data_3K7H
# 
_entry.id   3K7H 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3K7H         
RCSB  RCSB055642   
WWPDB D_1000055642 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3k7g 'the Indian Hedgehog N-terminal signalling domain, wild type'          unspecified 
PDB 3k7i 'the E131K mutant of the Indian Hedgehog N-terminal signalling domain' unspecified 
PDB 3k7j 'the D100E mutant of the Indian Hedgehog N-terminal signalling domain' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3K7H 
_pdbx_database_status.recvd_initial_deposition_date   2009-10-13 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'He, Y.-X.'   1 
'Kang, Y.'    2 
'Zhang, W.J.' 3 
'Yu, J.'      4 
'Ma, G.'      5 
'Zhou, C.-Z.' 6 
# 
_citation.id                        primary 
_citation.title                     'Crystal structure of the E95K mutant of the Indian Hedgehog N-terminal signalling domain' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'He, Y.-X.'   1 
primary 'Kang, Y.'    2 
primary 'Zhang, W.J.' 3 
primary 'Yu, J.'      4 
primary 'Ma, G.'      5 
primary 'Zhou, C.-Z.' 6 
# 
_cell.entry_id           3K7H 
_cell.length_a           107.890 
_cell.length_b           52.750 
_cell.length_c           35.440 
_cell.angle_alpha        90.00 
_cell.angle_beta         90.54 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3K7H 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Indian hedgehog protein' 21115.699 1   ? E95K 'Indian hedgehog protein N-product' ? 
2 non-polymer syn 'ZINC ION'                65.409    1   ? ?    ?                                   ? 
3 non-polymer syn 'SULFATE ION'             96.063    1   ? ?    ?                                   ? 
4 water       nat water                     18.015    182 ? ?    ?                                   ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'IHH, HHG-2' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MRGSHHHHHHGSCGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIARSSERFKELTPNYNPDIIFKDEK
NTGADRLMTQRCKDRLNSLAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYGLLARLAVEAGF
DWVYYESKAHVHCSVKSEHSAAAKTGG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MRGSHHHHHHGSCGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIARSSERFKELTPNYNPDIIFKDEK
NTGADRLMTQRCKDRLNSLAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYGLLARLAVEAGF
DWVYYESKAHVHCSVKSEHSAAAKTGG
;
_entity_poly.pdbx_strand_id                 B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ARG n 
1 3   GLY n 
1 4   SER n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  GLY n 
1 12  SER n 
1 13  CYS n 
1 14  GLY n 
1 15  PRO n 
1 16  GLY n 
1 17  ARG n 
1 18  VAL n 
1 19  VAL n 
1 20  GLY n 
1 21  SER n 
1 22  ARG n 
1 23  ARG n 
1 24  ARG n 
1 25  PRO n 
1 26  PRO n 
1 27  ARG n 
1 28  LYS n 
1 29  LEU n 
1 30  VAL n 
1 31  PRO n 
1 32  LEU n 
1 33  ALA n 
1 34  TYR n 
1 35  LYS n 
1 36  GLN n 
1 37  PHE n 
1 38  SER n 
1 39  PRO n 
1 40  ASN n 
1 41  VAL n 
1 42  PRO n 
1 43  GLU n 
1 44  LYS n 
1 45  THR n 
1 46  LEU n 
1 47  GLY n 
1 48  ALA n 
1 49  SER n 
1 50  GLY n 
1 51  ARG n 
1 52  TYR n 
1 53  GLU n 
1 54  GLY n 
1 55  LYS n 
1 56  ILE n 
1 57  ALA n 
1 58  ARG n 
1 59  SER n 
1 60  SER n 
1 61  GLU n 
1 62  ARG n 
1 63  PHE n 
1 64  LYS n 
1 65  GLU n 
1 66  LEU n 
1 67  THR n 
1 68  PRO n 
1 69  ASN n 
1 70  TYR n 
1 71  ASN n 
1 72  PRO n 
1 73  ASP n 
1 74  ILE n 
1 75  ILE n 
1 76  PHE n 
1 77  LYS n 
1 78  ASP n 
1 79  GLU n 
1 80  LYS n 
1 81  ASN n 
1 82  THR n 
1 83  GLY n 
1 84  ALA n 
1 85  ASP n 
1 86  ARG n 
1 87  LEU n 
1 88  MET n 
1 89  THR n 
1 90  GLN n 
1 91  ARG n 
1 92  CYS n 
1 93  LYS n 
1 94  ASP n 
1 95  ARG n 
1 96  LEU n 
1 97  ASN n 
1 98  SER n 
1 99  LEU n 
1 100 ALA n 
1 101 ILE n 
1 102 SER n 
1 103 VAL n 
1 104 MET n 
1 105 ASN n 
1 106 GLN n 
1 107 TRP n 
1 108 PRO n 
1 109 GLY n 
1 110 VAL n 
1 111 LYS n 
1 112 LEU n 
1 113 ARG n 
1 114 VAL n 
1 115 THR n 
1 116 GLU n 
1 117 GLY n 
1 118 TRP n 
1 119 ASP n 
1 120 GLU n 
1 121 ASP n 
1 122 GLY n 
1 123 HIS n 
1 124 HIS n 
1 125 SER n 
1 126 GLU n 
1 127 GLU n 
1 128 SER n 
1 129 LEU n 
1 130 HIS n 
1 131 TYR n 
1 132 GLU n 
1 133 GLY n 
1 134 ARG n 
1 135 ALA n 
1 136 VAL n 
1 137 ASP n 
1 138 ILE n 
1 139 THR n 
1 140 THR n 
1 141 SER n 
1 142 ASP n 
1 143 ARG n 
1 144 ASP n 
1 145 ARG n 
1 146 ASN n 
1 147 LYS n 
1 148 TYR n 
1 149 GLY n 
1 150 LEU n 
1 151 LEU n 
1 152 ALA n 
1 153 ARG n 
1 154 LEU n 
1 155 ALA n 
1 156 VAL n 
1 157 GLU n 
1 158 ALA n 
1 159 GLY n 
1 160 PHE n 
1 161 ASP n 
1 162 TRP n 
1 163 VAL n 
1 164 TYR n 
1 165 TYR n 
1 166 GLU n 
1 167 SER n 
1 168 LYS n 
1 169 ALA n 
1 170 HIS n 
1 171 VAL n 
1 172 HIS n 
1 173 CYS n 
1 174 SER n 
1 175 VAL n 
1 176 LYS n 
1 177 SER n 
1 178 GLU n 
1 179 HIS n 
1 180 SER n 
1 181 ALA n 
1 182 ALA n 
1 183 ALA n 
1 184 LYS n 
1 185 THR n 
1 186 GLY n 
1 187 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 IHH 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               Rosseta 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    IHH_HUMAN 
_struct_ref.pdbx_db_accession          Q14623 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;CGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIARSSERFKELTPNYNPDIIFKDEENTGADRLMTQRC
KDRLNSLAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYGLLARLAVEAGFDWVYYESKAHVH
CSVKSEHSAAAKTGG
;
_struct_ref.pdbx_align_begin           28 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              3K7H 
_struct_ref_seq.pdbx_strand_id                B 
_struct_ref_seq.seq_align_beg                 13 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 187 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q14623 
_struct_ref_seq.db_align_beg                  28 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  202 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       28 
_struct_ref_seq.pdbx_auth_seq_align_end       202 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3K7H MET B 1  ? UNP Q14623 ?   ?  'INITIATING METHIONINE' 16 1  
1 3K7H ARG B 2  ? UNP Q14623 ?   ?  'EXPRESSION TAG'        17 2  
1 3K7H GLY B 3  ? UNP Q14623 ?   ?  'EXPRESSION TAG'        18 3  
1 3K7H SER B 4  ? UNP Q14623 ?   ?  'EXPRESSION TAG'        19 4  
1 3K7H HIS B 5  ? UNP Q14623 ?   ?  'EXPRESSION TAG'        20 5  
1 3K7H HIS B 6  ? UNP Q14623 ?   ?  'EXPRESSION TAG'        21 6  
1 3K7H HIS B 7  ? UNP Q14623 ?   ?  'EXPRESSION TAG'        22 7  
1 3K7H HIS B 8  ? UNP Q14623 ?   ?  'EXPRESSION TAG'        23 8  
1 3K7H HIS B 9  ? UNP Q14623 ?   ?  'EXPRESSION TAG'        24 9  
1 3K7H HIS B 10 ? UNP Q14623 ?   ?  'EXPRESSION TAG'        25 10 
1 3K7H GLY B 11 ? UNP Q14623 ?   ?  'EXPRESSION TAG'        26 11 
1 3K7H SER B 12 ? UNP Q14623 ?   ?  'EXPRESSION TAG'        27 12 
1 3K7H LYS B 80 ? UNP Q14623 GLU 95 'ENGINEERED MUTATION'   95 13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
_exptl.entry_id          3K7H 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      2.39 
_exptl_crystal.density_percent_sol   48.49 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.temp            289 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              6.5 
_exptl_crystal_grow.pdbx_details    
'0.1M sodium cacodylate, pH 6.5, 30% PEG 8000, 0.2M (NH4)2SO4, VAPOR DIFFUSION, HANGING DROP, temperature 289K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'MAR scanner 345 mm plate' 
_diffrn_detector.pdbx_collection_date   2006-07-10 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.54178 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU MICROMAX-007 HF' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.54178 
# 
_reflns.entry_id                     3K7H 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             26.971 
_reflns.d_resolution_high            1.50 
_reflns.number_obs                   31798 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         99.5 
_reflns.pdbx_Rmerge_I_obs            0.048 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        14.7 
_reflns.B_iso_Wilson_estimate        17.41 
_reflns.pdbx_redundancy              3.5 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.50 
_reflns_shell.d_res_low              1.58 
_reflns_shell.percent_possible_all   98.4 
_reflns_shell.Rmerge_I_obs           0.656 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.0 
_reflns_shell.pdbx_redundancy        3.3 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      4575 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3K7H 
_refine.ls_number_reflns_obs                     31791 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.37 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             26.971 
_refine.ls_d_res_high                            1.500 
_refine.ls_percent_reflns_obs                    99.47 
_refine.ls_R_factor_obs                          0.1902 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1898 
_refine.ls_R_factor_R_free                       0.1978 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 5.04 
_refine.ls_number_reflns_R_free                  1603 
_refine.ls_number_reflns_R_work                  30188 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               20.307 
_refine.aniso_B[1][1]                            -2.684 
_refine.aniso_B[2][2]                            -1.778 
_refine.aniso_B[3][3]                            -3.447 
_refine.aniso_B[1][2]                            -0.000 
_refine.aniso_B[1][3]                            0.586 
_refine.aniso_B[2][3]                            -0.000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.433 
_refine.solvent_model_param_bsol                 42.011 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1VHH' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.15 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   0.897 
_refine.B_iso_max                                57.33 
_refine.B_iso_min                                12.48 
_refine.pdbx_overall_phase_error                 17.780 
_refine.occupancy_max                            1.00 
_refine.occupancy_min                            0.41 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1260 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         6 
_refine_hist.number_atoms_solvent             182 
_refine_hist.number_atoms_total               1448 
_refine_hist.d_res_high                       1.500 
_refine_hist.d_res_low                        26.971 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.005  ? ? 1294 'X-RAY DIFFRACTION' ? 
f_angle_d          0.995  ? ? 1747 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 17.208 ? ? 480  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.077  ? ? 181  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.003  ? ? 228  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
. 1.5000 1.5484  2699 0.2748 98.00  0.2807 . . 157 . . . . 'X-RAY DIFFRACTION' 
. 1.5484 1.6038  2703 0.2469 99.00  0.2578 . . 116 . . . . 'X-RAY DIFFRACTION' 
. 1.6038 1.6680  2733 0.2041 99.00  0.2357 . . 141 . . . . 'X-RAY DIFFRACTION' 
. 1.6680 1.7439  2745 0.1737 99.00  0.2009 . . 113 . . . . 'X-RAY DIFFRACTION' 
. 1.7439 1.8358  2721 0.1648 100.00 0.1992 . . 151 . . . . 'X-RAY DIFFRACTION' 
. 1.8358 1.9508  2757 0.1530 100.00 0.2050 . . 153 . . . . 'X-RAY DIFFRACTION' 
. 1.9508 2.1013  2745 0.1565 100.00 0.1711 . . 152 . . . . 'X-RAY DIFFRACTION' 
. 2.1013 2.3127  2759 0.1580 100.00 0.1816 . . 144 . . . . 'X-RAY DIFFRACTION' 
. 2.3127 2.6471  2744 0.1724 100.00 0.1990 . . 164 . . . . 'X-RAY DIFFRACTION' 
. 2.6471 3.3341  2769 0.1702 100.00 0.1720 . . 160 . . . . 'X-RAY DIFFRACTION' 
. 3.3341 26.9756 2813 0.1690 100.00 0.1601 . . 152 . . . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3K7H 
_struct.title                     'Crystal structure of the E95K mutant of the Indian Hedgehog N-terminal signalling domain' 
_struct.pdbx_descriptor           'Indian hedgehog protein' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3K7H 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            
;alpha+beta sandwich, Autocatalytic cleavage, Cell membrane, Developmental protein, Disease mutation, Glycoprotein, Hydrolase, Lipoprotein, Membrane, Palmitate, Protease, Secreted, SIGNALING PROTEIN
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 4 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 SER A 60  ? LEU A 66  ? SER B 75  LEU B 81  5 ? 7  
HELX_P HELX_P2 2 GLY A 83  ? ASP A 85  ? GLY B 98  ASP B 100 5 ? 3  
HELX_P HELX_P3 3 THR A 89  ? TRP A 107 ? THR B 104 TRP B 122 1 ? 19 
HELX_P HELX_P4 4 SER A 128 ? GLY A 133 ? SER B 143 GLY B 148 5 ? 6  
HELX_P HELX_P5 5 ASP A 144 ? ASN A 146 ? ASP B 159 ASN B 161 5 ? 3  
HELX_P HELX_P6 6 LYS A 147 ? ALA A 158 ? LYS B 162 ALA B 173 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? A HIS 130 NE2 ? ? ? 1_555 B ZN  . ZN ? ? B HIS 145  B ZN  1001 1_555 ? ? ? ? ? ? ? 2.039 ? 
metalc2 metalc ? ? A ASP 137 OD1 ? ? ? 1_555 B ZN  . ZN ? ? B ASP 152  B ZN  1001 1_555 ? ? ? ? ? ? ? 1.975 ? 
metalc3 metalc ? ? A HIS 172 ND1 ? ? ? 1_555 B ZN  . ZN ? ? B HIS 187  B ZN  1001 1_555 ? ? ? ? ? ? ? 2.089 ? 
metalc4 metalc ? ? B ZN  .   ZN  ? ? ? 1_555 D HOH . O  ? ? B ZN  1001 B HOH 368  1_555 ? ? ? ? ? ? ? 2.049 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          SER 
_struct_mon_prot_cis.label_seq_id           38 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           SER 
_struct_mon_prot_cis.auth_seq_id            53 
_struct_mon_prot_cis.auth_asym_id           B 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    39 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     54 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    B 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       -3.48 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? parallel      
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 37  ? SER A 38  ? PHE B 52  SER B 53  
A 2 TRP A 162 ? SER A 167 ? TRP B 177 SER B 182 
A 3 HIS A 170 ? SER A 174 ? HIS B 185 SER B 189 
A 4 ALA A 135 ? THR A 140 ? ALA B 150 THR B 155 
A 5 LEU A 112 ? GLU A 116 ? LEU B 127 GLU B 131 
A 6 ILE A 74  ? PHE A 76  ? ILE B 89  PHE B 91  
B 1 THR A 67  ? PRO A 68  ? THR B 82  PRO B 83  
B 2 LEU A 87  ? MET A 88  ? LEU B 102 MET B 103 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N SER A 38  ? N SER B 53  O VAL A 163 ? O VAL B 178 
A 2 3 N TYR A 164 ? N TYR B 179 O HIS A 172 ? O HIS B 187 
A 3 4 O CYS A 173 ? O CYS B 188 N VAL A 136 ? N VAL B 151 
A 4 5 O ASP A 137 ? O ASP B 152 N GLU A 116 ? N GLU B 131 
A 5 6 O VAL A 114 ? O VAL B 129 N ILE A 75  ? N ILE B 90  
B 1 2 N THR A 67  ? N THR B 82  O MET A 88  ? O MET B 103 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE ZN B 1001' 
AC2 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE SO4 B 1'   
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 HIS A 130 ? HIS B 145 . ? 1_555 ? 
2  AC1 5 ASP A 137 ? ASP B 152 . ? 1_555 ? 
3  AC1 5 HIS A 172 ? HIS B 187 . ? 1_555 ? 
4  AC1 5 ALA A 182 ? ALA B 197 . ? 4_455 ? 
5  AC1 5 HOH D .   ? HOH B 368 . ? 1_555 ? 
6  AC2 7 HOH D .   ? HOH B 13  . ? 1_555 ? 
7  AC2 7 LYS A 77  ? LYS B 92  . ? 1_555 ? 
8  AC2 7 ARG A 113 ? ARG B 128 . ? 1_555 ? 
9  AC2 7 THR A 115 ? THR B 130 . ? 1_555 ? 
10 AC2 7 ARG A 143 ? ARG B 158 . ? 1_555 ? 
11 AC2 7 HOH D .   ? HOH B 205 . ? 1_555 ? 
12 AC2 7 HOH D .   ? HOH B 234 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3K7H 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3K7H 
_atom_sites.fract_transf_matrix[1][1]   0.009269 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000087 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.018957 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.028218 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . PRO A 1 26  ? 4.186   -34.258 -6.749  1.00 33.86 ? 41   PRO B N   1 
ATOM   2    C  CA  . PRO A 1 26  ? 3.076   -33.345 -6.453  1.00 29.62 ? 41   PRO B CA  1 
ATOM   3    C  C   . PRO A 1 26  ? 2.326   -32.935 -7.716  1.00 30.93 ? 41   PRO B C   1 
ATOM   4    O  O   . PRO A 1 26  ? 2.913   -32.881 -8.797  1.00 30.66 ? 41   PRO B O   1 
ATOM   5    C  CB  . PRO A 1 26  ? 3.775   -32.130 -5.834  1.00 29.18 ? 41   PRO B CB  1 
ATOM   6    C  CG  . PRO A 1 26  ? 5.169   -32.179 -6.356  1.00 28.51 ? 41   PRO B CG  1 
ATOM   7    C  CD  . PRO A 1 26  ? 5.503   -33.626 -6.556  1.00 31.25 ? 41   PRO B CD  1 
ATOM   8    N  N   . ARG A 1 27  ? 1.035   -32.659 -7.575  1.00 31.51 ? 42   ARG B N   1 
ATOM   9    C  CA  . ARG A 1 27  ? 0.230   -32.171 -8.684  1.00 32.04 ? 42   ARG B CA  1 
ATOM   10   C  C   . ARG A 1 27  ? -0.017  -30.680 -8.501  1.00 25.83 ? 42   ARG B C   1 
ATOM   11   O  O   . ARG A 1 27  ? -0.124  -30.198 -7.374  1.00 26.41 ? 42   ARG B O   1 
ATOM   12   C  CB  . ARG A 1 27  ? -1.117  -32.900 -8.741  1.00 37.70 ? 42   ARG B CB  1 
ATOM   13   C  CG  . ARG A 1 27  ? -1.043  -34.388 -9.070  1.00 44.90 ? 42   ARG B CG  1 
ATOM   14   C  CD  . ARG A 1 27  ? -0.531  -35.210 -7.891  1.00 49.31 ? 42   ARG B CD  1 
ATOM   15   N  NE  . ARG A 1 27  ? -1.192  -34.857 -6.636  1.00 52.80 ? 42   ARG B NE  1 
ATOM   16   C  CZ  . ARG A 1 27  ? -2.352  -35.363 -6.230  1.00 55.37 ? 42   ARG B CZ  1 
ATOM   17   N  NH1 . ARG A 1 27  ? -2.993  -36.248 -6.984  1.00 57.33 ? 42   ARG B NH1 1 
ATOM   18   N  NH2 . ARG A 1 27  ? -2.875  -34.983 -5.070  1.00 56.27 ? 42   ARG B NH2 1 
ATOM   19   N  N   . LYS A 1 28  ? -0.106  -29.954 -9.608  1.00 24.95 ? 43   LYS B N   1 
ATOM   20   C  CA  . LYS A 1 28  ? -0.481  -28.548 -9.564  1.00 23.72 ? 43   LYS B CA  1 
ATOM   21   C  C   . LYS A 1 28  ? -1.939  -28.428 -9.128  1.00 25.84 ? 43   LYS B C   1 
ATOM   22   O  O   . LYS A 1 28  ? -2.813  -29.117 -9.660  1.00 26.74 ? 43   LYS B O   1 
ATOM   23   C  CB  . LYS A 1 28  ? -0.270  -27.897 -10.933 1.00 28.01 ? 43   LYS B CB  1 
ATOM   24   C  CG  . LYS A 1 28  ? -0.988  -26.572 -11.118 1.00 32.87 ? 43   LYS B CG  1 
ATOM   25   C  CD  . LYS A 1 28  ? -0.462  -25.829 -12.339 1.00 41.96 ? 43   LYS B CD  1 
ATOM   26   C  CE  . LYS A 1 28  ? -1.442  -24.765 -12.815 1.00 42.03 ? 43   LYS B CE  1 
ATOM   27   N  NZ  . LYS A 1 28  ? -2.566  -25.350 -13.605 1.00 38.57 ? 43   LYS B NZ  1 
ATOM   28   N  N   . LEU A 1 29  ? -2.202  -27.569 -8.148  1.00 21.33 ? 44   LEU B N   1 
ATOM   29   C  CA  . LEU A 1 29  ? -3.568  -27.365 -7.679  1.00 21.68 ? 44   LEU B CA  1 
ATOM   30   C  C   . LEU A 1 29  ? -4.246  -26.312 -8.543  1.00 21.71 ? 44   LEU B C   1 
ATOM   31   O  O   . LEU A 1 29  ? -3.783  -25.174 -8.628  1.00 23.51 ? 44   LEU B O   1 
ATOM   32   C  CB  . LEU A 1 29  ? -3.584  -26.938 -6.209  1.00 20.93 ? 44   LEU B CB  1 
ATOM   33   C  CG  . LEU A 1 29  ? -3.219  -28.023 -5.195  1.00 23.20 ? 44   LEU B CG  1 
ATOM   34   C  CD1 . LEU A 1 29  ? -2.924  -27.409 -3.835  1.00 23.54 ? 44   LEU B CD1 1 
ATOM   35   C  CD2 . LEU A 1 29  ? -4.333  -29.053 -5.098  1.00 27.11 ? 44   LEU B CD2 1 
ATOM   36   N  N   . VAL A 1 30  ? -5.336  -26.706 -9.193  1.00 19.10 ? 45   VAL B N   1 
ATOM   37   C  CA  . VAL A 1 30  ? -6.069  -25.815 -10.081 1.00 18.77 ? 45   VAL B CA  1 
ATOM   38   C  C   . VAL A 1 30  ? -7.322  -25.333 -9.364  1.00 17.63 ? 45   VAL B C   1 
ATOM   39   O  O   . VAL A 1 30  ? -8.130  -26.145 -8.911  1.00 19.33 ? 45   VAL B O   1 
ATOM   40   C  CB  . VAL A 1 30  ? -6.473  -26.537 -11.390 1.00 21.19 ? 45   VAL B CB  1 
ATOM   41   C  CG1 . VAL A 1 30  ? -7.190  -25.579 -12.337 1.00 23.51 ? 45   VAL B CG1 1 
ATOM   42   C  CG2 . VAL A 1 30  ? -5.248  -27.151 -12.062 1.00 22.75 ? 45   VAL B CG2 1 
ATOM   43   N  N   . PRO A 1 31  ? -7.485  -24.008 -9.244  1.00 16.40 ? 46   PRO B N   1 
ATOM   44   C  CA  . PRO A 1 31  ? -8.685  -23.522 -8.553  1.00 16.38 ? 46   PRO B CA  1 
ATOM   45   C  C   . PRO A 1 31  ? -9.940  -23.857 -9.350  1.00 15.57 ? 46   PRO B C   1 
ATOM   46   O  O   . PRO A 1 31  ? -9.882  -23.981 -10.576 1.00 18.53 ? 46   PRO B O   1 
ATOM   47   C  CB  . PRO A 1 31  ? -8.472  -22.004 -8.510  1.00 17.12 ? 46   PRO B CB  1 
ATOM   48   C  CG  . PRO A 1 31  ? -7.477  -21.731 -9.617  1.00 21.80 ? 46   PRO B CG  1 
ATOM   49   C  CD  . PRO A 1 31  ? -6.569  -22.912 -9.597  1.00 19.98 ? 46   PRO B CD  1 
ATOM   50   N  N   . LEU A 1 32  ? -11.066 -24.020 -8.665  1.00 15.39 ? 47   LEU B N   1 
ATOM   51   C  CA  . LEU A 1 32  ? -12.338 -24.133 -9.365  1.00 15.64 ? 47   LEU B CA  1 
ATOM   52   C  C   . LEU A 1 32  ? -12.714 -22.778 -9.945  1.00 16.02 ? 47   LEU B C   1 
ATOM   53   O  O   . LEU A 1 32  ? -12.397 -21.734 -9.365  1.00 16.42 ? 47   LEU B O   1 
ATOM   54   C  CB  . LEU A 1 32  ? -13.448 -24.617 -8.426  1.00 15.63 ? 47   LEU B CB  1 
ATOM   55   C  CG  . LEU A 1 32  ? -13.633 -26.128 -8.275  1.00 15.80 ? 47   LEU B CG  1 
ATOM   56   C  CD1 . LEU A 1 32  ? -12.440 -26.769 -7.584  1.00 17.82 ? 47   LEU B CD1 1 
ATOM   57   C  CD2 . LEU A 1 32  ? -14.928 -26.456 -7.539  1.00 16.34 ? 47   LEU B CD2 1 
ATOM   58   N  N   . ALA A 1 33  ? -13.377 -22.797 -11.100 1.00 15.58 ? 48   ALA B N   1 
ATOM   59   C  CA  . ALA A 1 33  ? -13.940 -21.586 -11.673 1.00 16.30 ? 48   ALA B CA  1 
ATOM   60   C  C   . ALA A 1 33  ? -15.224 -21.216 -10.953 1.00 14.94 ? 48   ALA B C   1 
ATOM   61   O  O   . ALA A 1 33  ? -15.868 -22.062 -10.330 1.00 14.68 ? 48   ALA B O   1 
ATOM   62   C  CB  . ALA A 1 33  ? -14.215 -21.772 -13.166 1.00 17.53 ? 48   ALA B CB  1 
ATOM   63   N  N   . TYR A 1 34  ? -15.599 -19.948 -11.064 1.00 16.51 ? 49   TYR B N   1 
ATOM   64   C  CA  . TYR A 1 34  ? -16.885 -19.477 -10.574 1.00 16.95 ? 49   TYR B CA  1 
ATOM   65   C  C   . TYR A 1 34  ? -18.006 -20.344 -11.161 1.00 16.40 ? 49   TYR B C   1 
ATOM   66   O  O   . TYR A 1 34  ? -18.050 -20.579 -12.374 1.00 16.31 ? 49   TYR B O   1 
ATOM   67   C  CB  . TYR A 1 34  ? -17.047 -17.996 -10.937 1.00 16.67 ? 49   TYR B CB  1 
ATOM   68   C  CG  . TYR A 1 34  ? -18.385 -17.370 -10.593 1.00 18.37 ? 49   TYR B CG  1 
ATOM   69   C  CD1 . TYR A 1 34  ? -18.924 -17.484 -9.320  1.00 18.51 ? 49   TYR B CD1 1 
ATOM   70   C  CD2 . TYR A 1 34  ? -19.088 -16.631 -11.538 1.00 20.36 ? 49   TYR B CD2 1 
ATOM   71   C  CE1 . TYR A 1 34  ? -20.148 -16.904 -9.004  1.00 19.08 ? 49   TYR B CE1 1 
ATOM   72   C  CE2 . TYR A 1 34  ? -20.310 -16.040 -11.229 1.00 19.44 ? 49   TYR B CE2 1 
ATOM   73   C  CZ  . TYR A 1 34  ? -20.835 -16.182 -9.963  1.00 18.48 ? 49   TYR B CZ  1 
ATOM   74   O  OH  . TYR A 1 34  ? -22.048 -15.597 -9.651  1.00 20.75 ? 49   TYR B OH  1 
ATOM   75   N  N   . LYS A 1 35  ? -18.867 -20.848 -10.273 1.00 15.92 ? 50   LYS B N   1 
ATOM   76   C  CA  . LYS A 1 35  ? -20.006 -21.724 -10.596 1.00 15.64 ? 50   LYS B CA  1 
ATOM   77   C  C   . LYS A 1 35  ? -19.661 -23.198 -10.874 1.00 15.42 ? 50   LYS B C   1 
ATOM   78   O  O   . LYS A 1 35  ? -20.552 -24.031 -11.061 1.00 17.08 ? 50   LYS B O   1 
ATOM   79   C  CB  . LYS A 1 35  ? -20.870 -21.141 -11.722 1.00 16.28 ? 50   LYS B CB  1 
ATOM   80   C  CG  . LYS A 1 35  ? -21.618 -19.879 -11.326 1.00 16.24 ? 50   LYS B CG  1 
ATOM   81   C  CD  . LYS A 1 35  ? -22.536 -20.128 -10.129 1.00 16.86 ? 50   LYS B CD  1 
ATOM   82   C  CE  . LYS A 1 35  ? -23.498 -18.972 -9.928  1.00 20.07 ? 50   LYS B CE  1 
ATOM   83   N  NZ  . LYS A 1 35  ? -24.498 -19.281 -8.864  1.00 17.82 ? 50   LYS B NZ  1 
ATOM   84   N  N   . GLN A 1 36  ? -18.375 -23.517 -10.888 1.00 14.65 ? 51   GLN B N   1 
ATOM   85   C  CA  . GLN A 1 36  ? -17.953 -24.901 -11.046 1.00 14.58 ? 51   GLN B CA  1 
ATOM   86   C  C   . GLN A 1 36  ? -18.269 -25.718 -9.797  1.00 14.81 ? 51   GLN B C   1 
ATOM   87   O  O   . GLN A 1 36  ? -18.209 -25.211 -8.674  1.00 14.53 ? 51   GLN B O   1 
ATOM   88   C  CB  . GLN A 1 36  ? -16.457 -24.967 -11.352 1.00 14.18 ? 51   GLN B CB  1 
ATOM   89   C  CG  . GLN A 1 36  ? -15.951 -26.381 -11.622 1.00 16.23 ? 51   GLN B CG  1 
ATOM   90   C  CD  . GLN A 1 36  ? -14.499 -26.421 -12.040 1.00 15.38 ? 51   GLN B CD  1 
ATOM   91   O  OE1 . GLN A 1 36  ? -13.847 -25.385 -12.173 1.00 16.20 ? 51   GLN B OE1 1 
ATOM   92   N  NE2 . GLN A 1 36  ? -13.983 -27.624 -12.257 1.00 18.62 ? 51   GLN B NE2 1 
ATOM   93   N  N   . PHE A 1 37  ? -18.614 -26.984 -9.997  1.00 15.01 ? 52   PHE B N   1 
ATOM   94   C  CA  . PHE A 1 37  ? -18.802 -27.901 -8.880  1.00 14.88 ? 52   PHE B CA  1 
ATOM   95   C  C   . PHE A 1 37  ? -18.048 -29.201 -9.135  1.00 15.36 ? 52   PHE B C   1 
ATOM   96   O  O   . PHE A 1 37  ? -17.827 -29.597 -10.284 1.00 16.38 ? 52   PHE B O   1 
ATOM   97   C  CB  . PHE A 1 37  ? -20.293 -28.150 -8.589  1.00 15.07 ? 52   PHE B CB  1 
ATOM   98   C  CG  . PHE A 1 37  ? -21.112 -28.471 -9.807  1.00 15.22 ? 52   PHE B CG  1 
ATOM   99   C  CD1 . PHE A 1 37  ? -21.698 -27.459 -10.555 1.00 18.15 ? 52   PHE B CD1 1 
ATOM   100  C  CD2 . PHE A 1 37  ? -21.317 -29.785 -10.189 1.00 16.51 ? 52   PHE B CD2 1 
ATOM   101  C  CE1 . PHE A 1 37  ? -22.461 -27.751 -11.677 1.00 19.57 ? 52   PHE B CE1 1 
ATOM   102  C  CE2 . PHE A 1 37  ? -22.081 -30.083 -11.313 1.00 16.94 ? 52   PHE B CE2 1 
ATOM   103  C  CZ  . PHE A 1 37  ? -22.653 -29.065 -12.053 1.00 19.62 ? 52   PHE B CZ  1 
ATOM   104  N  N   . SER A 1 38  ? -17.632 -29.844 -8.052  1.00 14.44 ? 53   SER B N   1 
ATOM   105  C  CA  . SER A 1 38  ? -16.834 -31.055 -8.126  1.00 14.55 ? 53   SER B CA  1 
ATOM   106  C  C   . SER A 1 38  ? -17.248 -32.005 -7.006  1.00 16.34 ? 53   SER B C   1 
ATOM   107  O  O   . SER A 1 38  ? -17.369 -31.589 -5.861  1.00 14.91 ? 53   SER B O   1 
ATOM   108  C  CB  . SER A 1 38  ? -15.355 -30.701 -7.978  1.00 16.72 ? 53   SER B CB  1 
ATOM   109  O  OG  . SER A 1 38  ? -14.538 -31.839 -8.182  1.00 20.82 ? 53   SER B OG  1 
ATOM   110  N  N   . PRO A 1 39  ? -17.481 -33.287 -7.326  1.00 15.78 ? 54   PRO B N   1 
ATOM   111  C  CA  . PRO A 1 39  ? -17.447 -33.866 -8.673  1.00 18.10 ? 54   PRO B CA  1 
ATOM   112  C  C   . PRO A 1 39  ? -18.493 -33.221 -9.577  1.00 16.88 ? 54   PRO B C   1 
ATOM   113  O  O   . PRO A 1 39  ? -19.441 -32.587 -9.104  1.00 16.26 ? 54   PRO B O   1 
ATOM   114  C  CB  . PRO A 1 39  ? -17.804 -35.338 -8.424  1.00 20.47 ? 54   PRO B CB  1 
ATOM   115  C  CG  . PRO A 1 39  ? -18.568 -35.318 -7.133  1.00 19.22 ? 54   PRO B CG  1 
ATOM   116  C  CD  . PRO A 1 39  ? -17.820 -34.301 -6.316  1.00 18.27 ? 54   PRO B CD  1 
ATOM   117  N  N   . ASN A 1 40  ? -18.302 -33.382 -10.882 1.00 17.98 ? 55   ASN B N   1 
ATOM   118  C  CA  . ASN A 1 40  ? -19.126 -32.696 -11.871 1.00 16.24 ? 55   ASN B CA  1 
ATOM   119  C  C   . ASN A 1 40  ? -20.483 -33.354 -12.099 1.00 19.07 ? 55   ASN B C   1 
ATOM   120  O  O   . ASN A 1 40  ? -20.873 -33.624 -13.235 1.00 23.07 ? 55   ASN B O   1 
ATOM   121  C  CB  . ASN A 1 40  ? -18.364 -32.578 -13.190 1.00 16.19 ? 55   ASN B CB  1 
ATOM   122  C  CG  . ASN A 1 40  ? -19.031 -31.636 -14.155 1.00 21.45 ? 55   ASN B CG  1 
ATOM   123  O  OD1 . ASN A 1 40  ? -20.015 -30.977 -13.814 0.47 20.10 ? 55   ASN B OD1 1 
ATOM   124  N  ND2 . ASN A 1 40  ? -18.516 -31.578 -15.378 0.77 18.71 ? 55   ASN B ND2 1 
ATOM   125  N  N   . VAL A 1 41  ? -21.195 -33.605 -11.007 1.00 15.93 ? 56   VAL B N   1 
ATOM   126  C  CA  . VAL A 1 41  ? -22.516 -34.218 -11.030 1.00 17.04 ? 56   VAL B CA  1 
ATOM   127  C  C   . VAL A 1 41  ? -23.379 -33.457 -10.025 1.00 15.69 ? 56   VAL B C   1 
ATOM   128  O  O   . VAL A 1 41  ? -22.851 -32.718 -9.202  1.00 16.45 ? 56   VAL B O   1 
ATOM   129  C  CB  . VAL A 1 41  ? -22.445 -35.693 -10.616 1.00 17.71 ? 56   VAL B CB  1 
ATOM   130  C  CG1 . VAL A 1 41  ? -21.596 -36.485 -11.612 1.00 19.08 ? 56   VAL B CG1 1 
ATOM   131  C  CG2 . VAL A 1 41  ? -21.887 -35.819 -9.204  1.00 17.56 ? 56   VAL B CG2 1 
ATOM   132  N  N   . PRO A 1 42  ? -24.709 -33.623 -10.082 1.00 16.93 ? 57   PRO B N   1 
ATOM   133  C  CA  . PRO A 1 42  ? -25.565 -32.922 -9.116  1.00 16.64 ? 57   PRO B CA  1 
ATOM   134  C  C   . PRO A 1 42  ? -25.257 -33.310 -7.672  1.00 16.20 ? 57   PRO B C   1 
ATOM   135  O  O   . PRO A 1 42  ? -24.862 -34.447 -7.409  1.00 14.59 ? 57   PRO B O   1 
ATOM   136  C  CB  . PRO A 1 42  ? -26.977 -33.371 -9.506  1.00 16.55 ? 57   PRO B CB  1 
ATOM   137  C  CG  . PRO A 1 42  ? -26.857 -33.729 -10.952 1.00 18.63 ? 57   PRO B CG  1 
ATOM   138  C  CD  . PRO A 1 42  ? -25.498 -34.338 -11.100 1.00 19.03 ? 57   PRO B CD  1 
ATOM   139  N  N   . GLU A 1 43  ? -25.428 -32.358 -6.759  1.00 16.08 ? 58   GLU B N   1 
ATOM   140  C  CA  . GLU A 1 43  ? -25.088 -32.551 -5.349  1.00 15.08 ? 58   GLU B CA  1 
ATOM   141  C  C   . GLU A 1 43  ? -25.719 -33.787 -4.727  1.00 15.34 ? 58   GLU B C   1 
ATOM   142  O  O   . GLU A 1 43  ? -25.057 -34.537 -4.008  1.00 16.11 ? 58   GLU B O   1 
ATOM   143  C  CB  . GLU A 1 43  ? -25.522 -31.341 -4.532  1.00 14.65 ? 58   GLU B CB  1 
ATOM   144  C  CG  . GLU A 1 43  ? -25.121 -31.445 -3.069  1.00 14.55 ? 58   GLU B CG  1 
ATOM   145  C  CD  . GLU A 1 43  ? -25.477 -30.205 -2.287  1.00 14.27 ? 58   GLU B CD  1 
ATOM   146  O  OE1 . GLU A 1 43  ? -26.534 -29.601 -2.582  1.00 16.11 ? 58   GLU B OE1 1 
ATOM   147  O  OE2 . GLU A 1 43  ? -24.695 -29.837 -1.376  1.00 13.89 ? 58   GLU B OE2 1 
ATOM   148  N  N   . LYS A 1 44  ? -27.010 -33.973 -4.972  1.00 16.00 ? 59   LYS B N   1 
ATOM   149  C  CA  . LYS A 1 44  ? -27.729 -35.063 -4.328  1.00 16.84 ? 59   LYS B CA  1 
ATOM   150  C  C   . LYS A 1 44  ? -27.792 -36.287 -5.224  1.00 19.77 ? 59   LYS B C   1 
ATOM   151  O  O   . LYS A 1 44  ? -28.870 -36.793 -5.532  1.00 25.35 ? 59   LYS B O   1 
ATOM   152  C  CB  . LYS A 1 44  ? -29.121 -34.620 -3.887  1.00 18.01 ? 59   LYS B CB  1 
ATOM   153  C  CG  . LYS A 1 44  ? -29.083 -33.673 -2.696  1.00 22.09 ? 59   LYS B CG  1 
ATOM   154  C  CD  . LYS A 1 44  ? -30.362 -32.896 -2.590  1.00 27.71 ? 59   LYS B CD  1 
ATOM   155  C  CE  . LYS A 1 44  ? -30.067 -31.426 -2.406  1.00 26.98 ? 59   LYS B CE  1 
ATOM   156  N  NZ  . LYS A 1 44  ? -31.222 -30.601 -2.832  1.00 29.54 ? 59   LYS B NZ  1 
ATOM   157  N  N   . THR A 1 45  ? -26.621 -36.732 -5.659  1.00 18.82 ? 60   THR B N   1 
ATOM   158  C  CA  . THR A 1 45  ? -26.468 -38.036 -6.297  1.00 18.41 ? 60   THR B CA  1 
ATOM   159  C  C   . THR A 1 45  ? -25.506 -38.846 -5.443  1.00 18.63 ? 60   THR B C   1 
ATOM   160  O  O   . THR A 1 45  ? -24.718 -38.287 -4.681  1.00 17.14 ? 60   THR B O   1 
ATOM   161  C  CB  . THR A 1 45  ? -25.940 -37.920 -7.746  1.00 17.91 ? 60   THR B CB  1 
ATOM   162  O  OG1 . THR A 1 45  ? -24.670 -37.259 -7.752  1.00 18.58 ? 60   THR B OG1 1 
ATOM   163  C  CG2 . THR A 1 45  ? -26.925 -37.151 -8.619  1.00 20.79 ? 60   THR B CG2 1 
ATOM   164  N  N   . LEU A 1 46  ? -25.573 -40.168 -5.549  1.00 18.38 ? 61   LEU B N   1 
ATOM   165  C  CA  . LEU A 1 46  ? -24.772 -41.024 -4.682  1.00 18.99 ? 61   LEU B CA  1 
ATOM   166  C  C   . LEU A 1 46  ? -23.267 -40.832 -4.857  1.00 19.37 ? 61   LEU B C   1 
ATOM   167  O  O   . LEU A 1 46  ? -22.501 -41.066 -3.924  1.00 22.33 ? 61   LEU B O   1 
ATOM   168  C  CB  . LEU A 1 46  ? -25.160 -42.493 -4.868  1.00 20.91 ? 61   LEU B CB  1 
ATOM   169  C  CG  . LEU A 1 46  ? -26.452 -42.863 -4.138  1.00 21.59 ? 61   LEU B CG  1 
ATOM   170  C  CD1 . LEU A 1 46  ? -26.889 -44.272 -4.503  1.00 22.08 ? 61   LEU B CD1 1 
ATOM   171  C  CD2 . LEU A 1 46  ? -26.279 -42.737 -2.630  1.00 24.10 ? 61   LEU B CD2 1 
ATOM   172  N  N   . GLY A 1 47  ? -22.847 -40.410 -6.046  1.00 19.31 ? 62   GLY B N   1 
ATOM   173  C  CA  . GLY A 1 47  ? -21.440 -40.140 -6.295  1.00 21.50 ? 62   GLY B CA  1 
ATOM   174  C  C   . GLY A 1 47  ? -20.962 -38.860 -5.631  1.00 21.06 ? 62   GLY B C   1 
ATOM   175  O  O   . GLY A 1 47  ? -19.757 -38.625 -5.503  1.00 21.82 ? 62   GLY B O   1 
ATOM   176  N  N   . ALA A 1 48  ? -21.912 -38.030 -5.214  1.00 18.86 ? 63   ALA B N   1 
ATOM   177  C  CA  . ALA A 1 48  ? -21.605 -36.774 -4.535  1.00 15.98 ? 63   ALA B CA  1 
ATOM   178  C  C   . ALA A 1 48  ? -22.061 -36.862 -3.079  1.00 15.96 ? 63   ALA B C   1 
ATOM   179  O  O   . ALA A 1 48  ? -21.587 -37.725 -2.347  1.00 16.94 ? 63   ALA B O   1 
ATOM   180  C  CB  . ALA A 1 48  ? -22.245 -35.585 -5.260  1.00 17.29 ? 63   ALA B CB  1 
ATOM   181  N  N   . SER A 1 49  ? -23.003 -36.012 -2.669  1.00 14.91 ? 64   SER B N   1 
ATOM   182  C  CA  . SER A 1 49  ? -23.438 -35.995 -1.269  1.00 14.10 ? 64   SER B CA  1 
ATOM   183  C  C   . SER A 1 49  ? -24.676 -36.845 -0.948  1.00 14.02 ? 64   SER B C   1 
ATOM   184  O  O   . SER A 1 49  ? -25.137 -36.861 0.188   1.00 15.95 ? 64   SER B O   1 
ATOM   185  C  CB  . SER A 1 49  ? -23.616 -34.556 -0.766  1.00 13.64 ? 64   SER B CB  1 
ATOM   186  O  OG  . SER A 1 49  ? -22.361 -33.901 -0.758  1.00 13.64 ? 64   SER B OG  1 
ATOM   187  N  N   . GLY A 1 50  ? -25.199 -37.564 -1.937  1.00 15.34 ? 65   GLY B N   1 
ATOM   188  C  CA  . GLY A 1 50  ? -26.244 -38.537 -1.667  1.00 16.85 ? 65   GLY B CA  1 
ATOM   189  C  C   . GLY A 1 50  ? -27.671 -38.088 -1.913  1.00 21.08 ? 65   GLY B C   1 
ATOM   190  O  O   . GLY A 1 50  ? -28.050 -37.804 -3.050  1.00 25.67 ? 65   GLY B O   1 
ATOM   191  N  N   . ARG A 1 51  ? -28.474 -38.072 -0.853  1.00 18.24 ? 66   ARG B N   1 
ATOM   192  C  CA  . ARG A 1 51  ? -29.886 -37.707 -0.933  1.00 17.97 ? 66   ARG B CA  1 
ATOM   193  C  C   . ARG A 1 51  ? -30.237 -36.681 0.135   1.00 19.36 ? 66   ARG B C   1 
ATOM   194  O  O   . ARG A 1 51  ? -29.631 -36.671 1.204   1.00 20.23 ? 66   ARG B O   1 
ATOM   195  C  CB  . ARG A 1 51  ? -30.770 -38.933 -0.671  1.00 20.96 ? 66   ARG B CB  1 
ATOM   196  C  CG  . ARG A 1 51  ? -30.519 -40.133 -1.553  1.00 22.61 ? 66   ARG B CG  1 
ATOM   197  C  CD  . ARG A 1 51  ? -31.377 -41.308 -1.092  1.00 24.01 ? 66   ARG B CD  1 
ATOM   198  N  NE  . ARG A 1 51  ? -31.322 -42.412 -2.042  1.00 24.30 ? 66   ARG B NE  1 
ATOM   199  C  CZ  . ARG A 1 51  ? -30.507 -43.455 -1.935  1.00 24.38 ? 66   ARG B CZ  1 
ATOM   200  N  NH1 . ARG A 1 51  ? -29.683 -43.548 -0.897  1.00 21.44 ? 66   ARG B NH1 1 
ATOM   201  N  NH2 . ARG A 1 51  ? -30.524 -44.405 -2.866  1.00 21.19 ? 66   ARG B NH2 1 
ATOM   202  N  N   . TYR A 1 52  ? -31.226 -35.835 -0.148  1.00 18.79 ? 67   TYR B N   1 
ATOM   203  C  CA  . TYR A 1 52  ? -31.860 -35.021 0.888   1.00 17.96 ? 67   TYR B CA  1 
ATOM   204  C  C   . TYR A 1 52  ? -32.690 -35.945 1.767   1.00 19.58 ? 67   TYR B C   1 
ATOM   205  O  O   . TYR A 1 52  ? -33.539 -36.683 1.264   1.00 20.10 ? 67   TYR B O   1 
ATOM   206  C  CB  . TYR A 1 52  ? -32.771 -33.973 0.253   1.00 19.88 ? 67   TYR B CB  1 
ATOM   207  C  CG  . TYR A 1 52  ? -33.502 -33.080 1.231   1.00 21.01 ? 67   TYR B CG  1 
ATOM   208  C  CD1 . TYR A 1 52  ? -32.809 -32.216 2.070   1.00 18.68 ? 67   TYR B CD1 1 
ATOM   209  C  CD2 . TYR A 1 52  ? -34.895 -33.076 1.291   1.00 20.67 ? 67   TYR B CD2 1 
ATOM   210  C  CE1 . TYR A 1 52  ? -33.481 -31.382 2.950   1.00 20.25 ? 67   TYR B CE1 1 
ATOM   211  C  CE2 . TYR A 1 52  ? -35.573 -32.247 2.166   1.00 21.38 ? 67   TYR B CE2 1 
ATOM   212  C  CZ  . TYR A 1 52  ? -34.862 -31.405 2.994   1.00 21.51 ? 67   TYR B CZ  1 
ATOM   213  O  OH  . TYR A 1 52  ? -35.534 -30.575 3.865   1.00 22.80 ? 67   TYR B OH  1 
ATOM   214  N  N   . GLU A 1 53  ? -32.450 -35.903 3.074   1.00 18.56 ? 68   GLU B N   1 
ATOM   215  C  CA  . GLU A 1 53  ? -33.127 -36.804 4.000   1.00 20.75 ? 68   GLU B CA  1 
ATOM   216  C  C   . GLU A 1 53  ? -34.105 -36.071 4.910   1.00 20.68 ? 68   GLU B C   1 
ATOM   217  O  O   . GLU A 1 53  ? -34.622 -36.639 5.871   1.00 20.26 ? 68   GLU B O   1 
ATOM   218  C  CB  . GLU A 1 53  ? -32.100 -37.620 4.791   1.00 19.15 ? 68   GLU B CB  1 
ATOM   219  C  CG  . GLU A 1 53  ? -31.317 -38.575 3.883   1.00 19.17 ? 68   GLU B CG  1 
ATOM   220  C  CD  . GLU A 1 53  ? -30.139 -39.261 4.553   1.00 18.96 ? 68   GLU B CD  1 
ATOM   221  O  OE1 . GLU A 1 53  ? -29.293 -39.816 3.813   1.00 20.63 ? 68   GLU B OE1 1 
ATOM   222  O  OE2 . GLU A 1 53  ? -30.050 -39.243 5.801   1.00 21.46 ? 68   GLU B OE2 1 
ATOM   223  N  N   . GLY A 1 54  ? -34.369 -34.807 4.590   1.00 19.64 ? 69   GLY B N   1 
ATOM   224  C  CA  . GLY A 1 54  ? -35.362 -34.031 5.313   1.00 18.12 ? 69   GLY B CA  1 
ATOM   225  C  C   . GLY A 1 54  ? -34.767 -33.086 6.337   1.00 18.19 ? 69   GLY B C   1 
ATOM   226  O  O   . GLY A 1 54  ? -33.715 -33.356 6.914   1.00 18.93 ? 69   GLY B O   1 
ATOM   227  N  N   . LYS A 1 55  ? -35.447 -31.967 6.559   1.00 18.29 ? 70   LYS B N   1 
ATOM   228  C  CA  . LYS A 1 55  ? -34.990 -30.969 7.515   0.96 18.91 ? 70   LYS B CA  1 
ATOM   229  C  C   . LYS A 1 55  ? -34.786 -31.562 8.896   1.00 18.59 ? 70   LYS B C   1 
ATOM   230  O  O   . LYS A 1 55  ? -35.535 -32.444 9.328   1.00 19.84 ? 70   LYS B O   1 
ATOM   231  C  CB  . LYS A 1 55  ? -36.007 -29.829 7.633   1.00 22.11 ? 70   LYS B CB  1 
ATOM   232  C  CG  . LYS A 1 55  ? -36.131 -28.936 6.421   0.66 20.69 ? 70   LYS B CG  1 
ATOM   233  C  CD  . LYS A 1 55  ? -36.981 -27.716 6.764   0.59 22.47 ? 70   LYS B CD  1 
ATOM   234  C  CE  . LYS A 1 55  ? -36.698 -26.547 5.827   0.41 22.23 ? 70   LYS B CE  1 
ATOM   235  N  NZ  . LYS A 1 55  ? -37.075 -25.238 6.446   1.00 32.06 ? 70   LYS B NZ  1 
ATOM   236  N  N   . ILE A 1 56  ? -33.772 -31.065 9.595   1.00 16.51 ? 71   ILE B N   1 
ATOM   237  C  CA  . ILE A 1 56  ? -33.612 -31.376 11.007  1.00 16.61 ? 71   ILE B CA  1 
ATOM   238  C  C   . ILE A 1 56  ? -34.015 -30.161 11.824  1.00 18.81 ? 71   ILE B C   1 
ATOM   239  O  O   . ILE A 1 56  ? -33.413 -29.091 11.703  1.00 18.38 ? 71   ILE B O   1 
ATOM   240  C  CB  . ILE A 1 56  ? -32.161 -31.767 11.340  1.00 17.20 ? 71   ILE B CB  1 
ATOM   241  C  CG1 . ILE A 1 56  ? -31.811 -33.095 10.665  1.00 18.57 ? 71   ILE B CG1 1 
ATOM   242  C  CG2 . ILE A 1 56  ? -31.953 -31.818 12.855  1.00 20.09 ? 71   ILE B CG2 1 
ATOM   243  C  CD1 . ILE A 1 56  ? -30.360 -33.485 10.815  1.00 19.20 ? 71   ILE B CD1 1 
ATOM   244  N  N   . ALA A 1 57  ? -35.060 -30.322 12.629  1.00 20.28 ? 72   ALA B N   1 
ATOM   245  C  CA  . ALA A 1 57  ? -35.478 -29.279 13.553  1.00 22.39 ? 72   ALA B CA  1 
ATOM   246  C  C   . ALA A 1 57  ? -34.864 -29.509 14.927  1.00 24.57 ? 72   ALA B C   1 
ATOM   247  O  O   . ALA A 1 57  ? -34.595 -30.648 15.325  1.00 23.43 ? 72   ALA B O   1 
ATOM   248  C  CB  . ALA A 1 57  ? -36.997 -29.223 13.648  1.00 24.23 ? 72   ALA B CB  1 
ATOM   249  N  N   . ARG A 1 58  ? -34.643 -28.416 15.646  1.00 22.83 ? 73   ARG B N   1 
ATOM   250  C  CA  . ARG A 1 58  ? -34.045 -28.472 16.968  1.00 25.62 ? 73   ARG B CA  1 
ATOM   251  C  C   . ARG A 1 58  ? -34.784 -29.461 17.871  1.00 27.56 ? 73   ARG B C   1 
ATOM   252  O  O   . ARG A 1 58  ? -34.172 -30.137 18.699  1.00 29.27 ? 73   ARG B O   1 
ATOM   253  C  CB  . ARG A 1 58  ? -34.045 -27.074 17.592  1.00 28.06 ? 73   ARG B CB  1 
ATOM   254  C  CG  . ARG A 1 58  ? -33.088 -26.909 18.750  1.00 30.11 ? 73   ARG B CG  1 
ATOM   255  C  CD  . ARG A 1 58  ? -32.934 -25.443 19.127  1.00 30.90 ? 73   ARG B CD  1 
ATOM   256  N  NE  . ARG A 1 58  ? -32.083 -24.712 18.187  1.00 28.05 ? 73   ARG B NE  1 
ATOM   257  C  CZ  . ARG A 1 58  ? -30.773 -24.550 18.338  1.00 28.62 ? 73   ARG B CZ  1 
ATOM   258  N  NH1 . ARG A 1 58  ? -30.154 -25.068 19.391  1.00 31.06 ? 73   ARG B NH1 1 
ATOM   259  N  NH2 . ARG A 1 58  ? -30.080 -23.866 17.439  1.00 26.21 ? 73   ARG B NH2 1 
ATOM   260  N  N   . SER A 1 59  ? -36.097 -29.557 17.689  1.00 27.88 ? 74   SER B N   1 
ATOM   261  C  CA  . SER A 1 59  ? -36.938 -30.393 18.541  1.00 30.03 ? 74   SER B CA  1 
ATOM   262  C  C   . SER A 1 59  ? -37.013 -31.849 18.089  1.00 28.27 ? 74   SER B C   1 
ATOM   263  O  O   . SER A 1 59  ? -37.588 -32.691 18.782  1.00 32.51 ? 74   SER B O   1 
ATOM   264  C  CB  . SER A 1 59  ? -38.353 -29.820 18.593  1.00 28.87 ? 74   SER B CB  1 
ATOM   265  O  OG  . SER A 1 59  ? -38.972 -29.915 17.321  1.00 31.91 ? 74   SER B OG  1 
ATOM   266  N  N   . SER A 1 60  ? -36.438 -32.151 16.929  1.00 28.71 ? 75   SER B N   1 
ATOM   267  C  CA  . SER A 1 60  ? -36.589 -33.472 16.331  1.00 27.13 ? 75   SER B CA  1 
ATOM   268  C  C   . SER A 1 60  ? -35.572 -34.482 16.855  1.00 26.63 ? 75   SER B C   1 
ATOM   269  O  O   . SER A 1 60  ? -34.542 -34.115 17.418  1.00 25.26 ? 75   SER B O   1 
ATOM   270  C  CB  . SER A 1 60  ? -36.474 -33.380 14.811  1.00 25.65 ? 75   SER B CB  1 
ATOM   271  O  OG  . SER A 1 60  ? -35.125 -33.199 14.421  1.00 26.25 ? 75   SER B OG  1 
ATOM   272  N  N   . GLU A 1 61  ? -35.869 -35.760 16.651  1.00 26.01 ? 76   GLU B N   1 
ATOM   273  C  CA  . GLU A 1 61  ? -34.969 -36.828 17.057  1.00 27.79 ? 76   GLU B CA  1 
ATOM   274  C  C   . GLU A 1 61  ? -33.648 -36.748 16.302  1.00 25.68 ? 76   GLU B C   1 
ATOM   275  O  O   . GLU A 1 61  ? -32.589 -37.013 16.865  1.00 25.50 ? 76   GLU B O   1 
ATOM   276  C  CB  . GLU A 1 61  ? -35.630 -38.191 16.830  1.00 30.02 ? 76   GLU B CB  1 
ATOM   277  C  CG  . GLU A 1 61  ? -36.493 -38.645 17.996  1.00 32.93 ? 76   GLU B CG  1 
ATOM   278  C  CD  . GLU A 1 61  ? -35.662 -39.005 19.213  1.00 37.09 ? 76   GLU B CD  1 
ATOM   279  O  OE1 . GLU A 1 61  ? -34.883 -39.981 19.132  1.00 39.28 ? 76   GLU B OE1 1 
ATOM   280  O  OE2 . GLU A 1 61  ? -35.788 -38.318 20.249  1.00 40.11 ? 76   GLU B OE2 1 
ATOM   281  N  N   . ARG A 1 62  ? -33.711 -36.374 15.027  1.00 23.94 ? 77   ARG B N   1 
ATOM   282  C  CA  . ARG A 1 62  ? -32.510 -36.307 14.206  1.00 22.90 ? 77   ARG B CA  1 
ATOM   283  C  C   . ARG A 1 62  ? -31.598 -35.140 14.588  1.00 21.86 ? 77   ARG B C   1 
ATOM   284  O  O   . ARG A 1 62  ? -30.498 -35.011 14.054  1.00 19.56 ? 77   ARG B O   1 
ATOM   285  C  CB  . ARG A 1 62  ? -32.863 -36.286 12.712  1.00 23.54 ? 77   ARG B CB  1 
ATOM   286  C  CG  . ARG A 1 62  ? -33.088 -37.687 12.145  1.00 24.49 ? 77   ARG B CG  1 
ATOM   287  C  CD  . ARG A 1 62  ? -33.756 -37.684 10.778  1.00 23.78 ? 77   ARG B CD  1 
ATOM   288  N  NE  . ARG A 1 62  ? -32.896 -37.155 9.722   1.00 22.01 ? 77   ARG B NE  1 
ATOM   289  C  CZ  . ARG A 1 62  ? -33.139 -36.030 9.056   1.00 21.33 ? 77   ARG B CZ  1 
ATOM   290  N  NH1 . ARG A 1 62  ? -34.217 -35.315 9.342   1.00 22.58 ? 77   ARG B NH1 1 
ATOM   291  N  NH2 . ARG A 1 62  ? -32.309 -35.625 8.105   1.00 21.74 ? 77   ARG B NH2 1 
ATOM   292  N  N   . PHE A 1 63  ? -32.047 -34.304 15.519  1.00 19.98 ? 78   PHE B N   1 
ATOM   293  C  CA  . PHE A 1 63  ? -31.185 -33.247 16.036  1.00 21.57 ? 78   PHE B CA  1 
ATOM   294  C  C   . PHE A 1 63  ? -29.918 -33.842 16.654  1.00 21.95 ? 78   PHE B C   1 
ATOM   295  O  O   . PHE A 1 63  ? -28.867 -33.211 16.637  1.00 21.79 ? 78   PHE B O   1 
ATOM   296  C  CB  . PHE A 1 63  ? -31.925 -32.372 17.055  1.00 20.32 ? 78   PHE B CB  1 
ATOM   297  C  CG  . PHE A 1 63  ? -31.078 -31.272 17.641  1.00 24.55 ? 78   PHE B CG  1 
ATOM   298  C  CD1 . PHE A 1 63  ? -30.689 -30.187 16.867  1.00 25.04 ? 78   PHE B CD1 1 
ATOM   299  C  CD2 . PHE A 1 63  ? -30.674 -31.320 18.967  1.00 25.12 ? 78   PHE B CD2 1 
ATOM   300  C  CE1 . PHE A 1 63  ? -29.909 -29.170 17.406  1.00 26.14 ? 78   PHE B CE1 1 
ATOM   301  C  CE2 . PHE A 1 63  ? -29.895 -30.310 19.513  1.00 27.63 ? 78   PHE B CE2 1 
ATOM   302  C  CZ  . PHE A 1 63  ? -29.513 -29.232 18.731  1.00 29.44 ? 78   PHE B CZ  1 
ATOM   303  N  N   . LYS A 1 64  ? -29.999 -35.059 17.190  1.00 22.43 ? 79   LYS B N   1 
ATOM   304  C  CA  . LYS A 1 64  ? -28.794 -35.665 17.763  1.00 22.26 ? 79   LYS B CA  1 
ATOM   305  C  C   . LYS A 1 64  ? -27.793 -36.154 16.714  1.00 22.28 ? 79   LYS B C   1 
ATOM   306  O  O   . LYS A 1 64  ? -26.716 -36.648 17.056  1.00 23.90 ? 79   LYS B O   1 
ATOM   307  C  CB  . LYS A 1 64  ? -29.107 -36.758 18.798  1.00 27.89 ? 79   LYS B CB  1 
ATOM   308  C  CG  . LYS A 1 64  ? -30.498 -37.332 18.747  1.00 30.67 ? 79   LYS B CG  1 
ATOM   309  C  CD  . LYS A 1 64  ? -30.826 -38.069 20.049  1.00 27.33 ? 79   LYS B CD  1 
ATOM   310  C  CE  . LYS A 1 64  ? -32.000 -39.004 19.855  1.00 29.72 ? 79   LYS B CE  1 
ATOM   311  N  NZ  . LYS A 1 64  ? -31.771 -39.918 18.698  1.00 35.29 ? 79   LYS B NZ  1 
ATOM   312  N  N   . GLU A 1 65  ? -28.143 -35.996 15.443  1.00 18.79 ? 80   GLU B N   1 
ATOM   313  C  CA  . GLU A 1 65  ? -27.209 -36.263 14.356  1.00 22.00 ? 80   GLU B CA  1 
ATOM   314  C  C   . GLU A 1 65  ? -26.152 -35.167 14.330  1.00 21.54 ? 80   GLU B C   1 
ATOM   315  O  O   . GLU A 1 65  ? -25.085 -35.330 13.732  1.00 22.63 ? 80   GLU B O   1 
ATOM   316  C  CB  . GLU A 1 65  ? -27.945 -36.285 13.013  1.00 23.93 ? 80   GLU B CB  1 
ATOM   317  C  CG  . GLU A 1 65  ? -28.879 -37.476 12.820  1.00 26.58 ? 80   GLU B CG  1 
ATOM   318  C  CD  . GLU A 1 65  ? -28.145 -38.705 12.324  1.00 27.92 ? 80   GLU B CD  1 
ATOM   319  O  OE1 . GLU A 1 65  ? -27.706 -38.707 11.155  1.00 29.61 ? 80   GLU B OE1 1 
ATOM   320  O  OE2 . GLU A 1 65  ? -28.007 -39.672 13.101  1.00 37.13 ? 80   GLU B OE2 1 
ATOM   321  N  N   . LEU A 1 66  ? -26.466 -34.048 14.980  1.00 19.97 ? 81   LEU B N   1 
ATOM   322  C  CA  . LEU A 1 66  ? -25.612 -32.867 14.940  1.00 18.92 ? 81   LEU B CA  1 
ATOM   323  C  C   . LEU A 1 66  ? -24.727 -32.730 16.170  1.00 20.15 ? 81   LEU B C   1 
ATOM   324  O  O   . LEU A 1 66  ? -25.160 -32.944 17.305  1.00 23.16 ? 81   LEU B O   1 
ATOM   325  C  CB  . LEU A 1 66  ? -26.452 -31.596 14.753  1.00 18.27 ? 81   LEU B CB  1 
ATOM   326  C  CG  . LEU A 1 66  ? -27.417 -31.657 13.566  1.00 18.64 ? 81   LEU B CG  1 
ATOM   327  C  CD1 . LEU A 1 66  ? -28.185 -30.348 13.385  1.00 20.98 ? 81   LEU B CD1 1 
ATOM   328  C  CD2 . LEU A 1 66  ? -26.667 -32.031 12.296  1.00 19.01 ? 81   LEU B CD2 1 
ATOM   329  N  N   . THR A 1 67  ? -23.484 -32.344 15.923  1.00 19.43 ? 82   THR B N   1 
ATOM   330  C  CA  . THR A 1 67  ? -22.498 -32.158 16.972  1.00 22.56 ? 82   THR B CA  1 
ATOM   331  C  C   . THR A 1 67  ? -21.845 -30.795 16.747  1.00 21.10 ? 82   THR B C   1 
ATOM   332  O  O   . THR A 1 67  ? -21.544 -30.439 15.613  1.00 19.00 ? 82   THR B O   1 
ATOM   333  C  CB  . THR A 1 67  ? -21.440 -33.287 16.917  1.00 22.74 ? 82   THR B CB  1 
ATOM   334  O  OG1 . THR A 1 67  ? -20.446 -33.081 17.925  1.00 26.43 ? 82   THR B OG1 1 
ATOM   335  C  CG2 . THR A 1 67  ? -20.765 -33.352 15.540  1.00 24.23 ? 82   THR B CG2 1 
ATOM   336  N  N   . PRO A 1 68  ? -21.633 -30.021 17.823  1.00 19.91 ? 83   PRO B N   1 
ATOM   337  C  CA  . PRO A 1 68  ? -21.011 -28.698 17.677  1.00 18.38 ? 83   PRO B CA  1 
ATOM   338  C  C   . PRO A 1 68  ? -19.520 -28.800 17.359  1.00 19.17 ? 83   PRO B C   1 
ATOM   339  O  O   . PRO A 1 68  ? -18.803 -29.595 17.969  1.00 21.56 ? 83   PRO B O   1 
ATOM   340  C  CB  . PRO A 1 68  ? -21.194 -28.062 19.065  1.00 23.95 ? 83   PRO B CB  1 
ATOM   341  C  CG  . PRO A 1 68  ? -22.149 -28.955 19.803  1.00 25.66 ? 83   PRO B CG  1 
ATOM   342  C  CD  . PRO A 1 68  ? -21.984 -30.316 19.221  1.00 25.17 ? 83   PRO B CD  1 
ATOM   343  N  N   . ASN A 1 69  ? -19.063 -27.997 16.405  1.00 16.80 ? 84   ASN B N   1 
ATOM   344  C  CA  . ASN A 1 69  ? -17.645 -27.929 16.085  1.00 16.67 ? 84   ASN B CA  1 
ATOM   345  C  C   . ASN A 1 69  ? -17.027 -26.705 16.754  1.00 17.11 ? 84   ASN B C   1 
ATOM   346  O  O   . ASN A 1 69  ? -17.395 -25.578 16.441  1.00 18.08 ? 84   ASN B O   1 
ATOM   347  C  CB  . ASN A 1 69  ? -17.456 -27.862 14.567  1.00 16.60 ? 84   ASN B CB  1 
ATOM   348  C  CG  . ASN A 1 69  ? -16.005 -27.999 14.152  1.00 18.83 ? 84   ASN B CG  1 
ATOM   349  O  OD1 . ASN A 1 69  ? -15.104 -27.605 14.882  1.00 20.98 ? 84   ASN B OD1 1 
ATOM   350  N  ND2 . ASN A 1 69  ? -15.774 -28.557 12.970  1.00 17.91 ? 84   ASN B ND2 1 
ATOM   351  N  N   . TYR A 1 70  ? -16.108 -26.934 17.693  1.00 18.21 ? 85   TYR B N   1 
ATOM   352  C  CA  . TYR A 1 70  ? -15.407 -25.844 18.372  1.00 17.67 ? 85   TYR B CA  1 
ATOM   353  C  C   . TYR A 1 70  ? -13.909 -25.855 18.080  1.00 19.09 ? 85   TYR B C   1 
ATOM   354  O  O   . TYR A 1 70  ? -13.091 -25.504 18.928  1.00 22.24 ? 85   TYR B O   1 
ATOM   355  C  CB  . TYR A 1 70  ? -15.668 -25.866 19.889  1.00 17.45 ? 85   TYR B CB  1 
ATOM   356  C  CG  . TYR A 1 70  ? -16.992 -25.235 20.259  1.00 18.18 ? 85   TYR B CG  1 
ATOM   357  C  CD1 . TYR A 1 70  ? -17.134 -23.851 20.293  1.00 18.05 ? 85   TYR B CD1 1 
ATOM   358  C  CD2 . TYR A 1 70  ? -18.103 -26.016 20.551  1.00 18.02 ? 85   TYR B CD2 1 
ATOM   359  C  CE1 . TYR A 1 70  ? -18.346 -23.264 20.614  1.00 19.23 ? 85   TYR B CE1 1 
ATOM   360  C  CE2 . TYR A 1 70  ? -19.318 -25.437 20.878  1.00 20.24 ? 85   TYR B CE2 1 
ATOM   361  C  CZ  . TYR A 1 70  ? -19.433 -24.065 20.902  1.00 20.60 ? 85   TYR B CZ  1 
ATOM   362  O  OH  . TYR A 1 70  ? -20.645 -23.496 21.225  1.00 28.11 ? 85   TYR B OH  1 
ATOM   363  N  N   . ASN A 1 71  ? -13.558 -26.243 16.862  1.00 19.00 ? 86   ASN B N   1 
ATOM   364  C  CA  . ASN A 1 71  ? -12.174 -26.206 16.417  1.00 18.49 ? 86   ASN B CA  1 
ATOM   365  C  C   . ASN A 1 71  ? -11.622 -24.789 16.553  1.00 19.01 ? 86   ASN B C   1 
ATOM   366  O  O   . ASN A 1 71  ? -12.151 -23.860 15.951  1.00 18.41 ? 86   ASN B O   1 
ATOM   367  C  CB  . ASN A 1 71  ? -12.121 -26.661 14.956  1.00 19.28 ? 86   ASN B CB  1 
ATOM   368  C  CG  . ASN A 1 71  ? -10.707 -26.836 14.438  1.00 19.39 ? 86   ASN B CG  1 
ATOM   369  O  OD1 . ASN A 1 71  ? -9.759  -26.226 14.935  1.00 20.50 ? 86   ASN B OD1 1 
ATOM   370  N  ND2 . ASN A 1 71  ? -10.564 -27.666 13.416  1.00 20.34 ? 86   ASN B ND2 1 
ATOM   371  N  N   . PRO A 1 72  ? -10.560 -24.615 17.361  1.00 20.24 ? 87   PRO B N   1 
ATOM   372  C  CA  . PRO A 1 72  ? -9.974  -23.285 17.575  1.00 22.85 ? 87   PRO B CA  1 
ATOM   373  C  C   . PRO A 1 72  ? -9.487  -22.629 16.283  1.00 20.75 ? 87   PRO B C   1 
ATOM   374  O  O   . PRO A 1 72  ? -9.328  -21.407 16.231  1.00 23.73 ? 87   PRO B O   1 
ATOM   375  C  CB  . PRO A 1 72  ? -8.772  -23.573 18.492  1.00 23.23 ? 87   PRO B CB  1 
ATOM   376  C  CG  . PRO A 1 72  ? -9.058  -24.888 19.118  1.00 24.16 ? 87   PRO B CG  1 
ATOM   377  C  CD  . PRO A 1 72  ? -9.846  -25.666 18.107  1.00 21.99 ? 87   PRO B CD  1 
ATOM   378  N  N   . ASP A 1 73  ? -9.255  -23.434 15.252  1.00 19.97 ? 88   ASP B N   1 
ATOM   379  C  CA  . ASP A 1 73  ? -8.695  -22.924 14.005  1.00 21.64 ? 88   ASP B CA  1 
ATOM   380  C  C   . ASP A 1 73  ? -9.752  -22.649 12.935  1.00 20.65 ? 88   ASP B C   1 
ATOM   381  O  O   . ASP A 1 73  ? -9.417  -22.470 11.764  1.00 18.75 ? 88   ASP B O   1 
ATOM   382  C  CB  . ASP A 1 73  ? -7.625  -23.879 13.474  1.00 20.88 ? 88   ASP B CB  1 
ATOM   383  C  CG  . ASP A 1 73  ? -6.400  -23.937 14.373  1.00 24.93 ? 88   ASP B CG  1 
ATOM   384  O  OD1 . ASP A 1 73  ? -6.133  -22.945 15.084  1.00 27.48 ? 88   ASP B OD1 1 
ATOM   385  O  OD2 . ASP A 1 73  ? -5.706  -24.974 14.358  1.00 29.50 ? 88   ASP B OD2 1 
ATOM   386  N  N   . ILE A 1 74  ? -11.023 -22.624 13.332  1.00 17.62 ? 89   ILE B N   1 
ATOM   387  C  CA  . ILE A 1 74  ? -12.094 -22.249 12.413  1.00 18.64 ? 89   ILE B CA  1 
ATOM   388  C  C   . ILE A 1 74  ? -12.879 -21.076 12.972  1.00 17.73 ? 89   ILE B C   1 
ATOM   389  O  O   . ILE A 1 74  ? -13.240 -21.068 14.148  1.00 18.67 ? 89   ILE B O   1 
ATOM   390  C  CB  . ILE A 1 74  ? -13.065 -23.411 12.147  1.00 17.00 ? 89   ILE B CB  1 
ATOM   391  C  CG1 . ILE A 1 74  ? -12.305 -24.634 11.618  1.00 17.36 ? 89   ILE B CG1 1 
ATOM   392  C  CG2 . ILE A 1 74  ? -14.154 -22.980 11.152  1.00 17.07 ? 89   ILE B CG2 1 
ATOM   393  C  CD1 . ILE A 1 74  ? -13.174 -25.868 11.445  1.00 16.91 ? 89   ILE B CD1 1 
ATOM   394  N  N   . ILE A 1 75  ? -13.123 -20.083 12.126  1.00 17.43 ? 90   ILE B N   1 
ATOM   395  C  CA  . ILE A 1 75  ? -13.926 -18.924 12.493  1.00 16.12 ? 90   ILE B CA  1 
ATOM   396  C  C   . ILE A 1 75  ? -15.364 -19.181 12.073  1.00 17.57 ? 90   ILE B C   1 
ATOM   397  O  O   . ILE A 1 75  ? -15.613 -19.536 10.920  1.00 17.91 ? 90   ILE B O   1 
ATOM   398  C  CB  . ILE A 1 75  ? -13.429 -17.653 11.770  1.00 18.31 ? 90   ILE B CB  1 
ATOM   399  C  CG1 . ILE A 1 75  ? -11.940 -17.419 12.054  1.00 23.07 ? 90   ILE B CG1 1 
ATOM   400  C  CG2 . ILE A 1 75  ? -14.289 -16.441 12.135  1.00 20.26 ? 90   ILE B CG2 1 
ATOM   401  C  CD1 . ILE A 1 75  ? -11.590 -17.357 13.522  1.00 25.82 ? 90   ILE B CD1 1 
ATOM   402  N  N   . PHE A 1 76  ? -16.306 -19.012 12.999  1.00 17.20 ? 91   PHE B N   1 
ATOM   403  C  CA  . PHE A 1 76  ? -17.724 -19.120 12.664  1.00 14.98 ? 91   PHE B CA  1 
ATOM   404  C  C   . PHE A 1 76  ? -18.392 -17.754 12.746  1.00 17.28 ? 91   PHE B C   1 
ATOM   405  O  O   . PHE A 1 76  ? -18.361 -17.106 13.787  1.00 18.56 ? 91   PHE B O   1 
ATOM   406  C  CB  . PHE A 1 76  ? -18.440 -20.124 13.575  1.00 17.16 ? 91   PHE B CB  1 
ATOM   407  C  CG  . PHE A 1 76  ? -18.053 -21.555 13.319  1.00 16.33 ? 91   PHE B CG  1 
ATOM   408  C  CD1 . PHE A 1 76  ? -18.825 -22.354 12.493  1.00 16.76 ? 91   PHE B CD1 1 
ATOM   409  C  CD2 . PHE A 1 76  ? -16.909 -22.091 13.884  1.00 17.12 ? 91   PHE B CD2 1 
ATOM   410  C  CE1 . PHE A 1 76  ? -18.480 -23.673 12.254  1.00 17.43 ? 91   PHE B CE1 1 
ATOM   411  C  CE2 . PHE A 1 76  ? -16.553 -23.408 13.645  1.00 16.62 ? 91   PHE B CE2 1 
ATOM   412  C  CZ  . PHE A 1 76  ? -17.340 -24.198 12.817  1.00 15.76 ? 91   PHE B CZ  1 
ATOM   413  N  N   . LYS A 1 77  ? -18.985 -17.322 11.639  1.00 17.04 ? 92   LYS B N   1 
ATOM   414  C  CA  . LYS A 1 77  ? -19.670 -16.032 11.564  1.00 16.40 ? 92   LYS B CA  1 
ATOM   415  C  C   . LYS A 1 77  ? -20.827 -15.902 12.566  1.00 18.62 ? 92   LYS B C   1 
ATOM   416  O  O   . LYS A 1 77  ? -21.030 -14.837 13.154  1.00 19.22 ? 92   LYS B O   1 
ATOM   417  C  CB  . LYS A 1 77  ? -20.167 -15.803 10.135  1.00 17.54 ? 92   LYS B CB  1 
ATOM   418  C  CG  . LYS A 1 77  ? -20.731 -14.418 9.853   1.00 18.93 ? 92   LYS B CG  1 
ATOM   419  C  CD  . LYS A 1 77  ? -21.115 -14.285 8.385   1.00 20.19 ? 92   LYS B CD  1 
ATOM   420  C  CE  . LYS A 1 77  ? -21.366 -12.836 8.002   1.00 25.38 ? 92   LYS B CE  1 
ATOM   421  N  NZ  . LYS A 1 77  ? -22.606 -12.316 8.616   1.00 30.28 ? 92   LYS B NZ  1 
ATOM   422  N  N   . ASP A 1 78  ? -21.591 -16.975 12.748  1.00 18.11 ? 93   ASP B N   1 
ATOM   423  C  CA  . ASP A 1 78  ? -22.710 -16.968 13.690  1.00 18.70 ? 93   ASP B CA  1 
ATOM   424  C  C   . ASP A 1 78  ? -23.613 -15.750 13.472  1.00 20.34 ? 93   ASP B C   1 
ATOM   425  O  O   . ASP A 1 78  ? -23.955 -15.051 14.423  1.00 20.15 ? 93   ASP B O   1 
ATOM   426  C  CB  . ASP A 1 78  ? -22.186 -16.988 15.131  1.00 19.56 ? 93   ASP B CB  1 
ATOM   427  C  CG  . ASP A 1 78  ? -23.280 -17.232 16.152  1.00 22.11 ? 93   ASP B CG  1 
ATOM   428  O  OD1 . ASP A 1 78  ? -24.284 -17.884 15.808  1.00 19.57 ? 93   ASP B OD1 1 
ATOM   429  O  OD2 . ASP A 1 78  ? -23.135 -16.768 17.308  1.00 23.77 ? 93   ASP B OD2 1 
ATOM   430  N  N   . GLU A 1 79  ? -24.005 -15.500 12.226  1.00 19.42 ? 94   GLU B N   1 
ATOM   431  C  CA  . GLU A 1 79  ? -24.722 -14.263 11.910  1.00 21.32 ? 94   GLU B CA  1 
ATOM   432  C  C   . GLU A 1 79  ? -26.126 -14.193 12.512  1.00 21.56 ? 94   GLU B C   1 
ATOM   433  O  O   . GLU A 1 79  ? -26.680 -13.105 12.667  1.00 22.81 ? 94   GLU B O   1 
ATOM   434  C  CB  . GLU A 1 79  ? -24.747 -13.985 10.396  1.00 24.20 ? 94   GLU B CB  1 
ATOM   435  C  CG  . GLU A 1 79  ? -25.743 -14.810 9.604   1.00 22.84 ? 94   GLU B CG  1 
ATOM   436  C  CD  . GLU A 1 79  ? -25.749 -14.473 8.112   1.00 22.14 ? 94   GLU B CD  1 
ATOM   437  O  OE1 . GLU A 1 79  ? -26.647 -14.968 7.406   1.00 24.12 ? 94   GLU B OE1 1 
ATOM   438  O  OE2 . GLU A 1 79  ? -24.866 -13.722 7.646   1.00 23.16 ? 94   GLU B OE2 1 
ATOM   439  N  N   . LYS A 1 80  ? -26.702 -15.342 12.856  1.00 21.04 ? 95   LYS B N   1 
ATOM   440  C  CA  . LYS A 1 80  ? -28.019 -15.354 13.490  1.00 22.21 ? 95   LYS B CA  1 
ATOM   441  C  C   . LYS A 1 80  ? -27.945 -15.442 15.016  1.00 22.89 ? 95   LYS B C   1 
ATOM   442  O  O   . LYS A 1 80  ? -28.974 -15.495 15.689  1.00 23.70 ? 95   LYS B O   1 
ATOM   443  C  CB  . LYS A 1 80  ? -28.885 -16.482 12.924  1.00 26.30 ? 95   LYS B CB  1 
ATOM   444  C  CG  . LYS A 1 80  ? -29.262 -16.264 11.467  1.00 24.79 ? 95   LYS B CG  1 
ATOM   445  C  CD  . LYS A 1 80  ? -30.258 -17.294 10.979  1.00 27.53 ? 95   LYS B CD  1 
ATOM   446  C  CE  . LYS A 1 80  ? -29.648 -18.683 10.948  1.00 23.83 ? 95   LYS B CE  1 
ATOM   447  N  NZ  . LYS A 1 80  ? -30.443 -19.578 10.056  1.00 20.29 ? 95   LYS B NZ  1 
ATOM   448  N  N   . ASN A 1 81  ? -26.727 -15.456 15.551  1.00 21.26 ? 96   ASN B N   1 
ATOM   449  C  CA  . ASN A 1 81  ? -26.512 -15.431 16.996  1.00 22.71 ? 96   ASN B CA  1 
ATOM   450  C  C   . ASN A 1 81  ? -27.158 -16.600 17.744  1.00 23.42 ? 96   ASN B C   1 
ATOM   451  O  O   . ASN A 1 81  ? -27.628 -16.443 18.877  1.00 23.69 ? 96   ASN B O   1 
ATOM   452  C  CB  . ASN A 1 81  ? -27.003 -14.104 17.581  1.00 23.33 ? 96   ASN B CB  1 
ATOM   453  C  CG  . ASN A 1 81  ? -26.448 -13.840 18.966  1.00 26.07 ? 96   ASN B CG  1 
ATOM   454  O  OD1 . ASN A 1 81  ? -25.266 -14.076 19.233  1.00 30.25 ? 96   ASN B OD1 1 
ATOM   455  N  ND2 . ASN A 1 81  ? -27.295 -13.335 19.852  1.00 28.96 ? 96   ASN B ND2 1 
ATOM   456  N  N   . THR A 1 82  ? -27.181 -17.771 17.111  1.00 20.68 ? 97   THR B N   1 
ATOM   457  C  CA  . THR A 1 82  ? -27.734 -18.970 17.735  1.00 21.16 ? 97   THR B CA  1 
ATOM   458  C  C   . THR A 1 82  ? -26.695 -20.083 17.907  1.00 21.40 ? 97   THR B C   1 
ATOM   459  O  O   . THR A 1 82  ? -26.958 -21.075 18.586  1.00 21.34 ? 97   THR B O   1 
ATOM   460  C  CB  . THR A 1 82  ? -28.873 -19.565 16.896  1.00 19.73 ? 97   THR B CB  1 
ATOM   461  O  OG1 . THR A 1 82  ? -28.366 -19.895 15.596  1.00 19.66 ? 97   THR B OG1 1 
ATOM   462  C  CG2 . THR A 1 82  ? -30.028 -18.579 16.757  1.00 21.06 ? 97   THR B CG2 1 
ATOM   463  N  N   . GLY A 1 83  ? -25.534 -19.927 17.274  1.00 20.07 ? 98   GLY B N   1 
ATOM   464  C  CA  . GLY A 1 83  ? -24.515 -20.965 17.252  1.00 19.37 ? 98   GLY B CA  1 
ATOM   465  C  C   . GLY A 1 83  ? -24.847 -22.120 16.319  1.00 18.22 ? 98   GLY B C   1 
ATOM   466  O  O   . GLY A 1 83  ? -24.150 -23.136 16.313  1.00 17.90 ? 98   GLY B O   1 
ATOM   467  N  N   . ALA A 1 84  ? -25.909 -21.971 15.532  1.00 17.31 ? 99   ALA B N   1 
ATOM   468  C  CA  . ALA A 1 84  ? -26.353 -23.044 14.635  1.00 17.46 ? 99   ALA B CA  1 
ATOM   469  C  C   . ALA A 1 84  ? -25.317 -23.415 13.574  1.00 18.61 ? 99   ALA B C   1 
ATOM   470  O  O   . ALA A 1 84  ? -25.296 -24.552 13.094  1.00 18.49 ? 99   ALA B O   1 
ATOM   471  C  CB  . ALA A 1 84  ? -27.677 -22.676 13.970  1.00 18.52 ? 99   ALA B CB  1 
ATOM   472  N  N   . ASP A 1 85  ? -24.459 -22.472 13.200  1.00 16.74 ? 100  ASP B N   1 
ATOM   473  C  CA  . ASP A 1 85  ? -23.495 -22.757 12.141  1.00 16.43 ? 100  ASP B CA  1 
ATOM   474  C  C   . ASP A 1 85  ? -22.401 -23.746 12.570  1.00 17.19 ? 100  ASP B C   1 
ATOM   475  O  O   . ASP A 1 85  ? -21.721 -24.319 11.718  1.00 18.86 ? 100  ASP B O   1 
ATOM   476  C  CB  . ASP A 1 85  ? -22.927 -21.478 11.485  1.00 18.03 ? 100  ASP B CB  1 
ATOM   477  C  CG  . ASP A 1 85  ? -22.185 -20.562 12.460  1.00 20.68 ? 100  ASP B CG  1 
ATOM   478  O  OD1 . ASP A 1 85  ? -21.645 -19.540 11.976  1.00 20.06 ? 100  ASP B OD1 1 
ATOM   479  O  OD2 . ASP A 1 85  ? -22.145 -20.836 13.674  1.00 22.53 ? 100  ASP B OD2 1 
ATOM   480  N  N   . ARG A 1 86  ? -22.266 -23.964 13.877  1.00 18.32 ? 101  ARG B N   1 
ATOM   481  C  CA  . ARG A 1 86  ? -21.309 -24.939 14.401  1.00 16.25 ? 101  ARG B CA  1 
ATOM   482  C  C   . ARG A 1 86  ? -21.864 -26.351 14.429  1.00 16.43 ? 101  ARG B C   1 
ATOM   483  O  O   . ARG A 1 86  ? -21.109 -27.308 14.577  1.00 18.39 ? 101  ARG B O   1 
ATOM   484  C  CB  . ARG A 1 86  ? -20.879 -24.579 15.824  1.00 17.38 ? 101  ARG B CB  1 
ATOM   485  C  CG  . ARG A 1 86  ? -20.105 -23.304 15.923  1.00 19.86 ? 101  ARG B CG  1 
ATOM   486  C  CD  . ARG A 1 86  ? -19.755 -23.012 17.365  1.00 19.06 ? 101  ARG B CD  1 
ATOM   487  N  NE  . ARG A 1 86  ? -19.017 -21.762 17.453  1.00 20.69 ? 101  ARG B NE  1 
ATOM   488  C  CZ  . ARG A 1 86  ? -17.700 -21.661 17.320  1.00 18.99 ? 101  ARG B CZ  1 
ATOM   489  N  NH1 . ARG A 1 86  ? -16.966 -22.743 17.095  1.00 18.06 ? 101  ARG B NH1 1 
ATOM   490  N  NH2 . ARG A 1 86  ? -17.115 -20.472 17.411  1.00 23.83 ? 101  ARG B NH2 1 
ATOM   491  N  N   . LEU A 1 87  ? -23.182 -26.482 14.310  1.00 17.36 ? 102  LEU B N   1 
ATOM   492  C  CA  . LEU A 1 87  ? -23.819 -27.784 14.471  1.00 16.80 ? 102  LEU B CA  1 
ATOM   493  C  C   . LEU A 1 87  ? -23.858 -28.520 13.141  1.00 17.62 ? 102  LEU B C   1 
ATOM   494  O  O   . LEU A 1 87  ? -24.457 -28.049 12.179  1.00 17.92 ? 102  LEU B O   1 
ATOM   495  C  CB  . LEU A 1 87  ? -25.231 -27.637 15.049  1.00 17.43 ? 102  LEU B CB  1 
ATOM   496  C  CG  . LEU A 1 87  ? -25.296 -27.373 16.554  1.00 18.92 ? 102  LEU B CG  1 
ATOM   497  C  CD1 . LEU A 1 87  ? -26.674 -26.864 16.964  1.00 24.23 ? 102  LEU B CD1 1 
ATOM   498  C  CD2 . LEU A 1 87  ? -24.929 -28.625 17.339  1.00 21.89 ? 102  LEU B CD2 1 
ATOM   499  N  N   . MET A 1 88  ? -23.209 -29.677 13.087  1.00 14.72 ? 103  MET B N   1 
ATOM   500  C  CA  . MET A 1 88  ? -23.053 -30.380 11.823  1.00 14.32 ? 103  MET B CA  1 
ATOM   501  C  C   . MET A 1 88  ? -22.853 -31.864 12.082  1.00 14.66 ? 103  MET B C   1 
ATOM   502  O  O   . MET A 1 88  ? -22.576 -32.271 13.211  1.00 15.73 ? 103  MET B O   1 
ATOM   503  C  CB  . MET A 1 88  ? -21.854 -29.811 11.048  1.00 15.90 ? 103  MET B CB  1 
ATOM   504  C  CG  . MET A 1 88  ? -20.516 -29.971 11.783  1.00 15.47 ? 103  MET B CG  1 
ATOM   505  S  SD  . MET A 1 88  ? -19.158 -29.061 11.016  1.00 16.46 ? 103  MET B SD  1 
ATOM   506  C  CE  . MET A 1 88  ? -19.704 -27.382 11.354  1.00 16.20 ? 103  MET B CE  1 
ATOM   507  N  N   . THR A 1 89  ? -22.987 -32.684 11.047  1.00 13.72 ? 104  THR B N   1 
ATOM   508  C  CA  . THR A 1 89  ? -22.742 -34.111 11.239  1.00 14.82 ? 104  THR B CA  1 
ATOM   509  C  C   . THR A 1 89  ? -21.256 -34.391 11.460  1.00 15.86 ? 104  THR B C   1 
ATOM   510  O  O   . THR A 1 89  ? -20.394 -33.561 11.145  1.00 15.00 ? 104  THR B O   1 
ATOM   511  C  CB  . THR A 1 89  ? -23.233 -34.938 10.043  1.00 14.63 ? 104  THR B CB  1 
ATOM   512  O  OG1 . THR A 1 89  ? -22.436 -34.617 8.897   1.00 15.31 ? 104  THR B OG1 1 
ATOM   513  C  CG2 . THR A 1 89  ? -24.708 -34.661 9.761   1.00 15.40 ? 104  THR B CG2 1 
ATOM   514  N  N   . GLN A 1 90  ? -20.958 -35.568 12.000  1.00 15.44 ? 105  GLN B N   1 
ATOM   515  C  CA  . GLN A 1 90  ? -19.573 -35.943 12.250  1.00 15.26 ? 105  GLN B CA  1 
ATOM   516  C  C   . GLN A 1 90  ? -18.727 -35.922 10.973  1.00 16.84 ? 105  GLN B C   1 
ATOM   517  O  O   . GLN A 1 90  ? -17.605 -35.417 10.983  1.00 17.82 ? 105  GLN B O   1 
ATOM   518  C  CB  . GLN A 1 90  ? -19.497 -37.318 12.917  1.00 17.59 ? 105  GLN B CB  1 
ATOM   519  C  CG  . GLN A 1 90  ? -18.096 -37.690 13.378  1.00 19.91 ? 105  GLN B CG  1 
ATOM   520  C  CD  . GLN A 1 90  ? -17.576 -36.767 14.464  1.00 20.78 ? 105  GLN B CD  1 
ATOM   521  O  OE1 . GLN A 1 90  ? -18.239 -36.554 15.482  1.00 23.54 ? 105  GLN B OE1 1 
ATOM   522  N  NE2 . GLN A 1 90  ? -16.383 -36.216 14.257  1.00 23.48 ? 105  GLN B NE2 1 
ATOM   523  N  N   . ARG A 1 91  ? -19.262 -36.457 9.875   1.00 16.04 ? 106  ARG B N   1 
ATOM   524  C  CA  . ARG A 1 91  ? -18.526 -36.446 8.616   1.00 15.16 ? 106  ARG B CA  1 
ATOM   525  C  C   . ARG A 1 91  ? -18.245 -35.013 8.156   1.00 15.70 ? 106  ARG B C   1 
ATOM   526  O  O   . ARG A 1 91  ? -17.148 -34.701 7.677   1.00 16.74 ? 106  ARG B O   1 
ATOM   527  C  CB  . ARG A 1 91  ? -19.271 -37.223 7.530   1.00 17.16 ? 106  ARG B CB  1 
ATOM   528  C  CG  . ARG A 1 91  ? -18.508 -37.294 6.218   1.00 17.81 ? 106  ARG B CG  1 
ATOM   529  C  CD  . ARG A 1 91  ? -19.247 -38.132 5.199   1.00 17.45 ? 106  ARG B CD  1 
ATOM   530  N  NE  . ARG A 1 91  ? -18.504 -38.272 3.949   1.00 20.65 ? 106  ARG B NE  1 
ATOM   531  C  CZ  . ARG A 1 91  ? -17.693 -39.288 3.664   1.00 27.13 ? 106  ARG B CZ  1 
ATOM   532  N  NH1 . ARG A 1 91  ? -17.510 -40.266 4.547   1.00 28.54 ? 106  ARG B NH1 1 
ATOM   533  N  NH2 . ARG A 1 91  ? -17.061 -39.325 2.494   1.00 28.00 ? 106  ARG B NH2 1 
ATOM   534  N  N   . CYS A 1 92  ? -19.231 -34.138 8.313   1.00 13.18 ? 107  CYS B N   1 
ATOM   535  C  CA  . CYS A 1 92  ? -19.020 -32.728 7.983   1.00 14.14 ? 107  CYS B CA  1 
ATOM   536  C  C   . CYS A 1 92  ? -17.903 -32.132 8.846   1.00 14.79 ? 107  CYS B C   1 
ATOM   537  O  O   . CYS A 1 92  ? -17.025 -31.420 8.349   1.00 15.53 ? 107  CYS B O   1 
ATOM   538  C  CB  . CYS A 1 92  ? -20.321 -31.931 8.153   1.00 14.15 ? 107  CYS B CB  1 
ATOM   539  S  SG  . CYS A 1 92  ? -20.282 -30.281 7.368   1.00 16.03 ? 107  CYS B SG  1 
ATOM   540  N  N   . LYS A 1 93  ? -17.942 -32.432 10.139  1.00 13.82 ? 108  LYS B N   1 
ATOM   541  C  CA  . LYS A 1 93  ? -16.917 -31.964 11.067  1.00 15.67 ? 108  LYS B CA  1 
ATOM   542  C  C   . LYS A 1 93  ? -15.534 -32.469 10.662  1.00 15.77 ? 108  LYS B C   1 
ATOM   543  O  O   . LYS A 1 93  ? -14.568 -31.705 10.649  1.00 15.89 ? 108  LYS B O   1 
ATOM   544  C  CB  . LYS A 1 93  ? -17.254 -32.400 12.495  1.00 18.54 ? 108  LYS B CB  1 
ATOM   545  C  CG  . LYS A 1 93  ? -16.170 -32.086 13.510  1.00 21.17 ? 108  LYS B CG  1 
ATOM   546  C  CD  . LYS A 1 93  ? -16.472 -32.739 14.858  1.00 27.18 ? 108  LYS B CD  1 
ATOM   547  C  CE  . LYS A 1 93  ? -15.184 -33.166 15.563  1.00 32.50 ? 108  LYS B CE  1 
ATOM   548  N  NZ  . LYS A 1 93  ? -15.425 -34.215 16.604  1.00 35.01 ? 108  LYS B NZ  1 
ATOM   549  N  N   . ASP A 1 94  ? -15.441 -33.753 10.329  1.00 15.58 ? 109  ASP B N   1 
ATOM   550  C  CA  . ASP A 1 94  ? -14.153 -34.345 9.959   1.00 16.19 ? 109  ASP B CA  1 
ATOM   551  C  C   . ASP A 1 94  ? -13.554 -33.694 8.708   1.00 16.20 ? 109  ASP B C   1 
ATOM   552  O  O   . ASP A 1 94  ? -12.370 -33.358 8.684   1.00 16.83 ? 109  ASP B O   1 
ATOM   553  C  CB  . ASP A 1 94  ? -14.281 -35.858 9.762   1.00 18.86 ? 109  ASP B CB  1 
ATOM   554  C  CG  . ASP A 1 94  ? -14.541 -36.597 11.061  1.00 21.26 ? 109  ASP B CG  1 
ATOM   555  O  OD1 . ASP A 1 94  ? -14.266 -36.040 12.146  1.00 24.49 ? 109  ASP B OD1 1 
ATOM   556  O  OD2 . ASP A 1 94  ? -15.017 -37.746 10.992  1.00 23.77 ? 109  ASP B OD2 1 
ATOM   557  N  N   . ARG A 1 95  ? -14.370 -33.509 7.673   1.00 15.73 ? 110  ARG B N   1 
ATOM   558  C  CA  . ARG A 1 95  ? -13.877 -32.880 6.455   1.00 15.70 ? 110  ARG B CA  1 
ATOM   559  C  C   . ARG A 1 95  ? -13.523 -31.417 6.704   1.00 14.97 ? 110  ARG B C   1 
ATOM   560  O  O   . ARG A 1 95  ? -12.517 -30.918 6.192   1.00 14.88 ? 110  ARG B O   1 
ATOM   561  C  CB  . ARG A 1 95  ? -14.903 -32.984 5.322   1.00 16.61 ? 110  ARG B CB  1 
ATOM   562  C  CG  . ARG A 1 95  ? -15.287 -34.399 4.958   1.00 16.53 ? 110  ARG B CG  1 
ATOM   563  C  CD  . ARG A 1 95  ? -14.091 -35.251 4.580   1.00 21.79 ? 110  ARG B CD  1 
ATOM   564  N  NE  . ARG A 1 95  ? -14.342 -36.640 4.943   1.00 33.60 ? 110  ARG B NE  1 
ATOM   565  C  CZ  . ARG A 1 95  ? -13.952 -37.176 6.093   1.00 30.81 ? 110  ARG B CZ  1 
ATOM   566  N  NH1 . ARG A 1 95  ? -13.271 -36.441 6.961   1.00 35.85 ? 110  ARG B NH1 1 
ATOM   567  N  NH2 . ARG A 1 95  ? -14.227 -38.444 6.373   1.00 36.27 ? 110  ARG B NH2 1 
ATOM   568  N  N   . LEU A 1 96  ? -14.352 -30.732 7.484   1.00 13.86 ? 111  LEU B N   1 
ATOM   569  C  CA  . LEU A 1 96  ? -14.105 -29.320 7.785   1.00 13.69 ? 111  LEU B CA  1 
ATOM   570  C  C   . LEU A 1 96  ? -12.797 -29.151 8.557   1.00 15.46 ? 111  LEU B C   1 
ATOM   571  O  O   . LEU A 1 96  ? -12.031 -28.216 8.305   1.00 15.51 ? 111  LEU B O   1 
ATOM   572  C  CB  . LEU A 1 96  ? -15.267 -28.713 8.576   1.00 15.90 ? 111  LEU B CB  1 
ATOM   573  C  CG  . LEU A 1 96  ? -15.344 -27.185 8.616   1.00 14.83 ? 111  LEU B CG  1 
ATOM   574  C  CD1 . LEU A 1 96  ? -15.716 -26.639 7.249   1.00 14.96 ? 111  LEU B CD1 1 
ATOM   575  C  CD2 . LEU A 1 96  ? -16.339 -26.707 9.674   1.00 15.53 ? 111  LEU B CD2 1 
ATOM   576  N  N   . ASN A 1 97  ? -12.548 -30.054 9.502   1.00 14.94 ? 112  ASN B N   1 
ATOM   577  C  CA  . ASN A 1 97  ? -11.328 -29.986 10.302  1.00 16.52 ? 112  ASN B CA  1 
ATOM   578  C  C   . ASN A 1 97  ? -10.077 -30.249 9.459   1.00 17.11 ? 112  ASN B C   1 
ATOM   579  O  O   . ASN A 1 97  ? -9.032  -29.629 9.667   1.00 17.18 ? 112  ASN B O   1 
ATOM   580  C  CB  . ASN A 1 97  ? -11.409 -30.944 11.494  1.00 15.55 ? 112  ASN B CB  1 
ATOM   581  C  CG  . ASN A 1 97  ? -12.431 -30.502 12.537  1.00 17.17 ? 112  ASN B CG  1 
ATOM   582  O  OD1 . ASN A 1 97  ? -12.859 -29.339 12.567  1.00 19.07 ? 112  ASN B OD1 1 
ATOM   583  N  ND2 . ASN A 1 97  ? -12.814 -31.428 13.411  1.00 18.85 ? 112  ASN B ND2 1 
ATOM   584  N  N   . SER A 1 98  ? -10.193 -31.152 8.492   1.00 15.05 ? 113  SER B N   1 
ATOM   585  C  CA  . SER A 1 98  ? -9.108  -31.398 7.554   1.00 15.70 ? 113  SER B CA  1 
ATOM   586  C  C   . SER A 1 98  ? -8.848  -30.150 6.718   1.00 16.81 ? 113  SER B C   1 
ATOM   587  O  O   . SER A 1 98  ? -7.699  -29.750 6.528   1.00 16.39 ? 113  SER B O   1 
ATOM   588  C  CB  . SER A 1 98  ? -9.454  -32.581 6.649   1.00 18.13 ? 113  SER B CB  1 
ATOM   589  O  OG  . SER A 1 98  ? -8.477  -32.748 5.637   0.95 21.00 ? 113  SER B OG  1 
ATOM   590  N  N   . LEU A 1 99  ? -9.923  -29.528 6.236   1.00 15.08 ? 114  LEU B N   1 
ATOM   591  C  CA  . LEU A 1 99  ? -9.813  -28.311 5.437   1.00 15.09 ? 114  LEU B CA  1 
ATOM   592  C  C   . LEU A 1 99  ? -9.202  -27.163 6.246   1.00 15.54 ? 114  LEU B C   1 
ATOM   593  O  O   . LEU A 1 99  ? -8.444  -26.357 5.708   1.00 16.57 ? 114  LEU B O   1 
ATOM   594  C  CB  . LEU A 1 99  ? -11.180 -27.913 4.873   1.00 14.89 ? 114  LEU B CB  1 
ATOM   595  C  CG  . LEU A 1 99  ? -11.249 -26.641 4.026   1.00 13.34 ? 114  LEU B CG  1 
ATOM   596  C  CD1 . LEU A 1 99  ? -10.317 -26.714 2.813   1.00 13.78 ? 114  LEU B CD1 1 
ATOM   597  C  CD2 . LEU A 1 99  ? -12.688 -26.401 3.581   1.00 15.16 ? 114  LEU B CD2 1 
ATOM   598  N  N   . ALA A 1 100 ? -9.532  -27.090 7.535   1.00 15.21 ? 115  ALA B N   1 
ATOM   599  C  CA  . ALA A 1 100 ? -8.986  -26.036 8.382   1.00 16.09 ? 115  ALA B CA  1 
ATOM   600  C  C   . ALA A 1 100 ? -7.454  -26.074 8.390   1.00 16.30 ? 115  ALA B C   1 
ATOM   601  O  O   . ALA A 1 100 ? -6.797  -25.030 8.340   1.00 16.51 ? 115  ALA B O   1 
ATOM   602  C  CB  . ALA A 1 100 ? -9.539  -26.144 9.801   1.00 15.19 ? 115  ALA B CB  1 
ATOM   603  N  N   . ILE A 1 101 ? -6.895  -27.279 8.434   1.00 16.23 ? 116  ILE B N   1 
ATOM   604  C  CA  . ILE A 1 101 ? -5.444  -27.430 8.385   1.00 16.71 ? 116  ILE B CA  1 
ATOM   605  C  C   . ILE A 1 101 ? -4.911  -26.997 7.026   1.00 18.06 ? 116  ILE B C   1 
ATOM   606  O  O   . ILE A 1 101 ? -3.922  -26.264 6.940   1.00 18.35 ? 116  ILE B O   1 
ATOM   607  C  CB  . ILE A 1 101 ? -5.006  -28.878 8.689   1.00 17.69 ? 116  ILE B CB  1 
ATOM   608  C  CG1 . ILE A 1 101 ? -5.394  -29.253 10.122  1.00 21.13 ? 116  ILE B CG1 1 
ATOM   609  C  CG2 . ILE A 1 101 ? -3.502  -29.032 8.505   1.00 19.86 ? 116  ILE B CG2 1 
ATOM   610  C  CD1 . ILE A 1 101 ? -5.265  -30.737 10.425  1.00 21.56 ? 116  ILE B CD1 1 
ATOM   611  N  N   . SER A 1 102 ? -5.568  -27.447 5.963   1.00 15.83 ? 117  SER B N   1 
ATOM   612  C  CA  . SER A 1 102 ? -5.145  -27.099 4.612   1.00 16.53 ? 117  SER B CA  1 
ATOM   613  C  C   . SER A 1 102 ? -5.196  -25.595 4.346   1.00 15.70 ? 117  SER B C   1 
ATOM   614  O  O   . SER A 1 102 ? -4.331  -25.051 3.662   1.00 16.60 ? 117  SER B O   1 
ATOM   615  C  CB  . SER A 1 102 ? -5.971  -27.861 3.577   1.00 19.75 ? 117  SER B CB  1 
ATOM   616  O  OG  . SER A 1 102 ? -5.673  -29.246 3.640   1.00 26.37 ? 117  SER B OG  1 
ATOM   617  N  N   . VAL A 1 103 ? -6.199  -24.916 4.890   1.00 14.92 ? 118  VAL B N   1 
ATOM   618  C  CA  . VAL A 1 103 ? -6.311  -23.476 4.673   1.00 16.69 ? 118  VAL B CA  1 
ATOM   619  C  C   . VAL A 1 103 ? -5.149  -22.734 5.334   1.00 16.61 ? 118  VAL B C   1 
ATOM   620  O  O   . VAL A 1 103 ? -4.549  -21.847 4.727   1.00 16.50 ? 118  VAL B O   1 
ATOM   621  C  CB  . VAL A 1 103 ? -7.683  -22.912 5.150   1.00 16.26 ? 118  VAL B CB  1 
ATOM   622  C  CG1 . VAL A 1 103 ? -7.676  -21.387 5.168   1.00 15.77 ? 118  VAL B CG1 1 
ATOM   623  C  CG2 . VAL A 1 103 ? -8.808  -23.428 4.251   1.00 17.31 ? 118  VAL B CG2 1 
ATOM   624  N  N   . MET A 1 104 ? -4.833  -23.102 6.571   1.00 16.24 ? 119  MET B N   1 
ATOM   625  C  CA  . MET A 1 104 ? -3.717  -22.488 7.285   1.00 16.32 ? 119  MET B CA  1 
ATOM   626  C  C   . MET A 1 104 ? -2.401  -22.775 6.568   1.00 17.33 ? 119  MET B C   1 
ATOM   627  O  O   . MET A 1 104 ? -1.534  -21.907 6.479   1.00 17.92 ? 119  MET B O   1 
ATOM   628  C  CB  . MET A 1 104 ? -3.666  -22.967 8.737   1.00 18.65 ? 119  MET B CB  1 
ATOM   629  C  CG  . MET A 1 104 ? -4.882  -22.527 9.548   1.00 18.92 ? 119  MET B CG  1 
ATOM   630  S  SD  . MET A 1 104 ? -4.773  -22.967 11.288  1.00 22.76 ? 119  MET B SD  1 
ATOM   631  C  CE  . MET A 1 104 ? -4.836  -24.749 11.201  1.00 25.89 ? 119  MET B CE  1 
ATOM   632  N  N   . ASN A 1 105 ? -2.254  -23.990 6.048   1.00 16.38 ? 120  ASN B N   1 
ATOM   633  C  CA  . ASN A 1 105 ? -1.085  -24.312 5.226   1.00 16.85 ? 120  ASN B CA  1 
ATOM   634  C  C   . ASN A 1 105 ? -1.010  -23.466 3.954   1.00 17.52 ? 120  ASN B C   1 
ATOM   635  O  O   . ASN A 1 105 ? 0.057   -22.968 3.588   1.00 17.93 ? 120  ASN B O   1 
ATOM   636  C  CB  . ASN A 1 105 ? -1.073  -25.792 4.847   1.00 16.82 ? 120  ASN B CB  1 
ATOM   637  C  CG  . ASN A 1 105 ? -0.585  -26.687 5.974   1.00 18.24 ? 120  ASN B CG  1 
ATOM   638  O  OD1 . ASN A 1 105 ? -0.037  -26.211 6.973   1.00 19.53 ? 120  ASN B OD1 1 
ATOM   639  N  ND2 . ASN A 1 105 ? -0.776  -27.997 5.812   1.00 20.18 ? 120  ASN B ND2 1 
ATOM   640  N  N   . GLN A 1 106 ? -2.142  -23.308 3.274   1.00 16.94 ? 121  GLN B N   1 
ATOM   641  C  CA  . GLN A 1 106 ? -2.163  -22.607 1.996   1.00 15.97 ? 121  GLN B CA  1 
ATOM   642  C  C   . GLN A 1 106 ? -1.816  -21.126 2.131   1.00 16.42 ? 121  GLN B C   1 
ATOM   643  O  O   . GLN A 1 106 ? -1.078  -20.573 1.318   1.00 15.85 ? 121  GLN B O   1 
ATOM   644  C  CB  . GLN A 1 106 ? -3.538  -22.753 1.333   1.00 16.14 ? 121  GLN B CB  1 
ATOM   645  C  CG  . GLN A 1 106 ? -3.622  -22.071 -0.013  1.00 16.39 ? 121  GLN B CG  1 
ATOM   646  C  CD  . GLN A 1 106 ? -2.722  -22.713 -1.047  1.00 17.35 ? 121  GLN B CD  1 
ATOM   647  O  OE1 . GLN A 1 106 ? -3.039  -23.775 -1.580  1.00 18.78 ? 121  GLN B OE1 1 
ATOM   648  N  NE2 . GLN A 1 106 ? -1.599  -22.063 -1.346  1.00 16.77 ? 121  GLN B NE2 1 
ATOM   649  N  N   . TRP A 1 107 ? -2.373  -20.487 3.153   1.00 16.72 ? 122  TRP B N   1 
ATOM   650  C  CA  . TRP A 1 107 ? -2.183  -19.060 3.374   1.00 17.29 ? 122  TRP B CA  1 
ATOM   651  C  C   . TRP A 1 107 ? -1.825  -18.826 4.835   1.00 17.23 ? 122  TRP B C   1 
ATOM   652  O  O   . TRP A 1 107 ? -2.698  -18.586 5.668   1.00 17.63 ? 122  TRP B O   1 
ATOM   653  C  CB  . TRP A 1 107 ? -3.469  -18.293 3.051   1.00 18.28 ? 122  TRP B CB  1 
ATOM   654  C  CG  . TRP A 1 107 ? -3.978  -18.433 1.642   1.00 15.99 ? 122  TRP B CG  1 
ATOM   655  C  CD1 . TRP A 1 107 ? -3.478  -17.829 0.522   1.00 17.60 ? 122  TRP B CD1 1 
ATOM   656  C  CD2 . TRP A 1 107 ? -5.124  -19.182 1.217   1.00 16.48 ? 122  TRP B CD2 1 
ATOM   657  N  NE1 . TRP A 1 107 ? -4.236  -18.170 -0.578  1.00 19.18 ? 122  TRP B NE1 1 
ATOM   658  C  CE2 . TRP A 1 107 ? -5.249  -19.004 -0.177  1.00 17.38 ? 122  TRP B CE2 1 
ATOM   659  C  CE3 . TRP A 1 107 ? -6.048  -20.000 1.879   1.00 16.46 ? 122  TRP B CE3 1 
ATOM   660  C  CZ2 . TRP A 1 107 ? -6.265  -19.607 -0.919  1.00 16.72 ? 122  TRP B CZ2 1 
ATOM   661  C  CZ3 . TRP A 1 107 ? -7.060  -20.600 1.139   1.00 17.11 ? 122  TRP B CZ3 1 
ATOM   662  C  CH2 . TRP A 1 107 ? -7.159  -20.398 -0.245  1.00 15.96 ? 122  TRP B CH2 1 
ATOM   663  N  N   . PRO A 1 108 ? -0.533  -18.919 5.159   1.00 17.97 ? 123  PRO B N   1 
ATOM   664  C  CA  . PRO A 1 108 ? -0.101  -18.716 6.545   1.00 17.67 ? 123  PRO B CA  1 
ATOM   665  C  C   . PRO A 1 108 ? -0.660  -17.414 7.107   1.00 17.33 ? 123  PRO B C   1 
ATOM   666  O  O   . PRO A 1 108 ? -0.554  -16.367 6.461   1.00 19.90 ? 123  PRO B O   1 
ATOM   667  C  CB  . PRO A 1 108 ? 1.420   -18.645 6.419   1.00 21.31 ? 123  PRO B CB  1 
ATOM   668  C  CG  . PRO A 1 108 ? 1.722   -19.509 5.235   1.00 21.13 ? 123  PRO B CG  1 
ATOM   669  C  CD  . PRO A 1 108 ? 0.582   -19.288 4.271   1.00 17.44 ? 123  PRO B CD  1 
ATOM   670  N  N   . GLY A 1 109 ? -1.272  -17.488 8.286   1.00 17.01 ? 124  GLY B N   1 
ATOM   671  C  CA  . GLY A 1 109 ? -1.858  -16.316 8.920   1.00 18.73 ? 124  GLY B CA  1 
ATOM   672  C  C   . GLY A 1 109 ? -3.360  -16.216 8.705   1.00 19.93 ? 124  GLY B C   1 
ATOM   673  O  O   . GLY A 1 109 ? -4.046  -15.435 9.367   1.00 20.70 ? 124  GLY B O   1 
ATOM   674  N  N   . VAL A 1 110 ? -3.870  -17.020 7.778   1.00 18.11 ? 125  VAL B N   1 
ATOM   675  C  CA  . VAL A 1 110 ? -5.287  -17.012 7.424   1.00 16.37 ? 125  VAL B CA  1 
ATOM   676  C  C   . VAL A 1 110 ? -5.940  -18.300 7.929   1.00 15.46 ? 125  VAL B C   1 
ATOM   677  O  O   . VAL A 1 110 ? -5.282  -19.329 8.042   1.00 16.93 ? 125  VAL B O   1 
ATOM   678  C  CB  . VAL A 1 110 ? -5.457  -16.895 5.888   1.00 16.16 ? 125  VAL B CB  1 
ATOM   679  C  CG1 . VAL A 1 110 ? -6.914  -17.017 5.477   1.00 17.12 ? 125  VAL B CG1 1 
ATOM   680  C  CG2 . VAL A 1 110 ? -4.873  -15.575 5.380   1.00 18.58 ? 125  VAL B CG2 1 
ATOM   681  N  N   . LYS A 1 111 ? -7.233  -18.233 8.244   1.00 15.49 ? 126  LYS B N   1 
ATOM   682  C  CA  . LYS A 1 111 ? -7.970  -19.400 8.717   1.00 16.78 ? 126  LYS B CA  1 
ATOM   683  C  C   . LYS A 1 111 ? -9.227  -19.631 7.895   1.00 16.85 ? 126  LYS B C   1 
ATOM   684  O  O   . LYS A 1 111 ? -9.717  -18.735 7.206   1.00 16.71 ? 126  LYS B O   1 
ATOM   685  C  CB  . LYS A 1 111 ? -8.357  -19.245 10.190  1.00 17.65 ? 126  LYS B CB  1 
ATOM   686  C  CG  . LYS A 1 111 ? -7.189  -19.383 11.160  1.00 18.04 ? 126  LYS B CG  1 
ATOM   687  C  CD  . LYS A 1 111 ? -7.653  -19.293 12.607  1.00 23.17 ? 126  LYS B CD  1 
ATOM   688  C  CE  . LYS A 1 111 ? -6.499  -19.559 13.564  1.00 27.36 ? 126  LYS B CE  1 
ATOM   689  N  NZ  . LYS A 1 111 ? -6.951  -19.595 14.984  1.00 28.90 ? 126  LYS B NZ  1 
ATOM   690  N  N   . LEU A 1 112 ? -9.741  -20.849 7.984   1.00 15.62 ? 127  LEU B N   1 
ATOM   691  C  CA  . LEU A 1 112 ? -11.033 -21.190 7.415   1.00 14.68 ? 127  LEU B CA  1 
ATOM   692  C  C   . LEU A 1 112 ? -12.142 -20.484 8.184   1.00 15.19 ? 127  LEU B C   1 
ATOM   693  O  O   . LEU A 1 112 ? -12.101 -20.392 9.419   1.00 16.06 ? 127  LEU B O   1 
ATOM   694  C  CB  . LEU A 1 112 ? -11.221 -22.702 7.500   1.00 13.02 ? 127  LEU B CB  1 
ATOM   695  C  CG  . LEU A 1 112 ? -12.555 -23.272 7.034   1.00 12.95 ? 127  LEU B CG  1 
ATOM   696  C  CD1 . LEU A 1 112 ? -12.794 -22.999 5.551   1.00 15.20 ? 127  LEU B CD1 1 
ATOM   697  C  CD2 . LEU A 1 112 ? -12.553 -24.768 7.326   1.00 14.28 ? 127  LEU B CD2 1 
ATOM   698  N  N   . ARG A 1 113 ? -13.135 -19.995 7.447   1.00 14.84 ? 128  ARG B N   1 
ATOM   699  C  CA  . ARG A 1 113 ? -14.269 -19.286 8.027   1.00 14.67 ? 128  ARG B CA  1 
ATOM   700  C  C   . ARG A 1 113 ? -15.569 -19.863 7.471   1.00 16.50 ? 128  ARG B C   1 
ATOM   701  O  O   . ARG A 1 113 ? -15.697 -20.080 6.267   1.00 16.67 ? 128  ARG B O   1 
ATOM   702  C  CB  . ARG A 1 113 ? -14.158 -17.787 7.719   1.00 14.51 ? 128  ARG B CB  1 
ATOM   703  C  CG  . ARG A 1 113 ? -15.335 -16.934 8.192   1.00 16.47 ? 128  ARG B CG  1 
ATOM   704  C  CD  . ARG A 1 113 ? -14.966 -15.459 8.075   1.00 18.13 ? 128  ARG B CD  1 
ATOM   705  N  NE  . ARG A 1 113 ? -16.077 -14.530 8.279   1.00 17.37 ? 128  ARG B NE  1 
ATOM   706  C  CZ  . ARG A 1 113 ? -16.818 -14.023 7.296   1.00 19.30 ? 128  ARG B CZ  1 
ATOM   707  N  NH1 . ARG A 1 113 ? -16.596 -14.387 6.039   1.00 17.74 ? 128  ARG B NH1 1 
ATOM   708  N  NH2 . ARG A 1 113 ? -17.794 -13.163 7.573   1.00 20.30 ? 128  ARG B NH2 1 
ATOM   709  N  N   . VAL A 1 114 ? -16.516 -20.130 8.364   1.00 14.98 ? 129  VAL B N   1 
ATOM   710  C  CA  . VAL A 1 114 ? -17.831 -20.646 7.996   1.00 14.42 ? 129  VAL B CA  1 
ATOM   711  C  C   . VAL A 1 114 ? -18.846 -19.517 8.128   1.00 14.88 ? 129  VAL B C   1 
ATOM   712  O  O   . VAL A 1 114 ? -18.963 -18.897 9.191   1.00 15.16 ? 129  VAL B O   1 
ATOM   713  C  CB  . VAL A 1 114 ? -18.244 -21.827 8.906   1.00 13.58 ? 129  VAL B CB  1 
ATOM   714  C  CG1 . VAL A 1 114 ? -19.723 -22.160 8.724   1.00 14.87 ? 129  VAL B CG1 1 
ATOM   715  C  CG2 . VAL A 1 114 ? -17.360 -23.051 8.644   1.00 16.69 ? 129  VAL B CG2 1 
ATOM   716  N  N   . THR A 1 115 ? -19.570 -19.233 7.051   1.00 14.22 ? 130  THR B N   1 
ATOM   717  C  CA  . THR A 1 115 ? -20.565 -18.168 7.075   1.00 15.53 ? 130  THR B CA  1 
ATOM   718  C  C   . THR A 1 115 ? -22.004 -18.684 7.144   1.00 16.57 ? 130  THR B C   1 
ATOM   719  O  O   . THR A 1 115 ? -22.930 -17.915 7.388   1.00 19.58 ? 130  THR B O   1 
ATOM   720  C  CB  . THR A 1 115 ? -20.408 -17.219 5.875   1.00 17.55 ? 130  THR B CB  1 
ATOM   721  O  OG1 . THR A 1 115 ? -20.631 -17.943 4.657   1.00 17.52 ? 130  THR B OG1 1 
ATOM   722  C  CG2 . THR A 1 115 ? -19.000 -16.615 5.869   1.00 18.01 ? 130  THR B CG2 1 
ATOM   723  N  N   . GLU A 1 116 ? -22.187 -19.982 6.931   1.00 15.19 ? 131  GLU B N   1 
ATOM   724  C  CA  . GLU A 1 116 ? -23.502 -20.611 7.061   1.00 15.41 ? 131  GLU B CA  1 
ATOM   725  C  C   . GLU A 1 116 ? -23.302 -22.110 7.246   1.00 14.95 ? 131  GLU B C   1 
ATOM   726  O  O   . GLU A 1 116 ? -22.512 -22.729 6.536   1.00 15.17 ? 131  GLU B O   1 
ATOM   727  C  CB  . GLU A 1 116 ? -24.370 -20.327 5.824   1.00 16.02 ? 131  GLU B CB  1 
ATOM   728  C  CG  . GLU A 1 116 ? -25.678 -21.136 5.731   1.00 17.25 ? 131  GLU B CG  1 
ATOM   729  C  CD  . GLU A 1 116 ? -26.789 -20.626 6.635   1.00 17.33 ? 131  GLU B CD  1 
ATOM   730  O  OE1 . GLU A 1 116 ? -26.492 -20.108 7.734   1.00 18.05 ? 131  GLU B OE1 1 
ATOM   731  O  OE2 . GLU A 1 116 ? -27.974 -20.760 6.248   1.00 17.93 ? 131  GLU B OE2 1 
ATOM   732  N  N   . GLY A 1 117 ? -24.005 -22.686 8.213   1.00 14.85 ? 132  GLY B N   1 
ATOM   733  C  CA  . GLY A 1 117 ? -23.943 -24.117 8.455   1.00 14.34 ? 132  GLY B CA  1 
ATOM   734  C  C   . GLY A 1 117 ? -25.357 -24.653 8.487   1.00 14.51 ? 132  GLY B C   1 
ATOM   735  O  O   . GLY A 1 117 ? -26.072 -24.555 7.496   1.00 14.98 ? 132  GLY B O   1 
ATOM   736  N  N   . TRP A 1 118 ? -25.774 -25.183 9.634   1.00 13.58 ? 133  TRP B N   1 
ATOM   737  C  CA  . TRP A 1 118 ? -27.126 -25.707 9.782   1.00 14.37 ? 133  TRP B CA  1 
ATOM   738  C  C   . TRP A 1 118 ? -28.117 -24.554 9.786   1.00 15.48 ? 133  TRP B C   1 
ATOM   739  O  O   . TRP A 1 118 ? -27.957 -23.595 10.542  1.00 15.10 ? 133  TRP B O   1 
ATOM   740  C  CB  . TRP A 1 118 ? -27.239 -26.525 11.075  1.00 13.75 ? 133  TRP B CB  1 
ATOM   741  C  CG  . TRP A 1 118 ? -28.622 -26.999 11.420  1.00 15.17 ? 133  TRP B CG  1 
ATOM   742  C  CD1 . TRP A 1 118 ? -29.488 -27.680 10.620  1.00 16.42 ? 133  TRP B CD1 1 
ATOM   743  C  CD2 . TRP A 1 118 ? -29.270 -26.861 12.688  1.00 16.32 ? 133  TRP B CD2 1 
ATOM   744  N  NE1 . TRP A 1 118 ? -30.652 -27.961 11.306  1.00 15.59 ? 133  TRP B NE1 1 
ATOM   745  C  CE2 . TRP A 1 118 ? -30.539 -27.468 12.579  1.00 15.79 ? 133  TRP B CE2 1 
ATOM   746  C  CE3 . TRP A 1 118 ? -28.899 -26.278 13.906  1.00 19.00 ? 133  TRP B CE3 1 
ATOM   747  C  CZ2 . TRP A 1 118 ? -31.440 -27.509 13.641  1.00 20.18 ? 133  TRP B CZ2 1 
ATOM   748  C  CZ3 . TRP A 1 118 ? -29.795 -26.322 14.961  1.00 20.95 ? 133  TRP B CZ3 1 
ATOM   749  C  CH2 . TRP A 1 118 ? -31.049 -26.930 14.822  1.00 22.26 ? 133  TRP B CH2 1 
ATOM   750  N  N   . ASP A 1 119 ? -29.120 -24.638 8.916   1.00 14.61 ? 134  ASP B N   1 
ATOM   751  C  CA  . ASP A 1 119 ? -30.108 -23.571 8.772   1.00 14.69 ? 134  ASP B CA  1 
ATOM   752  C  C   . ASP A 1 119 ? -31.476 -24.015 9.283   1.00 16.33 ? 134  ASP B C   1 
ATOM   753  O  O   . ASP A 1 119 ? -32.131 -24.865 8.673   1.00 16.31 ? 134  ASP B O   1 
ATOM   754  C  CB  . ASP A 1 119 ? -30.204 -23.142 7.308   1.00 14.36 ? 134  ASP B CB  1 
ATOM   755  C  CG  . ASP A 1 119 ? -31.263 -22.085 7.077   1.00 15.63 ? 134  ASP B CG  1 
ATOM   756  O  OD1 . ASP A 1 119 ? -31.654 -21.399 8.052   1.00 16.56 ? 134  ASP B OD1 1 
ATOM   757  O  OD2 . ASP A 1 119 ? -31.700 -21.952 5.919   1.00 16.88 ? 134  ASP B OD2 1 
ATOM   758  N  N   . GLU A 1 120 ? -31.902 -23.418 10.395  1.00 17.10 ? 135  GLU B N   1 
ATOM   759  C  CA  . GLU A 1 120 ? -33.200 -23.706 11.007  1.00 17.97 ? 135  GLU B CA  1 
ATOM   760  C  C   . GLU A 1 120 ? -34.348 -22.919 10.375  1.00 20.52 ? 135  GLU B C   1 
ATOM   761  O  O   . GLU A 1 120 ? -35.517 -23.154 10.692  1.00 20.82 ? 135  GLU B O   1 
ATOM   762  C  CB  . GLU A 1 120 ? -33.169 -23.349 12.495  1.00 20.29 ? 135  GLU B CB  1 
ATOM   763  C  CG  . GLU A 1 120 ? -32.026 -23.939 13.295  1.00 20.40 ? 135  GLU B CG  1 
ATOM   764  C  CD  . GLU A 1 120 ? -32.169 -23.633 14.775  1.00 23.24 ? 135  GLU B CD  1 
ATOM   765  O  OE1 . GLU A 1 120 ? -33.043 -24.243 15.425  1.00 24.77 ? 135  GLU B OE1 1 
ATOM   766  O  OE2 . GLU A 1 120 ? -31.416 -22.775 15.284  1.00 24.16 ? 135  GLU B OE2 1 
ATOM   767  N  N   . ASP A 1 121 ? -34.022 -21.985 9.488   1.00 17.57 ? 136  ASP B N   1 
ATOM   768  C  CA  . ASP A 1 121 ? -34.995 -20.984 9.047   1.00 20.70 ? 136  ASP B CA  1 
ATOM   769  C  C   . ASP A 1 121 ? -35.504 -21.102 7.610   1.00 22.61 ? 136  ASP B C   1 
ATOM   770  O  O   . ASP A 1 121 ? -36.501 -20.472 7.256   1.00 27.18 ? 136  ASP B O   1 
ATOM   771  C  CB  . ASP A 1 121 ? -34.430 -19.585 9.275   1.00 20.02 ? 136  ASP B CB  1 
ATOM   772  C  CG  . ASP A 1 121 ? -34.186 -19.295 10.739  1.00 21.74 ? 136  ASP B CG  1 
ATOM   773  O  OD1 . ASP A 1 121 ? -35.147 -19.388 11.533  1.00 25.15 ? 136  ASP B OD1 1 
ATOM   774  O  OD2 . ASP A 1 121 ? -33.032 -18.987 11.091  1.00 20.48 ? 136  ASP B OD2 1 
ATOM   775  N  N   . GLY A 1 122 ? -34.829 -21.885 6.777   1.00 19.27 ? 137  GLY B N   1 
ATOM   776  C  CA  . GLY A 1 122 ? -35.291 -22.090 5.416   1.00 19.97 ? 137  GLY B CA  1 
ATOM   777  C  C   . GLY A 1 122 ? -34.895 -20.989 4.450   1.00 18.55 ? 137  GLY B C   1 
ATOM   778  O  O   . GLY A 1 122 ? -35.707 -20.540 3.642   1.00 22.52 ? 137  GLY B O   1 
ATOM   779  N  N   . HIS A 1 123 ? -33.634 -20.572 4.520   1.00 18.49 ? 138  HIS B N   1 
ATOM   780  C  CA  . HIS A 1 123 ? -33.120 -19.499 3.675   1.00 19.05 ? 138  HIS B CA  1 
ATOM   781  C  C   . HIS A 1 123 ? -32.418 -20.012 2.418   1.00 19.36 ? 138  HIS B C   1 
ATOM   782  O  O   . HIS A 1 123 ? -31.628 -19.293 1.804   1.00 23.26 ? 138  HIS B O   1 
ATOM   783  C  CB  . HIS A 1 123 ? -32.160 -18.610 4.470   1.00 20.31 ? 138  HIS B CB  1 
ATOM   784  C  CG  . HIS A 1 123 ? -32.805 -17.892 5.611   1.00 20.53 ? 138  HIS B CG  1 
ATOM   785  N  ND1 . HIS A 1 123 ? -32.139 -17.614 6.784   1.00 20.74 ? 138  HIS B ND1 1 
ATOM   786  C  CD2 . HIS A 1 123 ? -34.058 -17.398 5.762   1.00 22.91 ? 138  HIS B CD2 1 
ATOM   787  C  CE1 . HIS A 1 123 ? -32.953 -16.977 7.609   1.00 21.98 ? 138  HIS B CE1 1 
ATOM   788  N  NE2 . HIS A 1 123 ? -34.122 -16.832 7.013   1.00 21.45 ? 138  HIS B NE2 1 
ATOM   789  N  N   . HIS A 1 124 ? -32.701 -21.256 2.044   1.00 18.95 ? 139  HIS B N   1 
ATOM   790  C  CA  . HIS A 1 124 ? -32.134 -21.841 0.832   1.00 20.66 ? 139  HIS B CA  1 
ATOM   791  C  C   . HIS A 1 124 ? -33.236 -22.495 0.001   1.00 21.33 ? 139  HIS B C   1 
ATOM   792  O  O   . HIS A 1 124 ? -34.420 -22.263 0.245   1.00 23.77 ? 139  HIS B O   1 
ATOM   793  C  CB  . HIS A 1 124 ? -31.022 -22.835 1.192   1.00 19.01 ? 139  HIS B CB  1 
ATOM   794  C  CG  . HIS A 1 124 ? -29.960 -22.243 2.068   1.00 18.47 ? 139  HIS B CG  1 
ATOM   795  N  ND1 . HIS A 1 124 ? -28.867 -21.571 1.563   1.00 19.67 ? 139  HIS B ND1 1 
ATOM   796  C  CD2 . HIS A 1 124 ? -29.850 -22.179 3.416   1.00 17.48 ? 139  HIS B CD2 1 
ATOM   797  C  CE1 . HIS A 1 124 ? -28.119 -21.134 2.563   1.00 17.77 ? 139  HIS B CE1 1 
ATOM   798  N  NE2 . HIS A 1 124 ? -28.695 -21.490 3.698   1.00 18.07 ? 139  HIS B NE2 1 
ATOM   799  N  N   . SER A 1 125 ? -32.859 -23.302 -0.986  1.00 20.88 ? 140  SER B N   1 
ATOM   800  C  CA  . SER A 1 125 ? -33.858 -23.991 -1.800  1.00 22.01 ? 140  SER B CA  1 
ATOM   801  C  C   . SER A 1 125 ? -34.611 -25.012 -0.956  1.00 24.52 ? 140  SER B C   1 
ATOM   802  O  O   . SER A 1 125 ? -34.268 -25.244 0.201   1.00 24.18 ? 140  SER B O   1 
ATOM   803  C  CB  . SER A 1 125 ? -33.204 -24.665 -3.010  1.00 24.99 ? 140  SER B CB  1 
ATOM   804  O  OG  . SER A 1 125 ? -32.196 -25.572 -2.605  0.55 23.84 ? 140  SER B OG  1 
ATOM   805  N  N   . GLU A 1 126 ? -35.625 -25.635 -1.549  1.00 22.81 ? 141  GLU B N   1 
ATOM   806  C  CA  . GLU A 1 126 ? -36.544 -26.511 -0.821  1.00 26.33 ? 141  GLU B CA  1 
ATOM   807  C  C   . GLU A 1 126 ? -35.896 -27.711 -0.117  1.00 26.39 ? 141  GLU B C   1 
ATOM   808  O  O   . GLU A 1 126 ? -36.346 -28.120 0.961   1.00 28.48 ? 141  GLU B O   1 
ATOM   809  C  CB  . GLU A 1 126 ? -37.647 -26.995 -1.766  1.00 30.41 ? 141  GLU B CB  1 
ATOM   810  C  CG  . GLU A 1 126 ? -38.671 -27.917 -1.126  1.00 36.75 ? 141  GLU B CG  1 
ATOM   811  C  CD  . GLU A 1 126 ? -39.781 -28.301 -2.090  1.00 42.59 ? 141  GLU B CD  1 
ATOM   812  O  OE1 . GLU A 1 126 ? -40.170 -29.489 -2.112  1.00 49.11 ? 141  GLU B OE1 1 
ATOM   813  O  OE2 . GLU A 1 126 ? -40.258 -27.416 -2.832  1.00 49.20 ? 141  GLU B OE2 1 
ATOM   814  N  N   . GLU A 1 127 ? -34.848 -28.268 -0.718  1.00 22.64 ? 142  GLU B N   1 
ATOM   815  C  CA  . GLU A 1 127 ? -34.223 -29.496 -0.218  1.00 21.52 ? 142  GLU B CA  1 
ATOM   816  C  C   . GLU A 1 127 ? -32.726 -29.328 0.057   1.00 21.51 ? 142  GLU B C   1 
ATOM   817  O  O   . GLU A 1 127 ? -31.908 -30.179 -0.308  1.00 20.20 ? 142  GLU B O   1 
ATOM   818  C  CB  . GLU A 1 127 ? -34.469 -30.653 -1.199  1.00 21.63 ? 142  GLU B CB  1 
ATOM   819  C  CG  . GLU A 1 127 ? -35.956 -30.935 -1.401  1.00 23.90 ? 142  GLU B CG  1 
ATOM   820  C  CD  . GLU A 1 127 ? -36.242 -32.231 -2.147  1.00 28.14 ? 142  GLU B CD  1 
ATOM   821  O  OE1 . GLU A 1 127 ? -37.411 -32.442 -2.533  1.00 33.52 ? 142  GLU B OE1 1 
ATOM   822  O  OE2 . GLU A 1 127 ? -35.312 -33.038 -2.346  1.00 29.84 ? 142  GLU B OE2 1 
ATOM   823  N  N   . SER A 1 128 ? -32.378 -28.239 0.732   1.00 17.65 ? 143  SER B N   1 
ATOM   824  C  CA  . SER A 1 128 ? -30.980 -27.919 1.005   1.00 16.83 ? 143  SER B CA  1 
ATOM   825  C  C   . SER A 1 128 ? -30.365 -28.818 2.074   1.00 14.75 ? 143  SER B C   1 
ATOM   826  O  O   . SER A 1 128 ? -30.983 -29.080 3.114   1.00 14.97 ? 143  SER B O   1 
ATOM   827  C  CB  . SER A 1 128 ? -30.857 -26.457 1.439   1.00 16.58 ? 143  SER B CB  1 
ATOM   828  O  OG  . SER A 1 128 ? -29.506 -26.136 1.744   1.00 16.57 ? 143  SER B OG  1 
ATOM   829  N  N   . LEU A 1 129 ? -29.134 -29.270 1.835   1.00 15.49 ? 144  LEU B N   1 
ATOM   830  C  CA  . LEU A 1 129 ? -28.403 -30.031 2.846   1.00 14.36 ? 144  LEU B CA  1 
ATOM   831  C  C   . LEU A 1 129 ? -28.030 -29.153 4.047   1.00 14.03 ? 144  LEU B C   1 
ATOM   832  O  O   . LEU A 1 129 ? -27.647 -29.656 5.097   1.00 14.87 ? 144  LEU B O   1 
ATOM   833  C  CB  . LEU A 1 129 ? -27.164 -30.712 2.246   1.00 14.46 ? 144  LEU B CB  1 
ATOM   834  C  CG  . LEU A 1 129 ? -27.483 -31.824 1.236   1.00 14.35 ? 144  LEU B CG  1 
ATOM   835  C  CD1 . LEU A 1 129 ? -26.211 -32.507 0.739   1.00 13.92 ? 144  LEU B CD1 1 
ATOM   836  C  CD2 . LEU A 1 129 ? -28.434 -32.863 1.810   1.00 17.38 ? 144  LEU B CD2 1 
ATOM   837  N  N   . HIS A 1 130 ? -28.154 -27.837 3.896   1.00 15.44 ? 145  HIS B N   1 
ATOM   838  C  CA  . HIS A 1 130 ? -28.031 -26.957 5.055   1.00 13.82 ? 145  HIS B CA  1 
ATOM   839  C  C   . HIS A 1 130 ? -29.077 -27.286 6.118   1.00 16.27 ? 145  HIS B C   1 
ATOM   840  O  O   . HIS A 1 130 ? -28.846 -27.060 7.301   1.00 14.65 ? 145  HIS B O   1 
ATOM   841  C  CB  . HIS A 1 130 ? -28.168 -25.486 4.657   1.00 14.80 ? 145  HIS B CB  1 
ATOM   842  C  CG  . HIS A 1 130 ? -26.947 -24.918 4.002   1.00 14.10 ? 145  HIS B CG  1 
ATOM   843  N  ND1 . HIS A 1 130 ? -25.803 -24.601 4.705   1.00 14.68 ? 145  HIS B ND1 1 
ATOM   844  C  CD2 . HIS A 1 130 ? -26.694 -24.599 2.709   1.00 14.20 ? 145  HIS B CD2 1 
ATOM   845  C  CE1 . HIS A 1 130 ? -24.896 -24.123 3.873   1.00 13.61 ? 145  HIS B CE1 1 
ATOM   846  N  NE2 . HIS A 1 130 ? -25.414 -24.106 2.657   1.00 14.65 ? 145  HIS B NE2 1 
ATOM   847  N  N   . TYR A 1 131 ? -30.234 -27.793 5.696   1.00 15.81 ? 146  TYR B N   1 
ATOM   848  C  CA  . TYR A 1 131 ? -31.326 -28.033 6.641   1.00 15.08 ? 146  TYR B CA  1 
ATOM   849  C  C   . TYR A 1 131 ? -31.059 -29.218 7.554   1.00 16.25 ? 146  TYR B C   1 
ATOM   850  O  O   . TYR A 1 131 ? -31.738 -29.386 8.571   1.00 16.96 ? 146  TYR B O   1 
ATOM   851  C  CB  . TYR A 1 131 ? -32.662 -28.218 5.921   1.00 17.54 ? 146  TYR B CB  1 
ATOM   852  C  CG  . TYR A 1 131 ? -33.055 -27.044 5.062   1.00 16.29 ? 146  TYR B CG  1 
ATOM   853  C  CD1 . TYR A 1 131 ? -32.613 -25.760 5.361   1.00 17.23 ? 146  TYR B CD1 1 
ATOM   854  C  CD2 . TYR A 1 131 ? -33.873 -27.214 3.952   1.00 16.93 ? 146  TYR B CD2 1 
ATOM   855  C  CE1 . TYR A 1 131 ? -32.974 -24.680 4.576   1.00 18.29 ? 146  TYR B CE1 1 
ATOM   856  C  CE2 . TYR A 1 131 ? -34.241 -26.140 3.164   1.00 17.49 ? 146  TYR B CE2 1 
ATOM   857  C  CZ  . TYR A 1 131 ? -33.791 -24.875 3.482   1.00 18.97 ? 146  TYR B CZ  1 
ATOM   858  O  OH  . TYR A 1 131 ? -34.149 -23.807 2.691   1.00 18.58 ? 146  TYR B OH  1 
ATOM   859  N  N   . GLU A 1 132 ? -30.078 -30.041 7.187   1.00 16.16 ? 147  GLU B N   1 
ATOM   860  C  CA  . GLU A 1 132 ? -29.737 -31.210 7.996   1.00 15.50 ? 147  GLU B CA  1 
ATOM   861  C  C   . GLU A 1 132 ? -28.268 -31.276 8.438   1.00 15.11 ? 147  GLU B C   1 
ATOM   862  O  O   . GLU A 1 132 ? -27.753 -32.351 8.743   1.00 16.41 ? 147  GLU B O   1 
ATOM   863  C  CB  . GLU A 1 132 ? -30.161 -32.507 7.287   1.00 18.04 ? 147  GLU B CB  1 
ATOM   864  C  CG  . GLU A 1 132 ? -29.739 -32.613 5.824   1.00 16.59 ? 147  GLU B CG  1 
ATOM   865  C  CD  . GLU A 1 132 ? -30.163 -33.936 5.190   1.00 17.85 ? 147  GLU B CD  1 
ATOM   866  O  OE1 . GLU A 1 132 ? -29.863 -34.993 5.779   1.00 18.23 ? 147  GLU B OE1 1 
ATOM   867  O  OE2 . GLU A 1 132 ? -30.798 -33.913 4.114   1.00 18.90 ? 147  GLU B OE2 1 
ATOM   868  N  N   . GLY A 1 133 ? -27.604 -30.123 8.492   1.00 14.19 ? 148  GLY B N   1 
ATOM   869  C  CA  . GLY A 1 133 ? -26.270 -30.045 9.056   1.00 14.20 ? 148  GLY B CA  1 
ATOM   870  C  C   . GLY A 1 133 ? -25.205 -30.765 8.242   1.00 15.90 ? 148  GLY B C   1 
ATOM   871  O  O   . GLY A 1 133 ? -24.208 -31.236 8.794   1.00 15.68 ? 148  GLY B O   1 
ATOM   872  N  N   . ARG A 1 134 ? -25.410 -30.834 6.927   1.00 13.56 ? 149  ARG B N   1 
ATOM   873  C  CA  . ARG A 1 134 ? -24.469 -31.516 6.036   1.00 14.84 ? 149  ARG B CA  1 
ATOM   874  C  C   . ARG A 1 134 ? -23.870 -30.605 4.979   1.00 13.49 ? 149  ARG B C   1 
ATOM   875  O  O   . ARG A 1 134 ? -23.236 -31.078 4.031   1.00 13.78 ? 149  ARG B O   1 
ATOM   876  C  CB  . ARG A 1 134 ? -25.132 -32.721 5.363   1.00 15.13 ? 149  ARG B CB  1 
ATOM   877  C  CG  . ARG A 1 134 ? -25.221 -33.912 6.279   1.00 15.56 ? 149  ARG B CG  1 
ATOM   878  C  CD  . ARG A 1 134 ? -25.329 -35.194 5.480   1.00 21.84 ? 149  ARG B CD  1 
ATOM   879  N  NE  . ARG A 1 134 ? -26.693 -35.456 5.056   1.00 22.77 ? 149  ARG B NE  1 
ATOM   880  C  CZ  . ARG A 1 134 ? -27.072 -35.755 3.815   1.00 18.61 ? 149  ARG B CZ  1 
ATOM   881  N  NH1 . ARG A 1 134 ? -26.200 -35.824 2.819   1.00 20.14 ? 149  ARG B NH1 1 
ATOM   882  N  NH2 . ARG A 1 134 ? -28.348 -35.993 3.571   1.00 16.19 ? 149  ARG B NH2 1 
ATOM   883  N  N   . ALA A 1 135 ? -24.072 -29.301 5.131   1.00 13.21 ? 150  ALA B N   1 
ATOM   884  C  CA  . ALA A 1 135 ? -23.484 -28.340 4.208   1.00 14.19 ? 150  ALA B CA  1 
ATOM   885  C  C   . ALA A 1 135 ? -23.003 -27.106 4.954   1.00 14.73 ? 150  ALA B C   1 
ATOM   886  O  O   . ALA A 1 135 ? -23.661 -26.638 5.881   1.00 15.25 ? 150  ALA B O   1 
ATOM   887  C  CB  . ALA A 1 135 ? -24.483 -27.947 3.121   1.00 14.77 ? 150  ALA B CB  1 
ATOM   888  N  N   . VAL A 1 136 ? -21.851 -26.591 4.541   1.00 13.96 ? 151  VAL B N   1 
ATOM   889  C  CA  . VAL A 1 136 ? -21.353 -25.317 5.033   1.00 13.98 ? 151  VAL B CA  1 
ATOM   890  C  C   . VAL A 1 136 ? -21.034 -24.392 3.868   1.00 14.72 ? 151  VAL B C   1 
ATOM   891  O  O   . VAL A 1 136 ? -20.636 -24.846 2.790   1.00 14.61 ? 151  VAL B O   1 
ATOM   892  C  CB  . VAL A 1 136 ? -20.080 -25.503 5.883   1.00 15.88 ? 151  VAL B CB  1 
ATOM   893  C  CG1 . VAL A 1 136 ? -20.427 -26.098 7.240   1.00 16.38 ? 151  VAL B CG1 1 
ATOM   894  C  CG2 . VAL A 1 136 ? -19.054 -26.356 5.142   1.00 15.89 ? 151  VAL B CG2 1 
ATOM   895  N  N   . ASP A 1 137 ? -21.226 -23.096 4.086   1.00 12.91 ? 152  ASP B N   1 
ATOM   896  C  CA  . ASP A 1 137 ? -20.711 -22.073 3.178   1.00 13.90 ? 152  ASP B CA  1 
ATOM   897  C  C   . ASP A 1 137 ? -19.467 -21.486 3.817   1.00 14.70 ? 152  ASP B C   1 
ATOM   898  O  O   . ASP A 1 137 ? -19.467 -21.162 5.005   1.00 13.89 ? 152  ASP B O   1 
ATOM   899  C  CB  . ASP A 1 137 ? -21.755 -20.986 2.906   1.00 13.31 ? 152  ASP B CB  1 
ATOM   900  C  CG  . ASP A 1 137 ? -22.979 -21.526 2.195   1.00 14.48 ? 152  ASP B CG  1 
ATOM   901  O  OD1 . ASP A 1 137 ? -22.843 -22.563 1.497   1.00 14.30 ? 152  ASP B OD1 1 
ATOM   902  O  OD2 . ASP A 1 137 ? -24.067 -20.928 2.337   1.00 16.26 ? 152  ASP B OD2 1 
ATOM   903  N  N   . ILE A 1 138 ? -18.407 -21.358 3.032   1.00 13.76 ? 153  ILE B N   1 
ATOM   904  C  CA  . ILE A 1 138 ? -17.108 -21.001 3.576   1.00 14.83 ? 153  ILE B CA  1 
ATOM   905  C  C   . ILE A 1 138 ? -16.417 -19.869 2.833   1.00 14.40 ? 153  ILE B C   1 
ATOM   906  O  O   . ILE A 1 138 ? -16.664 -19.620 1.641   1.00 14.89 ? 153  ILE B O   1 
ATOM   907  C  CB  . ILE A 1 138 ? -16.148 -22.216 3.619   1.00 15.68 ? 153  ILE B CB  1 
ATOM   908  C  CG1 . ILE A 1 138 ? -15.876 -22.749 2.206   1.00 13.96 ? 153  ILE B CG1 1 
ATOM   909  C  CG2 . ILE A 1 138 ? -16.693 -23.324 4.537   1.00 15.16 ? 153  ILE B CG2 1 
ATOM   910  C  CD1 . ILE A 1 138 ? -14.752 -23.801 2.164   1.00 15.67 ? 153  ILE B CD1 1 
ATOM   911  N  N   . THR A 1 139 ? -15.537 -19.194 3.567   1.00 15.55 ? 154  THR B N   1 
ATOM   912  C  CA  . THR A 1 139 ? -14.625 -18.207 3.009   1.00 14.88 ? 154  THR B CA  1 
ATOM   913  C  C   . THR A 1 139 ? -13.291 -18.370 3.725   1.00 16.11 ? 154  THR B C   1 
ATOM   914  O  O   . THR A 1 139 ? -13.135 -19.232 4.592   1.00 15.27 ? 154  THR B O   1 
ATOM   915  C  CB  . THR A 1 139 ? -15.116 -16.765 3.276   1.00 15.73 ? 154  THR B CB  1 
ATOM   916  O  OG1 . THR A 1 139 ? -14.962 -16.459 4.668   1.00 15.97 ? 154  THR B OG1 1 
ATOM   917  C  CG2 . THR A 1 139 ? -16.578 -16.601 2.877   1.00 15.17 ? 154  THR B CG2 1 
ATOM   918  N  N   . THR A 1 140 ? -12.328 -17.528 3.371   1.00 16.83 ? 155  THR B N   1 
ATOM   919  C  CA  . THR A 1 140 ? -11.127 -17.392 4.174   1.00 15.45 ? 155  THR B CA  1 
ATOM   920  C  C   . THR A 1 140 ? -11.397 -16.286 5.190   1.00 16.74 ? 155  THR B C   1 
ATOM   921  O  O   . THR A 1 140 ? -12.284 -15.459 4.987   1.00 17.55 ? 155  THR B O   1 
ATOM   922  C  CB  . THR A 1 140 ? -9.925  -17.039 3.299   1.00 15.85 ? 155  THR B CB  1 
ATOM   923  O  OG1 . THR A 1 140 ? -10.282 -15.955 2.431   1.00 17.01 ? 155  THR B OG1 1 
ATOM   924  C  CG2 . THR A 1 140 ? -9.516  -18.243 2.453   1.00 17.51 ? 155  THR B CG2 1 
ATOM   925  N  N   . SER A 1 141 ? -10.639 -16.274 6.282   1.00 15.55 ? 156  SER B N   1 
ATOM   926  C  CA  . SER A 1 141 ? -10.891 -15.338 7.380   1.00 17.30 ? 156  SER B CA  1 
ATOM   927  C  C   . SER A 1 141 ? -10.655 -13.886 6.980   1.00 17.52 ? 156  SER B C   1 
ATOM   928  O  O   . SER A 1 141 ? -11.214 -12.970 7.592   1.00 19.55 ? 156  SER B O   1 
ATOM   929  C  CB  . SER A 1 141 ? -10.016 -15.688 8.580   1.00 17.22 ? 156  SER B CB  1 
ATOM   930  O  OG  . SER A 1 141 ? -8.645  -15.665 8.217   1.00 18.31 ? 156  SER B OG  1 
ATOM   931  N  N   . ASP A 1 142 ? -9.826  -13.676 5.964   1.00 17.47 ? 157  ASP B N   1 
ATOM   932  C  CA  . ASP A 1 142 ? -9.551  -12.323 5.480   1.00 18.56 ? 157  ASP B CA  1 
ATOM   933  C  C   . ASP A 1 142 ? -10.583 -11.820 4.463   1.00 18.36 ? 157  ASP B C   1 
ATOM   934  O  O   . ASP A 1 142 ? -10.504 -10.679 3.996   1.00 19.39 ? 157  ASP B O   1 
ATOM   935  C  CB  . ASP A 1 142 ? -8.125  -12.211 4.923   1.00 18.02 ? 157  ASP B CB  1 
ATOM   936  C  CG  . ASP A 1 142 ? -7.883  -13.100 3.711   1.00 20.27 ? 157  ASP B CG  1 
ATOM   937  O  OD1 . ASP A 1 142 ? -8.806  -13.829 3.286   1.00 18.49 ? 157  ASP B OD1 1 
ATOM   938  O  OD2 . ASP A 1 142 ? -6.755  -13.060 3.177   1.00 20.04 ? 157  ASP B OD2 1 
ATOM   939  N  N   . ARG A 1 143 ? -11.555 -12.665 4.132   1.00 17.75 ? 158  ARG B N   1 
ATOM   940  C  CA  . ARG A 1 143 ? -12.600 -12.299 3.179   1.00 18.86 ? 158  ARG B CA  1 
ATOM   941  C  C   . ARG A 1 143 ? -12.033 -11.830 1.831   1.00 17.86 ? 158  ARG B C   1 
ATOM   942  O  O   . ARG A 1 143 ? -12.631 -11.003 1.141   1.00 20.16 ? 158  ARG B O   1 
ATOM   943  C  CB  . ARG A 1 143 ? -13.557 -11.260 3.785   1.00 19.32 ? 158  ARG B CB  1 
ATOM   944  C  CG  . ARG A 1 143 ? -14.243 -11.732 5.065   1.00 19.65 ? 158  ARG B CG  1 
ATOM   945  C  CD  . ARG A 1 143 ? -15.247 -10.703 5.587   1.00 22.50 ? 158  ARG B CD  1 
ATOM   946  N  NE  . ARG A 1 143 ? -16.353 -10.489 4.656   1.00 23.63 ? 158  ARG B NE  1 
ATOM   947  C  CZ  . ARG A 1 143 ? -16.587 -9.344  4.020   1.00 26.77 ? 158  ARG B CZ  1 
ATOM   948  N  NH1 . ARG A 1 143 ? -15.799 -8.296  4.226   1.00 28.01 ? 158  ARG B NH1 1 
ATOM   949  N  NH2 . ARG A 1 143 ? -17.616 -9.241  3.185   1.00 28.72 ? 158  ARG B NH2 1 
ATOM   950  N  N   . ASP A 1 144 ? -10.880 -12.375 1.451   1.00 16.66 ? 159  ASP B N   1 
ATOM   951  C  CA  . ASP A 1 144 ? -10.295 -12.079 0.150   1.00 17.67 ? 159  ASP B CA  1 
ATOM   952  C  C   . ASP A 1 144 ? -10.956 -12.939 -0.919  1.00 18.31 ? 159  ASP B C   1 
ATOM   953  O  O   . ASP A 1 144 ? -10.614 -14.113 -1.077  1.00 17.85 ? 159  ASP B O   1 
ATOM   954  C  CB  . ASP A 1 144 ? -8.784  -12.332 0.168   1.00 19.66 ? 159  ASP B CB  1 
ATOM   955  C  CG  . ASP A 1 144 ? -8.130  -12.073 -1.180  1.00 18.57 ? 159  ASP B CG  1 
ATOM   956  O  OD1 . ASP A 1 144 ? -8.810  -11.557 -2.090  1.00 20.21 ? 159  ASP B OD1 1 
ATOM   957  O  OD2 . ASP A 1 144 ? -6.932  -12.391 -1.332  1.00 20.63 ? 159  ASP B OD2 1 
ATOM   958  N  N   . ARG A 1 145 ? -11.898 -12.352 -1.652  1.00 17.38 ? 160  ARG B N   1 
ATOM   959  C  CA  . ARG A 1 145 ? -12.673 -13.105 -2.634  1.00 18.31 ? 160  ARG B CA  1 
ATOM   960  C  C   . ARG A 1 145 ? -11.806 -13.724 -3.727  1.00 17.93 ? 160  ARG B C   1 
ATOM   961  O  O   . ARG A 1 145 ? -12.205 -14.697 -4.368  1.00 18.88 ? 160  ARG B O   1 
ATOM   962  C  CB  . ARG A 1 145 ? -13.781 -12.237 -3.232  1.00 18.98 ? 160  ARG B CB  1 
ATOM   963  C  CG  . ARG A 1 145 ? -14.879 -11.897 -2.242  1.00 19.65 ? 160  ARG B CG  1 
ATOM   964  C  CD  . ARG A 1 145 ? -16.038 -11.173 -2.907  1.00 20.94 ? 160  ARG B CD  1 
ATOM   965  N  NE  . ARG A 1 145 ? -15.647 -9.863  -3.428  1.00 23.28 ? 160  ARG B NE  1 
ATOM   966  C  CZ  . ARG A 1 145 ? -15.560 -8.763  -2.686  1.00 23.96 ? 160  ARG B CZ  1 
ATOM   967  N  NH1 . ARG A 1 145 ? -15.824 -8.812  -1.385  1.00 27.02 ? 160  ARG B NH1 1 
ATOM   968  N  NH2 . ARG A 1 145 ? -15.200 -7.614  -3.243  1.00 27.25 ? 160  ARG B NH2 1 
ATOM   969  N  N   . ASN A 1 146 ? -10.611 -13.177 -3.926  1.00 18.14 ? 161  ASN B N   1 
ATOM   970  C  CA  . ASN A 1 146 ? -9.682  -13.744 -4.894  1.00 17.44 ? 161  ASN B CA  1 
ATOM   971  C  C   . ASN A 1 146 ? -9.181  -15.136 -4.516  1.00 17.90 ? 161  ASN B C   1 
ATOM   972  O  O   . ASN A 1 146 ? -8.672  -15.866 -5.364  1.00 19.05 ? 161  ASN B O   1 
ATOM   973  C  CB  . ASN A 1 146 ? -8.483  -12.819 -5.089  1.00 21.02 ? 161  ASN B CB  1 
ATOM   974  C  CG  . ASN A 1 146 ? -8.852  -11.524 -5.776  1.00 26.25 ? 161  ASN B CG  1 
ATOM   975  O  OD1 . ASN A 1 146 ? -9.641  -11.509 -6.718  1.00 29.97 ? 161  ASN B OD1 1 
ATOM   976  N  ND2 . ASN A 1 146 ? -8.276  -10.425 -5.308  1.00 31.40 ? 161  ASN B ND2 1 
ATOM   977  N  N   . LYS A 1 147 ? -9.321  -15.499 -3.241  1.00 16.54 ? 162  LYS B N   1 
ATOM   978  C  CA  . LYS A 1 147 ? -8.834  -16.785 -2.746  1.00 16.04 ? 162  LYS B CA  1 
ATOM   979  C  C   . LYS A 1 147 ? -9.839  -17.929 -2.911  1.00 15.43 ? 162  LYS B C   1 
ATOM   980  O  O   . LYS A 1 147 ? -9.487  -19.090 -2.686  1.00 14.90 ? 162  LYS B O   1 
ATOM   981  C  CB  . LYS A 1 147 ? -8.464  -16.681 -1.261  1.00 17.08 ? 162  LYS B CB  1 
ATOM   982  C  CG  . LYS A 1 147 ? -7.209  -15.852 -0.971  1.00 15.39 ? 162  LYS B CG  1 
ATOM   983  C  CD  . LYS A 1 147 ? -6.854  -15.863 0.521   1.00 15.49 ? 162  LYS B CD  1 
ATOM   984  C  CE  . LYS A 1 147 ? -5.526  -15.161 0.791   1.00 20.00 ? 162  LYS B CE  1 
ATOM   985  N  NZ  . LYS A 1 147 ? -5.649  -13.677 0.774   1.00 19.75 ? 162  LYS B NZ  1 
ATOM   986  N  N   . TYR A 1 148 ? -11.077 -17.617 -3.293  1.00 15.90 ? 163  TYR B N   1 
ATOM   987  C  CA  . TYR A 1 148 ? -12.163 -18.595 -3.124  1.00 13.00 ? 163  TYR B CA  1 
ATOM   988  C  C   . TYR A 1 148 ? -12.119 -19.755 -4.120  1.00 13.94 ? 163  TYR B C   1 
ATOM   989  O  O   . TYR A 1 148 ? -12.515 -20.872 -3.789  1.00 14.97 ? 163  TYR B O   1 
ATOM   990  C  CB  . TYR A 1 148 ? -13.550 -17.931 -3.098  1.00 15.40 ? 163  TYR B CB  1 
ATOM   991  C  CG  . TYR A 1 148 ? -13.753 -16.967 -1.942  1.00 15.47 ? 163  TYR B CG  1 
ATOM   992  C  CD1 . TYR A 1 148 ? -12.788 -16.821 -0.945  1.00 15.45 ? 163  TYR B CD1 1 
ATOM   993  C  CD2 . TYR A 1 148 ? -14.920 -16.218 -1.838  1.00 17.02 ? 163  TYR B CD2 1 
ATOM   994  C  CE1 . TYR A 1 148 ? -12.975 -15.940 0.117   1.00 16.12 ? 163  TYR B CE1 1 
ATOM   995  C  CE2 . TYR A 1 148 ? -15.113 -15.330 -0.787  1.00 16.59 ? 163  TYR B CE2 1 
ATOM   996  C  CZ  . TYR A 1 148 ? -14.141 -15.196 0.188   1.00 14.96 ? 163  TYR B CZ  1 
ATOM   997  O  OH  . TYR A 1 148 ? -14.342 -14.313 1.237   1.00 18.15 ? 163  TYR B OH  1 
ATOM   998  N  N   . GLY A 1 149 ? -11.635 -19.501 -5.332  1.00 13.80 ? 164  GLY B N   1 
ATOM   999  C  CA  . GLY A 1 149 ? -11.480 -20.575 -6.301  1.00 15.18 ? 164  GLY B CA  1 
ATOM   1000 C  C   . GLY A 1 149 ? -10.531 -21.638 -5.765  1.00 13.94 ? 164  GLY B C   1 
ATOM   1001 O  O   . GLY A 1 149 ? -10.786 -22.846 -5.858  1.00 14.99 ? 164  GLY B O   1 
ATOM   1002 N  N   . LEU A 1 150 ? -9.419  -21.187 -5.196  1.00 15.04 ? 165  LEU B N   1 
ATOM   1003 C  CA  . LEU A 1 150 ? -8.453  -22.109 -4.615  1.00 14.94 ? 165  LEU B CA  1 
ATOM   1004 C  C   . LEU A 1 150 ? -8.989  -22.757 -3.330  1.00 15.38 ? 165  LEU B C   1 
ATOM   1005 O  O   . LEU A 1 150 ? -8.767  -23.941 -3.082  1.00 14.88 ? 165  LEU B O   1 
ATOM   1006 C  CB  . LEU A 1 150 ? -7.123  -21.394 -4.377  1.00 16.28 ? 165  LEU B CB  1 
ATOM   1007 C  CG  . LEU A 1 150 ? -6.010  -22.225 -3.750  1.00 17.58 ? 165  LEU B CG  1 
ATOM   1008 C  CD1 . LEU A 1 150 ? -5.822  -23.532 -4.512  1.00 16.43 ? 165  LEU B CD1 1 
ATOM   1009 C  CD2 . LEU A 1 150 ? -4.725  -21.412 -3.735  1.00 17.56 ? 165  LEU B CD2 1 
ATOM   1010 N  N   . LEU A 1 151 ? -9.713  -21.980 -2.528  1.00 14.03 ? 166  LEU B N   1 
ATOM   1011 C  CA  . LEU A 1 151 ? -10.377 -22.511 -1.342  1.00 13.88 ? 166  LEU B CA  1 
ATOM   1012 C  C   . LEU A 1 151 ? -11.284 -23.675 -1.728  1.00 13.91 ? 166  LEU B C   1 
ATOM   1013 O  O   . LEU A 1 151 ? -11.322 -24.699 -1.044  1.00 14.03 ? 166  LEU B O   1 
ATOM   1014 C  CB  . LEU A 1 151 ? -11.200 -21.414 -0.656  1.00 13.58 ? 166  LEU B CB  1 
ATOM   1015 C  CG  . LEU A 1 151 ? -11.983 -21.827 0.597   1.00 13.19 ? 166  LEU B CG  1 
ATOM   1016 C  CD1 . LEU A 1 151 ? -11.047 -22.327 1.705   1.00 14.37 ? 166  LEU B CD1 1 
ATOM   1017 C  CD2 . LEU A 1 151 ? -12.861 -20.669 1.075   1.00 15.48 ? 166  LEU B CD2 1 
ATOM   1018 N  N   . ALA A 1 152 ? -12.014 -23.511 -2.828  1.00 14.61 ? 167  ALA B N   1 
ATOM   1019 C  CA  . ALA A 1 152 ? -12.871 -24.581 -3.329  1.00 15.54 ? 167  ALA B CA  1 
ATOM   1020 C  C   . ALA A 1 152 ? -12.055 -25.835 -3.671  1.00 14.06 ? 167  ALA B C   1 
ATOM   1021 O  O   . ALA A 1 152 ? -12.443 -26.944 -3.323  1.00 14.62 ? 167  ALA B O   1 
ATOM   1022 C  CB  . ALA A 1 152 ? -13.679 -24.109 -4.541  1.00 14.78 ? 167  ALA B CB  1 
ATOM   1023 N  N   . ARG A 1 153 ? -10.921 -25.655 -4.343  1.00 15.71 ? 168  ARG B N   1 
ATOM   1024 C  CA  . ARG A 1 153 ? -10.054 -26.785 -4.665  1.00 16.96 ? 168  ARG B CA  1 
ATOM   1025 C  C   . ARG A 1 153 ? -9.546  -27.476 -3.390  1.00 15.83 ? 168  ARG B C   1 
ATOM   1026 O  O   . ARG A 1 153 ? -9.507  -28.706 -3.311  1.00 15.26 ? 168  ARG B O   1 
ATOM   1027 C  CB  . ARG A 1 153 ? -8.903  -26.330 -5.566  1.00 16.10 ? 168  ARG B CB  1 
ATOM   1028 C  CG  . ARG A 1 153 ? -7.803  -27.368 -5.805  1.00 16.80 ? 168  ARG B CG  1 
ATOM   1029 C  CD  . ARG A 1 153 ? -8.352  -28.692 -6.308  1.00 18.15 ? 168  ARG B CD  1 
ATOM   1030 N  NE  . ARG A 1 153 ? -8.990  -28.586 -7.615  1.00 18.98 ? 168  ARG B NE  1 
ATOM   1031 C  CZ  . ARG A 1 153 ? -9.744  -29.546 -8.143  1.00 19.98 ? 168  ARG B CZ  1 
ATOM   1032 N  NH1 . ARG A 1 153 ? -9.955  -30.667 -7.468  1.00 23.62 ? 168  ARG B NH1 1 
ATOM   1033 N  NH2 . ARG A 1 153 ? -10.294 -29.380 -9.336  1.00 23.74 ? 168  ARG B NH2 1 
ATOM   1034 N  N   . LEU A 1 154 ? -9.176  -26.688 -2.385  1.00 13.98 ? 169  LEU B N   1 
ATOM   1035 C  CA  . LEU A 1 154 ? -8.738  -27.259 -1.115  1.00 15.27 ? 169  LEU B CA  1 
ATOM   1036 C  C   . LEU A 1 154 ? -9.849  -28.081 -0.468  1.00 14.26 ? 169  LEU B C   1 
ATOM   1037 O  O   . LEU A 1 154 ? -9.592  -29.123 0.125   1.00 16.21 ? 169  LEU B O   1 
ATOM   1038 C  CB  . LEU A 1 154 ? -8.286  -26.165 -0.149  1.00 15.13 ? 169  LEU B CB  1 
ATOM   1039 C  CG  . LEU A 1 154 ? -7.101  -25.302 -0.576  1.00 17.31 ? 169  LEU B CG  1 
ATOM   1040 C  CD1 . LEU A 1 154 ? -6.791  -24.303 0.516   1.00 17.75 ? 169  LEU B CD1 1 
ATOM   1041 C  CD2 . LEU A 1 154 ? -5.880  -26.159 -0.898  1.00 18.62 ? 169  LEU B CD2 1 
ATOM   1042 N  N   . ALA A 1 155 ? -11.087 -27.616 -0.589  1.00 14.02 ? 170  ALA B N   1 
ATOM   1043 C  CA  . ALA A 1 155 ? -12.209 -28.339 -0.005  1.00 13.95 ? 170  ALA B CA  1 
ATOM   1044 C  C   . ALA A 1 155 ? -12.417 -29.692 -0.690  1.00 14.21 ? 170  ALA B C   1 
ATOM   1045 O  O   . ALA A 1 155 ? -12.778 -30.677 -0.042  1.00 15.20 ? 170  ALA B O   1 
ATOM   1046 C  CB  . ALA A 1 155 ? -13.484 -27.500 -0.054  1.00 14.87 ? 170  ALA B CB  1 
ATOM   1047 N  N   . VAL A 1 156 ? -12.180 -29.739 -1.998  1.00 14.63 ? 171  VAL B N   1 
ATOM   1048 C  CA  . VAL A 1 156 ? -12.209 -31.008 -2.721  1.00 14.00 ? 171  VAL B CA  1 
ATOM   1049 C  C   . VAL A 1 156 ? -11.114 -31.937 -2.197  1.00 15.34 ? 171  VAL B C   1 
ATOM   1050 O  O   . VAL A 1 156 ? -11.372 -33.101 -1.873  1.00 17.00 ? 171  VAL B O   1 
ATOM   1051 C  CB  . VAL A 1 156 ? -12.032 -30.811 -4.245  1.00 15.85 ? 171  VAL B CB  1 
ATOM   1052 C  CG1 . VAL A 1 156 ? -11.917 -32.171 -4.940  1.00 16.24 ? 171  VAL B CG1 1 
ATOM   1053 C  CG2 . VAL A 1 156 ? -13.193 -29.997 -4.822  1.00 16.91 ? 171  VAL B CG2 1 
ATOM   1054 N  N   . GLU A 1 157 ? -9.895  -31.416 -2.096  1.00 16.71 ? 172  GLU B N   1 
ATOM   1055 C  CA  . GLU A 1 157 ? -8.773  -32.228 -1.630  1.00 17.33 ? 172  GLU B CA  1 
ATOM   1056 C  C   . GLU A 1 157 ? -8.956  -32.689 -0.178  1.00 19.41 ? 172  GLU B C   1 
ATOM   1057 O  O   . GLU A 1 157 ? -8.429  -33.730 0.215   1.00 18.94 ? 172  GLU B O   1 
ATOM   1058 C  CB  . GLU A 1 157 ? -7.456  -31.467 -1.799  1.00 18.85 ? 172  GLU B CB  1 
ATOM   1059 C  CG  . GLU A 1 157 ? -7.188  -31.019 -3.233  1.00 20.96 ? 172  GLU B CG  1 
ATOM   1060 C  CD  . GLU A 1 157 ? -7.145  -32.174 -4.211  1.00 26.78 ? 172  GLU B CD  1 
ATOM   1061 O  OE1 . GLU A 1 157 ? -7.827  -32.099 -5.259  1.00 29.33 ? 172  GLU B OE1 1 
ATOM   1062 O  OE2 . GLU A 1 157 ? -6.434  -33.159 -3.930  1.00 34.12 ? 172  GLU B OE2 1 
ATOM   1063 N  N   . ALA A 1 158 ? -9.718  -31.922 0.603   1.00 16.33 ? 173  ALA B N   1 
ATOM   1064 C  CA  . ALA A 1 158 ? -9.999  -32.254 2.004   1.00 16.80 ? 173  ALA B CA  1 
ATOM   1065 C  C   . ALA A 1 158 ? -11.054 -33.353 2.135   1.00 16.33 ? 173  ALA B C   1 
ATOM   1066 O  O   . ALA A 1 158 ? -11.327 -33.835 3.236   1.00 18.95 ? 173  ALA B O   1 
ATOM   1067 C  CB  . ALA A 1 158 ? -10.450 -31.016 2.762   1.00 16.74 ? 173  ALA B CB  1 
ATOM   1068 N  N   . GLY A 1 159 ? -11.670 -33.724 1.018   1.00 17.21 ? 174  GLY B N   1 
ATOM   1069 C  CA  . GLY A 1 159 ? -12.602 -34.834 1.010   1.00 16.45 ? 174  GLY B CA  1 
ATOM   1070 C  C   . GLY A 1 159 ? -14.069 -34.489 1.154   1.00 16.06 ? 174  GLY B C   1 
ATOM   1071 O  O   . GLY A 1 159 ? -14.890 -35.370 1.422   1.00 16.62 ? 174  GLY B O   1 
ATOM   1072 N  N   . PHE A 1 160 ? -14.430 -33.221 0.985   1.00 15.01 ? 175  PHE B N   1 
ATOM   1073 C  CA  . PHE A 1 160 ? -15.855 -32.902 0.926   1.00 14.47 ? 175  PHE B CA  1 
ATOM   1074 C  C   . PHE A 1 160 ? -16.470 -33.647 -0.250  1.00 14.14 ? 175  PHE B C   1 
ATOM   1075 O  O   . PHE A 1 160 ? -15.848 -33.777 -1.303  1.00 15.82 ? 175  PHE B O   1 
ATOM   1076 C  CB  . PHE A 1 160 ? -16.096 -31.394 0.832   1.00 14.04 ? 175  PHE B CB  1 
ATOM   1077 C  CG  . PHE A 1 160 ? -16.138 -30.721 2.168   1.00 14.59 ? 175  PHE B CG  1 
ATOM   1078 C  CD1 . PHE A 1 160 ? -17.281 -30.787 2.949   1.00 13.92 ? 175  PHE B CD1 1 
ATOM   1079 C  CD2 . PHE A 1 160 ? -15.028 -30.054 2.662   1.00 14.37 ? 175  PHE B CD2 1 
ATOM   1080 C  CE1 . PHE A 1 160 ? -17.326 -30.183 4.198   1.00 14.56 ? 175  PHE B CE1 1 
ATOM   1081 C  CE2 . PHE A 1 160 ? -15.065 -29.452 3.910   1.00 14.71 ? 175  PHE B CE2 1 
ATOM   1082 C  CZ  . PHE A 1 160 ? -16.216 -29.510 4.675   1.00 15.94 ? 175  PHE B CZ  1 
ATOM   1083 N  N   . ASP A 1 161 ? -17.682 -34.156 -0.064  1.00 14.96 ? 176  ASP B N   1 
ATOM   1084 C  CA  . ASP A 1 161 ? -18.312 -34.987 -1.093  1.00 13.90 ? 176  ASP B CA  1 
ATOM   1085 C  C   . ASP A 1 161 ? -18.856 -34.189 -2.269  1.00 15.07 ? 176  ASP B C   1 
ATOM   1086 O  O   . ASP A 1 161 ? -19.009 -34.723 -3.367  1.00 14.73 ? 176  ASP B O   1 
ATOM   1087 C  CB  . ASP A 1 161 ? -19.384 -35.873 -0.476  1.00 16.34 ? 176  ASP B CB  1 
ATOM   1088 C  CG  . ASP A 1 161 ? -18.809 -36.803 0.559   1.00 17.49 ? 176  ASP B CG  1 
ATOM   1089 O  OD1 . ASP A 1 161 ? -17.919 -37.604 0.201   1.00 20.10 ? 176  ASP B OD1 1 
ATOM   1090 O  OD2 . ASP A 1 161 ? -19.218 -36.714 1.729   1.00 16.63 ? 176  ASP B OD2 1 
ATOM   1091 N  N   . TRP A 1 162 ? -19.123 -32.907 -2.042  1.00 14.31 ? 177  TRP B N   1 
ATOM   1092 C  CA  . TRP A 1 162 ? -19.498 -32.013 -3.126  1.00 12.88 ? 177  TRP B CA  1 
ATOM   1093 C  C   . TRP A 1 162 ? -19.021 -30.622 -2.777  1.00 12.81 ? 177  TRP B C   1 
ATOM   1094 O  O   . TRP A 1 162 ? -19.153 -30.183 -1.635  1.00 13.63 ? 177  TRP B O   1 
ATOM   1095 C  CB  . TRP A 1 162 ? -21.013 -32.018 -3.341  1.00 13.83 ? 177  TRP B CB  1 
ATOM   1096 C  CG  . TRP A 1 162 ? -21.487 -31.512 -4.695  1.00 14.69 ? 177  TRP B CG  1 
ATOM   1097 C  CD1 . TRP A 1 162 ? -21.292 -32.109 -5.914  1.00 14.84 ? 177  TRP B CD1 1 
ATOM   1098 C  CD2 . TRP A 1 162 ? -22.268 -30.338 -4.947  1.00 13.90 ? 177  TRP B CD2 1 
ATOM   1099 N  NE1 . TRP A 1 162 ? -21.892 -31.370 -6.908  1.00 14.58 ? 177  TRP B NE1 1 
ATOM   1100 C  CE2 . TRP A 1 162 ? -22.504 -30.281 -6.343  1.00 14.73 ? 177  TRP B CE2 1 
ATOM   1101 C  CE3 . TRP A 1 162 ? -22.791 -29.326 -4.131  1.00 15.59 ? 177  TRP B CE3 1 
ATOM   1102 C  CZ2 . TRP A 1 162 ? -23.240 -29.252 -6.935  1.00 14.33 ? 177  TRP B CZ2 1 
ATOM   1103 C  CZ3 . TRP A 1 162 ? -23.528 -28.310 -4.722  1.00 14.75 ? 177  TRP B CZ3 1 
ATOM   1104 C  CH2 . TRP A 1 162 ? -23.745 -28.281 -6.111  1.00 13.47 ? 177  TRP B CH2 1 
ATOM   1105 N  N   . VAL A 1 163 ? -18.457 -29.938 -3.761  1.00 13.59 ? 178  VAL B N   1 
ATOM   1106 C  CA  . VAL A 1 163 ? -17.965 -28.584 -3.569  1.00 13.91 ? 178  VAL B CA  1 
ATOM   1107 C  C   . VAL A 1 163 ? -18.433 -27.749 -4.756  1.00 13.35 ? 178  VAL B C   1 
ATOM   1108 O  O   . VAL A 1 163 ? -18.334 -28.180 -5.906  1.00 13.93 ? 178  VAL B O   1 
ATOM   1109 C  CB  . VAL A 1 163 ? -16.428 -28.564 -3.487  1.00 14.22 ? 178  VAL B CB  1 
ATOM   1110 C  CG1 . VAL A 1 163 ? -15.913 -27.139 -3.374  1.00 13.93 ? 178  VAL B CG1 1 
ATOM   1111 C  CG2 . VAL A 1 163 ? -15.950 -29.392 -2.298  1.00 13.75 ? 178  VAL B CG2 1 
ATOM   1112 N  N   . TYR A 1 164 ? -18.958 -26.565 -4.473  1.00 14.02 ? 179  TYR B N   1 
ATOM   1113 C  CA  . TYR A 1 164 ? -19.589 -25.742 -5.489  1.00 14.08 ? 179  TYR B CA  1 
ATOM   1114 C  C   . TYR A 1 164 ? -19.217 -24.288 -5.234  1.00 14.44 ? 179  TYR B C   1 
ATOM   1115 O  O   . TYR A 1 164 ? -19.505 -23.742 -4.170  1.00 13.64 ? 179  TYR B O   1 
ATOM   1116 C  CB  . TYR A 1 164 ? -21.102 -25.974 -5.415  1.00 14.90 ? 179  TYR B CB  1 
ATOM   1117 C  CG  . TYR A 1 164 ? -21.992 -25.085 -6.254  1.00 14.18 ? 179  TYR B CG  1 
ATOM   1118 C  CD1 . TYR A 1 164 ? -21.610 -24.644 -7.520  1.00 15.31 ? 179  TYR B CD1 1 
ATOM   1119 C  CD2 . TYR A 1 164 ? -23.253 -24.732 -5.786  1.00 16.73 ? 179  TYR B CD2 1 
ATOM   1120 C  CE1 . TYR A 1 164 ? -22.456 -23.841 -8.276  1.00 15.36 ? 179  TYR B CE1 1 
ATOM   1121 C  CE2 . TYR A 1 164 ? -24.096 -23.949 -6.529  1.00 16.67 ? 179  TYR B CE2 1 
ATOM   1122 C  CZ  . TYR A 1 164 ? -23.700 -23.504 -7.768  1.00 17.27 ? 179  TYR B CZ  1 
ATOM   1123 O  OH  . TYR A 1 164 ? -24.565 -22.711 -8.488  1.00 23.37 ? 179  TYR B OH  1 
ATOM   1124 N  N   . TYR A 1 165 ? -18.525 -23.682 -6.186  1.00 14.62 ? 180  TYR B N   1 
ATOM   1125 C  CA  . TYR A 1 165 ? -18.128 -22.282 -6.079  1.00 14.13 ? 180  TYR B CA  1 
ATOM   1126 C  C   . TYR A 1 165 ? -19.371 -21.450 -6.417  1.00 15.77 ? 180  TYR B C   1 
ATOM   1127 O  O   . TYR A 1 165 ? -19.513 -20.901 -7.516  1.00 15.29 ? 180  TYR B O   1 
ATOM   1128 C  CB  . TYR A 1 165 ? -16.959 -22.029 -7.038  1.00 15.13 ? 180  TYR B CB  1 
ATOM   1129 C  CG  . TYR A 1 165 ? -16.269 -20.684 -6.951  1.00 14.57 ? 180  TYR B CG  1 
ATOM   1130 C  CD1 . TYR A 1 165 ? -16.790 -19.637 -6.194  1.00 14.93 ? 180  TYR B CD1 1 
ATOM   1131 C  CD2 . TYR A 1 165 ? -15.104 -20.450 -7.673  1.00 14.79 ? 180  TYR B CD2 1 
ATOM   1132 C  CE1 . TYR A 1 165 ? -16.147 -18.397 -6.154  1.00 16.81 ? 180  TYR B CE1 1 
ATOM   1133 C  CE2 . TYR A 1 165 ? -14.459 -19.231 -7.637  1.00 15.57 ? 180  TYR B CE2 1 
ATOM   1134 C  CZ  . TYR A 1 165 ? -14.981 -18.208 -6.883  1.00 16.47 ? 180  TYR B CZ  1 
ATOM   1135 O  OH  . TYR A 1 165 ? -14.328 -16.993 -6.878  1.00 18.52 ? 180  TYR B OH  1 
ATOM   1136 N  N   . GLU A 1 166 ? -20.283 -21.387 -5.447  1.00 14.62 ? 181  GLU B N   1 
ATOM   1137 C  CA  . GLU A 1 166 ? -21.656 -20.937 -5.671  1.00 14.70 ? 181  GLU B CA  1 
ATOM   1138 C  C   . GLU A 1 166 ? -21.845 -19.431 -5.877  1.00 16.17 ? 181  GLU B C   1 
ATOM   1139 O  O   . GLU A 1 166 ? -22.699 -19.009 -6.660  1.00 15.72 ? 181  GLU B O   1 
ATOM   1140 C  CB  . GLU A 1 166 ? -22.547 -21.414 -4.520  1.00 15.92 ? 181  GLU B CB  1 
ATOM   1141 C  CG  . GLU A 1 166 ? -23.977 -20.945 -4.649  1.00 15.09 ? 181  GLU B CG  1 
ATOM   1142 C  CD  . GLU A 1 166 ? -24.886 -21.487 -3.568  1.00 17.16 ? 181  GLU B CD  1 
ATOM   1143 O  OE1 . GLU A 1 166 ? -26.093 -21.629 -3.849  1.00 18.45 ? 181  GLU B OE1 1 
ATOM   1144 O  OE2 . GLU A 1 166 ? -24.411 -21.760 -2.446  1.00 17.05 ? 181  GLU B OE2 1 
ATOM   1145 N  N   . SER A 1 167 ? -21.080 -18.619 -5.160  1.00 15.00 ? 182  SER B N   1 
ATOM   1146 C  CA  . SER A 1 167 ? -21.143 -17.180 -5.374  1.00 15.71 ? 182  SER B CA  1 
ATOM   1147 C  C   . SER A 1 167 ? -19.751 -16.581 -5.241  1.00 14.63 ? 182  SER B C   1 
ATOM   1148 O  O   . SER A 1 167 ? -18.832 -17.223 -4.732  1.00 16.24 ? 182  SER B O   1 
ATOM   1149 C  CB  . SER A 1 167 ? -22.118 -16.502 -4.403  1.00 19.83 ? 182  SER B CB  1 
ATOM   1150 O  OG  . SER A 1 167 ? -21.468 -16.045 -3.225  1.00 16.89 ? 182  SER B OG  1 
ATOM   1151 N  N   . LYS A 1 168 ? -19.588 -15.345 -5.701  1.00 15.95 ? 183  LYS B N   1 
ATOM   1152 C  CA  . LYS A 1 168 ? -18.307 -14.676 -5.528  1.00 16.30 ? 183  LYS B CA  1 
ATOM   1153 C  C   . LYS A 1 168 ? -17.969 -14.505 -4.044  1.00 16.91 ? 183  LYS B C   1 
ATOM   1154 O  O   . LYS A 1 168 ? -16.818 -14.239 -3.690  1.00 18.66 ? 183  LYS B O   1 
ATOM   1155 C  CB  . LYS A 1 168 ? -18.314 -13.314 -6.226  1.00 17.50 ? 183  LYS B CB  1 
ATOM   1156 C  CG  . LYS A 1 168 ? -18.441 -13.389 -7.741  1.00 18.67 ? 183  LYS B CG  1 
ATOM   1157 C  CD  . LYS A 1 168 ? -17.158 -13.877 -8.388  1.00 20.11 ? 183  LYS B CD  1 
ATOM   1158 C  CE  . LYS A 1 168 ? -17.224 -13.694 -9.897  1.00 26.00 ? 183  LYS B CE  1 
ATOM   1159 N  NZ  . LYS A 1 168 ? -15.876 -13.757 -10.523 1.00 32.51 ? 183  LYS B NZ  1 
ATOM   1160 N  N   . ALA A 1 169 ? -18.969 -14.670 -3.182  1.00 15.98 ? 184  ALA B N   1 
ATOM   1161 C  CA  . ALA A 1 169 ? -18.811 -14.427 -1.744  1.00 17.37 ? 184  ALA B CA  1 
ATOM   1162 C  C   . ALA A 1 169 ? -18.641 -15.677 -0.884  1.00 16.36 ? 184  ALA B C   1 
ATOM   1163 O  O   . ALA A 1 169 ? -18.399 -15.563 0.314   1.00 15.88 ? 184  ALA B O   1 
ATOM   1164 C  CB  . ALA A 1 169 ? -19.980 -13.618 -1.217  1.00 19.37 ? 184  ALA B CB  1 
ATOM   1165 N  N   . HIS A 1 170 ? -18.781 -16.863 -1.472  1.00 16.33 ? 185  HIS B N   1 
ATOM   1166 C  CA  . HIS A 1 170 ? -18.632 -18.092 -0.690  1.00 15.16 ? 185  HIS B CA  1 
ATOM   1167 C  C   . HIS A 1 170 ? -18.534 -19.342 -1.544  1.00 14.01 ? 185  HIS B C   1 
ATOM   1168 O  O   . HIS A 1 170 ? -18.949 -19.351 -2.700  1.00 13.98 ? 185  HIS B O   1 
ATOM   1169 C  CB  . HIS A 1 170 ? -19.819 -18.269 0.256   1.00 15.22 ? 185  HIS B CB  1 
ATOM   1170 C  CG  . HIS A 1 170 ? -21.049 -18.792 -0.420  1.00 17.73 ? 185  HIS B CG  1 
ATOM   1171 N  ND1 . HIS A 1 170 ? -21.874 -17.997 -1.184  1.00 22.25 ? 185  HIS B ND1 1 
ATOM   1172 C  CD2 . HIS A 1 170 ? -21.571 -20.041 -0.477  1.00 14.74 ? 185  HIS B CD2 1 
ATOM   1173 C  CE1 . HIS A 1 170 ? -22.868 -18.728 -1.662  1.00 19.01 ? 185  HIS B CE1 1 
ATOM   1174 N  NE2 . HIS A 1 170 ? -22.706 -19.972 -1.248  1.00 17.08 ? 185  HIS B NE2 1 
ATOM   1175 N  N   . VAL A 1 171 ? -18.003 -20.400 -0.939  1.00 13.36 ? 186  VAL B N   1 
ATOM   1176 C  CA  . VAL A 1 171 ? -18.003 -21.733 -1.533  1.00 13.25 ? 186  VAL B CA  1 
ATOM   1177 C  C   . VAL A 1 171 ? -18.940 -22.616 -0.707  1.00 13.05 ? 186  VAL B C   1 
ATOM   1178 O  O   . VAL A 1 171 ? -18.889 -22.596 0.521   1.00 13.77 ? 186  VAL B O   1 
ATOM   1179 C  CB  . VAL A 1 171 ? -16.593 -22.355 -1.510  1.00 12.48 ? 186  VAL B CB  1 
ATOM   1180 C  CG1 . VAL A 1 171 ? -16.614 -23.744 -2.116  1.00 15.06 ? 186  VAL B CG1 1 
ATOM   1181 C  CG2 . VAL A 1 171 ? -15.600 -21.463 -2.261  1.00 15.48 ? 186  VAL B CG2 1 
ATOM   1182 N  N   . HIS A 1 172 ? -19.801 -23.380 -1.377  1.00 13.09 ? 187  HIS B N   1 
ATOM   1183 C  CA  . HIS A 1 172 ? -20.731 -24.299 -0.715  1.00 14.07 ? 187  HIS B CA  1 
ATOM   1184 C  C   . HIS A 1 172 ? -20.141 -25.702 -0.715  1.00 13.35 ? 187  HIS B C   1 
ATOM   1185 O  O   . HIS A 1 172 ? -19.828 -26.243 -1.781  1.00 14.20 ? 187  HIS B O   1 
ATOM   1186 C  CB  . HIS A 1 172 ? -22.073 -24.293 -1.471  1.00 12.76 ? 187  HIS B CB  1 
ATOM   1187 C  CG  . HIS A 1 172 ? -23.032 -25.372 -1.056  1.00 13.81 ? 187  HIS B CG  1 
ATOM   1188 N  ND1 . HIS A 1 172 ? -24.028 -25.171 -0.124  1.00 13.11 ? 187  HIS B ND1 1 
ATOM   1189 C  CD2 . HIS A 1 172 ? -23.162 -26.656 -1.464  1.00 13.13 ? 187  HIS B CD2 1 
ATOM   1190 C  CE1 . HIS A 1 172 ? -24.728 -26.281 0.025   1.00 14.84 ? 187  HIS B CE1 1 
ATOM   1191 N  NE2 . HIS A 1 172 ? -24.224 -27.198 -0.781  1.00 13.95 ? 187  HIS B NE2 1 
ATOM   1192 N  N   . CYS A 1 173 ? -19.976 -26.286 0.468   1.00 13.78 ? 188  CYS B N   1 
ATOM   1193 C  CA  . CYS A 1 173 ? -19.428 -27.641 0.595   1.00 13.43 ? 188  CYS B CA  1 
ATOM   1194 C  C   . CYS A 1 173 ? -20.378 -28.555 1.341   1.00 14.66 ? 188  CYS B C   1 
ATOM   1195 O  O   . CYS A 1 173 ? -20.968 -28.156 2.341   1.00 14.53 ? 188  CYS B O   1 
ATOM   1196 C  CB  . CYS A 1 173 ? -18.103 -27.610 1.358   1.00 14.67 ? 188  CYS B CB  1 
ATOM   1197 S  SG  . CYS A 1 173 ? -16.888 -26.435 0.721   1.00 15.85 ? 188  CYS B SG  1 
ATOM   1198 N  N   . SER A 1 174 ? -20.502 -29.799 0.896   1.00 13.29 ? 189  SER B N   1 
ATOM   1199 C  CA  . SER A 1 174 ? -21.395 -30.723 1.584   1.00 12.94 ? 189  SER B CA  1 
ATOM   1200 C  C   . SER A 1 174 ? -20.825 -32.131 1.714   1.00 14.04 ? 189  SER B C   1 
ATOM   1201 O  O   . SER A 1 174 ? -19.818 -32.476 1.080   1.00 13.68 ? 189  SER B O   1 
ATOM   1202 C  CB  . SER A 1 174 ? -22.776 -30.769 0.915   1.00 13.38 ? 189  SER B CB  1 
ATOM   1203 O  OG  . SER A 1 174 ? -22.689 -31.245 -0.415  1.00 13.93 ? 189  SER B OG  1 
ATOM   1204 N  N   . VAL A 1 175 ? -21.478 -32.938 2.545   1.00 14.55 ? 190  VAL B N   1 
ATOM   1205 C  CA  . VAL A 1 175 ? -21.060 -34.318 2.739   1.00 14.23 ? 190  VAL B CA  1 
ATOM   1206 C  C   . VAL A 1 175 ? -22.234 -35.286 2.648   1.00 13.73 ? 190  VAL B C   1 
ATOM   1207 O  O   . VAL A 1 175 ? -23.391 -34.905 2.847   1.00 14.83 ? 190  VAL B O   1 
ATOM   1208 C  CB  . VAL A 1 175 ? -20.368 -34.524 4.112   1.00 14.23 ? 190  VAL B CB  1 
ATOM   1209 C  CG1 . VAL A 1 175 ? -19.089 -33.711 4.203   1.00 15.06 ? 190  VAL B CG1 1 
ATOM   1210 C  CG2 . VAL A 1 175 ? -21.305 -34.170 5.255   1.00 14.59 ? 190  VAL B CG2 1 
ATOM   1211 N  N   . LYS A 1 176 ? -21.906 -36.539 2.338   1.00 14.93 ? 191  LYS B N   1 
ATOM   1212 C  CA  . LYS A 1 176 ? -22.853 -37.645 2.410   1.00 16.76 ? 191  LYS B CA  1 
ATOM   1213 C  C   . LYS A 1 176 ? -23.326 -37.882 3.843   1.00 18.86 ? 191  LYS B C   1 
ATOM   1214 O  O   . LYS A 1 176 ? -22.680 -37.467 4.807   1.00 17.66 ? 191  LYS B O   1 
ATOM   1215 C  CB  . LYS A 1 176 ? -22.198 -38.943 1.910   1.00 18.54 ? 191  LYS B CB  1 
ATOM   1216 C  CG  . LYS A 1 176 ? -21.438 -38.854 0.595   1.00 23.86 ? 191  LYS B CG  1 
ATOM   1217 C  CD  . LYS A 1 176 ? -20.580 -40.112 0.407   1.00 24.46 ? 191  LYS B CD  1 
ATOM   1218 C  CE  . LYS A 1 176 ? -19.614 -39.989 -0.762  1.00 28.33 ? 191  LYS B CE  1 
ATOM   1219 N  NZ  . LYS A 1 176 ? -20.287 -40.101 -2.082  1.00 27.93 ? 191  LYS B NZ  1 
ATOM   1220 N  N   . SER A 1 177 ? -24.455 -38.566 3.976   1.00 16.65 ? 192  SER B N   1 
ATOM   1221 C  CA  . SER A 1 177 ? -24.915 -39.027 5.274   1.00 18.59 ? 192  SER B CA  1 
ATOM   1222 C  C   . SER A 1 177 ? -24.332 -40.403 5.560   1.00 19.95 ? 192  SER B C   1 
ATOM   1223 O  O   . SER A 1 177 ? -23.676 -41.007 4.709   1.00 20.25 ? 192  SER B O   1 
ATOM   1224 C  CB  . SER A 1 177 ? -26.442 -39.123 5.301   1.00 18.96 ? 192  SER B CB  1 
ATOM   1225 O  OG  . SER A 1 177 ? -26.872 -40.309 4.652   1.00 19.74 ? 192  SER B OG  1 
ATOM   1226 N  N   . GLU A 1 178 ? -24.596 -40.906 6.760   1.00 21.90 ? 193  GLU B N   1 
ATOM   1227 C  CA  . GLU A 1 178 ? -24.186 -42.254 7.135   1.00 20.87 ? 193  GLU B CA  1 
ATOM   1228 C  C   . GLU A 1 178 ? -25.295 -43.266 6.875   1.00 24.67 ? 193  GLU B C   1 
ATOM   1229 O  O   . GLU A 1 178 ? -25.282 -44.360 7.442   1.00 25.81 ? 193  GLU B O   1 
ATOM   1230 C  CB  . GLU A 1 178 ? -23.807 -42.300 8.614   1.00 23.68 ? 193  GLU B CB  1 
ATOM   1231 C  CG  . GLU A 1 178 ? -22.814 -41.229 9.028   1.00 24.69 ? 193  GLU B CG  1 
ATOM   1232 C  CD  . GLU A 1 178 ? -21.455 -41.399 8.368   1.00 27.32 ? 193  GLU B CD  1 
ATOM   1233 O  OE1 . GLU A 1 178 ? -21.180 -42.486 7.813   1.00 30.41 ? 193  GLU B OE1 1 
ATOM   1234 O  OE2 . GLU A 1 178 ? -20.653 -40.445 8.406   1.00 26.52 ? 193  GLU B OE2 1 
ATOM   1235 N  N   . HIS A 1 179 ? -26.246 -42.906 6.015   1.00 21.48 ? 194  HIS B N   1 
ATOM   1236 C  CA  . HIS A 1 179 ? -27.447 -43.712 5.831   1.00 21.09 ? 194  HIS B CA  1 
ATOM   1237 C  C   . HIS A 1 179 ? -27.665 -44.195 4.397   1.00 21.11 ? 194  HIS B C   1 
ATOM   1238 O  O   . HIS A 1 179 ? -28.804 -44.285 3.930   1.00 21.39 ? 194  HIS B O   1 
ATOM   1239 C  CB  . HIS A 1 179 ? -28.670 -42.928 6.318   1.00 19.32 ? 194  HIS B CB  1 
ATOM   1240 C  CG  . HIS A 1 179 ? -28.493 -42.334 7.680   1.00 21.13 ? 194  HIS B CG  1 
ATOM   1241 N  ND1 . HIS A 1 179 ? -28.276 -43.107 8.800   1.00 22.00 ? 194  HIS B ND1 1 
ATOM   1242 C  CD2 . HIS A 1 179 ? -28.496 -41.047 8.104   1.00 21.09 ? 194  HIS B CD2 1 
ATOM   1243 C  CE1 . HIS A 1 179 ? -28.150 -42.322 9.856   1.00 23.10 ? 194  HIS B CE1 1 
ATOM   1244 N  NE2 . HIS A 1 179 ? -28.280 -41.068 9.461   1.00 21.34 ? 194  HIS B NE2 1 
ATOM   1245 N  N   . SER A 1 180 ? -26.581 -44.529 3.702   1.00 21.54 ? 195  SER B N   1 
ATOM   1246 C  CA  . SER A 1 180 ? -26.702 -45.011 2.329   1.00 19.92 ? 195  SER B CA  1 
ATOM   1247 C  C   . SER A 1 180 ? -25.751 -46.164 2.031   1.00 20.44 ? 195  SER B C   1 
ATOM   1248 O  O   . SER A 1 180 ? -25.629 -46.591 0.886   1.00 21.87 ? 195  SER B O   1 
ATOM   1249 C  CB  . SER A 1 180 ? -26.452 -43.863 1.344   1.00 25.01 ? 195  SER B CB  1 
ATOM   1250 O  OG  . SER A 1 180 ? -25.161 -43.302 1.536   1.00 27.25 ? 195  SER B OG  1 
ATOM   1251 N  N   . ALA A 1 181 ? -25.080 -46.674 3.057   1.00 21.43 ? 196  ALA B N   1 
ATOM   1252 C  CA  . ALA A 1 181 ? -23.987 -47.617 2.830   1.00 21.69 ? 196  ALA B CA  1 
ATOM   1253 C  C   . ALA A 1 181 ? -24.388 -49.072 2.557   1.00 19.78 ? 196  ALA B C   1 
ATOM   1254 O  O   . ALA A 1 181 ? -23.564 -49.851 2.079   1.00 20.80 ? 196  ALA B O   1 
ATOM   1255 C  CB  . ALA A 1 181 ? -22.974 -47.545 3.965   1.00 25.96 ? 196  ALA B CB  1 
ATOM   1256 N  N   . ALA A 1 182 ? -25.628 -49.452 2.856   1.00 20.10 ? 197  ALA B N   1 
ATOM   1257 C  CA  . ALA A 1 182 ? -26.042 -50.835 2.610   1.00 17.33 ? 197  ALA B CA  1 
ATOM   1258 C  C   . ALA A 1 182 ? -25.872 -51.196 1.135   1.00 17.57 ? 197  ALA B C   1 
ATOM   1259 O  O   . ALA A 1 182 ? -26.181 -50.406 0.244   1.00 16.42 ? 197  ALA B O   1 
ATOM   1260 C  CB  . ALA A 1 182 ? -27.483 -51.064 3.060   1.00 20.22 ? 197  ALA B CB  1 
HETATM 1261 ZN ZN  . ZN  B 2 .   ? -24.522 -23.446 0.946   1.00 15.42 ? 1001 ZN  B ZN  1 
HETATM 1262 S  S   . SO4 C 3 .   ? -19.220 -12.585 4.153   1.00 30.75 ? 1    SO4 B S   1 
HETATM 1263 O  O1  . SO4 C 3 .   ? -17.839 -12.986 3.899   1.00 24.08 ? 1    SO4 B O1  1 
HETATM 1264 O  O2  . SO4 C 3 .   ? -19.649 -11.731 3.042   1.00 35.79 ? 1    SO4 B O2  1 
HETATM 1265 O  O3  . SO4 C 3 .   ? -20.110 -13.739 4.244   1.00 34.63 ? 1    SO4 B O3  1 
HETATM 1266 O  O4  . SO4 C 3 .   ? -19.321 -11.859 5.421   1.00 30.88 ? 1    SO4 B O4  1 
HETATM 1267 O  O   . HOH D 4 .   ? -8.451  -18.538 -6.050  1.00 17.68 ? 2    HOH B O   1 
HETATM 1268 O  O   . HOH D 4 .   ? -21.582 -38.215 9.605   1.00 19.19 ? 3    HOH B O   1 
HETATM 1269 O  O   . HOH D 4 .   ? -17.871 -37.111 -3.995  1.00 19.40 ? 4    HOH B O   1 
HETATM 1270 O  O   . HOH D 4 .   ? -27.461 -28.359 -0.243  1.00 16.35 ? 5    HOH B O   1 
HETATM 1271 O  O   . HOH D 4 .   ? -14.823 -14.986 -5.253  1.00 19.76 ? 6    HOH B O   1 
HETATM 1272 O  O   . HOH D 4 .   ? -30.403 -20.724 13.977  1.00 19.13 ? 7    HOH B O   1 
HETATM 1273 O  O   . HOH D 4 .   ? -28.776 -32.271 -6.582  1.00 20.32 ? 8    HOH B O   1 
HETATM 1274 O  O   . HOH D 4 .   ? -15.625 -32.753 -4.002  1.00 18.16 ? 9    HOH B O   1 
HETATM 1275 O  O   . HOH D 4 .   ? -8.157  -22.723 9.356   1.00 18.58 ? 10   HOH B O   1 
HETATM 1276 O  O   . HOH D 4 .   ? -31.998 -40.592 7.116   1.00 19.19 ? 11   HOH B O   1 
HETATM 1277 O  O   . HOH D 4 .   ? -29.775 -21.714 11.508  1.00 18.60 ? 12   HOH B O   1 
HETATM 1278 O  O   . HOH D 4 .   ? -21.460 -9.691  2.734   1.00 22.41 ? 13   HOH B O   1 
HETATM 1279 O  O   . HOH D 4 .   ? -23.238 -26.385 10.612  1.00 19.42 ? 14   HOH B O   1 
HETATM 1280 O  O   . HOH D 4 .   ? -24.251 -27.791 8.309   1.00 20.09 ? 15   HOH B O   1 
HETATM 1281 O  O   . HOH D 4 .   ? -22.999 -36.901 7.519   1.00 16.46 ? 203  HOH B O   1 
HETATM 1282 O  O   . HOH D 4 .   ? -23.513 -17.733 10.169  1.00 22.53 ? 204  HOH B O   1 
HETATM 1283 O  O   . HOH D 4 .   ? -16.892 -13.353 1.320   1.00 20.84 ? 205  HOH B O   1 
HETATM 1284 O  O   . HOH D 4 .   ? -26.024 -21.567 9.991   1.00 19.09 ? 206  HOH B O   1 
HETATM 1285 O  O   . HOH D 4 .   ? -0.000  -18.485 0.000   0.50 23.03 ? 207  HOH B O   1 
HETATM 1286 O  O   . HOH D 4 .   ? -12.192 -24.829 21.293  1.00 22.37 ? 208  HOH B O   1 
HETATM 1287 O  O   . HOH D 4 .   ? -8.227  -28.887 12.258  1.00 21.06 ? 209  HOH B O   1 
HETATM 1288 O  O   . HOH D 4 .   ? -6.024  -29.593 -9.046  1.00 23.70 ? 210  HOH B O   1 
HETATM 1289 O  O   . HOH D 4 .   ? -7.142  -29.588 1.264   1.00 21.34 ? 211  HOH B O   1 
HETATM 1290 O  O   . HOH D 4 .   ? -25.955 -19.486 0.839   1.00 20.16 ? 212  HOH B O   1 
HETATM 1291 O  O   . HOH D 4 .   ? 2.346   -23.921 4.442   1.00 21.25 ? 213  HOH B O   1 
HETATM 1292 O  O   . HOH D 4 .   ? -11.471 -16.954 -6.746  1.00 21.14 ? 214  HOH B O   1 
HETATM 1293 O  O   . HOH D 4 .   ? -27.108 -30.070 -7.456  1.00 22.36 ? 215  HOH B O   1 
HETATM 1294 O  O   . HOH D 4 .   ? -13.500 -34.823 -2.260  1.00 22.55 ? 216  HOH B O   1 
HETATM 1295 O  O   . HOH D 4 .   ? -11.231 -19.358 -10.073 1.00 23.99 ? 217  HOH B O   1 
HETATM 1296 O  O   . HOH D 4 .   ? -21.285 -20.068 16.185  1.00 20.83 ? 218  HOH B O   1 
HETATM 1297 O  O   . HOH D 4 .   ? 0.663   -22.080 8.084   1.00 24.16 ? 219  HOH B O   1 
HETATM 1298 O  O   . HOH D 4 .   ? -8.997  -18.465 -8.766  1.00 24.66 ? 220  HOH B O   1 
HETATM 1299 O  O   . HOH D 4 .   ? -12.163 -9.444  -1.840  1.00 24.42 ? 221  HOH B O   1 
HETATM 1300 O  O   . HOH D 4 .   ? -7.516  -13.258 8.479   1.00 26.21 ? 222  HOH B O   1 
HETATM 1301 O  O   . HOH D 4 .   ? -32.335 -18.829 13.701  1.00 24.14 ? 223  HOH B O   1 
HETATM 1302 O  O   . HOH D 4 .   ? -28.079 -35.150 8.066   1.00 21.29 ? 224  HOH B O   1 
HETATM 1303 O  O   . HOH D 4 .   ? -23.153 -24.128 -11.994 1.00 26.11 ? 225  HOH B O   1 
HETATM 1304 O  O   . HOH D 4 .   ? -15.198 -29.438 18.905  1.00 25.08 ? 226  HOH B O   1 
HETATM 1305 O  O   . HOH D 4 .   ? -7.092  -31.439 3.652   1.00 22.54 ? 227  HOH B O   1 
HETATM 1306 O  O   . HOH D 4 .   ? -27.597 -37.553 8.882   1.00 24.33 ? 228  HOH B O   1 
HETATM 1307 O  O   . HOH D 4 .   ? -15.635 -30.067 -11.723 1.00 22.19 ? 229  HOH B O   1 
HETATM 1308 O  O   . HOH D 4 .   ? -12.343 -34.329 13.205  1.00 29.11 ? 230  HOH B O   1 
HETATM 1309 O  O   . HOH D 4 .   ? -36.965 -36.548 7.606   1.00 26.09 ? 231  HOH B O   1 
HETATM 1310 O  O   . HOH D 4 .   ? -15.517 -18.061 15.613  1.00 23.48 ? 232  HOH B O   1 
HETATM 1311 O  O   . HOH D 4 .   ? -19.067 -28.434 -12.666 1.00 23.44 ? 233  HOH B O   1 
HETATM 1312 O  O   . HOH D 4 .   ? -19.932 -15.866 2.777   1.00 22.94 ? 234  HOH B O   1 
HETATM 1313 O  O   . HOH D 4 .   ? -34.627 -25.935 8.224   1.00 23.78 ? 235  HOH B O   1 
HETATM 1314 O  O   . HOH D 4 .   ? -37.052 -32.553 11.801  1.00 27.01 ? 236  HOH B O   1 
HETATM 1315 O  O   . HOH D 4 .   ? -23.085 -37.118 13.219  1.00 22.48 ? 237  HOH B O   1 
HETATM 1316 O  O   . HOH D 4 .   ? -23.604 -43.815 4.273   1.00 26.59 ? 238  HOH B O   1 
HETATM 1317 O  O   . HOH D 4 .   ? -23.462 -24.183 18.734  1.00 27.23 ? 239  HOH B O   1 
HETATM 1318 O  O   . HOH D 4 .   ? -29.499 -18.819 7.366   1.00 23.44 ? 240  HOH B O   1 
HETATM 1319 O  O   . HOH D 4 .   ? -23.484 -39.126 -9.468  1.00 25.90 ? 241  HOH B O   1 
HETATM 1320 O  O   . HOH D 4 .   ? -27.175 -31.912 18.728  1.00 26.07 ? 242  HOH B O   1 
HETATM 1321 O  O   . HOH D 4 .   ? -23.512 -32.340 -13.999 1.00 24.83 ? 243  HOH B O   1 
HETATM 1322 O  O   . HOH D 4 .   ? -27.356 -17.328 8.491   1.00 26.15 ? 244  HOH B O   1 
HETATM 1323 O  O   . HOH D 4 .   ? -14.344 -15.957 -9.650  1.00 28.46 ? 245  HOH B O   1 
HETATM 1324 O  O   . HOH D 4 .   ? -35.350 -27.276 10.507  1.00 25.37 ? 246  HOH B O   1 
HETATM 1325 O  O   . HOH D 4 .   ? -35.137 -25.839 14.657  1.00 26.25 ? 247  HOH B O   1 
HETATM 1326 O  O   . HOH D 4 .   ? -19.128 -18.130 16.477  1.00 23.66 ? 248  HOH B O   1 
HETATM 1327 O  O   . HOH D 4 .   ? -4.590  -20.836 -7.529  1.00 23.56 ? 249  HOH B O   1 
HETATM 1328 O  O   . HOH D 4 .   ? -2.310  -29.173 3.464   1.00 27.61 ? 250  HOH B O   1 
HETATM 1329 O  O   . HOH D 4 .   ? -27.351 -38.844 1.811   1.00 23.92 ? 251  HOH B O   1 
HETATM 1330 O  O   . HOH D 4 .   ? -15.825 -34.793 -11.663 1.00 29.09 ? 252  HOH B O   1 
HETATM 1331 O  O   . HOH D 4 .   ? -5.578  -18.661 -6.123  1.00 25.07 ? 253  HOH B O   1 
HETATM 1332 O  O   . HOH D 4 .   ? -3.020  -23.081 -6.898  1.00 22.93 ? 254  HOH B O   1 
HETATM 1333 O  O   . HOH D 4 .   ? -27.633 -28.494 -4.934  1.00 24.72 ? 255  HOH B O   1 
HETATM 1334 O  O   . HOH D 4 .   ? -30.301 -37.806 8.095   1.00 25.38 ? 256  HOH B O   1 
HETATM 1335 O  O   . HOH D 4 .   ? -25.175 -38.549 8.579   1.00 23.14 ? 257  HOH B O   1 
HETATM 1336 O  O   . HOH D 4 .   ? -38.480 -36.363 15.384  1.00 30.71 ? 258  HOH B O   1 
HETATM 1337 O  O   . HOH D 4 .   ? -4.556  -11.993 4.184   1.00 27.56 ? 259  HOH B O   1 
HETATM 1338 O  O   . HOH D 4 .   ? -24.997 -46.684 6.118   1.00 26.86 ? 260  HOH B O   1 
HETATM 1339 O  O   . HOH D 4 .   ? -16.816 -13.633 11.015  1.00 26.25 ? 261  HOH B O   1 
HETATM 1340 O  O   . HOH D 4 .   ? -26.855 -21.892 -6.469  1.00 25.57 ? 262  HOH B O   1 
HETATM 1341 O  O   . HOH D 4 .   ? -1.831  -26.012 -0.504  1.00 32.10 ? 263  HOH B O   1 
HETATM 1342 O  O   . HOH D 4 .   ? -27.368 -23.634 18.030  1.00 28.31 ? 264  HOH B O   1 
HETATM 1343 O  O   . HOH D 4 .   ? -36.477 -35.392 11.350  1.00 29.72 ? 265  HOH B O   1 
HETATM 1344 O  O   . HOH D 4 .   ? -37.664 -33.918 8.238   1.00 26.96 ? 266  HOH B O   1 
HETATM 1345 O  O   . HOH D 4 .   ? -9.882  -23.026 -13.097 1.00 27.24 ? 267  HOH B O   1 
HETATM 1346 O  O   . HOH D 4 .   ? -25.521 -45.259 10.163  1.00 33.13 ? 268  HOH B O   1 
HETATM 1347 O  O   . HOH D 4 .   ? -11.159 -35.437 5.450   1.00 29.19 ? 269  HOH B O   1 
HETATM 1348 O  O   . HOH D 4 .   ? -18.091 -40.620 7.413   1.00 30.32 ? 270  HOH B O   1 
HETATM 1349 O  O   . HOH D 4 .   ? -26.466 -20.856 -10.282 1.00 31.97 ? 271  HOH B O   1 
HETATM 1350 O  O   . HOH D 4 .   ? -36.265 -25.404 12.031  1.00 24.64 ? 272  HOH B O   1 
HETATM 1351 O  O   . HOH D 4 .   ? -16.381 -38.194 -1.900  1.00 27.42 ? 273  HOH B O   1 
HETATM 1352 O  O   . HOH D 4 .   ? -29.591 -42.001 1.858   1.00 26.20 ? 274  HOH B O   1 
HETATM 1353 O  O   . HOH D 4 .   ? -4.910  -17.498 -3.562  1.00 26.32 ? 275  HOH B O   1 
HETATM 1354 O  O   . HOH D 4 .   ? -21.922 -44.786 6.331   1.00 32.07 ? 276  HOH B O   1 
HETATM 1355 O  O   . HOH D 4 .   ? -1.084  -15.659 3.601   1.00 30.36 ? 277  HOH B O   1 
HETATM 1356 O  O   . HOH D 4 .   ? -2.929  -12.813 1.153   1.00 31.49 ? 278  HOH B O   1 
HETATM 1357 O  O   . HOH D 4 .   ? -30.175 -27.266 -2.530  1.00 26.32 ? 279  HOH B O   1 
HETATM 1358 O  O   . HOH D 4 .   ? -15.522 -37.276 -5.577  1.00 28.71 ? 280  HOH B O   1 
HETATM 1359 O  O   . HOH D 4 .   ? -13.776 -34.141 -7.476  1.00 29.81 ? 281  HOH B O   1 
HETATM 1360 O  O   . HOH D 4 .   ? -36.284 -36.891 13.579  1.00 27.62 ? 282  HOH B O   1 
HETATM 1361 O  O   . HOH D 4 .   ? -26.266 -30.031 -10.931 1.00 31.00 ? 283  HOH B O   1 
HETATM 1362 O  O   . HOH D 4 .   ? -14.359 -38.110 1.120   1.00 33.16 ? 284  HOH B O   1 
HETATM 1363 O  O   . HOH D 4 .   ? -17.051 -19.354 -14.697 1.00 28.49 ? 285  HOH B O   1 
HETATM 1364 O  O   . HOH D 4 .   ? -6.141  -27.403 13.146  1.00 27.92 ? 286  HOH B O   1 
HETATM 1365 O  O   . HOH D 4 .   ? -5.429  -11.841 -3.376  1.00 31.93 ? 287  HOH B O   1 
HETATM 1366 O  O   . HOH D 4 .   ? -24.430 -17.508 19.651  1.00 30.57 ? 288  HOH B O   1 
HETATM 1367 O  O   . HOH D 4 .   ? -0.647  -16.489 -1.626  1.00 28.26 ? 289  HOH B O   1 
HETATM 1368 O  O   . HOH D 4 .   ? -33.119 -33.263 -3.542  1.00 33.59 ? 290  HOH B O   1 
HETATM 1369 O  O   . HOH D 4 .   ? -32.781 -21.288 17.292  1.00 31.35 ? 291  HOH B O   1 
HETATM 1370 O  O   . HOH D 4 .   ? -10.441 -26.923 -10.933 1.00 27.04 ? 292  HOH B O   1 
HETATM 1371 O  O   . HOH D 4 .   ? -14.255 -35.161 -5.204  1.00 29.96 ? 293  HOH B O   1 
HETATM 1372 O  O   . HOH D 4 .   ? -31.195 -27.164 21.386  1.00 35.44 ? 294  HOH B O   1 
HETATM 1373 O  O   . HOH D 4 .   ? -23.664 -40.845 -1.149  1.00 28.26 ? 295  HOH B O   1 
HETATM 1374 O  O   . HOH D 4 .   ? -27.390 -33.124 -14.456 1.00 31.91 ? 296  HOH B O   1 
HETATM 1375 O  O   . HOH D 4 .   ? -16.425 -29.274 -14.179 1.00 26.65 ? 297  HOH B O   1 
HETATM 1376 O  O   . HOH D 4 .   ? -7.192  -22.343 -13.751 1.00 33.31 ? 298  HOH B O   1 
HETATM 1377 O  O   . HOH D 4 .   ? -26.414 -35.552 -14.166 1.00 31.23 ? 299  HOH B O   1 
HETATM 1378 O  O   . HOH D 4 .   ? -17.819 -39.511 -7.407  1.00 33.57 ? 300  HOH B O   1 
HETATM 1379 O  O   . HOH D 4 .   ? -38.285 -31.837 5.516   1.00 30.60 ? 301  HOH B O   1 
HETATM 1380 O  O   . HOH D 4 .   ? -25.265 -40.250 1.617   1.00 28.06 ? 302  HOH B O   1 
HETATM 1381 O  O   . HOH D 4 .   ? -23.658 -25.824 20.852  1.00 34.12 ? 303  HOH B O   1 
HETATM 1382 O  O   . HOH D 4 .   ? -24.124 -20.560 20.835  1.00 32.31 ? 304  HOH B O   1 
HETATM 1383 O  O   . HOH D 4 .   ? -29.208 -11.908 12.148  1.00 29.84 ? 305  HOH B O   1 
HETATM 1384 O  O   . HOH D 4 .   ? -38.710 -32.668 -0.195  1.00 36.93 ? 306  HOH B O   1 
HETATM 1385 O  O   . HOH D 4 .   ? -26.156 -10.531 12.374  1.00 28.43 ? 307  HOH B O   1 
HETATM 1386 O  O   . HOH D 4 .   ? -3.911  -20.491 -10.163 1.00 33.33 ? 308  HOH B O   1 
HETATM 1387 O  O   . HOH D 4 .   ? -36.681 -24.772 -4.200  1.00 35.66 ? 309  HOH B O   1 
HETATM 1388 O  O   . HOH D 4 .   ? -10.295 -34.582 10.118  1.00 27.95 ? 310  HOH B O   1 
HETATM 1389 O  O   . HOH D 4 .   ? -33.037 -28.099 -2.935  1.00 31.96 ? 311  HOH B O   1 
HETATM 1390 O  O   . HOH D 4 .   ? -18.139 -11.618 10.034  1.00 31.44 ? 312  HOH B O   1 
HETATM 1391 O  O   . HOH D 4 .   ? -5.856  -33.320 2.376   1.00 35.25 ? 313  HOH B O   1 
HETATM 1392 O  O   . HOH D 4 .   ? -16.214 -38.979 9.123   1.00 31.88 ? 314  HOH B O   1 
HETATM 1393 O  O   . HOH D 4 .   ? -36.017 -37.200 -0.028  1.00 30.49 ? 315  HOH B O   1 
HETATM 1394 O  O   . HOH D 4 .   ? -13.941 -18.233 -12.950 1.00 30.48 ? 316  HOH B O   1 
HETATM 1395 O  O   . HOH D 4 .   ? -19.976 -38.130 16.675  1.00 33.72 ? 317  HOH B O   1 
HETATM 1396 O  O   . HOH D 4 .   ? -21.962 -44.193 2.132   1.00 36.49 ? 318  HOH B O   1 
HETATM 1397 O  O   . HOH D 4 .   ? -24.307 -41.362 -8.298  1.00 26.41 ? 319  HOH B O   1 
HETATM 1398 O  O   . HOH D 4 .   ? -23.680 -38.897 11.336  1.00 34.04 ? 320  HOH B O   1 
HETATM 1399 O  O   . HOH D 4 .   ? -22.506 -47.121 7.307   1.00 34.70 ? 321  HOH B O   1 
HETATM 1400 O  O   . HOH D 4 .   ? -25.964 -18.357 11.220  1.00 28.76 ? 322  HOH B O   1 
HETATM 1401 O  O   . HOH D 4 .   ? -12.672 -13.539 10.041  1.00 30.57 ? 323  HOH B O   1 
HETATM 1402 O  O   . HOH D 4 .   ? -22.855 -9.688  7.173   1.00 33.18 ? 324  HOH B O   1 
HETATM 1403 O  O   . HOH D 4 .   ? -21.131 -40.246 -9.920  1.00 31.28 ? 325  HOH B O   1 
HETATM 1404 O  O   . HOH D 4 .   ? -10.280 -20.369 -12.691 1.00 33.01 ? 326  HOH B O   1 
HETATM 1405 O  O   . HOH D 4 .   ? -32.659 -29.515 21.321  1.00 35.24 ? 327  HOH B O   1 
HETATM 1406 O  O   . HOH D 4 .   ? -29.199 -21.149 20.547  1.00 35.12 ? 328  HOH B O   1 
HETATM 1407 O  O   . HOH D 4 .   ? -4.860  -29.699 -0.335  1.00 32.73 ? 329  HOH B O   1 
HETATM 1408 O  O   . HOH D 4 .   ? -37.280 -23.758 1.866   1.00 35.97 ? 330  HOH B O   1 
HETATM 1409 O  O   . HOH D 4 .   ? -14.205 -35.942 -9.650  1.00 33.58 ? 331  HOH B O   1 
HETATM 1410 O  O   . HOH D 4 .   ? -2.945  -25.387 14.314  1.00 34.85 ? 332  HOH B O   1 
HETATM 1411 O  O   . HOH D 4 .   ? -3.110  -16.040 -2.529  1.00 33.14 ? 333  HOH B O   1 
HETATM 1412 O  O   . HOH D 4 .   ? -13.607 -37.356 -2.038  1.00 33.23 ? 334  HOH B O   1 
HETATM 1413 O  O   . HOH D 4 .   ? -0.271  -24.362 9.133   1.00 29.31 ? 335  HOH B O   1 
HETATM 1414 O  O   . HOH D 4 .   ? -7.423  -27.415 15.934  1.00 33.27 ? 336  HOH B O   1 
HETATM 1415 O  O   . HOH D 4 .   ? -35.423 -19.447 0.800   1.00 31.57 ? 337  HOH B O   1 
HETATM 1416 O  O   . HOH D 4 .   ? -14.229 -20.199 16.521  1.00 31.92 ? 338  HOH B O   1 
HETATM 1417 O  O   . HOH D 4 .   ? -38.129 -21.678 2.990   1.00 36.56 ? 339  HOH B O   1 
HETATM 1418 O  O   . HOH D 4 .   ? -9.345  -34.548 -6.486  1.00 36.17 ? 340  HOH B O   1 
HETATM 1419 O  O   . HOH D 4 .   ? -10.873 -27.457 -13.624 1.00 31.84 ? 341  HOH B O   1 
HETATM 1420 O  O   . HOH D 4 .   ? -3.064  -26.984 1.532   1.00 32.26 ? 342  HOH B O   1 
HETATM 1421 O  O   . HOH D 4 .   ? -8.422  -35.336 4.665   1.00 32.53 ? 343  HOH B O   1 
HETATM 1422 O  O   . HOH D 4 .   ? -23.086 -13.284 20.923  1.00 33.98 ? 344  HOH B O   1 
HETATM 1423 O  O   . HOH D 4 .   ? -3.039  -30.338 -12.219 1.00 34.40 ? 345  HOH B O   1 
HETATM 1424 O  O   . HOH D 4 .   ? -33.618 -19.793 -1.850  1.00 34.28 ? 346  HOH B O   1 
HETATM 1425 O  O   . HOH D 4 .   ? -2.985  -19.515 9.763   1.00 24.65 ? 347  HOH B O   1 
HETATM 1426 O  O   . HOH D 4 .   ? -14.201 -22.778 17.107  1.00 27.47 ? 348  HOH B O   1 
HETATM 1427 O  O   . HOH D 4 .   ? -25.735 -30.148 -14.911 1.00 34.67 ? 349  HOH B O   1 
HETATM 1428 O  O   . HOH D 4 .   ? -14.128 -30.179 16.082  1.00 30.18 ? 350  HOH B O   1 
HETATM 1429 O  O   . HOH D 4 .   ? -26.142 -17.795 14.005  1.00 27.39 ? 351  HOH B O   1 
HETATM 1430 O  O   . HOH D 4 .   ? -28.326 -24.194 -6.488  1.00 30.13 ? 352  HOH B O   1 
HETATM 1431 O  O   . HOH D 4 .   ? -13.418 -21.684 19.029  1.00 32.49 ? 353  HOH B O   1 
HETATM 1432 O  O   . HOH D 4 .   ? -25.109 -19.819 13.550  1.00 27.27 ? 354  HOH B O   1 
HETATM 1433 O  O   . HOH D 4 .   ? -19.534 -19.430 -15.788 1.00 32.84 ? 355  HOH B O   1 
HETATM 1434 O  O   . HOH D 4 .   ? -25.899 -27.427 -9.339  1.00 37.42 ? 356  HOH B O   1 
HETATM 1435 O  O   . HOH D 4 .   ? -8.131  -31.425 13.265  1.00 33.16 ? 357  HOH B O   1 
HETATM 1436 O  O   . HOH D 4 .   ? -25.751 -27.497 21.032  1.00 33.00 ? 358  HOH B O   1 
HETATM 1437 O  O   . HOH D 4 .   ? -35.967 -39.806 13.442  1.00 35.10 ? 359  HOH B O   1 
HETATM 1438 O  O   . HOH D 4 .   ? -37.535 -27.117 16.425  1.00 33.43 ? 360  HOH B O   1 
HETATM 1439 O  O   . HOH D 4 .   ? -25.529 -40.589 11.753  1.00 33.69 ? 361  HOH B O   1 
HETATM 1440 O  O   . HOH D 4 .   ? -40.873 -34.511 -0.946  1.00 35.73 ? 362  HOH B O   1 
HETATM 1441 O  O   . HOH D 4 .   ? -30.789 -25.137 -5.178  1.00 33.84 ? 363  HOH B O   1 
HETATM 1442 O  O   . HOH D 4 .   ? -23.579 -14.867 23.260  1.00 30.18 ? 364  HOH B O   1 
HETATM 1443 O  O   . HOH D 4 .   ? -20.057 -12.198 12.600  1.00 34.10 ? 365  HOH B O   1 
HETATM 1444 O  O   . HOH D 4 .   ? -9.771  -15.668 -8.619  1.00 35.52 ? 366  HOH B O   1 
HETATM 1445 O  O   . HOH D 4 .   ? -21.401 -40.502 -12.606 1.00 37.79 ? 367  HOH B O   1 
HETATM 1446 O  O   . HOH D 4 .   ? -25.740 -22.316 -0.253  1.00 15.93 ? 368  HOH B O   1 
HETATM 1447 O  O   . HOH D 4 .   ? -23.706 -15.699 5.465   1.00 26.97 ? 369  HOH B O   1 
HETATM 1448 O  O   . HOH D 4 .   ? -24.774 -13.584 4.797   1.00 25.63 ? 370  HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   16  ?   ?   ?   B . n 
A 1 2   ARG 2   17  ?   ?   ?   B . n 
A 1 3   GLY 3   18  ?   ?   ?   B . n 
A 1 4   SER 4   19  ?   ?   ?   B . n 
A 1 5   HIS 5   20  ?   ?   ?   B . n 
A 1 6   HIS 6   21  ?   ?   ?   B . n 
A 1 7   HIS 7   22  ?   ?   ?   B . n 
A 1 8   HIS 8   23  ?   ?   ?   B . n 
A 1 9   HIS 9   24  ?   ?   ?   B . n 
A 1 10  HIS 10  25  ?   ?   ?   B . n 
A 1 11  GLY 11  26  ?   ?   ?   B . n 
A 1 12  SER 12  27  ?   ?   ?   B . n 
A 1 13  CYS 13  28  ?   ?   ?   B . n 
A 1 14  GLY 14  29  ?   ?   ?   B . n 
A 1 15  PRO 15  30  ?   ?   ?   B . n 
A 1 16  GLY 16  31  ?   ?   ?   B . n 
A 1 17  ARG 17  32  ?   ?   ?   B . n 
A 1 18  VAL 18  33  ?   ?   ?   B . n 
A 1 19  VAL 19  34  ?   ?   ?   B . n 
A 1 20  GLY 20  35  ?   ?   ?   B . n 
A 1 21  SER 21  36  ?   ?   ?   B . n 
A 1 22  ARG 22  37  ?   ?   ?   B . n 
A 1 23  ARG 23  38  ?   ?   ?   B . n 
A 1 24  ARG 24  39  ?   ?   ?   B . n 
A 1 25  PRO 25  40  ?   ?   ?   B . n 
A 1 26  PRO 26  41  41  PRO PRO B . n 
A 1 27  ARG 27  42  42  ARG ARG B . n 
A 1 28  LYS 28  43  43  LYS LYS B . n 
A 1 29  LEU 29  44  44  LEU LEU B . n 
A 1 30  VAL 30  45  45  VAL VAL B . n 
A 1 31  PRO 31  46  46  PRO PRO B . n 
A 1 32  LEU 32  47  47  LEU LEU B . n 
A 1 33  ALA 33  48  48  ALA ALA B . n 
A 1 34  TYR 34  49  49  TYR TYR B . n 
A 1 35  LYS 35  50  50  LYS LYS B . n 
A 1 36  GLN 36  51  51  GLN GLN B . n 
A 1 37  PHE 37  52  52  PHE PHE B . n 
A 1 38  SER 38  53  53  SER SER B . n 
A 1 39  PRO 39  54  54  PRO PRO B . n 
A 1 40  ASN 40  55  55  ASN ASN B . n 
A 1 41  VAL 41  56  56  VAL VAL B . n 
A 1 42  PRO 42  57  57  PRO PRO B . n 
A 1 43  GLU 43  58  58  GLU GLU B . n 
A 1 44  LYS 44  59  59  LYS LYS B . n 
A 1 45  THR 45  60  60  THR THR B . n 
A 1 46  LEU 46  61  61  LEU LEU B . n 
A 1 47  GLY 47  62  62  GLY GLY B . n 
A 1 48  ALA 48  63  63  ALA ALA B . n 
A 1 49  SER 49  64  64  SER SER B . n 
A 1 50  GLY 50  65  65  GLY GLY B . n 
A 1 51  ARG 51  66  66  ARG ARG B . n 
A 1 52  TYR 52  67  67  TYR TYR B . n 
A 1 53  GLU 53  68  68  GLU GLU B . n 
A 1 54  GLY 54  69  69  GLY GLY B . n 
A 1 55  LYS 55  70  70  LYS LYS B . n 
A 1 56  ILE 56  71  71  ILE ILE B . n 
A 1 57  ALA 57  72  72  ALA ALA B . n 
A 1 58  ARG 58  73  73  ARG ARG B . n 
A 1 59  SER 59  74  74  SER SER B . n 
A 1 60  SER 60  75  75  SER SER B . n 
A 1 61  GLU 61  76  76  GLU GLU B . n 
A 1 62  ARG 62  77  77  ARG ARG B . n 
A 1 63  PHE 63  78  78  PHE PHE B . n 
A 1 64  LYS 64  79  79  LYS LYS B . n 
A 1 65  GLU 65  80  80  GLU GLU B . n 
A 1 66  LEU 66  81  81  LEU LEU B . n 
A 1 67  THR 67  82  82  THR THR B . n 
A 1 68  PRO 68  83  83  PRO PRO B . n 
A 1 69  ASN 69  84  84  ASN ASN B . n 
A 1 70  TYR 70  85  85  TYR TYR B . n 
A 1 71  ASN 71  86  86  ASN ASN B . n 
A 1 72  PRO 72  87  87  PRO PRO B . n 
A 1 73  ASP 73  88  88  ASP ASP B . n 
A 1 74  ILE 74  89  89  ILE ILE B . n 
A 1 75  ILE 75  90  90  ILE ILE B . n 
A 1 76  PHE 76  91  91  PHE PHE B . n 
A 1 77  LYS 77  92  92  LYS LYS B . n 
A 1 78  ASP 78  93  93  ASP ASP B . n 
A 1 79  GLU 79  94  94  GLU GLU B . n 
A 1 80  LYS 80  95  95  LYS LYS B . n 
A 1 81  ASN 81  96  96  ASN ASN B . n 
A 1 82  THR 82  97  97  THR THR B . n 
A 1 83  GLY 83  98  98  GLY GLY B . n 
A 1 84  ALA 84  99  99  ALA ALA B . n 
A 1 85  ASP 85  100 100 ASP ASP B . n 
A 1 86  ARG 86  101 101 ARG ARG B . n 
A 1 87  LEU 87  102 102 LEU LEU B . n 
A 1 88  MET 88  103 103 MET MET B . n 
A 1 89  THR 89  104 104 THR THR B . n 
A 1 90  GLN 90  105 105 GLN GLN B . n 
A 1 91  ARG 91  106 106 ARG ARG B . n 
A 1 92  CYS 92  107 107 CYS CYS B . n 
A 1 93  LYS 93  108 108 LYS LYS B . n 
A 1 94  ASP 94  109 109 ASP ASP B . n 
A 1 95  ARG 95  110 110 ARG ARG B . n 
A 1 96  LEU 96  111 111 LEU LEU B . n 
A 1 97  ASN 97  112 112 ASN ASN B . n 
A 1 98  SER 98  113 113 SER SER B . n 
A 1 99  LEU 99  114 114 LEU LEU B . n 
A 1 100 ALA 100 115 115 ALA ALA B . n 
A 1 101 ILE 101 116 116 ILE ILE B . n 
A 1 102 SER 102 117 117 SER SER B . n 
A 1 103 VAL 103 118 118 VAL VAL B . n 
A 1 104 MET 104 119 119 MET MET B . n 
A 1 105 ASN 105 120 120 ASN ASN B . n 
A 1 106 GLN 106 121 121 GLN GLN B . n 
A 1 107 TRP 107 122 122 TRP TRP B . n 
A 1 108 PRO 108 123 123 PRO PRO B . n 
A 1 109 GLY 109 124 124 GLY GLY B . n 
A 1 110 VAL 110 125 125 VAL VAL B . n 
A 1 111 LYS 111 126 126 LYS LYS B . n 
A 1 112 LEU 112 127 127 LEU LEU B . n 
A 1 113 ARG 113 128 128 ARG ARG B . n 
A 1 114 VAL 114 129 129 VAL VAL B . n 
A 1 115 THR 115 130 130 THR THR B . n 
A 1 116 GLU 116 131 131 GLU GLU B . n 
A 1 117 GLY 117 132 132 GLY GLY B . n 
A 1 118 TRP 118 133 133 TRP TRP B . n 
A 1 119 ASP 119 134 134 ASP ASP B . n 
A 1 120 GLU 120 135 135 GLU GLU B . n 
A 1 121 ASP 121 136 136 ASP ASP B . n 
A 1 122 GLY 122 137 137 GLY GLY B . n 
A 1 123 HIS 123 138 138 HIS HIS B . n 
A 1 124 HIS 124 139 139 HIS HIS B . n 
A 1 125 SER 125 140 140 SER SER B . n 
A 1 126 GLU 126 141 141 GLU GLU B . n 
A 1 127 GLU 127 142 142 GLU GLU B . n 
A 1 128 SER 128 143 143 SER SER B . n 
A 1 129 LEU 129 144 144 LEU LEU B . n 
A 1 130 HIS 130 145 145 HIS HIS B . n 
A 1 131 TYR 131 146 146 TYR TYR B . n 
A 1 132 GLU 132 147 147 GLU GLU B . n 
A 1 133 GLY 133 148 148 GLY GLY B . n 
A 1 134 ARG 134 149 149 ARG ARG B . n 
A 1 135 ALA 135 150 150 ALA ALA B . n 
A 1 136 VAL 136 151 151 VAL VAL B . n 
A 1 137 ASP 137 152 152 ASP ASP B . n 
A 1 138 ILE 138 153 153 ILE ILE B . n 
A 1 139 THR 139 154 154 THR THR B . n 
A 1 140 THR 140 155 155 THR THR B . n 
A 1 141 SER 141 156 156 SER SER B . n 
A 1 142 ASP 142 157 157 ASP ASP B . n 
A 1 143 ARG 143 158 158 ARG ARG B . n 
A 1 144 ASP 144 159 159 ASP ASP B . n 
A 1 145 ARG 145 160 160 ARG ARG B . n 
A 1 146 ASN 146 161 161 ASN ASN B . n 
A 1 147 LYS 147 162 162 LYS LYS B . n 
A 1 148 TYR 148 163 163 TYR TYR B . n 
A 1 149 GLY 149 164 164 GLY GLY B . n 
A 1 150 LEU 150 165 165 LEU LEU B . n 
A 1 151 LEU 151 166 166 LEU LEU B . n 
A 1 152 ALA 152 167 167 ALA ALA B . n 
A 1 153 ARG 153 168 168 ARG ARG B . n 
A 1 154 LEU 154 169 169 LEU LEU B . n 
A 1 155 ALA 155 170 170 ALA ALA B . n 
A 1 156 VAL 156 171 171 VAL VAL B . n 
A 1 157 GLU 157 172 172 GLU GLU B . n 
A 1 158 ALA 158 173 173 ALA ALA B . n 
A 1 159 GLY 159 174 174 GLY GLY B . n 
A 1 160 PHE 160 175 175 PHE PHE B . n 
A 1 161 ASP 161 176 176 ASP ASP B . n 
A 1 162 TRP 162 177 177 TRP TRP B . n 
A 1 163 VAL 163 178 178 VAL VAL B . n 
A 1 164 TYR 164 179 179 TYR TYR B . n 
A 1 165 TYR 165 180 180 TYR TYR B . n 
A 1 166 GLU 166 181 181 GLU GLU B . n 
A 1 167 SER 167 182 182 SER SER B . n 
A 1 168 LYS 168 183 183 LYS LYS B . n 
A 1 169 ALA 169 184 184 ALA ALA B . n 
A 1 170 HIS 170 185 185 HIS HIS B . n 
A 1 171 VAL 171 186 186 VAL VAL B . n 
A 1 172 HIS 172 187 187 HIS HIS B . n 
A 1 173 CYS 173 188 188 CYS CYS B . n 
A 1 174 SER 174 189 189 SER SER B . n 
A 1 175 VAL 175 190 190 VAL VAL B . n 
A 1 176 LYS 176 191 191 LYS LYS B . n 
A 1 177 SER 177 192 192 SER SER B . n 
A 1 178 GLU 178 193 193 GLU GLU B . n 
A 1 179 HIS 179 194 194 HIS HIS B . n 
A 1 180 SER 180 195 195 SER SER B . n 
A 1 181 ALA 181 196 196 ALA ALA B . n 
A 1 182 ALA 182 197 197 ALA ALA B . n 
A 1 183 ALA 183 198 ?   ?   ?   B . n 
A 1 184 LYS 184 199 ?   ?   ?   B . n 
A 1 185 THR 185 200 ?   ?   ?   B . n 
A 1 186 GLY 186 201 ?   ?   ?   B . n 
A 1 187 GLY 187 202 ?   ?   ?   B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
_pdbx_struct_special_symmetry.id              1 
_pdbx_struct_special_symmetry.PDB_model_num   1 
_pdbx_struct_special_symmetry.auth_asym_id    B 
_pdbx_struct_special_symmetry.auth_comp_id    HOH 
_pdbx_struct_special_symmetry.auth_seq_id     207 
_pdbx_struct_special_symmetry.PDB_ins_code    ? 
_pdbx_struct_special_symmetry.label_asym_id   D 
_pdbx_struct_special_symmetry.label_comp_id   HOH 
_pdbx_struct_special_symmetry.label_seq_id    . 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 NE2 ? A HIS 130 ? B HIS 145 ? 1_555 ZN ? B ZN . ? B ZN 1001 ? 1_555 OD1 ? A ASP 137 ? B ASP 152 ? 1_555 106.4 ? 
2 NE2 ? A HIS 130 ? B HIS 145 ? 1_555 ZN ? B ZN . ? B ZN 1001 ? 1_555 ND1 ? A HIS 172 ? B HIS 187 ? 1_555 105.4 ? 
3 OD1 ? A ASP 137 ? B ASP 152 ? 1_555 ZN ? B ZN . ? B ZN 1001 ? 1_555 ND1 ? A HIS 172 ? B HIS 187 ? 1_555 108.1 ? 
4 NE2 ? A HIS 130 ? B HIS 145 ? 1_555 ZN ? B ZN . ? B ZN 1001 ? 1_555 O   ? D HOH .   ? B HOH 368 ? 1_555 114.2 ? 
5 OD1 ? A ASP 137 ? B ASP 152 ? 1_555 ZN ? B ZN . ? B ZN 1001 ? 1_555 O   ? D HOH .   ? B HOH 368 ? 1_555 115.0 ? 
6 ND1 ? A HIS 172 ? B HIS 187 ? 1_555 ZN ? B ZN . ? B ZN 1001 ? 1_555 O   ? D HOH .   ? B HOH 368 ? 1_555 107.2 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2011-01-26 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
MAR345dtb 'data collection' .                 ? 1 
MOLREP    phasing           .                 ? 2 
PHENIX    refinement        '(phenix.refine)' ? 3 
MOSFLM    'data reduction'  .                 ? 4 
SCALA     'data scaling'    .                 ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LYS B 50 ? ? 77.84   -4.52   
2 1 LYS B 59 ? ? -95.67  54.83   
3 1 ALA B 63 ? ? -112.08 -117.73 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 B MET 16  ? A MET 1   
2  1 Y 1 B ARG 17  ? A ARG 2   
3  1 Y 1 B GLY 18  ? A GLY 3   
4  1 Y 1 B SER 19  ? A SER 4   
5  1 Y 1 B HIS 20  ? A HIS 5   
6  1 Y 1 B HIS 21  ? A HIS 6   
7  1 Y 1 B HIS 22  ? A HIS 7   
8  1 Y 1 B HIS 23  ? A HIS 8   
9  1 Y 1 B HIS 24  ? A HIS 9   
10 1 Y 1 B HIS 25  ? A HIS 10  
11 1 Y 1 B GLY 26  ? A GLY 11  
12 1 Y 1 B SER 27  ? A SER 12  
13 1 Y 1 B CYS 28  ? A CYS 13  
14 1 Y 1 B GLY 29  ? A GLY 14  
15 1 Y 1 B PRO 30  ? A PRO 15  
16 1 Y 1 B GLY 31  ? A GLY 16  
17 1 Y 1 B ARG 32  ? A ARG 17  
18 1 Y 1 B VAL 33  ? A VAL 18  
19 1 Y 1 B VAL 34  ? A VAL 19  
20 1 Y 1 B GLY 35  ? A GLY 20  
21 1 Y 1 B SER 36  ? A SER 21  
22 1 Y 1 B ARG 37  ? A ARG 22  
23 1 Y 1 B ARG 38  ? A ARG 23  
24 1 Y 1 B ARG 39  ? A ARG 24  
25 1 Y 1 B PRO 40  ? A PRO 25  
26 1 Y 1 B ALA 198 ? A ALA 183 
27 1 Y 1 B LYS 199 ? A LYS 184 
28 1 Y 1 B THR 200 ? A THR 185 
29 1 Y 1 B GLY 201 ? A GLY 186 
30 1 Y 1 B GLY 202 ? A GLY 187 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'ZINC ION'    ZN  
3 'SULFATE ION' SO4 
4 water         HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 ZN  1   1001 1001 ZN  ZN  B . 
C 3 SO4 1   1    1    SO4 SO4 B . 
D 4 HOH 1   2    2    HOH HOH B . 
D 4 HOH 2   3    3    HOH HOH B . 
D 4 HOH 3   4    4    HOH HOH B . 
D 4 HOH 4   5    5    HOH HOH B . 
D 4 HOH 5   6    6    HOH HOH B . 
D 4 HOH 6   7    7    HOH HOH B . 
D 4 HOH 7   8    8    HOH HOH B . 
D 4 HOH 8   9    9    HOH HOH B . 
D 4 HOH 9   10   10   HOH HOH B . 
D 4 HOH 10  11   11   HOH HOH B . 
D 4 HOH 11  12   12   HOH HOH B . 
D 4 HOH 12  13   13   HOH HOH B . 
D 4 HOH 13  14   14   HOH HOH B . 
D 4 HOH 14  15   15   HOH HOH B . 
D 4 HOH 15  203  1    HOH HOH B . 
D 4 HOH 16  204  16   HOH HOH B . 
D 4 HOH 17  205  17   HOH HOH B . 
D 4 HOH 18  206  18   HOH HOH B . 
D 4 HOH 19  207  19   HOH HOH B . 
D 4 HOH 20  208  20   HOH HOH B . 
D 4 HOH 21  209  21   HOH HOH B . 
D 4 HOH 22  210  22   HOH HOH B . 
D 4 HOH 23  211  23   HOH HOH B . 
D 4 HOH 24  212  24   HOH HOH B . 
D 4 HOH 25  213  25   HOH HOH B . 
D 4 HOH 26  214  26   HOH HOH B . 
D 4 HOH 27  215  27   HOH HOH B . 
D 4 HOH 28  216  28   HOH HOH B . 
D 4 HOH 29  217  29   HOH HOH B . 
D 4 HOH 30  218  30   HOH HOH B . 
D 4 HOH 31  219  31   HOH HOH B . 
D 4 HOH 32  220  32   HOH HOH B . 
D 4 HOH 33  221  33   HOH HOH B . 
D 4 HOH 34  222  34   HOH HOH B . 
D 4 HOH 35  223  35   HOH HOH B . 
D 4 HOH 36  224  36   HOH HOH B . 
D 4 HOH 37  225  37   HOH HOH B . 
D 4 HOH 38  226  38   HOH HOH B . 
D 4 HOH 39  227  39   HOH HOH B . 
D 4 HOH 40  228  40   HOH HOH B . 
D 4 HOH 41  229  41   HOH HOH B . 
D 4 HOH 42  230  42   HOH HOH B . 
D 4 HOH 43  231  43   HOH HOH B . 
D 4 HOH 44  232  44   HOH HOH B . 
D 4 HOH 45  233  45   HOH HOH B . 
D 4 HOH 46  234  46   HOH HOH B . 
D 4 HOH 47  235  47   HOH HOH B . 
D 4 HOH 48  236  49   HOH HOH B . 
D 4 HOH 49  237  50   HOH HOH B . 
D 4 HOH 50  238  51   HOH HOH B . 
D 4 HOH 51  239  52   HOH HOH B . 
D 4 HOH 52  240  53   HOH HOH B . 
D 4 HOH 53  241  54   HOH HOH B . 
D 4 HOH 54  242  55   HOH HOH B . 
D 4 HOH 55  243  56   HOH HOH B . 
D 4 HOH 56  244  57   HOH HOH B . 
D 4 HOH 57  245  58   HOH HOH B . 
D 4 HOH 58  246  59   HOH HOH B . 
D 4 HOH 59  247  60   HOH HOH B . 
D 4 HOH 60  248  61   HOH HOH B . 
D 4 HOH 61  249  62   HOH HOH B . 
D 4 HOH 62  250  63   HOH HOH B . 
D 4 HOH 63  251  64   HOH HOH B . 
D 4 HOH 64  252  65   HOH HOH B . 
D 4 HOH 65  253  66   HOH HOH B . 
D 4 HOH 66  254  67   HOH HOH B . 
D 4 HOH 67  255  68   HOH HOH B . 
D 4 HOH 68  256  69   HOH HOH B . 
D 4 HOH 69  257  70   HOH HOH B . 
D 4 HOH 70  258  71   HOH HOH B . 
D 4 HOH 71  259  72   HOH HOH B . 
D 4 HOH 72  260  73   HOH HOH B . 
D 4 HOH 73  261  74   HOH HOH B . 
D 4 HOH 74  262  75   HOH HOH B . 
D 4 HOH 75  263  76   HOH HOH B . 
D 4 HOH 76  264  77   HOH HOH B . 
D 4 HOH 77  265  78   HOH HOH B . 
D 4 HOH 78  266  79   HOH HOH B . 
D 4 HOH 79  267  80   HOH HOH B . 
D 4 HOH 80  268  81   HOH HOH B . 
D 4 HOH 81  269  82   HOH HOH B . 
D 4 HOH 82  270  83   HOH HOH B . 
D 4 HOH 83  271  84   HOH HOH B . 
D 4 HOH 84  272  85   HOH HOH B . 
D 4 HOH 85  273  86   HOH HOH B . 
D 4 HOH 86  274  87   HOH HOH B . 
D 4 HOH 87  275  88   HOH HOH B . 
D 4 HOH 88  276  89   HOH HOH B . 
D 4 HOH 89  277  90   HOH HOH B . 
D 4 HOH 90  278  91   HOH HOH B . 
D 4 HOH 91  279  92   HOH HOH B . 
D 4 HOH 92  280  93   HOH HOH B . 
D 4 HOH 93  281  94   HOH HOH B . 
D 4 HOH 94  282  95   HOH HOH B . 
D 4 HOH 95  283  96   HOH HOH B . 
D 4 HOH 96  284  97   HOH HOH B . 
D 4 HOH 97  285  98   HOH HOH B . 
D 4 HOH 98  286  99   HOH HOH B . 
D 4 HOH 99  287  100  HOH HOH B . 
D 4 HOH 100 288  102  HOH HOH B . 
D 4 HOH 101 289  103  HOH HOH B . 
D 4 HOH 102 290  104  HOH HOH B . 
D 4 HOH 103 291  105  HOH HOH B . 
D 4 HOH 104 292  106  HOH HOH B . 
D 4 HOH 105 293  107  HOH HOH B . 
D 4 HOH 106 294  108  HOH HOH B . 
D 4 HOH 107 295  109  HOH HOH B . 
D 4 HOH 108 296  110  HOH HOH B . 
D 4 HOH 109 297  111  HOH HOH B . 
D 4 HOH 110 298  112  HOH HOH B . 
D 4 HOH 111 299  113  HOH HOH B . 
D 4 HOH 112 300  114  HOH HOH B . 
D 4 HOH 113 301  115  HOH HOH B . 
D 4 HOH 114 302  116  HOH HOH B . 
D 4 HOH 115 303  117  HOH HOH B . 
D 4 HOH 116 304  118  HOH HOH B . 
D 4 HOH 117 305  119  HOH HOH B . 
D 4 HOH 118 306  120  HOH HOH B . 
D 4 HOH 119 307  121  HOH HOH B . 
D 4 HOH 120 308  122  HOH HOH B . 
D 4 HOH 121 309  123  HOH HOH B . 
D 4 HOH 122 310  124  HOH HOH B . 
D 4 HOH 123 311  125  HOH HOH B . 
D 4 HOH 124 312  126  HOH HOH B . 
D 4 HOH 125 313  127  HOH HOH B . 
D 4 HOH 126 314  128  HOH HOH B . 
D 4 HOH 127 315  129  HOH HOH B . 
D 4 HOH 128 316  130  HOH HOH B . 
D 4 HOH 129 317  131  HOH HOH B . 
D 4 HOH 130 318  132  HOH HOH B . 
D 4 HOH 131 319  133  HOH HOH B . 
D 4 HOH 132 320  134  HOH HOH B . 
D 4 HOH 133 321  135  HOH HOH B . 
D 4 HOH 134 322  136  HOH HOH B . 
D 4 HOH 135 323  137  HOH HOH B . 
D 4 HOH 136 324  138  HOH HOH B . 
D 4 HOH 137 325  139  HOH HOH B . 
D 4 HOH 138 326  140  HOH HOH B . 
D 4 HOH 139 327  141  HOH HOH B . 
D 4 HOH 140 328  142  HOH HOH B . 
D 4 HOH 141 329  143  HOH HOH B . 
D 4 HOH 142 330  144  HOH HOH B . 
D 4 HOH 143 331  145  HOH HOH B . 
D 4 HOH 144 332  146  HOH HOH B . 
D 4 HOH 145 333  147  HOH HOH B . 
D 4 HOH 146 334  148  HOH HOH B . 
D 4 HOH 147 335  149  HOH HOH B . 
D 4 HOH 148 336  150  HOH HOH B . 
D 4 HOH 149 337  151  HOH HOH B . 
D 4 HOH 150 338  152  HOH HOH B . 
D 4 HOH 151 339  153  HOH HOH B . 
D 4 HOH 152 340  154  HOH HOH B . 
D 4 HOH 153 341  155  HOH HOH B . 
D 4 HOH 154 342  156  HOH HOH B . 
D 4 HOH 155 343  157  HOH HOH B . 
D 4 HOH 156 344  158  HOH HOH B . 
D 4 HOH 157 345  159  HOH HOH B . 
D 4 HOH 158 346  160  HOH HOH B . 
D 4 HOH 159 347  161  HOH HOH B . 
D 4 HOH 160 348  163  HOH HOH B . 
D 4 HOH 161 349  164  HOH HOH B . 
D 4 HOH 162 350  165  HOH HOH B . 
D 4 HOH 163 351  166  HOH HOH B . 
D 4 HOH 164 352  167  HOH HOH B . 
D 4 HOH 165 353  168  HOH HOH B . 
D 4 HOH 166 354  169  HOH HOH B . 
D 4 HOH 167 355  170  HOH HOH B . 
D 4 HOH 168 356  171  HOH HOH B . 
D 4 HOH 169 357  172  HOH HOH B . 
D 4 HOH 170 358  173  HOH HOH B . 
D 4 HOH 171 359  174  HOH HOH B . 
D 4 HOH 172 360  175  HOH HOH B . 
D 4 HOH 173 361  176  HOH HOH B . 
D 4 HOH 174 362  177  HOH HOH B . 
D 4 HOH 175 363  178  HOH HOH B . 
D 4 HOH 176 364  179  HOH HOH B . 
D 4 HOH 177 365  180  HOH HOH B . 
D 4 HOH 178 366  181  HOH HOH B . 
D 4 HOH 179 367  182  HOH HOH B . 
D 4 HOH 180 368  184  HOH HOH B . 
D 4 HOH 181 369  185  HOH HOH B . 
D 4 HOH 182 370  186  HOH HOH B . 
#