
ATOM   1628 C C   . LYS B 1 34  ? 5.896   5.351  5.041  1.00 51.79  ? 14   LYS B C   1 
ATOM   1629 O O   . LYS B 1 34  ? 5.141   4.890  5.894  1.00 49.88  ? 14   LYS B O   1 
ATOM   1630 C CB  . LYS B 1 34  ? 4.882   6.634  3.098  1.00 93.68  ? 14   LYS B CB  1 
ATOM   1631 C CG  . LYS B 1 34  ? 5.276   5.421  2.250  1.00 76.21  ? 14   LYS B CG  1 
ATOM   1632 C CD  . LYS B 1 34  ? 4.954   5.606  0.779  1.00 173.11 ? 14   LYS B CD  1 
ATOM   1633 C CE  . LYS B 1 34  ? 5.475   4.429  -0.035 1.00 101.90 ? 14   LYS B CE  1 
ATOM   1634 N NZ  . LYS B 1 34  ? 5.433   4.695  -1.498 1.00 122.06 ? 14   LYS B NZ  1 
ATOM   1635 N N   . ASN B 1 35  ? 6.951   4.679  4.581  1.00 54.44  ? 15   ASN B N   1 
ATOM   1636 C CA  . ASN B 1 35  ? 7.272   3.327  5.040  1.00 53.18  ? 15   ASN B CA  1 
ATOM   1637 C C   . ASN B 1 35  ? 7.763   3.289  6.494  1.00 100.60 ? 15   ASN B C   1 
ATOM   1638 O O   . ASN B 1 35  ? 7.375   2.414  7.280  1.00 55.68  ? 15   ASN B O   1 
ATOM   1639 C CB  . ASN B 1 35  ? 8.327   2.702  4.123  1.00 60.23  ? 15   ASN B CB  1 
ATOM   1640 C CG  . ASN B 1 35  ? 7.774   2.350  2.755  1.00 170.57 ? 15   ASN B CG  1 
ATOM   1641 O OD1 . ASN B 1 35  ? 6.565   2.155  2.589  1.00 62.83  ? 15   ASN B OD1 1 
ATOM   1642 N ND2 . ASN B 1 35  ? 8.659   2.260  1.766  1.00 80.15  ? 15   ASN B ND2 1 
ATOM   1643 N N   . SER B 1 36  ? 8.625   4.245  6.835  1.00 52.18  ? 16   SER B N   1 
ATOM   1644 C CA  . SER B 1 36  ? 9.145   4.385  8.187  1.00 45.74  ? 16   SER B CA  1 
ATOM   1645 C C   . SER B 1 36  ? 8.022   4.706  9.137  1.00 42.34  ? 16   SER B C   1 
ATOM   1646 O O   . SER B 1 36  ? 7.893   4.065  10.188 1.00 43.48  ? 16   SER B O   1 
ATOM   1647 C CB  . SER B 1 36  ? 10.211  5.466  8.228  1.00 52.68  ? 16   SER B CB  1 
ATOM   1648 O OG  . SER B 1 36  ? 11.332  5.046  7.481  1.00 64.71  ? 16   SER B OG  1 
ATOM   1649 N N   . ILE B 1 37  ? 7.173   5.646  8.737  1.00 43.55  ? 17   ILE B N   1 
ATOM   1650 C CA  . ILE B 1 37  ? 5.991   6.001  9.503  1.00 36.05  ? 17   ILE B CA  1 
ATOM   1651 C C   . ILE B 1 37  ? 5.083   4.810  9.774  1.00 53.48  ? 17   ILE B C   1 
ATOM   1652 O O   . ILE B 1 37  ? 4.587   4.635  10.888 1.00 53.40  ? 17   ILE B O   1 
ATOM   1653 C CB  . ILE B 1 37  ? 5.233   7.199  8.895  1.00 53.33  ? 17   ILE B CB  1 
ATOM   1654 C CG1 . ILE B 1 37  ? 6.112   8.466  8.987  1.00 47.92  ? 17   ILE B CG1 1 
ATOM   1655 C CG2 . ILE B 1 37  ? 3.905   7.376  9.588  1.00 44.94  ? 17   ILE B CG2 1 
ATOM   1656 C CD1 . ILE B 1 37  ? 5.424   9.769  8.720  1.00 53.49  ? 17   ILE B CD1 1 
ATOM   1657 N N   . ALA B 1 38  ? 4.897   3.974  8.759  1.00 69.29  ? 18   ALA B N   1 
ATOM   1658 C CA  . ALA B 1 38  ? 4.117   2.749  8.887  1.00 55.56  ? 18   ALA B CA  1 
ATOM   1659 C C   . ALA B 1 38  ? 4.759   1.768  9.871  1.00 46.51  ? 18   ALA B C   1 
ATOM   1660 O O   . ALA B 1 38  ? 4.082   1.211  10.754 1.00 49.32  ? 18   ALA B O   1 
ATOM   1661 C CB  . ALA B 1 38  ? 3.952   2.083  7.503  1.00 46.57  ? 18   ALA B CB  1 
ATOM   1662 N N   . GLU B 1 39  ? 6.064   1.551  9.706  1.00 42.93  ? 19   GLU B N   1 
ATOM   1663 C CA  . GLU B 1 39  ? 6.785   0.552  10.477 1.00 41.25  ? 19   GLU B CA  1 
ATOM   1664 C C   . GLU B 1 39  ? 6.976   0.962  11.938 1.00 51.97  ? 19   GLU B C   1 
ATOM   1665 O O   . GLU B 1 39  ? 6.764   0.157  12.828 1.00 43.47  ? 19   GLU B O   1 
ATOM   1666 C CB  . GLU B 1 39  ? 8.132   0.243  9.825  1.00 44.52  ? 19   GLU B CB  1 
ATOM   1667 C CG  . GLU B 1 39  ? 8.876   -0.913 10.514 1.00 59.65  ? 19   GLU B CG  1 
ATOM   1668 C CD  . GLU B 1 39  ? 10.142  -1.352 9.790  1.00 55.37  ? 19   GLU B CD  1 
ATOM   1669 O OE1 . GLU B 1 39  ? 10.471  -0.769 8.727  1.00 87.69  ? 19   GLU B OE1 1 
ATOM   1670 O OE2 . GLU B 1 39  ? 10.814  -2.286 10.297 1.00 65.79  ? 19   GLU B OE2 1 
ATOM   1671 N N   . PHE B 1 40  ? 7.342   2.220  12.178 1.00 51.73  ? 20   PHE B N   1 
ATOM   1672 C CA  . PHE B 1 40  ? 7.746   2.646  13.533 1.00 45.29  ? 20   PHE B CA  1 
ATOM   1673 C C   . PHE B 1 40  ? 6.857   3.635  14.276 1.00 43.58  ? 20   PHE B C   1 
ATOM   1674 O O   . PHE B 1 40  ? 6.883   3.694  15.502 1.00 49.95  ? 20   PHE B O   1 
ATOM   1675 C CB  . PHE B 1 40  ? 9.162   3.204  13.465 1.00 45.61  ? 20   PHE B CB  1 
ATOM   1676 C CG  . PHE B 1 40  ? 10.182  2.203  13.010 1.00 39.73  ? 20   PHE B CG  1 
ATOM   1677 C CD1 . PHE B 1 40  ? 10.536  1.135  13.832 1.00 46.22  ? 20   PHE B CD1 1 
ATOM   1678 C CD2 . PHE B 1 40  ? 10.812  2.342  11.775 1.00 43.39  ? 20   PHE B CD2 1 
ATOM   1679 C CE1 . PHE B 1 40  ? 11.495  0.208  13.420 1.00 46.13  ? 20   PHE B CE1 1 
ATOM   1680 C CE2 . PHE B 1 40  ? 11.777  1.432  11.361 1.00 57.93  ? 20   PHE B CE2 1 
ATOM   1681 C CZ  . PHE B 1 40  ? 12.107  0.361  12.177 1.00 42.73  ? 20   PHE B CZ  1 
ATOM   1682 N N   . HIS B 1 41  ? 6.067   4.406  13.547 1.00 34.86  ? 21   HIS B N   1 
ATOM   1683 C CA  . HIS B 1 41  ? 5.406   5.557  14.123 1.00 41.39  ? 21   HIS B CA  1 
ATOM   1684 C C   . HIS B 1 41  ? 3.866   5.495  14.033 1.00 51.90  ? 21   HIS B C   1 
ATOM   1685 O O   . HIS B 1 41  ? 3.204   6.517  14.102 1.00 44.66  ? 21   HIS B O   1 
ATOM   1686 C CB  . HIS B 1 41  ? 5.993   6.830  13.469 1.00 31.72  ? 21   HIS B CB  1 
ATOM   1687 C CG  . HIS B 1 41  ? 7.491   6.950  13.624 1.00 33.10  ? 21   HIS B CG  1 
ATOM   1688 N ND1 . HIS B 1 41  ? 8.089   7.141  14.853 1.00 34.36  ? 21   HIS B ND1 1 
ATOM   1689 C CD2 . HIS B 1 41  ? 8.488   6.974  12.711 1.00 46.02  ? 21   HIS B CD2 1 
ATOM   1690 C CE1 . HIS B 1 41  ? 9.395   7.239  14.692 1.00 34.84  ? 21   HIS B CE1 1 
ATOM   1691 N NE2 . HIS B 1 41  ? 9.664   7.130  13.400 1.00 31.25  ? 21   HIS B NE2 1 
ATOM   1692 N N   . THR B 1 42  ? 3.308   4.290  13.920 1.00 50.53  ? 22   THR B N   1 
ATOM   1693 C CA  . THR B 1 42  ? 1.854   4.098  13.789 1.00 44.89  ? 22   THR B CA  1 
ATOM   1694 C C   . THR B 1 42  ? 1.308   3.236  14.925 1.00 42.59  ? 22   THR B C   1 
ATOM   1695 O O   . THR B 1 42  ? 1.844   2.159  15.221 1.00 54.89  ? 22   THR B O   1 
ATOM   1696 C CB  . THR B 1 42  ? 1.508   3.445  12.429 1.00 48.65  ? 22   THR B CB  1 
ATOM   1697 O OG1 . THR B 1 42  ? 2.049   4.244  11.373 1.00 56.35  ? 22   THR B OG1 1 
ATOM   1698 C CG2 . THR B 1 42  ? -0.009  3.371  12.246 1.00 48.25  ? 22   THR B CG2 1 
ATOM   1699 N N   . TYR B 1 43  ? 0.241   3.710  15.556 1.00 49.41  ? 23   TYR B N   1 
ATOM   1700 C CA  . TYR B 1 43  ? -0.261  3.073  16.770 1.00 50.38  ? 23   TYR B CA  1 
ATOM   1701 C C   . TYR B 1 43  ? -1.716  2.678  16.628 1.00 56.61  ? 23   TYR B C   1 
ATOM   1702 O O   . TYR B 1 43  ? -2.478  3.369  15.950 1.00 52.14  ? 23   TYR B O   1 
ATOM   1703 C CB  . TYR B 1 43  ? -0.077  4.004  17.977 1.00 58.28  ? 23   TYR B CB  1 
ATOM   1704 C CG  . TYR B 1 43  ? 1.374   4.375  18.169 1.00 45.03  ? 23   TYR B CG  1 
ATOM   1705 C CD1 . TYR B 1 43  ? 2.217   3.566  18.921 1.00 52.34  ? 23   TYR B CD1 1 
ATOM   1706 C CD2 . TYR B 1 43  ? 1.919   5.508  17.540 1.00 46.02  ? 23   TYR B CD2 1 
ATOM   1707 C CE1 . TYR B 1 43  ? 3.566   3.888  19.081 1.00 45.60  ? 23   TYR B CE1 1 
ATOM   1708 C CE2 . TYR B 1 43  ? 3.286   5.832  17.689 1.00 40.95  ? 23   TYR B CE2 1 
ATOM   1709 C CZ  . TYR B 1 43  ? 4.089   5.019  18.460 1.00 37.89  ? 23   TYR B CZ  1 
ATOM   1710 O OH  . TYR B 1 43  ? 5.457   5.316  18.623 1.00 41.66  ? 23   TYR B OH  1 
ATOM   1711 N N   . GLN B 1 44  ? -2.075  1.577  17.290 1.00 63.57  ? 24   GLN B N   1 
ATOM   1712 C CA  . GLN B 1 44  ? -3.456  1.101  17.391 1.00 70.21  ? 24   GLN B CA  1 
ATOM   1713 C C   . GLN B 1 44  ? -4.254  1.981  18.352 1.00 59.65  ? 24   GLN B C   1 
ATOM   1714 O O   . GLN B 1 44  ? -3.827  2.217  19.484 1.00 92.30  ? 24   GLN B O   1 
ATOM   1715 C CB  . GLN B 1 44  ? -3.486  -0.356 17.870 1.00 90.93  ? 24   GLN B CB  1 
ATOM   1716 C CG  . GLN B 1 44  ? -2.862  -1.367 16.906 1.00 167.00 ? 24   GLN B CG  1 
ATOM   1717 C CD  . GLN B 1 44  ? -3.837  -1.866 15.850 1.00 222.23 ? 24   GLN B CD  1 
ATOM   1718 O OE1 . GLN B 1 44  ? -4.403  -1.082 15.084 1.00 259.85 ? 24   GLN B OE1 1 
ATOM   1719 N NE2 . GLN B 1 44  ? -4.028  -3.181 15.799 1.00 132.90 ? 24   GLN B NE2 1 
ATOM   1720 N N   . LEU B 1 45  ? -5.427  2.429  17.899 1.00 129.88 ? 25   LEU B N   1 
ATOM   1721 C CA  . LEU B 1 45  ? -6.247  3.421  18.616 1.00 130.52 ? 25   LEU B CA  1 
ATOM   1722 C C   . LEU B 1 45  ? -6.881  2.895  19.908 1.00 117.09 ? 25   LEU B C   1 
ATOM   1723 O O   . LEU B 1 45  ? -8.106  2.896  20.063 1.00 125.92 ? 25   LEU B O   1 
ATOM   1724 C CB  . LEU B 1 45  ? -7.327  4.009  17.696 1.00 71.03  ? 25   LEU B CB  1 
ATOM   1725 C CG  . LEU B 1 45  ? -6.933  4.386  16.265 1.00 164.52 ? 25   LEU B CG  1 
ATOM   1726 C CD1 . LEU B 1 45  ? -7.281  3.259  15.286 1.00 88.36  ? 25   LEU B CD1 1 
ATOM   1727 C CD2 . LEU B 1 45  ? -7.610  5.683  15.857 1.00 65.35  ? 25   LEU B CD2 1 
ATOM   1728 N N   . ASP B 1 46  ? -6.023  2.463  20.830 1.00 120.20 ? 26   ASP B N   1 
ATOM   1729 C CA  . ASP B 1 46  ? -6.420  1.966  22.144 1.00 85.00  ? 26   ASP B CA  1 
ATOM   1730 C C   . ASP B 1 46  ? -7.009  3.104  22.998 1.00 79.09  ? 26   ASP B C   1 
ATOM   1731 O O   . ASP B 1 46  ? -6.440  4.200  23.041 1.00 167.78 ? 26   ASP B O   1 
ATOM   1732 C CB  . ASP B 1 46  ? -5.196  1.349  22.837 1.00 82.76  ? 26   ASP B CB  1 
ATOM   1733 C CG  . ASP B 1 46  ? -5.565  0.297  23.868 1.00 141.64 ? 26   ASP B CG  1 
ATOM   1734 O OD1 . ASP B 1 46  ? -5.253  -0.891 23.636 1.00 165.37 ? 26   ASP B OD1 1 
ATOM   1735 O OD2 . ASP B 1 46  ? -6.156  0.651  24.909 1.00 157.22 ? 26   ASP B OD2 1 
ATOM   1736 N N   . PRO B 1 47  ? -8.159  2.856  23.663 1.00 108.13 ? 27   PRO B N   1 
ATOM   1737 C CA  . PRO B 1 47  ? -8.717  3.846  24.592 1.00 76.66  ? 27   PRO B CA  1 
ATOM   1738 C C   . PRO B 1 47  ? -7.902  3.929  25.880 1.00 95.21  ? 27   PRO B C   1 
ATOM   1739 O O   . PRO B 1 47  ? -7.370  2.914  26.346 1.00 79.03  ? 27   PRO B O   1 
ATOM   1740 C CB  . PRO B 1 47  ? -10.121 3.306  24.880 1.00 124.24 ? 27   PRO B CB  1 
ATOM   1741 C CG  . PRO B 1 47  ? -10.015 1.843  24.667 1.00 83.62  ? 27   PRO B CG  1 
ATOM   1742 C CD  . PRO B 1 47  ? -9.007  1.652  23.568 1.00 131.90 ? 27   PRO B CD  1 
ATOM   1743 N N   . GLY B 1 48  ? -7.798  5.126  26.450 1.00 63.49  ? 28   GLY B N   1 
ATOM   1744 C CA  . GLY B 1 48  ? -6.950  5.321  27.633 1.00 122.16 ? 28   GLY B CA  1 
ATOM   1745 C C   . GLY B 1 48  ? -5.464  5.455  27.317 1.00 67.98  ? 28   GLY B C   1 
ATOM   1746 O O   . GLY B 1 48  ? -4.654  5.675  28.220 1.00 56.95  ? 28   GLY B O   1 
ATOM   1747 N N   . SER B 1 49  ? -5.118  5.276  26.041 1.00 57.97  ? 29   SER B N   1 
ATOM   1748 C CA  . SER B 1 49  ? -3.796  5.588  25.496 1.00 48.46  ? 29   SER B CA  1 
ATOM   1749 C C   . SER B 1 49  ? -3.926  6.704  24.470 1.00 89.20  ? 29   SER B C   1 
ATOM   1750 O O   . SER B 1 49  ? -4.983  6.888  23.860 1.00 52.76  ? 29   SER B O   1 
ATOM   1751 C CB  . SER B 1 49  ? -3.161  4.368  24.826 1.00 47.47  ? 29   SER B CB  1 
ATOM   1752 O OG  . SER B 1 49  ? -2.952  3.335  25.766 1.00 84.17  ? 29   SER B OG  1 
ATOM   1753 N N   . CYS B 1 50  ? -2.846  7.457  24.299 1.00 55.16  ? 30   CYS B N   1 
ATOM   1754 C CA  . CYS B 1 50  ? -2.764  8.489  23.278 1.00 52.59  ? 30   CYS B CA  1 
ATOM   1755 C C   . CYS B 1 50  ? -1.351  8.487  22.736 1.00 47.99  ? 30   CYS B C   1 
ATOM   1756 O O   . CYS B 1 50  ? -0.410  8.018  23.405 1.00 41.93  ? 30   CYS B O   1 
ATOM   1757 C CB  . CYS B 1 50  ? -3.151  9.868  23.834 1.00 48.34  ? 30   CYS B CB  1 
ATOM   1758 S SG  . CYS B 1 50  ? -1.975  10.609 24.998 1.00 67.90  ? 30   CYS B SG  1 
ATOM   1759 N N   . SER B 1 51  ? -1.212  8.988  21.523 1.00 42.90  ? 31   SER B N   1 
ATOM   1760 C CA  . SER B 1 51  ? 0.050   8.929  20.806 1.00 41.20  ? 31   SER B CA  1 
ATOM   1761 C C   . SER B 1 51  ? 0.236   10.175 19.972 1.00 50.95  ? 31   SER B C   1 
ATOM   1762 O O   . SER B 1 51  ? -0.731  10.868 19.635 1.00 42.29  ? 31   SER B O   1 
ATOM   1763 C CB  . SER B 1 51  ? 0.143   7.676  19.920 1.00 45.83  ? 31   SER B CB  1 
ATOM   1764 O OG  . SER B 1 51  ? -0.628  7.783  18.733 1.00 71.69  ? 31   SER B OG  1 
ATOM   1765 N N   . SER B 1 52  ? 1.484   10.450 19.618 1.00 31.58  ? 32   SER B N   1 
ATOM   1766 C CA  . SER B 1 52  ? 1.791   11.633 18.843 1.00 32.65  ? 32   SER B CA  1 
ATOM   1767 C C   . SER B 1 52  ? 3.062   11.432 18.055 1.00 38.09  ? 32   SER B C   1 
ATOM   1768 O O   . SER B 1 52  ? 3.965   10.781 18.517 1.00 36.56  ? 32   SER B O   1 
ATOM   1769 C CB  . SER B 1 52  ? 1.887   12.879 19.740 1.00 39.45  ? 32   SER B CB  1 
ATOM   1770 O OG  . SER B 1 52  ? 2.175   14.013 18.967 1.00 60.05  ? 32   SER B OG  1 
ATOM   1771 N N   . LEU B 1 53  ? 3.112   11.984 16.853 1.00 30.46  ? 33   LEU B N   1 
ATOM   1772 C CA  . LEU B 1 53  ? 4.312   11.952 16.018 1.00 33.11  ? 33   LEU B CA  1 
ATOM   1773 C C   . LEU B 1 53  ? 4.813   13.379 15.739 1.00 35.97  ? 33   LEU B C   1 
ATOM   1774 O O   . LEU B 1 53  ? 4.034   14.262 15.370 1.00 42.21  ? 33   LEU B O   1 
ATOM   1775 C CB  . LEU B 1 53  ? 4.047   11.183 14.703 1.00 41.19  ? 33   LEU B CB  1 
ATOM   1776 C CG  . LEU B 1 53  ? 5.137   11.241 13.630 1.00 34.33  ? 33   LEU B CG  1 
ATOM   1777 C CD1 . LEU B 1 53  ? 6.423   10.527 14.032 1.00 33.82  ? 33   LEU B CD1 1 
ATOM   1778 C CD2 . LEU B 1 53  ? 4.599   10.676 12.341 1.00 58.41  ? 33   LEU B CD2 1 
ATOM   1779 N N   . HIS B 1 54  ? 6.116   13.588 15.909 1.00 34.52  ? 34   HIS B N   1 
ATOM   1780 C CA  . HIS B 1 54  ? 6.790   14.855 15.637 1.00 34.24  ? 34   HIS B CA  1 
ATOM   1781 C C   . HIS B 1 54  ? 7.904   14.654 14.639 1.00 33.97  ? 34   HIS B C   1 
ATOM   1782 O O   . HIS B 1 54  ? 8.472   13.586 14.559 1.00 38.71  ? 34   HIS B O   1 
ATOM   1783 C CB  . HIS B 1 54  ? 7.365   15.439 16.941 1.00 33.55  ? 34   HIS B CB  1 
ATOM   1784 C CG  . HIS B 1 54  ? 6.294   15.923 17.857 1.00 39.80  ? 34   HIS B CG  1 
ATOM   1785 N ND1 . HIS B 1 54  ? 5.653   15.096 18.748 1.00 41.94  ? 34   HIS B ND1 1 
ATOM   1786 C CD2 . HIS B 1 54  ? 5.711   17.134 17.983 1.00 43.56  ? 34   HIS B CD2 1 
ATOM   1787 C CE1 . HIS B 1 54  ? 4.732   15.776 19.400 1.00 37.21  ? 34   HIS B CE1 1 
ATOM   1788 N NE2 . HIS B 1 54  ? 4.752   17.020 18.958 1.00 46.63  ? 34   HIS B NE2 1 
ATOM   1789 N N   . ALA B 1 55  ? 8.208   15.696 13.884 1.00 29.12  ? 35   ALA B N   1 
ATOM   1790 C CA  . ALA B 1 55  ? 9.266   15.665 12.911 1.00 36.54  ? 35   ALA B CA  1 
ATOM   1791 C C   . ALA B 1 55  ? 10.152  16.884 13.096 1.00 34.82  ? 35   ALA B C   1 
ATOM   1792 O O   . ALA B 1 55  ? 9.692   17.968 13.517 1.00 34.11  ? 35   ALA B O   1 
ATOM   1793 C CB  . ALA B 1 55  ? 8.676   15.682 11.518 1.00 32.94  ? 35   ALA B CB  1 
ATOM   1794 N N   . GLN B 1 56  ? 11.404  16.737 12.727 1.00 29.83  ? 36   GLN B N   1 
ATOM   1795 C CA  . GLN B 1 56  ? 12.362  17.823 12.847 1.00 35.39  ? 36   GLN B CA  1 
ATOM   1796 C C   . GLN B 1 56  ? 13.376  17.749 11.725 1.00 40.46  ? 36   GLN B C   1 
ATOM   1797 O O   . GLN B 1 56  ? 14.094  16.751 11.613 1.00 35.94  ? 36   GLN B O   1 
ATOM   1798 C CB  . GLN B 1 56  ? 13.084  17.791 14.210 1.00 31.05  ? 36   GLN B CB  1 
ATOM   1799 C CG  . GLN B 1 56  ? 14.168  18.852 14.373 1.00 29.53  ? 36   GLN B CG  1 
ATOM   1800 C CD  . GLN B 1 56  ? 13.611  20.270 14.483 1.00 34.54  ? 36   GLN B CD  1 
ATOM   1801 O OE1 . GLN B 1 56  ? 12.717  20.561 15.296 1.00 37.86  ? 36   GLN B OE1 1 
ATOM   1802 N NE2 . GLN B 1 56  ? 14.176  21.172 13.710 1.00 38.44  ? 36   GLN B NE2 1 
ATOM   1803 N N   . ARG B 1 57  ? 13.443  18.810 10.905 1.00 29.87  ? 37   ARG B N   1 
ATOM   1804 C CA  . ARG B 1 57  ? 14.505  18.921 9.931  1.00 29.00  ? 37   ARG B CA  1 
ATOM   1805 C C   . ARG B 1 57  ? 15.775  19.455 10.547 1.00 35.10  ? 37   ARG B C   1 
ATOM   1806 O O   . ARG B 1 57  ? 15.742  20.375 11.359 1.00 35.73  ? 37   ARG B O   1 
ATOM   1807 C CB  . ARG B 1 57  ? 14.026  19.811 8.734  1.00 34.10  ? 37   ARG B CB  1 
ATOM   1808 C CG  . ARG B 1 57  ? 14.993  19.761 7.525  1.00 39.58  ? 37   ARG B CG  1 
ATOM   1809 C CD  . ARG B 1 57  ? 14.402  20.516 6.304  1.00 38.15  ? 37   ARG B CD  1 
ATOM   1810 N NE  . ARG B 1 57  ? 13.021  20.117 6.069  1.00 47.09  ? 37   ARG B NE  1 
ATOM   1811 C CZ  . ARG B 1 57  ? 11.960  20.876 6.324  1.00 46.82  ? 37   ARG B CZ  1 
ATOM   1812 N NH1 . ARG B 1 57  ? 12.113  22.109 6.803  1.00 47.92  ? 37   ARG B NH1 1 
ATOM   1813 N NH2 . ARG B 1 57  ? 10.741  20.397 6.107  1.00 47.82  ? 37   ARG B NH2 1 
ATOM   1814 N N   . ILE B 1 58  ? 16.906  18.874 10.153 1.00 30.01  ? 38   ILE B N   1 
ATOM   1815 C CA  . ILE B 1 58  ? 18.202  19.245 10.688 1.00 28.12  ? 38   ILE B CA  1 
ATOM   1816 C C   . ILE B 1 58  ? 19.214  19.388 9.558  1.00 41.67  ? 38   ILE B C   1 
ATOM   1817 O O   . ILE B 1 58  ? 19.423  18.438 8.799  1.00 39.48  ? 38   ILE B O   1 
ATOM   1818 C CB  . ILE B 1 58  ? 18.724  18.194 11.653 1.00 31.41  ? 38   ILE B CB  1 
ATOM   1819 C CG1 . ILE B 1 58  ? 17.708  17.975 12.800 1.00 33.43  ? 38   ILE B CG1 1 
ATOM   1820 C CG2 . ILE B 1 58  ? 20.086  18.585 12.159 1.00 29.86  ? 38   ILE B CG2 1 
ATOM   1821 C CD1 . ILE B 1 58  ? 18.225  16.993 13.923 1.00 31.39  ? 38   ILE B CD1 1 
ATOM   1822 N N   . HIS B 1 59  ? 19.860  20.553 9.479  1.00 40.08  ? 39   HIS B N   1 
ATOM   1823 C CA  . HIS B 1 59  ? 20.885  20.795 8.446  1.00 40.88  ? 39   HIS B CA  1 
ATOM   1824 C C   . HIS B 1 59  ? 22.269  20.328 8.927  1.00 33.37  ? 39   HIS B C   1 
ATOM   1825 O O   . HIS B 1 59  ? 23.172  21.110 9.213  1.00 40.65  ? 39   HIS B O   1 
ATOM   1826 C CB  . HIS B 1 59  ? 20.774  22.242 7.885  1.00 39.80  ? 39   HIS B CB  1 
ATOM   1827 C CG  . HIS B 1 59  ? 19.456  22.481 7.203  1.00 43.07  ? 39   HIS B CG  1 
ATOM   1828 N ND1 . HIS B 1 59  ? 18.418  23.172 7.796  1.00 50.13  ? 39   HIS B ND1 1 
ATOM   1829 C CD2 . HIS B 1 59  ? 18.968  22.021 6.023  1.00 41.40  ? 39   HIS B CD2 1 
ATOM   1830 C CE1 . HIS B 1 59  ? 17.363  23.160 6.997  1.00 49.07  ? 39   HIS B CE1 1 
ATOM   1831 N NE2 . HIS B 1 59  ? 17.670  22.465 5.916  1.00 54.35  ? 39   HIS B NE2 1 
ATOM   1832 N N   . ALA B 1 60  ? 22.382  18.999 9.027  1.00 40.50  ? 40   ALA B N   1 
ATOM   1833 C CA  . ALA B 1 60  ? 23.614  18.327 9.416  1.00 43.66  ? 40   ALA B CA  1 
ATOM   1834 C C   . ALA B 1 60  ? 23.587  16.900 8.858  1.00 36.57  ? 40   ALA B C   1 
ATOM   1835 O O   . ALA B 1 60  ? 22.516  16.419 8.441  1.00 33.74  ? 40   ALA B O   1 
ATOM   1836 C CB  . ALA B 1 60  ? 23.807  18.338 10.967 1.00 46.51  ? 40   ALA B CB  1 
ATOM   1837 N N   . PRO B 1 61  ? 24.758  16.223 8.821  1.00 35.48  ? 41   PRO B N   1 
ATOM   1838 C CA  . PRO B 1 61  ? 24.836  14.870 8.239  1.00 36.36  ? 41   PRO B CA  1 
ATOM   1839 C C   . PRO B 1 61  ? 24.086  13.866 9.143  1.00 40.84  ? 41   PRO B C   1 
ATOM   1840 O O   . PRO B 1 61  ? 24.218  13.952 10.387 1.00 36.73  ? 41   PRO B O   1 
ATOM   1841 C CB  . PRO B 1 61  ? 26.343  14.572 8.212  1.00 47.22  ? 41   PRO B CB  1 
ATOM   1842 C CG  . PRO B 1 61  ? 27.040  15.888 8.533  1.00 46.91  ? 41   PRO B CG  1 
ATOM   1843 C CD  . PRO B 1 61  ? 26.061  16.666 9.365  1.00 41.50  ? 41   PRO B CD  1 
ATOM   1844 N N   . PRO B 1 62  ? 23.280  12.963 8.550  1.00 41.10  ? 42   PRO B N   1 
ATOM   1845 C CA  . PRO B 1 62  ? 22.563  11.973 9.361  1.00 39.87  ? 42   PRO B CA  1 
ATOM   1846 C C   . PRO B 1 62  ? 23.432  11.129 10.248 1.00 39.40  ? 42   PRO B C   1 
ATOM   1847 O O   . PRO B 1 62  ? 22.919  10.684 11.271 1.00 35.86  ? 42   PRO B O   1 
ATOM   1848 C CB  . PRO B 1 62  ? 21.857  11.073 8.338  1.00 46.91  ? 42   PRO B CB  1 
ATOM   1849 C CG  . PRO B 1 62  ? 22.459  11.426 7.019  1.00 52.56  ? 42   PRO B CG  1 
ATOM   1850 C CD  . PRO B 1 62  ? 22.943  12.830 7.119  1.00 46.26  ? 42   PRO B CD  1 
ATOM   1851 N N   . GLU B 1 63  ? 24.695  10.865 9.876  1.00 36.02  ? 43   GLU B N   1 
ATOM   1852 C CA  . GLU B 1 63  ? 25.574  10.107 10.779 1.00 47.89  ? 43   GLU B CA  1 
ATOM   1853 C C   . GLU B 1 63  ? 25.823  10.873 12.045 1.00 51.71  ? 43   GLU B C   1 
ATOM   1854 O O   . GLU B 1 63  ? 25.868  10.284 13.115 1.00 37.50  ? 43   GLU B O   1 
ATOM   1855 C CB  . GLU B 1 63  ? 26.927  9.682  10.166 1.00 42.18  ? 43   GLU B CB  1 
ATOM   1856 C CG  . GLU B 1 63  ? 27.457  10.500 9.014  1.00 122.85 ? 43   GLU B CG  1 
ATOM   1857 C CD  . GLU B 1 63  ? 26.707  10.234 7.730  1.00 220.00 ? 43   GLU B CD  1 
ATOM   1858 O OE1 . GLU B 1 63  ? 26.815  9.126  7.155  1.00 95.69  ? 43   GLU B OE1 1 
ATOM   1859 O OE2 . GLU B 1 63  ? 25.992  11.149 7.305  1.00 42.07  ? 43   GLU B OE2 1 
ATOM   1860 N N   . LEU B 1 64  ? 25.984  12.190 11.928 1.00 38.56  ? 44   LEU B N   1 
ATOM   1861 C CA  . LEU B 1 64  ? 26.217  13.011 13.095 1.00 34.92  ? 44   LEU B CA  1 
ATOM   1862 C C   . LEU B 1 64  ? 24.981  13.041 13.999 1.00 29.54  ? 44   LEU B C   1 
ATOM   1863 O O   . LEU B 1 64  ? 25.109  12.926 15.220 1.00 36.87  ? 44   LEU B O   1 
ATOM   1864 C CB  . LEU B 1 64  ? 26.561  14.438 12.674 1.00 40.08  ? 44   LEU B CB  1 
ATOM   1865 C CG  . LEU B 1 64  ? 26.723  15.445 13.805 1.00 35.89  ? 44   LEU B CG  1 
ATOM   1866 C CD1 . LEU B 1 64  ? 27.945  15.091 14.672 1.00 38.40  ? 44   LEU B CD1 1 
ATOM   1867 C CD2 . LEU B 1 64  ? 26.913  16.830 13.218 1.00 51.53  ? 44   LEU B CD2 1 
ATOM   1868 N N   . VAL B 1 65  ? 23.811  13.228 13.394 1.00 29.81  ? 45   VAL B N   1 
ATOM   1869 C CA  . VAL B 1 65  ? 22.565  13.250 14.172 1.00 31.86  ? 45   VAL B CA  1 
ATOM   1870 C C   . VAL B 1 65  ? 22.412  11.904 14.883 1.00 32.23  ? 45   VAL B C   1 
ATOM   1871 O O   . VAL B 1 65  ? 22.128  11.836 16.092 1.00 29.72  ? 45   VAL B O   1 
ATOM   1872 C CB  . VAL B 1 65  ? 21.350  13.537 13.287 1.00 29.90  ? 45   VAL B CB  1 
ATOM   1873 C CG1 . VAL B 1 65  ? 20.070  13.600 14.103 1.00 27.37  ? 45   VAL B CG1 1 
ATOM   1874 C CG2 . VAL B 1 65  ? 21.541  14.908 12.588 1.00 38.76  ? 45   VAL B CG2 1 
ATOM   1875 N N   . TRP B 1 66  ? 22.604  10.819 14.144 1.00 30.86  ? 46   TRP B N   1 
ATOM   1876 C CA  . TRP B 1 66  ? 22.527  9.497  14.770 1.00 31.86  ? 46   TRP B CA  1 
ATOM   1877 C C   . TRP B 1 66  ? 23.498  9.286  15.910 1.00 39.42  ? 46   TRP B C   1 
ATOM   1878 O O   . TRP B 1 66  ? 23.120  8.706  16.945 1.00 33.27  ? 46   TRP B O   1 
ATOM   1879 C CB  . TRP B 1 66  ? 22.672  8.395  13.716 1.00 35.81  ? 46   TRP B CB  1 
ATOM   1880 C CG  . TRP B 1 66  ? 22.646  6.988  14.308 1.00 33.04  ? 46   TRP B CG  1 
ATOM   1881 C CD1 . TRP B 1 66  ? 23.683  6.093  14.328 1.00 37.89  ? 46   TRP B CD1 1 
ATOM   1882 C CD2 . TRP B 1 66  ? 21.565  6.364  15.044 1.00 31.58  ? 46   TRP B CD2 1 
ATOM   1883 N NE1 . TRP B 1 66  ? 23.310  4.951  15.010 1.00 31.48  ? 46   TRP B NE1 1 
ATOM   1884 C CE2 . TRP B 1 66  ? 22.014  5.077  15.431 1.00 36.06  ? 46   TRP B CE2 1 
ATOM   1885 C CE3 . TRP B 1 66  ? 20.269  6.760  15.392 1.00 34.26  ? 46   TRP B CE3 1 
ATOM   1886 C CZ2 . TRP B 1 66  ? 21.209  4.179  16.147 1.00 35.15  ? 46   TRP B CZ2 1 
ATOM   1887 C CZ3 . TRP B 1 66  ? 19.456  5.853  16.112 1.00 32.76  ? 46   TRP B CZ3 1 
ATOM   1888 C CH2 . TRP B 1 66  ? 19.946  4.591  16.488 1.00 33.52  ? 46   TRP B CH2 1 
ATOM   1889 N N   . SER B 1 67  ? 24.737  9.759  15.758 1.00 27.43  ? 47   SER B N   1 
ATOM   1890 C CA  . SER B 1 67  ? 25.742  9.624  16.803 1.00 32.08  ? 47   SER B CA  1 
ATOM   1891 C C   . SER B 1 67  ? 25.350  10.270 18.133 1.00 39.81  ? 47   SER B C   1 
ATOM   1892 O O   . SER B 1 67  ? 25.787  9.823  19.169 1.00 35.11  ? 47   SER B O   1 
ATOM   1893 C CB  . SER B 1 67  ? 27.109  10.165 16.374 1.00 36.19  ? 47   SER B CB  1 
ATOM   1894 O OG  . SER B 1 67  ? 27.154  11.589 16.410 1.00 38.67  ? 47   SER B OG  1 
ATOM   1895 N N   . ILE B 1 68  ? 24.528  11.314 18.080 1.00 38.80  ? 48   ILE B N   1 
ATOM   1896 C CA  . ILE B 1 68  ? 23.994  11.968 19.280 1.00 30.05  ? 48   ILE B CA  1 
ATOM   1897 C C   . ILE B 1 68  ? 22.794  11.182 19.871 1.00 28.26  ? 48   ILE B C   1 
ATOM   1898 O O   . ILE B 1 68  ? 22.740  10.886 21.071 1.00 35.40  ? 48   ILE B O   1 
ATOM   1899 C CB  . ILE B 1 68  ? 23.560  13.413 18.936 1.00 27.60  ? 48   ILE B CB  1 
ATOM   1900 C CG1 . ILE B 1 68  ? 24.745  14.217 18.397 1.00 32.76  ? 48   ILE B CG1 1 
ATOM   1901 C CG2 . ILE B 1 68  ? 22.928  14.127 20.197 1.00 29.68  ? 48   ILE B CG2 1 
ATOM   1902 C CD1 . ILE B 1 68  ? 24.347  15.588 17.806 1.00 36.84  ? 48   ILE B CD1 1 
ATOM   1903 N N   . VAL B 1 69  ? 21.827  10.884 19.005 1.00 26.48  ? 49   VAL B N   1 
ATOM   1904 C CA  . VAL B 1 69  ? 20.522  10.290 19.396 1.00 26.34  ? 49   VAL B CA  1 
ATOM   1905 C C   . VAL B 1 69  ? 20.682  8.854  19.891 1.00 28.28  ? 49   VAL B C   1 
ATOM   1906 O O   . VAL B 1 69  ? 19.843  8.354  20.654 1.00 31.59  ? 49   VAL B O   1 
ATOM   1907 C CB  . VAL B 1 69  ? 19.627  10.307 18.120 1.00 34.31  ? 49   VAL B CB  1 
ATOM   1908 C CG1 . VAL B 1 69  ? 18.566  9.242  18.084 1.00 46.91  ? 49   VAL B CG1 1 
ATOM   1909 C CG2 . VAL B 1 69  ? 19.021  11.692 17.944 1.00 42.91  ? 49   VAL B CG2 1 
ATOM   1910 N N   . ARG B 1 70  ? 21.743  8.165  19.441 1.00 28.96  ? 50   ARG B N   1 
ATOM   1911 C CA  . ARG B 1 70  ? 21.956  6.733  19.833 1.00 27.96  ? 50   ARG B CA  1 
ATOM   1912 C C   . ARG B 1 70  ? 22.613  6.606  21.222 1.00 29.01  ? 50   ARG B C   1 
ATOM   1913 O O   . ARG B 1 70  ? 22.690  5.493  21.777 1.00 33.78  ? 50   ARG B O   1 
ATOM   1914 C CB  . ARG B 1 70  ? 22.888  6.032  18.840 1.00 32.74  ? 50   ARG B CB  1 
ATOM   1915 C CG  . ARG B 1 70  ? 24.340  6.470  18.956 1.00 30.66  ? 50   ARG B CG  1 
ATOM   1916 C CD  . ARG B 1 70  ? 25.202  5.756  17.906 1.00 42.57  ? 50   ARG B CD  1 
ATOM   1917 N NE  . ARG B 1 70  ? 25.255  4.307  18.127 1.00 40.00  ? 50   ARG B NE  1 
ATOM   1918 C CZ  . ARG B 1 70  ? 26.046  3.727  19.025 1.00 41.06  ? 50   ARG B CZ  1 
ATOM   1919 N NH1 . ARG B 1 70  ? 26.848  4.466  19.782 1.00 39.14  ? 50   ARG B NH1 1 
ATOM   1920 N NH2 . ARG B 1 70  ? 26.036  2.411  19.166 1.00 41.49  ? 50   ARG B NH2 1 
ATOM   1921 N N   . ARG B 1 71  ? 23.095  7.709  21.769 1.00 30.48  ? 51   ARG B N   1 
ATOM   1922 C CA  . ARG B 1 71  ? 23.805  7.695  23.057 1.00 33.95  ? 51   ARG B CA  1 
ATOM   1923 C C   . ARG B 1 71  ? 22.838  7.673  24.234 1.00 26.52  ? 51   ARG B C   1 
ATOM   1924 O O   . ARG B 1 71  ? 22.531  8.703  24.827 1.00 29.28  ? 51   ARG B O   1 
ATOM   1925 C CB  . ARG B 1 71  ? 24.780  8.870  23.229 1.00 40.18  ? 51   ARG B CB  1 
ATOM   1926 C CG  . ARG B 1 71  ? 26.079  8.745  22.468 1.00 52.33  ? 51   ARG B CG  1 
ATOM   1927 C CD  . ARG B 1 71  ? 26.902  7.523  22.908 1.00 124.37 ? 51   ARG B CD  1 
ATOM   1928 N NE  . ARG B 1 71  ? 27.281  7.541  24.325 1.00 50.49  ? 51   ARG B NE  1 
ATOM   1929 C CZ  . ARG B 1 71  ? 28.368  8.134  24.821 1.00 200.65 ? 51   ARG B CZ  1 
ATOM   1930 N NH1 . ARG B 1 71  ? 29.213  8.784  24.029 1.00 64.93  ? 51   ARG B NH1 1 
ATOM   1931 N NH2 . ARG B 1 71  ? 28.613  8.077  26.125 1.00 64.15  ? 51   ARG B NH2 1 
ATOM   1932 N N   . PHE B 1 72  ? 22.485  6.457  24.633 1.00 29.24  ? 52   PHE B N   1 
ATOM   1933 C CA  . PHE B 1 72  ? 21.405  6.228  25.598 1.00 29.96  ? 52   PHE B CA  1 
ATOM   1934 C C   . PHE B 1 72  ? 21.832  6.741  26.942 1.00 32.38  ? 52   PHE B C   1 
ATOM   1935 O O   . PHE B 1 72  ? 21.029  7.175  27.713 1.00 28.33  ? 52   PHE B O   1 
ATOM   1936 C CB  . PHE B 1 72  ? 21.053  4.725  25.659 1.00 28.66  ? 52   PHE B CB  1 
ATOM   1937 C CG  . PHE B 1 72  ? 19.924  4.400  26.596 1.00 27.39  ? 52   PHE B CG  1 
ATOM   1938 C CD1 . PHE B 1 72  ? 18.617  4.767  26.257 1.00 28.24  ? 52   PHE B CD1 1 
ATOM   1939 C CD2 . PHE B 1 72  ? 20.167  3.730  27.805 1.00 31.47  ? 52   PHE B CD2 1 
ATOM   1940 C CE1 . PHE B 1 72  ? 17.552  4.467  27.113 1.00 32.33  ? 52   PHE B CE1 1 
ATOM   1941 C CE2 . PHE B 1 72  ? 19.122  3.459  28.660 1.00 30.72  ? 52   PHE B CE2 1 
ATOM   1942 C CZ  . PHE B 1 72  ? 17.802  3.799  28.291 1.00 28.41  ? 52   PHE B CZ  1 
ATOM   1943 N N   . ASP B 1 73  ? 23.122  6.729  27.195 1.00 25.98  ? 53   ASP B N   1 
ATOM   1944 C CA  . ASP B 1 73  ? 23.615  7.194  28.499 1.00 32.25  ? 53   ASP B CA  1 
ATOM   1945 C C   . ASP B 1 73  ? 23.806  8.708  28.608 1.00 35.63  ? 53   ASP B C   1 
ATOM   1946 O O   . ASP B 1 73  ? 24.112  9.203  29.683 1.00 34.74  ? 53   ASP B O   1 
ATOM   1947 C CB  . ASP B 1 73  ? 24.935  6.503  28.858 1.00 39.70  ? 53   ASP B CB  1 
ATOM   1948 C CG  . ASP B 1 73  ? 26.001  6.658  27.773 1.00 44.89  ? 53   ASP B CG  1 
ATOM   1949 O OD1 . ASP B 1 73  ? 25.690  6.613  26.560 1.00 46.30  ? 53   ASP B OD1 1 
ATOM   1950 O OD2 . ASP B 1 73  ? 27.172  6.814  28.161 1.00 46.39  ? 53   ASP B OD2 1 
ATOM   1951 N N   . LYS B 1 74  ? 23.592  9.450  27.521 1.00 30.21  ? 54   LYS B N   1 
ATOM   1952 C CA  . LYS B 1 74  ? 23.752  10.916 27.548 1.00 31.42  ? 54   LYS B CA  1 
ATOM   1953 C C   . LYS B 1 74  ? 22.559  11.643 26.921 1.00 33.41  ? 54   LYS B C   1 
ATOM   1954 O O   . LYS B 1 74  ? 22.737  12.396 25.945 1.00 33.51  ? 54   LYS B O   1 
ATOM   1955 C CB  . LYS B 1 74  ? 25.008  11.305 26.758 1.00 39.85  ? 54   LYS B CB  1 
ATOM   1956 C CG  . LYS B 1 74  ? 26.236  10.698 27.325 1.00 33.98  ? 54   LYS B CG  1 
ATOM   1957 C CD  . LYS B 1 74  ? 26.556  11.303 28.679 1.00 54.23  ? 54   LYS B CD  1 
ATOM   1958 C CE  . LYS B 1 74  ? 27.923  10.855 29.169 1.00 81.80  ? 54   LYS B CE  1 
ATOM   1959 N NZ  . LYS B 1 74  ? 28.148  11.273 30.580 1.00 87.91  ? 54   LYS B NZ  1 
ATOM   1960 N N   . PRO B 1 75  ? 21.358  11.453 27.490 1.00 30.78  ? 55   PRO B N   1 
ATOM   1961 C CA  . PRO B 1 75  ? 20.209  12.136 26.897 1.00 34.30  ? 55   PRO B CA  1 
ATOM   1962 C C   . PRO B 1 75  ? 20.329  13.659 27.040 1.00 34.41  ? 55   PRO B C   1 
ATOM   1963 O O   . PRO B 1 75  ? 19.725  14.394 26.254 1.00 28.38  ? 55   PRO B O   1 
ATOM   1964 C CB  . PRO B 1 75  ? 19.013  11.581 27.690 1.00 30.83  ? 55   PRO B CB  1 
ATOM   1965 C CG  . PRO B 1 75  ? 19.614  11.163 29.045 1.00 33.77  ? 55   PRO B CG  1 
ATOM   1966 C CD  . PRO B 1 75  ? 20.987  10.656 28.680 1.00 28.01  ? 55   PRO B CD  1 
ATOM   1967 N N   . GLN B 1 76  ? 21.071  14.123 28.058 1.00 29.12  ? 56   GLN B N   1 
ATOM   1968 C CA  . GLN B 1 76  ? 21.204  15.573 28.358 1.00 29.05  ? 56   GLN B CA  1 
ATOM   1969 C C   . GLN B 1 76  ? 21.916  16.368 27.244 1.00 32.59  ? 56   GLN B C   1 
ATOM   1970 O O   . GLN B 1 76  ? 21.778  17.579 27.168 1.00 34.42  ? 56   GLN B O   1 
ATOM   1971 C CB  . GLN B 1 76  ? 21.910  15.823 29.690 1.00 31.49  ? 56   GLN B CB  1 
ATOM   1972 C CG  . GLN B 1 76  ? 23.355  15.328 29.717 1.00 34.96  ? 56   GLN B CG  1 
ATOM   1973 C CD  . GLN B 1 76  ? 23.496  13.896 30.227 1.00 44.78  ? 56   GLN B CD  1 
ATOM   1974 O OE1 . GLN B 1 76  ? 22.641  13.056 30.028 1.00 34.78  ? 56   GLN B OE1 1 
ATOM   1975 N NE2 . GLN B 1 76  ? 24.607  13.622 30.862 1.00 42.16  ? 56   GLN B NE2 1 
ATOM   1976 N N   . THR B 1 77  ? 22.629  15.671 26.363 1.00 29.40  ? 57   THR B N   1 
ATOM   1977 C CA  . THR B 1 77  ? 23.281  16.309 25.217 1.00 28.99  ? 57   THR B CA  1 
ATOM   1978 C C   . THR B 1 77  ? 22.267  16.935 24.284 1.00 29.89  ? 57   THR B C   1 
ATOM   1979 O O   . THR B 1 77  ? 22.547  17.943 23.631 1.00 35.80  ? 57   THR B O   1 
ATOM   1980 C CB  . THR B 1 77  ? 24.063  15.265 24.431 1.00 37.39  ? 57   THR B CB  1 
ATOM   1981 O OG1 . THR B 1 77  ? 25.148  14.810 25.250 1.00 42.08  ? 57   THR B OG1 1 
ATOM   1982 C CG2 . THR B 1 77  ? 24.629  15.855 23.143 1.00 38.81  ? 57   THR B CG2 1 
ATOM   1983 N N   . TYR B 1 78  ? 21.096  16.337 24.197 1.00 27.76  ? 58   TYR B N   1 
ATOM   1984 C CA  . TYR B 1 78  ? 20.072  16.831 23.246 1.00 32.00  ? 58   TYR B CA  1 
ATOM   1985 C C   . TYR B 1 78  ? 18.714  17.088 23.875 1.00 39.53  ? 58   TYR B C   1 
ATOM   1986 O O   . TYR B 1 78  ? 17.835  17.555 23.197 1.00 36.19  ? 58   TYR B O   1 
ATOM   1987 C CB  . TYR B 1 78  ? 19.947  15.924 22.008 1.00 38.36  ? 58   TYR B CB  1 
ATOM   1988 C CG  . TYR B 1 78  ? 19.489  14.490 22.297 1.00 28.18  ? 58   TYR B CG  1 
ATOM   1989 C CD1 . TYR B 1 78  ? 18.144  14.123 22.153 1.00 45.94  ? 58   TYR B CD1 1 
ATOM   1990 C CD2 . TYR B 1 78  ? 20.390  13.532 22.702 1.00 36.05  ? 58   TYR B CD2 1 
ATOM   1991 C CE1 . TYR B 1 78  ? 17.732  12.806 22.424 1.00 33.79  ? 58   TYR B CE1 1 
ATOM   1992 C CE2 . TYR B 1 78  ? 19.989  12.234 23.001 1.00 37.52  ? 58   TYR B CE2 1 
ATOM   1993 C CZ  . TYR B 1 78  ? 18.661  11.885 22.854 1.00 45.38  ? 58   TYR B CZ  1 
ATOM   1994 O OH  . TYR B 1 78  ? 18.279  10.604 23.144 1.00 43.29  ? 58   TYR B OH  1 
ATOM   1995 N N   . LYS B 1 79  ? 18.544  16.812 25.173 1.00 27.02  ? 59   LYS B N   1 
ATOM   1996 C CA  . LYS B 1 79  ? 17.255  17.030 25.821 1.00 25.67  ? 59   LYS B CA  1 
ATOM   1997 C C   . LYS B 1 79  ? 17.368  18.150 26.808 1.00 29.35  ? 59   LYS B C   1 
ATOM   1998 O O   . LYS B 1 79  ? 18.418  18.335 27.424 1.00 33.30  ? 59   LYS B O   1 
ATOM   1999 C CB  . LYS B 1 79  ? 16.794  15.753 26.522 1.00 25.44  ? 59   LYS B CB  1 
ATOM   2000 C CG  . LYS B 1 79  ? 16.555  14.589 25.514 1.00 26.68  ? 59   LYS B CG  1 
ATOM   2001 C CD  . LYS B 1 79  ? 15.859  13.472 26.276 1.00 32.36  ? 59   LYS B CD  1 
ATOM   2002 C CE  . LYS B 1 79  ? 15.547  12.322 25.325 1.00 42.44  ? 59   LYS B CE  1 
ATOM   2003 N NZ  . LYS B 1 79  ? 14.753  11.236 26.014 1.00 33.34  ? 59   LYS B NZ  1 
ATOM   2004 N N   . HIS B 1 80  ? 16.292  18.917 26.948 1.00 27.84  ? 60   HIS B N   1 
ATOM   2005 C CA  . HIS B 1 80  ? 16.184  19.936 27.988 1.00 29.99  ? 60   HIS B CA  1 
ATOM   2006 C C   . HIS B 1 80  ? 15.795  19.280 29.331 1.00 32.52  ? 60   HIS B C   1 
ATOM   2007 O O   . HIS B 1 80  ? 15.387  18.137 29.356 1.00 32.42  ? 60   HIS B O   1 
ATOM   2008 C CB  . HIS B 1 80  ? 15.056  20.901 27.599 1.00 49.85  ? 60   HIS B CB  1 
ATOM   2009 C CG  . HIS B 1 80  ? 15.367  21.781 26.427 1.00 29.89  ? 60   HIS B CG  1 
ATOM   2010 N ND1 . HIS B 1 80  ? 16.199  22.870 26.538 1.00 34.15  ? 60   HIS B ND1 1 
ATOM   2011 C CD2 . HIS B 1 80  ? 14.931  21.768 25.142 1.00 33.34  ? 60   HIS B CD2 1 
ATOM   2012 C CE1 . HIS B 1 80  ? 16.276  23.486 25.373 1.00 34.13  ? 60   HIS B CE1 1 
ATOM   2013 N NE2 . HIS B 1 80  ? 15.483  22.862 24.527 1.00 29.54  ? 60   HIS B NE2 1 
ATOM   2014 N N   . PHE B 1 81  ? 15.928  20.032 30.425 1.00 29.57  ? 61   PHE B N   1 
ATOM   2015 C CA  . PHE B 1 81  ? 15.294  19.669 31.737 1.00 28.19  ? 61   PHE B CA  1 
ATOM   2016 C C   . PHE B 1 81  ? 16.025  18.558 32.484 1.00 34.73  ? 61   PHE B C   1 
ATOM   2017 O O   . PHE B 1 81  ? 15.593  18.144 33.568 1.00 37.80  ? 61   PHE B O   1 
ATOM   2018 C CB  . PHE B 1 81  ? 13.822  19.282 31.552 1.00 29.31  ? 61   PHE B CB  1 
ATOM   2019 C CG  . PHE B 1 81  ? 13.019  20.307 30.771 1.00 25.79  ? 61   PHE B CG  1 
ATOM   2020 C CD1 . PHE B 1 81  ? 13.040  21.647 31.158 1.00 26.97  ? 61   PHE B CD1 1 
ATOM   2021 C CD2 . PHE B 1 81  ? 12.266  19.922 29.658 1.00 31.99  ? 61   PHE B CD2 1 
ATOM   2022 C CE1 . PHE B 1 81  ? 12.339  22.624 30.441 1.00 33.85  ? 61   PHE B CE1 1 
ATOM   2023 C CE2 . PHE B 1 81  ? 11.517  20.897 28.934 1.00 32.40  ? 61   PHE B CE2 1 
ATOM   2024 C CZ  . PHE B 1 81  ? 11.571  22.234 29.333 1.00 28.27  ? 61   PHE B CZ  1 
ATOM   2025 N N   . ILE B 1 82  ? 17.143  18.096 31.938 1.00 32.97  ? 62   ILE B N   1 
ATOM   2026 C CA  . ILE B 1 82  ? 17.907  17.029 32.599 1.00 27.41  ? 62   ILE B CA  1 
ATOM   2027 C C   . ILE B 1 82  ? 19.035  17.598 33.430 1.00 37.33  ? 62   ILE B C   1 
ATOM   2028 O O   . ILE B 1 82  ? 19.915  18.308 32.923 1.00 38.27  ? 62   ILE B O   1 
ATOM   2029 C CB  . ILE B 1 82  ? 18.394  15.984 31.581 1.00 28.21  ? 62   ILE B CB  1 
ATOM   2030 C CG1 . ILE B 1 82  ? 17.138  15.303 30.975 1.00 27.39  ? 62   ILE B CG1 1 
ATOM   2031 C CG2 . ILE B 1 82  ? 19.225  14.926 32.252 1.00 33.68  ? 62   ILE B CG2 1 
ATOM   2032 C CD1 . ILE B 1 82  ? 17.439  14.301 29.852 1.00 33.37  ? 62   ILE B CD1 1 
ATOM   2033 N N   . LYS B 1 83  ? 18.957  17.334 34.728 1.00 31.17  ? 63   LYS B N   1 
ATOM   2034 C CA  . LYS B 1 83  ? 20.032  17.718 35.668 1.00 32.04  ? 63   LYS B CA  1 
ATOM   2035 C C   . LYS B 1 83  ? 21.250  16.776 35.516 1.00 38.45  ? 63   LYS B C   1 
ATOM   2036 O O   . LYS B 1 83  ? 22.416  17.226 35.433 1.00 39.86  ? 63   LYS B O   1 
ATOM   2037 C CB  . LYS B 1 83  ? 19.494  17.716 37.102 1.00 33.99  ? 63   LYS B CB  1 
ATOM   2038 C CG  . LYS B 1 83  ? 20.587  17.925 38.199 1.00 39.40  ? 63   LYS B CG  1 
ATOM   2039 C CD  . LYS B 1 83  ? 19.923  17.854 39.591 1.00 39.51  ? 63   LYS B CD  1 
ATOM   2040 C CE  . LYS B 1 83  ? 20.836  18.348 40.746 1.00 50.90  ? 63   LYS B CE  1 
ATOM   2041 N NZ  . LYS B 1 83  ? 22.135  17.613 40.918 1.00 42.67  ? 63   LYS B NZ  1 
ATOM   2042 N N   . SER B 1 84  ? 20.978  15.470 35.511 1.00 31.73  ? 64   SER B N   1 
ATOM   2043 C CA  . SER B 1 84  ? 22.009  14.443 35.357 1.00 39.90  ? 64   SER B CA  1 
ATOM   2044 C C   . SER B 1 84  ? 21.385  13.127 34.913 1.00 35.38  ? 64   SER B C   1 
ATOM   2045 O O   . SER B 1 84  ? 20.171  12.974 34.958 1.00 29.27  ? 64   SER B O   1 
ATOM   2046 C CB  . SER B 1 84  ? 22.792  14.208 36.667 1.00 38.87  ? 64   SER B CB  1 
ATOM   2047 O OG  . SER B 1 84  ? 21.961  13.794 37.777 1.00 34.34  ? 64   SER B OG  1 
ATOM   2048 N N   . CYS B 1 85  ? 22.240  12.187 34.515 1.00 32.40  ? 65   CYS B N   1 
ATOM   2049 C CA  . CYS B 1 85  ? 21.817  10.844 34.159 1.00 31.66  ? 65   CYS B CA  1 
ATOM   2050 C C   . CYS B 1 85  ? 22.913  9.868  34.582 1.00 39.33  ? 65   CYS B C   1 
ATOM   2051 O O   . CYS B 1 85  ? 24.098  10.177 34.436 1.00 40.18  ? 65   CYS B O   1 
ATOM   2052 C CB  . CYS B 1 85  ? 21.604  10.778 32.644 1.00 36.35  ? 65   CYS B CB  1 
ATOM   2053 S SG  . CYS B 1 85  ? 20.857  9.232  32.151 1.00 34.38  ? 65   CYS B SG  1 
ATOM   2054 N N   . SER B 1 86  ? 22.530  8.722  35.146 1.00 34.19  ? 66   SER B N   1 
ATOM   2055 C CA  . SER B 1 86  ? 23.505  7.693  35.501 1.00 38.16  ? 66   SER B CA  1 
ATOM   2056 C C   . SER B 1 86  ? 23.047  6.376  34.940 1.00 43.94  ? 66   SER B C   1 
ATOM   2057 O O   . SER B 1 86  ? 21.858  6.169  34.684 1.00 33.43  ? 66   SER B O   1 
ATOM   2058 C CB  . SER B 1 86  ? 23.712  7.623  37.021 1.00 40.09  ? 66   SER B CB  1 
ATOM   2059 O OG  . SER B 1 86  ? 22.584  7.061  37.673 1.00 37.87  ? 66   SER B OG  1 
ATOM   2060 N N   . VAL B 1 87  ? 24.016  5.510  34.687 1.00 39.80  ? 67   VAL B N   1 
ATOM   2061 C CA  . VAL B 1 87  ? 23.773  4.165  34.196 1.00 36.07  ? 67   VAL B CA  1 
ATOM   2062 C C   . VAL B 1 87  ? 24.597  3.207  35.073 1.00 45.86  ? 67   VAL B C   1 
ATOM   2063 O O   . VAL B 1 87  ? 25.432  3.672  35.842 1.00 41.74  ? 67   VAL B O   1 
ATOM   2064 C CB  . VAL B 1 87  ? 24.151  4.038  32.686 1.00 41.15  ? 67   VAL B CB  1 
ATOM   2065 C CG1 . VAL B 1 87  ? 23.156  4.808  31.794 1.00 38.35  ? 67   VAL B CG1 1 
ATOM   2066 C CG2 . VAL B 1 87  ? 25.594  4.502  32.420 1.00 47.41  ? 67   VAL B CG2 1 
ATOM   2067 N N   . GLU B 1 88  ? 24.358  1.901  34.957 1.00 44.48  ? 68   GLU B N   1 
ATOM   2068 C CA  . GLU B 1 88  ? 25.055  0.872  35.766 1.00 49.07  ? 68   GLU B CA  1 
ATOM   2069 C C   . GLU B 1 88  ? 26.576  0.969  35.703 1.00 56.09  ? 68   GLU B C   1 
ATOM   2070 O O   . GLU B 1 88  ? 27.127  1.564  34.764 1.00 46.45  ? 68   GLU B O   1 
ATOM   2071 C CB  . GLU B 1 88  ? 24.608  -0.538 35.350 1.00 51.11  ? 68   GLU B CB  1 
ATOM   2072 C CG  . GLU B 1 88  ? 25.067  -0.980 33.955 1.00 159.04 ? 68   GLU B CG  1 
ATOM   2073 C CD  . GLU B 1 88  ? 25.203  -2.492 33.802 1.00 187.71 ? 68   GLU B CD  1 
ATOM   2074 O OE1 . GLU B 1 88  ? 25.939  -2.927 32.889 1.00 155.77 ? 68   GLU B OE1 1 
ATOM   2075 O OE2 . GLU B 1 88  ? 24.583  -3.246 34.583 1.00 146.89 ? 68   GLU B OE2 1 
ATOM   2076 N N   . GLN B 1 89  ? 27.240  0.367  36.696 1.00 87.62  ? 69   GLN B N   1 
ATOM   2077 C CA  . GLN B 1 89  ? 28.700  0.458  36.887 1.00 103.02 ? 69   GLN B CA  1 
ATOM   2078 C C   . GLN B 1 89  ? 29.495  -0.593 36.111 1.00 102.04 ? 69   GLN B C   1 
ATOM   2079 O O   . GLN B 1 89  ? 30.147  -1.462 36.691 1.00 153.42 ? 69   GLN B O   1 
ATOM   2080 C CB  . GLN B 1 89  ? 29.058  0.425  38.380 1.00 100.90 ? 69   GLN B CB  1 
ATOM   2081 C CG  . GLN B 1 89  ? 29.295  1.803  38.988 1.00 173.82 ? 69   GLN B CG  1 
ATOM   2082 C CD  . GLN B 1 89  ? 30.438  2.551  38.313 1.00 243.26 ? 69   GLN B CD  1 
ATOM   2083 O OE1 . GLN B 1 89  ? 30.248  3.644  37.776 1.00 101.15 ? 69   GLN B OE1 1 
ATOM   2084 N NE2 . GLN B 1 89  ? 31.627  1.955  38.323 1.00 90.84  ? 69   GLN B NE2 1 
ATOM   2085 N N   A ASN B 1 90  ? 29.263  -0.608 34.798 0.50 100.35 ? 70   ASN B N   1 
ATOM   2086 N N   B ASN B 1 90  ? 29.618  -0.293 34.821 0.50 35.71  ? 70   ASN B N   1 
ATOM   2087 C CA  A ASN B 1 90  ? 29.470  -1.783 33.937 0.50 119.70 ? 70   ASN B CA  1 
ATOM   2088 C CA  B ASN B 1 90  ? 30.443  -0.960 33.792 0.50 37.25  ? 70   ASN B CA  1 
ATOM   2089 C C   A ASN B 1 90  ? 28.770  -1.572 32.602 0.50 108.86 ? 70   ASN B C   1 
ATOM   2090 C C   B ASN B 1 90  ? 29.721  -0.831 32.449 0.50 60.52  ? 70   ASN B C   1 
ATOM   2091 O O   A ASN B 1 90  ? 28.726  -2.467 31.754 0.50 75.74  ? 70   ASN B O   1 
ATOM   2092 O O   B ASN B 1 90  ? 30.335  -0.888 31.384 0.50 77.21  ? 70   ASN B O   1 
ATOM   2093 C CB  A ASN B 1 90  ? 28.873  -3.051 34.575 0.50 118.72 ? 70   ASN B CB  1 
ATOM   2094 C CB  B ASN B 1 90  ? 30.753  -2.426 34.105 0.50 97.22  ? 70   ASN B CB  1 
ATOM   2095 C CG  A ASN B 1 90  ? 29.921  -3.951 35.215 0.50 159.55 ? 70   ASN B CG  1 
ATOM   2096 C CG  B ASN B 1 90  ? 32.171  -2.625 34.610 0.50 108.15 ? 70   ASN B CG  1 
ATOM   2097 O OD1 A ASN B 1 90  ? 31.062  -4.029 34.757 0.50 222.29 ? 70   ASN B OD1 1 
ATOM   2098 O OD1 B ASN B 1 90  ? 32.890  -1.660 34.870 0.50 39.06  ? 70   ASN B OD1 1 
ATOM   2099 N ND2 A ASN B 1 90  ? 29.525  -4.650 36.275 0.50 69.23  ? 70   ASN B ND2 1 
ATOM   2100 N ND2 B ASN B 1 90  ? 32.581  -3.881 34.749 0.50 126.24 ? 70   ASN B ND2 1 
ATOM   2101 N N   A PHE B 1 91  ? 28.200  -0.385 32.429 0.50 112.18 ? 71   PHE B N   1 
ATOM   2102 N N   B PHE B 1 91  ? 28.403  -0.659 32.535 0.50 95.66  ? 71   PHE B N   1 
ATOM   2103 C CA  A PHE B 1 91  ? 27.331  -0.116 31.291 0.50 86.44  ? 71   PHE B CA  1 
ATOM   2104 C CA  B PHE B 1 91  ? 27.536  -0.296 31.407 0.50 72.75  ? 71   PHE B CA  1 
ATOM   2105 C C   A PHE B 1 91  ? 27.890  -0.591 29.955 0.50 46.71  ? 71   PHE B C   1 
ATOM   2106 C C   B PHE B 1 91  ? 27.998  -0.720 30.005 0.50 37.06  ? 71   PHE B C   1 
ATOM   2107 O O   A PHE B 1 91  ? 28.952  -0.146 29.509 0.50 58.05  ? 71   PHE B O   1 
ATOM   2108 O O   B PHE B 1 91  ? 29.077  -0.333 29.548 0.50 62.39  ? 71   PHE B O   1 
ATOM   2109 C CB  A PHE B 1 91  ? 26.975  1.372  31.218 0.50 101.33 ? 71   PHE B CB  1 
ATOM   2110 C CB  B PHE B 1 91  ? 27.226  1.212  31.450 0.50 52.89  ? 71   PHE B CB  1 
ATOM   2111 C CG  A PHE B 1 91  ? 25.892  1.699  30.215 0.50 54.70  ? 71   PHE B CG  1 
ATOM   2112 C CG  B PHE B 1 91  ? 26.415  1.711  30.276 0.50 35.20  ? 71   PHE B CG  1 
ATOM   2113 C CD1 A PHE B 1 91  ? 24.552  1.489  30.523 0.50 32.14  ? 71   PHE B CD1 1 
ATOM   2114 C CD1 B PHE B 1 91  ? 25.081  1.339  30.119 0.50 45.78  ? 71   PHE B CD1 1 
ATOM   2115 C CD2 A PHE B 1 91  ? 26.216  2.230  28.967 0.50 30.54  ? 71   PHE B CD2 1 
ATOM   2116 C CD2 B PHE B 1 91  ? 26.983  2.560  29.336 0.50 47.80  ? 71   PHE B CD2 1 
ATOM   2117 C CE1 A PHE B 1 91  ? 23.539  1.801  29.587 0.50 32.49  ? 71   PHE B CE1 1 
ATOM   2118 C CE1 B PHE B 1 91  ? 24.331  1.801  29.028 0.50 55.84  ? 71   PHE B CE1 1 
ATOM   2119 C CE2 A PHE B 1 91  ? 25.217  2.553  28.034 0.50 43.17  ? 71   PHE B CE2 1 
ATOM   2120 C CE2 B PHE B 1 91  ? 26.244  3.029  28.251 0.50 38.35  ? 71   PHE B CE2 1 
ATOM   2121 C CZ  A PHE B 1 91  ? 23.878  2.344  28.349 0.50 27.81  ? 71   PHE B CZ  1 
ATOM   2122 C CZ  B PHE B 1 91  ? 24.914  2.652  28.095 0.50 36.84  ? 71   PHE B CZ  1 
ATOM   2123 N N   . GLU B 1 92  ? 27.154  -1.504 29.334 1.00 42.46  ? 72   GLU B N   1 
ATOM   2124 C CA  . GLU B 1 92  ? 27.308  -1.802 27.906 1.00 40.21  ? 72   GLU B CA  1 
ATOM   2125 C C   . GLU B 1 92  ? 25.950  -1.415 27.380 1.00 53.85  ? 72   GLU B C   1 
ATOM   2126 O O   . GLU B 1 92  ? 24.935  -1.753 27.970 1.00 44.46  ? 72   GLU B O   1 
ATOM   2127 C CB  . GLU B 1 92  ? 27.545  -3.288 27.637 1.00 39.64  ? 72   GLU B CB  1 
ATOM   2128 C CG  . GLU B 1 92  ? 28.852  -3.847 28.165 1.00 161.08 ? 72   GLU B CG  1 
ATOM   2129 C CD  . GLU B 1 92  ? 28.820  -5.358 28.261 1.00 190.29 ? 72   GLU B CD  1 
ATOM   2130 O OE1 . GLU B 1 92  ? 28.773  -6.033 27.207 1.00 130.41 ? 72   GLU B OE1 1 
ATOM   2131 O OE2 . GLU B 1 92  ? 28.834  -5.866 29.401 1.00 81.62  ? 72   GLU B OE2 1 
ATOM   2132 N N   . MET B 1 93  ? 25.925  -0.657 26.305 1.00 42.84  ? 73   MET B N   1 
ATOM   2133 C CA  A MET B 1 93  ? 24.640  -0.199 25.763 0.50 26.30  ? 73   MET B CA  1 
ATOM   2134 C CA  B MET B 1 93  ? 24.702  -0.147 25.738 0.50 76.41  ? 73   MET B CA  1 
ATOM   2135 C C   . MET B 1 93  ? 24.055  -1.252 24.873 1.00 47.02  ? 73   MET B C   1 
ATOM   2136 O O   . MET B 1 93  ? 24.349  -1.338 23.676 1.00 54.10  ? 73   MET B O   1 
ATOM   2137 C CB  A MET B 1 93  ? 24.785  1.109  24.981 0.50 83.55  ? 73   MET B CB  1 
ATOM   2138 C CB  B MET B 1 93  ? 25.062  1.122  24.938 0.50 23.69  ? 73   MET B CB  1 
ATOM   2139 C CG  A MET B 1 93  ? 23.497  1.539  24.256 0.50 24.76  ? 73   MET B CG  1 
ATOM   2140 C CG  B MET B 1 93  ? 23.968  2.163  24.830 0.50 41.86  ? 73   MET B CG  1 
ATOM   2141 S SD  A MET B 1 93  ? 23.596  3.166  23.475 0.50 36.64  ? 73   MET B SD  1 
ATOM   2142 S SD  B MET B 1 93  ? 24.610  3.677  24.076 0.50 42.11  ? 73   MET B SD  1 
ATOM   2143 C CE  A MET B 1 93  ? 24.766  4.006  24.562 0.50 42.36  ? 73   MET B CE  1 
ATOM   2144 C CE  B MET B 1 93  ? 25.049  3.131  22.426 0.50 27.77  ? 73   MET B CE  1 
ATOM   2145 N N   . ARG B 1 94  ? 23.222  -2.099 25.487 1.00 37.93  ? 74   ARG B N   1 
ATOM   2146 C CA  . ARG B 1 94  ? 22.509  -3.152 24.790 1.00 34.69  ? 74   ARG B CA  1 
ATOM   2147 C C   . ARG B 1 94  ? 21.023  -3.017 25.120 1.00 29.34  ? 74   ARG B C   1 
ATOM   2148 O O   . ARG B 1 94  ? 20.670  -2.555 26.212 1.00 32.62  ? 74   ARG B O   1 
ATOM   2149 C CB  . ARG B 1 94  ? 23.015  -4.541 25.291 1.00 34.23  ? 74   ARG B CB  1 
ATOM   2150 C CG  . ARG B 1 94  ? 24.433  -4.863 24.895 1.00 42.20  ? 74   ARG B CG  1 
ATOM   2151 C CD  . ARG B 1 94  ? 24.760  -6.309 25.214 1.00 51.64  ? 74   ARG B CD  1 
ATOM   2152 N NE  . ARG B 1 94  ? 26.012  -6.753 24.584 1.00 58.99  ? 74   ARG B NE  1 
ATOM   2153 C CZ  . ARG B 1 94  ? 26.087  -7.387 23.410 1.00 46.15  ? 74   ARG B CZ  1 
ATOM   2154 N NH1 . ARG B 1 94  ? 24.989  -7.657 22.700 1.00 55.66  ? 74   ARG B NH1 1 
ATOM   2155 N NH2 . ARG B 1 94  ? 27.272  -7.746 22.935 1.00 275.30 ? 74   ARG B NH2 1 
ATOM   2156 N N   . VAL B 1 95  ? 20.155  -3.464 24.225 1.00 30.98  ? 75   VAL B N   1 
ATOM   2157 C CA  . VAL B 1 95  ? 18.733  -3.412 24.520 1.00 33.77  ? 75   VAL B CA  1 
ATOM   2158 C C   . VAL B 1 95  ? 18.460  -4.060 25.877 1.00 35.25  ? 75   VAL B C   1 
ATOM   2159 O O   . VAL B 1 95  ? 19.022  -5.136 26.193 1.00 31.96  ? 75   VAL B O   1 
ATOM   2160 C CB  . VAL B 1 95  ? 17.917  -4.082 23.390 1.00 33.12  ? 75   VAL B CB  1 
ATOM   2161 C CG1 . VAL B 1 95  ? 16.488  -4.376 23.831 1.00 38.53  ? 75   VAL B CG1 1 
ATOM   2162 C CG2 . VAL B 1 95  ? 17.888  -3.198 22.160 1.00 37.13  ? 75   VAL B CG2 1 
ATOM   2163 N N   . GLY B 1 96  ? 17.603  -3.402 26.664 1.00 27.54  ? 76   GLY B N   1 
ATOM   2164 C CA  . GLY B 1 96  ? 17.245  -3.836 28.011 1.00 29.79  ? 76   GLY B CA  1 
ATOM   2165 C C   . GLY B 1 96  ? 18.027  -3.134 29.087 1.00 30.95  ? 76   GLY B C   1 
ATOM   2166 O O   . GLY B 1 96  ? 17.671  -3.234 30.277 1.00 32.39  ? 76   GLY B O   1 
ATOM   2167 N N   . CYS B 1 97  ? 19.097  -2.413 28.707 1.00 33.37  ? 77   CYS B N   1 
ATOM   2168 C CA  . CYS B 1 97  ? 19.783  -1.586 29.706 1.00 36.60  ? 77   CYS B CA  1 
ATOM   2169 C C   . CYS B 1 97  ? 18.898  -0.418 30.201 1.00 30.86  ? 77   CYS B C   1 
ATOM   2170 O O   . CYS B 1 97  ? 17.896  -0.054 29.552 1.00 30.03  ? 77   CYS B O   1 
ATOM   2171 C CB  . CYS B 1 97  ? 21.140  -1.105 29.195 1.00 32.58  ? 77   CYS B CB  1 
ATOM   2172 S SG  . CYS B 1 97  ? 21.007  0.171  27.938 1.00 37.03  ? 77   CYS B SG  1 
ATOM   2173 N N   . THR B 1 98  ? 19.243  0.121  31.359 1.00 29.21  ? 78   THR B N   1 
ATOM   2174 C CA  . THR B 1 98  ? 18.459  1.191  31.951 1.00 26.11  ? 78   THR B CA  1 
ATOM   2175 C C   . THR B 1 98  ? 19.323  2.411  32.264 1.00 28.16  ? 78   THR B C   1 
ATOM   2176 O O   . THR B 1 98  ? 20.560  2.333  32.351 1.00 33.72  ? 78   THR B O   1 
ATOM   2177 C CB  . THR B 1 98  ? 17.697  0.725  33.214 1.00 40.76  ? 78   THR B CB  1 
ATOM   2178 O OG1 . THR B 1 98  ? 18.658  0.333  34.217 1.00 36.28  ? 78   THR B OG1 1 
ATOM   2179 C CG2 . THR B 1 98  ? 16.720  -0.461 32.867 1.00 37.22  ? 78   THR B CG2 1 
ATOM   2180 N N   . ARG B 1 99  ? 18.664  3.554  32.450 1.00 29.90  ? 79   ARG B N   1 
ATOM   2181 C CA  . ARG B 1 99  ? 19.351  4.785  32.907 1.00 25.55  ? 79   ARG B CA  1 
ATOM   2182 C C   . ARG B 1 99  ? 18.425  5.453  33.914 1.00 29.14  ? 79   ARG B C   1 
ATOM   2183 O O   . ARG B 1 99  ? 17.214  5.274  33.845 1.00 29.17  ? 79   ARG B O   1 
ATOM   2184 C CB  . ARG B 1 99  ? 19.600  5.719  31.703 1.00 24.65  ? 79   ARG B CB  1 
ATOM   2185 C CG  . ARG B 1 99  ? 18.311  6.183  31.041 1.00 28.26  ? 79   ARG B CG  1 
ATOM   2186 C CD  . ARG B 1 99  ? 18.645  7.065  29.855 1.00 31.27  ? 79   ARG B CD  1 
ATOM   2187 N NE  . ARG B 1 99  ? 17.429  7.449  29.136 1.00 29.72  ? 79   ARG B NE  1 
ATOM   2188 C CZ  . ARG B 1 99  ? 17.401  7.863  27.868 1.00 32.52  ? 79   ARG B CZ  1 
ATOM   2189 N NH1 . ARG B 1 99  ? 18.524  7.955  27.135 1.00 27.71  ? 79   ARG B NH1 1 
ATOM   2190 N NH2 . ARG B 1 99  ? 16.238  8.189  27.322 1.00 32.50  ? 79   ARG B NH2 1 
ATOM   2191 N N   . ASP B 1 100 ? 19.002  6.233  34.834 1.00 27.65  ? 80   ASP B N   1 
ATOM   2192 C CA  . ASP B 1 100 ? 18.232  6.951  35.839 1.00 28.63  ? 80   ASP B CA  1 
ATOM   2193 C C   . ASP B 1 100 ? 18.437  8.424  35.590 1.00 28.00  ? 80   ASP B C   1 
ATOM   2194 O O   . ASP B 1 100 ? 19.510  8.979  35.833 1.00 32.30  ? 80   ASP B O   1 
ATOM   2195 C CB  . ASP B 1 100 ? 18.722  6.602  37.237 1.00 35.04  ? 80   ASP B CB  1 
ATOM   2196 C CG  . ASP B 1 100 ? 18.407  5.148  37.622 1.00 62.77  ? 80   ASP B CG  1 
ATOM   2197 O OD1 . ASP B 1 100 ? 17.399  4.593  37.119 1.00 43.63  ? 80   ASP B OD1 1 
ATOM   2198 O OD2 . ASP B 1 100 ? 19.159  4.563  38.430 1.00 113.77 ? 80   ASP B OD2 1 
ATOM   2199 N N   . VAL B 1 101 ? 17.399  9.035  35.046 1.00 23.35  ? 81   VAL B N   1 
ATOM   2200 C CA  . VAL B 1 101 ? 17.474  10.429 34.652 1.00 24.20  ? 81   VAL B CA  1 
ATOM   2201 C C   . VAL B 1 101 ? 16.966  11.303 35.803 1.00 34.66  ? 81   VAL B C   1 
ATOM   2202 O O   . VAL B 1 101 ? 15.933  11.015 36.399 1.00 34.03  ? 81   VAL B O   1 
ATOM   2203 C CB  . VAL B 1 101 ? 16.620  10.650 33.358 1.00 30.21  ? 81   VAL B CB  1 
ATOM   2204 C CG1 . VAL B 1 101 ? 16.531  12.112 33.013 1.00 37.09  ? 81   VAL B CG1 1 
ATOM   2205 C CG2 . VAL B 1 101 ? 17.247  9.889  32.181 1.00 36.25  ? 81   VAL B CG2 1 
ATOM   2206 N N   . ILE B 1 102 ? 17.697  12.364 36.114 1.00 30.98  ? 82   ILE B N   1 
ATOM   2207 C CA  . ILE B 1 102 ? 17.273  13.297 37.167 1.00 29.37  ? 82   ILE B CA  1 
ATOM   2208 C C   . ILE B 1 102 ? 16.812  14.574 36.436 1.00 29.76  ? 82   ILE B C   1 
ATOM   2209 O O   . ILE B 1 102 ? 17.569  15.117 35.677 1.00 29.57  ? 82   ILE B O   1 
ATOM   2210 C CB  . ILE B 1 102 ? 18.470  13.655 38.061 1.00 32.84  ? 82   ILE B CB  1 
ATOM   2211 C CG1 . ILE B 1 102 ? 19.148  12.363 38.576 1.00 40.21  ? 82   ILE B CG1 1 
ATOM   2212 C CG2 . ILE B 1 102 ? 18.009  14.569 39.210 1.00 32.53  ? 82   ILE B CG2 1 
ATOM   2213 C CD1 . ILE B 1 102 ? 18.187  11.387 39.280 1.00 34.28  ? 82   ILE B CD1 1 
ATOM   2214 N N   . VAL B 1 103 ? 15.605  15.034 36.737 1.00 31.65  ? 83   VAL B N   1 
ATOM   2215 C CA  . VAL B 1 103 ? 14.978  16.198 36.122 1.00 28.24  ? 83   VAL B CA  1 
ATOM   2216 C C   . VAL B 1 103 ? 15.189  17.458 36.992 1.00 35.95  ? 83   VAL B C   1 
ATOM   2217 O O   . VAL B 1 103 ? 15.203  17.369 38.210 1.00 35.56  ? 83   VAL B O   1 
ATOM   2218 C CB  . VAL B 1 103 ? 13.450  16.002 36.102 1.00 32.19  ? 83   VAL B CB  1 
ATOM   2219 C CG1 . VAL B 1 103 ? 12.831  16.966 35.182 1.00 39.34  ? 83   VAL B CG1 1 
ATOM   2220 C CG2 . VAL B 1 103 ? 13.075  14.574 35.676 1.00 56.70  ? 83   VAL B CG2 1 
ATOM   2221 N N   . ILE B 1 104 ? 15.288  18.634 36.387 1.00 32.35  ? 84   ILE B N   1 
ATOM   2222 C CA  . ILE B 1 104 ? 15.307  19.830 37.208 1.00 27.11  ? 84   ILE B CA  1 
ATOM   2223 C C   . ILE B 1 104 ? 13.971  20.022 37.932 1.00 25.57  ? 84   ILE B C   1 
ATOM   2224 O O   . ILE B 1 104 ? 12.897  19.537 37.495 1.00 36.55  ? 84   ILE B O   1 
ATOM   2225 C CB  . ILE B 1 104 ? 15.665  21.084 36.371 1.00 54.52  ? 84   ILE B CB  1 
ATOM   2226 C CG1 . ILE B 1 104 ? 14.509  21.448 35.436 1.00 38.32  ? 84   ILE B CG1 1 
ATOM   2227 C CG2 . ILE B 1 104 ? 16.951  20.836 35.593 1.00 48.28  ? 84   ILE B CG2 1 
ATOM   2228 C CD1 . ILE B 1 104 ? 14.759  22.742 34.549 1.00 40.00  ? 84   ILE B CD1 1 
ATOM   2229 N N   . SER B 1 105 ? 14.006  20.723 39.070 1.00 45.43  ? 85   SER B N   1 
ATOM   2230 C CA  . SER B 1 105 ? 12.758  20.952 39.814 1.00 36.85  ? 85   SER B CA  1 
ATOM   2231 C C   . SER B 1 105 ? 11.824  21.940 39.113 1.00 47.12  ? 85   SER B C   1 
ATOM   2232 O O   . SER B 1 105 ? 12.268  22.855 38.404 1.00 53.93  ? 85   SER B O   1 
ATOM   2233 C CB  . SER B 1 105 ? 13.049  21.397 41.260 1.00 60.82  ? 85   SER B CB  1 
ATOM   2234 O OG  . SER B 1 105 ? 14.210  22.209 41.317 1.00 81.40  ? 85   SER B OG  1 
ATOM   2235 N N   . GLY B 1 106 ? 10.530  21.718 39.297 1.00 54.76  ? 86   GLY B N   1 
ATOM   2236 C CA  . GLY B 1 106 ? 9.534   22.530 38.654 1.00 43.36  ? 86   GLY B CA  1 
ATOM   2237 C C   . GLY B 1 106 ? 8.632   21.724 37.755 1.00 97.78  ? 86   GLY B C   1 
ATOM   2238 O O   . GLY B 1 106 ? 7.627   22.242 37.294 1.00 53.39  ? 86   GLY B O   1 
ATOM   2239 N N   . LEU B 1 107 ? 8.975   20.460 37.504 1.00 40.16  ? 87   LEU B N   1 
ATOM   2240 C CA  . LEU B 1 107 ? 8.211   19.670 36.558 1.00 85.54  ? 87   LEU B CA  1 
ATOM   2241 C C   . LEU B 1 107 ? 7.423   18.595 37.312 1.00 84.22  ? 87   LEU B C   1 
ATOM   2242 O O   . LEU B 1 107 ? 7.619   18.444 38.529 1.00 53.01  ? 87   LEU B O   1 
ATOM   2243 C CB  . LEU B 1 107 ? 9.148   19.109 35.479 1.00 41.73  ? 87   LEU B CB  1 
ATOM   2244 C CG  . LEU B 1 107 ? 9.578   20.126 34.406 1.00 38.39  ? 87   LEU B CG  1 
ATOM   2245 C CD1 . LEU B 1 107 ? 10.890  19.696 33.789 1.00 38.90  ? 87   LEU B CD1 1 
ATOM   2246 C CD2 . LEU B 1 107 ? 8.519   20.191 33.334 1.00 47.66  ? 87   LEU B CD2 1 
ATOM   2247 N N   . PRO B 1 108 ? 6.519   17.865 36.611 1.00 54.52  ? 88   PRO B N   1 
ATOM   2248 C CA  . PRO B 1 108 ? 5.694   16.838 37.284 1.00 64.22  ? 88   PRO B CA  1 
ATOM   2249 C C   . PRO B 1 108 ? 6.520   15.707 37.905 1.00 97.01  ? 88   PRO B C   1 
ATOM   2250 O O   . PRO B 1 108 ? 5.990   14.950 38.725 1.00 60.59  ? 88   PRO B O   1 
ATOM   2251 C CB  . PRO B 1 108 ? 4.799   16.297 36.152 1.00 61.49  ? 88   PRO B CB  1 
ATOM   2252 C CG  . PRO B 1 108 ? 4.813   17.362 35.080 1.00 64.39  ? 88   PRO B CG  1 
ATOM   2253 C CD  . PRO B 1 108 ? 6.203   17.939 35.170 1.00 50.73  ? 88   PRO B CD  1 
ATOM   2254 N N   . ALA B 1 109 ? 7.804   15.638 37.533 1.00 67.76  ? 89   ALA B N   1 
ATOM   2255 C CA  . ALA B 1 109 ? 8.740   14.601 37.971 1.00 42.47  ? 89   ALA B CA  1 
ATOM   2256 C C   . ALA B 1 109 ? 10.082  15.128 38.492 1.00 43.46  ? 89   ALA B C   1 
ATOM   2257 O O   . ALA B 1 109 ? 10.544  16.195 38.101 1.00 74.10  ? 89   ALA B O   1 
ATOM   2258 C CB  . ALA B 1 109 ? 9.004   13.660 36.826 1.00 81.85  ? 89   ALA B CB  1 
ATOM   2259 N N   . ASN B 1 110 ? 10.685  14.326 39.371 1.00 33.73  ? 90   ASN B N   1 
ATOM   2260 C CA  . ASN B 1 110 ? 12.030  14.478 39.905 1.00 39.78  ? 90   ASN B CA  1 
ATOM   2261 C C   . ASN B 1 110 ? 13.004  13.558 39.175 1.00 41.19  ? 90   ASN B C   1 
ATOM   2262 O O   . ASN B 1 110 ? 14.192  13.889 39.025 1.00 35.87  ? 90   ASN B O   1 
ATOM   2263 C CB  . ASN B 1 110 ? 12.055  14.027 41.400 1.00 39.84  ? 90   ASN B CB  1 
ATOM   2264 C CG  . ASN B 1 110 ? 11.710  15.151 42.372 1.00 43.73  ? 90   ASN B CG  1 
ATOM   2265 O OD1 . ASN B 1 110 ? 11.950  16.320 42.091 1.00 70.54  ? 90   ASN B OD1 1 
ATOM   2266 N ND2 . ASN B 1 110 ? 11.155  14.789 43.526 1.00 109.63 ? 90   ASN B ND2 1 
ATOM   2267 N N   . THR B 1 111 ? 12.532  12.356 38.807 1.00 35.19  ? 91   THR B N   1 
ATOM   2268 C CA  . THR B 1 111 ? 13.435  11.313 38.307 1.00 37.31  ? 91   THR B CA  1 
ATOM   2269 C C   . THR B 1 111 ? 12.641  10.461 37.334 1.00 32.91  ? 91   THR B C   1 
ATOM   2270 O O   . THR B 1 111 ? 11.410  10.413 37.400 1.00 36.13  ? 91   THR B O   1 
ATOM   2271 C CB  . THR B 1 111 ? 13.906  10.367 39.434 1.00 45.23  ? 91   THR B CB  1 
ATOM   2272 O OG1 . THR B 1 111 ? 12.764  9.672  39.951 1.00 52.58  ? 91   THR B OG1 1 
ATOM   2273 C CG2 . THR B 1 111 ? 14.553  11.146 40.586 1.00 42.23  ? 91   THR B CG2 1 
ATOM   2274 N N   . SER B 1 112 ? 13.360  9.736  36.492 1.00 27.90  ? 92   SER B N   1 
ATOM   2275 C CA  . SER B 1 112 ? 12.705  8.805  35.587 1.00 29.72  ? 92   SER B CA  1 
ATOM   2276 C C   . SER B 1 112 ? 13.656  7.658  35.352 1.00 30.91  ? 92   SER B C   1 
ATOM   2277 O O   . SER B 1 112 ? 14.841  7.895  35.118 1.00 33.44  ? 92   SER B O   1 
ATOM   2278 C CB  . SER B 1 112 ? 12.543  9.538  34.254 1.00 31.56  ? 92   SER B CB  1 
ATOM   2279 O OG  . SER B 1 112 ? 11.826  8.742  33.319 1.00 36.74  ? 92   SER B OG  1 
ATOM   2280 N N   . THR B 1 113 ? 13.166  6.418  35.418 1.00 28.75  ? 93   THR B N   1 
ATOM   2281 C CA  . THR B 1 113 ? 13.963  5.258  34.998 1.00 25.68  ? 93   THR B CA  1 
ATOM   2282 C C   . THR B 1 113 ? 13.451  4.747  33.694 1.00 28.28  ? 93   THR B C   1 
ATOM   2283 O O   . THR B 1 113 ? 12.248  4.599  33.557 1.00 28.40  ? 93   THR B O   1 
ATOM   2284 C CB  . THR B 1 113 ? 13.833  4.118  36.049 1.00 39.15  ? 93   THR B CB  1 
ATOM   2285 O OG1 . THR B 1 113 ? 14.229  4.648  37.318 1.00 41.75  ? 93   THR B OG1 1 
ATOM   2286 C CG2 . THR B 1 113 ? 14.767  2.978  35.710 1.00 34.60  ? 93   THR B CG2 1 
ATOM   2287 N N   . GLU B 1 114 ? 14.363  4.584  32.739 1.00 28.92  ? 94   GLU B N   1 
ATOM   2288 C CA  . GLU B 1 114 ? 14.075  4.315  31.359 1.00 24.49  ? 94   GLU B CA  1 
ATOM   2289 C C   . GLU B 1 114 ? 14.819  3.102  30.883 1.00 28.29  ? 94   GLU B C   1 
ATOM   2290 O O   . GLU B 1 114 ? 15.989  2.932  31.231 1.00 30.31  ? 94   GLU B O   1 
ATOM   2291 C CB  . GLU B 1 114 ? 14.419  5.550  30.504 1.00 29.27  ? 94   GLU B CB  1 
ATOM   2292 C CG  . GLU B 1 114 ? 13.431  6.671  30.841 1.00 45.38  ? 94   GLU B CG  1 
ATOM   2293 C CD  . GLU B 1 114 ? 13.854  8.092  30.519 1.00 172.50 ? 94   GLU B CD  1 
ATOM   2294 O OE1 . GLU B 1 114 ? 14.897  8.308  29.859 1.00 32.99  ? 94   GLU B OE1 1 
ATOM   2295 O OE2 . GLU B 1 114 ? 13.094  9.003  30.943 1.00 36.34  ? 94   GLU B OE2 1 
ATOM   2296 N N   . ARG B 1 115 ? 14.185  2.331  29.993 1.00 24.61  ? 95   ARG B N   1 
ATOM   2297 C CA  . ARG B 1 115 ? 14.774  1.084  29.538 1.00 26.11  ? 95   ARG B CA  1 
ATOM   2298 C C   . ARG B 1 115 ? 14.948  1.181  28.054 1.00 32.78  ? 95   ARG B C   1 
ATOM   2299 O O   . ARG B 1 115 ? 14.033  1.603  27.365 1.00 26.49  ? 95   ARG B O   1 
ATOM   2300 C CB  . ARG B 1 115 ? 13.887  -0.126 29.907 1.00 30.49  ? 95   ARG B CB  1 
ATOM   2301 C CG  . ARG B 1 115 ? 14.379  -1.467 29.339 1.00 32.26  ? 95   ARG B CG  1 
ATOM   2302 C CD  . ARG B 1 115 ? 13.317  -2.588 29.488 1.00 29.62  ? 95   ARG B CD  1 
ATOM   2303 N NE  . ARG B 1 115 ? 12.285  -2.343 28.482 1.00 33.03  ? 95   ARG B NE  1 
ATOM   2304 C CZ  . ARG B 1 115 ? 10.980  -2.273 28.696 1.00 35.19  ? 95   ARG B CZ  1 
ATOM   2305 N NH1 . ARG B 1 115 ? 10.453  -2.466 29.902 1.00 33.77  ? 95   ARG B NH1 1 
ATOM   2306 N NH2 . ARG B 1 115 ? 10.195  -2.055 27.646 1.00 32.49  ? 95   ARG B NH2 1 
ATOM   2307 N N   . LEU B 1 116 ? 16.131  0.861  27.557 1.00 26.09  ? 96   LEU B N   1 
ATOM   2308 C CA  . LEU B 1 116 ? 16.373  0.891  26.097 1.00 27.39  ? 96   LEU B CA  1 
ATOM   2309 C C   . LEU B 1 116 ? 15.632  -0.240 25.383 1.00 35.55  ? 96   LEU B C   1 
ATOM   2310 O O   . LEU B 1 116 ? 15.824  -1.402 25.729 1.00 29.96  ? 96   LEU B O   1 
ATOM   2311 C CB  . LEU B 1 116 ? 17.882  0.830  25.847 1.00 26.35  ? 96   LEU B CB  1 
ATOM   2312 C CG  . LEU B 1 116 ? 18.399  0.824  24.400 1.00 27.77  ? 96   LEU B CG  1 
ATOM   2313 C CD1 . LEU B 1 116 ? 18.030  2.148  23.730 1.00 28.38  ? 96   LEU B CD1 1 
ATOM   2314 C CD2 . LEU B 1 116 ? 19.927  0.725  24.489 1.00 28.01  ? 96   LEU B CD2 1 
ATOM   2315 N N   . ASP B 1 117 ? 14.770  0.090  24.408 1.00 27.36  ? 97   ASP B N   1 
ATOM   2316 C CA  . ASP B 1 117 ? 13.946  -0.895 23.727 1.00 24.94  ? 97   ASP B CA  1 
ATOM   2317 C C   . ASP B 1 117 ? 14.528  -1.360 22.403 1.00 35.15  ? 97   ASP B C   1 
ATOM   2318 O O   . ASP B 1 117 ? 14.340  -2.524 21.981 1.00 32.88  ? 97   ASP B O   1 
ATOM   2319 C CB  . ASP B 1 117 ? 12.567  -0.324 23.412 1.00 29.35  ? 97   ASP B CB  1 
ATOM   2320 C CG  . ASP B 1 117 ? 11.690  -0.190 24.653 1.00 33.35  ? 97   ASP B CG  1 
ATOM   2321 O OD1 . ASP B 1 117 ? 11.804  -1.035 25.559 1.00 38.34  ? 97   ASP B OD1 1 
ATOM   2322 O OD2 . ASP B 1 117 ? 10.901  0.778  24.702 1.00 35.43  ? 97   ASP B OD2 1 
ATOM   2323 N N   . ILE B 1 118 ? 15.174  -0.435 21.712 1.00 28.76  ? 98   ILE B N   1 
ATOM   2324 C CA  . ILE B 1 118 ? 15.616  -0.650 20.329 1.00 31.80  ? 98   ILE B CA  1 
ATOM   2325 C C   . ILE B 1 118 ? 16.903  0.111  20.145 1.00 28.48  ? 98   ILE B C   1 
ATOM   2326 O O   . ILE B 1 118 ? 17.025  1.277  20.544 1.00 28.54  ? 98   ILE B O   1 
ATOM   2327 C CB  . ILE B 1 118 ? 14.598  -0.070 19.296 1.00 32.19  ? 98   ILE B CB  1 
ATOM   2328 C CG1 . ILE B 1 118 ? 13.185  -0.603 19.502 1.00 34.81  ? 98   ILE B CG1 1 
ATOM   2329 C CG2 . ILE B 1 118 ? 15.037  -0.386 17.848 1.00 33.71  ? 98   ILE B CG2 1 
ATOM   2330 C CD1 . ILE B 1 118 ? 12.134  0.114  18.682 1.00 43.91  ? 98   ILE B CD1 1 
ATOM   2331 N N   . LEU B 1 119 ? 17.892  -0.522 19.529 1.00 30.70  ? 99   LEU B N   1 
ATOM   2332 C CA  . LEU B 1 119 ? 19.033  0.236  19.074 1.00 31.63  ? 99   LEU B CA  1 
ATOM   2333 C C   . LEU B 1 119 ? 19.544  -0.422 17.812 1.00 42.13  ? 99   LEU B C   1 
ATOM   2334 O O   . LEU B 1 119 ? 20.151  -1.496 17.845 1.00 41.17  ? 99   LEU B O   1 
ATOM   2335 C CB  . LEU B 1 119 ? 20.142  0.260  20.116 1.00 32.19  ? 99   LEU B CB  1 
ATOM   2336 C CG  . LEU B 1 119 ? 21.363  1.115  19.789 1.00 46.17  ? 99   LEU B CG  1 
ATOM   2337 C CD1 . LEU B 1 119 ? 20.960  2.581  19.791 1.00 56.38  ? 99   LEU B CD1 1 
ATOM   2338 C CD2 . LEU B 1 119 ? 22.409  0.856  20.824 1.00 59.92  ? 99   LEU B CD2 1 
ATOM   2339 N N   . ASP B 1 120 ? 19.276  0.200  16.688 1.00 33.80  ? 100  ASP B N   1 
ATOM   2340 C CA  . ASP B 1 120 ? 19.632  -0.456 15.440 1.00 33.95  ? 100  ASP B CA  1 
ATOM   2341 C C   . ASP B 1 120 ? 20.490  0.522  14.662 1.00 42.19  ? 100  ASP B C   1 
ATOM   2342 O O   . ASP B 1 120 ? 19.991  1.470  14.081 1.00 38.08  ? 100  ASP B O   1 
ATOM   2343 C CB  . ASP B 1 120 ? 18.373  -0.817 14.686 1.00 32.36  ? 100  ASP B CB  1 
ATOM   2344 C CG  . ASP B 1 120 ? 18.669  -1.447 13.350 1.00 137.90 ? 100  ASP B CG  1 
ATOM   2345 O OD1 . ASP B 1 120 ? 19.818  -1.366 12.891 1.00 42.62  ? 100  ASP B OD1 1 
ATOM   2346 O OD2 . ASP B 1 120 ? 17.761  -2.028 12.748 1.00 43.86  ? 100  ASP B OD2 1 
ATOM   2347 N N   . ASP B 1 121 ? 21.794  0.271  14.685 1.00 35.84  ? 101  ASP B N   1 
ATOM   2348 C CA  . ASP B 1 121 ? 22.767  1.161  14.065 1.00 43.63  ? 101  ASP B CA  1 
ATOM   2349 C C   . ASP B 1 121 ? 22.754  1.157  12.551 1.00 48.72  ? 101  ASP B C   1 
ATOM   2350 O O   . ASP B 1 121 ? 23.228  2.105  11.922 1.00 44.43  ? 101  ASP B O   1 
ATOM   2351 C CB  . ASP B 1 121 ? 24.169  0.827  14.569 1.00 38.30  ? 101  ASP B CB  1 
ATOM   2352 C CG  . ASP B 1 121 ? 24.415  1.368  15.954 1.00 54.09  ? 101  ASP B CG  1 
ATOM   2353 O OD1 . ASP B 1 121 ? 23.963  2.497  16.218 1.00 48.37  ? 101  ASP B OD1 1 
ATOM   2354 O OD2 . ASP B 1 121 ? 25.052  0.683  16.774 1.00 47.50  ? 101  ASP B OD2 1 
ATOM   2355 N N   . GLU B 1 122 ? 22.208  0.097  11.968 1.00 50.02  ? 102  GLU B N   1 
ATOM   2356 C CA  . GLU B 1 122 ? 22.168  -0.004 10.512 1.00 59.63  ? 102  GLU B CA  1 
ATOM   2357 C C   . GLU B 1 122 ? 20.998  0.806  9.964  1.00 59.21  ? 102  GLU B C   1 
ATOM   2358 O O   . GLU B 1 122 ? 21.103  1.410  8.903  1.00 65.15  ? 102  GLU B O   1 
ATOM   2359 C CB  . GLU B 1 122 ? 22.087  -1.476 10.038 1.00 52.42  ? 102  GLU B CB  1 
ATOM   2360 C CG  . GLU B 1 122 ? 22.932  -2.476 10.846 1.00 121.41 ? 102  GLU B CG  1 
ATOM   2361 C CD  . GLU B 1 122 ? 24.408  -2.102 10.930 1.00 197.74 ? 102  GLU B CD  1 
ATOM   2362 O OE1 . GLU B 1 122 ? 24.997  -1.734 9.889  1.00 214.81 ? 102  GLU B OE1 1 
ATOM   2363 O OE2 . GLU B 1 122 ? 24.980  -2.184 12.042 1.00 81.52  ? 102  GLU B OE2 1 
ATOM   2364 N N   . ARG B 1 123 ? 19.881  0.818  10.685 1.00 35.53  ? 103  ARG B N   1 
ATOM   2365 C CA  . ARG B 1 123 ? 18.701  1.508  10.204 1.00 34.64  ? 103  ARG B CA  1 
ATOM   2366 C C   . ARG B 1 123 ? 18.508  2.850  10.903 1.00 41.02  ? 103  ARG B C   1 
ATOM   2367 O O   . ARG B 1 123 ? 17.605  3.590  10.541 1.00 44.57  ? 103  ARG B O   1 
ATOM   2368 C CB  . ARG B 1 123 ? 17.461  0.650  10.425 1.00 36.82  ? 103  ARG B CB  1 
ATOM   2369 C CG  . ARG B 1 123 ? 17.577  -0.740 9.784  1.00 50.62  ? 103  ARG B CG  1 
ATOM   2370 C CD  . ARG B 1 123 ? 16.262  -1.471 9.836  1.00 43.46  ? 103  ARG B CD  1 
ATOM   2371 N NE  . ARG B 1 123 ? 15.254  -0.826 8.988  1.00 62.65  ? 103  ARG B NE  1 
ATOM   2372 C CZ  . ARG B 1 123 ? 13.956  -1.126 9.006  1.00 70.89  ? 103  ARG B CZ  1 
ATOM   2373 N NH1 . ARG B 1 123 ? 13.492  -2.061 9.836  1.00 57.87  ? 103  ARG B NH1 1 
ATOM   2374 N NH2 . ARG B 1 123 ? 13.119  -0.487 8.199  1.00 55.65  ? 103  ARG B NH2 1 
ATOM   2375 N N   . ARG B 1 124 ? 19.359  3.139  11.905 1.00 33.63  ? 104  ARG B N   1 
ATOM   2376 C CA  . ARG B 1 124 ? 19.248  4.376  12.711 1.00 31.83  ? 104  ARG B CA  1 
ATOM   2377 C C   . ARG B 1 124 ? 17.885  4.505  13.385 1.00 35.76  ? 104  ARG B C   1 
ATOM   2378 O O   . ARG B 1 124 ? 17.148  5.469  13.139 1.00 36.26  ? 104  ARG B O   1 
ATOM   2379 C CB  . ARG B 1 124 ? 19.532  5.609  11.851 1.00 32.78  ? 104  ARG B CB  1 
ATOM   2380 C CG  . ARG B 1 124 ? 20.906  5.547  11.218 1.00 38.21  ? 104  ARG B CG  1 
ATOM   2381 C CD  . ARG B 1 124 ? 21.189  6.838  10.502 1.00 45.94  ? 104  ARG B CD  1 
ATOM   2382 N NE  . ARG B 1 124 ? 22.511  6.796  9.897  1.00 53.31  ? 104  ARG B NE  1 
ATOM   2383 C CZ  . ARG B 1 124 ? 22.736  6.948  8.597  1.00 65.55  ? 104  ARG B CZ  1 
ATOM   2384 N NH1 . ARG B 1 124 ? 21.730  7.172  7.759  1.00 43.16  ? 104  ARG B NH1 1 
ATOM   2385 N NH2 . ARG B 1 124 ? 23.972  6.880  8.140  1.00 53.61  ? 104  ARG B NH2 1 
ATOM   2386 N N   . VAL B 1 125 ? 17.561  3.538  14.251 1.00 32.65  ? 105  VAL B N   1 
ATOM   2387 C CA  . VAL B 1 125 ? 16.263  3.535  14.954 1.00 28.03  ? 105  VAL B CA  1 
ATOM   2388 C C   . VAL B 1 125 ? 16.597  3.277  16.406 1.00 33.15  ? 105  VAL B C   1 
ATOM   2389 O O   . VAL B 1 125 ? 17.393  2.396  16.699 1.00 33.50  ? 105  VAL B O   1 
ATOM   2390 C CB  . VAL B 1 125 ? 15.343  2.391  14.516 1.00 34.11  ? 105  VAL B CB  1 
ATOM   2391 C CG1 . VAL B 1 125 ? 14.014  2.394  15.319 1.00 34.33  ? 105  VAL B CG1 1 
ATOM   2392 C CG2 . VAL B 1 125 ? 15.086  2.432  13.026 1.00 47.82  ? 105  VAL B CG2 1 
ATOM   2393 N N   . THR B 1 126 ? 16.072  4.103  17.302 1.00 27.62  ? 106  THR B N   1 
ATOM   2394 C CA  . THR B 1 126 ? 16.223  3.827  18.751 1.00 29.45  ? 106  THR B CA  1 
ATOM   2395 C C   . THR B 1 126 ? 14.909  4.063  19.452 1.00 30.37  ? 106  THR B C   1 
ATOM   2396 O O   . THR B 1 126 ? 13.969  4.601  18.856 1.00 29.01  ? 106  THR B O   1 
ATOM   2397 C CB  . THR B 1 126 ? 17.392  4.604  19.392 1.00 33.70  ? 106  THR B CB  1 
ATOM   2398 O OG1 . THR B 1 126 ? 17.664  4.092  20.714 1.00 38.83  ? 106  THR B OG1 1 
ATOM   2399 C CG2 . THR B 1 126 ? 17.115  6.130  19.477 1.00 27.42  ? 106  THR B CG2 1 
ATOM   2400 N N   . GLY B 1 127 ? 14.756  3.555  20.667 1.00 27.35  ? 107  GLY B N   1 
ATOM   2401 C CA  . GLY B 1 127 ? 13.498  3.790  21.370 1.00 25.81  ? 107  GLY B CA  1 
ATOM   2402 C C   . GLY B 1 127 ? 13.692  3.398  22.822 1.00 27.41  ? 107  GLY B C   1 
ATOM   2403 O O   . GLY B 1 127 ? 14.646  2.665  23.134 1.00 28.59  ? 107  GLY B O   1 
ATOM   2404 N N   . PHE B 1 128 ? 12.824  3.918  23.699 1.00 27.51  ? 108  PHE B N   1 
ATOM   2405 C CA  . PHE B 1 128 ? 12.897  3.601  25.111 1.00 29.27  ? 108  PHE B CA  1 
ATOM   2406 C C   . PHE B 1 128 ? 11.527  3.619  25.765 1.00 30.00  ? 108  PHE B C   1 
ATOM   2407 O O   . PHE B 1 128 ? 10.591  4.130  25.201 1.00 25.67  ? 108  PHE B O   1 
ATOM   2408 C CB  . PHE B 1 128 ? 13.841  4.592  25.834 1.00 29.55  ? 108  PHE B CB  1 
ATOM   2409 C CG  . PHE B 1 128 ? 13.268  5.971  25.994 1.00 29.93  ? 108  PHE B CG  1 
ATOM   2410 C CD1 . PHE B 1 128 ? 12.533  6.315  27.123 1.00 36.54  ? 108  PHE B CD1 1 
ATOM   2411 C CD2 . PHE B 1 128 ? 13.525  6.960  25.073 1.00 23.97  ? 108  PHE B CD2 1 
ATOM   2412 C CE1 . PHE B 1 128 ? 12.016  7.617  27.285 1.00 31.78  ? 108  PHE B CE1 1 
ATOM   2413 C CE2 . PHE B 1 128 ? 12.984  8.239  25.217 1.00 23.31  ? 108  PHE B CE2 1 
ATOM   2414 C CZ  . PHE B 1 128 ? 12.247  8.575  26.310 1.00 29.96  ? 108  PHE B CZ  1 
ATOM   2415 N N   . SER B 1 129 ? 11.442  3.047  26.967 1.00 24.63  ? 109  SER B N   1 
ATOM   2416 C CA  . SER B 1 129 ? 10.186  3.007  27.707 1.00 26.90  ? 109  SER B CA  1 
ATOM   2417 C C   . SER B 1 129 ? 10.474  3.485  29.104 1.00 27.52  ? 109  SER B C   1 
ATOM   2418 O O   . SER B 1 129 ? 11.495  3.119  29.680 1.00 31.61  ? 109  SER B O   1 
ATOM   2419 C CB  . SER B 1 129 ? 9.715   1.544  27.853 1.00 33.63  ? 109  SER B CB  1 
ATOM   2420 O OG  . SER B 1 129 ? 9.205   1.008  26.623 1.00 33.49  ? 109  SER B OG  1 
ATOM   2421 N N   . ILE B 1 130 ? 9.566   4.265  29.657 1.00 26.60  ? 110  ILE B N   1 
ATOM   2422 C CA  . ILE B 1 130 ? 9.744   4.707  31.070 1.00 26.46  ? 110  ILE B CA  1 
ATOM   2423 C C   . ILE B 1 130 ? 9.195   3.604  31.981 1.00 31.96  ? 110  ILE B C   1 
ATOM   2424 O O   . ILE B 1 130 ? 8.033   3.200  31.843 1.00 36.78  ? 110  ILE B O   1 
ATOM   2425 C CB  . ILE B 1 130 ? 9.000   6.011  31.333 1.00 33.80  ? 110  ILE B CB  1 
ATOM   2426 C CG1 . ILE B 1 130 ? 9.511   7.098  30.386 1.00 29.21  ? 110  ILE B CG1 1 
ATOM   2427 C CG2 . ILE B 1 130 ? 9.133   6.405  32.787 1.00 39.97  ? 110  ILE B CG2 1 
ATOM   2428 C CD1 . ILE B 1 130 ? 8.912   8.479  30.620 1.00 44.49  ? 110  ILE B CD1 1 
ATOM   2429 N N   . ILE B 1 131 ? 10.031  3.142  32.907 1.00 33.07  ? 111  ILE B N   1 
ATOM   2430 C CA  . ILE B 1 131 ? 9.675   1.992  33.752 1.00 39.48  ? 111  ILE B CA  1 
ATOM   2431 C C   . ILE B 1 131 ? 9.553   2.299  35.245 1.00 40.94  ? 111  ILE B C   1 
ATOM   2432 O O   . ILE B 1 131 ? 9.151   1.441  36.034 1.00 44.68  ? 111  ILE B O   1 
ATOM   2433 C CB  . ILE B 1 131 ? 10.633  0.792  33.509 1.00 41.36  ? 111  ILE B CB  1 
ATOM   2434 C CG1 . ILE B 1 131 ? 12.089  1.174  33.778 1.00 41.01  ? 111  ILE B CG1 1 
ATOM   2435 C CG2 . ILE B 1 131 ? 10.454  0.254  32.083 1.00 41.81  ? 111  ILE B CG2 1 
ATOM   2436 C CD1 . ILE B 1 131 ? 13.039  -0.010 33.972 1.00 38.95  ? 111  ILE B CD1 1 
ATOM   2437 N N   . GLY B 1 132 ? 9.851   3.529  35.619 1.00 34.21  ? 112  GLY B N   1 
ATOM   2438 C CA  . GLY B 1 132 ? 9.851   3.934  37.020 1.00 47.07  ? 112  GLY B CA  1 
ATOM   2439 C C   . GLY B 1 132 ? 10.191  5.403  37.177 1.00 53.64  ? 112  GLY B C   1 
ATOM   2440 O O   . GLY B 1 132 ? 10.403  6.108  36.196 1.00 32.76  ? 112  GLY B O   1 
ATOM   2441 N N   . GLY B 1 133 ? 10.216  5.859  38.425 1.00 47.61  ? 113  GLY B N   1 
ATOM   2442 C CA  . GLY B 1 133 ? 10.567  7.240  38.753 1.00 48.48  ? 113  GLY B CA  1 
ATOM   2443 C C   . GLY B 1 133 ? 9.393   7.953  39.387 1.00 87.70  ? 113  GLY B C   1 
ATOM   2444 O O   . GLY B 1 133 ? 8.258   7.469  39.312 1.00 58.48  ? 113  GLY B O   1 
ATOM   2445 N N   . GLU B 1 134 ? 9.660   9.099  40.014 1.00 66.29  ? 114  GLU B N   1 
ATOM   2446 C CA  . GLU B 1 134 ? 8.587   9.922  40.568 1.00 137.98 ? 114  GLU B CA  1 
ATOM   2447 C C   . GLU B 1 134 ? 8.064   10.844 39.478 1.00 108.80 ? 114  GLU B C   1 
ATOM   2448 O O   . GLU B 1 134 ? 8.587   11.944 39.305 1.00 92.34  ? 114  GLU B O   1 
ATOM   2449 C CB  . GLU B 1 134 ? 9.058   10.762 41.766 1.00 103.47 ? 114  GLU B CB  1 
ATOM   2450 C CG  . GLU B 1 134 ? 7.896   11.288 42.629 1.00 120.42 ? 114  GLU B CG  1 
ATOM   2451 C CD  . GLU B 1 134 ? 7.915   12.804 42.846 1.00 215.88 ? 114  GLU B CD  1 
ATOM   2452 O OE1 . GLU B 1 134 ? 7.937   13.562 41.850 1.00 67.01  ? 114  GLU B OE1 1 
ATOM   2453 O OE2 . GLU B 1 134 ? 7.872   13.242 44.017 1.00 58.72  ? 114  GLU B OE2 1 
ATOM   2454 N N   . HIS B 1 135 ? 7.058   10.378 38.734 1.00 65.55  ? 115  HIS B N   1 
ATOM   2455 C CA  . HIS B 1 135 ? 6.353   11.210 37.731 1.00 59.99  ? 115  HIS B CA  1 
ATOM   2456 C C   . HIS B 1 135 ? 4.994   10.677 37.260 1.00 92.74  ? 115  HIS B C   1 
ATOM   2457 O O   . HIS B 1 135 ? 4.460   9.712  37.820 1.00 137.25 ? 115  HIS B O   1 
ATOM   2458 C CB  . HIS B 1 135 ? 7.246   11.548 36.523 1.00 55.29  ? 115  HIS B CB  1 
ATOM   2459 C CG  . HIS B 1 135 ? 7.675   10.361 35.724 1.00 167.60 ? 115  HIS B CG  1 
ATOM   2460 N ND1 . HIS B 1 135 ? 8.908   9.763  35.882 1.00 56.85  ? 115  HIS B ND1 1 
ATOM   2461 C CD2 . HIS B 1 135 ? 7.042   9.675  34.743 1.00 43.97  ? 115  HIS B CD2 1 
ATOM   2462 C CE1 . HIS B 1 135 ? 9.012   8.751  35.040 1.00 44.62  ? 115  HIS B CE1 1 
ATOM   2463 N NE2 . HIS B 1 135 ? 7.892   8.674  34.341 1.00 184.85 ? 115  HIS B NE2 1 
ATOM   2464 N N   . ARG B 1 136 ? 4.449   11.313 36.221 1.00 53.28  ? 116  ARG B N   1 
ATOM   2465 C CA  . ARG B 1 136 ? 3.063   11.049 35.798 1.00 71.04  ? 116  ARG B CA  1 
ATOM   2466 C C   . ARG B 1 136 ? 2.880   10.435 34.395 1.00 92.56  ? 116  ARG B C   1 
ATOM   2467 O O   . ARG B 1 136 ? 1.784   10.505 33.832 1.00 79.73  ? 116  ARG B O   1 
ATOM   2468 C CB  . ARG B 1 136 ? 2.231   12.342 35.909 1.00 69.94  ? 116  ARG B CB  1 
ATOM   2469 C CG  . ARG B 1 136 ? 2.499   13.211 37.150 1.00 81.11  ? 116  ARG B CG  1 
ATOM   2470 C CD  . ARG B 1 136 ? 2.144   12.495 38.450 1.00 86.12  ? 116  ARG B CD  1 
ATOM   2471 N NE  . ARG B 1 136 ? 1.747   13.435 39.493 1.00 138.50 ? 116  ARG B NE  1 
ATOM   2472 C CZ  . ARG B 1 136 ? 0.500   13.862 39.683 1.00 241.90 ? 116  ARG B CZ  1 
ATOM   2473 N NH1 . ARG B 1 136 ? -0.486  13.438 38.897 1.00 110.31 ? 116  ARG B NH1 1 
ATOM   2474 N NH2 . ARG B 1 136 ? 0.238   14.721 40.659 1.00 316.53 ? 116  ARG B NH2 1 
ATOM   2475 N N   . LEU B 1 137 ? 3.925   9.826  33.834 1.00 56.74  ? 117  LEU B N   1 
ATOM   2476 C CA  . LEU B 1 137 ? 3.855   9.333  32.443 1.00 94.11  ? 117  LEU B CA  1 
ATOM   2477 C C   . LEU B 1 137 ? 3.835   7.804  32.270 1.00 77.47  ? 117  LEU B C   1 
ATOM   2478 O O   . LEU B 1 137 ? 4.734   7.200  31.662 1.00 48.33  ? 117  LEU B O   1 
ATOM   2479 C CB  . LEU B 1 137 ? 4.954   9.968  31.588 1.00 47.65  ? 117  LEU B CB  1 
ATOM   2480 C CG  . LEU B 1 137 ? 4.917   11.476 31.341 1.00 41.59  ? 117  LEU B CG  1 
ATOM   2481 C CD1 . LEU B 1 137 ? 6.118   11.796 30.501 1.00 38.76  ? 117  LEU B CD1 1 
ATOM   2482 C CD2 . LEU B 1 137 ? 3.682   11.959 30.629 1.00 44.05  ? 117  LEU B CD2 1 
ATOM   2483 N N   . THR B 1 138 ? 2.765   7.193  32.754 1.00 53.80  ? 118  THR B N   1 
ATOM   2484 C CA  . THR B 1 138 ? 2.699   5.730  32.873 1.00 41.15  ? 118  THR B CA  1 
ATOM   2485 C C   . THR B 1 138 ? 2.646   5.046  31.513 1.00 33.86  ? 118  THR B C   1 
ATOM   2486 O O   . THR B 1 138 ? 1.865   5.431  30.613 1.00 49.38  ? 118  THR B O   1 
ATOM   2487 C CB  . THR B 1 138 ? 1.503   5.248  33.790 1.00 52.85  ? 118  THR B CB  1 
ATOM   2488 O OG1 . THR B 1 138 ? 0.415   4.772  32.983 1.00 85.58  ? 118  THR B OG1 1 
ATOM   2489 C CG2 . THR B 1 138 ? 1.021   6.370  34.696 1.00 46.06  ? 118  THR B CG2 1 
ATOM   2490 N N   . ASN B 1 139 ? 3.491   4.023  31.382 1.00 37.94  ? 119  ASN B N   1 
ATOM   2491 C CA  . ASN B 1 139 ? 3.647   3.261  30.143 1.00 33.89  ? 119  ASN B CA  1 
ATOM   2492 C C   . ASN B 1 139 ? 4.123   4.076  28.917 1.00 32.90  ? 119  ASN B C   1 
ATOM   2493 O O   . ASN B 1 139 ? 3.877   3.700  27.759 1.00 42.52  ? 119  ASN B O   1 
ATOM   2494 C CB  . ASN B 1 139 ? 2.387   2.447  29.818 1.00 44.10  ? 119  ASN B CB  1 
ATOM   2495 C CG  . ASN B 1 139 ? 2.133   1.341  30.839 1.00 50.88  ? 119  ASN B CG  1 
ATOM   2496 O OD1 . ASN B 1 139 ? 3.063   0.674  31.300 1.00 59.55  ? 119  ASN B OD1 1 
ATOM   2497 N ND2 . ASN B 1 139 ? 0.874   1.153  31.202 1.00 71.12  ? 119  ASN B ND2 1 
ATOM   2498 N N   . TYR B 1 140 ? 4.813   5.181  29.174 1.00 30.28  ? 120  TYR B N   1 
ATOM   2499 C CA  . TYR B 1 140 ? 5.365   5.986  28.081 1.00 31.18  ? 120  TYR B CA  1 
ATOM   2500 C C   . TYR B 1 140 ? 6.390   5.184  27.318 1.00 31.03  ? 120  TYR B C   1 
ATOM   2501 O O   . TYR B 1 140 ? 7.299   4.599  27.921 1.00 30.12  ? 120  TYR B O   1 
ATOM   2502 C CB  . TYR B 1 140 ? 5.984   7.250  28.663 1.00 28.85  ? 120  TYR B CB  1 
ATOM   2503 C CG  . TYR B 1 140 ? 6.505   8.214  27.618 1.00 31.68  ? 120  TYR B CG  1 
ATOM   2504 C CD1 . TYR B 1 140 ? 5.698   9.266  27.151 1.00 27.89  ? 120  TYR B CD1 1 
ATOM   2505 C CD2 . TYR B 1 140 ? 7.812   8.077  27.094 1.00 30.37  ? 120  TYR B CD2 1 
ATOM   2506 C CE1 . TYR B 1 140 ? 6.174   10.176 26.197 1.00 34.25  ? 120  TYR B CE1 1 
ATOM   2507 C CE2 . TYR B 1 140 ? 8.315   8.991  26.136 1.00 28.45  ? 120  TYR B CE2 1 
ATOM   2508 C CZ  . TYR B 1 140 ? 7.492   10.040 25.692 1.00 29.84  ? 120  TYR B CZ  1 
ATOM   2509 O OH  . TYR B 1 140 ? 7.927   10.952 24.708 1.00 32.92  ? 120  TYR B OH  1 
ATOM   2510 N N   . LYS B 1 141 ? 6.253   5.161  25.995 1.00 25.62  ? 121  LYS B N   1 
ATOM   2511 C CA  . LYS B 1 141 ? 7.199   4.437  25.118 1.00 28.86  ? 121  LYS B CA  1 
ATOM   2512 C C   . LYS B 1 141 ? 7.410   5.301  23.900 1.00 30.91  ? 121  LYS B C   1 
ATOM   2513 O O   . LYS B 1 141 ? 6.447   5.766  23.323 1.00 29.07  ? 121  LYS B O   1 
ATOM   2514 C CB  . LYS B 1 141 ? 6.597   3.096  24.664 1.00 28.77  ? 121  LYS B CB  1 
ATOM   2515 C CG  . LYS B 1 141 ? 7.508   2.309  23.761 1.00 33.97  ? 121  LYS B CG  1 
ATOM   2516 C CD  . LYS B 1 141 ? 6.983   0.877  23.597 1.00 41.94  ? 121  LYS B CD  1 
ATOM   2517 C CE  . LYS B 1 141 ? 8.034   -0.029 22.961 1.00 46.13  ? 121  LYS B CE  1 
ATOM   2518 N NZ  . LYS B 1 141 ? 8.425   0.400  21.583 1.00 40.32  ? 121  LYS B NZ  1 
ATOM   2519 N N   . SER B 1 142 ? 8.665   5.539  23.527 1.00 27.79  ? 122  SER B N   1 
ATOM   2520 C CA  . SER B 1 142 ? 9.058   6.474  22.465 1.00 26.97  ? 122  SER B CA  1 
ATOM   2521 C C   . SER B 1 142 ? 9.927   5.753  21.442 1.00 28.76  ? 122  SER B C   1 
ATOM   2522 O O   . SER B 1 142 ? 10.710  4.877  21.805 1.00 26.52  ? 122  SER B O   1 
ATOM   2523 C CB  . SER B 1 142 ? 9.908   7.603  23.130 1.00 32.45  ? 122  SER B CB  1 
ATOM   2524 O OG  . SER B 1 142 ? 10.360  8.539  22.218 1.00 43.36  ? 122  SER B OG  1 
ATOM   2525 N N   . VAL B 1 143 ? 9.782   6.098  20.153 1.00 25.04  ? 123  VAL B N   1 
ATOM   2526 C CA  . VAL B 1 143 ? 10.675  5.636  19.112 1.00 25.64  ? 123  VAL B CA  1 
ATOM   2527 C C   . VAL B 1 143 ? 11.154  6.846  18.305 1.00 28.06  ? 123  VAL B C   1 
ATOM   2528 O O   . VAL B 1 143 ? 10.353  7.724  17.978 1.00 32.77  ? 123  VAL B O   1 
ATOM   2529 C CB  . VAL B 1 143 ? 9.967   4.539  18.230 1.00 29.57  ? 123  VAL B CB  1 
ATOM   2530 C CG1 . VAL B 1 143 ? 10.831  4.072  17.071 1.00 34.01  ? 123  VAL B CG1 1 
ATOM   2531 C CG2 . VAL B 1 143 ? 9.496   3.352  19.138 1.00 32.02  ? 123  VAL B CG2 1 
ATOM   2532 N N   . THR B 1 144 ? 12.438  6.844  17.954 1.00 26.65  ? 124  THR B N   1 
ATOM   2533 C CA  . THR B 1 144 ? 13.072  7.903  17.165 1.00 24.77  ? 124  THR B CA  1 
ATOM   2534 C C   . THR B 1 144 ? 13.760  7.261  15.985 1.00 31.24  ? 124  THR B C   1 
ATOM   2535 O O   . THR B 1 144 ? 14.539  6.281  16.141 1.00 32.22  ? 124  THR B O   1 
ATOM   2536 C CB  . THR B 1 144 ? 14.165  8.643  18.024 1.00 31.26  ? 124  THR B CB  1 
ATOM   2537 O OG1 . THR B 1 144 ? 13.509  9.243  19.151 1.00 29.67  ? 124  THR B OG1 1 
ATOM   2538 C CG2 . THR B 1 144 ? 14.801  9.776  17.198 1.00 38.18  ? 124  THR B CG2 1 
ATOM   2539 N N   . THR B 1 145 ? 13.546  7.825  14.797 1.00 28.19  ? 125  THR B N   1 
ATOM   2540 C CA  . THR B 1 145 ? 14.254  7.308  13.621 1.00 31.53  ? 125  THR B CA  1 
ATOM   2541 C C   . THR B 1 145 ? 14.891  8.493  12.901 1.00 36.96  ? 125  THR B C   1 
ATOM   2542 O O   . THR B 1 145 ? 14.340  9.615  12.901 1.00 32.17  ? 125  THR B O   1 
ATOM   2543 C CB  . THR B 1 145 ? 13.295  6.566  12.672 1.00 33.81  ? 125  THR B CB  1 
ATOM   2544 O OG1 . THR B 1 145 ? 12.240  7.445  12.323 1.00 33.49  ? 125  THR B OG1 1 
ATOM   2545 C CG2 . THR B 1 145 ? 12.635  5.335  13.349 1.00 37.00  ? 125  THR B CG2 1 
ATOM   2546 N N   . VAL B 1 146 ? 16.050  8.238  12.298 1.00 27.31  ? 126  VAL B N   1 
ATOM   2547 C CA  . VAL B 1 146 ? 16.855  9.280  11.673 1.00 27.15  ? 126  VAL B CA  1 
ATOM   2548 C C   . VAL B 1 146 ? 16.901  8.968  10.174 1.00 33.77  ? 126  VAL B C   1 
ATOM   2549 O O   . VAL B 1 146 ? 17.090  7.805  9.802  1.00 31.91  ? 126  VAL B O   1 
ATOM   2550 C CB  . VAL B 1 146 ? 18.255  9.294  12.280 1.00 37.82  ? 126  VAL B CB  1 
ATOM   2551 C CG1 . VAL B 1 146 ? 19.182  10.305 11.584 1.00 31.94  ? 126  VAL B CG1 1 
ATOM   2552 C CG2 . VAL B 1 146 ? 18.130  9.609  13.774 1.00 37.20  ? 126  VAL B CG2 1 
ATOM   2553 N N   . HIS B 1 147 ? 16.748  9.999  9.340  1.00 35.44  ? 127  HIS B N   1 
ATOM   2554 C CA  . HIS B 1 147 ? 16.595  9.793  7.866  1.00 31.75  ? 127  HIS B CA  1 
ATOM   2555 C C   . HIS B 1 147 ? 17.492  10.731 7.064  1.00 41.00  ? 127  HIS B C   1 
ATOM   2556 O O   . HIS B 1 147 ? 17.628  11.922 7.387  1.00 34.48  ? 127  HIS B O   1 
ATOM   2557 C CB  . HIS B 1 147 ? 15.141  9.967  7.460  1.00 36.32  ? 127  HIS B CB  1 
ATOM   2558 C CG  . HIS B 1 147 ? 14.201  9.149  8.288  1.00 47.40  ? 127  HIS B CG  1 
ATOM   2559 N ND1 . HIS B 1 147 ? 13.797  7.881  7.920  1.00 38.62  ? 127  HIS B ND1 1 
ATOM   2560 C CD2 . HIS B 1 147 ? 13.629  9.395  9.495  1.00 35.67  ? 127  HIS B CD2 1 
ATOM   2561 C CE1 . HIS B 1 147 ? 12.999  7.389  8.859  1.00 47.40  ? 127  HIS B CE1 1 
ATOM   2562 N NE2 . HIS B 1 147 ? 12.887  8.286  9.827  1.00 38.76  ? 127  HIS B NE2 1 
ATOM   2563 N N   . ARG B 1 148 ? 18.119  10.180 6.025  1.00 40.48  ? 128  ARG B N   1 
ATOM   2564 C CA  . ARG B 1 148 ? 18.958  10.965 5.091  1.00 42.80  ? 128  ARG B CA  1 
ATOM   2565 C C   . ARG B 1 148 ? 18.120  11.526 3.951  1.00 41.14  ? 128  ARG B C   1 
ATOM   2566 O O   . ARG B 1 148 ? 17.290  10.798 3.378  1.00 43.83  ? 128  ARG B O   1 
ATOM   2567 C CB  . ARG B 1 148 ? 20.075  10.080 4.498  1.00 44.14  ? 128  ARG B CB  1 
ATOM   2568 C CG  . ARG B 1 148 ? 21.062  10.796 3.566  1.00 48.66  ? 128  ARG B CG  1 
ATOM   2569 C CD  . ARG B 1 148 ? 22.099  9.813  2.985  1.00 46.75  ? 128  ARG B CD  1 
ATOM   2570 N NE  . ARG B 1 148 ? 22.900  9.141  4.016  1.00 66.73  ? 128  ARG B NE  1 
ATOM   2571 C CZ  . ARG B 1 148 ? 24.093  9.555  4.438  1.00 91.64  ? 128  ARG B CZ  1 
ATOM   2572 N NH1 . ARG B 1 148 ? 24.642  10.646 3.914  1.00 93.88  ? 128  ARG B NH1 1 
ATOM   2573 N NH2 . ARG B 1 148 ? 24.739  8.874  5.381  1.00 49.17  ? 128  ARG B NH2 1 
ATOM   2574 N N   . PHE B 1 149 ? 18.316  12.809 3.629  1.00 34.30  ? 129  PHE B N   1 
ATOM   2575 C CA  . PHE B 1 149 ? 17.675  13.382 2.441  1.00 49.79  ? 129  PHE B CA  1 
ATOM   2576 C C   . PHE B 1 149 ? 18.717  14.051 1.594  1.00 48.05  ? 129  PHE B C   1 
ATOM   2577 O O   . PHE B 1 149 ? 19.699  14.585 2.116  1.00 42.60  ? 129  PHE B O   1 
ATOM   2578 C CB  . PHE B 1 149 ? 16.584  14.388 2.802  1.00 47.57  ? 129  PHE B CB  1 
ATOM   2579 C CG  . PHE B 1 149 ? 15.270  13.761 3.129  1.00 45.01  ? 129  PHE B CG  1 
ATOM   2580 C CD1 . PHE B 1 149 ? 14.323  13.555 2.133  1.00 50.13  ? 129  PHE B CD1 1 
ATOM   2581 C CD2 . PHE B 1 149 ? 14.966  13.375 4.453  1.00 32.93  ? 129  PHE B CD2 1 
ATOM   2582 C CE1 . PHE B 1 149 ? 13.086  12.963 2.421  1.00 49.13  ? 129  PHE B CE1 1 
ATOM   2583 C CE2 . PHE B 1 149 ? 13.756  12.786 4.747  1.00 34.67  ? 129  PHE B CE2 1 
ATOM   2584 C CZ  . PHE B 1 149 ? 12.796  12.583 3.742  1.00 58.09  ? 129  PHE B CZ  1 
ATOM   2585 N N   . GLU B 1 150 ? 18.502  14.006 0.273  1.00 43.99  ? 130  GLU B N   1 
ATOM   2586 C CA  . GLU B 1 150 ? 19.364  14.682 -0.684 1.00 53.85  ? 130  GLU B CA  1 
ATOM   2587 C C   . GLU B 1 150 ? 18.510  15.301 -1.795 1.00 49.92  ? 130  GLU B C   1 
ATOM   2588 O O   . GLU B 1 150 ? 17.589  14.660 -2.324 1.00 53.23  ? 130  GLU B O   1 
ATOM   2589 C CB  . GLU B 1 150 ? 20.409  13.704 -1.253 1.00 54.15  ? 130  GLU B CB  1 
ATOM   2590 C CG  . GLU B 1 150 ? 21.556  13.387 -0.272 1.00 113.02 ? 130  GLU B CG  1 
ATOM   2591 C CD  . GLU B 1 150 ? 22.385  12.170 -0.663 1.00 141.29 ? 130  GLU B CD  1 
ATOM   2592 O OE1 . GLU B 1 150 ? 22.237  11.694 -1.813 1.00 77.75  ? 130  GLU B OE1 1 
ATOM   2593 O OE2 . GLU B 1 150 ? 23.187  11.695 0.183  1.00 65.59  ? 130  GLU B OE2 1 
ATOM   2594 N N   . LYS B 1 151 ? 18.774  16.572 -2.080 1.00 45.91  ? 131  LYS B N   1 
ATOM   2595 C CA  . LYS B 1 151 ? 18.220  17.250 -3.246 1.00 51.15  ? 131  LYS B CA  1 
ATOM   2596 C C   . LYS B 1 151 ? 19.324  18.120 -3.802 1.00 47.91  ? 131  LYS B C   1 
ATOM   2597 O O   . LYS B 1 151 ? 19.866  18.986 -3.096 1.00 61.79  ? 131  LYS B O   1 
ATOM   2598 C CB  . LYS B 1 151 ? 16.993  18.098 -2.908 1.00 67.94  ? 131  LYS B CB  1 
ATOM   2599 C CG  . LYS B 1 151 ? 15.663  17.379 -3.055 1.00 133.02 ? 131  LYS B CG  1 
ATOM   2600 C CD  . LYS B 1 151 ? 15.195  17.348 -4.504 1.00 84.99  ? 131  LYS B CD  1 
ATOM   2601 C CE  . LYS B 1 151 ? 13.947  16.486 -4.651 1.00 173.54 ? 131  LYS B CE  1 
ATOM   2602 N NZ  . LYS B 1 151 ? 13.425  16.438 -6.046 1.00 96.80  ? 131  LYS B NZ  1 
ATOM   2603 N N   . GLU B 1 152 ? 19.663  17.862 -5.064 1.00 74.26  ? 132  GLU B N   1 
ATOM   2604 C CA  . GLU B 1 152 ? 20.757  18.541 -5.743 1.00 82.50  ? 132  GLU B CA  1 
ATOM   2605 C C   . GLU B 1 152 ? 22.077  18.200 -5.053 1.00 46.41  ? 132  GLU B C   1 
ATOM   2606 O O   . GLU B 1 152 ? 22.435  17.017 -4.929 1.00 67.63  ? 132  GLU B O   1 
ATOM   2607 C CB  . GLU B 1 152 ? 20.519  20.057 -5.787 1.00 82.31  ? 132  GLU B CB  1 
ATOM   2608 C CG  . GLU B 1 152 ? 19.280  20.474 -6.575 1.00 161.35 ? 132  GLU B CG  1 
ATOM   2609 C CD  . GLU B 1 152 ? 18.691  21.787 -6.095 1.00 185.85 ? 132  GLU B CD  1 
ATOM   2610 O OE1 . GLU B 1 152 ? 18.264  21.857 -4.921 1.00 140.90 ? 132  GLU B OE1 1 
ATOM   2611 O OE2 . GLU B 1 152 ? 18.644  22.746 -6.897 1.00 134.93 ? 132  GLU B OE2 1 
ATOM   2612 N N   . ASN B 1 153 ? 22.773  19.231 -4.572 1.00 40.03  ? 133  ASN B N   1 
ATOM   2613 C CA  . ASN B 1 153 ? 24.099  19.049 -3.993 1.00 42.77  ? 133  ASN B CA  1 
ATOM   2614 C C   . ASN B 1 153 ? 24.071  19.128 -2.457 1.00 36.49  ? 133  ASN B C   1 
ATOM   2615 O O   . ASN B 1 153 ? 25.117  19.272 -1.835 1.00 45.49  ? 133  ASN B O   1 
ATOM   2616 C CB  . ASN B 1 153 ? 25.051  20.101 -4.564 1.00 54.38  ? 133  ASN B CB  1 
ATOM   2617 C CG  . ASN B 1 153 ? 25.052  20.097 -6.073 1.00 115.04 ? 133  ASN B CG  1 
ATOM   2618 O OD1 . ASN B 1 153 ? 24.707  19.092 -6.685 1.00 56.53  ? 133  ASN B OD1 1 
ATOM   2619 N ND2 . ASN B 1 153 ? 25.408  21.215 -6.681 1.00 47.13  ? 133  ASN B ND2 1 
ATOM   2620 N N   . ARG B 1 154 ? 22.871  19.019 -1.895 1.00 45.37  ? 134  ARG B N   1 
ATOM   2621 C CA  . ARG B 1 154 ? 22.695  19.185 -0.449 1.00 46.75  ? 134  ARG B CA  1 
ATOM   2622 C C   . ARG B 1 154 ? 22.129  17.968 0.262  1.00 40.39  ? 134  ARG B C   1 
ATOM   2623 O O   . ARG B 1 154 ? 21.173  17.336 -0.221 1.00 45.54  ? 134  ARG B O   1 
ATOM   2624 C CB  . ARG B 1 154 ? 21.844  20.422 -0.153 1.00 49.10  ? 134  ARG B CB  1 
ATOM   2625 C CG  . ARG B 1 154 ? 22.650  21.728 -0.137 1.00 56.26  ? 134  ARG B CG  1 
ATOM   2626 C CD  . ARG B 1 154 ? 23.464  21.862 1.143  1.00 177.99 ? 134  ARG B CD  1 
ATOM   2627 N NE  . ARG B 1 154 ? 24.252  23.091 1.181  1.00 84.74  ? 134  ARG B NE  1 
ATOM   2628 C CZ  . ARG B 1 154 ? 23.917  24.184 1.865  1.00 218.64 ? 134  ARG B CZ  1 
ATOM   2629 N NH1 . ARG B 1 154 ? 22.798  24.225 2.586  1.00 106.94 ? 134  ARG B NH1 1 
ATOM   2630 N NH2 . ARG B 1 154 ? 24.710  25.245 1.830  1.00 156.38 ? 134  ARG B NH2 1 
ATOM   2631 N N   . ILE B 1 155 ? 22.761  17.648 1.395  1.00 43.50  ? 135  ILE B N   1 
ATOM   2632 C CA  . ILE B 1 155 ? 22.337  16.579 2.308  1.00 32.22  ? 135  ILE B CA  1 
ATOM   2633 C C   . ILE B 1 155 ? 21.668  17.267 3.544  1.00 39.45  ? 135  ILE B C   1 
ATOM   2634 O O   . ILE B 1 155 ? 22.129  18.313 4.019  1.00 40.62  ? 135  ILE B O   1 
ATOM   2635 C CB  . ILE B 1 155 ? 23.587  15.844 2.886  1.00 42.77  ? 135  ILE B CB  1 
ATOM   2636 C CG1 . ILE B 1 155 ? 24.518  15.345 1.765  1.00 54.27  ? 135  ILE B CG1 1 
ATOM   2637 C CG2 . ILE B 1 155 ? 23.146  14.688 3.786  1.00 43.95  ? 135  ILE B CG2 1 
ATOM   2638 C CD1 . ILE B 1 155 ? 25.907  14.984 2.237  1.00 45.48  ? 135  ILE B CD1 1 
ATOM   2639 N N   . TRP B 1 156 ? 20.588  16.681 4.028  1.00 44.00  ? 136  TRP B N   1 
ATOM   2640 C CA  . TRP B 1 156 ? 20.050  17.060 5.339  1.00 31.59  ? 136  TRP B CA  1 
ATOM   2641 C C   . TRP B 1 156 ? 19.413  15.839 5.986  1.00 39.86  ? 136  TRP B C   1 
ATOM   2642 O O   . TRP B 1 156 ? 19.307  14.770 5.374  1.00 38.81  ? 136  TRP B O   1 
ATOM   2643 C CB  . TRP B 1 156 ? 19.086  18.250 5.230  1.00 33.32  ? 136  TRP B CB  1 
ATOM   2644 C CG  . TRP B 1 156 ? 17.769  17.946 4.624  1.00 30.58  ? 136  TRP B CG  1 
ATOM   2645 C CD1 . TRP B 1 156 ? 16.605  17.634 5.277  1.00 38.97  ? 136  TRP B CD1 1 
ATOM   2646 C CD2 . TRP B 1 156 ? 17.435  17.987 3.223  1.00 38.99  ? 136  TRP B CD2 1 
ATOM   2647 N NE1 . TRP B 1 156 ? 15.591  17.435 4.377  1.00 45.29  ? 136  TRP B NE1 1 
ATOM   2648 C CE2 . TRP B 1 156 ? 16.068  17.656 3.112  1.00 38.97  ? 136  TRP B CE2 1 
ATOM   2649 C CE3 . TRP B 1 156 ? 18.171  18.245 2.056  1.00 43.20  ? 136  TRP B CE3 1 
ATOM   2650 C CZ2 . TRP B 1 156 ? 15.408  17.576 1.868  1.00 47.32  ? 136  TRP B CZ2 1 
ATOM   2651 C CZ3 . TRP B 1 156 ? 17.507  18.175 0.811  1.00 44.18  ? 136  TRP B CZ3 1 
ATOM   2652 C CH2 . TRP B 1 156 ? 16.146  17.839 0.736  1.00 49.44  ? 136  TRP B CH2 1 
ATOM   2653 N N   . THR B 1 157 ? 18.975  16.020 7.230  1.00 39.38  ? 137  THR B N   1 
ATOM   2654 C CA  . THR B 1 157 ? 18.426  14.945 8.055  1.00 32.93  ? 137  THR B CA  1 
ATOM   2655 C C   . THR B 1 157 ? 16.992  15.310 8.428  1.00 31.80  ? 137  THR B C   1 
ATOM   2656 O O   . THR B 1 157 ? 16.675  16.489 8.670  1.00 34.93  ? 137  THR B O   1 
ATOM   2657 C CB  . THR B 1 157 ? 19.287  14.788 9.311  1.00 41.80  ? 137  THR B CB  1 
ATOM   2658 O OG1 . THR B 1 157 ? 20.639  14.482 8.929  1.00 38.22  ? 137  THR B OG1 1 
ATOM   2659 C CG2 . THR B 1 157 ? 18.749  13.663 10.250 1.00 36.28  ? 137  THR B CG2 1 
ATOM   2660 N N   . VAL B 1 158 ? 16.121  14.316 8.445  1.00 33.70  ? 138  VAL B N   1 
ATOM   2661 C CA  . VAL B 1 158 ? 14.857  14.459 9.114  1.00 32.38  ? 138  VAL B CA  1 
ATOM   2662 C C   . VAL B 1 158 ? 14.866  13.468 10.276 1.00 38.12  ? 138  VAL B C   1 
ATOM   2663 O O   . VAL B 1 158 ? 15.251  12.314 10.110 1.00 33.18  ? 138  VAL B O   1 
ATOM   2664 C CB  . VAL B 1 158 ? 13.676  14.263 8.150  1.00 41.02  ? 138  VAL B CB  1 
ATOM   2665 C CG1 . VAL B 1 158 ? 12.365  14.263 8.879  1.00 34.21  ? 138  VAL B CG1 1 
ATOM   2666 C CG2 . VAL B 1 158 ? 13.709  15.386 7.093  1.00 35.69  ? 138  VAL B CG2 1 
ATOM   2667 N N   . VAL B 1 159 ? 14.533  13.956 11.469 1.00 29.21  ? 139  VAL B N   1 
ATOM   2668 C CA  . VAL B 1 159 ? 14.290  13.044 12.588 1.00 28.66  ? 139  VAL B CA  1 
ATOM   2669 C C   . VAL B 1 159 ? 12.818  12.945 12.844 1.00 28.81  ? 139  VAL B C   1 
ATOM   2670 O O   . VAL B 1 159 ? 12.148  13.967 12.908 1.00 32.96  ? 139  VAL B O   1 
ATOM   2671 C CB  . VAL B 1 159 ? 14.939  13.582 13.866 1.00 28.19  ? 139  VAL B CB  1 
ATOM   2672 C CG1 . VAL B 1 159 ? 14.623  12.610 15.038 1.00 28.00  ? 139  VAL B CG1 1 
ATOM   2673 C CG2 . VAL B 1 159 ? 16.428  13.728 13.665 1.00 29.18  ? 139  VAL B CG2 1 
ATOM   2674 N N   . LEU B 1 160 ? 12.313  11.716 13.005 1.00 32.29  ? 140  LEU B N   1 
ATOM   2675 C CA  . LEU B 1 160 ? 10.927  11.455 13.373 1.00 30.23  ? 140  LEU B CA  1 
ATOM   2676 C C   . LEU B 1 160 ? 10.936  10.867 14.797 1.00 34.23  ? 140  LEU B C   1 
ATOM   2677 O O   . LEU B 1 160 ? 11.688  9.929  15.046 1.00 33.32  ? 140  LEU B O   1 
ATOM   2678 C CB  . LEU B 1 160 ? 10.283  10.411 12.452 1.00 34.42  ? 140  LEU B CB  1 
ATOM   2679 C CG  . LEU B 1 160 ? 10.013  10.824 10.990 1.00 41.13  ? 140  LEU B CG  1 
ATOM   2680 C CD1 . LEU B 1 160 ? 9.371   9.639  10.287 1.00 38.48  ? 140  LEU B CD1 1 
ATOM   2681 C CD2 . LEU B 1 160 ? 9.124   12.058 10.916 1.00 37.16  ? 140  LEU B CD2 1 
ATOM   2682 N N   . GLU B 1 161 ? 10.117  11.408 15.692 1.00 28.08  ? 141  GLU B N   1 
ATOM   2683 C CA  . GLU B 1 161 ? 9.938   10.830 17.035 1.00 26.43  ? 141  GLU B CA  1 
ATOM   2684 C C   . GLU B 1 161 ? 8.478   10.688 17.360 1.00 34.02  ? 141  GLU B C   1 
ATOM   2685 O O   . GLU B 1 161 ? 7.710   11.644 17.243 1.00 33.15  ? 141  GLU B O   1 
ATOM   2686 C CB  . GLU B 1 161 ? 10.622  11.719 18.112 1.00 28.25  ? 141  GLU B CB  1 
ATOM   2687 C CG  . GLU B 1 161 ? 10.608  11.112 19.537 1.00 33.95  ? 141  GLU B CG  1 
ATOM   2688 C CD  . GLU B 1 161 ? 11.495  11.850 20.556 1.00 59.63  ? 141  GLU B CD  1 
ATOM   2689 O OE1 . GLU B 1 161 ? 11.414  11.506 21.753 1.00 135.61 ? 141  GLU B OE1 1 
ATOM   2690 O OE2 . GLU B 1 161 ? 12.282  12.759 20.180 1.00 61.11  ? 141  GLU B OE2 1 
ATOM   2691 N N   . SER B 1 162 ? 8.095   9.502  17.810 1.00 30.73  ? 142  SER B N   1 
ATOM   2692 C CA  . SER B 1 162 ? 6.705   9.277  18.234 1.00 29.69  ? 142  SER B CA  1 
ATOM   2693 C C   . SER B 1 162 ? 6.632   8.660  19.620 1.00 31.59  ? 142  SER B C   1 
ATOM   2694 O O   . SER B 1 162 ? 7.604   8.070  20.130 1.00 31.16  ? 142  SER B O   1 
ATOM   2695 C CB  . SER B 1 162 ? 5.951   8.396  17.221 1.00 35.52  ? 142  SER B CB  1 
ATOM   2696 O OG  . SER B 1 162 ? 6.538   7.103  17.129 1.00 35.92  ? 142  SER B OG  1 
ATOM   2697 N N   . TYR B 1 163 ? 5.491   8.807  20.263 1.00 28.87  ? 143  TYR B N   1 
ATOM   2698 C CA  . TYR B 1 163 ? 5.364   8.153  21.564 1.00 31.40  ? 143  TYR B CA  1 
ATOM   2699 C C   . TYR B 1 163 ? 3.954   7.671  21.708 1.00 35.79  ? 143  TYR B C   1 
ATOM   2700 O O   . TYR B 1 163 ? 3.066   8.156  21.003 1.00 34.41  ? 143  TYR B O   1 
ATOM   2701 C CB  . TYR B 1 163 ? 5.765   9.094  22.721 1.00 32.43  ? 143  TYR B CB  1 
ATOM   2702 C CG  . TYR B 1 163 ? 4.792   10.266 22.882 1.00 33.64  ? 143  TYR B CG  1 
ATOM   2703 C CD1 . TYR B 1 163 ? 3.599   10.096 23.599 1.00 33.21  ? 143  TYR B CD1 1 
ATOM   2704 C CD2 . TYR B 1 163 ? 5.038   11.502 22.281 1.00 35.20  ? 143  TYR B CD2 1 
ATOM   2705 C CE1 . TYR B 1 163 ? 2.692   11.110 23.723 1.00 34.48  ? 143  TYR B CE1 1 
ATOM   2706 C CE2 . TYR B 1 163 ? 4.138   12.555 22.427 1.00 33.20  ? 143  TYR B CE2 1 
ATOM   2707 C CZ  . TYR B 1 163 ? 2.957   12.345 23.140 1.00 32.21  ? 143  TYR B CZ  1 
ATOM   2708 O OH  . TYR B 1 163 ? 2.017   13.347 23.274 1.00 41.07  ? 143  TYR B OH  1 
ATOM   2709 N N   . VAL B 1 164 ? 3.771   6.721  22.623 1.00 36.64  ? 144  VAL B N   1 
ATOM   2710 C CA  . VAL B 1 164 ? 2.438   6.350  23.101 1.00 34.50  ? 144  VAL B CA  1 
ATOM   2711 C C   . VAL B 1 164 ? 2.503   6.359  24.635 1.00 33.59  ? 144  VAL B C   1 
ATOM   2712 O O   . VAL B 1 164 ? 3.544   6.002  25.219 1.00 38.41  ? 144  VAL B O   1 
ATOM   2713 C CB  . VAL B 1 164 ? 1.999   4.953  22.483 1.00 35.24  ? 144  VAL B CB  1 
ATOM   2714 C CG1 . VAL B 1 164 ? 3.039   3.871  22.767 1.00 40.06  ? 144  VAL B CG1 1 
ATOM   2715 C CG2 . VAL B 1 164 ? 0.588   4.544  22.980 1.00 44.61  ? 144  VAL B CG2 1 
ATOM   2716 N N   . VAL B 1 165 ? 1.412   6.765  25.292 1.00 34.08  ? 145  VAL B N   1 
ATOM   2717 C CA  . VAL B 1 165 ? 1.400   6.850  26.729 1.00 34.07  ? 145  VAL B CA  1 
ATOM   2718 C C   . VAL B 1 165 ? -0.035  6.675  27.232 1.00 38.16  ? 145  VAL B C   1 
ATOM   2719 O O   . VAL B 1 165 ? -0.969  6.896  26.476 1.00 46.72  ? 145  VAL B O   1 
ATOM   2720 C CB  . VAL B 1 165 ? 2.044   8.208  27.208 1.00 42.51  ? 145  VAL B CB  1 
ATOM   2721 C CG1 . VAL B 1 165 ? 1.173   9.430  26.857 1.00 42.62  ? 145  VAL B CG1 1 
ATOM   2722 C CG2 . VAL B 1 165 ? 2.393   8.180  28.705 1.00 44.15  ? 145  VAL B CG2 1 
ATOM   2723 N N   . ASP B 1 166 ? -0.172  6.254  28.488 1.00 41.04  ? 146  ASP B N   1 
ATOM   2724 C CA  . ASP B 1 166 ? -1.486  6.072  29.111 1.00 44.60  ? 146  ASP B CA  1 
ATOM   2725 C C   . ASP B 1 166 ? -2.004  7.376  29.695 1.00 58.09  ? 146  ASP B C   1 
ATOM   2726 O O   . ASP B 1 166 ? -1.279  8.099  30.378 1.00 52.66  ? 146  ASP B O   1 
ATOM   2727 C CB  . ASP B 1 166 ? -1.422  4.992  30.184 1.00 48.85  ? 146  ASP B CB  1 
ATOM   2728 C CG  . ASP B 1 166 ? -1.185  3.600  29.607 1.00 55.77  ? 146  ASP B CG  1 
ATOM   2729 O OD1 . ASP B 1 166 ? -1.169  3.431  28.360 1.00 69.09  ? 146  ASP B OD1 1 
ATOM   2730 O OD2 . ASP B 1 166 ? -1.005  2.671  30.416 1.00 67.98  ? 146  ASP B OD2 1 
ATOM   2731 N N   . MET B 1 167 ? -3.268  7.674  29.418 1.00 62.33  ? 147  MET B N   1 
ATOM   2732 C CA  . MET B 1 167 ? -3.905  8.874  29.949 1.00 67.30  ? 147  MET B CA  1 
ATOM   2733 C C   . MET B 1 167 ? -4.429  8.624  31.363 1.00 109.08 ? 147  MET B C   1 
ATOM   2734 O O   . MET B 1 167 ? -4.761  7.483  31.708 1.00 83.31  ? 147  MET B O   1 
ATOM   2735 C CB  . MET B 1 167 ? -5.024  9.329  29.017 1.00 69.62  ? 147  MET B CB  1 
ATOM   2736 C CG  . MET B 1 167 ? -4.625  9.240  27.553 1.00 50.14  ? 147  MET B CG  1 
ATOM   2737 S SD  . MET B 1 167 ? -5.955  9.432  26.346 1.00 133.43 ? 147  MET B SD  1 
ATOM   2738 C CE  . MET B 1 167 ? -7.336  8.598  27.130 1.00 168.50 ? 147  MET B CE  1 
ATOM   2739 N N   . PRO B 1 168 ? -4.464  9.678  32.204 1.00 115.62 ? 148  PRO B N   1 
ATOM   2740 C CA  . PRO B 1 168 ? -5.177  9.561  33.471 1.00 137.51 ? 148  PRO B CA  1 
ATOM   2741 C C   . PRO B 1 168 ? -6.662  9.313  33.198 1.00 154.62 ? 148  PRO B C   1 
ATOM   2742 O O   . PRO B 1 168 ? -7.176  8.259  33.575 1.00 102.69 ? 148  PRO B O   1 
ATOM   2743 C CB  . PRO B 1 168 ? -4.947  10.924 34.139 1.00 115.96 ? 148  PRO B CB  1 
ATOM   2744 C CG  . PRO B 1 168 ? -3.742  11.478 33.470 1.00 133.56 ? 148  PRO B CG  1 
ATOM   2745 C CD  . PRO B 1 168 ? -3.842  11.004 32.057 1.00 105.56 ? 148  PRO B CD  1 
ATOM   2746 N N   . GLU B 1 169 ? -7.323  10.260 32.526 1.00 131.53 ? 149  GLU B N   1 
ATOM   2747 C CA  . GLU B 1 169 ? -8.714  10.093 32.083 1.00 140.64 ? 149  GLU B CA  1 
ATOM   2748 C C   . GLU B 1 169 ? -8.917  10.534 30.629 1.00 140.58 ? 149  GLU B C   1 
ATOM   2749 O O   . GLU B 1 169 ? -7.948  10.744 29.898 1.00 196.80 ? 149  GLU B O   1 
ATOM   2750 C CB  . GLU B 1 169 ? -9.691  10.831 33.012 1.00 128.52 ? 149  GLU B CB  1 
ATOM   2751 C CG  . GLU B 1 169 ? -9.759  10.312 34.459 1.00 161.52 ? 149  GLU B CG  1 
ATOM   2752 C CD  . GLU B 1 169 ? -9.763  8.784  34.584 1.00 227.81 ? 149  GLU B CD  1 
ATOM   2753 O OE1 . GLU B 1 169 ? -9.193  8.284  35.576 1.00 108.95 ? 149  GLU B OE1 1 
ATOM   2754 O OE2 . GLU B 1 169 ? -10.310 8.078  33.703 1.00 75.61  ? 149  GLU B OE2 1 
ATOM   2755 N N   . GLY B 1 170 ? -10.179 10.662 30.217 1.00 171.08 ? 150  GLY B N   1 
ATOM   2756 C CA  . GLY B 1 170 ? -10.527 11.100 28.863 1.00 168.65 ? 150  GLY B CA  1 
ATOM   2757 C C   . GLY B 1 170 ? -10.475 12.608 28.672 1.00 190.23 ? 150  GLY B C   1 
ATOM   2758 O O   . GLY B 1 170 ? -10.220 13.092 27.566 1.00 168.75 ? 150  GLY B O   1 
ATOM   2759 N N   . ASN B 1 171 ? -10.725 13.344 29.753 1.00 216.99 ? 151  ASN B N   1 
ATOM   2760 C CA  . ASN B 1 171 ? -10.677 14.810 29.755 1.00 220.75 ? 151  ASN B CA  1 
ATOM   2761 C C   . ASN B 1 171 ? -9.277  15.357 30.035 1.00 215.65 ? 151  ASN B C   1 
ATOM   2762 O O   . ASN B 1 171 ? -8.903  16.426 29.539 1.00 182.81 ? 151  ASN B O   1 
ATOM   2763 C CB  . ASN B 1 171 ? -11.678 15.377 30.770 1.00 210.33 ? 151  ASN B CB  1 
ATOM   2764 C CG  . ASN B 1 171 ? -11.680 14.610 32.089 1.00 203.57 ? 151  ASN B CG  1 
ATOM   2765 O OD1 . ASN B 1 171 ? -10.627 14.297 32.650 1.00 152.00 ? 151  ASN B OD1 1 
ATOM   2766 N ND2 . ASN B 1 171 ? -12.873 14.307 32.589 1.00 98.90  ? 151  ASN B ND2 1 
ATOM   2767 N N   . SER B 1 172 ? -8.518  14.614 30.839 1.00 214.27 ? 152  SER B N   1 
ATOM   2768 C CA  . SER B 1 172 ? -7.138  14.955 31.180 1.00 158.05 ? 152  SER B CA  1 
ATOM   2769 C C   . SER B 1 172 ? -6.144  14.341 30.190 1.00 150.93 ? 152  SER B C   1 
ATOM   2770 O O   . SER B 1 172 ? -4.927  14.369 30.418 1.00 113.58 ? 152  SER B O   1 
ATOM   2771 C CB  . SER B 1 172 ? -6.817  14.500 32.608 1.00 182.02 ? 152  SER B CB  1 
ATOM   2772 O OG  . SER B 1 172 ? -6.978  13.098 32.751 1.00 95.82  ? 152  SER B OG  1 
ATOM   2773 N N   . GLU B 1 173 ? -6.673  13.786 29.097 1.00 72.49  ? 153  GLU B N   1 
ATOM   2774 C CA  . GLU B 1 173 ? -5.848  13.191 28.050 1.00 118.26 ? 153  GLU B CA  1 
ATOM   2775 C C   . GLU B 1 173 ? -5.139  14.291 27.270 1.00 137.05 ? 153  GLU B C   1 
ATOM   2776 O O   . GLU B 1 173 ? -3.947  14.174 26.931 1.00 59.03  ? 153  GLU B O   1 
ATOM   2777 C CB  . GLU B 1 173 ? -6.698  12.294 27.134 1.00 96.33  ? 153  GLU B CB  1 
ATOM   2778 C CG  . GLU B 1 173 ? -7.315  12.934 25.882 1.00 157.48 ? 153  GLU B CG  1 
ATOM   2779 C CD  . GLU B 1 173 ? -6.582  12.557 24.601 1.00 145.07 ? 153  GLU B CD  1 
ATOM   2780 O OE1 . GLU B 1 173 ? -5.455  13.048 24.377 1.00 75.24  ? 153  GLU B OE1 1 
ATOM   2781 O OE2 . GLU B 1 173 ? -7.143  11.771 23.809 1.00 146.24 ? 153  GLU B OE2 1 
ATOM   2782 N N   . ASP B 1 174 ? -5.876  15.372 27.021 1.00 80.53  ? 154  ASP B N   1 
ATOM   2783 C CA  . ASP B 1 174 ? -5.363  16.488 26.250 1.00 71.28  ? 154  ASP B CA  1 
ATOM   2784 C C   . ASP B 1 174 ? -4.184  17.152 26.945 1.00 97.69  ? 154  ASP B C   1 
ATOM   2785 O O   . ASP B 1 174 ? -3.280  17.660 26.274 1.00 56.78  ? 154  ASP B O   1 
ATOM   2786 C CB  . ASP B 1 174 ? -6.471  17.490 25.939 1.00 90.56  ? 154  ASP B CB  1 
ATOM   2787 C CG  . ASP B 1 174 ? -7.316  17.066 24.752 1.00 159.67 ? 154  ASP B CG  1 
ATOM   2788 O OD1 . ASP B 1 174 ? -6.735  16.601 23.744 1.00 91.36  ? 154  ASP B OD1 1 
ATOM   2789 O OD2 . ASP B 1 174 ? -8.557  17.197 24.824 1.00 193.66 ? 154  ASP B OD2 1 
ATOM   2790 N N   . ASP B 1 175 ? -4.178  17.116 28.278 1.00 46.29  ? 155  ASP B N   1 
ATOM   2791 C CA  . ASP B 1 175 ? -3.096  17.736 29.045 1.00 51.24  ? 155  ASP B CA  1 
ATOM   2792 C C   . ASP B 1 175 ? -1.824  16.921 29.010 1.00 47.91  ? 155  ASP B C   1 
ATOM   2793 O O   . ASP B 1 175 ? -0.734  17.487 28.855 1.00 41.75  ? 155  ASP B O   1 
ATOM   2794 C CB  . ASP B 1 175 ? -3.491  17.957 30.488 1.00 50.41  ? 155  ASP B CB  1 
ATOM   2795 C CG  . ASP B 1 175 ? -4.667  18.879 30.622 1.00 160.35 ? 155  ASP B CG  1 
ATOM   2796 O OD1 . ASP B 1 175 ? -5.128  19.415 29.596 1.00 48.62  ? 155  ASP B OD1 1 
ATOM   2797 O OD2 . ASP B 1 175 ? -5.134  19.067 31.753 1.00 57.65  ? 155  ASP B OD2 1 
ATOM   2798 N N   . THR B 1 176 ? -1.965  15.605 29.186 1.00 43.80  ? 156  THR B N   1 
ATOM   2799 C CA  . THR B 1 176 ? -0.832  14.673 29.045 1.00 50.18  ? 156  THR B CA  1 
ATOM   2800 C C   . THR B 1 176 ? -0.197  14.781 27.657 1.00 42.12  ? 156  THR B C   1 
ATOM   2801 O O   . THR B 1 176 ? 1.017   14.885 27.542 1.00 38.45  ? 156  THR B O   1 
ATOM   2802 C CB  . THR B 1 176 ? -1.225  13.210 29.327 1.00 66.24  ? 156  THR B CB  1 
ATOM   2803 O OG1 . THR B 1 176 ? -2.390  12.869 28.566 1.00 104.80 ? 156  THR B OG1 1 
ATOM   2804 C CG2 . THR B 1 176 ? -1.521  13.023 30.797 1.00 43.01  ? 156  THR B CG2 1 
ATOM   2805 N N   . ARG B 1 177 ? -1.017  14.736 26.610 1.00 36.73  ? 157  ARG B N   1 
ATOM   2806 C CA  A ARG B 1 177 ? -0.557  14.900 25.241 0.50 33.12  ? 157  ARG B CA  1 
ATOM   2807 C CA  B ARG B 1 177 ? -0.534  14.886 25.238 0.50 40.68  ? 157  ARG B CA  1 
ATOM   2808 C C   . ARG B 1 177 ? 0.074   16.278 25.025 1.00 39.43  ? 157  ARG B C   1 
ATOM   2809 O O   . ARG B 1 177 ? 1.121   16.418 24.381 1.00 37.88  ? 157  ARG B O   1 
ATOM   2810 C CB  A ARG B 1 177 ? -1.750  14.731 24.304 0.50 43.80  ? 157  ARG B CB  1 
ATOM   2811 C CB  B ARG B 1 177 ? -1.685  14.665 24.246 0.50 39.83  ? 157  ARG B CB  1 
ATOM   2812 C CG  A ARG B 1 177 ? -1.401  14.542 22.855 0.50 44.39  ? 157  ARG B CG  1 
ATOM   2813 C CG  B ARG B 1 177 ? -1.385  13.758 23.044 0.50 64.34  ? 157  ARG B CG  1 
ATOM   2814 C CD  A ARG B 1 177 ? -2.652  14.453 22.004 0.50 66.58  ? 157  ARG B CD  1 
ATOM   2815 C CD  B ARG B 1 177 ? -2.660  13.526 22.212 0.50 67.50  ? 157  ARG B CD  1 
ATOM   2816 N NE  A ARG B 1 177 ? -2.425  13.661 20.798 0.50 67.56  ? 157  ARG B NE  1 
ATOM   2817 N NE  B ARG B 1 177 ? -2.710  12.204 21.573 0.50 113.28 ? 157  ARG B NE  1 
ATOM   2818 C CZ  A ARG B 1 177 ? -1.726  14.068 19.742 0.50 68.93  ? 157  ARG B CZ  1 
ATOM   2819 C CZ  B ARG B 1 177 ? -3.828  11.606 21.155 0.50 102.32 ? 157  ARG B CZ  1 
ATOM   2820 N NH1 A ARG B 1 177 ? -1.159  15.271 19.719 0.50 44.73  ? 157  ARG B NH1 1 
ATOM   2821 N NH1 B ARG B 1 177 ? -5.003  12.204 21.313 0.50 92.81  ? 157  ARG B NH1 1 
ATOM   2822 N NH2 A ARG B 1 177 ? -1.589  13.261 18.703 0.50 43.37  ? 157  ARG B NH2 1 
ATOM   2823 N NH2 B ARG B 1 177 ? -3.779  10.396 20.593 0.50 34.78  ? 157  ARG B NH2 1 
ATOM   2824 N N   . MET B 1 178 ? -0.570  17.308 25.565 1.00 40.67  ? 158  MET B N   1 
ATOM   2825 C CA  . MET B 1 178 ? -0.052  18.668 25.451 1.00 37.78  ? 158  MET B CA  1 
ATOM   2826 C C   . MET B 1 178 ? 1.339   18.800 26.128 1.00 34.02  ? 158  MET B C   1 
ATOM   2827 O O   . MET B 1 178 ? 2.253   19.416 25.540 1.00 39.59  ? 158  MET B O   1 
ATOM   2828 C CB  . MET B 1 178 ? -1.037  19.657 26.082 1.00 35.43  ? 158  MET B CB  1 
ATOM   2829 C CG  . MET B 1 178 ? -0.876  21.035 25.522 1.00 43.78  ? 158  MET B CG  1 
ATOM   2830 S SD  . MET B 1 178 ? -2.154  22.133 26.187 1.00 70.56  ? 158  MET B SD  1 
ATOM   2831 C CE  . MET B 1 178 ? -3.599  21.068 26.110 1.00 49.97  ? 158  MET B CE  1 
ATOM   2832 N N   . PHE B 1 179 ? 1.493   18.219 27.321 1.00 32.00  ? 159  PHE B N   1 
ATOM   2833 C CA  . PHE B 1 179 ? 2.752   18.276 28.028 1.00 32.36  ? 159  PHE B CA  1 
ATOM   2834 C C   . PHE B 1 179 ? 3.819   17.512 27.251 1.00 30.58  ? 159  PHE B C   1 
ATOM   2835 O O   . PHE B 1 179 ? 4.872   18.059 26.907 1.00 28.66  ? 159  PHE B O   1 
ATOM   2836 C CB  . PHE B 1 179 ? 2.627   17.729 29.467 1.00 31.98  ? 159  PHE B CB  1 
ATOM   2837 C CG  . PHE B 1 179 ? 3.946   17.579 30.170 1.00 41.30  ? 159  PHE B CG  1 
ATOM   2838 C CD1 . PHE B 1 179 ? 4.608   18.687 30.683 1.00 34.19  ? 159  PHE B CD1 1 
ATOM   2839 C CD2 . PHE B 1 179 ? 4.528   16.325 30.302 1.00 32.32  ? 159  PHE B CD2 1 
ATOM   2840 C CE1 . PHE B 1 179 ? 5.878   18.561 31.294 1.00 35.84  ? 159  PHE B CE1 1 
ATOM   2841 C CE2 . PHE B 1 179 ? 5.759   16.169 30.915 1.00 38.44  ? 159  PHE B CE2 1 
ATOM   2842 C CZ  . PHE B 1 179 ? 6.435   17.282 31.420 1.00 33.65  ? 159  PHE B CZ  1 
ATOM   2843 N N   . ALA B 1 180 ? 3.566   16.240 26.986 1.00 31.28  ? 160  ALA B N   1 
ATOM   2844 C CA  . ALA B 1 180 ? 4.554   15.425 26.303 1.00 33.56  ? 160  ALA B CA  1 
ATOM   2845 C C   . ALA B 1 180 ? 4.904   16.006 24.919 1.00 32.41  ? 160  ALA B C   1 
ATOM   2846 O O   . ALA B 1 180 ? 6.073   16.000 24.528 1.00 27.44  ? 160  ALA B O   1 
ATOM   2847 C CB  . ALA B 1 180 ? 4.069   13.973 26.208 1.00 28.45  ? 160  ALA B CB  1 
ATOM   2848 N N   . ASP B 1 181 ? 3.915   16.513 24.185 1.00 33.36  ? 161  ASP B N   1 
ATOM   2849 C CA  . ASP B 1 181 ? 4.168   17.165 22.878 1.00 29.93  ? 161  ASP B CA  1 
ATOM   2850 C C   . ASP B 1 181 ? 5.116   18.354 23.030 1.00 27.98  ? 161  ASP B C   1 
ATOM   2851 O O   . ASP B 1 181 ? 5.997   18.546 22.188 1.00 29.06  ? 161  ASP B O   1 
ATOM   2852 C CB  . ASP B 1 181 ? 2.877   17.697 22.259 1.00 33.28  ? 161  ASP B CB  1 
ATOM   2853 C CG  . ASP B 1 181 ? 2.076   16.633 21.534 1.00 49.87  ? 161  ASP B CG  1 
ATOM   2854 O OD1 . ASP B 1 181 ? 2.509   15.459 21.496 1.00 43.46  ? 161  ASP B OD1 1 
ATOM   2855 O OD2 . ASP B 1 181 ? 0.991   16.978 21.006 1.00 42.40  ? 161  ASP B OD2 1 
ATOM   2856 N N   . THR B 1 182 ? 4.962   19.107 24.134 1.00 31.50  ? 162  THR B N   1 
ATOM   2857 C CA  . THR B 1 182 ? 5.769   20.303 24.319 1.00 29.07  ? 162  THR B CA  1 
ATOM   2858 C C   . THR B 1 182 ? 7.209   19.878 24.502 1.00 25.29  ? 162  THR B C   1 
ATOM   2859 O O   . THR B 1 182 ? 8.065   20.413 23.825 1.00 28.19  ? 162  THR B O   1 
ATOM   2860 C CB  . THR B 1 182 ? 5.293   21.182 25.496 1.00 31.45  ? 162  THR B CB  1 
ATOM   2861 O OG1 . THR B 1 182 ? 3.913   21.509 25.267 1.00 34.69  ? 162  THR B OG1 1 
ATOM   2862 C CG2 . THR B 1 182 ? 6.064   22.526 25.492 1.00 31.44  ? 162  THR B CG2 1 
ATOM   2863 N N   . VAL B 1 183 ? 7.460   18.887 25.351 1.00 27.01  ? 163  VAL B N   1 
ATOM   2864 C CA  . VAL B 1 183 ? 8.836   18.466 25.665 1.00 28.53  ? 163  VAL B CA  1 
ATOM   2865 C C   . VAL B 1 183 ? 9.468   17.861 24.415 1.00 25.87  ? 163  VAL B C   1 
ATOM   2866 O O   . VAL B 1 183 ? 10.619  18.164 24.078 1.00 26.61  ? 163  VAL B O   1 
ATOM   2867 C CB  . VAL B 1 183 ? 8.848   17.450 26.857 1.00 27.50  ? 163  VAL B CB  1 
ATOM   2868 C CG1 . VAL B 1 183 ? 10.240  16.837 27.087 1.00 31.92  ? 163  VAL B CG1 1 
ATOM   2869 C CG2 . VAL B 1 183 ? 8.379   18.176 28.135 1.00 27.26  ? 163  VAL B CG2 1 
ATOM   2870 N N   . VAL B 1 184 ? 8.741   16.980 23.745 1.00 26.11  ? 164  VAL B N   1 
ATOM   2871 C CA  . VAL B 1 184 ? 9.317   16.310 22.578 1.00 27.20  ? 164  VAL B CA  1 
ATOM   2872 C C   . VAL B 1 184 ? 9.696   17.356 21.529 1.00 26.99  ? 164  VAL B C   1 
ATOM   2873 O O   . VAL B 1 184 ? 10.804  17.315 20.997 1.00 26.16  ? 164  VAL B O   1 
ATOM   2874 C CB  . VAL B 1 184 ? 8.364   15.241 21.979 1.00 30.96  ? 164  VAL B CB  1 
ATOM   2875 C CG1 . VAL B 1 184 ? 8.927   14.753 20.621 1.00 28.94  ? 164  VAL B CG1 1 
ATOM   2876 C CG2 . VAL B 1 184 ? 8.159   14.090 22.957 1.00 27.57  ? 164  VAL B CG2 1 
ATOM   2877 N N   . LYS B 1 185 ? 8.785   18.274 21.197 1.00 24.56  ? 165  LYS B N   1 
ATOM   2878 C CA  A LYS B 1 185 ? 9.114   19.344 20.236 0.50 27.69  ? 165  LYS B CA  1 
ATOM   2879 C CA  B LYS B 1 185 ? 9.078   19.361 20.249 0.50 18.77  ? 165  LYS B CA  1 
ATOM   2880 C C   . LYS B 1 185 ? 10.336  20.146 20.648 1.00 28.81  ? 165  LYS B C   1 
ATOM   2881 O O   . LYS B 1 185 ? 11.226  20.412 19.806 1.00 29.59  ? 165  LYS B O   1 
ATOM   2882 C CB  A LYS B 1 185 ? 7.950   20.284 20.046 0.50 22.25  ? 165  LYS B CB  1 
ATOM   2883 C CB  B LYS B 1 185 ? 7.866   20.279 20.144 0.50 47.71  ? 165  LYS B CB  1 
ATOM   2884 C CG  A LYS B 1 185 ? 6.757   19.663 19.415 0.50 28.65  ? 165  LYS B CG  1 
ATOM   2885 C CG  B LYS B 1 185 ? 7.968   21.363 19.096 0.50 30.77  ? 165  LYS B CG  1 
ATOM   2886 C CD  A LYS B 1 185 ? 5.731   20.773 19.175 0.50 35.87  ? 165  LYS B CD  1 
ATOM   2887 C CD  B LYS B 1 185 ? 6.623   22.037 18.905 0.50 35.40  ? 165  LYS B CD  1 
ATOM   2888 C CE  A LYS B 1 185 ? 4.509   20.309 18.431 0.50 76.39  ? 165  LYS B CE  1 
ATOM   2889 C CE  B LYS B 1 185 ? 6.697   23.321 18.091 0.50 57.57  ? 165  LYS B CE  1 
ATOM   2890 N NZ  A LYS B 1 185 ? 3.626   19.591 19.360 0.50 48.10  ? 165  LYS B NZ  1 
ATOM   2891 N NZ  B LYS B 1 185 ? 7.154   23.136 16.696 0.50 46.22  ? 165  LYS B NZ  1 
ATOM   2892 N N   . LEU B 1 186 ? 10.419  20.519 21.937 1.00 25.68  ? 166  LEU B N   1 
ATOM   2893 C CA  . LEU B 1 186 ? 11.578  21.262 22.438 1.00 24.67  ? 166  LEU B CA  1 
ATOM   2894 C C   . LEU B 1 186 ? 12.860  20.465 22.325 1.00 26.64  ? 166  LEU B C   1 
ATOM   2895 O O   . LEU B 1 186 ? 13.909  21.024 21.940 1.00 26.10  ? 166  LEU B O   1 
ATOM   2896 C CB  . LEU B 1 186 ? 11.371  21.667 23.907 1.00 25.97  ? 166  LEU B CB  1 
ATOM   2897 C CG  . LEU B 1 186 ? 10.440  22.837 24.214 1.00 27.37  ? 166  LEU B CG  1 
ATOM   2898 C CD1 . LEU B 1 186 ? 10.089  22.868 25.728 1.00 31.92  ? 166  LEU B CD1 1 
ATOM   2899 C CD2 . LEU B 1 186 ? 11.108  24.142 23.784 1.00 38.54  ? 166  LEU B CD2 1 
ATOM   2900 N N   . ASN B 1 187 ? 12.799  19.164 22.638 1.00 23.45  ? 167  ASN B N   1 
ATOM   2901 C CA  . ASN B 1 187 ? 14.011  18.342 22.632 1.00 24.08  ? 167  ASN B CA  1 
ATOM   2902 C C   . ASN B 1 187 ? 14.484  18.154 21.151 1.00 27.31  ? 167  ASN B C   1 
ATOM   2903 O O   . ASN B 1 187 ? 15.656  18.148 20.840 1.00 27.51  ? 167  ASN B O   1 
ATOM   2904 C CB  . ASN B 1 187 ? 13.720  17.003 23.278 1.00 21.62  ? 167  ASN B CB  1 
ATOM   2905 C CG  . ASN B 1 187 ? 13.635  17.127 24.804 1.00 26.61  ? 167  ASN B CG  1 
ATOM   2906 O OD1 . ASN B 1 187 ? 14.041  18.146 25.361 1.00 28.59  ? 167  ASN B OD1 1 
ATOM   2907 N ND2 . ASN B 1 187 ? 13.154  16.087 25.452 1.00 31.48  ? 167  ASN B ND2 1 
ATOM   2908 N N   . LEU B 1 188 ? 13.539  18.073 20.234 1.00 25.05  ? 168  LEU B N   1 
ATOM   2909 C CA  . LEU B 1 188 ? 13.940  17.945 18.808 1.00 26.26  ? 168  LEU B CA  1 
ATOM   2910 C C   . LEU B 1 188 ? 14.566  19.232 18.293 1.00 32.15  ? 168  LEU B C   1 
ATOM   2911 O O   . LEU B 1 188 ? 15.484  19.200 17.480 1.00 27.17  ? 168  LEU B O   1 
ATOM   2912 C CB  . LEU B 1 188 ? 12.725  17.596 17.937 1.00 26.33  ? 168  LEU B CB  1 
ATOM   2913 C CG  . LEU B 1 188 ? 12.294  16.116 18.033 1.00 27.56  ? 168  LEU B CG  1 
ATOM   2914 C CD1 . LEU B 1 188 ? 10.991  15.883 17.275 1.00 31.90  ? 168  LEU B CD1 1 
ATOM   2915 C CD2 . LEU B 1 188 ? 13.389  15.162 17.468 1.00 34.06  ? 168  LEU B CD2 1 
ATOM   2916 N N   . GLN B 1 189 ? 14.089  20.376 18.770 1.00 27.79  ? 169  GLN B N   1 
ATOM   2917 C CA  A GLN B 1 189 ? 14.687  21.673 18.450 0.50 33.28  ? 169  GLN B CA  1 
ATOM   2918 C CA  B GLN B 1 189 ? 14.727  21.636 18.360 0.50 21.74  ? 169  GLN B CA  1 
ATOM   2919 C C   . GLN B 1 189 ? 16.106  21.754 19.004 1.00 25.45  ? 169  GLN B C   1 
ATOM   2920 O O   . GLN B 1 189 ? 17.034  22.242 18.364 1.00 31.59  ? 169  GLN B O   1 
ATOM   2921 C CB  A GLN B 1 189 ? 13.823  22.788 19.049 0.50 20.97  ? 169  GLN B CB  1 
ATOM   2922 C CB  B GLN B 1 189 ? 13.849  22.862 18.665 0.50 63.12  ? 169  GLN B CB  1 
ATOM   2923 C CG  A GLN B 1 189 ? 12.534  23.027 18.272 0.50 22.92  ? 169  GLN B CG  1 
ATOM   2924 C CG  B GLN B 1 189 ? 14.416  24.221 18.178 0.50 44.25  ? 169  GLN B CG  1 
ATOM   2925 C CD  A GLN B 1 189 ? 11.719  24.188 18.824 0.50 39.31  ? 169  GLN B CD  1 
ATOM   2926 C CD  B GLN B 1 189 ? 14.979  24.198 16.726 0.50 31.95  ? 169  GLN B CD  1 
ATOM   2927 O OE1 A GLN B 1 189 ? 11.624  24.389 20.035 0.50 27.73  ? 169  GLN B OE1 1 
ATOM   2928 O OE1 B GLN B 1 189 ? 16.193  24.294 16.519 0.50 21.14  ? 169  GLN B OE1 1 
ATOM   2929 N NE2 A GLN B 1 189 ? 11.117  24.955 17.925 0.50 63.51  ? 169  GLN B NE2 1 
ATOM   2930 N NE2 B GLN B 1 189 ? 14.096  24.049 15.736 0.50 44.06  ? 169  GLN B NE2 1 
ATOM   2931 N N   . LYS B 1 190 ? 16.291  21.271 20.243 1.00 26.03  ? 170  LYS B N   1 
ATOM   2932 C CA  . LYS B 1 190 ? 17.620  21.300 20.792 1.00 22.56  ? 170  LYS B CA  1 
ATOM   2933 C C   . LYS B 1 190 ? 18.549  20.346 20.041 1.00 28.10  ? 170  LYS B C   1 
ATOM   2934 O O   . LYS B 1 190 ? 19.718  20.710 19.757 1.00 32.01  ? 170  LYS B O   1 
ATOM   2935 C CB  . LYS B 1 190 ? 17.606  20.945 22.298 1.00 29.61  ? 170  LYS B CB  1 
ATOM   2936 C CG  . LYS B 1 190 ? 19.026  20.880 22.906 1.00 31.75  ? 170  LYS B CG  1 
ATOM   2937 C CD  . LYS B 1 190 ? 19.005  20.670 24.434 1.00 36.54  ? 170  LYS B CD  1 
ATOM   2938 C CE  . LYS B 1 190 ? 20.418  20.401 24.990 1.00 39.89  ? 170  LYS B CE  1 
ATOM   2939 N NZ  . LYS B 1 190 ? 20.452  20.145 26.477 1.00 32.53  ? 170  LYS B NZ  1 
ATOM   2940 N N   . LEU B 1 191 ? 18.056  19.146 19.695 1.00 27.84  ? 171  LEU B N   1 
ATOM   2941 C CA  . LEU B 1 191 ? 18.788  18.230 18.834 1.00 26.19  ? 171  LEU B CA  1 
ATOM   2942 C C   . LEU B 1 191 ? 19.285  18.933 17.544 1.00 27.65  ? 171  LEU B C   1 
ATOM   2943 O O   . LEU B 1 191 ? 20.469  18.842 17.206 1.00 30.21  ? 171  LEU B O   1 
ATOM   2944 C CB  . LEU B 1 191 ? 17.901  17.064 18.437 1.00 23.09  ? 171  LEU B CB  1 
ATOM   2945 C CG  . LEU B 1 191 ? 18.576  15.964 17.570 1.00 29.08  ? 171  LEU B CG  1 
ATOM   2946 C CD1 . LEU B 1 191 ? 19.927  15.409 18.188 1.00 28.82  ? 171  LEU B CD1 1 
ATOM   2947 C CD2 . LEU B 1 191 ? 17.608  14.882 17.253 1.00 28.48  ? 171  LEU B CD2 1 
ATOM   2948 N N   . ALA B 1 192 ? 18.365  19.620 16.851 1.00 30.19  ? 172  ALA B N   1 
ATOM   2949 C CA  . ALA B 1 192 ? 18.723  20.392 15.632 1.00 30.10  ? 172  ALA B CA  1 
ATOM   2950 C C   . ALA B 1 192 ? 19.821  21.427 15.895 1.00 35.99  ? 172  ALA B C   1 
ATOM   2951 O O   . ALA B 1 192 ? 20.815  21.467 15.188 1.00 36.19  ? 172  ALA B O   1 
ATOM   2952 C CB  . ALA B 1 192 ? 17.453  21.033 15.039 1.00 30.45  ? 172  ALA B CB  1 
ATOM   2953 N N   . THR B 1 193 ? 19.657  22.251 16.928 1.00 28.14  ? 173  THR B N   1 
ATOM   2954 C CA  A THR B 1 193 ? 20.636  23.285 17.237 0.50 30.39  ? 173  THR B CA  1 
ATOM   2955 C CA  B THR B 1 193 ? 20.626  23.287 17.279 0.50 35.22  ? 173  THR B CA  1 
ATOM   2956 C C   . THR B 1 193 ? 22.003  22.688 17.598 1.00 42.33  ? 173  THR B C   1 
ATOM   2957 O O   . THR B 1 193 ? 23.044  23.170 17.111 1.00 39.11  ? 173  THR B O   1 
ATOM   2958 C CB  A THR B 1 193 ? 20.130  24.279 18.331 0.50 40.85  ? 173  THR B CB  1 
ATOM   2959 C CB  B THR B 1 193 ? 20.110  24.161 18.471 0.50 23.64  ? 173  THR B CB  1 
ATOM   2960 O OG1 A THR B 1 193 ? 20.106  23.630 19.606 0.50 58.48  ? 173  THR B OG1 1 
ATOM   2961 O OG1 B THR B 1 193 ? 18.754  24.558 18.226 0.50 54.60  ? 173  THR B OG1 1 
ATOM   2962 C CG2 A THR B 1 193 ? 18.723  24.789 17.995 0.50 20.04  ? 173  THR B CG2 1 
ATOM   2963 C CG2 B THR B 1 193 ? 20.961  25.398 18.652 0.50 41.80  ? 173  THR B CG2 1 
ATOM   2964 N N   . VAL B 1 194 ? 22.017  21.626 18.410 1.00 31.43  ? 174  VAL B N   1 
ATOM   2965 C CA  . VAL B 1 194 ? 23.253  20.974 18.828 1.00 31.96  ? 174  VAL B CA  1 
ATOM   2966 C C   . VAL B 1 194 ? 23.979  20.303 17.640 1.00 31.70  ? 174  VAL B C   1 
ATOM   2967 O O   . VAL B 1 194 ? 25.208  20.454 17.524 1.00 40.77  ? 174  VAL B O   1 
ATOM   2968 C CB  . VAL B 1 194 ? 23.020  19.896 19.940 1.00 31.22  ? 174  VAL B CB  1 
ATOM   2969 C CG1 . VAL B 1 194 ? 24.229  18.922 20.111 1.00 40.89  ? 174  VAL B CG1 1 
ATOM   2970 C CG2 . VAL B 1 194 ? 22.683  20.559 21.273 1.00 25.53  ? 174  VAL B CG2 1 
ATOM   2971 N N   . ALA B 1 195 ? 23.246  19.571 16.814 1.00 34.38  ? 175  ALA B N   1 
ATOM   2972 C CA  . ALA B 1 195 ? 23.835  18.873 15.637 1.00 32.09  ? 175  ALA B CA  1 
ATOM   2973 C C   . ALA B 1 195 ? 24.377  19.901 14.638 1.00 53.56  ? 175  ALA B C   1 
ATOM   2974 O O   . ALA B 1 195 ? 25.500  19.772 14.133 1.00 41.40  ? 175  ALA B O   1 
ATOM   2975 C CB  . ALA B 1 195 ? 22.799  17.993 14.949 1.00 30.95  ? 175  ALA B CB  1 
ATOM   2976 N N   . GLU B 1 196 ? 23.572  20.921 14.358 1.00 37.24  ? 176  GLU B N   1 
ATOM   2977 C CA  . GLU B 1 196 ? 24.031  22.046 13.493 1.00 37.70  ? 176  GLU B CA  1 
ATOM   2978 C C   . GLU B 1 196 ? 25.287  22.738 14.028 1.00 45.00  ? 176  GLU B C   1 
ATOM   2979 O O   . GLU B 1 196 ? 26.211  23.024 13.262 1.00 47.42  ? 176  GLU B O   1 
ATOM   2980 C CB  . GLU B 1 196 ? 22.887  23.005 13.173 1.00 35.23  ? 176  GLU B CB  1 
ATOM   2981 C CG  . GLU B 1 196 ? 21.861  22.344 12.259 1.00 34.20  ? 176  GLU B CG  1 
ATOM   2982 C CD  . GLU B 1 196 ? 20.539  23.053 12.128 1.00 47.47  ? 176  GLU B CD  1 
ATOM   2983 O OE1 . GLU B 1 196 ? 20.353  24.179 12.663 1.00 49.71  ? 176  GLU B OE1 1 
ATOM   2984 O OE2 . GLU B 1 196 ? 19.658  22.465 11.469 1.00 39.49  ? 176  GLU B OE2 1 
ATOM   2985 N N   . ALA B 1 197 ? 25.354  22.969 15.332 1.00 39.64  ? 177  ALA B N   1 
ATOM   2986 C CA  . ALA B 1 197 ? 26.540  23.564 15.952 1.00 41.57  ? 177  ALA B CA  1 
ATOM   2987 C C   . ALA B 1 197 ? 27.780  22.659 15.918 1.00 74.47  ? 177  ALA B C   1 
ATOM   2988 O O   . ALA B 1 197 ? 28.893  23.152 15.766 1.00 56.36  ? 177  ALA B O   1 
ATOM   2989 C CB  . ALA B 1 197 ? 26.246  24.036 17.384 1.00 45.61  ? 177  ALA B CB  1 
ATOM   2990 N N   . MET B 1 198 ? 27.590  21.346 16.065 1.00 47.37  ? 178  MET B N   1 
ATOM   2991 C CA  . MET B 1 198 ? 28.706  20.389 15.997 1.00 45.30  ? 178  MET B CA  1 
ATOM   2992 C C   . MET B 1 198 ? 29.255  20.236 14.589 1.00 52.58  ? 178  MET B C   1 
ATOM   2993 O O   . MET B 1 198 ? 30.439  19.978 14.391 1.00 55.25  ? 178  MET B O   1 
ATOM   2994 C CB  . MET B 1 198 ? 28.285  19.019 16.503 1.00 41.82  ? 178  MET B CB  1 
ATOM   2995 C CG  . MET B 1 198 ? 28.309  18.897 18.007 1.00 62.94  ? 178  MET B CG  1 
ATOM   2996 S SD  . MET B 1 198 ? 27.542  17.334 18.455 1.00 64.13  ? 178  MET B SD  1 
ATOM   2997 C CE  . MET B 1 198 ? 28.805  16.166 17.932 1.00 78.27  ? 178  MET B CE  1 
ATOM   2998 N N   . ALA B 1 199 ? 28.378  20.387 13.614 1.00 43.35  ? 179  ALA B N   1 
ATOM   2999 C CA  . ALA B 1 199 ? 28.750  20.263 12.214 1.00 51.80  ? 179  ALA B CA  1 
ATOM   3000 C C   . ALA B 1 199 ? 29.614  21.443 11.739 1.00 77.88  ? 179  ALA B C   1 
ATOM   3001 O O   . ALA B 1 199 ? 30.523  21.263 10.926 1.00 84.54  ? 179  ALA B O   1 
ATOM   3002 C CB  . ALA B 1 199 ? 27.509  20.136 11.361 1.00 42.71  ? 179  ALA B CB  1 
ATOM   3003 N N   . ARG B 1 200 ? 29.314  22.640 12.238 1.00 66.61  ? 180  ARG B N   1 
ATOM   3004 C CA  . ARG B 1 200 ? 30.112  23.841 11.948 1.00 64.93  ? 180  ARG B CA  1 
ATOM   3005 C C   . ARG B 1 200 ? 31.508  23.757 12.559 1.00 97.79  ? 180  ARG B C   1 
ATOM   3006 O O   . ARG B 1 200 ? 32.509  23.950 11.865 1.00 147.68 ? 180  ARG B O   1 
ATOM   3007 C CB  . ARG B 1 200 ? 29.426  25.103 12.484 1.00 45.48  ? 180  ARG B CB  1 
ATOM   3008 C CG  . ARG B 1 200 ? 28.109  25.473 11.805 1.00 83.19  ? 180  ARG B CG  1 
ATOM   3009 C CD  . ARG B 1 200 ? 27.696  26.905 12.145 1.00 102.27 ? 180  ARG B CD  1 
ATOM   3010 N NE  . ARG B 1 200 ? 27.751  27.171 13.583 1.00 77.44  ? 180  ARG B NE  1 
ATOM   3011 C CZ  . ARG B 1 200 ? 26.718  27.064 14.416 1.00 230.39 ? 180  ARG B CZ  1 
ATOM   3012 N NH1 . ARG B 1 200 ? 25.517  26.706 13.969 1.00 54.22  ? 180  ARG B NH1 1 
ATOM   3013 N NH2 . ARG B 1 200 ? 26.886  27.322 15.707 1.00 70.92  ? 180  ARG B NH2 1 
ATOM   3014 N N   . ASN B 1 201 ? 31.558  23.471 13.862 1.00 72.39  ? 181  ASN B N   1 
ATOM   3015 C CA  . ASN B 1 201 ? 32.808  23.419 14.626 1.00 94.20  ? 181  ASN B CA  1 
ATOM   3016 C C   . ASN B 1 201 ? 33.734  22.259 14.248 1.00 98.05  ? 181  ASN B C   1 
ATOM   3017 O O   . ASN B 1 201 ? 34.926  22.284 14.564 1.00 156.78 ? 181  ASN B O   1 
ATOM   3018 C CB  . ASN B 1 201 ? 32.517  23.396 16.131 1.00 134.46 ? 181  ASN B CB  1 
ATOM   3019 C CG  . ASN B 1 201 ? 31.861  24.678 16.624 1.00 174.89 ? 181  ASN B CG  1 
ATOM   3020 O OD1 . ASN B 1 201 ? 30.971  25.234 15.973 1.00 105.05 ? 181  ASN B OD1 1 
ATOM   3021 N ND2 . ASN B 1 201 ? 32.295  25.149 17.787 1.00 258.64 ? 181  ASN B ND2 1 
ATOM   3022 N N   . SER B 1 202 ? 33.182  21.249 13.581 1.00 110.25 ? 182  SER B N   1 
ATOM   3023 C CA  . SER B 1 202 ? 33.978  20.145 13.050 1.00 125.58 ? 182  SER B CA  1 
ATOM   3024 C C   . SER B 1 202 ? 34.711  20.578 11.783 1.00 153.84 ? 182  SER B C   1 
ATOM   3025 O O   . SER B 1 202 ? 35.854  20.176 11.553 1.00 194.19 ? 182  SER B O   1 
ATOM   3026 C CB  . SER B 1 202 ? 33.094  18.936 12.752 1.00 54.82  ? 182  SER B CB  1 
ATOM   3027 O OG  . SER B 1 202 ? 33.876  17.783 12.492 1.00 180.54 ? 182  SER B OG  1 
ATOM   3028 N N   . GLY B 1 203 ? 34.042  21.395 10.970 1.00 127.53 ? 183  GLY B N   1 
ATOM   3029 C CA  . GLY B 1 203 ? 34.619  21.921 9.736  1.00 147.43 ? 183  GLY B CA  1 
ATOM   3030 C C   . GLY B 1 203 ? 35.696  22.955 10.001 1.00 163.84 ? 183  GLY B C   1 
ATOM   3031 O O   . GLY B 1 203 ? 36.870  22.733 9.695  1.00 179.13 ? 183  GLY B O   1 
ATOM   3032 N N   . ASP B 1 204 ? 35.291  24.084 10.576 1.00 172.89 ? 184  ASP B N   1 
ATOM   3033 C CA  . ASP B 1 204 ? 36.213  25.170 10.897 1.00 183.10 ? 184  ASP B CA  1 
ATOM   3034 C C   . ASP B 1 204 ? 36.316  25.386 12.404 1.00 169.85 ? 184  ASP B C   1 
ATOM   3035 O O   . ASP B 1 204 ? 37.386  25.703 12.922 1.00 125.62 ? 184  ASP B O   1 
ATOM   3036 C CB  . ASP B 1 204 ? 35.781  26.468 10.206 1.00 202.56 ? 184  ASP B CB  1 
ATOM   3037 C CG  . ASP B 1 204 ? 35.877  26.390 8.688  1.00 216.88 ? 184  ASP B CG  1 
ATOM   3038 O OD1 . ASP B 1 204 ? 36.845  25.790 8.167  1.00 161.47 ? 184  ASP B OD1 1 
ATOM   3039 O OD2 . ASP B 1 204 ? 34.982  26.942 8.012  1.00 172.18 ? 184  ASP B OD2 1 
HETATM 3040 C C1  . A8S C 2 .   ? 11.529  12.426 26.557 1.00 47.63  ? 1001 A8S B C1  1 
HETATM 3041 C C2  . A8S C 2 .   ? 10.118  12.886 26.709 1.00 36.73  ? 1001 A8S B C2  1 
HETATM 3042 C C3  . A8S C 2 .   ? 9.519   13.331 27.835 1.00 41.35  ? 1001 A8S B C3  1 
HETATM 3043 C C4  . A8S C 2 .   ? 10.262  13.460 29.105 1.00 33.95  ? 1001 A8S B C4  1 
HETATM 3044 C C5  . A8S C 2 .   ? 9.662   13.821 30.257 1.00 33.83  ? 1001 A8S B C5  1 
HETATM 3045 C C6  . A8S C 2 .   ? 8.048   13.707 27.778 1.00 37.91  ? 1001 A8S B C6  1 
HETATM 3046 C C7  . A8S C 2 .   ? 10.407  13.918 31.563 1.00 37.39  ? 1001 A8S B C7  1 
HETATM 3047 O O7  . A8S C 2 .   ? 11.802  13.614 31.404 1.00 34.10  ? 1001 A8S B O7  1 
HETATM 3048 C C8  . A8S C 2 .   ? 10.305  15.396 31.903 1.00 32.95  ? 1001 A8S B C8  1 
HETATM 3049 C C9  . A8S C 2 .   ? 9.357   15.834 32.741 1.00 33.63  ? 1001 A8S B C9  1 
HETATM 3050 C C10 . A8S C 2 .   ? 8.371   14.888 33.318 1.00 36.96  ? 1001 A8S B C10 1 
HETATM 3051 O O10 . A8S C 2 .   ? 7.577   15.300 34.142 1.00 45.75  ? 1001 A8S B O10 1 
HETATM 3052 C C11 . A8S C 2 .   ? 8.355   13.428 32.907 1.00 29.58  ? 1001 A8S B C11 1 
HETATM 3053 O O11 . A8S C 2 .   ? 11.926  11.942 25.452 1.00 42.58  ? 1001 A8S B O11 1 
HETATM 3054 C C12 . A8S C 2 .   ? 9.793   12.981 32.637 1.00 31.29  ? 1001 A8S B C12 1 
HETATM 3055 O O12 . A8S C 2 .   ? 12.311  12.454 27.527 1.00 48.60  ? 1001 A8S B O12 1 
HETATM 3056 C C13 . A8S C 2 .   ? 11.247  16.386 31.276 1.00 29.73  ? 1001 A8S B C13 1 
HETATM 3057 C C14 . A8S C 2 .   ? 10.650  13.023 33.912 1.00 33.52  ? 1001 A8S B C14 1 
HETATM 3058 C C15 . A8S C 2 .   ? 9.796   11.507 32.206 1.00 31.00  ? 1001 A8S B C15 1 
HETATM 3059 O O   . HOH D 3 .   ? 14.456  53.090 18.912 1.00 41.91  ? 192  HOH A O   1 
HETATM 3060 O O   . HOH D 3 .   ? 18.152  38.864 8.503  1.00 84.04  ? 193  HOH A O   1 
HETATM 3061 O O   . HOH D 3 .   ? 22.119  53.245 27.298 1.00 31.65  ? 194  HOH A O   1 
HETATM 3062 O O   . HOH D 3 .   ? 23.756  38.715 14.544 1.00 55.36  ? 195  HOH A O   1 
HETATM 3063 O O   . HOH D 3 .   ? 25.237  40.011 16.137 1.00 49.56  ? 196  HOH A O   1 
HETATM 3064 O O   . HOH D 3 .   ? 23.205  41.814 14.260 1.00 61.97  ? 197  HOH A O   1 
HETATM 3065 O O   . HOH D 3 .   ? -0.618  52.949 31.130 1.00 78.54  ? 198  HOH A O   1 
HETATM 3066 O O   . HOH D 3 .   ? 20.964  51.136 16.124 1.00 44.81  ? 199  HOH A O   1 
HETATM 3067 O O   . HOH D 3 .   ? -4.654  27.491 41.861 1.00 46.05  ? 200  HOH A O   1 
HETATM 3068 O O   . HOH D 3 .   ? 7.134   40.352 31.072 1.00 32.15  ? 201  HOH A O   1 
HETATM 3069 O O   . HOH D 3 .   ? 6.548   34.407 31.739 1.00 52.23  ? 202  HOH A O   1 
HETATM 3070 O O   . HOH D 3 .   ? -0.160  23.647 22.693 1.00 76.55  ? 203  HOH A O   1 
HETATM 3071 O O   . HOH D 3 .   ? 5.690   44.289 36.084 1.00 27.46  ? 204  HOH A O   1 
HETATM 3072 O O   . HOH D 3 .   ? 22.238  49.422 33.235 1.00 34.77  ? 205  HOH A O   1 
HETATM 3073 O O   . HOH D 3 .   ? 20.493  54.276 25.051 1.00 37.62  ? 206  HOH A O   1 
HETATM 3074 O O   . HOH D 3 .   ? 18.654  51.968 26.820 1.00 31.59  ? 207  HOH A O   1 
HETATM 3075 O O   . HOH D 3 .   ? 11.958  42.005 45.693 1.00 53.41  ? 208  HOH A O   1 
HETATM 3076 O O   . HOH D 3 .   ? 0.620   24.110 25.640 1.00 46.37  ? 209  HOH A O   1 
HETATM 3077 O O   . HOH D 3 .   ? -6.796  30.123 25.387 1.00 54.60  ? 210  HOH A O   1 
HETATM 3078 O O   . HOH D 3 .   ? -6.402  24.751 37.355 1.00 79.84  ? 211  HOH A O   1 
HETATM 3079 O O   . HOH D 3 .   ? 3.600   35.441 42.724 1.00 48.43  ? 212  HOH A O   1 
HETATM 3080 O O   . HOH D 3 .   ? 16.501  27.109 28.609 1.00 46.77  ? 213  HOH A O   1 
HETATM 3081 O O   . HOH D 3 .   ? 5.030   32.883 13.117 1.00 59.67  ? 214  HOH A O   1 
HETATM 3082 O O   . HOH D 3 .   ? 2.743   39.637 10.072 1.00 89.90  ? 215  HOH A O   1 
HETATM 3083 O O   . HOH D 3 .   ? -6.494  32.050 40.851 0.50 46.50  ? 216  HOH A O   1 
HETATM 3084 O O   . HOH D 3 .   ? 4.640   25.379 22.857 1.00 54.02  ? 217  HOH A O   1 
HETATM 3085 O O   . HOH D 3 .   ? 5.411   49.393 17.495 1.00 46.71  ? 218  HOH A O   1 
HETATM 3086 O O   . HOH D 3 .   ? 19.295  45.461 36.589 1.00 37.70  ? 219  HOH A O   1 
HETATM 3087 O O   . HOH D 3 .   ? -0.903  43.520 19.203 1.00 37.29  ? 220  HOH A O   1 
HETATM 3088 O O   . HOH D 3 .   ? 14.999  30.724 18.723 1.00 51.63  ? 221  HOH A O   1 
HETATM 3089 O O   . HOH D 3 .   ? 20.228  36.262 21.208 1.00 33.66  ? 222  HOH A O   1 
HETATM 3090 O O   . HOH D 3 .   ? 11.705  49.485 25.035 1.00 35.51  ? 223  HOH A O   1 
HETATM 3091 O O   . HOH D 3 .   ? 3.803   47.554 16.925 1.00 46.24  ? 224  HOH A O   1 
HETATM 3092 O O   . HOH D 3 .   ? 6.772   37.130 29.962 1.00 43.81  ? 225  HOH A O   1 
HETATM 3093 O O   . HOH D 3 .   ? 0.671   43.561 27.585 1.00 47.38  ? 226  HOH A O   1 
HETATM 3094 O O   . HOH D 3 .   ? 16.684  53.396 23.563 1.00 53.13  ? 227  HOH A O   1 
HETATM 3095 O O   . HOH D 3 .   ? 2.074   27.324 25.167 1.00 31.75  ? 228  HOH A O   1 
HETATM 3096 O O   . HOH D 3 .   ? 18.071  50.460 21.398 1.00 59.67  ? 229  HOH A O   1 
HETATM 3097 O O   . HOH D 3 .   ? 1.888   33.841 31.094 1.00 49.33  ? 230  HOH A O   1 
HETATM 3098 O O   . HOH D 3 .   ? 20.393  36.427 28.195 1.00 33.42  ? 231  HOH A O   1 
HETATM 3099 O O   . HOH D 3 .   ? 3.632   53.400 31.612 1.00 46.94  ? 232  HOH A O   1 
HETATM 3100 O O   . HOH D 3 .   ? 0.813   37.296 21.527 1.00 43.25  ? 233  HOH A O   1 
HETATM 3101 O O   . HOH D 3 .   ? 1.177   38.279 26.974 1.00 39.18  ? 234  HOH A O   1 
HETATM 3102 O O   . HOH D 3 .   ? 26.817  38.438 17.885 1.00 51.03  ? 235  HOH A O   1 
HETATM 3103 O O   . HOH D 3 .   ? 23.587  51.778 34.213 1.00 47.53  ? 236  HOH A O   1 
HETATM 3104 O O   . HOH D 3 .   ? 1.018   48.905 37.801 1.00 46.99  ? 237  HOH A O   1 
HETATM 3105 O O   . HOH D 3 .   ? -3.938  21.426 40.218 1.00 66.55  ? 238  HOH A O   1 
HETATM 3106 O O   . HOH D 3 .   ? 15.419  21.816 43.773 1.00 75.77  ? 239  HOH A O   1 
HETATM 3107 O O   . HOH D 3 .   ? 18.203  28.268 40.314 0.50 37.72  ? 240  HOH A O   1 
HETATM 3108 O O   . HOH D 3 .   ? 19.175  34.195 28.708 1.00 51.23  ? 241  HOH A O   1 
HETATM 3109 O O   . HOH D 3 .   ? 11.433  31.329 12.187 1.00 50.91  ? 242  HOH A O   1 
HETATM 3110 O O   . HOH D 3 .   ? 11.664  50.166 20.956 1.00 46.82  ? 243  HOH A O   1 
HETATM 3111 O O   . HOH D 3 .   ? 11.304  27.426 21.632 1.00 40.67  ? 244  HOH A O   1 
HETATM 3112 O O   . HOH D 3 .   ? 13.585  49.226 37.085 1.00 41.77  ? 245  HOH A O   1 
HETATM 3113 O O   . HOH D 3 .   ? 1.974   27.791 44.370 1.00 63.28  ? 246  HOH A O   1 
HETATM 3114 O O   . HOH D 3 .   ? 1.441   49.093 19.658 1.00 49.54  ? 247  HOH A O   1 
HETATM 3115 O O   . HOH D 3 .   ? 21.679  37.097 24.716 1.00 50.82  ? 248  HOH A O   1 
HETATM 3116 O O   . HOH D 3 .   ? 11.605  47.326 42.610 1.00 51.85  ? 249  HOH A O   1 
HETATM 3117 O O   . HOH D 3 .   ? 15.728  24.096 54.940 1.00 71.22  ? 250  HOH A O   1 
HETATM 3118 O O   . HOH D 3 .   ? 16.445  32.892 24.828 1.00 31.41  ? 251  HOH A O   1 
HETATM 3119 O O   . HOH D 3 .   ? 15.839  54.516 29.561 1.00 45.35  ? 252  HOH A O   1 
HETATM 3120 O O   . HOH D 3 .   ? 2.601   30.837 17.928 1.00 42.58  ? 253  HOH A O   1 
HETATM 3121 O O   . HOH D 3 .   ? 8.309   31.385 47.789 1.00 72.65  ? 254  HOH A O   1 
HETATM 3122 O O   . HOH D 3 .   ? 4.859   40.260 29.870 1.00 30.17  ? 255  HOH A O   1 
HETATM 3123 O O   . HOH D 3 .   ? 1.492   41.075 27.356 1.00 37.91  ? 256  HOH A O   1 
HETATM 3124 O O   . HOH D 3 .   ? 14.146  50.996 20.560 1.00 36.27  ? 257  HOH A O   1 
HETATM 3125 O O   . HOH D 3 .   ? 17.784  55.003 32.984 1.00 39.29  ? 258  HOH A O   1 
HETATM 3126 O O   . HOH D 3 .   ? 3.503   24.290 25.031 1.00 39.36  ? 259  HOH A O   1 
HETATM 3127 O O   . HOH D 3 .   ? 7.921   38.390 27.653 1.00 50.64  ? 260  HOH A O   1 
HETATM 3128 O O   . HOH D 3 .   ? 5.205   28.349 44.660 1.00 79.10  ? 261  HOH A O   1 
HETATM 3129 O O   . HOH D 3 .   ? 1.920   51.169 34.728 1.00 41.12  ? 262  HOH A O   1 
HETATM 3130 O O   . HOH D 3 .   ? 3.595   50.851 19.704 1.00 56.44  ? 263  HOH A O   1 
HETATM 3131 O O   . HOH D 3 .   ? 17.093  41.611 11.039 1.00 54.03  ? 264  HOH A O   1 
HETATM 3132 O O   . HOH D 3 .   ? -6.452  33.436 24.922 1.00 56.88  ? 265  HOH A O   1 
HETATM 3133 O O   . HOH D 3 .   ? 17.397  52.440 16.719 1.00 62.18  ? 266  HOH A O   1 
HETATM 3134 O O   . HOH D 3 .   ? 11.950  44.487 52.152 1.00 61.29  ? 267  HOH A O   1 
HETATM 3135 O O   . HOH D 3 .   ? 3.410   37.767 29.458 1.00 33.18  ? 268  HOH A O   1 
HETATM 3136 O O   . HOH D 3 .   ? 1.758   37.137 48.130 1.00 60.91  ? 269  HOH A O   1 
HETATM 3137 O O   . HOH D 3 .   ? 17.190  23.410 32.203 1.00 64.19  ? 270  HOH A O   1 
HETATM 3138 O O   . HOH D 3 .   ? 20.433  34.719 18.925 1.00 63.71  ? 271  HOH A O   1 
HETATM 3139 O O   . HOH D 3 .   ? 29.585  40.417 22.873 1.00 80.27  ? 272  HOH A O   1 
HETATM 3140 O O   . HOH D 3 .   ? 29.417  47.544 26.119 1.00 52.16  ? 273  HOH A O   1 
HETATM 3141 O O   . HOH D 3 .   ? 10.533  45.935 46.681 1.00 77.52  ? 274  HOH A O   1 
HETATM 3142 O O   . HOH D 3 .   ? 11.788  43.992 43.823 1.00 48.86  ? 275  HOH A O   1 
HETATM 3143 O O   . HOH D 3 .   ? -1.201  37.656 19.734 1.00 61.01  ? 276  HOH A O   1 
HETATM 3144 O O   . HOH D 3 .   ? -9.923  39.798 32.314 1.00 47.17  ? 277  HOH A O   1 
HETATM 3145 O O   . HOH D 3 .   ? -9.671  42.174 33.985 1.00 43.51  ? 278  HOH A O   1 
HETATM 3146 O O   . HOH D 3 .   ? -12.919 40.412 23.848 1.00 70.39  ? 279  HOH A O   1 
HETATM 3147 O O   . HOH D 3 .   ? -10.919 44.338 30.257 1.00 69.19  ? 280  HOH A O   1 
HETATM 3148 O O   . HOH D 3 .   ? -7.803  45.246 24.430 1.00 69.12  ? 281  HOH A O   1 
HETATM 3149 O O   . HOH D 3 .   ? 2.611   55.572 25.768 1.00 67.30  ? 282  HOH A O   1 
HETATM 3150 O O   . HOH D 3 .   ? -3.206  30.115 46.385 1.00 59.26  ? 283  HOH A O   1 
HETATM 3151 O O   . HOH D 3 .   ? 16.865  44.671 7.827  1.00 73.31  ? 284  HOH A O   1 
HETATM 3152 O O   . HOH D 3 .   ? 16.213  26.929 41.358 1.00 55.21  ? 285  HOH A O   1 
HETATM 3153 O O   . HOH D 3 .   ? 7.744   32.090 4.364  1.00 88.49  ? 286  HOH A O   1 
HETATM 3154 O O   . HOH D 3 .   ? 1.504   38.135 24.740 1.00 49.10  ? 287  HOH A O   1 
HETATM 3155 O O   . HOH D 3 .   ? 9.796   38.656 44.766 1.00 41.85  ? 288  HOH A O   1 
HETATM 3156 O O   . HOH D 3 .   ? 15.945  50.866 22.908 1.00 47.46  ? 289  HOH A O   1 
HETATM 3157 O O   . HOH D 3 .   ? 4.978   39.871 26.977 1.00 35.89  ? 290  HOH A O   1 
HETATM 3158 O O   . HOH D 3 .   ? 27.728  38.299 20.326 1.00 60.08  ? 291  HOH A O   1 
HETATM 3159 O O   . HOH D 3 .   ? 25.861  45.060 17.163 1.00 46.96  ? 292  HOH A O   1 
HETATM 3160 O O   . HOH D 3 .   ? 1.685   51.564 31.782 1.00 36.46  ? 293  HOH A O   1 
HETATM 3161 O O   . HOH D 3 .   ? 11.450  37.715 49.876 1.00 51.55  ? 294  HOH A O   1 
HETATM 3162 O O   . HOH D 3 .   ? 0.199   37.794 17.138 1.00 80.86  ? 295  HOH A O   1 
HETATM 3163 O O   . HOH D 3 .   ? 7.882   33.175 49.368 1.00 61.35  ? 296  HOH A O   1 
HETATM 3164 O O   . HOH D 3 .   ? 24.044  42.563 16.465 1.00 38.68  ? 297  HOH A O   1 
HETATM 3165 O O   . HOH D 3 .   ? 0.386   28.006 37.399 1.00 60.55  ? 298  HOH A O   1 
HETATM 3166 O O   . HOH D 3 .   ? 17.205  34.767 39.857 1.00 53.96  ? 299  HOH A O   1 
HETATM 3167 O O   . HOH D 3 .   ? 17.069  31.772 39.496 1.00 57.09  ? 300  HOH A O   1 
HETATM 3168 O O   . HOH D 3 .   ? 9.091   32.191 34.352 1.00 56.92  ? 301  HOH A O   1 
HETATM 3169 O O   . HOH D 3 .   ? 18.875  45.234 39.496 1.00 66.04  ? 302  HOH A O   1 
HETATM 3170 O O   . HOH D 3 .   ? 3.476   39.294 42.350 1.00 42.03  ? 303  HOH A O   1 
HETATM 3171 O O   . HOH D 3 .   ? 7.009   53.428 18.575 1.00 65.83  ? 304  HOH A O   1 
HETATM 3172 O O   . HOH D 3 .   ? 13.771  26.189 21.877 1.00 44.44  ? 305  HOH A O   1 
HETATM 3173 O O   . HOH D 3 .   ? 19.742  34.694 23.508 1.00 62.91  ? 306  HOH A O   1 
HETATM 3174 O O   . HOH D 3 .   ? 3.214   32.944 33.441 1.00 61.24  ? 307  HOH A O   1 
HETATM 3175 O O   . HOH D 3 .   ? 0.511   27.080 22.929 1.00 59.93  ? 308  HOH A O   1 
HETATM 3176 O O   . HOH D 3 .   ? -3.325  51.183 30.463 1.00 44.75  ? 309  HOH A O   1 
HETATM 3177 O O   . HOH D 3 .   ? 14.086  46.868 49.659 1.00 47.51  ? 310  HOH A O   1 
HETATM 3178 O O   . HOH D 3 .   ? 13.433  46.677 52.478 1.00 48.63  ? 311  HOH A O   1 
HETATM 3179 O O   . HOH D 3 .   ? 26.565  33.539 22.430 1.00 72.95  ? 312  HOH A O   1 
HETATM 3180 O O   . HOH D 3 .   ? -3.518  43.060 42.500 1.00 57.05  ? 313  HOH A O   1 
HETATM 3181 O O   . HOH D 3 .   ? -6.456  42.976 40.911 0.50 66.61  ? 314  HOH A O   1 
HETATM 3182 O O   . HOH D 3 .   ? 11.909  34.377 50.432 1.00 49.40  ? 315  HOH A O   1 
HETATM 3183 O O   . HOH D 3 .   ? 17.618  34.616 26.555 1.00 36.15  ? 316  HOH A O   1 
HETATM 3184 O O   . HOH D 3 .   ? 17.430  35.183 16.568 1.00 47.91  ? 317  HOH A O   1 
HETATM 3185 O O   . HOH D 3 .   ? 22.438  53.847 32.891 1.00 59.82  ? 318  HOH A O   1 
HETATM 3186 O O   . HOH D 3 .   ? 25.419  37.686 28.011 1.00 73.51  ? 319  HOH A O   1 
HETATM 3187 O O   . HOH D 3 .   ? -9.718  46.103 31.993 1.00 76.56  ? 320  HOH A O   1 
HETATM 3188 O O   . HOH D 3 .   ? 4.276   44.977 12.461 1.00 61.95  ? 321  HOH A O   1 
HETATM 3189 O O   . HOH D 3 .   ? 8.514   34.548 29.097 1.00 37.19  ? 322  HOH A O   1 
HETATM 3190 O O   . HOH D 3 .   ? 8.146   36.231 32.978 1.00 42.30  ? 323  HOH A O   1 
HETATM 3191 O O   . HOH D 3 .   ? 5.648   29.716 29.907 1.00 53.30  ? 324  HOH A O   1 
HETATM 3192 O O   . HOH D 3 .   ? 0.804   53.233 25.639 1.00 49.17  ? 325  HOH A O   1 
HETATM 3193 O O   . HOH D 3 .   ? 2.604   41.893 30.274 1.00 36.02  ? 326  HOH A O   1 
HETATM 3194 O O   . HOH D 3 .   ? 18.623  31.802 40.915 0.50 44.74  ? 327  HOH A O   1 
HETATM 3195 O O   . HOH D 3 .   ? 1.531   46.965 17.878 1.00 60.38  ? 328  HOH A O   1 
HETATM 3196 O O   . HOH D 3 .   ? 11.312  28.106 19.064 1.00 41.47  ? 329  HOH A O   1 
HETATM 3197 O O   . HOH D 3 .   ? 18.124  32.141 19.208 1.00 64.18  ? 330  HOH A O   1 
HETATM 3198 O O   . HOH D 3 .   ? -4.455  25.251 39.728 1.00 72.54  ? 331  HOH A O   1 
HETATM 3199 O O   . HOH D 3 .   ? -15.420 37.044 24.735 1.00 77.68  ? 332  HOH A O   1 
HETATM 3200 O O   . HOH D 3 .   ? -6.455  29.358 40.937 0.50 45.51  ? 333  HOH A O   1 
HETATM 3201 O O   . HOH D 3 .   ? -12.383 37.375 25.817 1.00 66.80  ? 334  HOH A O   1 
HETATM 3202 O O   . HOH D 3 .   ? -8.574  25.430 30.057 1.00 67.08  ? 335  HOH A O   1 
HETATM 3203 O O   . HOH D 3 .   ? -7.451  29.990 31.274 1.00 66.68  ? 336  HOH A O   1 
HETATM 3204 O O   . HOH D 3 .   ? 4.980   58.971 21.418 1.00 67.25  ? 337  HOH A O   1 
HETATM 3205 O O   . HOH D 3 .   ? 17.380  43.555 39.311 1.00 60.48  ? 338  HOH A O   1 
HETATM 3206 O O   . HOH D 3 .   ? 23.297  38.353 26.283 1.00 54.58  ? 339  HOH A O   1 
HETATM 3207 O O   . HOH D 3 .   ? 10.496  52.650 16.340 1.00 52.19  ? 340  HOH A O   1 
HETATM 3208 O O   . HOH D 3 .   ? -0.938  49.886 19.568 1.00 61.16  ? 341  HOH A O   1 
HETATM 3209 O O   . HOH D 3 .   ? 21.551  36.292 16.490 1.00 48.88  ? 342  HOH A O   1 
HETATM 3210 O O   . HOH D 3 .   ? 2.234   43.467 13.435 1.00 52.79  ? 343  HOH A O   1 
HETATM 3211 O O   . HOH D 3 .   ? 0.782   39.755 15.442 1.00 65.34  ? 344  HOH A O   1 
HETATM 3212 O O   . HOH D 3 .   ? -1.588  32.123 19.501 1.00 70.53  ? 345  HOH A O   1 
HETATM 3213 O O   . HOH D 3 .   ? -4.809  28.477 23.611 1.00 56.38  ? 346  HOH A O   1 
HETATM 3214 O O   . HOH D 3 .   ? -9.421  29.466 33.122 1.00 45.97  ? 347  HOH A O   1 
HETATM 3215 O O   . HOH D 3 .   ? 5.028   27.204 32.535 1.00 57.60  ? 348  HOH A O   1 
HETATM 3216 O O   . HOH D 3 .   ? 2.065   30.546 38.728 1.00 53.21  ? 349  HOH A O   1 
HETATM 3217 O O   . HOH D 3 .   ? -3.479  48.910 18.793 1.00 89.18  ? 350  HOH A O   1 
HETATM 3218 O O   . HOH D 3 .   ? 22.540  33.703 24.693 1.00 71.89  ? 351  HOH A O   1 
HETATM 3219 O O   . HOH D 3 .   ? 9.986   54.693 33.914 1.00 47.02  ? 352  HOH A O   1 
HETATM 3220 O O   . HOH D 3 .   ? 14.977  57.133 19.820 1.00 40.29  ? 353  HOH A O   1 
HETATM 3221 O O   . HOH D 3 .   ? 18.015  34.644 11.679 1.00 74.41  ? 354  HOH A O   1 
HETATM 3222 O O   . HOH D 3 .   ? 19.408  36.751 9.770  1.00 90.38  ? 355  HOH A O   1 
HETATM 3223 O O   . HOH D 3 .   ? -2.221  26.937 23.796 1.00 57.46  ? 356  HOH A O   1 
HETATM 3224 O O   . HOH D 3 .   ? -10.894 34.723 27.255 1.00 48.89  ? 357  HOH A O   1 
HETATM 3225 O O   . HOH D 3 .   ? -8.019  48.045 35.096 1.00 57.51  ? 358  HOH A O   1 
HETATM 3226 O O   . HOH D 3 .   ? 2.536   18.649 38.672 1.00 47.63  ? 359  HOH A O   1 
HETATM 3227 O O   . HOH D 3 .   ? 1.671   54.503 28.994 1.00 66.68  ? 360  HOH A O   1 
HETATM 3228 O O   . HOH D 3 .   ? 0.044   20.298 39.462 1.00 71.13  ? 361  HOH A O   1 
HETATM 3229 O O   . HOH D 3 .   ? -5.085  45.730 21.802 1.00 73.00  ? 362  HOH A O   1 
HETATM 3230 O O   . HOH D 3 .   ? -4.827  48.091 23.239 1.00 54.64  ? 363  HOH A O   1 
HETATM 3231 O O   . HOH D 3 .   ? 25.113  31.309 20.216 1.00 72.00  ? 364  HOH A O   1 
HETATM 3232 O O   . HOH D 3 .   ? 21.498  32.466 30.260 1.00 79.32  ? 365  HOH A O   1 
HETATM 3233 O O   . HOH D 3 .   ? 10.278  53.008 21.791 1.00 69.31  ? 366  HOH A O   1 
HETATM 3234 O O   . HOH D 3 .   ? 11.273  57.684 24.654 1.00 53.72  ? 367  HOH A O   1 
HETATM 3235 O O   . HOH D 3 .   ? 11.062  46.982 37.067 1.00 60.01  ? 368  HOH A O   1 
HETATM 3236 O O   . HOH D 3 .   ? 15.483  49.912 40.815 1.00 66.39  ? 369  HOH A O   1 
HETATM 3237 O O   . HOH D 3 .   ? -1.076  38.346 45.800 1.00 57.47  ? 370  HOH A O   1 
HETATM 3238 O O   . HOH D 3 .   ? -2.950  41.261 44.645 1.00 48.56  ? 371  HOH A O   1 
HETATM 3239 O O   . HOH D 3 .   ? 20.468  55.411 33.349 1.00 52.35  ? 372  HOH A O   1 
HETATM 3240 O O   . HOH D 3 .   ? -9.377  35.620 24.824 1.00 66.68  ? 374  HOH A O   1 
HETATM 3241 O O   . HOH D 3 .   ? 15.438  54.720 20.858 1.00 63.11  ? 375  HOH A O   1 
HETATM 3242 O O   . HOH D 3 .   ? 3.781   42.623 42.187 1.00 61.53  ? 376  HOH A O   1 
HETATM 3243 O O   . HOH D 3 .   ? 12.084  53.756 17.938 1.00 82.96  ? 377  HOH A O   1 
HETATM 3244 O O   . HOH D 3 .   ? 23.564  33.732 29.251 1.00 63.55  ? 378  HOH A O   1 
HETATM 3245 O O   . HOH E 3 .   ? 10.557  1.960  22.250 1.00 29.37  ? 192  HOH B O   1 
HETATM 3246 O O   . HOH E 3 .   ? 6.620   4.369  20.810 1.00 36.34  ? 193  HOH B O   1 
HETATM 3247 O O   . HOH E 3 .   ? 25.091  3.751  12.163 1.00 58.51  ? 194  HOH B O   1 
HETATM 3248 O O   . HOH E 3 .   ? 19.523  9.177  24.648 1.00 39.91  ? 195  HOH B O   1 
HETATM 3249 O O   . HOH E 3 .   ? 17.454  24.842 20.909 1.00 41.98  ? 196  HOH B O   1 
HETATM 3250 O O   . HOH E 3 .   ? 23.869  12.282 23.201 1.00 38.11  ? 197  HOH B O   1 
HETATM 3251 O O   . HOH E 3 .   ? 1.565   4.998  8.374  1.00 62.81  ? 198  HOH B O   1 
HETATM 3252 O O   . HOH E 3 .   ? 15.075  23.854 22.198 1.00 36.31  ? 199  HOH B O   1 
HETATM 3253 O O   . HOH E 3 .   ? 12.401  13.976 23.813 1.00 39.22  ? 200  HOH B O   1 
HETATM 3254 O O   . HOH E 3 .   ? 15.863  25.763 5.825  1.00 72.91  ? 201  HOH B O   1 
HETATM 3255 O O   . HOH E 3 .   ? 8.733   18.811 15.992 1.00 38.36  ? 202  HOH B O   1 
HETATM 3256 O O   . HOH E 3 .   ? 15.669  5.398  10.253 1.00 38.55  ? 203  HOH B O   1 
HETATM 3257 O O   . HOH E 3 .   ? 0.993   22.498 18.337 1.00 105.54 ? 204  HOH B O   1 
HETATM 3258 O O   . HOH E 3 .   ? 1.440   19.941 19.828 1.00 80.00  ? 205  HOH B O   1 
HETATM 3259 O O   . HOH E 3 .   ? 2.316   15.659 16.897 1.00 78.98  ? 206  HOH B O   1 
HETATM 3260 O O   . HOH E 3 .   ? 7.309   22.940 22.314 1.00 40.91  ? 208  HOH B O   1 
HETATM 3261 O O   . HOH E 3 .   ? 23.349  25.611 15.934 1.00 44.01  ? 209  HOH B O   1 
HETATM 3262 O O   . HOH E 3 .   ? 12.886  7.512  21.435 1.00 33.94  ? 210  HOH B O   1 
HETATM 3263 O O   . HOH E 3 .   ? 14.016  -3.590 26.370 1.00 35.67  ? 211  HOH B O   1 
HETATM 3264 O O   . HOH E 3 .   ? 23.452  -3.532 28.780 1.00 33.61  ? 212  HOH B O   1 
HETATM 3265 O O   . HOH E 3 .   ? 20.890  18.514 -9.071 1.00 62.41  ? 213  HOH B O   1 
HETATM 3266 O O   . HOH E 3 .   ? 10.500  10.762 23.640 1.00 43.91  ? 214  HOH B O   1 
HETATM 3267 O O   . HOH E 3 .   ? 10.716  20.423 17.146 1.00 34.56  ? 215  HOH B O   1 
HETATM 3268 O O   . HOH E 3 .   ? -0.785  6.189  14.779 1.00 56.84  ? 216  HOH B O   1 
HETATM 3269 O O   . HOH E 3 .   ? 17.047  22.907 11.549 1.00 44.37  ? 217  HOH B O   1 
HETATM 3270 O O   . HOH E 3 .   ? 12.422  18.084 39.706 1.00 55.04  ? 218  HOH B O   1 
HETATM 3271 O O   . HOH E 3 .   ? 10.627  18.520 38.341 1.00 55.08  ? 219  HOH B O   1 
HETATM 3272 O O   . HOH E 3 .   ? 5.540   13.615 34.713 1.00 70.40  ? 220  HOH B O   1 
HETATM 3273 O O   . HOH E 3 .   ? 12.961  11.351 30.027 1.00 48.92  ? 221  HOH B O   1 
HETATM 3274 O O   . HOH E 3 .   ? 6.793   1.847  17.388 1.00 55.38  ? 222  HOH B O   1 
HETATM 3275 O O   . HOH E 3 .   ? 3.945   0.550  20.578 1.00 67.77  ? 223  HOH B O   1 
HETATM 3276 O O   . HOH E 3 .   ? 16.853  5.435  23.016 1.00 33.72  ? 224  HOH B O   1 
HETATM 3277 O O   . HOH E 3 .   ? 22.392  11.254 37.826 1.00 47.32  ? 225  HOH B O   1 
HETATM 3278 O O   . HOH E 3 .   ? 16.220  9.334  24.630 1.00 39.09  ? 226  HOH B O   1 
HETATM 3279 O O   . HOH E 3 .   ? 21.780  14.944 40.321 1.00 36.52  ? 227  HOH B O   1 
HETATM 3280 O O   . HOH E 3 .   ? 7.711   -2.161 30.149 1.00 48.09  ? 228  HOH B O   1 
HETATM 3281 O O   . HOH E 3 .   ? 24.872  13.274 34.327 1.00 36.67  ? 229  HOH B O   1 
HETATM 3282 O O   . HOH E 3 .   ? 17.857  7.189  5.592  1.00 47.22  ? 230  HOH B O   1 
HETATM 3283 O O   . HOH E 3 .   ? 28.477  0.565  25.434 1.00 60.19  ? 231  HOH B O   1 
HETATM 3284 O O   . HOH E 3 .   ? 2.991   -1.046 28.007 1.00 79.48  ? 232  HOH B O   1 
HETATM 3285 O O   . HOH E 3 .   ? 18.572  2.315  36.088 1.00 66.39  ? 233  HOH B O   1 
HETATM 3286 O O   . HOH E 3 .   ? 16.536  11.743 -0.785 1.00 47.59  ? 234  HOH B O   1 
HETATM 3287 O O   . HOH E 3 .   ? 24.492  19.673 24.201 1.00 40.30  ? 235  HOH B O   1 
HETATM 3288 O O   . HOH E 3 .   ? 21.313  -4.490 21.656 1.00 47.31  ? 236  HOH B O   1 
HETATM 3289 O O   . HOH E 3 .   ? 11.671  -3.504 32.422 1.00 37.77  ? 237  HOH B O   1 
HETATM 3290 O O   . HOH E 3 .   ? 16.558  2.489  39.587 1.00 96.59  ? 238  HOH B O   1 
HETATM 3291 O O   . HOH E 3 .   ? 19.120  6.697  8.060  1.00 53.34  ? 239  HOH B O   1 
HETATM 3292 O O   . HOH E 3 .   ? 19.295  6.887  23.050 1.00 35.46  ? 240  HOH B O   1 
HETATM 3293 O O   . HOH E 3 .   ? 13.515  16.298 28.266 1.00 41.32  ? 241  HOH B O   1 
HETATM 3294 O O   . HOH E 3 .   ? 17.319  8.149  41.091 1.00 39.25  ? 242  HOH B O   1 
HETATM 3295 O O   . HOH E 3 .   ? 4.372   -2.085 13.400 1.00 74.02  ? 243  HOH B O   1 
HETATM 3296 O O   . HOH E 3 .   ? -9.467  1.634  27.880 1.00 70.40  ? 244  HOH B O   1 
HETATM 3297 O O   . HOH E 3 .   ? 29.048  11.118 12.254 1.00 79.34  ? 245  HOH B O   1 
HETATM 3298 O O   . HOH E 3 .   ? 28.617  13.213 10.041 1.00 66.02  ? 246  HOH B O   1 
HETATM 3299 O O   . HOH E 3 .   ? 24.426  8.507  31.892 1.00 54.53  ? 247  HOH B O   1 
HETATM 3300 O O   . HOH E 3 .   ? 15.370  11.013 29.007 1.00 46.38  ? 248  HOH B O   1 
HETATM 3301 O O   . HOH E 3 .   ? 23.055  20.302 27.196 1.00 49.73  ? 249  HOH B O   1 
HETATM 3302 O O   . HOH E 3 .   ? 15.288  7.703  22.268 1.00 32.00  ? 250  HOH B O   1 
HETATM 3303 O O   . HOH E 3 .   ? 21.510  -1.461 32.746 1.00 43.21  ? 251  HOH B O   1 
HETATM 3304 O O   . HOH E 3 .   ? 22.414  0.889  33.516 1.00 51.54  ? 252  HOH B O   1 
HETATM 3305 O O   . HOH E 3 .   ? 25.886  -9.812 20.973 1.00 64.08  ? 253  HOH B O   1 
HETATM 3306 O O   . HOH E 3 .   ? 13.667  6.948  38.880 1.00 52.41  ? 254  HOH B O   1 
HETATM 3307 O O   . HOH E 3 .   ? 10.341  18.512 41.569 1.00 67.46  ? 255  HOH B O   1 
HETATM 3308 O O   . HOH E 3 .   ? 10.077  -3.081 34.466 1.00 58.54  ? 256  HOH B O   1 
HETATM 3309 O O   . HOH E 3 .   ? 6.657   5.161  35.245 1.00 58.04  ? 257  HOH B O   1 
HETATM 3310 O O   . HOH E 3 .   ? 5.557   3.570  33.326 1.00 50.16  ? 258  HOH B O   1 
HETATM 3311 O O   . HOH E 3 .   ? 15.231  10.875 20.750 1.00 52.70  ? 259  HOH B O   1 
HETATM 3312 O O   . HOH E 3 .   ? 21.616  20.790 4.696  1.00 57.69  ? 260  HOH B O   1 
HETATM 3313 O O   . HOH E 3 .   ? 16.144  28.236 15.774 1.00 76.69  ? 261  HOH B O   1 
HETATM 3314 O O   . HOH E 3 .   ? 8.786   27.041 18.452 1.00 50.65  ? 262  HOH B O   1 
HETATM 3315 O O   . HOH E 3 .   ? 25.206  11.464 37.768 1.00 60.44  ? 263  HOH B O   1 
HETATM 3316 O O   . HOH E 3 .   ? 27.373  18.853 22.821 1.00 73.23  ? 264  HOH B O   1 
HETATM 3317 O O   . HOH E 3 .   ? 16.303  8.521  38.476 1.00 47.56  ? 265  HOH B O   1 
HETATM 3318 O O   . HOH E 3 .   ? 22.565  5.629  4.776  1.00 58.95  ? 266  HOH B O   1 
HETATM 3319 O O   . HOH E 3 .   ? 24.201  -6.439 28.806 1.00 39.46  ? 267  HOH B O   1 
HETATM 3320 O O   . HOH E 3 .   ? -3.592  5.510  19.160 1.00 81.58  ? 268  HOH B O   1 
HETATM 3321 O O   . HOH E 3 .   ? 17.342  9.370  21.163 1.00 36.53  ? 269  HOH B O   1 
HETATM 3322 O O   . HOH E 3 .   ? 28.142  6.929  30.677 1.00 52.92  ? 270  HOH B O   1 
HETATM 3323 O O   . HOH E 3 .   ? 6.676   2.337  29.462 1.00 36.49  ? 271  HOH B O   1 
HETATM 3324 O O   . HOH E 3 .   ? 26.741  21.213 19.719 1.00 49.77  ? 272  HOH B O   1 
HETATM 3325 O O   . HOH E 3 .   ? 21.031  9.183  38.400 1.00 37.79  ? 273  HOH B O   1 
HETATM 3326 O O   . HOH E 3 .   ? -0.400  19.185 21.770 1.00 57.19  ? 274  HOH B O   1 
HETATM 3327 O O   . HOH E 3 .   ? 7.413   -0.775 26.972 1.00 47.04  ? 275  HOH B O   1 
HETATM 3328 O O   . HOH E 3 .   ? 14.371  -3.247 33.119 1.00 56.53  ? 276  HOH B O   1 
HETATM 3329 O O   . HOH E 3 .   ? 25.704  6.393  11.053 1.00 48.44  ? 277  HOH B O   1 
HETATM 3330 O O   . HOH E 3 .   ? 8.819   24.104 20.550 1.00 63.84  ? 278  HOH B O   1 
HETATM 3331 O O   . HOH E 3 .   ? 26.691  3.949  14.670 1.00 57.32  ? 279  HOH B O   1 
HETATM 3332 O O   . HOH E 3 .   ? 26.622  6.856  35.031 1.00 45.87  ? 280  HOH B O   1 
HETATM 3333 O O   . HOH E 3 .   ? 22.872  -2.196 15.430 1.00 49.49  ? 281  HOH B O   1 
HETATM 3334 O O   . HOH E 3 .   ? 27.337  6.377  15.207 1.00 56.68  ? 282  HOH B O   1 
HETATM 3335 O O   . HOH E 3 .   ? 5.945   12.704 19.300 1.00 46.02  ? 283  HOH B O   1 
HETATM 3336 O O   . HOH E 3 .   ? 14.055  23.792 7.818  1.00 57.86  ? 284  HOH B O   1 
HETATM 3337 O O   . HOH E 3 .   ? 27.455  7.559  19.569 1.00 38.59  ? 285  HOH B O   1 
HETATM 3338 O O   . HOH E 3 .   ? 26.705  7.697  12.804 1.00 48.55  ? 286  HOH B O   1 
HETATM 3339 O O   . HOH E 3 .   ? 13.116  20.008 2.793  1.00 62.26  ? 287  HOH B O   1 
HETATM 3340 O O   . HOH E 3 .   ? 8.009   18.371 -1.975 1.00 71.25  ? 288  HOH B O   1 
HETATM 3341 O O   . HOH E 3 .   ? 10.783  8.188  43.070 1.00 74.16  ? 289  HOH B O   1 
HETATM 3342 O O   . HOH E 3 .   ? 6.376   1.640  20.348 1.00 45.16  ? 290  HOH B O   1 
HETATM 3343 O O   . HOH E 3 .   ? 14.593  9.298  3.104  1.00 87.11  ? 291  HOH B O   1 
HETATM 3344 O O   . HOH E 3 .   ? -3.749  14.978 34.242 1.00 62.78  ? 292  HOH B O   1 
HETATM 3345 O O   . HOH E 3 .   ? 26.359  12.341 22.631 1.00 66.40  ? 293  HOH B O   1 
HETATM 3346 O O   . HOH E 3 .   ? 2.928   5.414  6.350  1.00 54.84  ? 294  HOH B O   1 
HETATM 3347 O O   . HOH E 3 .   ? 28.746  7.179  17.307 1.00 58.57  ? 295  HOH B O   1 
HETATM 3348 O O   . HOH E 3 .   ? 28.743  1.640  21.713 1.00 86.76  ? 296  HOH B O   1 
HETATM 3349 O O   . HOH E 3 .   ? 13.436  14.211 29.198 1.00 51.21  ? 297  HOH B O   1 
HETATM 3350 O O   . HOH E 3 .   ? 22.067  25.377 -0.510 1.00 87.54  ? 298  HOH B O   1 
HETATM 3351 O O   . HOH E 3 .   ? 25.671  27.616 2.371  1.00 92.32  ? 299  HOH B O   1 
HETATM 3352 O O   . HOH E 3 .   ? 28.328  12.833 18.525 1.00 69.62  ? 300  HOH B O   1 
HETATM 3353 O O   . HOH E 3 .   ? 28.687  4.140  34.614 1.00 59.02  ? 301  HOH B O   1 
HETATM 3354 O O   . HOH E 3 .   ? 23.730  3.507  8.638  1.00 75.21  ? 302  HOH B O   1 
HETATM 3355 O O   . HOH E 3 .   ? 3.676   17.993 6.711  1.00 86.52  ? 303  HOH B O   1 
HETATM 3356 O O   . HOH E 3 .   ? 1.656   25.105 5.936  1.00 75.29  ? 304  HOH B O   1 
HETATM 3357 O O   . HOH E 3 .   ? 0.247   25.246 9.227  1.00 83.20  ? 305  HOH B O   1 
HETATM 3358 O O   . HOH E 3 .   ? 15.265  14.650 20.632 1.00 69.31  ? 306  HOH B O   1 
HETATM 3359 O O   . HOH E 3 .   ? 9.586   22.921 17.482 1.00 50.69  ? 307  HOH B O   1 
HETATM 3360 O O   . HOH E 3 .   ? 19.549  24.706 22.783 1.00 61.22  ? 308  HOH B O   1 
HETATM 3361 O O   . HOH E 3 .   ? -6.371  7.957  21.908 1.00 77.96  ? 309  HOH B O   1 
HETATM 3362 O O   . HOH E 3 .   ? 0.734   27.649 6.888  1.00 98.80  ? 310  HOH B O   1 
HETATM 3363 O O   . HOH E 3 .   ? 3.379   27.465 7.490  1.00 82.93  ? 311  HOH B O   1 
HETATM 3364 O O   . HOH E 3 .   ? 3.511   21.466 21.612 1.00 50.08  ? 312  HOH B O   1 
HETATM 3365 O O   . HOH E 3 .   ? 6.099   17.713 13.798 1.00 45.92  ? 313  HOH B O   1 
HETATM 3366 O O   . HOH E 3 .   ? 6.411   19.313 15.958 1.00 77.51  ? 314  HOH B O   1 
HETATM 3367 O O   . HOH E 3 .   ? 12.512  23.868 11.741 1.00 68.53  ? 315  HOH B O   1 
HETATM 3368 O O   . HOH E 3 .   ? -10.107 6.481  19.558 1.00 75.78  ? 316  HOH B O   1 
HETATM 3369 O O   . HOH E 3 .   ? 4.481   16.089 11.271 1.00 85.80  ? 317  HOH B O   1 
HETATM 3370 O O   . HOH E 3 .   ? 15.412  6.603  5.880  1.00 57.40  ? 318  HOH B O   1 
HETATM 3371 O O   . HOH E 3 .   ? 5.628   25.090 15.567 1.00 76.43  ? 319  HOH B O   1 
HETATM 3372 O O   . HOH E 3 .   ? 15.027  -6.208 26.637 1.00 51.68  ? 320  HOH B O   1 
HETATM 3373 O O   . HOH E 3 .   ? -4.503  18.234 33.933 1.00 57.07  ? 321  HOH B O   1 
HETATM 3374 O O   . HOH E 3 .   ? 11.707  17.472 45.674 1.00 76.73  ? 322  HOH B O   1 
HETATM 3375 O O   . HOH E 3 .   ? 16.255  22.313 40.078 1.00 58.09  ? 323  HOH B O   1 
HETATM 3376 O O   . HOH E 3 .   ? 6.429   -0.039 6.339  1.00 82.52  ? 324  HOH B O   1 
HETATM 3377 O O   . HOH E 3 .   ? 0.684   13.190 15.609 1.00 62.11  ? 325  HOH B O   1 
HETATM 3378 O O   . HOH E 3 .   ? 26.346  12.255 5.093  1.00 55.39  ? 326  HOH B O   1 
HETATM 3379 O O   . HOH E 3 .   ? 23.638  23.996 5.195  1.00 60.00  ? 327  HOH B O   1 
HETATM 3380 O O   . HOH E 3 .   ? 4.948   18.101 9.581  1.00 85.29  ? 328  HOH B O   1 
HETATM 3381 O O   . HOH E 3 .   ? 24.813  16.145 33.725 1.00 64.24  ? 329  HOH B O   1 
HETATM 3382 O O   . HOH E 3 .   ? 29.319  8.366  21.107 1.00 64.49  ? 330  HOH B O   1 
HETATM 3383 O O   . HOH E 3 .   ? 26.174  16.225 27.507 1.00 70.16  ? 331  HOH B O   1 
HETATM 3384 O O   . HOH E 3 .   ? 19.119  19.079 29.940 1.00 34.12  ? 332  HOH B O   1 
HETATM 3385 O O   . HOH E 3 .   ? 4.796   7.594  36.250 1.00 77.15  ? 333  HOH B O   1 
HETATM 3386 O O   . HOH E 3 .   ? 6.888   -2.792 25.303 1.00 40.52  ? 334  HOH B O   1 
HETATM 3387 O O   . HOH E 3 .   ? 5.556   -4.390 27.227 1.00 45.63  ? 335  HOH B O   1 
HETATM 3388 O O   . HOH E 3 .   ? 1.424   20.915 22.899 1.00 48.56  ? 336  HOH B O   1 
HETATM 3389 O O   . HOH E 3 .   ? 11.862  22.403 3.425  1.00 66.82  ? 337  HOH B O   1 
HETATM 3390 O O   . HOH E 3 .   ? 1.387   0.240  10.288 1.00 65.36  ? 338  HOH B O   1 
HETATM 3391 O O   . HOH E 3 .   ? 3.302   7.479  39.640 1.00 85.74  ? 339  HOH B O   1 
HETATM 3392 O O   . HOH E 3 .   ? 3.080   4.952  37.598 1.00 116.06 ? 340  HOH B O   1 
HETATM 3393 O O   . HOH E 3 .   ? 25.605  23.639 10.600 1.00 69.86  ? 341  HOH B O   1 
HETATM 3394 O O   . HOH E 3 .   ? 6.544   25.777 19.668 1.00 76.40  ? 342  HOH B O   1 
HETATM 3395 O O   . HOH E 3 .   ? -2.158  4.933  20.922 1.00 61.56  ? 343  HOH B O   1 
HETATM 3396 O O   . HOH E 3 .   ? 0.856   8.750  16.384 1.00 67.61  ? 344  HOH B O   1 
HETATM 3397 O O   . HOH E 3 .   ? 21.120  3.426  36.377 1.00 65.87  ? 345  HOH B O   1 
HETATM 3398 O O   . HOH E 3 .   ? 8.166   16.691 40.437 1.00 60.11  ? 346  HOH B O   1 
HETATM 3399 O O   . HOH E 3 .   ? 17.484  -3.295 18.628 1.00 37.13  ? 347  HOH B O   1 
HETATM 3400 O O   . HOH E 3 .   ? 14.877  -2.018 14.242 1.00 71.39  ? 348  HOH B O   1 
HETATM 3401 O O   . HOH E 3 .   ? 1.721   2.902  26.549 1.00 57.70  ? 349  HOH B O   1 
HETATM 3402 O O   . HOH E 3 .   ? 13.390  18.353 43.174 1.00 55.89  ? 350  HOH B O   1 
HETATM 3403 O O   . HOH E 3 .   ? 4.314   9.407  5.116  1.00 71.97  ? 351  HOH B O   1 
HETATM 3404 O O   . HOH E 3 .   ? 8.223   5.669  1.773  1.00 61.38  ? 352  HOH B O   1 
HETATM 3405 O O   . HOH E 3 .   ? 10.138  5.303  4.974  1.00 60.96  ? 353  HOH B O   1 
HETATM 3406 O O   . HOH E 3 .   ? 4.553   0.639  4.297  1.00 75.62  ? 354  HOH B O   1 
HETATM 3407 O O   . HOH E 3 .   ? 4.139   1.471  13.613 1.00 55.52  ? 355  HOH B O   1 
HETATM 3408 O O   . HOH E 3 .   ? 29.276  11.244 25.190 1.00 82.05  ? 356  HOH B O   1 
HETATM 3409 O O   . HOH E 3 .   ? 21.867  19.316 29.521 1.00 76.34  ? 357  HOH B O   1 
HETATM 3410 O O   . HOH E 3 .   ? 22.624  18.437 32.308 1.00 48.30  ? 358  HOH B O   1 
HETATM 3411 O O   . HOH E 3 .   ? 28.139  14.668 29.971 1.00 68.63  ? 359  HOH B O   1 
HETATM 3412 O O   . HOH E 3 .   ? 26.586  15.935 31.848 1.00 71.14  ? 360  HOH B O   1 
HETATM 3413 O O   . HOH E 3 .   ? 28.313  13.766 24.857 1.00 71.53  ? 361  HOH B O   1 
HETATM 3414 O O   . HOH E 3 .   ? 15.967  -4.662 31.615 1.00 35.84  ? 362  HOH B O   1 
HETATM 3415 O O   . HOH E 3 .   ? 24.033  -6.858 31.216 1.00 70.97  ? 363  HOH B O   1 
HETATM 3416 O O   . HOH E 3 .   ? 20.635  5.627  40.481 1.00 50.09  ? 364  HOH B O   1 
HETATM 3417 O O   . HOH E 3 .   ? 24.080  7.295  40.409 1.00 61.78  ? 365  HOH B O   1 
HETATM 3418 O O   . HOH E 3 .   ? 18.631  21.252 39.469 1.00 58.94  ? 366  HOH B O   1 
HETATM 3419 O O   . HOH E 3 .   ? 7.900   -1.916 33.031 1.00 65.52  ? 367  HOH B O   1 
HETATM 3420 O O   . HOH E 3 .   ? 5.759   -0.341 29.376 1.00 59.00  ? 368  HOH B O   1 
HETATM 3421 O O   . HOH E 3 .   ? 4.764   12.575 40.809 1.00 75.99  ? 369  HOH B O   1 
HETATM 3422 O O   . HOH E 3 .   ? 1.059   1.056  24.666 1.00 62.94  ? 370  HOH B O   1 
HETATM 3423 O O   . HOH E 3 .   ? 18.607  21.654 -1.258 1.00 82.94  ? 371  HOH B O   1 
HETATM 3424 O O   . HOH E 3 .   ? 19.333  15.133 -6.451 1.00 98.03  ? 372  HOH B O   1 
HETATM 3425 O O   . HOH E 3 .   ? 20.457  6.768  3.698  1.00 70.39  ? 373  HOH B O   1 
HETATM 3426 O O   . HOH E 3 .   ? 4.661   0.738  27.349 1.00 51.74  ? 374  HOH B O   1 
HETATM 3427 O O   . HOH E 3 .   ? 4.473   -2.172 24.081 1.00 59.70  ? 375  HOH B O   1 
HETATM 3428 O O   . HOH E 3 .   ? 21.667  26.131 13.970 1.00 53.22  ? 376  HOH B O   1 
HETATM 3429 O O   . HOH E 3 .   ? 8.963   -3.388 23.742 1.00 65.64  ? 377  HOH B O   1 
HETATM 3430 O O   . HOH E 3 .   ? 9.535   -2.149 21.259 1.00 66.97  ? 378  HOH B O   1 
HETATM 3431 O O   . HOH E 3 .   ? 14.249  23.666 4.273  1.00 71.46  ? 379  HOH B O   1 
HETATM 3432 O O   . HOH E 3 .   ? 22.010  4.767  2.652  1.00 90.20  ? 380  HOH B O   1 
HETATM 3433 O O   . HOH E 3 .   ? 22.810  -3.643 31.727 1.00 54.89  ? 381  HOH B O   1 
HETATM 3434 O O   . HOH E 3 .   ? 13.762  10.989 22.919 1.00 41.56  ? 382  HOH B O   1 
HETATM 3435 O O   . HOH E 3 .   ? 25.470  11.157 32.253 1.00 48.41  ? 383  HOH B O   1 
HETATM 3436 O O   . HOH E 3 .   ? 16.675  8.515  0.387  1.00 99.07  ? 384  HOH B O   1 
HETATM 3437 O O   . HOH E 3 .   ? 19.551  9.948  0.050  1.00 86.99  ? 385  HOH B O   1 
HETATM 3438 O O   . HOH E 3 .   ? 24.722  6.176  5.050  1.00 71.82  ? 386  HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   -19 ?   ?   ?   A . n 
A 1 2   GLY 2   -18 ?   ?   ?   A . n 
A 1 3   SER 3   -17 ?   ?   ?   A . n 
A 1 4   SER 4   -16 ?   ?   ?   A . n 
A 1 5   HIS 5   -15 ?   ?   ?   A . n 
A 1 6   HIS 6   -14 ?   ?   ?   A . n 
A 1 7   HIS 7   -13 ?   ?   ?   A . n 
A 1 8   HIS 8   -12 ?   ?   ?   A . n 
A 1 9   HIS 9   -11 ?   ?   ?   A . n 
A 1 10  HIS 10  -10 ?   ?   ?   A . n 
A 1 11  SER 11  -9  ?   ?   ?   A . n 
A 1 12  SER 12  -8  ?   ?   ?   A . n 
A 1 13  GLY 13  -7  ?   ?   ?   A . n 
A 1 14  LEU 14  -6  ?   ?   ?   A . n 
A 1 15  VAL 15  -5  ?   ?   ?   A . n 
A 1 16  PRO 16  -4  ?   ?   ?   A . n 
A 1 17  ARG 17  -3  ?   ?   ?   A . n 
A 1 18  GLY 18  -2  ?   ?   ?   A . n 
A 1 19  SER 19  -1  ?   ?   ?   A . n 
A 1 20  HIS 20  0   ?   ?   ?   A . n 
A 1 21  MET 21  1   1   MET MET A . n 
A 1 22  PRO 22  2   2   PRO PRO A . n 
A 1 23  SER 23  3   3   SER SER A . n 
A 1 24  GLU 24  4   4   GLU GLU A . n 
A 1 25  LEU 25  5   5   LEU LEU A . n 
A 1 26  THR 26  6   6   THR THR A . n 
A 1 27  PRO 27  7   7   PRO PRO A . n 
A 1 28  GLU 28  8   8   GLU GLU A . n 
A 1 29  GLU 29  9   9   GLU GLU A . n 
A 1 30  ARG 30  10  10  ARG ARG A . n 
A 1 31  SER 31  11  11  SER SER A . n 
A 1 32  GLU 32  12  12  GLU GLU A . n 
A 1 33  LEU 33  13  13  LEU LEU A . n 
A 1 34  LYS 34  14  14  LYS LYS A . n 
A 1 35  ASN 35  15  15  ASN ASN A . n 
A 1 36  SER 36  16  16  SER SER A . n 
A 1 37  ILE 37  17  17  ILE ILE A . n 
A 1 38  ALA 38  18  18  ALA ALA A . n 
A 1 39  GLU 39  19  19  GLU GLU A . n 
A 1 40  PHE 40  20  20  PHE PHE A . n 
A 1 41  HIS 41  21  21  HIS HIS A . n 
A 1 42  THR 42  22  22  THR THR A . n 
A 1 43  TYR 43  23  23  TYR TYR A . n 
A 1 44  GLN 44  24  24  GLN GLN A . n 
A 1 45  LEU 45  25  25  LEU LEU A . n 
A 1 46  ASP 46  26  26  ASP ASP A . n 
A 1 47  PRO 47  27  27  PRO PRO A . n 
A 1 48  GLY 48  28  28  GLY GLY A . n 
A 1 49  SER 49  29  29  SER SER A . n 
A 1 50  CYS 50  30  30  CYS CYS A . n 
A 1 51  SER 51  31  31  SER SER A . n 
A 1 52  SER 52  32  32  SER SER A . n 
A 1 53  LEU 53  33  33  LEU LEU A . n 
A 1 54  HIS 54  34  34  HIS HIS A . n 
A 1 55  ALA 55  35  35  ALA ALA A . n 
A 1 56  GLN 56  36  36  GLN GLN A . n 
A 1 57  ARG 57  37  37  ARG ARG A . n 
A 1 58  ILE 58  38  38  ILE ILE A . n 
A 1 59  HIS 59  39  39  HIS HIS A . n 
A 1 60  ALA 60  40  40  ALA ALA A . n 
A 1 61  PRO 61  41  41  PRO PRO A . n 
A 1 62  PRO 62  42  42  PRO PRO A . n 
A 1 63  GLU 63  43  43  GLU GLU A . n 
A 1 64  LEU 64  44  44  LEU LEU A . n 
A 1 65  VAL 65  45  45  VAL VAL A . n 
A 1 66  TRP 66  46  46  TRP TRP A . n 
A 1 67  SER 67  47  47  SER SER A . n 
A 1 68  ILE 68  48  48  ILE ILE A . n 
A 1 69  VAL 69  49  49  VAL VAL A . n 
A 1 70  ARG 70  50  50  ARG ARG A . n 
A 1 71  ARG 71  51  51  ARG ARG A . n 
A 1 72  PHE 72  52  52  PHE PHE A . n 
A 1 73  ASP 73  53  53  ASP ASP A . n 
A 1 74  LYS 74  54  54  LYS LYS A . n 
A 1 75  PRO 75  55  55  PRO PRO A . n 
A 1 76  GLN 76  56  56  GLN GLN A . n 
A 1 77  THR 77  57  57  THR THR A . n 
A 1 78  TYR 78  58  58  TYR TYR A . n 
A 1 79  LYS 79  59  59  LYS LYS A . n 
A 1 80  HIS 80  60  60  HIS HIS A . n 
A 1 81  PHE 81  61  61  PHE PHE A . n 
A 1 82  ILE 82  62  62  ILE ILE A . n 
A 1 83  LYS 83  63  63  LYS LYS A . n 
A 1 84  SER 84  64  64  SER SER A . n 
A 1 85  CYS 85  65  65  CYS CYS A . n 
A 1 86  SER 86  66  66  SER SER A . n 
A 1 87  VAL 87  67  67  VAL VAL A . n 
A 1 88  GLU 88  68  68  GLU GLU A . n 
A 1 89  GLN 89  69  69  GLN GLN A . n 
A 1 90  ASN 90  70  70  ASN ASN A . n 
A 1 91  PHE 91  71  71  PHE PHE A . n 
A 1 92  GLU 92  72  72  GLU GLU A . n 
A 1 93  MET 93  73  73  MET MET A . n 
A 1 94  ARG 94  74  74  ARG ARG A . n 
A 1 95  VAL 95  75  75  VAL VAL A . n 
A 1 96  GLY 96  76  76  GLY GLY A . n 
A 1 97  CYS 97  77  77  CYS CYS A . n 
A 1 98  THR 98  78  78  THR THR A . n 
A 1 99  ARG 99  79  79  ARG ARG A . n 
A 1 100 ASP 100 80  80  ASP ASP A . n 
A 1 101 VAL 101 81  81  VAL VAL A . n 
A 1 102 ILE 102 82  82  ILE ILE A . n 
A 1 103 VAL 103 83  83  VAL VAL A . n 
A 1 104 ILE 104 84  84  ILE ILE A . n 
A 1 105 SER 105 85  85  SER SER A . n 
A 1 106 GLY 106 86  86  GLY GLY A . n 
A 1 107 LEU 107 87  87  LEU LEU A . n 
A 1 108 PRO 108 88  88  PRO PRO A . n 
A 1 109 ALA 109 89  89  ALA ALA A . n 
A 1 110 ASN 110 90  90  ASN ASN A . n 
A 1 111 THR 111 91  91  THR THR A . n 
A 1 112 SER 112 92  92  SER SER A . n 
A 1 113 THR 113 93  93  THR THR A . n 
A 1 114 GLU 114 94  94  GLU GLU A . n 
A 1 115 ARG 115 95  95  ARG ARG A . n 
A 1 116 LEU 116 96  96  LEU LEU A . n 
A 1 117 ASP 117 97  97  ASP ASP A . n 
A 1 118 ILE 118 98  98  ILE ILE A . n 
A 1 119 LEU 119 99  99  LEU LEU A . n 
A 1 120 ASP 120 100 100 ASP ASP A . n 
A 1 121 ASP 121 101 101 ASP ASP A . n 
A 1 122 GLU 122 102 102 GLU GLU A . n 
A 1 123 ARG 123 103 103 ARG ARG A . n 
A 1 124 ARG 124 104 104 ARG ARG A . n 
A 1 125 VAL 125 105 105 VAL VAL A . n 
A 1 126 THR 126 106 106 THR THR A . n 
A 1 127 GLY 127 107 107 GLY GLY A . n 
A 1 128 PHE 128 108 108 PHE PHE A . n 
A 1 129 SER 129 109 109 SER SER A . n 
A 1 130 ILE 130 110 110 ILE ILE A . n 
A 1 131 ILE 131 111 111 ILE ILE A . n 
A 1 132 GLY 132 112 112 GLY GLY A . n 
A 1 133 GLY 133 113 113 GLY GLY A . n 
A 1 134 GLU 134 114 114 GLU GLU A . n 
A 1 135 HIS 135 115 115 HIS HIS A . n 
A 1 136 ARG 136 116 116 ARG ARG A . n 
A 1 137 LEU 137 117 117 LEU LEU A . n 
A 1 138 THR 138 118 118 THR THR A . n 
A 1 139 ASN 139 119 119 ASN ASN A . n 
A 1 140 TYR 140 120 120 TYR TYR A . n 
A 1 141 LYS 141 121 121 LYS LYS A . n 
A 1 142 SER 142 122 122 SER SER A . n 
A 1 143 VAL 143 123 123 VAL VAL A . n 
A 1 144 THR 144 124 124 THR THR A . n 
A 1 145 THR 145 125 125 THR THR A . n 
A 1 146 VAL 146 126 126 VAL VAL A . n 
A 1 147 HIS 147 127 127 HIS HIS A . n 
A 1 148 ARG 148 128 128 ARG ARG A . n 
A 1 149 PHE 149 129 129 PHE PHE A . n 
A 1 150 GLU 150 130 130 GLU GLU A . n 
A 1 151 LYS 151 131 131 LYS LYS A . n 
A 1 152 GLU 152 132 132 GLU GLU A . n 
A 1 153 ASN 153 133 133 ASN ASN A . n 
A 1 154 ARG 154 134 134 ARG ARG A . n 
A 1 155 ILE 155 135 135 ILE ILE A . n 
A 1 156 TRP 156 136 136 TRP TRP A . n 
A 1 157 THR 157 137 137 THR THR A . n 
A 1 158 VAL 158 138 138 VAL VAL A . n 
A 1 159 VAL 159 139 139 VAL VAL A . n 
A 1 160 LEU 160 140 140 LEU LEU A . n 
A 1 161 GLU 161 141 141 GLU GLU A . n 
A 1 162 SER 162 142 142 SER SER A . n 
A 1 163 TYR 163 143 143 TYR TYR A . n 
A 1 164 VAL 164 144 144 VAL VAL A . n 
A 1 165 VAL 165 145 145 VAL VAL A . n 
A 1 166 ASP 166 146 146 ASP ASP A . n 
A 1 167 MET 167 147 147 MET MET A . n 
A 1 168 PRO 168 148 148 PRO PRO A . n 
A 1 169 GLU 169 149 149 GLU GLU A . n 
A 1 170 GLY 170 150 150 GLY GLY A . n 
A 1 171 ASN 171 151 151 ASN ASN A . n 
A 1 172 SER 172 152 152 SER SER A . n 
A 1 173 GLU 173 153 153 GLU GLU A . n 
A 1 174 ASP 174 154 154 ASP ASP A . n 
A 1 175 ASP 175 155 155 ASP ASP A . n 
A 1 176 THR 176 156 156 THR THR A . n 
A 1 177 ARG 177 157 157 ARG ARG A . n 
A 1 178 MET 178 158 158 MET MET A . n 
A 1 179 PHE 179 159 159 PHE PHE A . n 
A 1 180 ALA 180 160 160 ALA ALA A . n 
A 1 181 ASP 181 161 161 ASP ASP A . n 
A 1 182 THR 182 162 162 THR THR A . n 
A 1 183 VAL 183 163 163 VAL VAL A . n 
A 1 184 VAL 184 164 164 VAL VAL A . n 
A 1 185 LYS 185 165 165 LYS LYS A . n 
A 1 186 LEU 186 166 166 LEU LEU A . n 
A 1 187 ASN 187 167 167 ASN ASN A . n 
A 1 188 LEU 188 168 168 LEU LEU A . n 
A 1 189 GLN 189 169 169 GLN GLN A . n 
A 1 190 LYS 190 170 170 LYS LYS A . n 
A 1 191 LEU 191 171 171 LEU LEU A . n 
A 1 192 ALA 192 172 172 ALA ALA A . n 
A 1 193 THR 193 173 173 THR THR A . n 
A 1 194 VAL 194 174 174 VAL VAL A . n 
A 1 195 ALA 195 175 175 ALA ALA A . n 
A 1 196 GLU 196 176 176 GLU GLU A . n 
A 1 197 ALA 197 177 177 ALA ALA A . n 
A 1 198 MET 198 178 178 MET MET A . n 
A 1 199 ALA 199 179 179 ALA ALA A . n 
A 1 200 ARG 200 180 180 ARG ARG A . n 
A 1 201 ASN 201 181 181 ASN ASN A . n 
A 1 202 SER 202 182 182 SER SER A . n 
A 1 203 GLY 203 183 183 GLY GLY A . n 
A 1 204 ASP 204 184 ?   ?   ?   A . n 
A 1 205 GLY 205 185 ?   ?   ?   A . n 
A 1 206 SER 206 186 ?   ?   ?   A . n 
A 1 207 GLY 207 187 ?   ?   ?   A . n 
A 1 208 SER 208 188 ?   ?   ?   A . n 
A 1 209 GLN 209 189 ?   ?   ?   A . n 
A 1 210 VAL 210 190 ?   ?   ?   A . n 
A 1 211 THR 211 191 ?   ?   ?   A . n 
B 1 1   MET 1   -19 ?   ?   ?   B . n 
B 1 2   GLY 2   -18 ?   ?   ?   B . n 
B 1 3   SER 3   -17 ?   ?   ?   B . n 
B 1 4   SER 4   -16 ?   ?   ?   B . n 
B 1 5   HIS 5   -15 ?   ?   ?   B . n 
B 1 6   HIS 6   -14 ?   ?   ?   B . n 
B 1 7   HIS 7   -13 ?   ?   ?   B . n 
B 1 8   HIS 8   -12 ?   ?   ?   B . n 
B 1 9   HIS 9   -11 ?   ?   ?   B . n 
B 1 10  HIS 10  -10 ?   ?   ?   B . n 
B 1 11  SER 11  -9  ?   ?   ?   B . n 
B 1 12  SER 12  -8  ?   ?   ?   B . n 
B 1 13  GLY 13  -7  ?   ?   ?   B . n 
B 1 14  LEU 14  -6  ?   ?   ?   B . n 
B 1 15  VAL 15  -5  ?   ?   ?   B . n 
B 1 16  PRO 16  -4  ?   ?   ?   B . n 
B 1 17  ARG 17  -3  ?   ?   ?   B . n 
B 1 18  GLY 18  -2  ?   ?   ?   B . n 
B 1 19  SER 19  -1  ?   ?   ?   B . n 
B 1 20  HIS 20  0   ?   ?   ?   B . n 
B 1 21  MET 21  1   ?   ?   ?   B . n 
B 1 22  PRO 22  2   2   PRO PRO B . n 
B 1 23  SER 23  3   3   SER SER B . n 
B 1 24  GLU 24  4   4   GLU GLU B . n 
B 1 25  LEU 25  5   5   LEU LEU B . n 
B 1 26  THR 26  6   6   THR THR B . n 
B 1 27  PRO 27  7   7   PRO PRO B . n 
B 1 28  GLU 28  8   8   GLU GLU B . n 
B 1 29  GLU 29  9   9   GLU GLU B . n 
B 1 30  ARG 30  10  10  ARG ARG B . n 
B 1 31  SER 31  11  11  SER SER B . n 
B 1 32  GLU 32  12  12  GLU GLU B . n 
B 1 33  LEU 33  13  13  LEU LEU B . n 
B 1 34  LYS 34  14  14  LYS LYS B . n 
B 1 35  ASN 35  15  15  ASN ASN B . n 
B 1 36  SER 36  16  16  SER SER B . n 
B 1 37  ILE 37  17  17  ILE ILE B . n 
B 1 38  ALA 38  18  18  ALA ALA B . n 
B 1 39  GLU 39  19  19  GLU GLU B . n 
B 1 40  PHE 40  20  20  PHE PHE B . n 
B 1 41  HIS 41  21  21  HIS HIS B . n 
B 1 42  THR 42  22  22  THR THR B . n 
B 1 43  TYR 43  23  23  TYR TYR B . n 
B 1 44  GLN 44  24  24  GLN GLN B . n 
B 1 45  LEU 45  25  25  LEU LEU B . n 
B 1 46  ASP 46  26  26  ASP ASP B . n 
B 1 47  PRO 47  27  27  PRO PRO B . n 
B 1 48  GLY 48  28  28  GLY GLY B . n 
B 1 49  SER 49  29  29  SER SER B . n 
B 1 50  CYS 50  30  30  CYS CYS B . n 
B 1 51  SER 51  31  31  SER SER B . n 
B 1 52  SER 52  32  32  SER SER B . n 
B 1 53  LEU 53  33  33  LEU LEU B . n 
B 1 54  HIS 54  34  34  HIS HIS B . n 
B 1 55  ALA 55  35  35  ALA ALA B . n 
B 1 56  GLN 56  36  36  GLN GLN B . n 
B 1 57  ARG 57  37  37  ARG ARG B . n 
B 1 58  ILE 58  38  38  ILE ILE B . n 
B 1 59  HIS 59  39  39  HIS HIS B . n 
B 1 60  ALA 60  40  40  ALA ALA B . n 
B 1 61  PRO 61  41  41  PRO PRO B . n 
B 1 62  PRO 62  42  42  PRO PRO B . n 
B 1 63  GLU 63  43  43  GLU GLU B . n 
B 1 64  LEU 64  44  44  LEU LEU B . n 
B 1 65  VAL 65  45  45  VAL VAL B . n 
B 1 66  TRP 66  46  46  TRP TRP B . n 
B 1 67  SER 67  47  47  SER SER B . n 
B 1 68  ILE 68  48  48  ILE ILE B . n 
B 1 69  VAL 69  49  49  VAL VAL B . n 
B 1 70  ARG 70  50  50  ARG ARG B . n 
B 1 71  ARG 71  51  51  ARG ARG B . n 
B 1 72  PHE 72  52  52  PHE PHE B . n 
B 1 73  ASP 73  53  53  ASP ASP B . n 
B 1 74  LYS 74  54  54  LYS LYS B . n 
B 1 75  PRO 75  55  55  PRO PRO B . n 
B 1 76  GLN 76  56  56  GLN GLN B . n 
B 1 77  THR 77  57  57  THR THR B . n 
B 1 78  TYR 78  58  58  TYR TYR B . n 
B 1 79  LYS 79  59  59  LYS LYS B . n 
B 1 80  HIS 80  60  60  HIS HIS B . n 
B 1 81  PHE 81  61  61  PHE PHE B . n 
B 1 82  ILE 82  62  62  ILE ILE B . n 
B 1 83  LYS 83  63  63  LYS LYS B . n 
B 1 84  SER 84  64  64  SER SER B . n 
B 1 85  CYS 85  65  65  CYS CYS B . n 
B 1 86  SER 86  66  66  SER SER B . n 
B 1 87  VAL 87  67  67  VAL VAL B . n 
B 1 88  GLU 88  68  68  GLU GLU B . n 
B 1 89  GLN 89  69  69  GLN GLN B . n 
B 1 90  ASN 90  70  70  ASN ASN B . n 
B 1 91  PHE 91  71  71  PHE PHE B . n 
B 1 92  GLU 92  72  72  GLU GLU B . n 
B 1 93  MET 93  73  73  MET MET B . n 
B 1 94  ARG 94  74  74  ARG ARG B . n 
B 1 95  VAL 95  75  75  VAL VAL B . n 
B 1 96  GLY 96  76  76  GLY GLY B . n 
B 1 97  CYS 97  77  77  CYS CYS B . n 
B 1 98  THR 98  78  78  THR THR B . n 
B 1 99  ARG 99  79  79  ARG ARG B . n 
B 1 100 ASP 100 80  80  ASP ASP B . n 
B 1 101 VAL 101 81  81  VAL VAL B . n 
B 1 102 ILE 102 82  82  ILE ILE B . n 
B 1 103 VAL 103 83  83  VAL VAL B . n 
B 1 104 ILE 104 84  84  ILE ILE B . n 
B 1 105 SER 105 85  85  SER SER B . n 
B 1 106 GLY 106 86  86  GLY GLY B . n 
B 1 107 LEU 107 87  87  LEU LEU B . n 
B 1 108 PRO 108 88  88  PRO PRO B . n 
B 1 109 ALA 109 89  89  ALA ALA B . n 
B 1 110 ASN 110 90  90  ASN ASN B . n 
B 1 111 THR 111 91  91  THR THR B . n 
B 1 112 SER 112 92  92  SER SER B . n 
B 1 113 THR 113 93  93  THR THR B . n 
B 1 114 GLU 114 94  94  GLU GLU B . n 
B 1 115 ARG 115 95  95  ARG ARG B . n 
B 1 116 LEU 116 96  96  LEU LEU B . n 
B 1 117 ASP 117 97  97  ASP ASP B . n 
B 1 118 ILE 118 98  98  ILE ILE B . n 
B 1 119 LEU 119 99  99  LEU LEU B . n 
B 1 120 ASP 120 100 100 ASP ASP B . n 
B 1 121 ASP 121 101 101 ASP ASP B . n 
B 1 122 GLU 122 102 102 GLU GLU B . n 
B 1 123 ARG 123 103 103 ARG ARG B . n 
B 1 124 ARG 124 104 104 ARG ARG B . n 
B 1 125 VAL 125 105 105 VAL VAL B . n 
B 1 126 THR 126 106 106 THR THR B . n 
B 1 127 GLY 127 107 107 GLY GLY B . n 
B 1 128 PHE 128 108 108 PHE PHE B . n 
B 1 129 SER 129 109 109 SER SER B . n 
B 1 130 ILE 130 110 110 ILE ILE B . n 
B 1 131 ILE 131 111 111 ILE ILE B . n 
B 1 132 GLY 132 112 112 GLY GLY B . n 
B 1 133 GLY 133 113 113 GLY GLY B . n 
B 1 134 GLU 134 114 114 GLU GLU B . n 
B 1 135 HIS 135 115 115 HIS HIS B . n 
B 1 136 ARG 136 116 116 ARG ARG B . n 
B 1 137 LEU 137 117 117 LEU LEU B . n 
B 1 138 THR 138 118 118 THR THR B . n 
B 1 139 ASN 139 119 119 ASN ASN B . n 
B 1 140 TYR 140 120 120 TYR TYR B . n 
B 1 141 LYS 141 121 121 LYS LYS B . n 
B 1 142 SER 142 122 122 SER SER B . n 
B 1 143 VAL 143 123 123 VAL VAL B . n 
B 1 144 THR 144 124 124 THR THR B . n 
B 1 145 THR 145 125 125 THR THR B . n 
B 1 146 VAL 146 126 126 VAL VAL B . n 
B 1 147 HIS 147 127 127 HIS HIS B . n 
B 1 148 ARG 148 128 128 ARG ARG B . n 
B 1 149 PHE 149 129 129 PHE PHE B . n 
B 1 150 GLU 150 130 130 GLU GLU B . n 
B 1 151 LYS 151 131 131 LYS LYS B . n 
B 1 152 GLU 152 132 132 GLU GLU B . n 
B 1 153 ASN 153 133 133 ASN ASN B . n 
B 1 154 ARG 154 134 134 ARG ARG B . n 
B 1 155 ILE 155 135 135 ILE ILE B . n 
B 1 156 TRP 156 136 136 TRP TRP B . n 
B 1 157 THR 157 137 137 THR THR B . n 
B 1 158 VAL 158 138 138 VAL VAL B . n 
B 1 159 VAL 159 139 139 VAL VAL B . n 
B 1 160 LEU 160 140 140 LEU LEU B . n 
B 1 161 GLU 161 141 141 GLU GLU B . n 
B 1 162 SER 162 142 142 SER SER B . n 
B 1 163 TYR 163 143 143 TYR TYR B . n 
B 1 164 VAL 164 144 144 VAL VAL B . n 
B 1 165 VAL 165 145 145 VAL VAL B . n 
B 1 166 ASP 166 146 146 ASP ASP B . n 
B 1 167 MET 167 147 147 MET MET B . n 
B 1 168 PRO 168 148 148 PRO PRO B . n 
B 1 169 GLU 169 149 149 GLU GLU B . n 
B 1 170 GLY 170 150 150 GLY GLY B . n 
B 1 171 ASN 171 151 151 ASN ASN B . n 
B 1 172 SER 172 152 152 SER SER B . n 
B 1 173 GLU 173 153 153 GLU GLU B . n 
B 1 174 ASP 174 154 154 ASP ASP B . n 
B 1 175 ASP 175 155 155 ASP ASP B . n 
B 1 176 THR 176 156 156 THR THR B . n 
B 1 177 ARG 177 157 157 ARG ARG B . n 
B 1 178 MET 178 158 158 MET MET B . n 
B 1 179 PHE 179 159 159 PHE PHE B . n 
B 1 180 ALA 180 160 160 ALA ALA B . n 
B 1 181 ASP 181 161 161 ASP ASP B . n 
B 1 182 THR 182 162 162 THR THR B . n 
B 1 183 VAL 183 163 163 VAL VAL B . n 
B 1 184 VAL 184 164 164 VAL VAL B . n 
B 1 185 LYS 185 165 165 LYS LYS B . n 
B 1 186 LEU 186 166 166 LEU LEU B . n 
B 1 187 ASN 187 167 167 ASN ASN B . n 
B 1 188 LEU 188 168 168 LEU LEU B . n 
B 1 189 GLN 189 169 169 GLN GLN B . n 
B 1 190 LYS 190 170 170 LYS LYS B . n 
B 1 191 LEU 191 171 171 LEU LEU B . n 
B 1 192 ALA 192 172 172 ALA ALA B . n 
B 1 193 THR 193 173 173 THR THR B . n 
B 1 194 VAL 194 174 174 VAL VAL B . n 
B 1 195 ALA 195 175 175 ALA ALA B . n 
B 1 196 GLU 196 176 176 GLU GLU B . n 
B 1 197 ALA 197 177 177 ALA ALA B . n 
B 1 198 MET 198 178 178 MET MET B . n 
B 1 199 ALA 199 179 179 ALA ALA B . n 
B 1 200 ARG 200 180 180 ARG ARG B . n 
B 1 201 ASN 201 181 181 ASN ASN B . n 
B 1 202 SER 202 182 182 SER SER B . n 
B 1 203 GLY 203 183 183 GLY GLY B . n 
B 1 204 ASP 204 184 184 ASP ASP B . n 
B 1 205 GLY 205 185 ?   ?   ?   B . n 
B 1 206 SER 206 186 ?   ?   ?   B . n 
B 1 207 GLY 207 187 ?   ?   ?   B . n 
B 1 208 SER 208 188 ?   ?   ?   B . n 
B 1 209 GLN 209 189 ?   ?   ?   B . n 
B 1 210 VAL 210 190 ?   ?   ?   B . n 
B 1 211 THR 211 191 ?   ?   ?   B . n 
# 
loop_
_pdbx_struct_assembly.id 
_pdbx_struct_assembly.details 
_pdbx_struct_assembly.method_details 
_pdbx_struct_assembly.oligomeric_details 
_pdbx_struct_assembly.oligomeric_count 
1 author_and_software_defined_assembly PISA dimeric    2 
2 software_defined_assembly            PISA tetrameric 4 
# 
loop_
_pdbx_struct_assembly_gen.assembly_id 
_pdbx_struct_assembly_gen.oper_expression 
_pdbx_struct_assembly_gen.asym_id_list 
1 1   A,B,C,D,E 
2 1,2 A,B,C,D,E 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 1520  ? 
1 MORE         -14.0 ? 
1 'SSA (A^2)'  19430 ? 
2 'ABSA (A^2)' 6320  ? 
2 MORE         -33.9 ? 
2 'SSA (A^2)'  35570 ? 
# 
loop_
_pdbx_struct_oper_list.id 
_pdbx_struct_oper_list.type 
_pdbx_struct_oper_list.name 
_pdbx_struct_oper_list.symmetry_operation 
_pdbx_struct_oper_list.matrix[1][1] 
_pdbx_struct_oper_list.matrix[1][2] 
_pdbx_struct_oper_list.matrix[1][3] 
_pdbx_struct_oper_list.vector[1] 
_pdbx_struct_oper_list.matrix[2][1] 
_pdbx_struct_oper_list.matrix[2][2] 
_pdbx_struct_oper_list.matrix[2][3] 
_pdbx_struct_oper_list.vector[2] 
_pdbx_struct_oper_list.matrix[3][1] 
_pdbx_struct_oper_list.matrix[3][2] 
_pdbx_struct_oper_list.matrix[3][3] 
_pdbx_struct_oper_list.vector[3] 
1 'identity operation'         1_555 x,y,z       1.0000000000  0.0000000000 0.0000000000 0.0000000000  0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000  0.0000000000  
2 'crystal symmetry operation' 2_656 -x+1,y,-z+1 -1.0000000000 0.0000000000 0.0000000000 37.2911879266 0.0000000000 1.0000000000 
0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 81.8308273321 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 A HOH 216 ? D HOH . 
2 1 A HOH 314 ? D HOH . 
3 1 A HOH 327 ? D HOH . 
4 1 A HOH 333 ? D HOH . 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2009-11-17 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Non-polymer description'   
2 2 'Structure model' 'Version format compliance' 
# 
loop_
_software.pdbx_ordinal 
_software.name 
_software.version 
_software.date 
_software.type 
_software.contact_author 
_software.contact_author_email 
_software.classification 
_software.location 
_software.language 
_software.citation_id 
1 REFMAC      5.2.0019 ?               program 'Garib N. Murshudov' garib@ysbl.york.ac.uk refinement        
http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 
2 PDB_EXTRACT 3.005    'June 11, 2008' package PDB                  help@deposit.rcsb.org 'data extraction' 
http://sw-tools.pdb.org/apps/PDB_EXTRACT/    C++        ? 
3 HKL-2000    .        ?               ?       ?                    ?                     'data collection' ? ?          ? 
4 HKL-2000    .        ?               ?       ?                    ?                     'data reduction'  ? ?          ? 
5 HKL-2000    .        ?               ?       ?                    ?                     'data scaling'    ? ?          ? 
6 PHASER      .        ?               ?       ?                    ?                     phasing           ? ?          ? 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1  1 ASN A 70  ? B -111.30 55.18   
2  1 PHE A 71  ? ? -22.23  112.99  
3  1 PHE A 71  ? ? -29.13  112.99  
4  1 GLU A 132 ? ? 49.66   -128.91 
5  1 SER A 152 ? ? -169.86 33.93   
6  1 GLU B 4   ? ? -172.25 140.66  
7  1 LEU B 25  ? ? -69.81  59.72   
8  1 ASN B 70  ? A 164.97  4.11    
9  1 ASN B 70  ? B 148.53  -24.31  
10 1 PHE B 71  ? B 27.56   121.42  
11 1 LEU B 117 ? ? -110.22 65.31   
12 1 GLU B 132 ? ? 64.05   -121.11 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A MET -19 ? A MET 1   
2  1 Y 1 A GLY -18 ? A GLY 2   
3  1 Y 1 A SER -17 ? A SER 3   
4  1 Y 1 A SER -16 ? A SER 4   
5  1 Y 1 A HIS -15 ? A HIS 5   
6  1 Y 1 A HIS -14 ? A HIS 6   
7  1 Y 1 A HIS -13 ? A HIS 7   
8  1 Y 1 A HIS -12 ? A HIS 8   
9  1 Y 1 A HIS -11 ? A HIS 9   
10 1 Y 1 A HIS -10 ? A HIS 10  
11 1 Y 1 A SER -9  ? A SER 11  
12 1 Y 1 A SER -8  ? A SER 12  
13 1 Y 1 A GLY -7  ? A GLY 13  
14 1 Y 1 A LEU -6  ? A LEU 14  
15 1 Y 1 A VAL -5  ? A VAL 15  
16 1 Y 1 A PRO -4  ? A PRO 16  
17 1 Y 1 A ARG -3  ? A ARG 17  
18 1 Y 1 A GLY -2  ? A GLY 18  
19 1 Y 1 A SER -1  ? A SER 19  
20 1 Y 1 A HIS 0   ? A HIS 20  
21 1 Y 1 A ASP 184 ? A ASP 204 
22 1 Y 1 A GLY 185 ? A GLY 205 
23 1 Y 1 A SER 186 ? A SER 206 
24 1 Y 1 A GLY 187 ? A GLY 207 
25 1 Y 1 A SER 188 ? A SER 208 
26 1 Y 1 A GLN 189 ? A GLN 209 
27 1 Y 1 A VAL 190 ? A VAL 210 
28 1 Y 1 A THR 191 ? A THR 211 
29 1 Y 1 B MET -19 ? B MET 1   
30 1 Y 1 B GLY -18 ? B GLY 2   
31 1 Y 1 B SER -17 ? B SER 3   
32 1 Y 1 B SER -16 ? B SER 4   
33 1 Y 1 B HIS -15 ? B HIS 5   
34 1 Y 1 B HIS -14 ? B HIS 6   
35 1 Y 1 B HIS -13 ? B HIS 7   
36 1 Y 1 B HIS -12 ? B HIS 8   
37 1 Y 1 B HIS -11 ? B HIS 9   
38 1 Y 1 B HIS -10 ? B HIS 10  
39 1 Y 1 B SER -9  ? B SER 11  
40 1 Y 1 B SER -8  ? B SER 12  
41 1 Y 1 B GLY -7  ? B GLY 13  
42 1 Y 1 B LEU -6  ? B LEU 14  
43 1 Y 1 B VAL -5  ? B VAL 15  
44 1 Y 1 B PRO -4  ? B PRO 16  
45 1 Y 1 B ARG -3  ? B ARG 17  
46 1 Y 1 B GLY -2  ? B GLY 18  
47 1 Y 1 B SER -1  ? B SER 19  
48 1 Y 1 B HIS 0   ? B HIS 20  
49 1 Y 1 B MET 1   ? B MET 21  
50 1 Y 1 B GLY 185 ? B GLY 205 
51 1 Y 1 B SER 186 ? B SER 206 
52 1 Y 1 B GLY 187 ? B GLY 207 
53 1 Y 1 B SER 188 ? B SER 208 
54 1 Y 1 B GLN 189 ? B GLN 209 
55 1 Y 1 B VAL 190 ? B VAL 210 
56 1 Y 1 B THR 191 ? B THR 211 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 '(2Z,4E)-5-[(1S)-1-hydroxy-2,6,6-trimethyl-4-oxocyclohex-2-en-1-yl]-3-methylpenta-2,4-dienoic acid' A8S 
3 water                                                                                               HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
C 2 A8S 1   1001 1001 A8S A8S B . 
D 3 HOH 1   192  192  HOH HOH A . 
D 3 HOH 2   193  193  HOH HOH A . 
D 3 HOH 3   194  2    HOH HOH A . 
D 3 HOH 4   195  195  HOH HOH A . 
D 3 HOH 5   196  196  HOH HOH A . 
D 3 HOH 6   197  197  HOH HOH A . 
D 3 HOH 7   198  198  HOH HOH A . 
D 3 HOH 8   199  199  HOH HOH A . 
D 3 HOH 9   200  200  HOH HOH A . 
D 3 HOH 10  201  3    HOH HOH A . 
D 3 HOH 11  202  202  HOH HOH A . 
D 3 HOH 12  203  203  HOH HOH A . 
D 3 HOH 13  204  4    HOH HOH A . 
D 3 HOH 14  205  6    HOH HOH A . 
D 3 HOH 15  206  9    HOH HOH A . 
D 3 HOH 16  207  10   HOH HOH A . 
D 3 HOH 17  208  208  HOH HOH A . 
D 3 HOH 18  209  209  HOH HOH A . 
D 3 HOH 19  210  210  HOH HOH A . 
D 3 HOH 20  211  211  HOH HOH A . 
D 3 HOH 21  212  212  HOH HOH A . 
D 3 HOH 22  213  213  HOH HOH A . 
D 3 HOH 23  214  214  HOH HOH A . 
D 3 HOH 24  215  215  HOH HOH A . 
D 3 HOH 25  216  11   HOH HOH A . 
D 3 HOH 26  217  12   HOH HOH A . 
D 3 HOH 27  218  14   HOH HOH A . 
D 3 HOH 28  219  17   HOH HOH A . 
D 3 HOH 29  220  19   HOH HOH A . 
D 3 HOH 30  221  22   HOH HOH A . 
D 3 HOH 31  222  24   HOH HOH A . 
D 3 HOH 32  223  25   HOH HOH A . 
D 3 HOH 33  224  224  HOH HOH A . 
D 3 HOH 34  225  225  HOH HOH A . 
D 3 HOH 35  226  226  HOH HOH A . 
D 3 HOH 36  227  227  HOH HOH A . 
D 3 HOH 37  228  27   HOH HOH A . 
D 3 HOH 38  229  229  HOH HOH A . 
D 3 HOH 39  230  230  HOH HOH A . 
D 3 HOH 40  231  29   HOH HOH A . 
D 3 HOH 41  232  207  HOH HOH A . 
D 3 HOH 42  233  31   HOH HOH A . 
D 3 HOH 43  234  32   HOH HOH A . 
D 3 HOH 44  235  235  HOH HOH A . 
D 3 HOH 45  236  236  HOH HOH A . 
D 3 HOH 46  237  237  HOH HOH A . 
D 3 HOH 47  238  238  HOH HOH A . 
D 3 HOH 48  239  239  HOH HOH A . 
D 3 HOH 49  240  240  HOH HOH A . 
D 3 HOH 50  241  241  HOH HOH A . 
D 3 HOH 51  242  242  HOH HOH A . 
D 3 HOH 52  243  35   HOH HOH A . 
D 3 HOH 53  244  39   HOH HOH A . 
D 3 HOH 54  245  41   HOH HOH A . 
D 3 HOH 55  246  44   HOH HOH A . 
D 3 HOH 56  247  45   HOH HOH A . 
D 3 HOH 57  248  46   HOH HOH A . 
D 3 HOH 58  249  49   HOH HOH A . 
D 3 HOH 59  250  250  HOH HOH A . 
D 3 HOH 60  251  53   HOH HOH A . 
D 3 HOH 61  252  54   HOH HOH A . 
D 3 HOH 62  253  56   HOH HOH A . 
D 3 HOH 63  254  59   HOH HOH A . 
D 3 HOH 64  255  62   HOH HOH A . 
D 3 HOH 65  256  65   HOH HOH A . 
D 3 HOH 66  257  69   HOH HOH A . 
D 3 HOH 67  258  70   HOH HOH A . 
D 3 HOH 68  259  74   HOH HOH A . 
D 3 HOH 69  260  260  HOH HOH A . 
D 3 HOH 70  261  77   HOH HOH A . 
D 3 HOH 71  262  78   HOH HOH A . 
D 3 HOH 72  263  80   HOH HOH A . 
D 3 HOH 73  264  81   HOH HOH A . 
D 3 HOH 74  265  82   HOH HOH A . 
D 3 HOH 75  266  266  HOH HOH A . 
D 3 HOH 76  267  267  HOH HOH A . 
D 3 HOH 77  268  84   HOH HOH A . 
D 3 HOH 78  269  269  HOH HOH A . 
D 3 HOH 79  270  270  HOH HOH A . 
D 3 HOH 80  271  271  HOH HOH A . 
D 3 HOH 81  272  272  HOH HOH A . 
D 3 HOH 82  273  273  HOH HOH A . 
D 3 HOH 83  274  274  HOH HOH A . 
D 3 HOH 84  275  275  HOH HOH A . 
D 3 HOH 85  276  276  HOH HOH A . 
D 3 HOH 86  277  277  HOH HOH A . 
D 3 HOH 87  278  278  HOH HOH A . 
D 3 HOH 88  279  279  HOH HOH A . 
D 3 HOH 89  280  280  HOH HOH A . 
D 3 HOH 90  281  281  HOH HOH A . 
D 3 HOH 91  282  282  HOH HOH A . 
D 3 HOH 92  283  283  HOH HOH A . 
D 3 HOH 93  284  284  HOH HOH A . 
D 3 HOH 94  285  285  HOH HOH A . 
D 3 HOH 95  286  286  HOH HOH A . 
D 3 HOH 96  287  85   HOH HOH A . 
D 3 HOH 97  288  86   HOH HOH A . 
D 3 HOH 98  289  88   HOH HOH A . 
D 3 HOH 99  290  89   HOH HOH A . 
D 3 HOH 100 291  91   HOH HOH A . 
D 3 HOH 101 292  92   HOH HOH A . 
D 3 HOH 102 293  94   HOH HOH A . 
D 3 HOH 103 294  95   HOH HOH A . 
D 3 HOH 104 295  295  HOH HOH A . 
D 3 HOH 105 296  296  HOH HOH A . 
D 3 HOH 106 297  98   HOH HOH A . 
D 3 HOH 107 298  100  HOH HOH A . 
D 3 HOH 108 299  102  HOH HOH A . 
D 3 HOH 109 300  300  HOH HOH A . 
D 3 HOH 110 301  301  HOH HOH A . 
D 3 HOH 111 302  302  HOH HOH A . 
D 3 HOH 112 303  105  HOH HOH A . 
D 3 HOH 113 304  106  HOH HOH A . 
D 3 HOH 114 305  107  HOH HOH A . 
D 3 HOH 115 306  306  HOH HOH A . 
D 3 HOH 116 307  108  HOH HOH A . 
D 3 HOH 117 308  308  HOH HOH A . 
D 3 HOH 118 309  109  HOH HOH A . 
D 3 HOH 119 310  111  HOH HOH A . 
D 3 HOH 120 311  112  HOH HOH A . 
D 3 HOH 121 312  312  HOH HOH A . 
D 3 HOH 122 313  313  HOH HOH A . 
D 3 HOH 123 314  314  HOH HOH A . 
D 3 HOH 124 315  113  HOH HOH A . 
D 3 HOH 125 316  114  HOH HOH A . 
D 3 HOH 126 317  115  HOH HOH A . 
D 3 HOH 127 318  318  HOH HOH A . 
D 3 HOH 128 319  319  HOH HOH A . 
D 3 HOH 129 320  320  HOH HOH A . 
D 3 HOH 130 321  116  HOH HOH A . 
D 3 HOH 131 322  117  HOH HOH A . 
D 3 HOH 132 323  118  HOH HOH A . 
D 3 HOH 133 324  119  HOH HOH A . 
D 3 HOH 134 325  120  HOH HOH A . 
D 3 HOH 135 326  121  HOH HOH A . 
D 3 HOH 136 327  122  HOH HOH A . 
D 3 HOH 137 328  328  HOH HOH A . 
D 3 HOH 138 329  123  HOH HOH A . 
D 3 HOH 139 330  124  HOH HOH A . 
D 3 HOH 140 331  331  HOH HOH A . 
D 3 HOH 141 332  332  HOH HOH A . 
D 3 HOH 142 333  133  HOH HOH A . 
D 3 HOH 143 334  334  HOH HOH A . 
D 3 HOH 144 335  335  HOH HOH A . 
D 3 HOH 145 336  336  HOH HOH A . 
D 3 HOH 146 337  337  HOH HOH A . 
D 3 HOH 147 338  135  HOH HOH A . 
D 3 HOH 148 339  140  HOH HOH A . 
D 3 HOH 149 340  143  HOH HOH A . 
D 3 HOH 150 341  144  HOH HOH A . 
D 3 HOH 151 342  342  HOH HOH A . 
D 3 HOH 152 343  343  HOH HOH A . 
D 3 HOH 153 344  344  HOH HOH A . 
D 3 HOH 154 345  345  HOH HOH A . 
D 3 HOH 155 346  346  HOH HOH A . 
D 3 HOH 156 347  347  HOH HOH A . 
D 3 HOH 157 348  348  HOH HOH A . 
D 3 HOH 158 349  349  HOH HOH A . 
D 3 HOH 159 350  145  HOH HOH A . 
D 3 HOH 160 351  146  HOH HOH A . 
D 3 HOH 161 352  148  HOH HOH A . 
D 3 HOH 162 353  150  HOH HOH A . 
D 3 HOH 163 354  155  HOH HOH A . 
D 3 HOH 164 355  156  HOH HOH A . 
D 3 HOH 165 356  157  HOH HOH A . 
D 3 HOH 166 357  158  HOH HOH A . 
D 3 HOH 167 358  160  HOH HOH A . 
D 3 HOH 168 359  161  HOH HOH A . 
D 3 HOH 169 360  162  HOH HOH A . 
D 3 HOH 170 361  166  HOH HOH A . 
D 3 HOH 171 362  173  HOH HOH A . 
D 3 HOH 172 363  174  HOH HOH A . 
D 3 HOH 173 364  175  HOH HOH A . 
D 3 HOH 174 365  177  HOH HOH A . 
D 3 HOH 175 366  181  HOH HOH A . 
D 3 HOH 176 367  182  HOH HOH A . 
D 3 HOH 177 368  184  HOH HOH A . 
D 3 HOH 178 369  185  HOH HOH A . 
D 3 HOH 179 370  186  HOH HOH A . 
D 3 HOH 180 371  187  HOH HOH A . 
D 3 HOH 181 372  362  HOH HOH A . 
D 3 HOH 182 374  374  HOH HOH A . 
D 3 HOH 183 375  375  HOH HOH A . 
D 3 HOH 184 376  376  HOH HOH A . 
D 3 HOH 185 377  377  HOH HOH A . 
D 3 HOH 186 378  378  HOH HOH A . 
E 3 HOH 1   192  1    HOH HOH B . 
E 3 HOH 2   193  5    HOH HOH B . 
E 3 HOH 3   194  194  HOH HOH B . 
E 3 HOH 4   195  7    HOH HOH B . 
E 3 HOH 5   196  8    HOH HOH B . 
E 3 HOH 6   197  13   HOH HOH B . 
E 3 HOH 7   198  15   HOH HOH B . 
E 3 HOH 8   199  16   HOH HOH B . 
E 3 HOH 9   200  18   HOH HOH B . 
E 3 HOH 10  201  201  HOH HOH B . 
E 3 HOH 11  202  20   HOH HOH B . 
E 3 HOH 12  203  21   HOH HOH B . 
E 3 HOH 13  204  204  HOH HOH B . 
E 3 HOH 14  205  205  HOH HOH B . 
E 3 HOH 15  206  206  HOH HOH B . 
E 3 HOH 16  208  23   HOH HOH B . 
E 3 HOH 17  209  26   HOH HOH B . 
E 3 HOH 18  210  28   HOH HOH B . 
E 3 HOH 19  211  30   HOH HOH B . 
E 3 HOH 20  212  33   HOH HOH B . 
E 3 HOH 21  213  34   HOH HOH B . 
E 3 HOH 22  214  36   HOH HOH B . 
E 3 HOH 23  215  37   HOH HOH B . 
E 3 HOH 24  216  216  HOH HOH B . 
E 3 HOH 25  217  217  HOH HOH B . 
E 3 HOH 26  218  218  HOH HOH B . 
E 3 HOH 27  219  219  HOH HOH B . 
E 3 HOH 28  220  220  HOH HOH B . 
E 3 HOH 29  221  221  HOH HOH B . 
E 3 HOH 30  222  222  HOH HOH B . 
E 3 HOH 31  223  223  HOH HOH B . 
E 3 HOH 32  224  38   HOH HOH B . 
E 3 HOH 33  225  40   HOH HOH B . 
E 3 HOH 34  226  42   HOH HOH B . 
E 3 HOH 35  227  43   HOH HOH B . 
E 3 HOH 36  228  228  HOH HOH B . 
E 3 HOH 37  229  47   HOH HOH B . 
E 3 HOH 38  230  48   HOH HOH B . 
E 3 HOH 39  231  231  HOH HOH B . 
E 3 HOH 40  232  232  HOH HOH B . 
E 3 HOH 41  233  233  HOH HOH B . 
E 3 HOH 42  234  234  HOH HOH B . 
E 3 HOH 43  235  51   HOH HOH B . 
E 3 HOH 44  236  52   HOH HOH B . 
E 3 HOH 45  237  55   HOH HOH B . 
E 3 HOH 46  238  57   HOH HOH B . 
E 3 HOH 47  239  58   HOH HOH B . 
E 3 HOH 48  240  60   HOH HOH B . 
E 3 HOH 49  241  61   HOH HOH B . 
E 3 HOH 50  242  63   HOH HOH B . 
E 3 HOH 51  243  243  HOH HOH B . 
E 3 HOH 52  244  244  HOH HOH B . 
E 3 HOH 53  245  245  HOH HOH B . 
E 3 HOH 54  246  246  HOH HOH B . 
E 3 HOH 55  247  247  HOH HOH B . 
E 3 HOH 56  248  248  HOH HOH B . 
E 3 HOH 57  249  249  HOH HOH B . 
E 3 HOH 58  250  64   HOH HOH B . 
E 3 HOH 59  251  251  HOH HOH B . 
E 3 HOH 60  252  252  HOH HOH B . 
E 3 HOH 61  253  253  HOH HOH B . 
E 3 HOH 62  254  254  HOH HOH B . 
E 3 HOH 63  255  255  HOH HOH B . 
E 3 HOH 64  256  256  HOH HOH B . 
E 3 HOH 65  257  257  HOH HOH B . 
E 3 HOH 66  258  258  HOH HOH B . 
E 3 HOH 67  259  259  HOH HOH B . 
E 3 HOH 68  260  66   HOH HOH B . 
E 3 HOH 69  261  261  HOH HOH B . 
E 3 HOH 70  262  262  HOH HOH B . 
E 3 HOH 71  263  263  HOH HOH B . 
E 3 HOH 72  264  264  HOH HOH B . 
E 3 HOH 73  265  265  HOH HOH B . 
E 3 HOH 74  266  67   HOH HOH B . 
E 3 HOH 75  267  68   HOH HOH B . 
E 3 HOH 76  268  268  HOH HOH B . 
E 3 HOH 77  269  71   HOH HOH B . 
E 3 HOH 78  270  72   HOH HOH B . 
E 3 HOH 79  271  73   HOH HOH B . 
E 3 HOH 80  272  75   HOH HOH B . 
E 3 HOH 81  273  76   HOH HOH B . 
E 3 HOH 82  274  79   HOH HOH B . 
E 3 HOH 83  275  83   HOH HOH B . 
E 3 HOH 84  276  87   HOH HOH B . 
E 3 HOH 85  277  90   HOH HOH B . 
E 3 HOH 86  278  93   HOH HOH B . 
E 3 HOH 87  279  96   HOH HOH B . 
E 3 HOH 88  280  97   HOH HOH B . 
E 3 HOH 89  281  99   HOH HOH B . 
E 3 HOH 90  282  101  HOH HOH B . 
E 3 HOH 91  283  103  HOH HOH B . 
E 3 HOH 92  284  104  HOH HOH B . 
E 3 HOH 93  285  110  HOH HOH B . 
E 3 HOH 94  286  125  HOH HOH B . 
E 3 HOH 95  287  287  HOH HOH B . 
E 3 HOH 96  288  288  HOH HOH B . 
E 3 HOH 97  289  289  HOH HOH B . 
E 3 HOH 98  290  290  HOH HOH B . 
E 3 HOH 99  291  291  HOH HOH B . 
E 3 HOH 100 292  292  HOH HOH B . 
E 3 HOH 101 293  293  HOH HOH B . 
E 3 HOH 102 294  294  HOH HOH B . 
E 3 HOH 103 295  126  HOH HOH B . 
E 3 HOH 104 296  127  HOH HOH B . 
E 3 HOH 105 297  297  HOH HOH B . 
E 3 HOH 106 298  298  HOH HOH B . 
E 3 HOH 107 299  299  HOH HOH B . 
E 3 HOH 108 300  128  HOH HOH B . 
E 3 HOH 109 301  129  HOH HOH B . 
E 3 HOH 110 302  130  HOH HOH B . 
E 3 HOH 111 303  303  HOH HOH B . 
E 3 HOH 112 304  304  HOH HOH B . 
E 3 HOH 113 305  305  HOH HOH B . 
E 3 HOH 114 306  131  HOH HOH B . 
E 3 HOH 115 307  307  HOH HOH B . 
E 3 HOH 116 308  132  HOH HOH B . 
E 3 HOH 117 309  309  HOH HOH B . 
E 3 HOH 118 310  310  HOH HOH B . 
E 3 HOH 119 311  311  HOH HOH B . 
E 3 HOH 120 312  134  HOH HOH B . 
E 3 HOH 121 313  136  HOH HOH B . 
E 3 HOH 122 314  137  HOH HOH B . 
E 3 HOH 123 315  315  HOH HOH B . 
E 3 HOH 124 316  316  HOH HOH B . 
E 3 HOH 125 317  317  HOH HOH B . 
E 3 HOH 126 318  138  HOH HOH B . 
E 3 HOH 127 319  139  HOH HOH B . 
E 3 HOH 128 320  141  HOH HOH B . 
E 3 HOH 129 321  321  HOH HOH B . 
E 3 HOH 130 322  322  HOH HOH B . 
E 3 HOH 131 323  323  HOH HOH B . 
E 3 HOH 132 324  324  HOH HOH B . 
E 3 HOH 133 325  325  HOH HOH B . 
E 3 HOH 134 326  326  HOH HOH B . 
E 3 HOH 135 327  327  HOH HOH B . 
E 3 HOH 136 328  142  HOH HOH B . 
E 3 HOH 137 329  329  HOH HOH B . 
E 3 HOH 138 330  330  HOH HOH B . 
E 3 HOH 139 331  147  HOH HOH B . 
E 3 HOH 140 332  149  HOH HOH B . 
E 3 HOH 141 333  333  HOH HOH B . 
E 3 HOH 142 334  151  HOH HOH B . 
E 3 HOH 143 335  152  HOH HOH B . 
E 3 HOH 144 336  153  HOH HOH B . 
E 3 HOH 145 337  154  HOH HOH B . 
E 3 HOH 146 338  338  HOH HOH B . 
E 3 HOH 147 339  339  HOH HOH B . 
E 3 HOH 148 340  340  HOH HOH B . 
E 3 HOH 149 341  341  HOH HOH B . 
E 3 HOH 150 342  159  HOH HOH B . 
E 3 HOH 151 343  163  HOH HOH B . 
E 3 HOH 152 344  164  HOH HOH B . 
E 3 HOH 153 345  165  HOH HOH B . 
E 3 HOH 154 346  167  HOH HOH B . 
E 3 HOH 155 347  168  HOH HOH B . 
E 3 HOH 156 348  169  HOH HOH B . 
E 3 HOH 157 349  170  HOH HOH B . 
E 3 HOH 158 350  350  HOH HOH B . 
E 3 HOH 159 351  351  HOH HOH B . 
E 3 HOH 160 352  352  HOH HOH B . 
E 3 HOH 161 353  353  HOH HOH B . 
E 3 HOH 162 354  354  HOH HOH B . 
E 3 HOH 163 355  355  HOH HOH B . 
E 3 HOH 164 356  356  HOH HOH B . 
E 3 HOH 165 357  357  HOH HOH B . 
E 3 HOH 166 358  358  HOH HOH B . 
E 3 HOH 167 359  359  HOH HOH B . 
E 3 HOH 168 360  360  HOH HOH B . 
E 3 HOH 169 361  361  HOH HOH B . 
E 3 HOH 170 362  50   HOH HOH B . 
E 3 HOH 171 363  363  HOH HOH B . 
E 3 HOH 172 364  364  HOH HOH B . 
E 3 HOH 173 365  365  HOH HOH B . 
E 3 HOH 174 366  366  HOH HOH B . 
E 3 HOH 175 367  367  HOH HOH B . 
E 3 HOH 176 368  368  HOH HOH B . 
E 3 HOH 177 369  369  HOH HOH B . 
E 3 HOH 178 370  370  HOH HOH B . 
E 3 HOH 179 371  371  HOH HOH B . 
E 3 HOH 180 372  372  HOH HOH B . 
E 3 HOH 181 373  373  HOH HOH B . 
E 3 HOH 182 374  171  HOH HOH B . 
E 3 HOH 183 375  172  HOH HOH B . 
E 3 HOH 184 376  176  HOH HOH B . 
E 3 HOH 185 377  178  HOH HOH B . 
E 3 HOH 186 378  179  HOH HOH B . 
E 3 HOH 187 379  379  HOH HOH B . 
E 3 HOH 188 380  380  HOH HOH B . 
E 3 HOH 189 381  180  HOH HOH B . 
E 3 HOH 190 382  183  HOH HOH B . 
E 3 HOH 191 383  188  HOH HOH B . 
E 3 HOH 192 384  189  HOH HOH B . 
E 3 HOH 193 385  190  HOH HOH B . 
E 3 HOH 194 386  191  HOH HOH B . 
#