data_3K7G
# 
_entry.id   3K7G 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3K7G         
RCSB  RCSB055641   
WWPDB D_1000055641 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3k7h 'the E95K mutant of the Indian Hedgehog N-terminal signalling domain'  unspecified 
PDB 3k7i 'the E131K mutant of the Indian Hedgehog N-terminal signalling domain' unspecified 
PDB 3k7j 'the D100E mutant of the Indian Hedgehog N-terminal signalling domain' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3K7G 
_pdbx_database_status.recvd_initial_deposition_date   2009-10-13 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'He, Y.-X.'   1 
'Kang, Y.'    2 
'Zhang, W.J.' 3 
'Yu, J.'      4 
'Ma, G.'      5 
'Zhou, C.-Z.' 6 
# 
_citation.id                        primary 
_citation.title                     'Crystal structure of the Indian Hedgehog N-terminal signalling domain' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'He, Y.-X.'   1 
primary 'Kang, Y.'    2 
primary 'Zhang, W.J.' 3 
primary 'Yu, J.'      4 
primary 'Ma, G.'      5 
primary 'Zhou, C.-Z.' 6 
# 
_cell.entry_id           3K7G 
_cell.length_a           107.660 
_cell.length_b           53.350 
_cell.length_c           35.440 
_cell.angle_alpha        90.00 
_cell.angle_beta         91.32 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3K7G 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Indian hedgehog protein' 21115.633 1   ? ? 'Indian hedgehog protein N-product' ? 
2 non-polymer syn 'ZINC ION'                65.409    1   ? ? ?                                   ? 
3 non-polymer syn 'SULFATE ION'             96.063    4   ? ? ?                                   ? 
4 non-polymer syn GLYCEROL                  92.094    1   ? ? ?                                   ? 
5 water       nat water                     18.015    248 ? ? ?                                   ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'IHH, HHG-2' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MRGSHHHHHHGSCGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIARSSERFKELTPNYNPDIIFKDEE
NTGADRLMTQRCKDRLNSLAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYGLLARLAVEAGF
DWVYYESKAHVHCSVKSEHSAAAKTGG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MRGSHHHHHHGSCGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIARSSERFKELTPNYNPDIIFKDEE
NTGADRLMTQRCKDRLNSLAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYGLLARLAVEAGF
DWVYYESKAHVHCSVKSEHSAAAKTGG
;
_entity_poly.pdbx_strand_id                 B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ARG n 
1 3   GLY n 
1 4   SER n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  GLY n 
1 12  SER n 
1 13  CYS n 
1 14  GLY n 
1 15  PRO n 
1 16  GLY n 
1 17  ARG n 
1 18  VAL n 
1 19  VAL n 
1 20  GLY n 
1 21  SER n 
1 22  ARG n 
1 23  ARG n 
1 24  ARG n 
1 25  PRO n 
1 26  PRO n 
1 27  ARG n 
1 28  LYS n 
1 29  LEU n 
1 30  VAL n 
1 31  PRO n 
1 32  LEU n 
1 33  ALA n 
1 34  TYR n 
1 35  LYS n 
1 36  GLN n 
1 37  PHE n 
1 38  SER n 
1 39  PRO n 
1 40  ASN n 
1 41  VAL n 
1 42  PRO n 
1 43  GLU n 
1 44  LYS n 
1 45  THR n 
1 46  LEU n 
1 47  GLY n 
1 48  ALA n 
1 49  SER n 
1 50  GLY n 
1 51  ARG n 
1 52  TYR n 
1 53  GLU n 
1 54  GLY n 
1 55  LYS n 
1 56  ILE n 
1 57  ALA n 
1 58  ARG n 
1 59  SER n 
1 60  SER n 
1 61  GLU n 
1 62  ARG n 
1 63  PHE n 
1 64  LYS n 
1 65  GLU n 
1 66  LEU n 
1 67  THR n 
1 68  PRO n 
1 69  ASN n 
1 70  TYR n 
1 71  ASN n 
1 72  PRO n 
1 73  ASP n 
1 74  ILE n 
1 75  ILE n 
1 76  PHE n 
1 77  LYS n 
1 78  ASP n 
1 79  GLU n 
1 80  GLU n 
1 81  ASN n 
1 82  THR n 
1 83  GLY n 
1 84  ALA n 
1 85  ASP n 
1 86  ARG n 
1 87  LEU n 
1 88  MET n 
1 89  THR n 
1 90  GLN n 
1 91  ARG n 
1 92  CYS n 
1 93  LYS n 
1 94  ASP n 
1 95  ARG n 
1 96  LEU n 
1 97  ASN n 
1 98  SER n 
1 99  LEU n 
1 100 ALA n 
1 101 ILE n 
1 102 SER n 
1 103 VAL n 
1 104 MET n 
1 105 ASN n 
1 106 GLN n 
1 107 TRP n 
1 108 PRO n 
1 109 GLY n 
1 110 VAL n 
1 111 LYS n 
1 112 LEU n 
1 113 ARG n 
1 114 VAL n 
1 115 THR n 
1 116 GLU n 
1 117 GLY n 
1 118 TRP n 
1 119 ASP n 
1 120 GLU n 
1 121 ASP n 
1 122 GLY n 
1 123 HIS n 
1 124 HIS n 
1 125 SER n 
1 126 GLU n 
1 127 GLU n 
1 128 SER n 
1 129 LEU n 
1 130 HIS n 
1 131 TYR n 
1 132 GLU n 
1 133 GLY n 
1 134 ARG n 
1 135 ALA n 
1 136 VAL n 
1 137 ASP n 
1 138 ILE n 
1 139 THR n 
1 140 THR n 
1 141 SER n 
1 142 ASP n 
1 143 ARG n 
1 144 ASP n 
1 145 ARG n 
1 146 ASN n 
1 147 LYS n 
1 148 TYR n 
1 149 GLY n 
1 150 LEU n 
1 151 LEU n 
1 152 ALA n 
1 153 ARG n 
1 154 LEU n 
1 155 ALA n 
1 156 VAL n 
1 157 GLU n 
1 158 ALA n 
1 159 GLY n 
1 160 PHE n 
1 161 ASP n 
1 162 TRP n 
1 163 VAL n 
1 164 TYR n 
1 165 TYR n 
1 166 GLU n 
1 167 SER n 
1 168 LYS n 
1 169 ALA n 
1 170 HIS n 
1 171 VAL n 
1 172 HIS n 
1 173 CYS n 
1 174 SER n 
1 175 VAL n 
1 176 LYS n 
1 177 SER n 
1 178 GLU n 
1 179 HIS n 
1 180 SER n 
1 181 ALA n 
1 182 ALA n 
1 183 ALA n 
1 184 LYS n 
1 185 THR n 
1 186 GLY n 
1 187 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 IHH 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               'Rosseta (DE3)' 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    IHH_HUMAN 
_struct_ref.pdbx_db_accession          Q14623 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;CGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIARSSERFKELTPNYNPDIIFKDEENTGADRLMTQRC
KDRLNSLAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYGLLARLAVEAGFDWVYYESKAHVH
CSVKSEHSAAAKTGG
;
_struct_ref.pdbx_align_begin           28 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              3K7G 
_struct_ref_seq.pdbx_strand_id                B 
_struct_ref_seq.seq_align_beg                 13 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 187 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q14623 
_struct_ref_seq.db_align_beg                  28 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  202 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       28 
_struct_ref_seq.pdbx_auth_seq_align_end       202 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3K7G MET B 1  ? UNP Q14623 ? ? 'INITIATING METHIONINE' 16 1  
1 3K7G ARG B 2  ? UNP Q14623 ? ? 'EXPRESSION TAG'        17 2  
1 3K7G GLY B 3  ? UNP Q14623 ? ? 'EXPRESSION TAG'        18 3  
1 3K7G SER B 4  ? UNP Q14623 ? ? 'EXPRESSION TAG'        19 4  
1 3K7G HIS B 5  ? UNP Q14623 ? ? 'EXPRESSION TAG'        20 5  
1 3K7G HIS B 6  ? UNP Q14623 ? ? 'EXPRESSION TAG'        21 6  
1 3K7G HIS B 7  ? UNP Q14623 ? ? 'EXPRESSION TAG'        22 7  
1 3K7G HIS B 8  ? UNP Q14623 ? ? 'EXPRESSION TAG'        23 8  
1 3K7G HIS B 9  ? UNP Q14623 ? ? 'EXPRESSION TAG'        24 9  
1 3K7G HIS B 10 ? UNP Q14623 ? ? 'EXPRESSION TAG'        25 10 
1 3K7G GLY B 11 ? UNP Q14623 ? ? 'EXPRESSION TAG'        26 11 
1 3K7G SER B 12 ? UNP Q14623 ? ? 'EXPRESSION TAG'        27 12 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ?                               'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ?                               'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ?                               'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ?                               'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ?                               'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ?                               'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ?                               'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ?                               'C2 H5 N O2'     75.067  
GOL non-polymer         . GLYCEROL        'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3'       92.094  
HIS 'L-peptide linking' y HISTIDINE       ?                               'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ?                               'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ?                               'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ?                               'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ?                               'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ?                               'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ?                               'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ?                               'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ?                               'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ?                               'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ?                               'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ?                               'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ?                               'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ?                               'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ?                               'Zn 2'           65.409  
# 
_exptl.entry_id          3K7G 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.41 
_exptl_crystal.density_percent_sol   48.95 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            289 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.5 
_exptl_crystal_grow.pdbx_details    '0.1M Tris-HCl, pH 8.5, 2.0M (NH4)2SO4, VAPOR DIFFUSION, HANGING DROP, temperature 289K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'MAR scanner 345 mm plate' 
_diffrn_detector.pdbx_collection_date   2007-03-10 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.54178 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU MICROMAX-007 HF' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.54178 
# 
_reflns.entry_id                     3K7G 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             23.90 
_reflns.d_resolution_high            1.50 
_reflns.number_obs                   32115 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.7 
_reflns.pdbx_Rmerge_I_obs            0.03 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        22.2 
_reflns.B_iso_Wilson_estimate        11.73 
_reflns.pdbx_redundancy              2.7 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.50 
_reflns_shell.d_res_low              1.58 
_reflns_shell.percent_possible_all   99.5 
_reflns_shell.Rmerge_I_obs           0.117 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    10.0 
_reflns_shell.pdbx_redundancy        2.7 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      4650 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3K7G 
_refine.ls_number_reflns_obs                     32107 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.41 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             21.311 
_refine.ls_d_res_high                            1.500 
_refine.ls_percent_reflns_obs                    99.67 
_refine.ls_R_factor_obs                          0.1727 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1721 
_refine.ls_R_factor_R_free                       0.1837 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.07 
_refine.ls_number_reflns_R_free                  1627 
_refine.ls_number_reflns_R_work                  30480 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               13.648 
_refine.solvent_model_param_bsol                 40.135 
_refine.solvent_model_param_ksol                 0.427 
_refine.aniso_B[1][1]                            1.628 
_refine.aniso_B[2][2]                            -0.044 
_refine.aniso_B[3][3]                            -1.584 
_refine.aniso_B[1][2]                            0.000 
_refine.aniso_B[1][3]                            0.441 
_refine.aniso_B[2][3]                            -0.000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1VHH' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.16 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   0.906 
_refine.B_iso_max                                47.89 
_refine.B_iso_min                                4.53 
_refine.pdbx_overall_phase_error                 16.290 
_refine.occupancy_max                            1.00 
_refine.occupancy_min                            0.56 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1260 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         27 
_refine_hist.number_atoms_solvent             248 
_refine_hist.number_atoms_total               1535 
_refine_hist.d_res_high                       1.500 
_refine_hist.d_res_low                        21.311 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.005  ? ? 1311 'X-RAY DIFFRACTION' ? 
f_angle_d          1.073  ? ? 1771 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 16.711 ? ? 481  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.077  ? ? 181  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.004  ? ? 229  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
. 1.5000 1.5441  2519 0.1760 99.00  0.1959 . . 130 . . . . 'X-RAY DIFFRACTION' 
. 1.5441 1.5940  2500 0.1663 100.00 0.1851 . . 127 . . . . 'X-RAY DIFFRACTION' 
. 1.5940 1.6509  2525 0.1639 100.00 0.1795 . . 148 . . . . 'X-RAY DIFFRACTION' 
. 1.6509 1.7170  2543 0.1759 100.00 0.2130 . . 139 . . . . 'X-RAY DIFFRACTION' 
. 1.7170 1.7951  2532 0.1649 100.00 0.1915 . . 124 . . . . 'X-RAY DIFFRACTION' 
. 1.7951 1.8897  2553 0.1537 100.00 0.1742 . . 140 . . . . 'X-RAY DIFFRACTION' 
. 1.8897 2.0080  2562 0.1517 100.00 0.1829 . . 122 . . . . 'X-RAY DIFFRACTION' 
. 2.0080 2.1629  2530 0.1470 100.00 0.1524 . . 141 . . . . 'X-RAY DIFFRACTION' 
. 2.1629 2.3803  2575 0.1592 100.00 0.1615 . . 116 . . . . 'X-RAY DIFFRACTION' 
. 2.3803 2.7241  2548 0.1760 100.00 0.1994 . . 140 . . . . 'X-RAY DIFFRACTION' 
. 2.7241 3.4298  2547 0.1673 100.00 0.1861 . . 140 . . . . 'X-RAY DIFFRACTION' 
. 3.4298 21.3126 2546 0.1571 98.00  0.1460 . . 160 . . . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3K7G 
_struct.title                     'Crystal structure of the Indian Hedgehog N-terminal signalling domain' 
_struct.pdbx_descriptor           'Indian hedgehog protein' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3K7G 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            
;alpha+beta sandwich, Autocatalytic cleavage, Cell membrane, Developmental protein, Disease mutation, Glycoprotein, Hydrolase, Lipoprotein, Membrane, Palmitate, Protease, Secreted, SIGNALING PROTEIN
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 3 ? 
F N N 3 ? 
G N N 4 ? 
H N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 60  ? LEU A 66  ? SER B 75  LEU B 81  5 ? 7  
HELX_P HELX_P2 2 GLY A 83  ? ASP A 85  ? GLY B 98  ASP B 100 5 ? 3  
HELX_P HELX_P3 3 THR A 89  ? TRP A 107 ? THR B 104 TRP B 122 1 ? 19 
HELX_P HELX_P4 4 SER A 128 ? GLY A 133 ? SER B 143 GLY B 148 5 ? 6  
HELX_P HELX_P5 5 ASP A 144 ? ASN A 146 ? ASP B 159 ASN B 161 5 ? 3  
HELX_P HELX_P6 6 LYS A 147 ? ALA A 158 ? LYS B 162 ALA B 173 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? A HIS 130 NE2 ? ? ? 1_555 B ZN  . ZN ? ? B HIS 145  B ZN  1001 1_555 ? ? ? ? ? ? ? 2.035 ? 
metalc2 metalc ? ? A ASP 137 OD1 ? ? ? 1_555 B ZN  . ZN ? ? B ASP 152  B ZN  1001 1_555 ? ? ? ? ? ? ? 2.003 ? 
metalc3 metalc ? ? A HIS 172 ND1 ? ? ? 1_555 B ZN  . ZN ? ? B HIS 187  B ZN  1001 1_555 ? ? ? ? ? ? ? 2.068 ? 
metalc4 metalc ? ? B ZN  .   ZN  ? ? ? 1_555 H HOH . O  ? ? B ZN  1001 B HOH 250  1_555 ? ? ? ? ? ? ? 2.039 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          SER 
_struct_mon_prot_cis.label_seq_id           38 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           SER 
_struct_mon_prot_cis.auth_seq_id            53 
_struct_mon_prot_cis.auth_asym_id           B 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    39 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     54 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    B 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -2.02 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? parallel      
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 37  ? SER A 38  ? PHE B 52  SER B 53  
A 2 TRP A 162 ? SER A 167 ? TRP B 177 SER B 182 
A 3 HIS A 170 ? SER A 174 ? HIS B 185 SER B 189 
A 4 ALA A 135 ? THR A 140 ? ALA B 150 THR B 155 
A 5 LEU A 112 ? GLU A 116 ? LEU B 127 GLU B 131 
A 6 ILE A 74  ? PHE A 76  ? ILE B 89  PHE B 91  
B 1 THR A 67  ? PRO A 68  ? THR B 82  PRO B 83  
B 2 LEU A 87  ? MET A 88  ? LEU B 102 MET B 103 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N SER A 38  ? N SER B 53  O VAL A 163 ? O VAL B 178 
A 2 3 N TYR A 164 ? N TYR B 179 O HIS A 172 ? O HIS B 187 
A 3 4 O CYS A 173 ? O CYS B 188 N VAL A 136 ? N VAL B 151 
A 4 5 O ASP A 137 ? O ASP B 152 N GLU A 116 ? N GLU B 131 
A 5 6 O VAL A 114 ? O VAL B 129 N ILE A 75  ? N ILE B 90  
B 1 2 N THR A 67  ? N THR B 82  O MET A 88  ? O MET B 103 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE ZN B 1001' 
AC2 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE SO4 B 1'   
AC3 Software ? ? ? ? 5  'BINDING SITE FOR RESIDUE SO4 B 2'   
AC4 Software ? ? ? ? 10 'BINDING SITE FOR RESIDUE SO4 B 3'   
AC5 Software ? ? ? ? 7  'BINDING SITE FOR RESIDUE SO4 B 4'   
AC6 Software ? ? ? ? 6  'BINDING SITE FOR RESIDUE GOL B 203' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5  HIS A 130 ? HIS B 145 . ? 1_555 ? 
2  AC1 5  ASP A 137 ? ASP B 152 . ? 1_555 ? 
3  AC1 5  HIS A 172 ? HIS B 187 . ? 1_555 ? 
4  AC1 5  ALA A 182 ? ALA B 197 . ? 4_455 ? 
5  AC1 5  HOH H .   ? HOH B 250 . ? 1_555 ? 
6  AC2 6  HOH H .   ? HOH B 13  . ? 1_555 ? 
7  AC2 6  GLN A 36  ? GLN B 51  . ? 1_555 ? 
8  AC2 6  SER A 38  ? SER B 53  . ? 1_555 ? 
9  AC2 6  ARG A 153 ? ARG B 168 . ? 1_555 ? 
10 AC2 6  HOH H .   ? HOH B 262 . ? 1_555 ? 
11 AC2 6  HOH H .   ? HOH B 384 . ? 1_555 ? 
12 AC3 5  TYR A 52  ? TYR B 67  . ? 1_555 ? 
13 AC3 5  GLY A 54  ? GLY B 69  . ? 1_555 ? 
14 AC3 5  LYS A 55  ? LYS B 70  . ? 1_555 ? 
15 AC3 5  ARG A 145 ? ARG B 160 . ? 4_445 ? 
16 AC3 5  HOH H .   ? HOH B 351 . ? 4_445 ? 
17 AC4 10 HOH H .   ? HOH B 14  . ? 1_555 ? 
18 AC4 10 ARG A 51  ? ARG B 66  . ? 1_555 ? 
19 AC4 10 LYS A 77  ? LYS B 92  . ? 4_445 ? 
20 AC4 10 ARG A 113 ? ARG B 128 . ? 4_445 ? 
21 AC4 10 THR A 115 ? THR B 130 . ? 4_445 ? 
22 AC4 10 ARG A 143 ? ARG B 158 . ? 4_445 ? 
23 AC4 10 HOH H .   ? HOH B 270 . ? 1_555 ? 
24 AC4 10 HOH H .   ? HOH B 336 . ? 1_555 ? 
25 AC4 10 HOH H .   ? HOH B 365 . ? 1_555 ? 
26 AC4 10 HOH H .   ? HOH B 422 . ? 1_555 ? 
27 AC5 7  ILE A 74  ? ILE B 89  . ? 1_555 ? 
28 AC5 7  ILE A 75  ? ILE B 90  . ? 1_555 ? 
29 AC5 7  PHE A 76  ? PHE B 91  . ? 1_555 ? 
30 AC5 7  ARG A 86  ? ARG B 101 . ? 1_555 ? 
31 AC5 7  HOH H .   ? HOH B 260 . ? 1_555 ? 
32 AC5 7  HOH H .   ? HOH B 416 . ? 1_555 ? 
33 AC5 7  HOH H .   ? HOH B 430 . ? 1_555 ? 
34 AC6 6  SER A 60  ? SER B 75  . ? 1_555 ? 
35 AC6 6  GLU A 61  ? GLU B 76  . ? 1_555 ? 
36 AC6 6  ARG A 62  ? ARG B 77  . ? 1_555 ? 
37 AC6 6  LYS A 168 ? LYS B 183 . ? 4_445 ? 
38 AC6 6  HOH H .   ? HOH B 366 . ? 4_445 ? 
39 AC6 6  HOH H .   ? HOH B 432 . ? 4_446 ? 
# 
_database_PDB_matrix.entry_id          3K7G 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3K7G 
_atom_sites.fract_transf_matrix[1][1]   0.009289 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000214 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.018744 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.028224 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . PRO A 1 26  ? 4.047   -34.249 -6.835  1.00 26.96 ? 41   PRO B N   1 
ATOM   2    C  CA  . PRO A 1 26  ? 2.901   -33.412 -6.473  1.00 24.99 ? 41   PRO B CA  1 
ATOM   3    C  C   . PRO A 1 26  ? 2.138   -32.977 -7.716  1.00 23.03 ? 41   PRO B C   1 
ATOM   4    O  O   . PRO A 1 26  ? 2.736   -32.834 -8.782  1.00 23.01 ? 41   PRO B O   1 
ATOM   5    C  CB  . PRO A 1 26  ? 3.553   -32.182 -5.822  1.00 23.39 ? 41   PRO B CB  1 
ATOM   6    C  CG  . PRO A 1 26  ? 5.058   -32.388 -5.937  1.00 23.16 ? 41   PRO B CG  1 
ATOM   7    C  CD  . PRO A 1 26  ? 5.277   -33.454 -6.950  1.00 27.64 ? 41   PRO B CD  1 
ATOM   8    N  N   . ARG A 1 27  ? 0.835   -32.767 -7.580  1.00 23.36 ? 42   ARG B N   1 
ATOM   9    C  CA  . ARG A 1 27  ? 0.039   -32.254 -8.683  1.00 25.05 ? 42   ARG B CA  1 
ATOM   10   C  C   . ARG A 1 27  ? -0.160  -30.754 -8.525  1.00 17.61 ? 42   ARG B C   1 
ATOM   11   O  O   . ARG A 1 27  ? -0.269  -30.242 -7.409  1.00 17.18 ? 42   ARG B O   1 
ATOM   12   C  CB  . ARG A 1 27  ? -1.325  -32.946 -8.754  1.00 29.85 ? 42   ARG B CB  1 
ATOM   13   C  CG  . ARG A 1 27  ? -1.273  -34.460 -8.907  1.00 34.79 ? 42   ARG B CG  1 
ATOM   14   C  CD  . ARG A 1 27  ? -1.021  -35.138 -7.568  1.00 40.77 ? 42   ARG B CD  1 
ATOM   15   N  NE  . ARG A 1 27  ? -1.800  -34.530 -6.491  1.00 43.51 ? 42   ARG B NE  1 
ATOM   16   C  CZ  . ARG A 1 27  ? -2.981  -34.976 -6.073  1.00 41.40 ? 42   ARG B CZ  1 
ATOM   17   N  NH1 . ARG A 1 27  ? -3.528  -36.043 -6.639  1.00 44.11 ? 42   ARG B NH1 1 
ATOM   18   N  NH2 . ARG A 1 27  ? -3.613  -34.357 -5.084  1.00 39.02 ? 42   ARG B NH2 1 
ATOM   19   N  N   . LYS A 1 28  ? -0.202  -30.054 -9.649  1.00 17.55 ? 43   LYS B N   1 
ATOM   20   C  CA  . LYS A 1 28  ? -0.509  -28.636 -9.656  1.00 15.07 ? 43   LYS B CA  1 
ATOM   21   C  C   . LYS A 1 28  ? -1.952  -28.452 -9.209  1.00 17.88 ? 43   LYS B C   1 
ATOM   22   O  O   . LYS A 1 28  ? -2.851  -29.155 -9.677  1.00 19.35 ? 43   LYS B O   1 
ATOM   23   C  CB  . LYS A 1 28  ? -0.305  -28.072 -11.063 1.00 22.22 ? 43   LYS B CB  1 
ATOM   24   C  CG  . LYS A 1 28  ? -0.906  -26.704 -11.299 1.00 28.96 ? 43   LYS B CG  1 
ATOM   25   C  CD  . LYS A 1 28  ? -0.445  -26.143 -12.639 1.00 36.46 ? 43   LYS B CD  1 
ATOM   26   C  CE  . LYS A 1 28  ? -1.291  -24.954 -13.075 1.00 31.86 ? 43   LYS B CE  1 
ATOM   27   N  NZ  . LYS A 1 28  ? -2.585  -25.376 -13.681 1.00 33.32 ? 43   LYS B NZ  1 
ATOM   28   N  N   . LEU A 1 29  ? -2.175  -27.532 -8.280  1.00 12.29 ? 44   LEU B N   1 
ATOM   29   C  CA  . LEU A 1 29  ? -3.530  -27.277 -7.811  1.00 13.31 ? 44   LEU B CA  1 
ATOM   30   C  C   . LEU A 1 29  ? -4.194  -26.214 -8.675  1.00 14.22 ? 44   LEU B C   1 
ATOM   31   O  O   . LEU A 1 29  ? -3.686  -25.101 -8.816  1.00 15.90 ? 44   LEU B O   1 
ATOM   32   C  CB  . LEU A 1 29  ? -3.532  -26.867 -6.339  1.00 16.72 ? 44   LEU B CB  1 
ATOM   33   C  CG  . LEU A 1 29  ? -3.158  -27.979 -5.358  1.00 19.44 ? 44   LEU B CG  1 
ATOM   34   C  CD1 . LEU A 1 29  ? -3.070  -27.434 -3.940  1.00 23.52 ? 44   LEU B CD1 1 
ATOM   35   C  CD2 . LEU A 1 29  ? -4.149  -29.135 -5.431  1.00 19.70 ? 44   LEU B CD2 1 
ATOM   36   N  N   . VAL A 1 30  ? -5.325  -26.585 -9.265  1.00 11.09 ? 45   VAL B N   1 
ATOM   37   C  CA  . VAL A 1 30  ? -6.066  -25.710 -10.153 1.00 10.20 ? 45   VAL B CA  1 
ATOM   38   C  C   . VAL A 1 30  ? -7.316  -25.242 -9.425  1.00 8.90  ? 45   VAL B C   1 
ATOM   39   O  O   . VAL A 1 30  ? -8.123  -26.063 -8.993  1.00 10.25 ? 45   VAL B O   1 
ATOM   40   C  CB  . VAL A 1 30  ? -6.470  -26.449 -11.445 1.00 12.66 ? 45   VAL B CB  1 
ATOM   41   C  CG1 . VAL A 1 30  ? -7.125  -25.482 -12.429 1.00 14.18 ? 45   VAL B CG1 1 
ATOM   42   C  CG2 . VAL A 1 30  ? -5.249  -27.127 -12.074 1.00 14.55 ? 45   VAL B CG2 1 
ATOM   43   N  N   . PRO A 1 31  ? -7.477  -23.923 -9.270  1.00 7.58  ? 46   PRO B N   1 
ATOM   44   C  CA  . PRO A 1 31  ? -8.686  -23.458 -8.578  1.00 7.59  ? 46   PRO B CA  1 
ATOM   45   C  C   . PRO A 1 31  ? -9.950  -23.821 -9.361  1.00 7.69  ? 46   PRO B C   1 
ATOM   46   O  O   . PRO A 1 31  ? -9.913  -23.974 -10.586 1.00 9.35  ? 46   PRO B O   1 
ATOM   47   C  CB  . PRO A 1 31  ? -8.514  -21.938 -8.529  1.00 9.55  ? 46   PRO B CB  1 
ATOM   48   C  CG  . PRO A 1 31  ? -7.511  -21.621 -9.601  1.00 13.93 ? 46   PRO B CG  1 
ATOM   49   C  CD  . PRO A 1 31  ? -6.626  -22.819 -9.743  1.00 10.94 ? 46   PRO B CD  1 
ATOM   50   N  N   . LEU A 1 32  ? -11.064 -23.978 -8.655  1.00 7.39  ? 47   LEU B N   1 
ATOM   51   C  CA  . LEU A 1 32  ? -12.347 -24.079 -9.332  1.00 7.75  ? 47   LEU B CA  1 
ATOM   52   C  C   . LEU A 1 32  ? -12.713 -22.708 -9.872  1.00 6.80  ? 47   LEU B C   1 
ATOM   53   O  O   . LEU A 1 32  ? -12.353 -21.686 -9.281  1.00 8.77  ? 47   LEU B O   1 
ATOM   54   C  CB  . LEU A 1 32  ? -13.447 -24.576 -8.382  1.00 6.57  ? 47   LEU B CB  1 
ATOM   55   C  CG  . LEU A 1 32  ? -13.615 -26.095 -8.296  1.00 6.60  ? 47   LEU B CG  1 
ATOM   56   C  CD1 . LEU A 1 32  ? -12.456 -26.747 -7.567  1.00 9.78  ? 47   LEU B CD1 1 
ATOM   57   C  CD2 . LEU A 1 32  ? -14.931 -26.455 -7.620  1.00 6.67  ? 47   LEU B CD2 1 
ATOM   58   N  N   . ALA A 1 33  ? -13.409 -22.696 -11.004 1.00 7.74  ? 48   ALA B N   1 
ATOM   59   C  CA  . ALA A 1 33  ? -13.953 -21.467 -11.556 1.00 8.97  ? 48   ALA B CA  1 
ATOM   60   C  C   . ALA A 1 33  ? -15.322 -21.183 -10.948 1.00 7.64  ? 48   ALA B C   1 
ATOM   61   O  O   . ALA A 1 33  ? -15.987 -22.074 -10.422 1.00 7.71  ? 48   ALA B O   1 
ATOM   62   C  CB  . ALA A 1 33  ? -14.060 -21.570 -13.059 1.00 11.16 ? 48   ALA B CB  1 
ATOM   63   N  N   . TYR A 1 34  ? -15.737 -19.927 -11.029 1.00 8.24  ? 49   TYR B N   1 
ATOM   64   C  CA  . TYR A 1 34  ? -17.060 -19.531 -10.582 1.00 8.65  ? 49   TYR B CA  1 
ATOM   65   C  C   . TYR A 1 34  ? -18.136 -20.427 -11.222 1.00 7.70  ? 49   TYR B C   1 
ATOM   66   O  O   . TYR A 1 34  ? -18.157 -20.619 -12.443 1.00 8.87  ? 49   TYR B O   1 
ATOM   67   C  CB  . TYR A 1 34  ? -17.258 -18.051 -10.920 1.00 9.11  ? 49   TYR B CB  1 
ATOM   68   C  CG  . TYR A 1 34  ? -18.608 -17.468 -10.599 1.00 8.68  ? 49   TYR B CG  1 
ATOM   69   C  CD1 . TYR A 1 34  ? -19.176 -17.612 -9.341  1.00 10.03 ? 49   TYR B CD1 1 
ATOM   70   C  CD2 . TYR A 1 34  ? -19.296 -16.733 -11.548 1.00 11.32 ? 49   TYR B CD2 1 
ATOM   71   C  CE1 . TYR A 1 34  ? -20.413 -17.067 -9.055  1.00 11.50 ? 49   TYR B CE1 1 
ATOM   72   C  CE2 . TYR A 1 34  ? -20.523 -16.169 -11.269 1.00 10.98 ? 49   TYR B CE2 1 
ATOM   73   C  CZ  . TYR A 1 34  ? -21.082 -16.343 -10.023 1.00 9.57  ? 49   TYR B CZ  1 
ATOM   74   O  OH  . TYR A 1 34  ? -22.311 -15.790 -9.736  1.00 11.37 ? 49   TYR B OH  1 
ATOM   75   N  N   . LYS A 1 35  ? -18.986 -20.996 -10.364 1.00 6.55  ? 50   LYS B N   1 
ATOM   76   C  CA  . LYS A 1 35  ? -20.104 -21.890 -10.710 1.00 7.21  ? 50   LYS B CA  1 
ATOM   77   C  C   . LYS A 1 35  ? -19.711 -23.342 -11.025 1.00 7.02  ? 50   LYS B C   1 
ATOM   78   O  O   . LYS A 1 35  ? -20.570 -24.185 -11.289 1.00 8.79  ? 50   LYS B O   1 
ATOM   79   C  CB  . LYS A 1 35  ? -21.011 -21.292 -11.797 1.00 7.58  ? 50   LYS B CB  1 
ATOM   80   C  CG  . LYS A 1 35  ? -21.758 -20.042 -11.353 1.00 8.42  ? 50   LYS B CG  1 
ATOM   81   C  CD  . LYS A 1 35  ? -22.707 -20.336 -10.190 1.00 9.98  ? 50   LYS B CD  1 
ATOM   82   C  CE  . LYS A 1 35  ? -23.640 -19.155 -9.934  1.00 10.98 ? 50   LYS B CE  1 
ATOM   83   N  NZ  . LYS A 1 35  ? -24.650 -19.462 -8.868  1.00 10.58 ? 50   LYS B NZ  1 
ATOM   84   N  N   . GLN A 1 36  ? -18.420 -23.638 -10.975 1.00 6.42  ? 51   GLN B N   1 
ATOM   85   C  CA  . GLN A 1 36  ? -17.969 -25.008 -11.163 1.00 6.95  ? 51   GLN B CA  1 
ATOM   86   C  C   . GLN A 1 36  ? -18.266 -25.841 -9.917  1.00 7.83  ? 51   GLN B C   1 
ATOM   87   O  O   . GLN A 1 36  ? -18.231 -25.334 -8.788  1.00 6.90  ? 51   GLN B O   1 
ATOM   88   C  CB  . GLN A 1 36  ? -16.469 -25.013 -11.481 1.00 6.22  ? 51   GLN B CB  1 
ATOM   89   C  CG  . GLN A 1 36  ? -15.839 -26.380 -11.710 1.00 6.51  ? 51   GLN B CG  1 
ATOM   90   C  CD  . GLN A 1 36  ? -14.354 -26.282 -12.041 1.00 7.27  ? 51   GLN B CD  1 
ATOM   91   O  OE1 . GLN A 1 36  ? -13.815 -25.194 -12.223 1.00 9.02  ? 51   GLN B OE1 1 
ATOM   92   N  NE2 . GLN A 1 36  ? -13.688 -27.432 -12.114 1.00 8.82  ? 51   GLN B NE2 1 
ATOM   93   N  N   . PHE A 1 37  ? -18.564 -27.119 -10.122 1.00 7.55  ? 52   PHE B N   1 
ATOM   94   C  CA  . PHE A 1 37  ? -18.705 -28.060 -9.020  1.00 7.64  ? 52   PHE B CA  1 
ATOM   95   C  C   . PHE A 1 37  ? -17.904 -29.324 -9.282  1.00 8.30  ? 52   PHE B C   1 
ATOM   96   O  O   . PHE A 1 37  ? -17.707 -29.732 -10.432 1.00 8.95  ? 52   PHE B O   1 
ATOM   97   C  CB  . PHE A 1 37  ? -20.178 -28.382 -8.701  1.00 7.31  ? 52   PHE B CB  1 
ATOM   98   C  CG  . PHE A 1 37  ? -21.010 -28.725 -9.904  1.00 7.41  ? 52   PHE B CG  1 
ATOM   99   C  CD1 . PHE A 1 37  ? -21.660 -27.736 -10.612 1.00 9.87  ? 52   PHE B CD1 1 
ATOM   100  C  CD2 . PHE A 1 37  ? -21.157 -30.034 -10.312 1.00 7.71  ? 52   PHE B CD2 1 
ATOM   101  C  CE1 . PHE A 1 37  ? -22.439 -28.045 -11.720 1.00 9.60  ? 52   PHE B CE1 1 
ATOM   102  C  CE2 . PHE A 1 37  ? -21.931 -30.352 -11.417 1.00 8.49  ? 52   PHE B CE2 1 
ATOM   103  C  CZ  . PHE A 1 37  ? -22.566 -29.360 -12.125 1.00 10.35 ? 52   PHE B CZ  1 
ATOM   104  N  N   . SER A 1 38  ? -17.429 -29.924 -8.201  1.00 7.02  ? 53   SER B N   1 
ATOM   105  C  CA  . SER A 1 38  ? -16.582 -31.105 -8.262  1.00 7.92  ? 53   SER B CA  1 
ATOM   106  C  C   . SER A 1 38  ? -17.004 -32.065 -7.170  1.00 8.08  ? 53   SER B C   1 
ATOM   107  O  O   . SER A 1 38  ? -17.132 -31.662 -6.023  1.00 7.48  ? 53   SER B O   1 
ATOM   108  C  CB  . SER A 1 38  ? -15.122 -30.722 -8.048  1.00 10.50 ? 53   SER B CB  1 
ATOM   109  O  OG  . SER A 1 38  ? -14.303 -31.883 -8.055  1.00 12.80 ? 53   SER B OG  1 
ATOM   110  N  N   . PRO A 1 39  ? -17.221 -33.343 -7.507  1.00 7.25  ? 54   PRO B N   1 
ATOM   111  C  CA  . PRO A 1 39  ? -17.127 -33.898 -8.858  1.00 7.94  ? 54   PRO B CA  1 
ATOM   112  C  C   . PRO A 1 39  ? -18.194 -33.280 -9.756  1.00 8.75  ? 54   PRO B C   1 
ATOM   113  O  O   . PRO A 1 39  ? -19.172 -32.721 -9.258  1.00 8.67  ? 54   PRO B O   1 
ATOM   114  C  CB  . PRO A 1 39  ? -17.403 -35.390 -8.632  1.00 9.43  ? 54   PRO B CB  1 
ATOM   115  C  CG  . PRO A 1 39  ? -18.239 -35.417 -7.393  1.00 10.31 ? 54   PRO B CG  1 
ATOM   116  C  CD  . PRO A 1 39  ? -17.592 -34.380 -6.528  1.00 8.34  ? 54   PRO B CD  1 
ATOM   117  N  N   . ASN A 1 40  ? -17.990 -33.381 -11.068 1.00 9.25  ? 55   ASN B N   1 
ATOM   118  C  CA  . ASN A 1 40  ? -18.825 -32.701 -12.058 1.00 10.09 ? 55   ASN B CA  1 
ATOM   119  C  C   . ASN A 1 40  ? -20.181 -33.363 -12.311 1.00 12.45 ? 55   ASN B C   1 
ATOM   120  O  O   . ASN A 1 40  ? -20.642 -33.454 -13.451 1.00 13.45 ? 55   ASN B O   1 
ATOM   121  C  CB  . ASN A 1 40  ? -18.057 -32.557 -13.376 1.00 11.74 ? 55   ASN B CB  1 
ATOM   122  C  CG  . ASN A 1 40  ? -17.766 -33.893 -14.032 1.00 14.88 ? 55   ASN B CG  1 
ATOM   123  O  OD1 . ASN A 1 40  ? -18.138 -34.948 -13.518 1.00 17.34 ? 55   ASN B OD1 1 
ATOM   124  N  ND2 . ASN A 1 40  ? -17.089 -33.854 -15.177 1.00 21.82 ? 55   ASN B ND2 1 
ATOM   125  N  N   . VAL A 1 41  ? -20.823 -33.795 -11.233 1.00 8.42  ? 56   VAL B N   1 
ATOM   126  C  CA  . VAL A 1 41  ? -22.136 -34.427 -11.295 1.00 10.93 ? 56   VAL B CA  1 
ATOM   127  C  C   . VAL A 1 41  ? -23.014 -33.740 -10.261 1.00 8.26  ? 56   VAL B C   1 
ATOM   128  O  O   . VAL A 1 41  ? -22.493 -33.028 -9.401  1.00 8.49  ? 56   VAL B O   1 
ATOM   129  C  CB  . VAL A 1 41  ? -22.050 -35.942 -11.012 1.00 11.82 ? 56   VAL B CB  1 
ATOM   130  C  CG1 . VAL A 1 41  ? -21.233 -36.629 -12.106 1.00 13.55 ? 56   VAL B CG1 1 
ATOM   131  C  CG2 . VAL A 1 41  ? -21.449 -36.213 -9.633  1.00 12.55 ? 56   VAL B CG2 1 
ATOM   132  N  N   . PRO A 1 42  ? -24.339 -33.926 -10.337 1.00 9.00  ? 57   PRO B N   1 
ATOM   133  C  CA  . PRO A 1 42  ? -25.216 -33.256 -9.366  1.00 8.83  ? 57   PRO B CA  1 
ATOM   134  C  C   . PRO A 1 42  ? -24.943 -33.667 -7.915  1.00 7.62  ? 57   PRO B C   1 
ATOM   135  O  O   . PRO A 1 42  ? -24.552 -34.803 -7.636  1.00 8.91  ? 57   PRO B O   1 
ATOM   136  C  CB  . PRO A 1 42  ? -26.621 -33.684 -9.799  1.00 9.51  ? 57   PRO B CB  1 
ATOM   137  C  CG  . PRO A 1 42  ? -26.469 -34.024 -11.267 1.00 12.73 ? 57   PRO B CG  1 
ATOM   138  C  CD  . PRO A 1 42  ? -25.105 -34.664 -11.358 1.00 10.09 ? 57   PRO B CD  1 
ATOM   139  N  N   . GLU A 1 43  ? -25.159 -32.724 -6.999  1.00 8.19  ? 58   GLU B N   1 
ATOM   140  C  CA  . GLU A 1 43  ? -24.830 -32.897 -5.588  1.00 7.76  ? 58   GLU B CA  1 
ATOM   141  C  C   . GLU A 1 43  ? -25.453 -34.133 -4.959  1.00 8.70  ? 58   GLU B C   1 
ATOM   142  O  O   . GLU A 1 43  ? -24.806 -34.855 -4.193  1.00 7.52  ? 58   GLU B O   1 
ATOM   143  C  CB  . GLU A 1 43  ? -25.295 -31.681 -4.793  1.00 7.08  ? 58   GLU B CB  1 
ATOM   144  C  CG  . GLU A 1 43  ? -24.938 -31.787 -3.313  1.00 6.60  ? 58   GLU B CG  1 
ATOM   145  C  CD  . GLU A 1 43  ? -25.345 -30.567 -2.517  1.00 6.99  ? 58   GLU B CD  1 
ATOM   146  O  OE1 . GLU A 1 43  ? -26.401 -29.968 -2.816  1.00 8.79  ? 58   GLU B OE1 1 
ATOM   147  O  OE2 . GLU A 1 43  ? -24.596 -30.204 -1.583  1.00 6.07  ? 58   GLU B OE2 1 
ATOM   148  N  N   . LYS A 1 44  ? -26.719 -34.377 -5.263  1.00 8.24  ? 59   LYS B N   1 
ATOM   149  C  CA  . LYS A 1 44  ? -27.423 -35.443 -4.561  1.00 8.95  ? 59   LYS B CA  1 
ATOM   150  C  C   . LYS A 1 44  ? -27.449 -36.768 -5.309  1.00 12.37 ? 59   LYS B C   1 
ATOM   151  O  O   . LYS A 1 44  ? -28.431 -37.504 -5.259  1.00 19.91 ? 59   LYS B O   1 
ATOM   152  C  CB  . LYS A 1 44  ? -28.808 -34.976 -4.112  1.00 16.19 ? 59   LYS B CB  1 
ATOM   153  C  CG  . LYS A 1 44  ? -28.714 -33.952 -2.988  1.00 17.47 ? 59   LYS B CG  1 
ATOM   154  C  CD  . LYS A 1 44  ? -30.043 -33.319 -2.699  1.00 18.74 ? 59   LYS B CD  1 
ATOM   155  C  CE  . LYS A 1 44  ? -29.896 -31.824 -2.591  1.00 20.08 ? 59   LYS B CE  1 
ATOM   156  N  NZ  . LYS A 1 44  ? -31.142 -31.164 -3.042  1.00 25.71 ? 59   LYS B NZ  1 
ATOM   157  N  N   . THR A 1 45  ? -26.351 -37.064 -5.993  1.00 12.11 ? 60   THR B N   1 
ATOM   158  C  CA  . THR A 1 45  ? -26.135 -38.376 -6.585  1.00 11.78 ? 60   THR B CA  1 
ATOM   159  C  C   . THR A 1 45  ? -25.167 -39.166 -5.714  1.00 12.08 ? 60   THR B C   1 
ATOM   160  O  O   . THR A 1 45  ? -24.442 -38.590 -4.901  1.00 11.27 ? 60   THR B O   1 
ATOM   161  C  CB  . THR A 1 45  ? -25.551 -38.267 -7.997  1.00 11.54 ? 60   THR B CB  1 
ATOM   162  O  OG1 . THR A 1 45  ? -24.284 -37.596 -7.949  1.00 13.34 ? 60   THR B OG1 1 
ATOM   163  C  CG2 . THR A 1 45  ? -26.500 -37.509 -8.912  1.00 16.43 ? 60   THR B CG2 1 
ATOM   164  N  N   . LEU A 1 46  ? -25.136 -40.486 -5.886  1.00 11.13 ? 61   LEU B N   1 
ATOM   165  C  CA  . LEU A 1 46  ? -24.318 -41.327 -5.018  1.00 10.64 ? 61   LEU B CA  1 
ATOM   166  C  C   . LEU A 1 46  ? -22.819 -41.115 -5.225  1.00 12.59 ? 61   LEU B C   1 
ATOM   167  O  O   . LEU A 1 46  ? -22.020 -41.419 -4.336  1.00 14.69 ? 61   LEU B O   1 
ATOM   168  C  CB  . LEU A 1 46  ? -24.698 -42.803 -5.162  1.00 12.34 ? 61   LEU B CB  1 
ATOM   169  C  CG  . LEU A 1 46  ? -26.067 -43.175 -4.593  1.00 11.83 ? 61   LEU B CG  1 
ATOM   170  C  CD1 . LEU A 1 46  ? -26.297 -44.669 -4.745  1.00 13.60 ? 61   LEU B CD1 1 
ATOM   171  C  CD2 . LEU A 1 46  ? -26.177 -42.765 -3.132  1.00 16.36 ? 61   LEU B CD2 1 
ATOM   172  N  N   . GLY A 1 47  ? -22.443 -40.590 -6.387  1.00 13.23 ? 62   GLY B N   1 
ATOM   173  C  CA  . GLY A 1 47  ? -21.056 -40.262 -6.664  1.00 15.01 ? 62   GLY B CA  1 
ATOM   174  C  C   . GLY A 1 47  ? -20.625 -38.980 -5.972  1.00 13.37 ? 62   GLY B C   1 
ATOM   175  O  O   . GLY A 1 47  ? -19.441 -38.645 -5.943  1.00 13.43 ? 62   GLY B O   1 
ATOM   176  N  N   . ALA A 1 48  ? -21.601 -38.260 -5.425  1.00 11.34 ? 63   ALA B N   1 
ATOM   177  C  CA  . ALA A 1 48  ? -21.343 -37.016 -4.704  1.00 10.07 ? 63   ALA B CA  1 
ATOM   178  C  C   . ALA A 1 48  ? -21.844 -37.140 -3.263  1.00 9.24  ? 63   ALA B C   1 
ATOM   179  O  O   . ALA A 1 48  ? -21.389 -38.016 -2.525  1.00 10.12 ? 63   ALA B O   1 
ATOM   180  C  CB  . ALA A 1 48  ? -21.990 -35.837 -5.423  1.00 10.27 ? 63   ALA B CB  1 
ATOM   181  N  N   . SER A 1 49  ? -22.792 -36.298 -2.858  1.00 7.48  ? 64   SER B N   1 
ATOM   182  C  CA  . SER A 1 49  ? -23.231 -36.305 -1.459  1.00 7.80  ? 64   SER B CA  1 
ATOM   183  C  C   . SER A 1 49  ? -24.492 -37.118 -1.176  1.00 8.09  ? 64   SER B C   1 
ATOM   184  O  O   . SER A 1 49  ? -24.989 -37.137 -0.054  1.00 9.15  ? 64   SER B O   1 
ATOM   185  C  CB  . SER A 1 49  ? -23.377 -34.877 -0.931  1.00 7.85  ? 64   SER B CB  1 
ATOM   186  O  OG  . SER A 1 49  ? -22.112 -34.245 -0.942  1.00 7.00  ? 64   SER B OG  1 
ATOM   187  N  N   . GLY A 1 50  ? -25.018 -37.793 -2.187  1.00 10.30 ? 65   GLY B N   1 
ATOM   188  C  CA  . GLY A 1 50  ? -26.177 -38.636 -1.970  1.00 11.81 ? 65   GLY B CA  1 
ATOM   189  C  C   . GLY A 1 50  ? -27.449 -37.865 -1.653  1.00 13.28 ? 65   GLY B C   1 
ATOM   190  O  O   . GLY A 1 50  ? -27.485 -36.632 -1.694  1.00 13.68 ? 65   GLY B O   1 
ATOM   191  N  N   . ARG A 1 51  ? -28.483 -38.609 -1.278  1.00 11.88 ? 66   ARG B N   1 
ATOM   192  C  CA  . ARG A 1 51  ? -29.856 -38.116 -1.225  1.00 11.54 ? 66   ARG B CA  1 
ATOM   193  C  C   . ARG A 1 51  ? -30.165 -37.167 -0.084  1.00 9.62  ? 66   ARG B C   1 
ATOM   194  O  O   . ARG A 1 51  ? -29.562 -37.231 0.980   1.00 11.48 ? 66   ARG B O   1 
ATOM   195  C  CB  . ARG A 1 51  ? -30.810 -39.299 -1.065  1.00 14.46 ? 66   ARG B CB  1 
ATOM   196  C  CG  . ARG A 1 51  ? -30.307 -40.580 -1.640  1.00 19.36 ? 66   ARG B CG  1 
ATOM   197  C  CD  . ARG A 1 51  ? -31.301 -41.687 -1.394  1.00 20.74 ? 66   ARG B CD  1 
ATOM   198  N  NE  . ARG A 1 51  ? -31.047 -42.778 -2.317  1.00 22.51 ? 66   ARG B NE  1 
ATOM   199  C  CZ  . ARG A 1 51  ? -30.230 -43.792 -2.066  1.00 26.57 ? 66   ARG B CZ  1 
ATOM   200  N  NH1 . ARG A 1 51  ? -29.601 -43.864 -0.897  1.00 21.30 ? 66   ARG B NH1 1 
ATOM   201  N  NH2 . ARG A 1 51  ? -30.057 -44.736 -2.980  1.00 23.39 ? 66   ARG B NH2 1 
ATOM   202  N  N   . TYR A 1 52  ? -31.154 -36.313 -0.311  1.00 10.39 ? 67   TYR B N   1 
ATOM   203  C  CA  . TYR A 1 52  ? -31.772 -35.554 0.764   1.00 10.16 ? 67   TYR B CA  1 
ATOM   204  C  C   . TYR A 1 52  ? -32.549 -36.502 1.673   1.00 11.13 ? 67   TYR B C   1 
ATOM   205  O  O   . TYR A 1 52  ? -33.346 -37.314 1.201   1.00 11.66 ? 67   TYR B O   1 
ATOM   206  C  CB  . TYR A 1 52  ? -32.709 -34.512 0.170   1.00 10.53 ? 67   TYR B CB  1 
ATOM   207  C  CG  . TYR A 1 52  ? -33.358 -33.585 1.176   1.00 10.28 ? 67   TYR B CG  1 
ATOM   208  C  CD1 . TYR A 1 52  ? -32.590 -32.748 1.973   1.00 9.51  ? 67   TYR B CD1 1 
ATOM   209  C  CD2 . TYR A 1 52  ? -34.742 -33.532 1.310   1.00 11.79 ? 67   TYR B CD2 1 
ATOM   210  C  CE1 . TYR A 1 52  ? -33.181 -31.888 2.878   1.00 11.53 ? 67   TYR B CE1 1 
ATOM   211  C  CE2 . TYR A 1 52  ? -35.342 -32.674 2.211   1.00 12.38 ? 67   TYR B CE2 1 
ATOM   212  C  CZ  . TYR A 1 52  ? -34.556 -31.849 2.990   1.00 13.07 ? 67   TYR B CZ  1 
ATOM   213  O  OH  . TYR A 1 52  ? -35.141 -30.989 3.892   1.00 14.21 ? 67   TYR B OH  1 
ATOM   214  N  N   . GLU A 1 53  ? -32.312 -36.395 2.975   1.00 8.35  ? 68   GLU B N   1 
ATOM   215  C  CA  . GLU A 1 53  ? -32.944 -37.286 3.943   1.00 9.58  ? 68   GLU B CA  1 
ATOM   216  C  C   . GLU A 1 53  ? -33.957 -36.575 4.835   1.00 11.17 ? 68   GLU B C   1 
ATOM   217  O  O   . GLU A 1 53  ? -34.471 -37.159 5.786   1.00 11.58 ? 68   GLU B O   1 
ATOM   218  C  CB  . GLU A 1 53  ? -31.877 -38.039 4.755   1.00 10.66 ? 68   GLU B CB  1 
ATOM   219  C  CG  . GLU A 1 53  ? -31.106 -39.026 3.863   1.00 11.66 ? 68   GLU B CG  1 
ATOM   220  C  CD  . GLU A 1 53  ? -29.925 -39.732 4.524   1.00 11.78 ? 68   GLU B CD  1 
ATOM   221  O  OE1 . GLU A 1 53  ? -29.112 -40.315 3.777   1.00 15.94 ? 68   GLU B OE1 1 
ATOM   222  O  OE2 . GLU A 1 53  ? -29.792 -39.708 5.764   1.00 13.40 ? 68   GLU B OE2 1 
ATOM   223  N  N   . GLY A 1 54  ? -34.261 -35.319 4.510   1.00 9.22  ? 69   GLY B N   1 
ATOM   224  C  CA  . GLY A 1 54  ? -35.244 -34.559 5.264   1.00 11.70 ? 69   GLY B CA  1 
ATOM   225  C  C   . GLY A 1 54  ? -34.636 -33.611 6.278   1.00 9.37  ? 69   GLY B C   1 
ATOM   226  O  O   . GLY A 1 54  ? -33.538 -33.833 6.772   1.00 9.47  ? 69   GLY B O   1 
ATOM   227  N  N   . LYS A 1 55  ? -35.372 -32.550 6.589   1.00 9.65  ? 70   LYS B N   1 
ATOM   228  C  CA  . LYS A 1 55  ? -34.900 -31.534 7.524   1.00 9.94  ? 70   LYS B CA  1 
ATOM   229  C  C   . LYS A 1 55  ? -34.655 -32.122 8.901   1.00 11.62 ? 70   LYS B C   1 
ATOM   230  O  O   . LYS A 1 55  ? -35.380 -33.011 9.343   1.00 11.53 ? 70   LYS B O   1 
ATOM   231  C  CB  . LYS A 1 55  ? -35.917 -30.398 7.657   1.00 13.54 ? 70   LYS B CB  1 
ATOM   232  C  CG  . LYS A 1 55  ? -36.093 -29.538 6.421   0.66 13.50 ? 70   LYS B CG  1 
ATOM   233  C  CD  . LYS A 1 55  ? -36.918 -28.302 6.747   0.77 19.37 ? 70   LYS B CD  1 
ATOM   234  C  CE  . LYS A 1 55  ? -37.031 -27.379 5.546   1.00 23.09 ? 70   LYS B CE  1 
ATOM   235  N  NZ  . LYS A 1 55  ? -37.588 -26.054 5.938   0.56 25.10 ? 70   LYS B NZ  1 
ATOM   236  N  N   . ILE A 1 56  ? -33.620 -31.618 9.564   1.00 8.78  ? 71   ILE B N   1 
ATOM   237  C  CA  . ILE A 1 56  ? -33.382 -31.911 10.969  1.00 10.23 ? 71   ILE B CA  1 
ATOM   238  C  C   . ILE A 1 56  ? -33.716 -30.678 11.803  1.00 11.81 ? 71   ILE B C   1 
ATOM   239  O  O   . ILE A 1 56  ? -33.159 -29.602 11.589  1.00 11.07 ? 71   ILE B O   1 
ATOM   240  C  CB  . ILE A 1 56  ? -31.919 -32.321 11.229  1.00 8.82  ? 71   ILE B CB  1 
ATOM   241  C  CG1 . ILE A 1 56  ? -31.617 -33.665 10.559  1.00 9.21  ? 71   ILE B CG1 1 
ATOM   242  C  CG2 . ILE A 1 56  ? -31.655 -32.399 12.738  1.00 10.54 ? 71   ILE B CG2 1 
ATOM   243  C  CD1 . ILE A 1 56  ? -30.166 -34.107 10.673  1.00 11.78 ? 71   ILE B CD1 1 
ATOM   244  N  N   . ALA A 1 57  ? -34.643 -30.838 12.744  1.00 14.16 ? 72   ALA B N   1 
ATOM   245  C  CA  . ALA A 1 57  ? -34.971 -29.780 13.696  1.00 16.37 ? 72   ALA B CA  1 
ATOM   246  C  C   . ALA A 1 57  ? -34.392 -30.150 15.055  1.00 15.05 ? 72   ALA B C   1 
ATOM   247  O  O   . ALA A 1 57  ? -34.047 -31.306 15.287  1.00 15.27 ? 72   ALA B O   1 
ATOM   248  C  CB  . ALA A 1 57  ? -36.477 -29.600 13.791  1.00 19.10 ? 72   ALA B CB  1 
ATOM   249  N  N   . ARG A 1 58  ? -34.283 -29.179 15.955  1.00 17.99 ? 73   ARG B N   1 
ATOM   250  C  CA  . ARG A 1 58  ? -33.741 -29.466 17.281  1.00 20.37 ? 73   ARG B CA  1 
ATOM   251  C  C   . ARG A 1 58  ? -34.533 -30.553 17.997  1.00 20.50 ? 73   ARG B C   1 
ATOM   252  O  O   . ARG A 1 58  ? -33.980 -31.299 18.803  1.00 23.65 ? 73   ARG B O   1 
ATOM   253  C  CB  . ARG A 1 58  ? -33.673 -28.204 18.141  1.00 24.79 ? 73   ARG B CB  1 
ATOM   254  C  CG  . ARG A 1 58  ? -32.803 -27.131 17.541  1.00 22.09 ? 73   ARG B CG  1 
ATOM   255  C  CD  . ARG A 1 58  ? -32.164 -26.234 18.579  1.00 26.27 ? 73   ARG B CD  1 
ATOM   256  N  NE  . ARG A 1 58  ? -31.267 -25.288 17.924  1.00 18.23 ? 73   ARG B NE  1 
ATOM   257  C  CZ  . ARG A 1 58  ? -29.983 -25.125 18.219  1.00 17.18 ? 73   ARG B CZ  1 
ATOM   258  N  NH1 . ARG A 1 58  ? -29.422 -25.827 19.197  1.00 20.59 ? 73   ARG B NH1 1 
ATOM   259  N  NH2 . ARG A 1 58  ? -29.263 -24.240 17.548  1.00 17.67 ? 73   ARG B NH2 1 
ATOM   260  N  N   . SER A 1 59  ? -35.823 -30.654 17.687  1.00 21.67 ? 74   SER B N   1 
ATOM   261  C  CA  . SER A 1 59  ? -36.692 -31.613 18.362  1.00 20.72 ? 74   SER B CA  1 
ATOM   262  C  C   . SER A 1 59  ? -36.716 -32.976 17.670  1.00 25.91 ? 74   SER B C   1 
ATOM   263  O  O   . SER A 1 59  ? -37.345 -33.917 18.154  1.00 27.64 ? 74   SER B O   1 
ATOM   264  C  CB  . SER A 1 59  ? -38.111 -31.052 18.495  1.00 24.88 ? 74   SER B CB  1 
ATOM   265  O  OG  . SER A 1 59  ? -38.615 -30.626 17.240  1.00 31.54 ? 74   SER B OG  1 
ATOM   266  N  N   . SER A 1 60  ? -36.020 -33.077 16.542  1.00 19.37 ? 75   SER B N   1 
ATOM   267  C  CA  . SER A 1 60  ? -35.959 -34.314 15.770  1.00 22.39 ? 75   SER B CA  1 
ATOM   268  C  C   . SER A 1 60  ? -35.101 -35.375 16.451  1.00 23.09 ? 75   SER B C   1 
ATOM   269  O  O   . SER A 1 60  ? -34.119 -35.053 17.118  1.00 19.82 ? 75   SER B O   1 
ATOM   270  C  CB  . SER A 1 60  ? -35.368 -34.040 14.384  1.00 19.36 ? 75   SER B CB  1 
ATOM   271  O  OG  . SER A 1 60  ? -36.057 -32.993 13.723  1.00 24.40 ? 75   SER B OG  1 
ATOM   272  N  N   . GLU A 1 61  ? -35.458 -36.641 16.261  1.00 23.71 ? 76   GLU B N   1 
ATOM   273  C  CA  . GLU A 1 61  ? -34.586 -37.736 16.672  1.00 19.40 ? 76   GLU B CA  1 
ATOM   274  C  C   . GLU A 1 61  ? -33.240 -37.583 15.982  1.00 20.89 ? 76   GLU B C   1 
ATOM   275  O  O   . GLU A 1 61  ? -32.189 -37.838 16.572  1.00 17.69 ? 76   GLU B O   1 
ATOM   276  C  CB  . GLU A 1 61  ? -35.192 -39.086 16.286  1.00 36.21 ? 76   GLU B CB  1 
ATOM   277  C  CG  . GLU A 1 61  ? -36.417 -39.496 17.082  1.00 38.68 ? 76   GLU B CG  1 
ATOM   278  C  CD  . GLU A 1 61  ? -36.057 -40.319 18.298  1.00 42.44 ? 76   GLU B CD  1 
ATOM   279  O  OE1 . GLU A 1 61  ? -35.217 -41.239 18.166  1.00 42.52 ? 76   GLU B OE1 1 
ATOM   280  O  OE2 . GLU A 1 61  ? -36.611 -40.045 19.383  1.00 45.74 ? 76   GLU B OE2 1 
ATOM   281  N  N   . ARG A 1 62  ? -33.273 -37.166 14.720  1.00 15.35 ? 77   ARG B N   1 
ATOM   282  C  CA  . ARG A 1 62  ? -32.046 -37.030 13.946  1.00 14.70 ? 77   ARG B CA  1 
ATOM   283  C  C   . ARG A 1 62  ? -31.183 -35.840 14.367  1.00 11.86 ? 77   ARG B C   1 
ATOM   284  O  O   . ARG A 1 62  ? -30.090 -35.675 13.854  1.00 11.87 ? 77   ARG B O   1 
ATOM   285  C  CB  . ARG A 1 62  ? -32.342 -36.988 12.442  1.00 13.00 ? 77   ARG B CB  1 
ATOM   286  C  CG  . ARG A 1 62  ? -32.560 -38.369 11.841  1.00 13.92 ? 77   ARG B CG  1 
ATOM   287  C  CD  . ARG A 1 62  ? -33.258 -38.305 10.491  1.00 14.54 ? 77   ARG B CD  1 
ATOM   288  N  NE  . ARG A 1 62  ? -32.441 -37.687 9.451   1.00 13.59 ? 77   ARG B NE  1 
ATOM   289  C  CZ  . ARG A 1 62  ? -32.761 -36.554 8.831   1.00 11.16 ? 77   ARG B CZ  1 
ATOM   290  N  NH1 . ARG A 1 62  ? -33.887 -35.923 9.139   1.00 14.22 ? 77   ARG B NH1 1 
ATOM   291  N  NH2 . ARG A 1 62  ? -31.959 -36.069 7.895   1.00 12.57 ? 77   ARG B NH2 1 
ATOM   292  N  N   . PHE A 1 63  ? -31.662 -35.024 15.303  1.00 10.75 ? 78   PHE B N   1 
ATOM   293  C  CA  . PHE A 1 63  ? -30.801 -33.984 15.864  1.00 9.89  ? 78   PHE B CA  1 
ATOM   294  C  C   . PHE A 1 63  ? -29.544 -34.615 16.480  1.00 10.68 ? 78   PHE B C   1 
ATOM   295  O  O   . PHE A 1 63  ? -28.496 -33.980 16.562  1.00 9.97  ? 78   PHE B O   1 
ATOM   296  C  CB  . PHE A 1 63  ? -31.553 -33.133 16.892  1.00 11.63 ? 78   PHE B CB  1 
ATOM   297  C  CG  . PHE A 1 63  ? -30.740 -31.995 17.457  1.00 13.61 ? 78   PHE B CG  1 
ATOM   298  C  CD1 . PHE A 1 63  ? -30.308 -30.959 16.644  1.00 12.87 ? 78   PHE B CD1 1 
ATOM   299  C  CD2 . PHE A 1 63  ? -30.420 -31.956 18.805  1.00 15.49 ? 78   PHE B CD2 1 
ATOM   300  C  CE1 . PHE A 1 63  ? -29.564 -29.910 17.160  1.00 13.85 ? 78   PHE B CE1 1 
ATOM   301  C  CE2 . PHE A 1 63  ? -29.677 -30.906 19.328  1.00 16.28 ? 78   PHE B CE2 1 
ATOM   302  C  CZ  . PHE A 1 63  ? -29.247 -29.885 18.501  1.00 15.14 ? 78   PHE B CZ  1 
ATOM   303  N  N   . LYS A 1 64  ? -29.650 -35.880 16.891  1.00 11.56 ? 79   LYS B N   1 
ATOM   304  C  CA  . LYS A 1 64  ? -28.510 -36.593 17.465  1.00 13.07 ? 79   LYS B CA  1 
ATOM   305  C  C   . LYS A 1 64  ? -27.432 -36.922 16.434  1.00 12.53 ? 79   LYS B C   1 
ATOM   306  O  O   . LYS A 1 64  ? -26.332 -37.334 16.793  1.00 16.84 ? 79   LYS B O   1 
ATOM   307  C  CB  . LYS A 1 64  ? -28.978 -37.866 18.172  1.00 15.49 ? 79   LYS B CB  1 
ATOM   308  C  CG  . LYS A 1 64  ? -29.816 -37.576 19.392  1.00 14.09 ? 79   LYS B CG  1 
ATOM   309  C  CD  . LYS A 1 64  ? -30.144 -38.855 20.152  1.00 17.25 ? 79   LYS B CD  1 
ATOM   310  C  CE  . LYS A 1 64  ? -30.824 -39.857 19.247  1.00 18.29 ? 79   LYS B CE  1 
ATOM   311  N  NZ  . LYS A 1 64  ? -32.226 -39.464 18.947  1.00 28.37 ? 79   LYS B NZ  1 
ATOM   312  N  N   . GLU A 1 65  ? -27.754 -36.736 15.159  1.00 11.82 ? 80   GLU B N   1 
ATOM   313  C  CA  . GLU A 1 65  ? -26.774 -36.869 14.089  1.00 12.23 ? 80   GLU B CA  1 
ATOM   314  C  C   . GLU A 1 65  ? -25.778 -35.712 14.132  1.00 12.30 ? 80   GLU B C   1 
ATOM   315  O  O   . GLU A 1 65  ? -24.698 -35.798 13.545  1.00 13.08 ? 80   GLU B O   1 
ATOM   316  C  CB  . GLU A 1 65  ? -27.458 -36.856 12.716  1.00 14.83 ? 80   GLU B CB  1 
ATOM   317  C  CG  . GLU A 1 65  ? -28.406 -38.017 12.441  1.00 16.69 ? 80   GLU B CG  1 
ATOM   318  C  CD  . GLU A 1 65  ? -27.689 -39.274 11.992  1.00 16.25 ? 80   GLU B CD  1 
ATOM   319  O  OE1 . GLU A 1 65  ? -26.922 -39.215 11.005  1.00 17.10 ? 80   GLU B OE1 1 
ATOM   320  O  OE2 . GLU A 1 65  ? -27.897 -40.330 12.625  1.00 22.90 ? 80   GLU B OE2 1 
ATOM   321  N  N   . LEU A 1 66  ? -26.157 -34.618 14.792  1.00 10.08 ? 81   LEU B N   1 
ATOM   322  C  CA  . LEU A 1 66  ? -25.353 -33.403 14.759  1.00 8.66  ? 81   LEU B CA  1 
ATOM   323  C  C   . LEU A 1 66  ? -24.478 -33.263 16.000  1.00 9.69  ? 81   LEU B C   1 
ATOM   324  O  O   . LEU A 1 66  ? -24.908 -33.540 17.127  1.00 11.69 ? 81   LEU B O   1 
ATOM   325  C  CB  . LEU A 1 66  ? -26.249 -32.174 14.586  1.00 7.03  ? 81   LEU B CB  1 
ATOM   326  C  CG  . LEU A 1 66  ? -27.204 -32.249 13.393  1.00 8.51  ? 81   LEU B CG  1 
ATOM   327  C  CD1 . LEU A 1 66  ? -27.932 -30.924 13.208  1.00 10.99 ? 81   LEU B CD1 1 
ATOM   328  C  CD2 . LEU A 1 66  ? -26.466 -32.642 12.125  1.00 9.94  ? 81   LEU B CD2 1 
ATOM   329  N  N   . THR A 1 67  ? -23.241 -32.841 15.764  1.00 9.03  ? 82   THR B N   1 
ATOM   330  C  CA  . THR A 1 67  ? -22.237 -32.651 16.797  1.00 11.94 ? 82   THR B CA  1 
ATOM   331  C  C   . THR A 1 67  ? -21.670 -31.233 16.640  1.00 12.30 ? 82   THR B C   1 
ATOM   332  O  O   . THR A 1 67  ? -21.442 -30.776 15.522  1.00 9.02  ? 82   THR B O   1 
ATOM   333  C  CB  . THR A 1 67  ? -21.131 -33.739 16.675  1.00 14.25 ? 82   THR B CB  1 
ATOM   334  O  OG1 . THR A 1 67  ? -20.156 -33.574 17.712  1.00 16.16 ? 82   THR B OG1 1 
ATOM   335  C  CG2 . THR A 1 67  ? -20.447 -33.710 15.298  1.00 16.30 ? 82   THR B CG2 1 
ATOM   336  N  N   . PRO A 1 68  ? -21.470 -30.514 17.753  1.00 10.79 ? 83   PRO B N   1 
ATOM   337  C  CA  . PRO A 1 68  ? -21.004 -29.121 17.686  1.00 9.23  ? 83   PRO B CA  1 
ATOM   338  C  C   . PRO A 1 68  ? -19.502 -29.013 17.416  1.00 10.64 ? 83   PRO B C   1 
ATOM   339  O  O   . PRO A 1 68  ? -18.709 -29.553 18.182  1.00 13.18 ? 83   PRO B O   1 
ATOM   340  C  CB  . PRO A 1 68  ? -21.307 -28.565 19.084  1.00 12.23 ? 83   PRO B CB  1 
ATOM   341  C  CG  . PRO A 1 68  ? -22.003 -29.680 19.835  1.00 16.62 ? 83   PRO B CG  1 
ATOM   342  C  CD  . PRO A 1 68  ? -21.718 -30.958 19.135  1.00 13.62 ? 83   PRO B CD  1 
ATOM   343  N  N   . ASN A 1 69  ? -19.116 -28.324 16.346  1.00 8.30  ? 84   ASN B N   1 
ATOM   344  C  CA  . ASN A 1 69  ? -17.704 -28.166 16.022  1.00 7.62  ? 84   ASN B CA  1 
ATOM   345  C  C   . ASN A 1 69  ? -17.137 -26.911 16.688  1.00 7.85  ? 84   ASN B C   1 
ATOM   346  O  O   . ASN A 1 69  ? -17.560 -25.797 16.368  1.00 7.93  ? 84   ASN B O   1 
ATOM   347  C  CB  . ASN A 1 69  ? -17.518 -28.098 14.499  1.00 7.14  ? 84   ASN B CB  1 
ATOM   348  C  CG  . ASN A 1 69  ? -16.063 -28.222 14.081  1.00 10.45 ? 84   ASN B CG  1 
ATOM   349  O  OD1 . ASN A 1 69  ? -15.163 -27.781 14.791  1.00 12.31 ? 84   ASN B OD1 1 
ATOM   350  N  ND2 . ASN A 1 69  ? -15.825 -28.816 12.914  1.00 8.79  ? 84   ASN B ND2 1 
ATOM   351  N  N   . TYR A 1 70  ? -16.219 -27.110 17.635  1.00 7.57  ? 85   TYR B N   1 
ATOM   352  C  CA  . TYR A 1 70  ? -15.546 -26.008 18.322  1.00 8.95  ? 85   TYR B CA  1 
ATOM   353  C  C   . TYR A 1 70  ? -14.040 -25.978 18.034  1.00 10.54 ? 85   TYR B C   1 
ATOM   354  O  O   . TYR A 1 70  ? -13.233 -25.587 18.874  1.00 12.52 ? 85   TYR B O   1 
ATOM   355  C  CB  . TYR A 1 70  ? -15.835 -26.050 19.834  1.00 9.06  ? 85   TYR B CB  1 
ATOM   356  C  CG  . TYR A 1 70  ? -17.029 -25.197 20.194  1.00 7.71  ? 85   TYR B CG  1 
ATOM   357  C  CD1 . TYR A 1 70  ? -16.889 -23.823 20.328  1.00 11.41 ? 85   TYR B CD1 1 
ATOM   358  C  CD2 . TYR A 1 70  ? -18.295 -25.752 20.371  1.00 9.12  ? 85   TYR B CD2 1 
ATOM   359  C  CE1 . TYR A 1 70  ? -17.959 -23.022 20.634  1.00 12.35 ? 85   TYR B CE1 1 
ATOM   360  C  CE2 . TYR A 1 70  ? -19.387 -24.943 20.684  1.00 9.25  ? 85   TYR B CE2 1 
ATOM   361  C  CZ  . TYR A 1 70  ? -19.198 -23.581 20.808  1.00 10.48 ? 85   TYR B CZ  1 
ATOM   362  O  OH  . TYR A 1 70  ? -20.242 -22.748 21.120  1.00 16.93 ? 85   TYR B OH  1 
ATOM   363  N  N   . ASN A 1 71  ? -13.669 -26.377 16.823  1.00 8.87  ? 86   ASN B N   1 
ATOM   364  C  CA  . ASN A 1 71  ? -12.281 -26.318 16.390  1.00 8.82  ? 86   ASN B CA  1 
ATOM   365  C  C   . ASN A 1 71  ? -11.775 -24.878 16.462  1.00 9.73  ? 86   ASN B C   1 
ATOM   366  O  O   . ASN A 1 71  ? -12.309 -23.998 15.796  1.00 9.87  ? 86   ASN B O   1 
ATOM   367  C  CB  . ASN A 1 71  ? -12.194 -26.848 14.954  1.00 8.13  ? 86   ASN B CB  1 
ATOM   368  C  CG  . ASN A 1 71  ? -10.770 -27.031 14.466  1.00 8.55  ? 86   ASN B CG  1 
ATOM   369  O  OD1 . ASN A 1 71  ? -9.833  -26.414 14.970  1.00 11.12 ? 86   ASN B OD1 1 
ATOM   370  N  ND2 . ASN A 1 71  ? -10.606 -27.879 13.450  1.00 10.94 ? 86   ASN B ND2 1 
ATOM   371  N  N   . PRO A 1 72  ? -10.748 -24.625 17.285  1.00 10.77 ? 87   PRO B N   1 
ATOM   372  C  CA  . PRO A 1 72  ? -10.233 -23.262 17.442  1.00 11.08 ? 87   PRO B CA  1 
ATOM   373  C  C   . PRO A 1 72  ? -9.669  -22.688 16.147  1.00 10.43 ? 87   PRO B C   1 
ATOM   374  O  O   . PRO A 1 72  ? -9.490  -21.474 16.047  1.00 12.07 ? 87   PRO B O   1 
ATOM   375  C  CB  . PRO A 1 72  ? -9.099  -23.427 18.465  1.00 13.22 ? 87   PRO B CB  1 
ATOM   376  C  CG  . PRO A 1 72  ? -9.365  -24.698 19.148  1.00 15.90 ? 87   PRO B CG  1 
ATOM   377  C  CD  . PRO A 1 72  ? -10.084 -25.584 18.183  1.00 10.76 ? 87   PRO B CD  1 
ATOM   378  N  N   . ASP A 1 73  ? -9.389  -23.554 15.178  1.00 9.37  ? 88   ASP B N   1 
ATOM   379  C  CA  . ASP A 1 73  ? -8.812  -23.111 13.916  1.00 10.09 ? 88   ASP B CA  1 
ATOM   380  C  C   . ASP A 1 73  ? -9.865  -22.876 12.832  1.00 10.65 ? 88   ASP B C   1 
ATOM   381  O  O   . ASP A 1 73  ? -9.526  -22.732 11.660  1.00 10.71 ? 88   ASP B O   1 
ATOM   382  C  CB  . ASP A 1 73  ? -7.762  -24.110 13.427  1.00 10.29 ? 88   ASP B CB  1 
ATOM   383  C  CG  . ASP A 1 73  ? -6.535  -24.154 14.322  1.00 12.77 ? 88   ASP B CG  1 
ATOM   384  O  OD1 . ASP A 1 73  ? -6.191  -23.109 14.914  1.00 14.65 ? 88   ASP B OD1 1 
ATOM   385  O  OD2 . ASP A 1 73  ? -5.914  -25.231 14.417  1.00 17.06 ? 88   ASP B OD2 1 
ATOM   386  N  N   . ILE A 1 74  ? -11.136 -22.844 13.225  1.00 7.77  ? 89   ILE B N   1 
ATOM   387  C  CA  . ILE A 1 74  ? -12.213 -22.470 12.304  1.00 8.01  ? 89   ILE B CA  1 
ATOM   388  C  C   . ILE A 1 74  ? -13.014 -21.311 12.888  1.00 8.16  ? 89   ILE B C   1 
ATOM   389  O  O   . ILE A 1 74  ? -13.321 -21.304 14.083  1.00 9.68  ? 89   ILE B O   1 
ATOM   390  C  CB  . ILE A 1 74  ? -13.164 -23.642 12.007  1.00 6.94  ? 89   ILE B CB  1 
ATOM   391  C  CG1 . ILE A 1 74  ? -12.384 -24.850 11.481  1.00 7.07  ? 89   ILE B CG1 1 
ATOM   392  C  CG2 . ILE A 1 74  ? -14.244 -23.215 10.998  1.00 7.77  ? 89   ILE B CG2 1 
ATOM   393  C  CD1 . ILE A 1 74  ? -13.201 -26.121 11.392  1.00 9.33  ? 89   ILE B CD1 1 
ATOM   394  N  N   . ILE A 1 75  ? -13.337 -20.333 12.050  1.00 7.79  ? 90   ILE B N   1 
ATOM   395  C  CA  . ILE A 1 75  ? -14.181 -19.200 12.429  1.00 7.24  ? 90   ILE B CA  1 
ATOM   396  C  C   . ILE A 1 75  ? -15.611 -19.505 12.000  1.00 8.81  ? 90   ILE B C   1 
ATOM   397  O  O   . ILE A 1 75  ? -15.829 -19.953 10.876  1.00 8.29  ? 90   ILE B O   1 
ATOM   398  C  CB  . ILE A 1 75  ? -13.725 -17.903 11.721  1.00 9.78  ? 90   ILE B CB  1 
ATOM   399  C  CG1 . ILE A 1 75  ? -12.248 -17.616 12.022  1.00 12.21 ? 90   ILE B CG1 1 
ATOM   400  C  CG2 . ILE A 1 75  ? -14.623 -16.735 12.110  1.00 10.38 ? 90   ILE B CG2 1 
ATOM   401  C  CD1 . ILE A 1 75  ? -11.902 -17.659 13.485  1.00 18.24 ? 90   ILE B CD1 1 
ATOM   402  N  N   . PHE A 1 76  ? -16.578 -19.296 12.891  1.00 8.28  ? 91   PHE B N   1 
ATOM   403  C  CA  . PHE A 1 76  ? -17.989 -19.478 12.553  1.00 7.80  ? 91   PHE B CA  1 
ATOM   404  C  C   . PHE A 1 76  ? -18.734 -18.153 12.639  1.00 9.96  ? 91   PHE B C   1 
ATOM   405  O  O   . PHE A 1 76  ? -18.722 -17.491 13.680  1.00 10.38 ? 91   PHE B O   1 
ATOM   406  C  CB  . PHE A 1 76  ? -18.652 -20.520 13.469  1.00 8.16  ? 91   PHE B CB  1 
ATOM   407  C  CG  . PHE A 1 76  ? -18.138 -21.924 13.268  1.00 6.58  ? 91   PHE B CG  1 
ATOM   408  C  CD1 . PHE A 1 76  ? -18.814 -22.821 12.444  1.00 7.19  ? 91   PHE B CD1 1 
ATOM   409  C  CD2 . PHE A 1 76  ? -16.975 -22.342 13.889  1.00 5.95  ? 91   PHE B CD2 1 
ATOM   410  C  CE1 . PHE A 1 76  ? -18.340 -24.106 12.255  1.00 6.79  ? 91   PHE B CE1 1 
ATOM   411  C  CE2 . PHE A 1 76  ? -16.500 -23.627 13.704  1.00 6.59  ? 91   PHE B CE2 1 
ATOM   412  C  CZ  . PHE A 1 76  ? -17.183 -24.507 12.885  1.00 8.10  ? 91   PHE B CZ  1 
ATOM   413  N  N   . LYS A 1 77  ? -19.374 -17.757 11.546  1.00 9.13  ? 92   LYS B N   1 
ATOM   414  C  CA  . LYS A 1 77  ? -20.082 -16.476 11.503  1.00 8.30  ? 92   LYS B CA  1 
ATOM   415  C  C   . LYS A 1 77  ? -21.240 -16.411 12.499  1.00 9.66  ? 92   LYS B C   1 
ATOM   416  O  O   . LYS A 1 77  ? -21.413 -15.404 13.200  1.00 12.21 ? 92   LYS B O   1 
ATOM   417  C  CB  . LYS A 1 77  ? -20.580 -16.194 10.081  1.00 9.21  ? 92   LYS B CB  1 
ATOM   418  C  CG  . LYS A 1 77  ? -21.119 -14.781 9.865   1.00 9.98  ? 92   LYS B CG  1 
ATOM   419  C  CD  . LYS A 1 77  ? -21.517 -14.583 8.403   1.00 13.01 ? 92   LYS B CD  1 
ATOM   420  C  CE  . LYS A 1 77  ? -21.830 -13.127 8.105   1.00 18.33 ? 92   LYS B CE  1 
ATOM   421  N  NZ  . LYS A 1 77  ? -22.984 -12.649 8.912   1.00 26.35 ? 92   LYS B NZ  1 
ATOM   422  N  N   . ASP A 1 78  ? -22.040 -17.473 12.552  1.00 9.71  ? 93   ASP B N   1 
ATOM   423  C  CA  . ASP A 1 78  ? -23.157 -17.557 13.492  1.00 8.22  ? 93   ASP B CA  1 
ATOM   424  C  C   . ASP A 1 78  ? -24.031 -16.307 13.475  1.00 10.92 ? 93   ASP B C   1 
ATOM   425  O  O   . ASP A 1 78  ? -24.282 -15.714 14.523  1.00 13.70 ? 93   ASP B O   1 
ATOM   426  C  CB  . ASP A 1 78  ? -22.625 -17.810 14.909  1.00 12.05 ? 93   ASP B CB  1 
ATOM   427  C  CG  . ASP A 1 78  ? -23.733 -18.091 15.909  1.00 14.11 ? 93   ASP B CG  1 
ATOM   428  O  OD1 . ASP A 1 78  ? -24.767 -18.673 15.521  1.00 11.76 ? 93   ASP B OD1 1 
ATOM   429  O  OD2 . ASP A 1 78  ? -23.568 -17.717 17.092  1.00 20.39 ? 93   ASP B OD2 1 
ATOM   430  N  N   . GLU A 1 79  ? -24.500 -15.900 12.303  1.00 10.42 ? 94   GLU B N   1 
ATOM   431  C  CA  . GLU A 1 79  ? -25.266 -14.656 12.248  1.00 12.69 ? 94   GLU B CA  1 
ATOM   432  C  C   . GLU A 1 79  ? -26.592 -14.771 13.012  1.00 15.96 ? 94   GLU B C   1 
ATOM   433  O  O   . GLU A 1 79  ? -27.110 -13.769 13.509  1.00 16.35 ? 94   GLU B O   1 
ATOM   434  C  CB  . GLU A 1 79  ? -25.455 -14.170 10.810  1.00 19.27 ? 94   GLU B CB  1 
ATOM   435  C  CG  . GLU A 1 79  ? -26.511 -14.894 10.030  1.00 15.47 ? 94   GLU B CG  1 
ATOM   436  C  CD  . GLU A 1 79  ? -26.460 -14.592 8.532   1.00 16.78 ? 94   GLU B CD  1 
ATOM   437  O  OE1 . GLU A 1 79  ? -27.402 -14.983 7.832   1.00 17.80 ? 94   GLU B OE1 1 
ATOM   438  O  OE2 . GLU A 1 79  ? -25.482 -13.982 8.050   1.00 19.95 ? 94   GLU B OE2 1 
ATOM   439  N  N   . GLU A 1 80  ? -27.116 -15.993 13.136  1.00 12.32 ? 95   GLU B N   1 
ATOM   440  C  CA  . GLU A 1 80  ? -28.366 -16.236 13.866  1.00 13.71 ? 95   GLU B CA  1 
ATOM   441  C  C   . GLU A 1 80  ? -28.186 -16.173 15.386  1.00 12.03 ? 95   GLU B C   1 
ATOM   442  O  O   . GLU A 1 80  ? -29.164 -16.121 16.139  1.00 15.29 ? 95   GLU B O   1 
ATOM   443  C  CB  . GLU A 1 80  ? -28.954 -17.598 13.478  1.00 14.93 ? 95   GLU B CB  1 
ATOM   444  C  CG  . GLU A 1 80  ? -29.287 -17.749 11.996  1.00 15.24 ? 95   GLU B CG  1 
ATOM   445  C  CD  . GLU A 1 80  ? -28.075 -18.109 11.132  1.00 20.63 ? 95   GLU B CD  1 
ATOM   446  O  OE1 . GLU A 1 80  ? -28.225 -18.114 9.887   1.00 19.13 ? 95   GLU B OE1 1 
ATOM   447  O  OE2 . GLU A 1 80  ? -26.978 -18.381 11.685  1.00 15.45 ? 95   GLU B OE2 1 
ATOM   448  N  N   . ASN A 1 81  ? -26.933 -16.199 15.833  1.00 11.74 ? 96   ASN B N   1 
ATOM   449  C  CA  . ASN A 1 81  ? -26.618 -16.178 17.257  1.00 13.35 ? 96   ASN B CA  1 
ATOM   450  C  C   . ASN A 1 81  ? -27.232 -17.365 17.994  1.00 13.85 ? 96   ASN B C   1 
ATOM   451  O  O   . ASN A 1 81  ? -27.716 -17.224 19.121  1.00 16.38 ? 96   ASN B O   1 
ATOM   452  C  CB  . ASN A 1 81  ? -27.084 -14.860 17.886  1.00 12.84 ? 96   ASN B CB  1 
ATOM   453  C  CG  . ASN A 1 81  ? -26.369 -14.551 19.183  1.00 17.78 ? 96   ASN B CG  1 
ATOM   454  O  OD1 . ASN A 1 81  ? -25.171 -14.801 19.321  1.00 18.01 ? 96   ASN B OD1 1 
ATOM   455  N  ND2 . ASN A 1 81  ? -27.101 -13.994 20.146  1.00 19.40 ? 96   ASN B ND2 1 
ATOM   456  N  N   . THR A 1 82  ? -27.196 -18.538 17.360  1.00 12.06 ? 97   THR B N   1 
ATOM   457  C  CA  . THR A 1 82  ? -27.776 -19.757 17.921  1.00 10.93 ? 97   THR B CA  1 
ATOM   458  C  C   . THR A 1 82  ? -26.775 -20.899 18.008  1.00 11.01 ? 97   THR B C   1 
ATOM   459  O  O   . THR A 1 82  ? -27.063 -21.941 18.601  1.00 13.21 ? 97   THR B O   1 
ATOM   460  C  CB  . THR A 1 82  ? -28.908 -20.286 17.039  1.00 11.89 ? 97   THR B CB  1 
ATOM   461  O  OG1 . THR A 1 82  ? -28.396 -20.488 15.717  1.00 9.75  ? 97   THR B OG1 1 
ATOM   462  C  CG2 . THR A 1 82  ? -30.064 -19.306 16.987  1.00 12.71 ? 97   THR B CG2 1 
ATOM   463  N  N   . GLY A 1 83  ? -25.615 -20.716 17.394  1.00 10.54 ? 98   GLY B N   1 
ATOM   464  C  CA  . GLY A 1 83  ? -24.646 -21.793 17.280  1.00 9.83  ? 98   GLY B CA  1 
ATOM   465  C  C   . GLY A 1 83  ? -24.973 -22.838 16.222  1.00 10.44 ? 98   GLY B C   1 
ATOM   466  O  O   . GLY A 1 83  ? -24.265 -23.834 16.117  1.00 9.55  ? 98   GLY B O   1 
ATOM   467  N  N   . ALA A 1 84  ? -26.027 -22.615 15.436  1.00 9.43  ? 99   ALA B N   1 
ATOM   468  C  CA  . ALA A 1 84  ? -26.415 -23.588 14.416  1.00 7.83  ? 99   ALA B CA  1 
ATOM   469  C  C   . ALA A 1 84  ? -25.285 -23.886 13.433  1.00 8.23  ? 99   ALA B C   1 
ATOM   470  O  O   . ALA A 1 84  ? -25.138 -25.025 12.995  1.00 8.51  ? 99   ALA B O   1 
ATOM   471  C  CB  . ALA A 1 84  ? -27.653 -23.114 13.659  1.00 9.00  ? 99   ALA B CB  1 
ATOM   472  N  N   . ASP A 1 85  ? -24.495 -22.876 13.072  1.00 6.81  ? 100  ASP B N   1 
ATOM   473  C  CA  . ASP A 1 85  ? -23.436 -23.089 12.082  1.00 8.40  ? 100  ASP B CA  1 
ATOM   474  C  C   . ASP A 1 85  ? -22.438 -24.167 12.524  1.00 7.27  ? 100  ASP B C   1 
ATOM   475  O  O   . ASP A 1 85  ? -21.761 -24.773 11.693  1.00 8.15  ? 100  ASP B O   1 
ATOM   476  C  CB  . ASP A 1 85  ? -22.656 -21.797 11.810  1.00 8.04  ? 100  ASP B CB  1 
ATOM   477  C  CG  . ASP A 1 85  ? -23.408 -20.803 10.931  1.00 11.35 ? 100  ASP B CG  1 
ATOM   478  O  OD1 . ASP A 1 85  ? -22.957 -19.642 10.881  1.00 12.02 ? 100  ASP B OD1 1 
ATOM   479  O  OD2 . ASP A 1 85  ? -24.423 -21.153 10.289  1.00 10.23 ? 100  ASP B OD2 1 
ATOM   480  N  N   . ARG A 1 86  ? -22.327 -24.388 13.828  1.00 7.34  ? 101  ARG B N   1 
ATOM   481  C  CA  . ARG A 1 86  ? -21.344 -25.335 14.344  1.00 6.53  ? 101  ARG B CA  1 
ATOM   482  C  C   . ARG A 1 86  ? -21.858 -26.766 14.336  1.00 7.40  ? 101  ARG B C   1 
ATOM   483  O  O   . ARG A 1 86  ? -21.075 -27.711 14.446  1.00 7.85  ? 101  ARG B O   1 
ATOM   484  C  CB  . ARG A 1 86  ? -20.956 -24.970 15.780  1.00 6.91  ? 101  ARG B CB  1 
ATOM   485  C  CG  . ARG A 1 86  ? -20.221 -23.657 15.906  1.00 8.90  ? 101  ARG B CG  1 
ATOM   486  C  CD  . ARG A 1 86  ? -19.913 -23.359 17.359  1.00 10.00 ? 101  ARG B CD  1 
ATOM   487  N  NE  . ARG A 1 86  ? -19.237 -22.072 17.482  1.00 10.30 ? 101  ARG B NE  1 
ATOM   488  C  CZ  . ARG A 1 86  ? -17.926 -21.898 17.345  1.00 9.54  ? 101  ARG B CZ  1 
ATOM   489  N  NH1 . ARG A 1 86  ? -17.130 -22.926 17.094  1.00 9.25  ? 101  ARG B NH1 1 
ATOM   490  N  NH2 . ARG A 1 86  ? -17.405 -20.684 17.483  1.00 13.46 ? 101  ARG B NH2 1 
ATOM   491  N  N   . LEU A 1 87  ? -23.168 -26.928 14.220  1.00 6.66  ? 102  LEU B N   1 
ATOM   492  C  CA  . LEU A 1 87  ? -23.763 -28.250 14.372  1.00 7.10  ? 102  LEU B CA  1 
ATOM   493  C  C   . LEU A 1 87  ? -23.794 -28.972 13.034  1.00 7.72  ? 102  LEU B C   1 
ATOM   494  O  O   . LEU A 1 87  ? -24.413 -28.500 12.077  1.00 7.38  ? 102  LEU B O   1 
ATOM   495  C  CB  . LEU A 1 87  ? -25.158 -28.145 14.999  1.00 8.14  ? 102  LEU B CB  1 
ATOM   496  C  CG  . LEU A 1 87  ? -25.150 -27.908 16.514  1.00 10.37 ? 102  LEU B CG  1 
ATOM   497  C  CD1 . LEU A 1 87  ? -26.423 -27.222 16.980  1.00 14.07 ? 102  LEU B CD1 1 
ATOM   498  C  CD2 . LEU A 1 87  ? -24.954 -29.224 17.248  1.00 11.20 ? 102  LEU B CD2 1 
ATOM   499  N  N   . MET A 1 88  ? -23.130 -30.122 12.971  1.00 7.18  ? 103  MET B N   1 
ATOM   500  C  CA  . MET A 1 88  ? -22.928 -30.798 11.698  1.00 5.29  ? 103  MET B CA  1 
ATOM   501  C  C   . MET A 1 88  ? -22.701 -32.285 11.934  1.00 7.03  ? 103  MET B C   1 
ATOM   502  O  O   . MET A 1 88  ? -22.408 -32.709 13.057  1.00 7.78  ? 103  MET B O   1 
ATOM   503  C  CB  . MET A 1 88  ? -21.718 -30.182 10.985  1.00 7.52  ? 103  MET B CB  1 
ATOM   504  C  CG  . MET A 1 88  ? -20.400 -30.327 11.759  1.00 8.40  ? 103  MET B CG  1 
ATOM   505  S  SD  . MET A 1 88  ? -19.044 -29.415 10.976  1.00 7.65  ? 103  MET B SD  1 
ATOM   506  C  CE  . MET A 1 88  ? -19.609 -27.730 11.238  1.00 7.45  ? 103  MET B CE  1 
ATOM   507  N  N   . THR A 1 89  ? -22.819 -33.091 10.888  1.00 5.94  ? 104  THR B N   1 
ATOM   508  C  CA  . THR A 1 89  ? -22.568 -34.515 11.058  1.00 7.61  ? 104  THR B CA  1 
ATOM   509  C  C   . THR A 1 89  ? -21.091 -34.777 11.305  1.00 8.72  ? 104  THR B C   1 
ATOM   510  O  O   . THR A 1 89  ? -20.235 -33.936 11.037  1.00 7.76  ? 104  THR B O   1 
ATOM   511  C  CB  . THR A 1 89  ? -22.999 -35.334 9.842   1.00 6.95  ? 104  THR B CB  1 
ATOM   512  O  OG1 . THR A 1 89  ? -22.226 -34.929 8.697   1.00 7.59  ? 104  THR B OG1 1 
ATOM   513  C  CG2 . THR A 1 89  ? -24.483 -35.163 9.575   1.00 8.34  ? 104  THR B CG2 1 
ATOM   514  N  N   . GLN A 1 90  ? -20.789 -35.971 11.794  1.00 8.31  ? 105  GLN B N   1 
ATOM   515  C  CA  . GLN A 1 90  ? -19.411 -36.336 12.054  1.00 9.87  ? 105  GLN B CA  1 
ATOM   516  C  C   . GLN A 1 90  ? -18.547 -36.252 10.791  1.00 7.91  ? 105  GLN B C   1 
ATOM   517  O  O   . GLN A 1 90  ? -17.424 -35.744 10.838  1.00 7.47  ? 105  GLN B O   1 
ATOM   518  C  CB  . GLN A 1 90  ? -19.341 -37.736 12.676  1.00 11.31 ? 105  GLN B CB  1 
ATOM   519  C  CG  . GLN A 1 90  ? -17.944 -38.159 13.096  1.00 16.15 ? 105  GLN B CG  1 
ATOM   520  C  CD  . GLN A 1 90  ? -17.370 -37.273 14.183  1.00 14.96 ? 105  GLN B CD  1 
ATOM   521  O  OE1 . GLN A 1 90  ? -18.050 -36.941 15.159  1.00 21.02 ? 105  GLN B OE1 1 
ATOM   522  N  NE2 . GLN A 1 90  ? -16.114 -36.878 14.020  1.00 17.97 ? 105  GLN B NE2 1 
ATOM   523  N  N   . ARG A 1 91  ? -19.065 -36.750 9.665   1.00 8.07  ? 106  ARG B N   1 
ATOM   524  C  CA  . ARG A 1 91  ? -18.309 -36.699 8.417   1.00 8.01  ? 106  ARG B CA  1 
ATOM   525  C  C   . ARG A 1 91  ? -18.051 -35.248 7.998   1.00 6.79  ? 106  ARG B C   1 
ATOM   526  O  O   . ARG A 1 91  ? -16.944 -34.903 7.581   1.00 7.38  ? 106  ARG B O   1 
ATOM   527  C  CB  . ARG A 1 91  ? -19.011 -37.485 7.306   1.00 8.59  ? 106  ARG B CB  1 
ATOM   528  C  CG  . ARG A 1 91  ? -18.192 -37.587 6.032   1.00 8.03  ? 106  ARG B CG  1 
ATOM   529  C  CD  . ARG A 1 91  ? -18.919 -38.407 4.979   1.00 9.33  ? 106  ARG B CD  1 
ATOM   530  N  NE  . ARG A 1 91  ? -18.154 -38.498 3.735   1.00 13.40 ? 106  ARG B NE  1 
ATOM   531  C  CZ  . ARG A 1 91  ? -17.201 -39.395 3.498   1.00 18.31 ? 106  ARG B CZ  1 
ATOM   532  N  NH1 . ARG A 1 91  ? -16.883 -40.301 4.421   1.00 19.97 ? 106  ARG B NH1 1 
ATOM   533  N  NH2 . ARG A 1 91  ? -16.562 -39.391 2.333   1.00 22.16 ? 106  ARG B NH2 1 
ATOM   534  N  N   . CYS A 1 92  ? -19.060 -34.399 8.138   1.00 6.42  ? 107  CYS B N   1 
ATOM   535  C  CA  . CYS A 1 92  ? -18.874 -32.985 7.839   1.00 6.08  ? 107  CYS B CA  1 
ATOM   536  C  C   . CYS A 1 92  ? -17.768 -32.411 8.730   1.00 7.15  ? 107  CYS B C   1 
ATOM   537  O  O   . CYS A 1 92  ? -16.884 -31.692 8.261   1.00 7.59  ? 107  CYS B O   1 
ATOM   538  C  CB  . CYS A 1 92  ? -20.179 -32.211 8.051   1.00 5.72  ? 107  CYS B CB  1 
ATOM   539  S  SG  . CYS A 1 92  ? -20.201 -30.582 7.262   1.00 7.55  ? 107  CYS B SG  1 
ATOM   540  N  N   . LYS A 1 93  ? -17.831 -32.715 10.023  1.00 8.13  ? 108  LYS B N   1 
ATOM   541  C  CA  . LYS A 1 93  ? -16.815 -32.249 10.968  1.00 7.92  ? 108  LYS B CA  1 
ATOM   542  C  C   . LYS A 1 93  ? -15.415 -32.706 10.566  1.00 6.44  ? 108  LYS B C   1 
ATOM   543  O  O   . LYS A 1 93  ? -14.457 -31.925 10.577  1.00 7.27  ? 108  LYS B O   1 
ATOM   544  C  CB  . LYS A 1 93  ? -17.139 -32.744 12.380  1.00 10.13 ? 108  LYS B CB  1 
ATOM   545  C  CG  . LYS A 1 93  ? -16.037 -32.495 13.396  1.00 11.89 ? 108  LYS B CG  1 
ATOM   546  C  CD  . LYS A 1 93  ? -16.424 -32.995 14.783  1.00 15.44 ? 108  LYS B CD  1 
ATOM   547  C  CE  . LYS A 1 93  ? -15.236 -32.887 15.735  1.00 19.41 ? 108  LYS B CE  1 
ATOM   548  N  NZ  . LYS A 1 93  ? -15.562 -33.351 17.121  1.00 24.54 ? 108  LYS B NZ  1 
ATOM   549  N  N   . ASP A 1 94  ? -15.296 -33.982 10.214  1.00 8.13  ? 109  ASP B N   1 
ATOM   550  C  CA  . ASP A 1 94  ? -13.994 -34.539 9.862   1.00 9.02  ? 109  ASP B CA  1 
ATOM   551  C  C   . ASP A 1 94  ? -13.405 -33.895 8.607   1.00 9.05  ? 109  ASP B C   1 
ATOM   552  O  O   . ASP A 1 94  ? -12.214 -33.572 8.565   1.00 8.99  ? 109  ASP B O   1 
ATOM   553  C  CB  . ASP A 1 94  ? -14.097 -36.057 9.690   1.00 9.85  ? 109  ASP B CB  1 
ATOM   554  C  CG  . ASP A 1 94  ? -14.297 -36.782 11.012  1.00 14.82 ? 109  ASP B CG  1 
ATOM   555  O  OD1 . ASP A 1 94  ? -13.956 -36.213 12.070  1.00 18.30 ? 109  ASP B OD1 1 
ATOM   556  O  OD2 . ASP A 1 94  ? -14.792 -37.925 10.988  1.00 17.67 ? 109  ASP B OD2 1 
ATOM   557  N  N   . ARG A 1 95  ? -14.234 -33.715 7.584   1.00 7.99  ? 110  ARG B N   1 
ATOM   558  C  CA  . ARG A 1 95  ? -13.759 -33.084 6.355   1.00 8.95  ? 110  ARG B CA  1 
ATOM   559  C  C   . ARG A 1 95  ? -13.432 -31.611 6.586   1.00 6.42  ? 110  ARG B C   1 
ATOM   560  O  O   . ARG A 1 95  ? -12.440 -31.090 6.064   1.00 7.54  ? 110  ARG B O   1 
ATOM   561  C  CB  . ARG A 1 95  ? -14.786 -33.233 5.220   1.00 8.59  ? 110  ARG B CB  1 
ATOM   562  C  CG  . ARG A 1 95  ? -15.074 -34.684 4.796   1.00 8.34  ? 110  ARG B CG  1 
ATOM   563  C  CD  . ARG A 1 95  ? -13.794 -35.458 4.521   1.00 10.45 ? 110  ARG B CD  1 
ATOM   564  N  NE  . ARG A 1 95  ? -13.319 -36.204 5.688   1.00 12.05 ? 110  ARG B NE  1 
ATOM   565  C  CZ  . ARG A 1 95  ? -12.038 -36.314 6.033   1.00 17.93 ? 110  ARG B CZ  1 
ATOM   566  N  NH1 . ARG A 1 95  ? -11.694 -37.023 7.104   1.00 16.85 ? 110  ARG B NH1 1 
ATOM   567  N  NH2 . ARG A 1 95  ? -11.102 -35.694 5.325   1.00 14.89 ? 110  ARG B NH2 1 
ATOM   568  N  N   . LEU A 1 96  ? -14.264 -30.935 7.375   1.00 6.95  ? 111  LEU B N   1 
ATOM   569  C  CA  . LEU A 1 96  ? -14.033 -29.527 7.673   1.00 7.39  ? 111  LEU B CA  1 
ATOM   570  C  C   . LEU A 1 96  ? -12.741 -29.344 8.463   1.00 6.79  ? 111  LEU B C   1 
ATOM   571  O  O   . LEU A 1 96  ? -11.984 -28.399 8.230   1.00 8.12  ? 111  LEU B O   1 
ATOM   572  C  CB  . LEU A 1 96  ? -15.216 -28.943 8.446   1.00 8.05  ? 111  LEU B CB  1 
ATOM   573  C  CG  . LEU A 1 96  ? -15.320 -27.417 8.485   1.00 7.94  ? 111  LEU B CG  1 
ATOM   574  C  CD1 . LEU A 1 96  ? -15.722 -26.892 7.117   1.00 8.68  ? 111  LEU B CD1 1 
ATOM   575  C  CD2 . LEU A 1 96  ? -16.335 -26.977 9.546   1.00 9.76  ? 111  LEU B CD2 1 
ATOM   576  N  N   . ASN A 1 97  ? -12.479 -30.263 9.388   1.00 6.75  ? 112  ASN B N   1 
ATOM   577  C  CA  . ASN A 1 97  ? -11.278 -30.166 10.210  1.00 7.85  ? 112  ASN B CA  1 
ATOM   578  C  C   . ASN A 1 97  ? -10.006 -30.409 9.393   1.00 7.80  ? 112  ASN B C   1 
ATOM   579  O  O   . ASN A 1 97  ? -8.981  -29.755 9.605   1.00 9.19  ? 112  ASN B O   1 
ATOM   580  C  CB  . ASN A 1 97  ? -11.376 -31.126 11.395  1.00 8.29  ? 112  ASN B CB  1 
ATOM   581  C  CG  . ASN A 1 97  ? -12.352 -30.639 12.468  1.00 9.10  ? 112  ASN B CG  1 
ATOM   582  O  OD1 . ASN A 1 97  ? -12.840 -29.498 12.438  1.00 9.33  ? 112  ASN B OD1 1 
ATOM   583  N  ND2 . ASN A 1 97  ? -12.635 -31.512 13.438  1.00 10.97 ? 112  ASN B ND2 1 
ATOM   584  N  N   . SER A 1 98  ? -10.085 -31.329 8.438   1.00 8.00  ? 113  SER B N   1 
ATOM   585  C  CA  . SER A 1 98  ? -8.980  -31.547 7.513   1.00 7.78  ? 113  SER B CA  1 
ATOM   586  C  C   . SER A 1 98  ? -8.737  -30.289 6.678   1.00 7.98  ? 113  SER B C   1 
ATOM   587  O  O   . SER A 1 98  ? -7.604  -29.843 6.515   1.00 7.74  ? 113  SER B O   1 
ATOM   588  C  CB  . SER A 1 98  ? -9.278  -32.735 6.600   1.00 9.59  ? 113  SER B CB  1 
ATOM   589  O  OG  . SER A 1 98  ? -8.303  -32.845 5.579   0.90 11.24 ? 113  SER B OG  1 
ATOM   590  N  N   . LEU A 1 99  ? -9.816  -29.707 6.164   1.00 7.34  ? 114  LEU B N   1 
ATOM   591  C  CA  . LEU A 1 99  ? -9.694  -28.499 5.361   1.00 8.28  ? 114  LEU B CA  1 
ATOM   592  C  C   . LEU A 1 99  ? -9.116  -27.342 6.178   1.00 7.87  ? 114  LEU B C   1 
ATOM   593  O  O   . LEU A 1 99  ? -8.351  -26.529 5.668   1.00 8.00  ? 114  LEU B O   1 
ATOM   594  C  CB  . LEU A 1 99  ? -11.053 -28.125 4.763   1.00 7.42  ? 114  LEU B CB  1 
ATOM   595  C  CG  . LEU A 1 99  ? -11.118 -26.828 3.959   1.00 6.71  ? 114  LEU B CG  1 
ATOM   596  C  CD1 . LEU A 1 99  ? -10.127 -26.854 2.778   1.00 7.57  ? 114  LEU B CD1 1 
ATOM   597  C  CD2 . LEU A 1 99  ? -12.542 -26.588 3.462   1.00 9.62  ? 114  LEU B CD2 1 
ATOM   598  N  N   . ALA A 1 100 ? -9.476  -27.262 7.454   1.00 6.87  ? 115  ALA B N   1 
ATOM   599  C  CA  . ALA A 1 100 ? -8.955  -26.195 8.300   1.00 7.26  ? 115  ALA B CA  1 
ATOM   600  C  C   . ALA A 1 100 ? -7.430  -26.195 8.332   1.00 8.18  ? 115  ALA B C   1 
ATOM   601  O  O   . ALA A 1 100 ? -6.800  -25.133 8.321   1.00 8.13  ? 115  ALA B O   1 
ATOM   602  C  CB  . ALA A 1 100 ? -9.522  -26.308 9.708   1.00 8.14  ? 115  ALA B CB  1 
ATOM   603  N  N   . ILE A 1 101 ? -6.836  -27.383 8.376   1.00 8.90  ? 116  ILE B N   1 
ATOM   604  C  CA  . ILE A 1 101 ? -5.379  -27.495 8.381   1.00 9.79  ? 116  ILE B CA  1 
ATOM   605  C  C   . ILE A 1 101 ? -4.811  -27.064 7.036   1.00 8.66  ? 116  ILE B C   1 
ATOM   606  O  O   . ILE A 1 101 ? -3.839  -26.311 6.972   1.00 9.95  ? 116  ILE B O   1 
ATOM   607  C  CB  . ILE A 1 101 ? -4.926  -28.930 8.708   1.00 8.91  ? 116  ILE B CB  1 
ATOM   608  C  CG1 . ILE A 1 101 ? -5.255  -29.266 10.165  1.00 11.53 ? 116  ILE B CG1 1 
ATOM   609  C  CG2 . ILE A 1 101 ? -3.432  -29.094 8.452   1.00 10.96 ? 116  ILE B CG2 1 
ATOM   610  C  CD1 . ILE A 1 101 ? -5.243  -30.758 10.465  1.00 12.73 ? 116  ILE B CD1 1 
ATOM   611  N  N   . SER A 1 102 ? -5.440  -27.521 5.960   1.00 8.18  ? 117  SER B N   1 
ATOM   612  C  CA  . SER A 1 102 ? -4.979  -27.176 4.619   1.00 9.77  ? 117  SER B CA  1 
ATOM   613  C  C   . SER A 1 102 ? -5.075  -25.682 4.327   1.00 9.66  ? 117  SER B C   1 
ATOM   614  O  O   . SER A 1 102 ? -4.222  -25.128 3.642   1.00 9.31  ? 117  SER B O   1 
ATOM   615  C  CB  . SER A 1 102 ? -5.727  -27.997 3.576   1.00 10.99 ? 117  SER B CB  1 
ATOM   616  O  OG  . SER A 1 102 ? -5.416  -29.367 3.759   1.00 17.98 ? 117  SER B OG  1 
ATOM   617  N  N   . VAL A 1 103 ? -6.098  -25.022 4.863   1.00 7.89  ? 118  VAL B N   1 
ATOM   618  C  CA  . VAL A 1 103 ? -6.236  -23.582 4.670   1.00 6.89  ? 118  VAL B CA  1 
ATOM   619  C  C   . VAL A 1 103 ? -5.113  -22.826 5.367   1.00 8.70  ? 118  VAL B C   1 
ATOM   620  O  O   . VAL A 1 103 ? -4.519  -21.913 4.796   1.00 9.63  ? 118  VAL B O   1 
ATOM   621  C  CB  . VAL A 1 103 ? -7.610  -23.073 5.163   1.00 8.04  ? 118  VAL B CB  1 
ATOM   622  C  CG1 . VAL A 1 103 ? -7.638  -21.549 5.201   1.00 8.75  ? 118  VAL B CG1 1 
ATOM   623  C  CG2 . VAL A 1 103 ? -8.717  -23.613 4.261   1.00 8.68  ? 118  VAL B CG2 1 
ATOM   624  N  N   . MET A 1 104 ? -4.816  -23.209 6.605   1.00 8.89  ? 119  MET B N   1 
ATOM   625  C  CA  . MET A 1 104 ? -3.731  -22.580 7.343   1.00 10.31 ? 119  MET B CA  1 
ATOM   626  C  C   . MET A 1 104 ? -2.396  -22.829 6.656   1.00 9.09  ? 119  MET B C   1 
ATOM   627  O  O   . MET A 1 104 ? -1.536  -21.952 6.635   1.00 12.31 ? 119  MET B O   1 
ATOM   628  C  CB  . MET A 1 104 ? -3.697  -23.076 8.789   1.00 11.69 ? 119  MET B CB  1 
ATOM   629  C  CG  . MET A 1 104 ? -4.891  -22.596 9.589   1.00 10.88 ? 119  MET B CG  1 
ATOM   630  S  SD  . MET A 1 104 ? -4.863  -23.105 11.315  1.00 13.87 ? 119  MET B SD  1 
ATOM   631  C  CE  . MET A 1 104 ? -4.774  -24.883 11.159  1.00 23.19 ? 119  MET B CE  1 
ATOM   632  N  N   . ASN A 1 105 ? -2.228  -24.024 6.097   1.00 8.84  ? 120  ASN B N   1 
ATOM   633  C  CA  . ASN A 1 105 ? -1.032  -24.324 5.310   1.00 10.53 ? 120  ASN B CA  1 
ATOM   634  C  C   . ASN A 1 105 ? -0.950  -23.474 4.048   1.00 12.30 ? 120  ASN B C   1 
ATOM   635  O  O   . ASN A 1 105 ? 0.121   -22.978 3.699   1.00 11.44 ? 120  ASN B O   1 
ATOM   636  C  CB  . ASN A 1 105 ? -0.993  -25.800 4.909   1.00 9.52  ? 120  ASN B CB  1 
ATOM   637  C  CG  . ASN A 1 105 ? -0.553  -26.710 6.039   1.00 10.16 ? 120  ASN B CG  1 
ATOM   638  O  OD1 . ASN A 1 105 ? -0.051  -26.256 7.065   1.00 13.42 ? 120  ASN B OD1 1 
ATOM   639  N  ND2 . ASN A 1 105 ? -0.730  -28.010 5.842   1.00 10.78 ? 120  ASN B ND2 1 
ATOM   640  N  N   . GLN A 1 106 ? -2.080  -23.327 3.357   1.00 10.13 ? 121  GLN B N   1 
ATOM   641  C  CA  . GLN A 1 106 ? -2.108  -22.616 2.078   1.00 10.50 ? 121  GLN B CA  1 
ATOM   642  C  C   . GLN A 1 106 ? -1.815  -21.133 2.227   1.00 12.57 ? 121  GLN B C   1 
ATOM   643  O  O   . GLN A 1 106 ? -1.091  -20.553 1.415   1.00 12.13 ? 121  GLN B O   1 
ATOM   644  C  CB  . GLN A 1 106 ? -3.456  -22.819 1.378   1.00 10.85 ? 121  GLN B CB  1 
ATOM   645  C  CG  . GLN A 1 106 ? -3.569  -22.102 0.034   1.00 10.46 ? 121  GLN B CG  1 
ATOM   646  C  CD  . GLN A 1 106 ? -2.727  -22.745 -1.057  1.00 11.66 ? 121  GLN B CD  1 
ATOM   647  O  OE1 . GLN A 1 106 ? -3.088  -23.788 -1.602  1.00 16.78 ? 121  GLN B OE1 1 
ATOM   648  N  NE2 . GLN A 1 106 ? -1.614  -22.106 -1.401  1.00 11.50 ? 121  GLN B NE2 1 
ATOM   649  N  N   . TRP A 1 107 ? -2.394  -20.520 3.255   1.00 12.57 ? 122  TRP B N   1 
ATOM   650  C  CA  . TRP A 1 107 ? -2.242  -19.094 3.497   1.00 11.81 ? 122  TRP B CA  1 
ATOM   651  C  C   . TRP A 1 107 ? -1.879  -18.872 4.952   1.00 13.58 ? 122  TRP B C   1 
ATOM   652  O  O   . TRP A 1 107 ? -2.747  -18.643 5.791   1.00 12.24 ? 122  TRP B O   1 
ATOM   653  C  CB  . TRP A 1 107 ? -3.545  -18.345 3.190   1.00 12.25 ? 122  TRP B CB  1 
ATOM   654  C  CG  . TRP A 1 107 ? -4.037  -18.464 1.770   1.00 10.55 ? 122  TRP B CG  1 
ATOM   655  C  CD1 . TRP A 1 107 ? -3.531  -17.833 0.668   1.00 11.59 ? 122  TRP B CD1 1 
ATOM   656  C  CD2 . TRP A 1 107 ? -5.152  -19.239 1.313   1.00 9.66  ? 122  TRP B CD2 1 
ATOM   657  N  NE1 . TRP A 1 107 ? -4.256  -18.178 -0.447  1.00 11.61 ? 122  TRP B NE1 1 
ATOM   658  C  CE2 . TRP A 1 107 ? -5.260  -19.036 -0.079  1.00 10.08 ? 122  TRP B CE2 1 
ATOM   659  C  CE3 . TRP A 1 107 ? -6.064  -20.091 1.943   1.00 9.08  ? 122  TRP B CE3 1 
ATOM   660  C  CZ2 . TRP A 1 107 ? -6.238  -19.659 -0.848  1.00 10.55 ? 122  TRP B CZ2 1 
ATOM   661  C  CZ3 . TRP A 1 107 ? -7.035  -20.703 1.180   1.00 9.55  ? 122  TRP B CZ3 1 
ATOM   662  C  CH2 . TRP A 1 107 ? -7.118  -20.481 -0.200  1.00 7.89  ? 122  TRP B CH2 1 
ATOM   663  N  N   . PRO A 1 108 ? -0.587  -18.963 5.269   1.00 13.78 ? 123  PRO B N   1 
ATOM   664  C  CA  . PRO A 1 108 ? -0.165  -18.742 6.655   1.00 15.27 ? 123  PRO B CA  1 
ATOM   665  C  C   . PRO A 1 108 ? -0.773  -17.456 7.229   1.00 15.63 ? 123  PRO B C   1 
ATOM   666  O  O   . PRO A 1 108 ? -0.680  -16.399 6.610   1.00 16.97 ? 123  PRO B O   1 
ATOM   667  C  CB  . PRO A 1 108 ? 1.358   -18.642 6.533   1.00 17.83 ? 123  PRO B CB  1 
ATOM   668  C  CG  . PRO A 1 108 ? 1.677   -19.530 5.357   1.00 17.88 ? 123  PRO B CG  1 
ATOM   669  C  CD  . PRO A 1 108 ? 0.541   -19.306 4.384   1.00 14.56 ? 123  PRO B CD  1 
ATOM   670  N  N   . GLY A 1 109 ? -1.417  -17.560 8.391   1.00 14.69 ? 124  GLY B N   1 
ATOM   671  C  CA  . GLY A 1 109 ? -2.046  -16.412 9.027   1.00 14.49 ? 124  GLY B CA  1 
ATOM   672  C  C   . GLY A 1 109 ? -3.544  -16.301 8.775   1.00 16.41 ? 124  GLY B C   1 
ATOM   673  O  O   . GLY A 1 109 ? -4.235  -15.495 9.395   1.00 17.20 ? 124  GLY B O   1 
ATOM   674  N  N   . VAL A 1 110 ? -4.044  -17.122 7.858   1.00 11.85 ? 125  VAL B N   1 
ATOM   675  C  CA  . VAL A 1 110 ? -5.457  -17.121 7.494   1.00 10.52 ? 125  VAL B CA  1 
ATOM   676  C  C   . VAL A 1 110 ? -6.099  -18.422 7.980   1.00 9.60  ? 125  VAL B C   1 
ATOM   677  O  O   . VAL A 1 110 ? -5.427  -19.449 8.074   1.00 10.93 ? 125  VAL B O   1 
ATOM   678  C  CB  . VAL A 1 110 ? -5.617  -17.008 5.964   1.00 10.34 ? 125  VAL B CB  1 
ATOM   679  C  CG1 . VAL A 1 110 ? -7.077  -17.157 5.547   1.00 11.13 ? 125  VAL B CG1 1 
ATOM   680  C  CG2 . VAL A 1 110 ? -5.050  -15.688 5.467   1.00 13.26 ? 125  VAL B CG2 1 
ATOM   681  N  N   . LYS A 1 111 ? -7.392  -18.368 8.299   1.00 9.88  ? 126  LYS B N   1 
ATOM   682  C  CA  . LYS A 1 111 ? -8.126  -19.547 8.758   1.00 9.64  ? 126  LYS B CA  1 
ATOM   683  C  C   . LYS A 1 111 ? -9.361  -19.814 7.907   1.00 8.39  ? 126  LYS B C   1 
ATOM   684  O  O   . LYS A 1 111 ? -9.872  -18.927 7.225   1.00 7.58  ? 126  LYS B O   1 
ATOM   685  C  CB  . LYS A 1 111 ? -8.556  -19.391 10.221  1.00 10.68 ? 126  LYS B CB  1 
ATOM   686  C  CG  . LYS A 1 111 ? -7.414  -19.511 11.223  1.00 10.67 ? 126  LYS B CG  1 
ATOM   687  C  CD  . LYS A 1 111 ? -7.922  -19.395 12.649  1.00 14.48 ? 126  LYS B CD  1 
ATOM   688  C  CE  . LYS A 1 111 ? -6.802  -19.671 13.646  1.00 20.35 ? 126  LYS B CE  1 
ATOM   689  N  NZ  . LYS A 1 111 ? -7.291  -19.648 15.054  1.00 21.09 ? 126  LYS B NZ  1 
ATOM   690  N  N   . LEU A 1 112 ? -9.831  -21.052 7.968   1.00 7.52  ? 127  LEU B N   1 
ATOM   691  C  CA  . LEU A 1 112 ? -11.103 -21.431 7.377   1.00 7.25  ? 127  LEU B CA  1 
ATOM   692  C  C   . LEU A 1 112 ? -12.248 -20.776 8.136   1.00 7.74  ? 127  LEU B C   1 
ATOM   693  O  O   . LEU A 1 112 ? -12.220 -20.699 9.373   1.00 6.60  ? 127  LEU B O   1 
ATOM   694  C  CB  . LEU A 1 112 ? -11.246 -22.948 7.446   1.00 7.48  ? 127  LEU B CB  1 
ATOM   695  C  CG  . LEU A 1 112 ? -12.554 -23.549 6.947   1.00 5.37  ? 127  LEU B CG  1 
ATOM   696  C  CD1 . LEU A 1 112 ? -12.782 -23.245 5.464   1.00 6.98  ? 127  LEU B CD1 1 
ATOM   697  C  CD2 . LEU A 1 112 ? -12.553 -25.050 7.200   1.00 8.34  ? 127  LEU B CD2 1 
ATOM   698  N  N   . ARG A 1 113 ? -13.254 -20.311 7.399   1.00 7.11  ? 128  ARG B N   1 
ATOM   699  C  CA  . ARG A 1 113 ? -14.424 -19.679 7.992   1.00 6.40  ? 128  ARG B CA  1 
ATOM   700  C  C   . ARG A 1 113 ? -15.705 -20.274 7.406   1.00 6.86  ? 128  ARG B C   1 
ATOM   701  O  O   . ARG A 1 113 ? -15.810 -20.485 6.192   1.00 6.88  ? 128  ARG B O   1 
ATOM   702  C  CB  . ARG A 1 113 ? -14.371 -18.171 7.748   1.00 7.98  ? 128  ARG B CB  1 
ATOM   703  C  CG  . ARG A 1 113 ? -15.604 -17.391 8.179   1.00 8.02  ? 128  ARG B CG  1 
ATOM   704  C  CD  . ARG A 1 113 ? -15.281 -15.913 8.120   1.00 9.71  ? 128  ARG B CD  1 
ATOM   705  N  NE  . ARG A 1 113 ? -16.430 -15.040 8.342   1.00 9.82  ? 128  ARG B NE  1 
ATOM   706  C  CZ  . ARG A 1 113 ? -17.151 -14.486 7.372   1.00 14.20 ? 128  ARG B CZ  1 
ATOM   707  N  NH1 . ARG A 1 113 ? -16.867 -14.739 6.100   1.00 11.43 ? 128  ARG B NH1 1 
ATOM   708  N  NH2 . ARG A 1 113 ? -18.166 -13.688 7.674   1.00 14.61 ? 128  ARG B NH2 1 
ATOM   709  N  N   . VAL A 1 114 ? -16.668 -20.548 8.281   1.00 6.24  ? 129  VAL B N   1 
ATOM   710  C  CA  . VAL A 1 114 ? -17.985 -21.028 7.892   1.00 5.88  ? 129  VAL B CA  1 
ATOM   711  C  C   . VAL A 1 114 ? -18.977 -19.878 8.011   1.00 6.33  ? 129  VAL B C   1 
ATOM   712  O  O   . VAL A 1 114 ? -19.122 -19.300 9.091   1.00 6.97  ? 129  VAL B O   1 
ATOM   713  C  CB  . VAL A 1 114 ? -18.435 -22.185 8.807   1.00 5.68  ? 129  VAL B CB  1 
ATOM   714  C  CG1 . VAL A 1 114 ? -19.873 -22.554 8.543   1.00 6.84  ? 129  VAL B CG1 1 
ATOM   715  C  CG2 . VAL A 1 114 ? -17.531 -23.399 8.616   1.00 7.17  ? 129  VAL B CG2 1 
ATOM   716  N  N   . THR A 1 115 ? -19.632 -19.519 6.910   1.00 5.72  ? 130  THR B N   1 
ATOM   717  C  CA  . THR A 1 115 ? -20.612 -18.435 6.939   1.00 6.05  ? 130  THR B CA  1 
ATOM   718  C  C   . THR A 1 115 ? -22.050 -18.942 7.041   1.00 7.69  ? 130  THR B C   1 
ATOM   719  O  O   . THR A 1 115 ? -22.957 -18.182 7.382   1.00 8.74  ? 130  THR B O   1 
ATOM   720  C  CB  . THR A 1 115 ? -20.465 -17.483 5.731   1.00 10.23 ? 130  THR B CB  1 
ATOM   721  O  OG1 . THR A 1 115 ? -20.656 -18.205 4.503   1.00 9.97  ? 130  THR B OG1 1 
ATOM   722  C  CG2 . THR A 1 115 ? -19.097 -16.834 5.743   1.00 11.84 ? 130  THR B CG2 1 
ATOM   723  N  N   . GLU A 1 116 ? -22.257 -20.223 6.757   1.00 6.08  ? 131  GLU B N   1 
ATOM   724  C  CA  . GLU A 1 116 ? -23.588 -20.823 6.846   1.00 7.20  ? 131  GLU B CA  1 
ATOM   725  C  C   . GLU A 1 116 ? -23.444 -22.330 6.949   1.00 7.99  ? 131  GLU B C   1 
ATOM   726  O  O   . GLU A 1 116 ? -22.898 -22.960 6.048   1.00 10.34 ? 131  GLU B O   1 
ATOM   727  C  CB  . GLU A 1 116 ? -24.431 -20.455 5.612   1.00 7.23  ? 131  GLU B CB  1 
ATOM   728  C  CG  . GLU A 1 116 ? -25.714 -21.264 5.433   1.00 8.59  ? 131  GLU B CG  1 
ATOM   729  C  CD  . GLU A 1 116 ? -26.833 -20.878 6.388   1.00 8.05  ? 131  GLU B CD  1 
ATOM   730  O  OE1 . GLU A 1 116 ? -26.568 -20.202 7.408   1.00 9.30  ? 131  GLU B OE1 1 
ATOM   731  O  OE2 . GLU A 1 116 ? -27.989 -21.249 6.108   1.00 8.50  ? 131  GLU B OE2 1 
ATOM   732  N  N   . GLY A 1 117 ? -23.930 -22.913 8.040   1.00 7.30  ? 132  GLY B N   1 
ATOM   733  C  CA  . GLY A 1 117 ? -23.877 -24.356 8.227   1.00 7.33  ? 132  GLY B CA  1 
ATOM   734  C  C   . GLY A 1 117 ? -25.281 -24.922 8.251   1.00 7.26  ? 132  GLY B C   1 
ATOM   735  O  O   . GLY A 1 117 ? -26.058 -24.714 7.310   1.00 7.90  ? 132  GLY B O   1 
ATOM   736  N  N   . TRP A 1 118 ? -25.614 -25.623 9.331   1.00 6.79  ? 133  TRP B N   1 
ATOM   737  C  CA  . TRP A 1 118 ? -26.966 -26.127 9.518   1.00 6.55  ? 133  TRP B CA  1 
ATOM   738  C  C   . TRP A 1 118 ? -27.951 -24.962 9.552   1.00 8.18  ? 133  TRP B C   1 
ATOM   739  O  O   . TRP A 1 118 ? -27.758 -23.989 10.289  1.00 7.95  ? 133  TRP B O   1 
ATOM   740  C  CB  . TRP A 1 118 ? -27.025 -26.948 10.810  1.00 7.41  ? 133  TRP B CB  1 
ATOM   741  C  CG  . TRP A 1 118 ? -28.378 -27.481 11.181  1.00 7.04  ? 133  TRP B CG  1 
ATOM   742  C  CD1 . TRP A 1 118 ? -29.257 -28.159 10.381  1.00 8.12  ? 133  TRP B CD1 1 
ATOM   743  C  CD2 . TRP A 1 118 ? -28.998 -27.393 12.470  1.00 6.50  ? 133  TRP B CD2 1 
ATOM   744  N  NE1 . TRP A 1 118 ? -30.386 -28.496 11.095  1.00 7.76  ? 133  TRP B NE1 1 
ATOM   745  C  CE2 . TRP A 1 118 ? -30.251 -28.029 12.377  1.00 7.19  ? 133  TRP B CE2 1 
ATOM   746  C  CE3 . TRP A 1 118 ? -28.615 -26.824 13.691  1.00 9.00  ? 133  TRP B CE3 1 
ATOM   747  C  CZ2 . TRP A 1 118 ? -31.120 -28.126 13.463  1.00 9.97  ? 133  TRP B CZ2 1 
ATOM   748  C  CZ3 . TRP A 1 118 ? -29.477 -26.921 14.768  1.00 9.13  ? 133  TRP B CZ3 1 
ATOM   749  C  CH2 . TRP A 1 118 ? -30.720 -27.556 14.643  1.00 10.43 ? 133  TRP B CH2 1 
ATOM   750  N  N   . ASP A 1 119 ? -28.996 -25.062 8.741   1.00 7.08  ? 134  ASP B N   1 
ATOM   751  C  CA  . ASP A 1 119 ? -30.004 -24.014 8.627   1.00 7.52  ? 134  ASP B CA  1 
ATOM   752  C  C   . ASP A 1 119 ? -31.313 -24.474 9.244   1.00 7.87  ? 134  ASP B C   1 
ATOM   753  O  O   . ASP A 1 119 ? -31.922 -25.438 8.781   1.00 9.76  ? 134  ASP B O   1 
ATOM   754  C  CB  . ASP A 1 119 ? -30.223 -23.649 7.152   1.00 7.15  ? 134  ASP B CB  1 
ATOM   755  C  CG  . ASP A 1 119 ? -31.257 -22.553 6.964   1.00 9.81  ? 134  ASP B CG  1 
ATOM   756  O  OD1 . ASP A 1 119 ? -31.579 -21.842 7.943   1.00 11.11 ? 134  ASP B OD1 1 
ATOM   757  O  OD2 . ASP A 1 119 ? -31.747 -22.396 5.831   1.00 9.23  ? 134  ASP B OD2 1 
ATOM   758  N  N   . GLU A 1 120 ? -31.725 -23.786 10.307  1.00 9.75  ? 135  GLU B N   1 
ATOM   759  C  CA  . GLU A 1 120 ? -33.011 -24.028 10.952  1.00 11.92 ? 135  GLU B CA  1 
ATOM   760  C  C   . GLU A 1 120 ? -34.127 -23.170 10.329  1.00 15.04 ? 135  GLU B C   1 
ATOM   761  O  O   . GLU A 1 120 ? -35.289 -23.316 10.713  1.00 23.19 ? 135  GLU B O   1 
ATOM   762  C  CB  . GLU A 1 120 ? -32.915 -23.701 12.451  1.00 10.93 ? 135  GLU B CB  1 
ATOM   763  C  CG  . GLU A 1 120 ? -31.767 -24.382 13.201  1.00 12.96 ? 135  GLU B CG  1 
ATOM   764  C  CD  . GLU A 1 120 ? -31.811 -24.119 14.697  1.00 12.76 ? 135  GLU B CD  1 
ATOM   765  O  OE1 . GLU A 1 120 ? -32.640 -24.749 15.386  1.00 14.44 ? 135  GLU B OE1 1 
ATOM   766  O  OE2 . GLU A 1 120 ? -31.014 -23.290 15.186  1.00 14.72 ? 135  GLU B OE2 1 
ATOM   767  N  N   . ASP A 1 121 ? -33.779 -22.293 9.378   1.00 14.33 ? 136  ASP B N   1 
ATOM   768  C  CA  . ASP A 1 121 ? -34.647 -21.163 8.954   1.00 18.14 ? 136  ASP B CA  1 
ATOM   769  C  C   . ASP A 1 121 ? -35.195 -21.144 7.512   1.00 20.08 ? 136  ASP B C   1 
ATOM   770  O  O   . ASP A 1 121 ? -35.781 -20.146 7.098   1.00 20.20 ? 136  ASP B O   1 
ATOM   771  C  CB  . ASP A 1 121 ? -33.920 -19.816 9.130   1.00 18.20 ? 136  ASP B CB  1 
ATOM   772  C  CG  . ASP A 1 121 ? -33.164 -19.704 10.436  1.00 23.23 ? 136  ASP B CG  1 
ATOM   773  O  OD1 . ASP A 1 121 ? -33.798 -19.778 11.506  1.00 21.55 ? 136  ASP B OD1 1 
ATOM   774  O  OD2 . ASP A 1 121 ? -31.929 -19.503 10.381  1.00 24.46 ? 136  ASP B OD2 1 
ATOM   775  N  N   . GLY A 1 122 ? -34.972 -22.190 6.728   1.00 15.94 ? 137  GLY B N   1 
ATOM   776  C  CA  . GLY A 1 122 ? -35.500 -22.240 5.367   1.00 15.32 ? 137  GLY B CA  1 
ATOM   777  C  C   . GLY A 1 122 ? -34.922 -21.240 4.370   1.00 15.38 ? 137  GLY B C   1 
ATOM   778  O  O   . GLY A 1 122 ? -35.640 -20.731 3.503   1.00 16.93 ? 137  GLY B O   1 
ATOM   779  N  N   . HIS A 1 123 ? -33.620 -20.979 4.465   1.00 11.55 ? 138  HIS B N   1 
ATOM   780  C  CA  . HIS A 1 123 ? -32.969 -19.974 3.622   1.00 12.66 ? 138  HIS B CA  1 
ATOM   781  C  C   . HIS A 1 123 ? -32.329 -20.524 2.350   1.00 11.96 ? 138  HIS B C   1 
ATOM   782  O  O   . HIS A 1 123 ? -31.557 -19.824 1.685   1.00 15.50 ? 138  HIS B O   1 
ATOM   783  C  CB  . HIS A 1 123 ? -31.901 -19.222 4.420   1.00 14.64 ? 138  HIS B CB  1 
ATOM   784  C  CG  . HIS A 1 123 ? -32.458 -18.371 5.516   1.00 14.25 ? 138  HIS B CG  1 
ATOM   785  N  ND1 . HIS A 1 123 ? -31.801 -18.166 6.710   1.00 16.26 ? 138  HIS B ND1 1 
ATOM   786  C  CD2 . HIS A 1 123 ? -33.623 -17.686 5.602   1.00 18.48 ? 138  HIS B CD2 1 
ATOM   787  C  CE1 . HIS A 1 123 ? -32.534 -17.381 7.481   1.00 18.71 ? 138  HIS B CE1 1 
ATOM   788  N  NE2 . HIS A 1 123 ? -33.645 -17.079 6.833   1.00 16.47 ? 138  HIS B NE2 1 
ATOM   789  N  N   . HIS A 1 124 ? -32.628 -21.773 2.017   1.00 11.33 ? 139  HIS B N   1 
ATOM   790  C  CA  . HIS A 1 124 ? -32.068 -22.380 0.820   1.00 10.70 ? 139  HIS B CA  1 
ATOM   791  C  C   . HIS A 1 124 ? -33.192 -22.953 -0.045  1.00 15.35 ? 139  HIS B C   1 
ATOM   792  O  O   . HIS A 1 124 ? -34.368 -22.707 0.220   1.00 17.67 ? 139  HIS B O   1 
ATOM   793  C  CB  . HIS A 1 124 ? -31.027 -23.440 1.205   1.00 11.31 ? 139  HIS B CB  1 
ATOM   794  C  CG  . HIS A 1 124 ? -29.926 -22.894 2.062   1.00 8.90  ? 139  HIS B CG  1 
ATOM   795  N  ND1 . HIS A 1 124 ? -28.744 -22.413 1.541   1.00 13.07 ? 139  HIS B ND1 1 
ATOM   796  C  CD2 . HIS A 1 124 ? -29.852 -22.705 3.401   1.00 7.98  ? 139  HIS B CD2 1 
ATOM   797  C  CE1 . HIS A 1 124 ? -27.979 -21.971 2.526   1.00 12.61 ? 139  HIS B CE1 1 
ATOM   798  N  NE2 . HIS A 1 124 ? -28.632 -22.129 3.665   1.00 8.22  ? 139  HIS B NE2 1 
ATOM   799  N  N   . SER A 1 125 ? -32.831 -23.691 -1.088  1.00 14.69 ? 140  SER B N   1 
ATOM   800  C  CA  . SER A 1 125 ? -33.820 -24.360 -1.925  1.00 15.79 ? 140  SER B CA  1 
ATOM   801  C  C   . SER A 1 125 ? -34.473 -25.497 -1.149  1.00 16.23 ? 140  SER B C   1 
ATOM   802  O  O   . SER A 1 125 ? -34.015 -25.866 -0.067  1.00 18.65 ? 140  SER B O   1 
ATOM   803  C  CB  . SER A 1 125 ? -33.168 -24.898 -3.200  1.00 16.34 ? 140  SER B CB  1 
ATOM   804  O  OG  . SER A 1 125 ? -32.249 -25.932 -2.899  0.56 18.57 ? 140  SER B OG  1 
ATOM   805  N  N   . GLU A 1 126 ? -35.526 -26.071 -1.716  1.00 15.03 ? 141  GLU B N   1 
ATOM   806  C  CA  . GLU A 1 126 ? -36.413 -26.975 -0.975  1.00 18.14 ? 141  GLU B CA  1 
ATOM   807  C  C   . GLU A 1 126 ? -35.788 -28.179 -0.247  1.00 22.41 ? 141  GLU B C   1 
ATOM   808  O  O   . GLU A 1 126 ? -36.219 -28.527 0.856   1.00 26.96 ? 141  GLU B O   1 
ATOM   809  C  CB  . GLU A 1 126 ? -37.550 -27.450 -1.882  1.00 24.15 ? 141  GLU B CB  1 
ATOM   810  C  CG  . GLU A 1 126 ? -38.646 -28.197 -1.147  1.00 32.88 ? 141  GLU B CG  1 
ATOM   811  C  CD  . GLU A 1 126 ? -39.831 -28.505 -2.040  1.00 40.00 ? 141  GLU B CD  1 
ATOM   812  O  OE1 . GLU A 1 126 ? -40.780 -29.161 -1.561  1.00 47.89 ? 141  GLU B OE1 1 
ATOM   813  O  OE2 . GLU A 1 126 ? -39.812 -28.089 -3.220  1.00 41.79 ? 141  GLU B OE2 1 
ATOM   814  N  N   . GLU A 1 127 ? -34.797 -28.813 -0.863  1.00 15.16 ? 142  GLU B N   1 
ATOM   815  C  CA  . GLU A 1 127 ? -34.182 -30.032 -0.325  1.00 13.68 ? 142  GLU B CA  1 
ATOM   816  C  C   . GLU A 1 127 ? -32.683 -29.871 -0.065  1.00 12.74 ? 142  GLU B C   1 
ATOM   817  O  O   . GLU A 1 127 ? -31.869 -30.716 -0.452  1.00 13.89 ? 142  GLU B O   1 
ATOM   818  C  CB  . GLU A 1 127 ? -34.410 -31.212 -1.276  1.00 13.21 ? 142  GLU B CB  1 
ATOM   819  C  CG  . GLU A 1 127 ? -35.879 -31.523 -1.500  1.00 14.86 ? 142  GLU B CG  1 
ATOM   820  C  CD  . GLU A 1 127 ? -36.120 -32.909 -2.071  1.00 22.54 ? 142  GLU B CD  1 
ATOM   821  O  OE1 . GLU A 1 127 ? -37.292 -33.337 -2.096  1.00 30.46 ? 142  GLU B OE1 1 
ATOM   822  O  OE2 . GLU A 1 127 ? -35.150 -33.574 -2.487  1.00 24.64 ? 142  GLU B OE2 1 
ATOM   823  N  N   . SER A 1 128 ? -32.323 -28.797 0.621   1.00 9.82  ? 143  SER B N   1 
ATOM   824  C  CA  . SER A 1 128 ? -30.922 -28.464 0.828   1.00 6.94  ? 143  SER B CA  1 
ATOM   825  C  C   . SER A 1 128 ? -30.273 -29.334 1.896   1.00 7.02  ? 143  SER B C   1 
ATOM   826  O  O   . SER A 1 128 ? -30.861 -29.563 2.957   1.00 7.60  ? 143  SER B O   1 
ATOM   827  C  CB  . SER A 1 128 ? -30.810 -27.005 1.259   1.00 7.99  ? 143  SER B CB  1 
ATOM   828  O  OG  . SER A 1 128 ? -29.464 -26.669 1.544   1.00 7.56  ? 143  SER B OG  1 
ATOM   829  N  N   . LEU A 1 129 ? -29.043 -29.773 1.646   1.00 7.01  ? 144  LEU B N   1 
ATOM   830  C  CA  . LEU A 1 129 ? -28.307 -30.507 2.669   1.00 7.35  ? 144  LEU B CA  1 
ATOM   831  C  C   . LEU A 1 129 ? -27.975 -29.624 3.877   1.00 6.13  ? 144  LEU B C   1 
ATOM   832  O  O   . LEU A 1 129 ? -27.631 -30.131 4.939   1.00 6.70  ? 144  LEU B O   1 
ATOM   833  C  CB  . LEU A 1 129 ? -27.055 -31.154 2.074   1.00 6.45  ? 144  LEU B CB  1 
ATOM   834  C  CG  . LEU A 1 129 ? -27.381 -32.181 0.989   1.00 7.96  ? 144  LEU B CG  1 
ATOM   835  C  CD1 . LEU A 1 129 ? -26.117 -32.862 0.475   1.00 8.47  ? 144  LEU B CD1 1 
ATOM   836  C  CD2 . LEU A 1 129 ? -28.368 -33.213 1.503   1.00 10.20 ? 144  LEU B CD2 1 
ATOM   837  N  N   . HIS A 1 130 ? -28.081 -28.304 3.726   1.00 6.35  ? 145  HIS B N   1 
ATOM   838  C  CA  . HIS A 1 130 ? -27.973 -27.419 4.888   1.00 5.63  ? 145  HIS B CA  1 
ATOM   839  C  C   . HIS A 1 130 ? -29.003 -27.758 5.969   1.00 7.66  ? 145  HIS B C   1 
ATOM   840  O  O   . HIS A 1 130 ? -28.753 -27.537 7.154   1.00 6.33  ? 145  HIS B O   1 
ATOM   841  C  CB  . HIS A 1 130 ? -28.143 -25.949 4.482   1.00 7.43  ? 145  HIS B CB  1 
ATOM   842  C  CG  . HIS A 1 130 ? -26.936 -25.355 3.824   1.00 6.43  ? 145  HIS B CG  1 
ATOM   843  N  ND1 . HIS A 1 130 ? -25.854 -24.896 4.542   1.00 5.82  ? 145  HIS B ND1 1 
ATOM   844  C  CD2 . HIS A 1 130 ? -26.648 -25.124 2.520   1.00 5.37  ? 145  HIS B CD2 1 
ATOM   845  C  CE1 . HIS A 1 130 ? -24.946 -24.414 3.712   1.00 6.20  ? 145  HIS B CE1 1 
ATOM   846  N  NE2 . HIS A 1 130 ? -25.403 -24.541 2.479   1.00 4.53  ? 145  HIS B NE2 1 
ATOM   847  N  N   . TYR A 1 131 ? -30.159 -28.283 5.570   1.00 7.05  ? 146  TYR B N   1 
ATOM   848  C  CA  . TYR A 1 131 ? -31.230 -28.520 6.535   1.00 7.61  ? 146  TYR B CA  1 
ATOM   849  C  C   . TYR A 1 131 ? -30.949 -29.726 7.411   1.00 8.12  ? 146  TYR B C   1 
ATOM   850  O  O   . TYR A 1 131 ? -31.625 -29.926 8.424   1.00 8.29  ? 146  TYR B O   1 
ATOM   851  C  CB  . TYR A 1 131 ? -32.582 -28.686 5.839   1.00 7.20  ? 146  TYR B CB  1 
ATOM   852  C  CG  . TYR A 1 131 ? -33.001 -27.500 4.999   1.00 7.80  ? 146  TYR B CG  1 
ATOM   853  C  CD1 . TYR A 1 131 ? -32.650 -26.208 5.358   1.00 9.17  ? 146  TYR B CD1 1 
ATOM   854  C  CD2 . TYR A 1 131 ? -33.758 -27.677 3.851   1.00 8.06  ? 146  TYR B CD2 1 
ATOM   855  C  CE1 . TYR A 1 131 ? -33.038 -25.125 4.593   1.00 11.10 ? 146  TYR B CE1 1 
ATOM   856  C  CE2 . TYR A 1 131 ? -34.146 -26.605 3.078   1.00 10.74 ? 146  TYR B CE2 1 
ATOM   857  C  CZ  . TYR A 1 131 ? -33.785 -25.331 3.452   1.00 11.29 ? 146  TYR B CZ  1 
ATOM   858  O  OH  . TYR A 1 131 ? -34.171 -24.251 2.691   1.00 13.75 ? 146  TYR B OH  1 
ATOM   859  N  N   . GLU A 1 132 ? -29.963 -30.533 7.033   1.00 6.63  ? 147  GLU B N   1 
ATOM   860  C  CA  . GLU A 1 132 ? -29.635 -31.723 7.821   1.00 7.19  ? 147  GLU B CA  1 
ATOM   861  C  C   . GLU A 1 132 ? -28.173 -31.780 8.267   1.00 7.75  ? 147  GLU B C   1 
ATOM   862  O  O   . GLU A 1 132 ? -27.655 -32.848 8.596   1.00 8.12  ? 147  GLU B O   1 
ATOM   863  C  CB  . GLU A 1 132 ? -30.054 -33.006 7.096   1.00 10.61 ? 147  GLU B CB  1 
ATOM   864  C  CG  . GLU A 1 132 ? -29.568 -33.127 5.662   1.00 9.68  ? 147  GLU B CG  1 
ATOM   865  C  CD  . GLU A 1 132 ? -29.946 -34.457 5.037   1.00 10.29 ? 147  GLU B CD  1 
ATOM   866  O  OE1 . GLU A 1 132 ? -29.585 -35.511 5.616   1.00 10.66 ? 147  GLU B OE1 1 
ATOM   867  O  OE2 . GLU A 1 132 ? -30.592 -34.457 3.968   1.00 10.51 ? 147  GLU B OE2 1 
ATOM   868  N  N   . GLY A 1 133 ? -27.517 -30.624 8.308   1.00 6.26  ? 148  GLY B N   1 
ATOM   869  C  CA  . GLY A 1 133 ? -26.177 -30.536 8.863   1.00 7.52  ? 148  GLY B CA  1 
ATOM   870  C  C   . GLY A 1 133 ? -25.100 -31.218 8.047   1.00 7.83  ? 148  GLY B C   1 
ATOM   871  O  O   . GLY A 1 133 ? -24.094 -31.672 8.597   1.00 8.11  ? 148  GLY B O   1 
ATOM   872  N  N   . ARG A 1 134 ? -25.302 -31.275 6.732   1.00 6.46  ? 149  ARG B N   1 
ATOM   873  C  CA  . ARG A 1 134 ? -24.339 -31.916 5.848   1.00 6.09  ? 149  ARG B CA  1 
ATOM   874  C  C   . ARG A 1 134 ? -23.754 -30.980 4.817   1.00 7.08  ? 149  ARG B C   1 
ATOM   875  O  O   . ARG A 1 134 ? -23.106 -31.433 3.877   1.00 7.40  ? 149  ARG B O   1 
ATOM   876  C  CB  . ARG A 1 134 ? -24.971 -33.122 5.148   1.00 7.32  ? 149  ARG B CB  1 
ATOM   877  C  CG  . ARG A 1 134 ? -25.105 -34.301 6.080   1.00 8.26  ? 149  ARG B CG  1 
ATOM   878  C  CD  . ARG A 1 134 ? -25.260 -35.604 5.339   1.00 15.01 ? 149  ARG B CD  1 
ATOM   879  N  NE  . ARG A 1 134 ? -26.607 -35.834 4.829   1.00 12.88 ? 149  ARG B NE  1 
ATOM   880  C  CZ  . ARG A 1 134 ? -26.894 -36.121 3.560   1.00 9.43  ? 149  ARG B CZ  1 
ATOM   881  N  NH1 . ARG A 1 134 ? -25.942 -36.167 2.643   1.00 11.46 ? 149  ARG B NH1 1 
ATOM   882  N  NH2 . ARG A 1 134 ? -28.147 -36.348 3.200   1.00 10.49 ? 149  ARG B NH2 1 
ATOM   883  N  N   . ALA A 1 135 ? -23.996 -29.683 4.972   1.00 5.67  ? 150  ALA B N   1 
ATOM   884  C  CA  . ALA A 1 135 ? -23.430 -28.701 4.050   1.00 5.37  ? 150  ALA B CA  1 
ATOM   885  C  C   . ALA A 1 135 ? -23.000 -27.430 4.766   1.00 5.76  ? 150  ALA B C   1 
ATOM   886  O  O   . ALA A 1 135 ? -23.693 -26.939 5.665   1.00 7.70  ? 150  ALA B O   1 
ATOM   887  C  CB  . ALA A 1 135 ? -24.414 -28.363 2.942   1.00 6.55  ? 150  ALA B CB  1 
ATOM   888  N  N   . VAL A 1 136 ? -21.867 -26.891 4.343   1.00 5.23  ? 151  VAL B N   1 
ATOM   889  C  CA  . VAL A 1 136 ? -21.362 -25.634 4.873   1.00 6.56  ? 151  VAL B CA  1 
ATOM   890  C  C   . VAL A 1 136 ? -20.987 -24.714 3.727   1.00 6.00  ? 151  VAL B C   1 
ATOM   891  O  O   . VAL A 1 136 ? -20.465 -25.166 2.701   1.00 7.88  ? 151  VAL B O   1 
ATOM   892  C  CB  . VAL A 1 136 ? -20.132 -25.847 5.786   1.00 6.76  ? 151  VAL B CB  1 
ATOM   893  C  CG1 . VAL A 1 136 ? -20.536 -26.524 7.094   1.00 7.57  ? 151  VAL B CG1 1 
ATOM   894  C  CG2 . VAL A 1 136 ? -19.065 -26.664 5.074   1.00 7.85  ? 151  VAL B CG2 1 
ATOM   895  N  N   . ASP A 1 137 ? -21.280 -23.432 3.892   1.00 4.99  ? 152  ASP B N   1 
ATOM   896  C  CA  . ASP A 1 137 ? -20.770 -22.406 2.997   1.00 5.73  ? 152  ASP B CA  1 
ATOM   897  C  C   . ASP A 1 137 ? -19.555 -21.795 3.669   1.00 6.05  ? 152  ASP B C   1 
ATOM   898  O  O   . ASP A 1 137 ? -19.608 -21.407 4.849   1.00 6.19  ? 152  ASP B O   1 
ATOM   899  C  CB  . ASP A 1 137 ? -21.836 -21.345 2.727   1.00 6.23  ? 152  ASP B CB  1 
ATOM   900  C  CG  . ASP A 1 137 ? -23.047 -21.916 2.028   1.00 7.51  ? 152  ASP B CG  1 
ATOM   901  O  OD1 . ASP A 1 137 ? -22.863 -22.887 1.273   1.00 7.59  ? 152  ASP B OD1 1 
ATOM   902  O  OD2 . ASP A 1 137 ? -24.176 -21.412 2.223   1.00 7.85  ? 152  ASP B OD2 1 
ATOM   903  N  N   . ILE A 1 138 ? -18.452 -21.734 2.933   1.00 5.93  ? 153  ILE B N   1 
ATOM   904  C  CA  . ILE A 1 138 ? -17.178 -21.320 3.495   1.00 4.93  ? 153  ILE B CA  1 
ATOM   905  C  C   . ILE A 1 138 ? -16.514 -20.164 2.766   1.00 6.32  ? 153  ILE B C   1 
ATOM   906  O  O   . ILE A 1 138 ? -16.783 -19.903 1.584   1.00 6.08  ? 153  ILE B O   1 
ATOM   907  C  CB  . ILE A 1 138 ? -16.177 -22.493 3.558   1.00 5.31  ? 153  ILE B CB  1 
ATOM   908  C  CG1 . ILE A 1 138 ? -15.851 -23.006 2.147   1.00 6.98  ? 153  ILE B CG1 1 
ATOM   909  C  CG2 . ILE A 1 138 ? -16.720 -23.609 4.449   1.00 7.75  ? 153  ILE B CG2 1 
ATOM   910  C  CD1 . ILE A 1 138 ? -14.688 -23.993 2.106   1.00 6.52  ? 153  ILE B CD1 1 
ATOM   911  N  N   . THR A 1 139 ? -15.643 -19.487 3.508   1.00 6.84  ? 154  THR B N   1 
ATOM   912  C  CA  . THR A 1 139 ? -14.768 -18.441 3.004   1.00 5.92  ? 154  THR B CA  1 
ATOM   913  C  C   . THR A 1 139 ? -13.428 -18.596 3.714   1.00 6.99  ? 154  THR B C   1 
ATOM   914  O  O   . THR A 1 139 ? -13.244 -19.500 4.536   1.00 5.69  ? 154  THR B O   1 
ATOM   915  C  CB  . THR A 1 139 ? -15.304 -17.020 3.326   1.00 7.45  ? 154  THR B CB  1 
ATOM   916  O  OG1 . THR A 1 139 ? -15.115 -16.730 4.726   1.00 7.33  ? 154  THR B OG1 1 
ATOM   917  C  CG2 . THR A 1 139 ? -16.771 -16.905 2.974   1.00 7.88  ? 154  THR B CG2 1 
ATOM   918  N  N   . THR A 1 140 ? -12.492 -17.713 3.398   1.00 7.94  ? 155  THR B N   1 
ATOM   919  C  CA  . THR A 1 140 ? -11.297 -17.556 4.214   1.00 7.52  ? 155  THR B CA  1 
ATOM   920  C  C   . THR A 1 140 ? -11.592 -16.474 5.250   1.00 9.04  ? 155  THR B C   1 
ATOM   921  O  O   . THR A 1 140 ? -12.502 -15.657 5.064   1.00 9.38  ? 155  THR B O   1 
ATOM   922  C  CB  . THR A 1 140 ? -10.085 -17.163 3.361   1.00 8.84  ? 155  THR B CB  1 
ATOM   923  O  OG1 . THR A 1 140 ? -10.452 -16.076 2.506   1.00 9.62  ? 155  THR B OG1 1 
ATOM   924  C  CG2 . THR A 1 140 ? -9.632  -18.348 2.513   1.00 9.93  ? 155  THR B CG2 1 
ATOM   925  N  N   . SER A 1 141 ? -10.833 -16.474 6.339   1.00 7.86  ? 156  SER B N   1 
ATOM   926  C  CA  . SER A 1 141 ? -11.080 -15.544 7.442   1.00 8.79  ? 156  SER B CA  1 
ATOM   927  C  C   . SER A 1 141 ? -10.907 -14.082 7.043   1.00 11.04 ? 156  SER B C   1 
ATOM   928  O  O   . SER A 1 141 ? -11.525 -13.196 7.638   1.00 11.82 ? 156  SER B O   1 
ATOM   929  C  CB  . SER A 1 141 ? -10.171 -15.882 8.625   1.00 10.00 ? 156  SER B CB  1 
ATOM   930  O  OG  . SER A 1 141 ? -8.812  -15.859 8.240   1.00 10.94 ? 156  SER B OG  1 
ATOM   931  N  N   . ASP A 1 142 ? -10.086 -13.831 6.028   1.00 9.15  ? 157  ASP B N   1 
ATOM   932  C  CA  . ASP A 1 142 ? -9.827  -12.465 5.582   1.00 10.14 ? 157  ASP B CA  1 
ATOM   933  C  C   . ASP A 1 142 ? -10.842 -11.988 4.545   1.00 10.87 ? 157  ASP B C   1 
ATOM   934  O  O   . ASP A 1 142 ? -10.788 -10.844 4.099   1.00 11.58 ? 157  ASP B O   1 
ATOM   935  C  CB  . ASP A 1 142 ? -8.396  -12.327 5.052   1.00 11.20 ? 157  ASP B CB  1 
ATOM   936  C  CG  . ASP A 1 142 ? -8.122  -13.211 3.852   1.00 11.28 ? 157  ASP B CG  1 
ATOM   937  O  OD1 . ASP A 1 142 ? -9.030  -13.951 3.419   1.00 11.78 ? 157  ASP B OD1 1 
ATOM   938  O  OD2 . ASP A 1 142 ? -6.986  -13.169 3.336   1.00 14.49 ? 157  ASP B OD2 1 
ATOM   939  N  N   . ARG A 1 143 ? -11.777 -12.864 4.179   1.00 9.44  ? 158  ARG B N   1 
ATOM   940  C  CA  . ARG A 1 143 ? -12.823 -12.522 3.218   1.00 10.27 ? 158  ARG B CA  1 
ATOM   941  C  C   . ARG A 1 143 ? -12.246 -11.985 1.908   1.00 9.96  ? 158  ARG B C   1 
ATOM   942  O  O   . ARG A 1 143 ? -12.835 -11.121 1.253   1.00 11.81 ? 158  ARG B O   1 
ATOM   943  C  CB  . ARG A 1 143 ? -13.832 -11.544 3.833   1.00 10.98 ? 158  ARG B CB  1 
ATOM   944  C  CG  . ARG A 1 143 ? -14.587 -12.135 5.018   1.00 13.56 ? 158  ARG B CG  1 
ATOM   945  C  CD  . ARG A 1 143 ? -15.625 -11.163 5.572   1.00 14.48 ? 158  ARG B CD  1 
ATOM   946  N  NE  . ARG A 1 143 ? -16.701 -10.894 4.622   1.00 15.96 ? 158  ARG B NE  1 
ATOM   947  C  CZ  . ARG A 1 143 ? -16.886 -9.726  4.014   1.00 17.33 ? 158  ARG B CZ  1 
ATOM   948  N  NH1 . ARG A 1 143 ? -16.068 -8.715  4.266   1.00 18.05 ? 158  ARG B NH1 1 
ATOM   949  N  NH2 . ARG A 1 143 ? -17.891 -9.568  3.160   1.00 17.34 ? 158  ARG B NH2 1 
ATOM   950  N  N   . ASP A 1 144 ? -11.097 -12.523 1.513   1.00 9.50  ? 159  ASP B N   1 
ATOM   951  C  CA  . ASP A 1 144 ? -10.498 -12.186 0.229   1.00 9.54  ? 159  ASP B CA  1 
ATOM   952  C  C   . ASP A 1 144 ? -11.137 -13.068 -0.838  1.00 8.93  ? 159  ASP B C   1 
ATOM   953  O  O   . ASP A 1 144 ? -10.765 -14.229 -1.001  1.00 10.35 ? 159  ASP B O   1 
ATOM   954  C  CB  . ASP A 1 144 ? -8.985  -12.401 0.271   1.00 11.94 ? 159  ASP B CB  1 
ATOM   955  C  CG  . ASP A 1 144 ? -8.310  -12.126 -1.060  1.00 12.06 ? 159  ASP B CG  1 
ATOM   956  O  OD1 . ASP A 1 144 ? -8.992  -11.702 -2.015  1.00 12.92 ? 159  ASP B OD1 1 
ATOM   957  O  OD2 . ASP A 1 144 ? -7.083  -12.334 -1.148  1.00 13.61 ? 159  ASP B OD2 1 
ATOM   958  N  N   . ARG A 1 145 ? -12.110 -12.513 -1.553  1.00 8.73  ? 160  ARG B N   1 
ATOM   959  C  CA  . ARG A 1 145 ? -12.863 -13.281 -2.539  1.00 9.55  ? 160  ARG B CA  1 
ATOM   960  C  C   . ARG A 1 145 ? -11.981 -13.878 -3.636  1.00 9.56  ? 160  ARG B C   1 
ATOM   961  O  O   . ARG A 1 145 ? -12.355 -14.863 -4.274  1.00 8.64  ? 160  ARG B O   1 
ATOM   962  C  CB  . ARG A 1 145 ? -13.978 -12.419 -3.138  1.00 10.33 ? 160  ARG B CB  1 
ATOM   963  C  CG  . ARG A 1 145 ? -15.093 -12.113 -2.148  1.00 11.06 ? 160  ARG B CG  1 
ATOM   964  C  CD  . ARG A 1 145 ? -16.236 -11.354 -2.794  1.00 13.08 ? 160  ARG B CD  1 
ATOM   965  N  NE  . ARG A 1 145 ? -15.860 -9.981  -3.117  1.00 22.57 ? 160  ARG B NE  1 
ATOM   966  C  CZ  . ARG A 1 145 ? -15.836 -8.987  -2.236  1.00 18.76 ? 160  ARG B CZ  1 
ATOM   967  N  NH1 . ARG A 1 145 ? -16.160 -9.204  -0.965  1.00 25.10 ? 160  ARG B NH1 1 
ATOM   968  N  NH2 . ARG A 1 145 ? -15.483 -7.771  -2.623  1.00 27.30 ? 160  ARG B NH2 1 
ATOM   969  N  N   . ASN A 1 146 ? -10.809 -13.295 -3.856  1.00 9.65  ? 161  ASN B N   1 
ATOM   970  C  CA  . ASN A 1 146 ? -9.893  -13.847 -4.846  1.00 9.44  ? 161  ASN B CA  1 
ATOM   971  C  C   . ASN A 1 146 ? -9.322  -15.208 -4.457  1.00 8.91  ? 161  ASN B C   1 
ATOM   972  O  O   . ASN A 1 146 ? -8.808  -15.928 -5.307  1.00 11.86 ? 161  ASN B O   1 
ATOM   973  C  CB  . ASN A 1 146 ? -8.760  -12.862 -5.146  1.00 14.22 ? 161  ASN B CB  1 
ATOM   974  C  CG  . ASN A 1 146 ? -9.234  -11.654 -5.928  1.00 24.56 ? 161  ASN B CG  1 
ATOM   975  O  OD1 . ASN A 1 146 ? -10.185 -11.738 -6.705  1.00 26.77 ? 161  ASN B OD1 1 
ATOM   976  N  ND2 . ASN A 1 146 ? -8.572  -10.522 -5.730  1.00 28.73 ? 161  ASN B ND2 1 
ATOM   977  N  N   . LYS A 1 147 ? -9.413  -15.560 -3.177  1.00 8.88  ? 162  LYS B N   1 
ATOM   978  C  CA  . LYS A 1 147 ? -8.892  -16.850 -2.712  1.00 7.83  ? 162  LYS B CA  1 
ATOM   979  C  C   . LYS A 1 147 ? -9.888  -17.991 -2.871  1.00 6.39  ? 162  LYS B C   1 
ATOM   980  O  O   . LYS A 1 147 ? -9.520  -19.152 -2.695  1.00 8.41  ? 162  LYS B O   1 
ATOM   981  C  CB  . LYS A 1 147 ? -8.493  -16.774 -1.232  1.00 8.41  ? 162  LYS B CB  1 
ATOM   982  C  CG  . LYS A 1 147 ? -7.264  -15.927 -0.930  1.00 9.49  ? 162  LYS B CG  1 
ATOM   983  C  CD  . LYS A 1 147 ? -6.942  -15.970 0.560   1.00 10.42 ? 162  LYS B CD  1 
ATOM   984  C  CE  . LYS A 1 147 ? -5.631  -15.255 0.869   1.00 12.00 ? 162  LYS B CE  1 
ATOM   985  N  NZ  . LYS A 1 147 ? -5.756  -13.765 0.855   1.00 13.73 ? 162  LYS B NZ  1 
ATOM   986  N  N   . TYR A 1 148 ? -11.138 -17.679 -3.198  1.00 7.07  ? 163  TYR B N   1 
ATOM   987  C  CA  . TYR A 1 148 ? -12.195 -18.690 -3.058  1.00 7.41  ? 163  TYR B CA  1 
ATOM   988  C  C   . TYR A 1 148 ? -12.124 -19.832 -4.077  1.00 7.18  ? 163  TYR B C   1 
ATOM   989  O  O   . TYR A 1 148 ? -12.531 -20.948 -3.772  1.00 7.31  ? 163  TYR B O   1 
ATOM   990  C  CB  . TYR A 1 148 ? -13.595 -18.064 -3.037  1.00 6.77  ? 163  TYR B CB  1 
ATOM   991  C  CG  . TYR A 1 148 ? -13.855 -17.119 -1.880  1.00 7.26  ? 163  TYR B CG  1 
ATOM   992  C  CD1 . TYR A 1 148 ? -12.906 -16.919 -0.883  1.00 7.44  ? 163  TYR B CD1 1 
ATOM   993  C  CD2 . TYR A 1 148 ? -15.059 -16.427 -1.793  1.00 7.42  ? 163  TYR B CD2 1 
ATOM   994  C  CE1 . TYR A 1 148 ? -13.149 -16.050 0.175   1.00 8.13  ? 163  TYR B CE1 1 
ATOM   995  C  CE2 . TYR A 1 148 ? -15.308 -15.549 -0.749  1.00 6.67  ? 163  TYR B CE2 1 
ATOM   996  C  CZ  . TYR A 1 148 ? -14.350 -15.363 0.226   1.00 7.94  ? 163  TYR B CZ  1 
ATOM   997  O  OH  . TYR A 1 148 ? -14.604 -14.488 1.258   1.00 9.38  ? 163  TYR B OH  1 
ATOM   998  N  N   . GLY A 1 149 ? -11.621 -19.567 -5.282  1.00 6.88  ? 164  GLY B N   1 
ATOM   999  C  CA  . GLY A 1 149 ? -11.477 -20.629 -6.267  1.00 7.30  ? 164  GLY B CA  1 
ATOM   1000 C  C   . GLY A 1 149 ? -10.502 -21.687 -5.767  1.00 6.97  ? 164  GLY B C   1 
ATOM   1001 O  O   . GLY A 1 149 ? -10.734 -22.899 -5.889  1.00 7.29  ? 164  GLY B O   1 
ATOM   1002 N  N   . LEU A 1 150 ? -9.394  -21.225 -5.199  1.00 6.75  ? 165  LEU B N   1 
ATOM   1003 C  CA  . LEU A 1 150 ? -8.405  -22.134 -4.634  1.00 7.30  ? 165  LEU B CA  1 
ATOM   1004 C  C   . LEU A 1 150 ? -8.951  -22.793 -3.356  1.00 7.38  ? 165  LEU B C   1 
ATOM   1005 O  O   . LEU A 1 150 ? -8.739  -23.983 -3.126  1.00 7.51  ? 165  LEU B O   1 
ATOM   1006 C  CB  . LEU A 1 150 ? -7.101  -21.391 -4.355  1.00 8.96  ? 165  LEU B CB  1 
ATOM   1007 C  CG  . LEU A 1 150 ? -5.969  -22.245 -3.789  1.00 10.30 ? 165  LEU B CG  1 
ATOM   1008 C  CD1 . LEU A 1 150 ? -5.797  -23.543 -4.577  1.00 11.50 ? 165  LEU B CD1 1 
ATOM   1009 C  CD2 . LEU A 1 150 ? -4.682  -21.429 -3.793  1.00 12.93 ? 165  LEU B CD2 1 
ATOM   1010 N  N   . LEU A 1 151 ? -9.666  -22.026 -2.536  1.00 7.28  ? 166  LEU B N   1 
ATOM   1011 C  CA  . LEU A 1 151 ? -10.312 -22.596 -1.353  1.00 7.28  ? 166  LEU B CA  1 
ATOM   1012 C  C   . LEU A 1 151 ? -11.191 -23.778 -1.750  1.00 6.39  ? 166  LEU B C   1 
ATOM   1013 O  O   . LEU A 1 151 ? -11.187 -24.828 -1.098  1.00 6.84  ? 166  LEU B O   1 
ATOM   1014 C  CB  . LEU A 1 151 ? -11.159 -21.534 -0.653  1.00 6.15  ? 166  LEU B CB  1 
ATOM   1015 C  CG  . LEU A 1 151 ? -11.947 -21.993 0.575   1.00 6.09  ? 166  LEU B CG  1 
ATOM   1016 C  CD1 . LEU A 1 151 ? -11.004 -22.480 1.687   1.00 8.43  ? 166  LEU B CD1 1 
ATOM   1017 C  CD2 . LEU A 1 151 ? -12.849 -20.862 1.055   1.00 7.85  ? 166  LEU B CD2 1 
ATOM   1018 N  N   . ALA A 1 152 ? -11.950 -23.608 -2.828  1.00 5.83  ? 167  ALA B N   1 
ATOM   1019 C  CA  . ALA A 1 152 ? -12.801 -24.688 -3.322  1.00 5.80  ? 167  ALA B CA  1 
ATOM   1020 C  C   . ALA A 1 152 ? -11.976 -25.923 -3.701  1.00 6.85  ? 167  ALA B C   1 
ATOM   1021 O  O   . ALA A 1 152 ? -12.339 -27.051 -3.361  1.00 6.19  ? 167  ALA B O   1 
ATOM   1022 C  CB  . ALA A 1 152 ? -13.647 -24.211 -4.503  1.00 5.53  ? 167  ALA B CB  1 
ATOM   1023 N  N   . ARG A 1 153 ? -10.865 -25.724 -4.405  1.00 6.04  ? 168  ARG B N   1 
ATOM   1024 C  CA  . ARG A 1 153 ? -10.004 -26.862 -4.732  1.00 7.24  ? 168  ARG B CA  1 
ATOM   1025 C  C   . ARG A 1 153 ? -9.466  -27.547 -3.472  1.00 7.10  ? 168  ARG B C   1 
ATOM   1026 O  O   . ARG A 1 153 ? -9.404  -28.778 -3.408  1.00 7.94  ? 168  ARG B O   1 
ATOM   1027 C  CB  . ARG A 1 153 ? -8.878  -26.439 -5.689  1.00 8.76  ? 168  ARG B CB  1 
ATOM   1028 C  CG  . ARG A 1 153 ? -7.884  -27.551 -6.057  1.00 8.24  ? 168  ARG B CG  1 
ATOM   1029 C  CD  . ARG A 1 153 ? -8.560  -28.753 -6.688  1.00 8.61  ? 168  ARG B CD  1 
ATOM   1030 N  NE  . ARG A 1 153 ? -9.166  -28.433 -7.973  1.00 8.99  ? 168  ARG B NE  1 
ATOM   1031 C  CZ  . ARG A 1 153 ? -10.013 -29.234 -8.610  1.00 10.78 ? 168  ARG B CZ  1 
ATOM   1032 N  NH1 . ARG A 1 153 ? -10.352 -30.401 -8.085  1.00 12.07 ? 168  ARG B NH1 1 
ATOM   1033 N  NH2 . ARG A 1 153 ? -10.521 -28.867 -9.780  1.00 11.44 ? 168  ARG B NH2 1 
ATOM   1034 N  N   . LEU A 1 154 ? -9.102  -26.758 -2.461  1.00 5.55  ? 169  LEU B N   1 
ATOM   1035 C  CA  . LEU A 1 154 ? -8.656  -27.347 -1.199  1.00 5.79  ? 169  LEU B CA  1 
ATOM   1036 C  C   . LEU A 1 154 ? -9.770  -28.177 -0.558  1.00 6.02  ? 169  LEU B C   1 
ATOM   1037 O  O   . LEU A 1 154 ? -9.511  -29.232 0.000   1.00 7.28  ? 169  LEU B O   1 
ATOM   1038 C  CB  . LEU A 1 154 ? -8.152  -26.278 -0.226  1.00 6.94  ? 169  LEU B CB  1 
ATOM   1039 C  CG  . LEU A 1 154 ? -6.914  -25.479 -0.637  1.00 8.26  ? 169  LEU B CG  1 
ATOM   1040 C  CD1 . LEU A 1 154 ? -6.620  -24.422 0.398   1.00 11.23 ? 169  LEU B CD1 1 
ATOM   1041 C  CD2 . LEU A 1 154 ? -5.705  -26.392 -0.837  1.00 11.01 ? 169  LEU B CD2 1 
ATOM   1042 N  N   . ALA A 1 155 ? -11.010 -27.710 -0.651  1.00 7.01  ? 170  ALA B N   1 
ATOM   1043 C  CA  . ALA A 1 155 ? -12.135 -28.470 -0.112  1.00 6.94  ? 170  ALA B CA  1 
ATOM   1044 C  C   . ALA A 1 155 ? -12.307 -29.818 -0.818  1.00 6.34  ? 170  ALA B C   1 
ATOM   1045 O  O   . ALA A 1 155 ? -12.648 -30.820 -0.184  1.00 7.33  ? 170  ALA B O   1 
ATOM   1046 C  CB  . ALA A 1 155 ? -13.422 -27.652 -0.172  1.00 7.20  ? 170  ALA B CB  1 
ATOM   1047 N  N   . VAL A 1 156 ? -12.077 -29.852 -2.129  1.00 6.58  ? 171  VAL B N   1 
ATOM   1048 C  CA  . VAL A 1 156 ? -12.083 -31.126 -2.839  1.00 8.60  ? 171  VAL B CA  1 
ATOM   1049 C  C   . VAL A 1 156 ? -10.966 -32.032 -2.310  1.00 8.84  ? 171  VAL B C   1 
ATOM   1050 O  O   . VAL A 1 156 ? -11.193 -33.204 -2.013  1.00 9.29  ? 171  VAL B O   1 
ATOM   1051 C  CB  . VAL A 1 156 ? -11.907 -30.937 -4.358  1.00 8.97  ? 171  VAL B CB  1 
ATOM   1052 C  CG1 . VAL A 1 156 ? -11.808 -32.302 -5.051  1.00 9.41  ? 171  VAL B CG1 1 
ATOM   1053 C  CG2 . VAL A 1 156 ? -13.064 -30.127 -4.937  1.00 8.20  ? 171  VAL B CG2 1 
ATOM   1054 N  N   . GLU A 1 157 ? -9.763  -31.478 -2.182  1.00 7.96  ? 172  GLU B N   1 
ATOM   1055 C  CA  . GLU A 1 157 ? -8.616  -32.251 -1.695  1.00 10.32 ? 172  GLU B CA  1 
ATOM   1056 C  C   . GLU A 1 157 ? -8.813  -32.750 -0.260  1.00 11.13 ? 172  GLU B C   1 
ATOM   1057 O  O   . GLU A 1 157 ? -8.269  -33.791 0.125   1.00 11.28 ? 172  GLU B O   1 
ATOM   1058 C  CB  . GLU A 1 157 ? -7.326  -31.429 -1.805  1.00 11.36 ? 172  GLU B CB  1 
ATOM   1059 C  CG  . GLU A 1 157 ? -6.885  -31.178 -3.247  1.00 13.29 ? 172  GLU B CG  1 
ATOM   1060 C  CD  . GLU A 1 157 ? -6.346  -32.425 -3.922  1.00 22.87 ? 172  GLU B CD  1 
ATOM   1061 O  OE1 . GLU A 1 157 ? -6.712  -32.672 -5.088  1.00 29.55 ? 172  GLU B OE1 1 
ATOM   1062 O  OE2 . GLU A 1 157 ? -5.556  -33.157 -3.288  1.00 26.27 ? 172  GLU B OE2 1 
ATOM   1063 N  N   . ALA A 1 158 ? -9.596  -32.013 0.524   1.00 8.02  ? 173  ALA B N   1 
ATOM   1064 C  CA  . ALA A 1 158 ? -9.880  -32.372 1.914   1.00 8.05  ? 173  ALA B CA  1 
ATOM   1065 C  C   . ALA A 1 158 ? -10.905 -33.494 2.027   1.00 8.60  ? 173  ALA B C   1 
ATOM   1066 O  O   . ALA A 1 158 ? -11.154 -33.995 3.121   1.00 10.43 ? 173  ALA B O   1 
ATOM   1067 C  CB  . ALA A 1 158 ? -10.354 -31.154 2.699   1.00 9.19  ? 173  ALA B CB  1 
ATOM   1068 N  N   . GLY A 1 159 ? -11.524 -33.862 0.911   1.00 9.38  ? 174  GLY B N   1 
ATOM   1069 C  CA  . GLY A 1 159 ? -12.426 -35.001 0.895   1.00 7.86  ? 174  GLY B CA  1 
ATOM   1070 C  C   . GLY A 1 159 ? -13.906 -34.683 0.991   1.00 7.40  ? 174  GLY B C   1 
ATOM   1071 O  O   . GLY A 1 159 ? -14.724 -35.585 1.188   1.00 8.48  ? 174  GLY B O   1 
ATOM   1072 N  N   . PHE A 1 160 ? -14.281 -33.416 0.849   1.00 7.28  ? 175  PHE B N   1 
ATOM   1073 C  CA  . PHE A 1 160 ? -15.703 -33.122 0.779   1.00 7.12  ? 175  PHE B CA  1 
ATOM   1074 C  C   . PHE A 1 160 ? -16.296 -33.850 -0.420  1.00 6.62  ? 175  PHE B C   1 
ATOM   1075 O  O   . PHE A 1 160 ? -15.667 -33.944 -1.476  1.00 8.41  ? 175  PHE B O   1 
ATOM   1076 C  CB  . PHE A 1 160 ? -15.965 -31.616 0.703   1.00 6.85  ? 175  PHE B CB  1 
ATOM   1077 C  CG  . PHE A 1 160 ? -16.009 -30.950 2.045   1.00 4.61  ? 175  PHE B CG  1 
ATOM   1078 C  CD1 . PHE A 1 160 ? -17.166 -30.977 2.805   1.00 6.01  ? 175  PHE B CD1 1 
ATOM   1079 C  CD2 . PHE A 1 160 ? -14.889 -30.304 2.549   1.00 7.27  ? 175  PHE B CD2 1 
ATOM   1080 C  CE1 . PHE A 1 160 ? -17.205 -30.371 4.062   1.00 5.92  ? 175  PHE B CE1 1 
ATOM   1081 C  CE2 . PHE A 1 160 ? -14.925 -29.693 3.788   1.00 6.91  ? 175  PHE B CE2 1 
ATOM   1082 C  CZ  . PHE A 1 160 ? -16.082 -29.728 4.541   1.00 6.87  ? 175  PHE B CZ  1 
ATOM   1083 N  N   . ASP A 1 161 ? -17.503 -34.370 -0.266  1.00 7.14  ? 176  ASP B N   1 
ATOM   1084 C  CA  . ASP A 1 161 ? -18.088 -35.202 -1.311  1.00 5.92  ? 176  ASP B CA  1 
ATOM   1085 C  C   . ASP A 1 161 ? -18.639 -34.398 -2.482  1.00 6.76  ? 176  ASP B C   1 
ATOM   1086 O  O   . ASP A 1 161 ? -18.807 -34.920 -3.580  1.00 6.83  ? 176  ASP B O   1 
ATOM   1087 C  CB  . ASP A 1 161 ? -19.133 -36.138 -0.710  1.00 8.64  ? 176  ASP B CB  1 
ATOM   1088 C  CG  . ASP A 1 161 ? -18.540 -37.053 0.338   1.00 10.00 ? 176  ASP B CG  1 
ATOM   1089 O  OD1 . ASP A 1 161 ? -17.609 -37.810 -0.000  1.00 12.26 ? 176  ASP B OD1 1 
ATOM   1090 O  OD2 . ASP A 1 161 ? -18.981 -36.999 1.500   1.00 8.59  ? 176  ASP B OD2 1 
ATOM   1091 N  N   . TRP A 1 162 ? -18.900 -33.118 -2.248  1.00 6.28  ? 177  TRP B N   1 
ATOM   1092 C  CA  . TRP A 1 162 ? -19.301 -32.216 -3.319  1.00 6.26  ? 177  TRP B CA  1 
ATOM   1093 C  C   . TRP A 1 162 ? -18.860 -30.823 -2.939  1.00 7.04  ? 177  TRP B C   1 
ATOM   1094 O  O   . TRP A 1 162 ? -19.000 -30.405 -1.783  1.00 6.69  ? 177  TRP B O   1 
ATOM   1095 C  CB  . TRP A 1 162 ? -20.810 -32.245 -3.523  1.00 6.27  ? 177  TRP B CB  1 
ATOM   1096 C  CG  . TRP A 1 162 ? -21.274 -31.740 -4.863  1.00 6.82  ? 177  TRP B CG  1 
ATOM   1097 C  CD1 . TRP A 1 162 ? -21.047 -32.316 -6.088  1.00 8.90  ? 177  TRP B CD1 1 
ATOM   1098 C  CD2 . TRP A 1 162 ? -22.089 -30.592 -5.105  1.00 5.95  ? 177  TRP B CD2 1 
ATOM   1099 N  NE1 . TRP A 1 162 ? -21.657 -31.579 -7.077  1.00 7.11  ? 177  TRP B NE1 1 
ATOM   1100 C  CE2 . TRP A 1 162 ? -22.316 -30.523 -6.501  1.00 6.44  ? 177  TRP B CE2 1 
ATOM   1101 C  CE3 . TRP A 1 162 ? -22.663 -29.617 -4.277  1.00 6.69  ? 177  TRP B CE3 1 
ATOM   1102 C  CZ2 . TRP A 1 162 ? -23.092 -29.513 -7.085  1.00 6.58  ? 177  TRP B CZ2 1 
ATOM   1103 C  CZ3 . TRP A 1 162 ? -23.439 -28.617 -4.859  1.00 6.70  ? 177  TRP B CZ3 1 
ATOM   1104 C  CH2 . TRP A 1 162 ? -23.639 -28.571 -6.252  1.00 6.97  ? 177  TRP B CH2 1 
ATOM   1105 N  N   . VAL A 1 163 ? -18.335 -30.101 -3.916  1.00 5.68  ? 178  VAL B N   1 
ATOM   1106 C  CA  . VAL A 1 163 ? -17.845 -28.744 -3.712  1.00 6.05  ? 178  VAL B CA  1 
ATOM   1107 C  C   . VAL A 1 163 ? -18.307 -27.916 -4.885  1.00 7.21  ? 178  VAL B C   1 
ATOM   1108 O  O   . VAL A 1 163 ? -18.135 -28.319 -6.030  1.00 7.89  ? 178  VAL B O   1 
ATOM   1109 C  CB  . VAL A 1 163 ? -16.315 -28.714 -3.628  1.00 4.98  ? 178  VAL B CB  1 
ATOM   1110 C  CG1 . VAL A 1 163 ? -15.824 -27.282 -3.497  1.00 8.59  ? 178  VAL B CG1 1 
ATOM   1111 C  CG2 . VAL A 1 163 ? -15.844 -29.558 -2.447  1.00 6.69  ? 178  VAL B CG2 1 
ATOM   1112 N  N   . TYR A 1 164 ? -18.875 -26.753 -4.597  1.00 5.82  ? 179  TYR B N   1 
ATOM   1113 C  CA  . TYR A 1 164 ? -19.548 -25.945 -5.606  1.00 5.57  ? 179  TYR B CA  1 
ATOM   1114 C  C   . TYR A 1 164 ? -19.225 -24.478 -5.342  1.00 5.36  ? 179  TYR B C   1 
ATOM   1115 O  O   . TYR A 1 164 ? -19.543 -23.949 -4.278  1.00 5.49  ? 179  TYR B O   1 
ATOM   1116 C  CB  . TYR A 1 164 ? -21.052 -26.241 -5.535  1.00 6.33  ? 179  TYR B CB  1 
ATOM   1117 C  CG  . TYR A 1 164 ? -21.984 -25.356 -6.336  1.00 5.67  ? 179  TYR B CG  1 
ATOM   1118 C  CD1 . TYR A 1 164 ? -21.626 -24.870 -7.590  1.00 6.75  ? 179  TYR B CD1 1 
ATOM   1119 C  CD2 . TYR A 1 164 ? -23.246 -25.031 -5.837  1.00 6.71  ? 179  TYR B CD2 1 
ATOM   1120 C  CE1 . TYR A 1 164 ? -22.503 -24.058 -8.320  1.00 6.94  ? 179  TYR B CE1 1 
ATOM   1121 C  CE2 . TYR A 1 164 ? -24.119 -24.230 -6.559  1.00 8.42  ? 179  TYR B CE2 1 
ATOM   1122 C  CZ  . TYR A 1 164 ? -23.745 -23.753 -7.790  1.00 8.68  ? 179  TYR B CZ  1 
ATOM   1123 O  OH  . TYR A 1 164 ? -24.632 -22.957 -8.480  1.00 12.09 ? 179  TYR B OH  1 
ATOM   1124 N  N   . TYR A 1 165 ? -18.551 -23.835 -6.288  1.00 5.85  ? 180  TYR B N   1 
ATOM   1125 C  CA  . TYR A 1 165 ? -18.199 -22.428 -6.160  1.00 4.98  ? 180  TYR B CA  1 
ATOM   1126 C  C   . TYR A 1 165 ? -19.453 -21.637 -6.511  1.00 7.01  ? 180  TYR B C   1 
ATOM   1127 O  O   . TYR A 1 165 ? -19.608 -21.110 -7.609  1.00 6.43  ? 180  TYR B O   1 
ATOM   1128 C  CB  . TYR A 1 165 ? -17.012 -22.128 -7.086  1.00 5.96  ? 180  TYR B CB  1 
ATOM   1129 C  CG  . TYR A 1 165 ? -16.343 -20.775 -6.955  1.00 5.91  ? 180  TYR B CG  1 
ATOM   1130 C  CD1 . TYR A 1 165 ? -16.906 -19.739 -6.217  1.00 7.54  ? 180  TYR B CD1 1 
ATOM   1131 C  CD2 . TYR A 1 165 ? -15.150 -20.526 -7.630  1.00 6.83  ? 180  TYR B CD2 1 
ATOM   1132 C  CE1 . TYR A 1 165 ? -16.271 -18.495 -6.140  1.00 7.96  ? 180  TYR B CE1 1 
ATOM   1133 C  CE2 . TYR A 1 165 ? -14.522 -19.309 -7.561  1.00 7.01  ? 180  TYR B CE2 1 
ATOM   1134 C  CZ  . TYR A 1 165 ? -15.082 -18.295 -6.824  1.00 8.23  ? 180  TYR B CZ  1 
ATOM   1135 O  OH  . TYR A 1 165 ? -14.434 -17.077 -6.768  1.00 11.09 ? 180  TYR B OH  1 
ATOM   1136 N  N   . GLU A 1 166 ? -20.365 -21.576 -5.545  1.00 5.82  ? 181  GLU B N   1 
ATOM   1137 C  CA  . GLU A 1 166 ? -21.745 -21.171 -5.781  1.00 8.00  ? 181  GLU B CA  1 
ATOM   1138 C  C   . GLU A 1 166 ? -21.957 -19.677 -5.960  1.00 6.69  ? 181  GLU B C   1 
ATOM   1139 O  O   . GLU A 1 166 ? -22.813 -19.253 -6.747  1.00 7.95  ? 181  GLU B O   1 
ATOM   1140 C  CB  . GLU A 1 166 ? -22.620 -21.659 -4.627  1.00 7.36  ? 181  GLU B CB  1 
ATOM   1141 C  CG  . GLU A 1 166 ? -24.067 -21.239 -4.761  1.00 8.72  ? 181  GLU B CG  1 
ATOM   1142 C  CD  . GLU A 1 166 ? -24.958 -21.855 -3.700  1.00 7.46  ? 181  GLU B CD  1 
ATOM   1143 O  OE1 . GLU A 1 166 ? -26.134 -22.116 -4.024  1.00 9.29  ? 181  GLU B OE1 1 
ATOM   1144 O  OE2 . GLU A 1 166 ? -24.485 -22.073 -2.559  1.00 7.98  ? 181  GLU B OE2 1 
ATOM   1145 N  N   . SER A 1 167 ? -21.220 -18.871 -5.203  1.00 6.24  ? 182  SER B N   1 
ATOM   1146 C  CA  . SER A 1 167 ? -21.308 -17.428 -5.375  1.00 7.99  ? 182  SER B CA  1 
ATOM   1147 C  C   . SER A 1 167 ? -19.934 -16.799 -5.240  1.00 7.30  ? 182  SER B C   1 
ATOM   1148 O  O   . SER A 1 167 ? -19.002 -17.428 -4.761  1.00 7.40  ? 182  SER B O   1 
ATOM   1149 C  CB  . SER A 1 167 ? -22.305 -16.791 -4.398  1.00 11.80 ? 182  SER B CB  1 
ATOM   1150 O  OG  . SER A 1 167 ? -21.665 -16.262 -3.250  1.00 11.37 ? 182  SER B OG  1 
ATOM   1151 N  N   . LYS A 1 168 ? -19.795 -15.554 -5.677  1.00 7.83  ? 183  LYS B N   1 
ATOM   1152 C  CA  . LYS A 1 168 ? -18.522 -14.872 -5.492  1.00 7.78  ? 183  LYS B CA  1 
ATOM   1153 C  C   . LYS A 1 168 ? -18.192 -14.739 -4.006  1.00 7.81  ? 183  LYS B C   1 
ATOM   1154 O  O   . LYS A 1 168 ? -17.035 -14.519 -3.641  1.00 9.14  ? 183  LYS B O   1 
ATOM   1155 C  CB  . LYS A 1 168 ? -18.552 -13.490 -6.146  1.00 8.36  ? 183  LYS B CB  1 
ATOM   1156 C  CG  . LYS A 1 168 ? -18.711 -13.519 -7.668  1.00 9.62  ? 183  LYS B CG  1 
ATOM   1157 C  CD  . LYS A 1 168 ? -17.461 -14.041 -8.366  1.00 11.69 ? 183  LYS B CD  1 
ATOM   1158 C  CE  . LYS A 1 168 ? -17.626 -13.963 -9.876  1.00 17.48 ? 183  LYS B CE  1 
ATOM   1159 N  NZ  . LYS A 1 168 ? -16.329 -14.110 -10.594 1.00 20.98 ? 183  LYS B NZ  1 
ATOM   1160 N  N   . ALA A 1 169 ? -19.208 -14.883 -3.158  1.00 7.76  ? 184  ALA B N   1 
ATOM   1161 C  CA  . ALA A 1 169 ? -19.034 -14.692 -1.715  1.00 9.85  ? 184  ALA B CA  1 
ATOM   1162 C  C   . ALA A 1 169 ? -18.813 -15.966 -0.892  1.00 7.82  ? 184  ALA B C   1 
ATOM   1163 O  O   . ALA A 1 169 ? -18.560 -15.877 0.304   1.00 7.83  ? 184  ALA B O   1 
ATOM   1164 C  CB  . ALA A 1 169 ? -20.198 -13.899 -1.135  1.00 10.28 ? 184  ALA B CB  1 
ATOM   1165 N  N   . HIS A 1 170 ? -18.912 -17.144 -1.508  1.00 7.00  ? 185  HIS B N   1 
ATOM   1166 C  CA  . HIS A 1 170 ? -18.743 -18.385 -0.745  1.00 6.09  ? 185  HIS B CA  1 
ATOM   1167 C  C   . HIS A 1 170 ? -18.618 -19.624 -1.613  1.00 6.82  ? 185  HIS B C   1 
ATOM   1168 O  O   . HIS A 1 170 ? -19.029 -19.635 -2.778  1.00 6.75  ? 185  HIS B O   1 
ATOM   1169 C  CB  . HIS A 1 170 ? -19.934 -18.604 0.190   1.00 7.82  ? 185  HIS B CB  1 
ATOM   1170 C  CG  . HIS A 1 170 ? -21.156 -19.116 -0.513  1.00 8.42  ? 185  HIS B CG  1 
ATOM   1171 N  ND1 . HIS A 1 170 ? -21.953 -18.315 -1.303  1.00 14.05 ? 185  HIS B ND1 1 
ATOM   1172 C  CD2 . HIS A 1 170 ? -21.690 -20.356 -0.578  1.00 7.38  ? 185  HIS B CD2 1 
ATOM   1173 C  CE1 . HIS A 1 170 ? -22.945 -19.036 -1.798  1.00 13.69 ? 185  HIS B CE1 1 
ATOM   1174 N  NE2 . HIS A 1 170 ? -22.812 -20.277 -1.363  1.00 8.17  ? 185  HIS B NE2 1 
ATOM   1175 N  N   . VAL A 1 171 ? -18.073 -20.671 -1.003  1.00 5.93  ? 186  VAL B N   1 
ATOM   1176 C  CA  . VAL A 1 171 ? -18.018 -22.005 -1.598  1.00 4.72  ? 186  VAL B CA  1 
ATOM   1177 C  C   . VAL A 1 171 ? -18.921 -22.942 -0.797  1.00 5.46  ? 186  VAL B C   1 
ATOM   1178 O  O   . VAL A 1 171 ? -18.830 -22.994 0.426   1.00 6.40  ? 186  VAL B O   1 
ATOM   1179 C  CB  . VAL A 1 171 ? -16.588 -22.561 -1.583  1.00 5.37  ? 186  VAL B CB  1 
ATOM   1180 C  CG1 . VAL A 1 171 ? -16.549 -23.935 -2.227  1.00 6.71  ? 186  VAL B CG1 1 
ATOM   1181 C  CG2 . VAL A 1 171 ? -15.629 -21.611 -2.304  1.00 8.31  ? 186  VAL B CG2 1 
ATOM   1182 N  N   . HIS A 1 172 ? -19.785 -23.678 -1.486  1.00 5.66  ? 187  HIS B N   1 
ATOM   1183 C  CA  . HIS A 1 172 ? -20.709 -24.618 -0.849  1.00 5.41  ? 187  HIS B CA  1 
ATOM   1184 C  C   . HIS A 1 172 ? -20.102 -26.003 -0.870  1.00 6.47  ? 187  HIS B C   1 
ATOM   1185 O  O   . HIS A 1 172 ? -19.785 -26.511 -1.945  1.00 6.17  ? 187  HIS B O   1 
ATOM   1186 C  CB  . HIS A 1 172 ? -22.028 -24.627 -1.633  1.00 5.57  ? 187  HIS B CB  1 
ATOM   1187 C  CG  . HIS A 1 172 ? -22.973 -25.717 -1.237  1.00 5.15  ? 187  HIS B CG  1 
ATOM   1188 N  ND1 . HIS A 1 172 ? -24.009 -25.519 -0.347  1.00 5.77  ? 187  HIS B ND1 1 
ATOM   1189 C  CD2 . HIS A 1 172 ? -23.050 -27.012 -1.624  1.00 5.21  ? 187  HIS B CD2 1 
ATOM   1190 C  CE1 . HIS A 1 172 ? -24.681 -26.648 -0.202  1.00 5.76  ? 187  HIS B CE1 1 
ATOM   1191 N  NE2 . HIS A 1 172 ? -24.123 -27.569 -0.972  1.00 6.46  ? 187  HIS B NE2 1 
ATOM   1192 N  N   . CYS A 1 173 ? -19.929 -26.602 0.310   1.00 5.47  ? 188  CYS B N   1 
ATOM   1193 C  CA  . CYS A 1 173 ? -19.323 -27.925 0.451   1.00 5.34  ? 188  CYS B CA  1 
ATOM   1194 C  C   . CYS A 1 173 ? -20.260 -28.847 1.191   1.00 5.29  ? 188  CYS B C   1 
ATOM   1195 O  O   . CYS A 1 173 ? -20.845 -28.451 2.204   1.00 6.45  ? 188  CYS B O   1 
ATOM   1196 C  CB  . CYS A 1 173 ? -18.022 -27.829 1.240   1.00 5.62  ? 188  CYS B CB  1 
ATOM   1197 S  SG  . CYS A 1 173 ? -16.859 -26.616 0.585   1.00 7.92  ? 188  CYS B SG  1 
ATOM   1198 N  N   . SER A 1 174 ? -20.393 -30.086 0.726   1.00 5.39  ? 189  SER B N   1 
ATOM   1199 C  CA  . SER A 1 174 ? -21.279 -31.021 1.408   1.00 5.19  ? 189  SER B CA  1 
ATOM   1200 C  C   . SER A 1 174 ? -20.684 -32.413 1.517   1.00 5.71  ? 189  SER B C   1 
ATOM   1201 O  O   . SER A 1 174 ? -19.688 -32.728 0.868   1.00 6.16  ? 189  SER B O   1 
ATOM   1202 C  CB  . SER A 1 174 ? -22.659 -31.071 0.740   1.00 6.44  ? 189  SER B CB  1 
ATOM   1203 O  OG  . SER A 1 174 ? -22.556 -31.502 -0.613  1.00 5.91  ? 189  SER B OG  1 
ATOM   1204 N  N   . VAL A 1 175 ? -21.301 -33.231 2.362   1.00 6.06  ? 190  VAL B N   1 
ATOM   1205 C  CA  . VAL A 1 175 ? -20.882 -34.615 2.554   1.00 6.64  ? 190  VAL B CA  1 
ATOM   1206 C  C   . VAL A 1 175 ? -22.067 -35.569 2.452   1.00 6.66  ? 190  VAL B C   1 
ATOM   1207 O  O   . VAL A 1 175 ? -23.226 -35.186 2.654   1.00 6.93  ? 190  VAL B O   1 
ATOM   1208 C  CB  . VAL A 1 175 ? -20.166 -34.821 3.922   1.00 7.28  ? 190  VAL B CB  1 
ATOM   1209 C  CG1 . VAL A 1 175 ? -18.913 -33.972 4.002   1.00 7.85  ? 190  VAL B CG1 1 
ATOM   1210 C  CG2 . VAL A 1 175 ? -21.099 -34.491 5.076   1.00 6.36  ? 190  VAL B CG2 1 
ATOM   1211 N  N   . LYS A 1 176 ? -21.751 -36.823 2.134   1.00 7.30  ? 191  LYS B N   1 
ATOM   1212 C  CA  . LYS A 1 176 ? -22.733 -37.904 2.155   1.00 7.55  ? 191  LYS B CA  1 
ATOM   1213 C  C   . LYS A 1 176 ? -23.072 -38.272 3.592   1.00 8.41  ? 191  LYS B C   1 
ATOM   1214 O  O   . LYS A 1 176 ? -22.348 -37.920 4.523   1.00 8.88  ? 191  LYS B O   1 
ATOM   1215 C  CB  . LYS A 1 176 ? -22.172 -39.132 1.433   1.00 11.59 ? 191  LYS B CB  1 
ATOM   1216 C  CG  . LYS A 1 176 ? -20.998 -39.774 2.142   1.00 13.65 ? 191  LYS B CG  1 
ATOM   1217 C  CD  . LYS A 1 176 ? -20.552 -41.056 1.442   1.00 18.67 ? 191  LYS B CD  1 
ATOM   1218 C  CE  . LYS A 1 176 ? -19.890 -40.739 0.117   1.00 21.51 ? 191  LYS B CE  1 
ATOM   1219 N  NZ  . LYS A 1 176 ? -19.370 -41.969 -0.558  1.00 31.14 ? 191  LYS B NZ  1 
ATOM   1220 N  N   . SER A 1 177 ? -24.186 -38.975 3.765   1.00 10.73 ? 192  SER B N   1 
ATOM   1221 C  CA  . SER A 1 177 ? -24.582 -39.475 5.074   1.00 13.31 ? 192  SER B CA  1 
ATOM   1222 C  C   . SER A 1 177 ? -24.056 -40.890 5.233   1.00 16.25 ? 192  SER B C   1 
ATOM   1223 O  O   . SER A 1 177 ? -23.613 -41.507 4.267   1.00 16.42 ? 192  SER B O   1 
ATOM   1224 C  CB  . SER A 1 177 ? -26.104 -39.507 5.193   1.00 13.83 ? 192  SER B CB  1 
ATOM   1225 O  OG  . SER A 1 177 ? -26.616 -40.672 4.567   1.00 16.29 ? 192  SER B OG  1 
ATOM   1226 N  N   . GLU A 1 178 ? -24.138 -41.419 6.446   1.00 18.15 ? 193  GLU B N   1 
ATOM   1227 C  CA  . GLU A 1 178 ? -23.731 -42.799 6.695   1.00 18.64 ? 193  GLU B CA  1 
ATOM   1228 C  C   . GLU A 1 178 ? -24.865 -43.784 6.436   1.00 21.51 ? 193  GLU B C   1 
ATOM   1229 O  O   . GLU A 1 178 ? -24.794 -44.943 6.843   1.00 19.01 ? 193  GLU B O   1 
ATOM   1230 C  CB  . GLU A 1 178 ? -23.234 -42.955 8.131   1.00 24.09 ? 193  GLU B CB  1 
ATOM   1231 C  CG  . GLU A 1 178 ? -24.253 -42.570 9.183   1.00 25.81 ? 193  GLU B CG  1 
ATOM   1232 C  CD  . GLU A 1 178 ? -23.816 -42.960 10.586  1.00 34.77 ? 193  GLU B CD  1 
ATOM   1233 O  OE1 . GLU A 1 178 ? -23.506 -44.154 10.805  1.00 34.51 ? 193  GLU B OE1 1 
ATOM   1234 O  OE2 . GLU A 1 178 ? -23.787 -42.073 11.468  1.00 35.18 ? 193  GLU B OE2 1 
ATOM   1235 N  N   . HIS A 1 179 ? -25.909 -43.339 5.746   1.00 15.87 ? 194  HIS B N   1 
ATOM   1236 C  CA  . HIS A 1 179 ? -27.106 -44.161 5.630   1.00 13.06 ? 194  HIS B CA  1 
ATOM   1237 C  C   . HIS A 1 179 ? -27.378 -44.804 4.248   1.00 18.76 ? 194  HIS B C   1 
ATOM   1238 O  O   . HIS A 1 179 ? -28.531 -45.010 3.871   1.00 17.58 ? 194  HIS B O   1 
ATOM   1239 C  CB  . HIS A 1 179 ? -28.321 -43.392 6.189   1.00 15.04 ? 194  HIS B CB  1 
ATOM   1240 C  CG  . HIS A 1 179 ? -28.092 -42.836 7.567   1.00 13.70 ? 194  HIS B CG  1 
ATOM   1241 N  ND1 . HIS A 1 179 ? -27.929 -43.637 8.677   1.00 12.88 ? 194  HIS B ND1 1 
ATOM   1242 C  CD2 . HIS A 1 179 ? -27.977 -41.559 8.008   1.00 15.60 ? 194  HIS B CD2 1 
ATOM   1243 C  CE1 . HIS A 1 179 ? -27.736 -42.881 9.743   1.00 17.79 ? 194  HIS B CE1 1 
ATOM   1244 N  NE2 . HIS A 1 179 ? -27.756 -41.616 9.365   1.00 19.06 ? 194  HIS B NE2 1 
ATOM   1245 N  N   . SER A 1 180 ? -26.310 -45.163 3.525   1.00 19.00 ? 195  SER B N   1 
ATOM   1246 C  CA  . SER A 1 180 ? -26.411 -45.927 2.269   1.00 21.32 ? 195  SER B CA  1 
ATOM   1247 C  C   . SER A 1 180 ? -25.413 -47.102 2.185   1.00 20.46 ? 195  SER B C   1 
ATOM   1248 O  O   . SER A 1 180 ? -25.045 -47.558 1.100   1.00 21.36 ? 195  SER B O   1 
ATOM   1249 C  CB  . SER A 1 180 ? -26.248 -45.006 1.061   1.00 23.57 ? 195  SER B CB  1 
ATOM   1250 O  OG  . SER A 1 180 ? -27.456 -44.323 0.781   1.00 34.97 ? 195  SER B OG  1 
ATOM   1251 N  N   . ALA A 1 181 ? -25.020 -47.599 3.349   1.00 17.85 ? 196  ALA B N   1 
ATOM   1252 C  CA  . ALA A 1 181 ? -23.977 -48.606 3.509   1.00 19.42 ? 196  ALA B CA  1 
ATOM   1253 C  C   . ALA A 1 181 ? -24.326 -49.977 2.942   1.00 16.31 ? 196  ALA B C   1 
ATOM   1254 O  O   . ALA A 1 181 ? -23.468 -50.663 2.379   1.00 17.40 ? 196  ALA B O   1 
ATOM   1255 C  CB  . ALA A 1 181 ? -23.639 -48.741 4.996   1.00 16.56 ? 196  ALA B CB  1 
ATOM   1256 N  N   . ALA A 1 182 ? -25.572 -50.397 3.124   1.00 11.65 ? 197  ALA B N   1 
ATOM   1257 C  CA  . ALA A 1 182 ? -25.961 -51.751 2.769   1.00 10.63 ? 197  ALA B CA  1 
ATOM   1258 C  C   . ALA A 1 182 ? -25.736 -52.008 1.287   1.00 10.78 ? 197  ALA B C   1 
ATOM   1259 O  O   . ALA A 1 182 ? -26.024 -51.154 0.452   1.00 9.78  ? 197  ALA B O   1 
ATOM   1260 C  CB  . ALA A 1 182 ? -27.412 -51.999 3.137   1.00 12.20 ? 197  ALA B CB  1 
HETATM 1261 ZN ZN  . ZN  B 2 .   ? -24.540 -23.859 0.767   0.91 6.15  ? 1001 ZN  B ZN  1 
HETATM 1262 S  S   . SO4 C 3 .   ? -12.467 -31.873 -11.061 1.00 18.22 ? 1    SO4 B S   1 
HETATM 1263 O  O1  . SO4 C 3 .   ? -13.906 -32.076 -11.196 1.00 19.78 ? 1    SO4 B O1  1 
HETATM 1264 O  O2  . SO4 C 3 .   ? -12.104 -32.039 -9.665  1.00 19.92 ? 1    SO4 B O2  1 
HETATM 1265 O  O3  . SO4 C 3 .   ? -11.762 -32.871 -11.864 1.00 23.63 ? 1    SO4 B O3  1 
HETATM 1266 O  O4  . SO4 C 3 .   ? -12.106 -30.543 -11.527 1.00 22.16 ? 1    SO4 B O4  1 
HETATM 1267 S  S   . SO4 D 3 .   ? -38.631 -31.531 4.414   1.00 22.50 ? 2    SO4 B S   1 
HETATM 1268 O  O1  . SO4 D 3 .   ? -39.674 -30.837 5.168   1.00 28.47 ? 2    SO4 B O1  1 
HETATM 1269 O  O2  . SO4 D 3 .   ? -37.933 -32.436 5.321   1.00 19.54 ? 2    SO4 B O2  1 
HETATM 1270 O  O3  . SO4 D 3 .   ? -39.254 -32.286 3.331   1.00 27.85 ? 2    SO4 B O3  1 
HETATM 1271 O  O4  . SO4 D 3 .   ? -37.718 -30.552 3.836   1.00 22.94 ? 2    SO4 B O4  1 
HETATM 1272 S  S   . SO4 E 3 .   ? -34.248 -39.618 -4.279  1.00 16.26 ? 3    SO4 B S   1 
HETATM 1273 O  O1  . SO4 E 3 .   ? -35.582 -40.138 -3.992  1.00 16.98 ? 3    SO4 B O1  1 
HETATM 1274 O  O2  . SO4 E 3 .   ? -33.964 -38.542 -3.339  1.00 20.18 ? 3    SO4 B O2  1 
HETATM 1275 O  O3  . SO4 E 3 .   ? -33.237 -40.655 -4.173  1.00 22.53 ? 3    SO4 B O3  1 
HETATM 1276 O  O4  . SO4 E 3 .   ? -34.216 -39.111 -5.655  1.00 19.04 ? 3    SO4 B O4  1 
HETATM 1277 S  S   . SO4 F 3 .   ? -14.953 -18.304 16.334  1.00 24.12 ? 4    SO4 B S   1 
HETATM 1278 O  O1  . SO4 F 3 .   ? -15.978 -17.982 15.352  1.00 16.72 ? 4    SO4 B O1  1 
HETATM 1279 O  O2  . SO4 F 3 .   ? -13.707 -17.610 16.013  1.00 26.72 ? 4    SO4 B O2  1 
HETATM 1280 O  O3  . SO4 F 3 .   ? -15.406 -17.882 17.660  1.00 26.81 ? 4    SO4 B O3  1 
HETATM 1281 O  O4  . SO4 F 3 .   ? -14.699 -19.744 16.308  1.00 22.18 ? 4    SO4 B O4  1 
HETATM 1282 C  C1  . GOL G 4 .   ? -35.949 -37.273 12.890  1.00 25.91 ? 203  GOL B C1  1 
HETATM 1283 O  O1  . GOL G 4 .   ? -36.678 -37.088 11.698  1.00 30.37 ? 203  GOL B O1  1 
HETATM 1284 C  C2  . GOL G 4 .   ? -36.739 -38.152 13.850  1.00 27.83 ? 203  GOL B C2  1 
HETATM 1285 O  O2  . GOL G 4 .   ? -37.850 -37.464 14.383  1.00 34.21 ? 203  GOL B O2  1 
HETATM 1286 C  C3  . GOL G 4 .   ? -37.168 -39.454 13.191  1.00 30.37 ? 203  GOL B C3  1 
HETATM 1287 O  O3  . GOL G 4 .   ? -36.105 -40.381 13.263  1.00 27.12 ? 203  GOL B O3  1 
HETATM 1288 O  O   . HOH H 5 .   ? -17.224 -14.158 11.172  1.00 15.68 ? 5    HOH B O   1 
HETATM 1289 O  O   . HOH H 5 .   ? -23.193 -26.789 10.432  1.00 8.71  ? 6    HOH B O   1 
HETATM 1290 O  O   . HOH H 5 .   ? -22.734 -37.131 7.128   1.00 9.55  ? 7    HOH B O   1 
HETATM 1291 O  O   . HOH H 5 .   ? -28.584 -32.573 -6.856  1.00 17.03 ? 8    HOH B O   1 
HETATM 1292 O  O   . HOH H 5 .   ? -22.967 -37.723 12.701  1.00 13.33 ? 9    HOH B O   1 
HETATM 1293 O  O   . HOH H 5 .   ? -15.371 -32.966 -4.157  1.00 9.61  ? 10   HOH B O   1 
HETATM 1294 O  O   . HOH H 5 .   ? -17.553 -37.281 -4.252  1.00 12.14 ? 11   HOH B O   1 
HETATM 1295 O  O   . HOH H 5 .   ? -14.973 -15.160 -5.269  1.00 12.16 ? 12   HOH B O   1 
HETATM 1296 O  O   . HOH H 5 .   ? -15.397 -29.926 -11.939 1.00 13.06 ? 13   HOH B O   1 
HETATM 1297 O  O   . HOH H 5 .   ? -32.211 -36.464 -2.994  1.00 14.82 ? 14   HOH B O   1 
HETATM 1298 O  O   . HOH H 5 .   ? -27.018 -32.596 18.593  1.00 13.90 ? 15   HOH B O   1 
HETATM 1299 O  O   . HOH H 5 .   ? -30.067 -13.861 20.009  1.00 27.45 ? 204  HOH B O   1 
HETATM 1300 O  O   . HOH H 5 .   ? -17.190 -37.404 -12.859 1.00 35.90 ? 205  HOH B O   1 
HETATM 1301 O  O   . HOH H 5 .   ? -32.645 -30.990 21.195  1.00 27.48 ? 206  HOH B O   1 
HETATM 1302 O  O   . HOH H 5 .   ? -8.725  -32.542 -11.136 1.00 27.72 ? 207  HOH B O   1 
HETATM 1303 O  O   . HOH H 5 .   ? -2.426  -28.141 -14.238 1.00 36.41 ? 208  HOH B O   1 
HETATM 1304 O  O   . HOH H 5 .   ? -0.614  -20.429 9.774   1.00 30.53 ? 209  HOH B O   1 
HETATM 1305 O  O   . HOH H 5 .   ? -3.676  -31.912 -1.645  1.00 30.79 ? 210  HOH B O   1 
HETATM 1306 O  O   . HOH H 5 .   ? -3.026  -23.718 -11.053 1.00 30.74 ? 211  HOH B O   1 
HETATM 1307 O  O   . HOH H 5 .   ? -35.144 -27.756 10.647  1.00 25.28 ? 212  HOH B O   1 
HETATM 1308 O  O   . HOH H 5 .   ? -31.114 -12.651 9.435   1.00 27.23 ? 213  HOH B O   1 
HETATM 1309 O  O   . HOH H 5 .   ? -4.868  -17.060 -8.230  1.00 34.49 ? 214  HOH B O   1 
HETATM 1310 O  O   . HOH H 5 .   ? -36.413 -25.459 16.662  1.00 31.67 ? 215  HOH B O   1 
HETATM 1311 O  O   . HOH H 5 .   ? -37.969 -24.618 3.705   1.00 31.60 ? 216  HOH B O   1 
HETATM 1312 O  O   . HOH H 5 .   ? -6.526  -15.300 11.216  1.00 31.45 ? 217  HOH B O   1 
HETATM 1313 O  O   . HOH H 5 .   ? -22.286 -39.260 14.746  1.00 28.13 ? 218  HOH B O   1 
HETATM 1314 O  O   . HOH H 5 .   ? -39.117 -32.379 -0.245  1.00 31.63 ? 219  HOH B O   1 
HETATM 1315 O  O   . HOH H 5 .   ? -16.931 -19.212 -14.540 1.00 23.04 ? 220  HOH B O   1 
HETATM 1316 O  O   . HOH H 5 .   ? -38.326 -31.505 10.566  1.00 30.00 ? 221  HOH B O   1 
HETATM 1317 O  O   . HOH H 5 .   ? -20.218 -39.948 -10.337 1.00 26.93 ? 222  HOH B O   1 
HETATM 1318 O  O   . HOH H 5 .   ? -24.082 -18.419 19.664  1.00 27.18 ? 223  HOH B O   1 
HETATM 1319 O  O   . HOH H 5 .   ? -2.995  -30.093 -12.373 1.00 30.82 ? 224  HOH B O   1 
HETATM 1320 O  O   . HOH H 5 .   ? -13.535 -8.502  5.936   1.00 30.82 ? 225  HOH B O   1 
HETATM 1321 O  O   . HOH H 5 .   ? -13.328 -40.972 5.555   1.00 34.61 ? 226  HOH B O   1 
HETATM 1322 O  O   . HOH H 5 .   ? -3.537  -18.651 12.245  1.00 32.29 ? 227  HOH B O   1 
HETATM 1323 O  O   . HOH H 5 .   ? -1.989  -14.117 -0.573  1.00 33.23 ? 228  HOH B O   1 
HETATM 1324 O  O   . HOH H 5 .   ? -9.292  -9.364  2.172   1.00 28.07 ? 229  HOH B O   1 
HETATM 1325 O  O   . HOH H 5 .   ? -8.927  -10.880 8.697   1.00 31.04 ? 230  HOH B O   1 
HETATM 1326 O  O   . HOH H 5 .   ? -20.026 -37.388 19.556  1.00 29.74 ? 231  HOH B O   1 
HETATM 1327 O  O   . HOH H 5 .   ? -7.821  -9.650  -3.370  1.00 29.25 ? 232  HOH B O   1 
HETATM 1328 O  O   . HOH H 5 .   ? -36.598 -36.404 -8.445  1.00 32.82 ? 233  HOH B O   1 
HETATM 1329 O  O   . HOH H 5 .   ? -30.604 -25.821 -5.417  1.00 30.72 ? 234  HOH B O   1 
HETATM 1330 O  O   . HOH H 5 .   ? -4.563  -29.776 14.447  1.00 33.65 ? 235  HOH B O   1 
HETATM 1331 O  O   . HOH H 5 .   ? -29.833 -34.423 -8.159  1.00 30.03 ? 236  HOH B O   1 
HETATM 1332 O  O   . HOH H 5 .   ? -21.366 -20.304 19.559  1.00 28.60 ? 237  HOH B O   1 
HETATM 1333 O  O   . HOH H 5 .   ? -21.076 -12.703 13.365  1.00 30.14 ? 238  HOH B O   1 
HETATM 1334 O  O   . HOH H 5 .   ? -12.075 -18.241 -13.990 1.00 34.04 ? 239  HOH B O   1 
HETATM 1335 O  O   . HOH H 5 .   ? -11.276 -35.868 -5.333  1.00 30.65 ? 240  HOH B O   1 
HETATM 1336 O  O   . HOH H 5 .   ? -2.451  -13.390 3.937   1.00 35.69 ? 241  HOH B O   1 
HETATM 1337 O  O   . HOH H 5 .   ? -24.730 -10.139 11.841  1.00 24.58 ? 242  HOH B O   1 
HETATM 1338 O  O   . HOH H 5 .   ? -24.891 -22.181 21.305  1.00 27.13 ? 243  HOH B O   1 
HETATM 1339 O  O   . HOH H 5 .   ? -26.370 -27.540 -9.102  1.00 28.56 ? 244  HOH B O   1 
HETATM 1340 O  O   . HOH H 5 .   ? -17.944 -38.601 -10.662 1.00 30.99 ? 245  HOH B O   1 
HETATM 1341 O  O   . HOH H 5 .   ? -1.903  -26.059 9.665   1.00 23.53 ? 246  HOH B O   1 
HETATM 1342 O  O   . HOH H 5 .   ? -0.000  -29.936 0.000   0.50 32.14 ? 247  HOH B O   1 
HETATM 1343 O  O   . HOH H 5 .   ? -30.978 -16.041 18.576  1.00 27.87 ? 248  HOH B O   1 
HETATM 1344 O  O   . HOH H 5 .   ? -13.673 -30.308 15.982  1.00 19.73 ? 249  HOH B O   1 
HETATM 1345 O  O   . HOH H 5 .   ? -25.809 -22.795 -0.422  1.00 7.23  ? 250  HOH B O   1 
HETATM 1346 O  O   . HOH H 5 .   ? -8.193  -22.872 9.285   1.00 9.03  ? 251  HOH B O   1 
HETATM 1347 O  O   . HOH H 5 .   ? -30.302 -21.090 13.968  1.00 11.55 ? 252  HOH B O   1 
HETATM 1348 O  O   . HOH H 5 .   ? -25.513 -20.209 13.384  1.00 9.86  ? 253  HOH B O   1 
HETATM 1349 O  O   . HOH H 5 .   ? -8.474  -18.558 -6.030  1.00 9.98  ? 254  HOH B O   1 
HETATM 1350 O  O   . HOH H 5 .   ? -8.278  -28.946 12.187  1.00 12.39 ? 255  HOH B O   1 
HETATM 1351 O  O   . HOH H 5 .   ? -11.244 -19.339 -9.941  1.00 14.71 ? 256  HOH B O   1 
HETATM 1352 O  O   . HOH H 5 .   ? -26.825 -22.172 -6.709  1.00 12.98 ? 257  HOH B O   1 
HETATM 1353 O  O   . HOH H 5 .   ? -27.866 -35.557 7.985   1.00 12.59 ? 258  HOH B O   1 
HETATM 1354 O  O   . HOH H 5 .   ? -27.484 -28.855 -0.498  1.00 10.94 ? 259  HOH B O   1 
HETATM 1355 O  O   . HOH H 5 .   ? -14.309 -22.423 16.785  1.00 15.34 ? 260  HOH B O   1 
HETATM 1356 O  O   . HOH H 5 .   ? -11.565 -16.960 -6.639  1.00 14.81 ? 261  HOH B O   1 
HETATM 1357 O  O   . HOH H 5 .   ? -15.279 -34.394 -11.740 1.00 13.70 ? 262  HOH B O   1 
HETATM 1358 O  O   . HOH H 5 .   ? -23.254 -32.849 -14.330 1.00 14.98 ? 263  HOH B O   1 
HETATM 1359 O  O   . HOH H 5 .   ? -13.325 -34.935 -2.351  1.00 13.66 ? 264  HOH B O   1 
HETATM 1360 O  O   . HOH H 5 .   ? -26.905 -30.451 -7.681  1.00 15.76 ? 265  HOH B O   1 
HETATM 1361 O  O   . HOH H 5 .   ? -24.207 -28.273 8.111   1.00 11.19 ? 266  HOH B O   1 
HETATM 1362 O  O   . HOH H 5 .   ? -9.038  -18.291 -8.699  1.00 16.85 ? 267  HOH B O   1 
HETATM 1363 O  O   . HOH H 5 .   ? -19.227 -28.140 -12.802 1.00 13.19 ? 268  HOH B O   1 
HETATM 1364 O  O   . HOH H 5 .   ? -7.047  -31.503 3.616   1.00 14.87 ? 269  HOH B O   1 
HETATM 1365 O  O   . HOH H 5 .   ? -36.543 -40.367 -1.396  1.00 13.40 ? 270  HOH B O   1 
HETATM 1366 O  O   . HOH H 5 .   ? -7.021  -29.667 1.257   1.00 14.01 ? 271  HOH B O   1 
HETATM 1367 O  O   . HOH H 5 .   ? -31.744 -41.215 7.129   1.00 12.95 ? 272  HOH B O   1 
HETATM 1368 O  O   . HOH H 5 .   ? -15.138 -29.774 18.649  1.00 17.25 ? 273  HOH B O   1 
HETATM 1369 O  O   . HOH H 5 .   ? -32.462 -19.327 14.000  1.00 17.35 ? 274  HOH B O   1 
HETATM 1370 O  O   . HOH H 5 .   ? -10.507 -26.579 -11.542 1.00 13.99 ? 275  HOH B O   1 
HETATM 1371 O  O   . HOH H 5 .   ? -8.627  -32.314 -6.743  1.00 16.30 ? 276  HOH B O   1 
HETATM 1372 O  O   . HOH H 5 .   ? -21.329 -38.665 9.435   1.00 15.11 ? 277  HOH B O   1 
HETATM 1373 O  O   . HOH H 5 .   ? -24.040 -16.147 5.650   1.00 14.71 ? 278  HOH B O   1 
HETATM 1374 O  O   . HOH H 5 .   ? -27.528 -28.950 -5.063  1.00 15.88 ? 279  HOH B O   1 
HETATM 1375 O  O   . HOH H 5 .   ? -6.066  -29.334 -9.024  1.00 17.77 ? 280  HOH B O   1 
HETATM 1376 O  O   . HOH H 5 .   ? -9.842  -22.680 -12.958 1.00 16.53 ? 281  HOH B O   1 
HETATM 1377 O  O   . HOH H 5 .   ? -0.000  -18.519 0.000   0.50 16.51 ? 282  HOH B O   1 
HETATM 1378 O  O   . HOH H 5 .   ? -34.581 -26.324 14.762  1.00 19.43 ? 283  HOH B O   1 
HETATM 1379 O  O   . HOH H 5 .   ? -12.569 -24.452 21.327  1.00 19.42 ? 284  HOH B O   1 
HETATM 1380 O  O   . HOH H 5 .   ? -3.101  -19.561 9.726   1.00 20.69 ? 285  HOH B O   1 
HETATM 1381 O  O   . HOH H 5 .   ? -29.671 -19.724 7.841   1.00 16.25 ? 286  HOH B O   1 
HETATM 1382 O  O   . HOH H 5 .   ? -27.080 -37.950 8.642   1.00 14.79 ? 287  HOH B O   1 
HETATM 1383 O  O   . HOH H 5 .   ? -30.182 -41.700 12.035  1.00 16.85 ? 288  HOH B O   1 
HETATM 1384 O  O   . HOH H 5 .   ? -17.730 -32.061 17.575  1.00 27.01 ? 289  HOH B O   1 
HETATM 1385 O  O   . HOH H 5 .   ? -24.496 -17.702 10.071  1.00 14.89 ? 290  HOH B O   1 
HETATM 1386 O  O   . HOH H 5 .   ? -23.479 -13.750 21.119  1.00 16.92 ? 291  HOH B O   1 
HETATM 1387 O  O   . HOH H 5 .   ? -14.663 -16.053 -9.471  1.00 18.14 ? 292  HOH B O   1 
HETATM 1388 O  O   . HOH H 5 .   ? -8.050  -21.933 21.695  1.00 19.48 ? 293  HOH B O   1 
HETATM 1389 O  O   . HOH H 5 .   ? -27.198 -21.221 9.977   1.00 13.20 ? 294  HOH B O   1 
HETATM 1390 O  O   . HOH H 5 .   ? -14.481 -38.575 7.017   1.00 19.74 ? 295  HOH B O   1 
HETATM 1391 O  O   . HOH H 5 .   ? -23.613 -26.176 -14.833 1.00 20.19 ? 296  HOH B O   1 
HETATM 1392 O  O   . HOH H 5 .   ? -29.918 -38.256 7.960   1.00 15.47 ? 297  HOH B O   1 
HETATM 1393 O  O   . HOH H 5 .   ? -36.654 -37.087 7.447   1.00 18.79 ? 298  HOH B O   1 
HETATM 1394 O  O   . HOH H 5 .   ? -1.842  -28.981 3.258   1.00 21.11 ? 299  HOH B O   1 
HETATM 1395 O  O   . HOH H 5 .   ? -7.633  -13.416 8.592   1.00 20.54 ? 300  HOH B O   1 
HETATM 1396 O  O   . HOH H 5 .   ? -21.300 -35.025 19.780  1.00 16.41 ? 301  HOH B O   1 
HETATM 1397 O  O   . HOH H 5 .   ? -6.009  -27.585 13.005  1.00 18.86 ? 302  HOH B O   1 
HETATM 1398 O  O   . HOH H 5 .   ? -26.896 -26.522 -6.574  1.00 21.97 ? 303  HOH B O   1 
HETATM 1399 O  O   . HOH H 5 .   ? -25.295 -28.224 -14.603 1.00 18.77 ? 304  HOH B O   1 
HETATM 1400 O  O   . HOH H 5 .   ? -23.201 -24.937 18.535  1.00 16.15 ? 305  HOH B O   1 
HETATM 1401 O  O   . HOH H 5 .   ? -19.200 -18.083 16.370  1.00 17.47 ? 306  HOH B O   1 
HETATM 1402 O  O   . HOH H 5 .   ? -4.509  -20.958 -7.594  1.00 18.26 ? 307  HOH B O   1 
HETATM 1403 O  O   . HOH H 5 .   ? -5.644  -18.712 -6.224  1.00 17.97 ? 308  HOH B O   1 
HETATM 1404 O  O   . HOH H 5 .   ? -25.951 -30.942 20.714  1.00 18.31 ? 309  HOH B O   1 
HETATM 1405 O  O   . HOH H 5 .   ? 2.320   -24.047 4.571   1.00 16.04 ? 310  HOH B O   1 
HETATM 1406 O  O   . HOH H 5 .   ? -37.482 -34.492 8.406   1.00 19.85 ? 311  HOH B O   1 
HETATM 1407 O  O   . HOH H 5 .   ? -28.979 -21.992 20.515  1.00 20.75 ? 312  HOH B O   1 
HETATM 1408 O  O   . HOH H 5 .   ? -26.422 -21.226 -10.359 1.00 20.74 ? 313  HOH B O   1 
HETATM 1409 O  O   . HOH H 5 .   ? -13.060 -13.895 10.060  1.00 16.64 ? 314  HOH B O   1 
HETATM 1410 O  O   . HOH H 5 .   ? -12.230 -9.541  -1.772  1.00 18.00 ? 315  HOH B O   1 
HETATM 1411 O  O   . HOH H 5 .   ? -30.111 -21.444 11.065  1.00 17.15 ? 316  HOH B O   1 
HETATM 1412 O  O   . HOH H 5 .   ? -27.104 -11.285 12.533  1.00 18.16 ? 317  HOH B O   1 
HETATM 1413 O  O   . HOH H 5 .   ? -16.952 -29.168 -14.236 1.00 18.25 ? 318  HOH B O   1 
HETATM 1414 O  O   . HOH H 5 .   ? 0.613   -22.190 8.205   1.00 20.74 ? 319  HOH B O   1 
HETATM 1415 O  O   . HOH H 5 .   ? -27.824 -34.207 20.641  1.00 23.55 ? 320  HOH B O   1 
HETATM 1416 O  O   . HOH H 5 .   ? -25.793 -17.551 7.699   1.00 15.94 ? 321  HOH B O   1 
HETATM 1417 O  O   . HOH H 5 .   ? -24.121 -34.942 19.334  1.00 18.83 ? 322  HOH B O   1 
HETATM 1418 O  O   . HOH H 5 .   ? -19.538 -39.957 -2.717  1.00 23.67 ? 323  HOH B O   1 
HETATM 1419 O  O   . HOH H 5 .   ? -24.628 -39.038 8.309   1.00 17.77 ? 324  HOH B O   1 
HETATM 1420 O  O   . HOH H 5 .   ? -3.069  -25.591 14.268  1.00 26.56 ? 325  HOH B O   1 
HETATM 1421 O  O   . HOH H 5 .   ? -25.585 -39.461 1.378   1.00 19.16 ? 326  HOH B O   1 
HETATM 1422 O  O   . HOH H 5 .   ? -4.946  -12.050 4.661   1.00 24.08 ? 327  HOH B O   1 
HETATM 1423 O  O   . HOH H 5 .   ? -37.502 -27.933 16.887  1.00 24.68 ? 328  HOH B O   1 
HETATM 1424 O  O   . HOH H 5 .   ? -15.229 -37.357 -5.798  1.00 20.58 ? 329  HOH B O   1 
HETATM 1425 O  O   . HOH H 5 .   ? -10.154 -34.691 9.973   1.00 19.27 ? 330  HOH B O   1 
HETATM 1426 O  O   . HOH H 5 .   ? -28.189 -39.667 1.625   1.00 22.82 ? 331  HOH B O   1 
HETATM 1427 O  O   . HOH H 5 .   ? -6.091  -23.254 20.488  1.00 24.21 ? 332  HOH B O   1 
HETATM 1428 O  O   . HOH H 5 .   ? -22.581 -22.734 20.109  1.00 20.27 ? 333  HOH B O   1 
HETATM 1429 O  O   . HOH H 5 .   ? -34.284 -26.780 8.371   1.00 24.25 ? 334  HOH B O   1 
HETATM 1430 O  O   . HOH H 5 .   ? -26.486 -36.262 21.182  1.00 23.20 ? 335  HOH B O   1 
HETATM 1431 O  O   . HOH H 5 .   ? -33.733 -42.735 -2.799  1.00 18.74 ? 336  HOH B O   1 
HETATM 1432 O  O   . HOH H 5 .   ? -32.813 -22.296 17.416  1.00 24.26 ? 337  HOH B O   1 
HETATM 1433 O  O   . HOH H 5 .   ? -24.532 -7.944  13.732  1.00 21.02 ? 338  HOH B O   1 
HETATM 1434 O  O   . HOH H 5 .   ? -17.710 -41.107 7.023   1.00 22.95 ? 339  HOH B O   1 
HETATM 1435 O  O   . HOH H 5 .   ? -4.470  -17.484 -3.551  1.00 21.60 ? 340  HOH B O   1 
HETATM 1436 O  O   . HOH H 5 .   ? -13.994 -35.178 -5.331  1.00 23.66 ? 341  HOH B O   1 
HETATM 1437 O  O   . HOH H 5 .   ? -23.053 -24.473 -12.258 1.00 22.90 ? 342  HOH B O   1 
HETATM 1438 O  O   . HOH H 5 .   ? -10.364 -19.996 -12.646 1.00 22.78 ? 343  HOH B O   1 
HETATM 1439 O  O   . HOH H 5 .   ? -15.981 -39.221 9.166   1.00 22.04 ? 344  HOH B O   1 
HETATM 1440 O  O   . HOH H 5 .   ? -30.010 -42.041 1.588   1.00 18.84 ? 345  HOH B O   1 
HETATM 1441 O  O   . HOH H 5 .   ? -32.489 -35.369 20.766  1.00 31.03 ? 346  HOH B O   1 
HETATM 1442 O  O   . HOH H 5 .   ? -23.746 -39.441 10.744  1.00 22.25 ? 347  HOH B O   1 
HETATM 1443 O  O   . HOH H 5 .   ? -13.525 -34.388 -7.694  1.00 23.29 ? 348  HOH B O   1 
HETATM 1444 O  O   . HOH H 5 .   ? -17.986 -11.314 0.087   1.00 19.85 ? 349  HOH B O   1 
HETATM 1445 O  O   . HOH H 5 .   ? -16.139 -38.313 -2.201  1.00 20.29 ? 350  HOH B O   1 
HETATM 1446 O  O   . HOH H 5 .   ? -15.060 -8.650  -5.215  1.00 24.76 ? 351  HOH B O   1 
HETATM 1447 O  O   . HOH H 5 .   ? -28.010 -30.561 22.886  1.00 27.01 ? 352  HOH B O   1 
HETATM 1448 O  O   . HOH H 5 .   ? -8.987  -28.484 -12.944 1.00 22.78 ? 353  HOH B O   1 
HETATM 1449 O  O   . HOH H 5 .   ? -20.945 -19.857 17.151  1.00 22.02 ? 354  HOH B O   1 
HETATM 1450 O  O   . HOH H 5 .   ? -35.297 -19.866 0.575   1.00 26.60 ? 355  HOH B O   1 
HETATM 1451 O  O   . HOH H 5 .   ? -4.621  -29.883 -0.034  1.00 24.11 ? 356  HOH B O   1 
HETATM 1452 O  O   . HOH H 5 .   ? -8.575  -28.296 20.177  1.00 28.29 ? 357  HOH B O   1 
HETATM 1453 O  O   . HOH H 5 .   ? -2.493  -26.222 1.606   1.00 24.19 ? 358  HOH B O   1 
HETATM 1454 O  O   . HOH H 5 .   ? -1.790  -26.084 -0.897  1.00 30.38 ? 359  HOH B O   1 
HETATM 1455 O  O   . HOH H 5 .   ? -7.471  -30.170 -11.493 1.00 26.50 ? 360  HOH B O   1 
HETATM 1456 O  O   . HOH H 5 .   ? -26.696 -24.635 19.823  1.00 26.89 ? 361  HOH B O   1 
HETATM 1457 O  O   . HOH H 5 .   ? -11.882 -34.441 13.092  1.00 21.90 ? 362  HOH B O   1 
HETATM 1458 O  O   . HOH H 5 .   ? -2.598  -28.421 -0.355  1.00 33.30 ? 363  HOH B O   1 
HETATM 1459 O  O   . HOH H 5 .   ? -5.802  -19.933 -12.071 1.00 25.99 ? 364  HOH B O   1 
HETATM 1460 O  O   . HOH H 5 .   ? -34.618 -36.598 -6.559  1.00 25.70 ? 365  HOH B O   1 
HETATM 1461 O  O   . HOH H 5 .   ? -15.741 -15.714 -13.453 1.00 29.01 ? 366  HOH B O   1 
HETATM 1462 O  O   . HOH H 5 .   ? -13.951 -36.020 -9.814  1.00 25.79 ? 367  HOH B O   1 
HETATM 1463 O  O   . HOH H 5 .   ? -6.908  -18.078 -10.521 1.00 27.38 ? 368  HOH B O   1 
HETATM 1464 O  O   . HOH H 5 .   ? -7.421  -27.298 15.939  1.00 25.38 ? 369  HOH B O   1 
HETATM 1465 O  O   . HOH H 5 .   ? -28.566 -40.350 -4.517  1.00 23.26 ? 370  HOH B O   1 
HETATM 1466 O  O   . HOH H 5 .   ? -8.105  -35.428 4.844   1.00 22.76 ? 371  HOH B O   1 
HETATM 1467 O  O   . HOH H 5 .   ? -2.958  -23.083 -6.962  1.00 19.25 ? 372  HOH B O   1 
HETATM 1468 O  O   . HOH H 5 .   ? -8.072  -31.571 13.206  1.00 26.05 ? 373  HOH B O   1 
HETATM 1469 O  O   . HOH H 5 .   ? -22.763 -12.097 11.745  1.00 23.15 ? 374  HOH B O   1 
HETATM 1470 O  O   . HOH H 5 .   ? -18.482 -40.253 9.867   1.00 27.06 ? 375  HOH B O   1 
HETATM 1471 O  O   . HOH H 5 .   ? -6.840  -27.238 18.798  1.00 30.59 ? 376  HOH B O   1 
HETATM 1472 O  O   . HOH H 5 .   ? -28.420 -24.422 -6.939  1.00 27.05 ? 377  HOH B O   1 
HETATM 1473 O  O   . HOH H 5 .   ? -20.165 -37.869 16.611  1.00 29.81 ? 378  HOH B O   1 
HETATM 1474 O  O   . HOH H 5 .   ? -37.461 -22.846 -0.470  1.00 33.54 ? 379  HOH B O   1 
HETATM 1475 O  O   . HOH H 5 .   ? -23.083 -40.469 -1.587  1.00 21.54 ? 380  HOH B O   1 
HETATM 1476 O  O   . HOH H 5 .   ? -28.605 -24.267 22.560  1.00 29.74 ? 381  HOH B O   1 
HETATM 1477 O  O   . HOH H 5 .   ? -32.901 -33.860 -3.551  1.00 24.78 ? 382  HOH B O   1 
HETATM 1478 O  O   . HOH H 5 .   ? -36.615 -33.622 11.512  1.00 26.21 ? 383  HOH B O   1 
HETATM 1479 O  O   . HOH H 5 .   ? -11.382 -29.665 -13.882 1.00 27.92 ? 384  HOH B O   1 
HETATM 1480 O  O   . HOH H 5 .   ? -14.216 -18.090 -12.706 1.00 26.07 ? 385  HOH B O   1 
HETATM 1481 O  O   . HOH H 5 .   ? -9.805  -15.618 -8.460  1.00 24.37 ? 386  HOH B O   1 
HETATM 1482 O  O   . HOH H 5 .   ? -5.630  -12.803 -3.324  1.00 21.85 ? 387  HOH B O   1 
HETATM 1483 O  O   . HOH H 5 .   ? -38.130 -26.822 2.192   1.00 28.63 ? 388  HOH B O   1 
HETATM 1484 O  O   . HOH H 5 .   ? -14.442 -39.832 12.919  1.00 32.53 ? 389  HOH B O   1 
HETATM 1485 O  O   . HOH H 5 .   ? -0.963  -15.747 3.738   1.00 27.67 ? 390  HOH B O   1 
HETATM 1486 O  O   . HOH H 5 .   ? -15.423 -38.838 -8.372  1.00 27.41 ? 391  HOH B O   1 
HETATM 1487 O  O   . HOH H 5 .   ? -25.082 -22.956 -11.841 1.00 30.48 ? 392  HOH B O   1 
HETATM 1488 O  O   . HOH H 5 .   ? -6.612  -35.570 -1.284  1.00 31.26 ? 393  HOH B O   1 
HETATM 1489 O  O   . HOH H 5 .   ? -29.798 -14.830 8.910   1.00 23.81 ? 394  HOH B O   1 
HETATM 1490 O  O   . HOH H 5 .   ? -5.511  -11.025 -5.385  1.00 37.31 ? 395  HOH B O   1 
HETATM 1491 O  O   . HOH H 5 .   ? -12.492 -10.472 7.635   1.00 28.07 ? 396  HOH B O   1 
HETATM 1492 O  O   . HOH H 5 .   ? -31.707 -22.145 19.731  1.00 29.20 ? 397  HOH B O   1 
HETATM 1493 O  O   . HOH H 5 .   ? -3.440  -30.579 2.291   1.00 28.62 ? 398  HOH B O   1 
HETATM 1494 O  O   . HOH H 5 .   ? -13.992 -38.253 0.857   1.00 25.23 ? 399  HOH B O   1 
HETATM 1495 O  O   . HOH H 5 .   ? -34.173 -33.812 19.557  1.00 28.98 ? 400  HOH B O   1 
HETATM 1496 O  O   . HOH H 5 .   ? -3.792  -20.668 -10.367 1.00 25.57 ? 401  HOH B O   1 
HETATM 1497 O  O   . HOH H 5 .   ? -31.239 -37.131 -5.442  1.00 24.48 ? 402  HOH B O   1 
HETATM 1498 O  O   . HOH H 5 .   ? -5.343  -31.140 -12.983 1.00 28.65 ? 403  HOH B O   1 
HETATM 1499 O  O   . HOH H 5 .   ? -34.113 -20.249 16.127  1.00 32.57 ? 404  HOH B O   1 
HETATM 1500 O  O   . HOH H 5 .   ? 2.614   -33.067 -11.733 1.00 34.30 ? 405  HOH B O   1 
HETATM 1501 O  O   . HOH H 5 .   ? -12.830 -17.231 -10.772 1.00 29.64 ? 406  HOH B O   1 
HETATM 1502 O  O   . HOH H 5 .   ? -18.033 -39.507 -8.119  1.00 29.27 ? 407  HOH B O   1 
HETATM 1503 O  O   . HOH H 5 .   ? -11.480 -20.006 18.921  1.00 29.94 ? 408  HOH B O   1 
HETATM 1504 O  O   . HOH H 5 .   ? -37.515 -41.840 20.898  1.00 28.66 ? 409  HOH B O   1 
HETATM 1505 O  O   . HOH H 5 .   ? -8.760  -19.766 20.008  1.00 30.25 ? 410  HOH B O   1 
HETATM 1506 O  O   . HOH H 5 .   ? -36.689 -24.503 1.501   1.00 27.88 ? 411  HOH B O   1 
HETATM 1507 O  O   . HOH H 5 .   ? -18.289 -11.947 10.110  1.00 27.61 ? 412  HOH B O   1 
HETATM 1508 O  O   . HOH H 5 .   ? -13.314 -37.508 -2.393  1.00 26.36 ? 413  HOH B O   1 
HETATM 1509 O  O   . HOH H 5 .   ? -5.213  -12.568 7.707   1.00 28.55 ? 414  HOH B O   1 
HETATM 1510 O  O   . HOH H 5 .   ? -5.623  -33.383 2.266   1.00 25.80 ? 415  HOH B O   1 
HETATM 1511 O  O   . HOH H 5 .   ? -11.768 -19.675 16.123  1.00 23.08 ? 416  HOH B O   1 
HETATM 1512 O  O   . HOH H 5 .   ? -17.646 -35.329 17.305  1.00 28.09 ? 417  HOH B O   1 
HETATM 1513 O  O   . HOH H 5 .   ? -8.633  -36.886 7.694   1.00 32.49 ? 418  HOH B O   1 
HETATM 1514 O  O   . HOH H 5 .   ? -30.119 -27.843 -2.918  1.00 21.76 ? 419  HOH B O   1 
HETATM 1515 O  O   . HOH H 5 .   ? -3.143  -12.794 1.392   1.00 32.77 ? 420  HOH B O   1 
HETATM 1516 O  O   . HOH H 5 .   ? 0.622   -31.430 -12.258 1.00 33.80 ? 421  HOH B O   1 
HETATM 1517 O  O   . HOH H 5 .   ? -34.186 -37.207 -1.269  1.00 25.38 ? 422  HOH B O   1 
HETATM 1518 O  O   . HOH H 5 .   ? -11.691 -8.854  -4.384  1.00 33.24 ? 423  HOH B O   1 
HETATM 1519 O  O   . HOH H 5 .   ? -1.270  -31.573 -4.915  1.00 35.33 ? 424  HOH B O   1 
HETATM 1520 O  O   . HOH H 5 .   ? -15.209 -11.480 -6.332  1.00 30.76 ? 425  HOH B O   1 
HETATM 1521 O  O   . HOH H 5 .   ? -8.493  -36.127 1.983   1.00 26.81 ? 426  HOH B O   1 
HETATM 1522 O  O   . HOH H 5 .   ? -35.871 -15.713 7.404   1.00 30.83 ? 427  HOH B O   1 
HETATM 1523 O  O   . HOH H 5 .   ? -34.958 -24.521 7.409   1.00 25.08 ? 428  HOH B O   1 
HETATM 1524 O  O   . HOH H 5 .   ? -13.441 -22.079 19.357  1.00 21.32 ? 429  HOH B O   1 
HETATM 1525 O  O   . HOH H 5 .   ? -15.095 -19.680 19.639  1.00 24.32 ? 430  HOH B O   1 
HETATM 1526 O  O   . HOH H 5 .   ? -5.539  -25.476 19.791  1.00 29.04 ? 431  HOH B O   1 
HETATM 1527 O  O   . HOH H 5 .   ? -20.781 -14.407 20.758  1.00 22.13 ? 432  HOH B O   1 
HETATM 1528 O  O   . HOH H 5 .   ? -1.170  -23.763 14.206  1.00 32.94 ? 433  HOH B O   1 
HETATM 1529 O  O   . HOH H 5 .   ? -35.846 -26.049 12.503  1.00 25.20 ? 434  HOH B O   1 
HETATM 1530 O  O   . HOH H 5 .   ? -13.761 -8.597  1.102   1.00 27.73 ? 435  HOH B O   1 
HETATM 1531 O  O   . HOH H 5 .   ? -25.646 -42.022 1.091   1.00 28.65 ? 436  HOH B O   1 
HETATM 1532 O  O   . HOH H 5 .   ? -30.420 -32.226 22.499  1.00 27.48 ? 437  HOH B O   1 
HETATM 1533 O  O   . HOH H 5 .   ? -29.603 -11.830 12.352  1.00 24.21 ? 438  HOH B O   1 
HETATM 1534 O  O   . HOH H 5 .   ? -21.228 -26.063 -13.470 1.00 24.03 ? 439  HOH B O   1 
HETATM 1535 O  O   . HOH H 5 .   ? -0.058  -24.346 9.418   1.00 27.03 ? 440  HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   16  ?   ?   ?   B . n 
A 1 2   ARG 2   17  ?   ?   ?   B . n 
A 1 3   GLY 3   18  ?   ?   ?   B . n 
A 1 4   SER 4   19  ?   ?   ?   B . n 
A 1 5   HIS 5   20  ?   ?   ?   B . n 
A 1 6   HIS 6   21  ?   ?   ?   B . n 
A 1 7   HIS 7   22  ?   ?   ?   B . n 
A 1 8   HIS 8   23  ?   ?   ?   B . n 
A 1 9   HIS 9   24  ?   ?   ?   B . n 
A 1 10  HIS 10  25  ?   ?   ?   B . n 
A 1 11  GLY 11  26  ?   ?   ?   B . n 
A 1 12  SER 12  27  ?   ?   ?   B . n 
A 1 13  CYS 13  28  ?   ?   ?   B . n 
A 1 14  GLY 14  29  ?   ?   ?   B . n 
A 1 15  PRO 15  30  ?   ?   ?   B . n 
A 1 16  GLY 16  31  ?   ?   ?   B . n 
A 1 17  ARG 17  32  ?   ?   ?   B . n 
A 1 18  VAL 18  33  ?   ?   ?   B . n 
A 1 19  VAL 19  34  ?   ?   ?   B . n 
A 1 20  GLY 20  35  ?   ?   ?   B . n 
A 1 21  SER 21  36  ?   ?   ?   B . n 
A 1 22  ARG 22  37  ?   ?   ?   B . n 
A 1 23  ARG 23  38  ?   ?   ?   B . n 
A 1 24  ARG 24  39  ?   ?   ?   B . n 
A 1 25  PRO 25  40  ?   ?   ?   B . n 
A 1 26  PRO 26  41  41  PRO PRO B . n 
A 1 27  ARG 27  42  42  ARG ARG B . n 
A 1 28  LYS 28  43  43  LYS LYS B . n 
A 1 29  LEU 29  44  44  LEU LEU B . n 
A 1 30  VAL 30  45  45  VAL VAL B . n 
A 1 31  PRO 31  46  46  PRO PRO B . n 
A 1 32  LEU 32  47  47  LEU LEU B . n 
A 1 33  ALA 33  48  48  ALA ALA B . n 
A 1 34  TYR 34  49  49  TYR TYR B . n 
A 1 35  LYS 35  50  50  LYS LYS B . n 
A 1 36  GLN 36  51  51  GLN GLN B . n 
A 1 37  PHE 37  52  52  PHE PHE B . n 
A 1 38  SER 38  53  53  SER SER B . n 
A 1 39  PRO 39  54  54  PRO PRO B . n 
A 1 40  ASN 40  55  55  ASN ASN B . n 
A 1 41  VAL 41  56  56  VAL VAL B . n 
A 1 42  PRO 42  57  57  PRO PRO B . n 
A 1 43  GLU 43  58  58  GLU GLU B . n 
A 1 44  LYS 44  59  59  LYS LYS B . n 
A 1 45  THR 45  60  60  THR THR B . n 
A 1 46  LEU 46  61  61  LEU LEU B . n 
A 1 47  GLY 47  62  62  GLY GLY B . n 
A 1 48  ALA 48  63  63  ALA ALA B . n 
A 1 49  SER 49  64  64  SER SER B . n 
A 1 50  GLY 50  65  65  GLY GLY B . n 
A 1 51  ARG 51  66  66  ARG ARG B . n 
A 1 52  TYR 52  67  67  TYR TYR B . n 
A 1 53  GLU 53  68  68  GLU GLU B . n 
A 1 54  GLY 54  69  69  GLY GLY B . n 
A 1 55  LYS 55  70  70  LYS LYS B . n 
A 1 56  ILE 56  71  71  ILE ILE B . n 
A 1 57  ALA 57  72  72  ALA ALA B . n 
A 1 58  ARG 58  73  73  ARG ARG B . n 
A 1 59  SER 59  74  74  SER SER B . n 
A 1 60  SER 60  75  75  SER SER B . n 
A 1 61  GLU 61  76  76  GLU GLU B . n 
A 1 62  ARG 62  77  77  ARG ARG B . n 
A 1 63  PHE 63  78  78  PHE PHE B . n 
A 1 64  LYS 64  79  79  LYS LYS B . n 
A 1 65  GLU 65  80  80  GLU GLU B . n 
A 1 66  LEU 66  81  81  LEU LEU B . n 
A 1 67  THR 67  82  82  THR THR B . n 
A 1 68  PRO 68  83  83  PRO PRO B . n 
A 1 69  ASN 69  84  84  ASN ASN B . n 
A 1 70  TYR 70  85  85  TYR TYR B . n 
A 1 71  ASN 71  86  86  ASN ASN B . n 
A 1 72  PRO 72  87  87  PRO PRO B . n 
A 1 73  ASP 73  88  88  ASP ASP B . n 
A 1 74  ILE 74  89  89  ILE ILE B . n 
A 1 75  ILE 75  90  90  ILE ILE B . n 
A 1 76  PHE 76  91  91  PHE PHE B . n 
A 1 77  LYS 77  92  92  LYS LYS B . n 
A 1 78  ASP 78  93  93  ASP ASP B . n 
A 1 79  GLU 79  94  94  GLU GLU B . n 
A 1 80  GLU 80  95  95  GLU GLU B . n 
A 1 81  ASN 81  96  96  ASN ASN B . n 
A 1 82  THR 82  97  97  THR THR B . n 
A 1 83  GLY 83  98  98  GLY GLY B . n 
A 1 84  ALA 84  99  99  ALA ALA B . n 
A 1 85  ASP 85  100 100 ASP ASP B . n 
A 1 86  ARG 86  101 101 ARG ARG B . n 
A 1 87  LEU 87  102 102 LEU LEU B . n 
A 1 88  MET 88  103 103 MET MET B . n 
A 1 89  THR 89  104 104 THR THR B . n 
A 1 90  GLN 90  105 105 GLN GLN B . n 
A 1 91  ARG 91  106 106 ARG ARG B . n 
A 1 92  CYS 92  107 107 CYS CYS B . n 
A 1 93  LYS 93  108 108 LYS LYS B . n 
A 1 94  ASP 94  109 109 ASP ASP B . n 
A 1 95  ARG 95  110 110 ARG ARG B . n 
A 1 96  LEU 96  111 111 LEU LEU B . n 
A 1 97  ASN 97  112 112 ASN ASN B . n 
A 1 98  SER 98  113 113 SER SER B . n 
A 1 99  LEU 99  114 114 LEU LEU B . n 
A 1 100 ALA 100 115 115 ALA ALA B . n 
A 1 101 ILE 101 116 116 ILE ILE B . n 
A 1 102 SER 102 117 117 SER SER B . n 
A 1 103 VAL 103 118 118 VAL VAL B . n 
A 1 104 MET 104 119 119 MET MET B . n 
A 1 105 ASN 105 120 120 ASN ASN B . n 
A 1 106 GLN 106 121 121 GLN GLN B . n 
A 1 107 TRP 107 122 122 TRP TRP B . n 
A 1 108 PRO 108 123 123 PRO PRO B . n 
A 1 109 GLY 109 124 124 GLY GLY B . n 
A 1 110 VAL 110 125 125 VAL VAL B . n 
A 1 111 LYS 111 126 126 LYS LYS B . n 
A 1 112 LEU 112 127 127 LEU LEU B . n 
A 1 113 ARG 113 128 128 ARG ARG B . n 
A 1 114 VAL 114 129 129 VAL VAL B . n 
A 1 115 THR 115 130 130 THR THR B . n 
A 1 116 GLU 116 131 131 GLU GLU B . n 
A 1 117 GLY 117 132 132 GLY GLY B . n 
A 1 118 TRP 118 133 133 TRP TRP B . n 
A 1 119 ASP 119 134 134 ASP ASP B . n 
A 1 120 GLU 120 135 135 GLU GLU B . n 
A 1 121 ASP 121 136 136 ASP ASP B . n 
A 1 122 GLY 122 137 137 GLY GLY B . n 
A 1 123 HIS 123 138 138 HIS HIS B . n 
A 1 124 HIS 124 139 139 HIS HIS B . n 
A 1 125 SER 125 140 140 SER SER B . n 
A 1 126 GLU 126 141 141 GLU GLU B . n 
A 1 127 GLU 127 142 142 GLU GLU B . n 
A 1 128 SER 128 143 143 SER SER B . n 
A 1 129 LEU 129 144 144 LEU LEU B . n 
A 1 130 HIS 130 145 145 HIS HIS B . n 
A 1 131 TYR 131 146 146 TYR TYR B . n 
A 1 132 GLU 132 147 147 GLU GLU B . n 
A 1 133 GLY 133 148 148 GLY GLY B . n 
A 1 134 ARG 134 149 149 ARG ARG B . n 
A 1 135 ALA 135 150 150 ALA ALA B . n 
A 1 136 VAL 136 151 151 VAL VAL B . n 
A 1 137 ASP 137 152 152 ASP ASP B . n 
A 1 138 ILE 138 153 153 ILE ILE B . n 
A 1 139 THR 139 154 154 THR THR B . n 
A 1 140 THR 140 155 155 THR THR B . n 
A 1 141 SER 141 156 156 SER SER B . n 
A 1 142 ASP 142 157 157 ASP ASP B . n 
A 1 143 ARG 143 158 158 ARG ARG B . n 
A 1 144 ASP 144 159 159 ASP ASP B . n 
A 1 145 ARG 145 160 160 ARG ARG B . n 
A 1 146 ASN 146 161 161 ASN ASN B . n 
A 1 147 LYS 147 162 162 LYS LYS B . n 
A 1 148 TYR 148 163 163 TYR TYR B . n 
A 1 149 GLY 149 164 164 GLY GLY B . n 
A 1 150 LEU 150 165 165 LEU LEU B . n 
A 1 151 LEU 151 166 166 LEU LEU B . n 
A 1 152 ALA 152 167 167 ALA ALA B . n 
A 1 153 ARG 153 168 168 ARG ARG B . n 
A 1 154 LEU 154 169 169 LEU LEU B . n 
A 1 155 ALA 155 170 170 ALA ALA B . n 
A 1 156 VAL 156 171 171 VAL VAL B . n 
A 1 157 GLU 157 172 172 GLU GLU B . n 
A 1 158 ALA 158 173 173 ALA ALA B . n 
A 1 159 GLY 159 174 174 GLY GLY B . n 
A 1 160 PHE 160 175 175 PHE PHE B . n 
A 1 161 ASP 161 176 176 ASP ASP B . n 
A 1 162 TRP 162 177 177 TRP TRP B . n 
A 1 163 VAL 163 178 178 VAL VAL B . n 
A 1 164 TYR 164 179 179 TYR TYR B . n 
A 1 165 TYR 165 180 180 TYR TYR B . n 
A 1 166 GLU 166 181 181 GLU GLU B . n 
A 1 167 SER 167 182 182 SER SER B . n 
A 1 168 LYS 168 183 183 LYS LYS B . n 
A 1 169 ALA 169 184 184 ALA ALA B . n 
A 1 170 HIS 170 185 185 HIS HIS B . n 
A 1 171 VAL 171 186 186 VAL VAL B . n 
A 1 172 HIS 172 187 187 HIS HIS B . n 
A 1 173 CYS 173 188 188 CYS CYS B . n 
A 1 174 SER 174 189 189 SER SER B . n 
A 1 175 VAL 175 190 190 VAL VAL B . n 
A 1 176 LYS 176 191 191 LYS LYS B . n 
A 1 177 SER 177 192 192 SER SER B . n 
A 1 178 GLU 178 193 193 GLU GLU B . n 
A 1 179 HIS 179 194 194 HIS HIS B . n 
A 1 180 SER 180 195 195 SER SER B . n 
A 1 181 ALA 181 196 196 ALA ALA B . n 
A 1 182 ALA 182 197 197 ALA ALA B . n 
A 1 183 ALA 183 198 ?   ?   ?   B . n 
A 1 184 LYS 184 199 ?   ?   ?   B . n 
A 1 185 THR 185 200 ?   ?   ?   B . n 
A 1 186 GLY 186 201 ?   ?   ?   B . n 
A 1 187 GLY 187 202 ?   ?   ?   B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_special_symmetry.id 
_pdbx_struct_special_symmetry.PDB_model_num 
_pdbx_struct_special_symmetry.auth_asym_id 
_pdbx_struct_special_symmetry.auth_comp_id 
_pdbx_struct_special_symmetry.auth_seq_id 
_pdbx_struct_special_symmetry.PDB_ins_code 
_pdbx_struct_special_symmetry.label_asym_id 
_pdbx_struct_special_symmetry.label_comp_id 
_pdbx_struct_special_symmetry.label_seq_id 
1 1 B HOH 247 ? H HOH . 
2 1 B HOH 282 ? H HOH . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 NE2 ? A HIS 130 ? B HIS 145 ? 1_555 ZN ? B ZN . ? B ZN 1001 ? 1_555 OD1 ? A ASP 137 ? B ASP 152 ? 1_555 107.8 ? 
2 NE2 ? A HIS 130 ? B HIS 145 ? 1_555 ZN ? B ZN . ? B ZN 1001 ? 1_555 ND1 ? A HIS 172 ? B HIS 187 ? 1_555 107.0 ? 
3 OD1 ? A ASP 137 ? B ASP 152 ? 1_555 ZN ? B ZN . ? B ZN 1001 ? 1_555 ND1 ? A HIS 172 ? B HIS 187 ? 1_555 108.1 ? 
4 NE2 ? A HIS 130 ? B HIS 145 ? 1_555 ZN ? B ZN . ? B ZN 1001 ? 1_555 O   ? H HOH .   ? B HOH 250 ? 1_555 113.7 ? 
5 OD1 ? A ASP 137 ? B ASP 152 ? 1_555 ZN ? B ZN . ? B ZN 1001 ? 1_555 O   ? H HOH .   ? B HOH 250 ? 1_555 114.5 ? 
6 ND1 ? A HIS 172 ? B HIS 187 ? 1_555 ZN ? B ZN . ? B ZN 1001 ? 1_555 O   ? H HOH .   ? B HOH 250 ? 1_555 105.3 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2011-01-26 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
MAR345dtb 'data collection' .                 ? 1 
MOLREP    phasing           .                 ? 2 
PHENIX    refinement        '(phenix.refine)' ? 3 
MOSFLM    'data reduction'  .                 ? 4 
SCALA     'data scaling'    .                 ? 5 
# 
_pdbx_validate_symm_contact.id                1 
_pdbx_validate_symm_contact.PDB_model_num     1 
_pdbx_validate_symm_contact.auth_atom_id_1    O 
_pdbx_validate_symm_contact.auth_asym_id_1    B 
_pdbx_validate_symm_contact.auth_comp_id_1    HOH 
_pdbx_validate_symm_contact.auth_seq_id_1     349 
_pdbx_validate_symm_contact.PDB_ins_code_1    ? 
_pdbx_validate_symm_contact.label_alt_id_1    ? 
_pdbx_validate_symm_contact.site_symmetry_1   1_555 
_pdbx_validate_symm_contact.auth_atom_id_2    O 
_pdbx_validate_symm_contact.auth_asym_id_2    B 
_pdbx_validate_symm_contact.auth_comp_id_2    HOH 
_pdbx_validate_symm_contact.auth_seq_id_2     422 
_pdbx_validate_symm_contact.PDB_ins_code_2    ? 
_pdbx_validate_symm_contact.label_alt_id_2    ? 
_pdbx_validate_symm_contact.site_symmetry_2   4_455 
_pdbx_validate_symm_contact.dist              2.18 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LYS B 50  ? ? 78.56   -0.99   
2 1 ASN B 55  ? ? -77.37  42.19   
3 1 LYS B 59  ? ? -96.56  36.46   
4 1 ALA B 63  ? ? -120.42 -119.13 
5 1 GLU B 131 ? ? -160.28 119.49  
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 B MET 16  ? A MET 1   
2  1 Y 1 B ARG 17  ? A ARG 2   
3  1 Y 1 B GLY 18  ? A GLY 3   
4  1 Y 1 B SER 19  ? A SER 4   
5  1 Y 1 B HIS 20  ? A HIS 5   
6  1 Y 1 B HIS 21  ? A HIS 6   
7  1 Y 1 B HIS 22  ? A HIS 7   
8  1 Y 1 B HIS 23  ? A HIS 8   
9  1 Y 1 B HIS 24  ? A HIS 9   
10 1 Y 1 B HIS 25  ? A HIS 10  
11 1 Y 1 B GLY 26  ? A GLY 11  
12 1 Y 1 B SER 27  ? A SER 12  
13 1 Y 1 B CYS 28  ? A CYS 13  
14 1 Y 1 B GLY 29  ? A GLY 14  
15 1 Y 1 B PRO 30  ? A PRO 15  
16 1 Y 1 B GLY 31  ? A GLY 16  
17 1 Y 1 B ARG 32  ? A ARG 17  
18 1 Y 1 B VAL 33  ? A VAL 18  
19 1 Y 1 B VAL 34  ? A VAL 19  
20 1 Y 1 B GLY 35  ? A GLY 20  
21 1 Y 1 B SER 36  ? A SER 21  
22 1 Y 1 B ARG 37  ? A ARG 22  
23 1 Y 1 B ARG 38  ? A ARG 23  
24 1 Y 1 B ARG 39  ? A ARG 24  
25 1 Y 1 B PRO 40  ? A PRO 25  
26 1 Y 1 B ALA 198 ? A ALA 183 
27 1 Y 1 B LYS 199 ? A LYS 184 
28 1 Y 1 B THR 200 ? A THR 185 
29 1 Y 1 B GLY 201 ? A GLY 186 
30 1 Y 1 B GLY 202 ? A GLY 187 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'ZINC ION'    ZN  
3 'SULFATE ION' SO4 
4 GLYCEROL      GOL 
5 water         HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 ZN  1   1001 1001 ZN  ZN  B . 
C 3 SO4 1   1    1    SO4 SO4 B . 
D 3 SO4 1   2    2    SO4 SO4 B . 
E 3 SO4 1   3    3    SO4 SO4 B . 
F 3 SO4 1   4    4    SO4 SO4 B . 
G 4 GOL 1   203  1    GOL GOL B . 
H 5 HOH 1   5    5    HOH HOH B . 
H 5 HOH 2   6    6    HOH HOH B . 
H 5 HOH 3   7    7    HOH HOH B . 
H 5 HOH 4   8    8    HOH HOH B . 
H 5 HOH 5   9    9    HOH HOH B . 
H 5 HOH 6   10   10   HOH HOH B . 
H 5 HOH 7   11   11   HOH HOH B . 
H 5 HOH 8   12   12   HOH HOH B . 
H 5 HOH 9   13   13   HOH HOH B . 
H 5 HOH 10  14   14   HOH HOH B . 
H 5 HOH 11  15   15   HOH HOH B . 
H 5 HOH 12  204  204  HOH HOH B . 
H 5 HOH 13  205  205  HOH HOH B . 
H 5 HOH 14  206  206  HOH HOH B . 
H 5 HOH 15  207  207  HOH HOH B . 
H 5 HOH 16  208  208  HOH HOH B . 
H 5 HOH 17  209  209  HOH HOH B . 
H 5 HOH 18  210  210  HOH HOH B . 
H 5 HOH 19  211  211  HOH HOH B . 
H 5 HOH 20  212  212  HOH HOH B . 
H 5 HOH 21  213  213  HOH HOH B . 
H 5 HOH 22  214  214  HOH HOH B . 
H 5 HOH 23  215  215  HOH HOH B . 
H 5 HOH 24  216  216  HOH HOH B . 
H 5 HOH 25  217  217  HOH HOH B . 
H 5 HOH 26  218  218  HOH HOH B . 
H 5 HOH 27  219  219  HOH HOH B . 
H 5 HOH 28  220  220  HOH HOH B . 
H 5 HOH 29  221  221  HOH HOH B . 
H 5 HOH 30  222  222  HOH HOH B . 
H 5 HOH 31  223  223  HOH HOH B . 
H 5 HOH 32  224  224  HOH HOH B . 
H 5 HOH 33  225  225  HOH HOH B . 
H 5 HOH 34  226  226  HOH HOH B . 
H 5 HOH 35  227  227  HOH HOH B . 
H 5 HOH 36  228  228  HOH HOH B . 
H 5 HOH 37  229  229  HOH HOH B . 
H 5 HOH 38  230  230  HOH HOH B . 
H 5 HOH 39  231  231  HOH HOH B . 
H 5 HOH 40  232  232  HOH HOH B . 
H 5 HOH 41  233  233  HOH HOH B . 
H 5 HOH 42  234  234  HOH HOH B . 
H 5 HOH 43  235  235  HOH HOH B . 
H 5 HOH 44  236  236  HOH HOH B . 
H 5 HOH 45  237  237  HOH HOH B . 
H 5 HOH 46  238  238  HOH HOH B . 
H 5 HOH 47  239  239  HOH HOH B . 
H 5 HOH 48  240  240  HOH HOH B . 
H 5 HOH 49  241  241  HOH HOH B . 
H 5 HOH 50  242  242  HOH HOH B . 
H 5 HOH 51  243  243  HOH HOH B . 
H 5 HOH 52  244  244  HOH HOH B . 
H 5 HOH 53  245  245  HOH HOH B . 
H 5 HOH 54  246  246  HOH HOH B . 
H 5 HOH 55  247  247  HOH HOH B . 
H 5 HOH 56  248  248  HOH HOH B . 
H 5 HOH 57  249  249  HOH HOH B . 
H 5 HOH 58  250  250  HOH HOH B . 
H 5 HOH 59  251  1    HOH HOH B . 
H 5 HOH 60  252  2    HOH HOH B . 
H 5 HOH 61  253  3    HOH HOH B . 
H 5 HOH 62  254  4    HOH HOH B . 
H 5 HOH 63  255  16   HOH HOH B . 
H 5 HOH 64  256  17   HOH HOH B . 
H 5 HOH 65  257  18   HOH HOH B . 
H 5 HOH 66  258  19   HOH HOH B . 
H 5 HOH 67  259  20   HOH HOH B . 
H 5 HOH 68  260  21   HOH HOH B . 
H 5 HOH 69  261  22   HOH HOH B . 
H 5 HOH 70  262  23   HOH HOH B . 
H 5 HOH 71  263  24   HOH HOH B . 
H 5 HOH 72  264  25   HOH HOH B . 
H 5 HOH 73  265  26   HOH HOH B . 
H 5 HOH 74  266  27   HOH HOH B . 
H 5 HOH 75  267  28   HOH HOH B . 
H 5 HOH 76  268  29   HOH HOH B . 
H 5 HOH 77  269  30   HOH HOH B . 
H 5 HOH 78  270  31   HOH HOH B . 
H 5 HOH 79  271  32   HOH HOH B . 
H 5 HOH 80  272  33   HOH HOH B . 
H 5 HOH 81  273  34   HOH HOH B . 
H 5 HOH 82  274  35   HOH HOH B . 
H 5 HOH 83  275  36   HOH HOH B . 
H 5 HOH 84  276  37   HOH HOH B . 
H 5 HOH 85  277  38   HOH HOH B . 
H 5 HOH 86  278  39   HOH HOH B . 
H 5 HOH 87  279  40   HOH HOH B . 
H 5 HOH 88  280  41   HOH HOH B . 
H 5 HOH 89  281  42   HOH HOH B . 
H 5 HOH 90  282  43   HOH HOH B . 
H 5 HOH 91  283  44   HOH HOH B . 
H 5 HOH 92  284  45   HOH HOH B . 
H 5 HOH 93  285  46   HOH HOH B . 
H 5 HOH 94  286  47   HOH HOH B . 
H 5 HOH 95  287  48   HOH HOH B . 
H 5 HOH 96  288  50   HOH HOH B . 
H 5 HOH 97  289  51   HOH HOH B . 
H 5 HOH 98  290  52   HOH HOH B . 
H 5 HOH 99  291  53   HOH HOH B . 
H 5 HOH 100 292  54   HOH HOH B . 
H 5 HOH 101 293  55   HOH HOH B . 
H 5 HOH 102 294  56   HOH HOH B . 
H 5 HOH 103 295  57   HOH HOH B . 
H 5 HOH 104 296  58   HOH HOH B . 
H 5 HOH 105 297  59   HOH HOH B . 
H 5 HOH 106 298  60   HOH HOH B . 
H 5 HOH 107 299  61   HOH HOH B . 
H 5 HOH 108 300  62   HOH HOH B . 
H 5 HOH 109 301  63   HOH HOH B . 
H 5 HOH 110 302  64   HOH HOH B . 
H 5 HOH 111 303  65   HOH HOH B . 
H 5 HOH 112 304  66   HOH HOH B . 
H 5 HOH 113 305  67   HOH HOH B . 
H 5 HOH 114 306  68   HOH HOH B . 
H 5 HOH 115 307  69   HOH HOH B . 
H 5 HOH 116 308  70   HOH HOH B . 
H 5 HOH 117 309  71   HOH HOH B . 
H 5 HOH 118 310  72   HOH HOH B . 
H 5 HOH 119 311  73   HOH HOH B . 
H 5 HOH 120 312  74   HOH HOH B . 
H 5 HOH 121 313  75   HOH HOH B . 
H 5 HOH 122 314  76   HOH HOH B . 
H 5 HOH 123 315  77   HOH HOH B . 
H 5 HOH 124 316  78   HOH HOH B . 
H 5 HOH 125 317  79   HOH HOH B . 
H 5 HOH 126 318  80   HOH HOH B . 
H 5 HOH 127 319  81   HOH HOH B . 
H 5 HOH 128 320  82   HOH HOH B . 
H 5 HOH 129 321  83   HOH HOH B . 
H 5 HOH 130 322  84   HOH HOH B . 
H 5 HOH 131 323  85   HOH HOH B . 
H 5 HOH 132 324  86   HOH HOH B . 
H 5 HOH 133 325  87   HOH HOH B . 
H 5 HOH 134 326  88   HOH HOH B . 
H 5 HOH 135 327  89   HOH HOH B . 
H 5 HOH 136 328  90   HOH HOH B . 
H 5 HOH 137 329  91   HOH HOH B . 
H 5 HOH 138 330  92   HOH HOH B . 
H 5 HOH 139 331  93   HOH HOH B . 
H 5 HOH 140 332  94   HOH HOH B . 
H 5 HOH 141 333  95   HOH HOH B . 
H 5 HOH 142 334  96   HOH HOH B . 
H 5 HOH 143 335  97   HOH HOH B . 
H 5 HOH 144 336  98   HOH HOH B . 
H 5 HOH 145 337  99   HOH HOH B . 
H 5 HOH 146 338  100  HOH HOH B . 
H 5 HOH 147 339  101  HOH HOH B . 
H 5 HOH 148 340  102  HOH HOH B . 
H 5 HOH 149 341  103  HOH HOH B . 
H 5 HOH 150 342  104  HOH HOH B . 
H 5 HOH 151 343  105  HOH HOH B . 
H 5 HOH 152 344  106  HOH HOH B . 
H 5 HOH 153 345  107  HOH HOH B . 
H 5 HOH 154 346  108  HOH HOH B . 
H 5 HOH 155 347  109  HOH HOH B . 
H 5 HOH 156 348  110  HOH HOH B . 
H 5 HOH 157 349  111  HOH HOH B . 
H 5 HOH 158 350  112  HOH HOH B . 
H 5 HOH 159 351  113  HOH HOH B . 
H 5 HOH 160 352  114  HOH HOH B . 
H 5 HOH 161 353  115  HOH HOH B . 
H 5 HOH 162 354  116  HOH HOH B . 
H 5 HOH 163 355  117  HOH HOH B . 
H 5 HOH 164 356  118  HOH HOH B . 
H 5 HOH 165 357  119  HOH HOH B . 
H 5 HOH 166 358  120  HOH HOH B . 
H 5 HOH 167 359  121  HOH HOH B . 
H 5 HOH 168 360  122  HOH HOH B . 
H 5 HOH 169 361  123  HOH HOH B . 
H 5 HOH 170 362  124  HOH HOH B . 
H 5 HOH 171 363  125  HOH HOH B . 
H 5 HOH 172 364  126  HOH HOH B . 
H 5 HOH 173 365  127  HOH HOH B . 
H 5 HOH 174 366  128  HOH HOH B . 
H 5 HOH 175 367  129  HOH HOH B . 
H 5 HOH 176 368  130  HOH HOH B . 
H 5 HOH 177 369  131  HOH HOH B . 
H 5 HOH 178 370  132  HOH HOH B . 
H 5 HOH 179 371  133  HOH HOH B . 
H 5 HOH 180 372  135  HOH HOH B . 
H 5 HOH 181 373  136  HOH HOH B . 
H 5 HOH 182 374  137  HOH HOH B . 
H 5 HOH 183 375  138  HOH HOH B . 
H 5 HOH 184 376  139  HOH HOH B . 
H 5 HOH 185 377  140  HOH HOH B . 
H 5 HOH 186 378  141  HOH HOH B . 
H 5 HOH 187 379  142  HOH HOH B . 
H 5 HOH 188 380  143  HOH HOH B . 
H 5 HOH 189 381  144  HOH HOH B . 
H 5 HOH 190 382  145  HOH HOH B . 
H 5 HOH 191 383  146  HOH HOH B . 
H 5 HOH 192 384  147  HOH HOH B . 
H 5 HOH 193 385  148  HOH HOH B . 
H 5 HOH 194 386  149  HOH HOH B . 
H 5 HOH 195 387  150  HOH HOH B . 
H 5 HOH 196 388  151  HOH HOH B . 
H 5 HOH 197 389  152  HOH HOH B . 
H 5 HOH 198 390  153  HOH HOH B . 
H 5 HOH 199 391  154  HOH HOH B . 
H 5 HOH 200 392  155  HOH HOH B . 
H 5 HOH 201 393  156  HOH HOH B . 
H 5 HOH 202 394  157  HOH HOH B . 
H 5 HOH 203 395  158  HOH HOH B . 
H 5 HOH 204 396  159  HOH HOH B . 
H 5 HOH 205 397  160  HOH HOH B . 
H 5 HOH 206 398  161  HOH HOH B . 
H 5 HOH 207 399  162  HOH HOH B . 
H 5 HOH 208 400  163  HOH HOH B . 
H 5 HOH 209 401  164  HOH HOH B . 
H 5 HOH 210 402  165  HOH HOH B . 
H 5 HOH 211 403  166  HOH HOH B . 
H 5 HOH 212 404  167  HOH HOH B . 
H 5 HOH 213 405  168  HOH HOH B . 
H 5 HOH 214 406  169  HOH HOH B . 
H 5 HOH 215 407  170  HOH HOH B . 
H 5 HOH 216 408  171  HOH HOH B . 
H 5 HOH 217 409  172  HOH HOH B . 
H 5 HOH 218 410  173  HOH HOH B . 
H 5 HOH 219 411  174  HOH HOH B . 
H 5 HOH 220 412  175  HOH HOH B . 
H 5 HOH 221 413  176  HOH HOH B . 
H 5 HOH 222 414  177  HOH HOH B . 
H 5 HOH 223 415  178  HOH HOH B . 
H 5 HOH 224 416  179  HOH HOH B . 
H 5 HOH 225 417  180  HOH HOH B . 
H 5 HOH 226 418  181  HOH HOH B . 
H 5 HOH 227 419  182  HOH HOH B . 
H 5 HOH 228 420  183  HOH HOH B . 
H 5 HOH 229 421  184  HOH HOH B . 
H 5 HOH 230 422  185  HOH HOH B . 
H 5 HOH 231 423  186  HOH HOH B . 
H 5 HOH 232 424  187  HOH HOH B . 
H 5 HOH 233 425  188  HOH HOH B . 
H 5 HOH 234 426  189  HOH HOH B . 
H 5 HOH 235 427  190  HOH HOH B . 
H 5 HOH 236 428  191  HOH HOH B . 
H 5 HOH 237 429  192  HOH HOH B . 
H 5 HOH 238 430  193  HOH HOH B . 
H 5 HOH 239 431  194  HOH HOH B . 
H 5 HOH 240 432  195  HOH HOH B . 
H 5 HOH 241 433  196  HOH HOH B . 
H 5 HOH 242 434  197  HOH HOH B . 
H 5 HOH 243 435  198  HOH HOH B . 
H 5 HOH 244 436  199  HOH HOH B . 
H 5 HOH 245 437  200  HOH HOH B . 
H 5 HOH 246 438  201  HOH HOH B . 
H 5 HOH 247 439  202  HOH HOH B . 
H 5 HOH 248 440  203  HOH HOH B . 
#