data_3K7J
# 
_entry.id   3K7J 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.281 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
PDB   3K7J         
RCSB  RCSB055644   
WWPDB D_1000055644 
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.db_id 
_pdbx_database_related.details 
_pdbx_database_related.content_type 
PDB 3k7g 'the Indian Hedgehog N-terminal signalling domain, wild type'          unspecified 
PDB 3k7h 'the E95K mutant of the Indian Hedgehog N-terminal signalling domain'  unspecified 
PDB 3k7i 'the E131K mutant of the Indian Hedgehog N-terminal signalling domain' unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.entry_id                        3K7J 
_pdbx_database_status.recvd_initial_deposition_date   2009-10-13 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.SG_entry                        ? 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.pdb_format_compatible           Y 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'He, Y.-X.'   1 
'Kang, Y.'    2 
'Zhang, W.J.' 3 
'Yu, J.'      4 
'Ma, G.'      5 
'Zhou, C.-Z.' 6 
# 
_citation.id                        primary 
_citation.title                     'Crystal structure of the D100E mutant of the Indian Hedgehog N-terminal signalling domain' 
_citation.journal_abbrev            'To be Published' 
_citation.journal_volume            ? 
_citation.page_first                ? 
_citation.page_last                 ? 
_citation.year                      ? 
_citation.journal_id_ASTM           ? 
_citation.country                   ? 
_citation.journal_id_ISSN           ? 
_citation.journal_id_CSD            0353 
_citation.book_publisher            ? 
_citation.pdbx_database_id_PubMed   ? 
_citation.pdbx_database_id_DOI      ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
primary 'He, Y.-X.'   1 
primary 'Kang, Y.'    2 
primary 'Zhang, W.J.' 3 
primary 'Yu, J.'      4 
primary 'Ma, G.'      5 
primary 'Zhou, C.-Z.' 6 
# 
_cell.entry_id           3K7J 
_cell.length_a           84.160 
_cell.length_b           52.400 
_cell.length_c           34.660 
_cell.angle_alpha        90.00 
_cell.angle_beta         89.97 
_cell.angle_gamma        90.00 
_cell.Z_PDB              4 
_cell.pdbx_unique_axis   ? 
_cell.length_a_esd       ? 
_cell.length_b_esd       ? 
_cell.length_c_esd       ? 
_cell.angle_alpha_esd    ? 
_cell.angle_beta_esd     ? 
_cell.angle_gamma_esd    ? 
# 
_symmetry.entry_id                         3K7J 
_symmetry.space_group_name_H-M             'C 1 2 1' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                5 
_symmetry.space_group_name_Hall            ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Indian hedgehog protein' 21129.658 1   ? D100E 'Indian hedgehog protein N-product' ? 
2 non-polymer syn 'ZINC ION'                65.409    1   ? ?     ?                                   ? 
3 non-polymer syn 'SULFATE ION'             96.063    5   ? ?     ?                                   ? 
4 non-polymer syn 'CARBONATE ION'           60.009    1   ? ?     ?                                   ? 
5 water       nat water                     18.015    102 ? ?     ?                                   ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'IHH, HHG-2' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;MRGSHHHHHHGSCGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIARSSERFKELTPNYNPDIIFKDEE
NTGAERLMTQRCKDRLNSLAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYGLLARLAVEAGF
DWVYYESKAHVHCSVKSEHSAAAKTGG
;
_entity_poly.pdbx_seq_one_letter_code_can   
;MRGSHHHHHHGSCGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIARSSERFKELTPNYNPDIIFKDEE
NTGAERLMTQRCKDRLNSLAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYGLLARLAVEAGF
DWVYYESKAHVHCSVKSEHSAAAKTGG
;
_entity_poly.pdbx_strand_id                 B 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   MET n 
1 2   ARG n 
1 3   GLY n 
1 4   SER n 
1 5   HIS n 
1 6   HIS n 
1 7   HIS n 
1 8   HIS n 
1 9   HIS n 
1 10  HIS n 
1 11  GLY n 
1 12  SER n 
1 13  CYS n 
1 14  GLY n 
1 15  PRO n 
1 16  GLY n 
1 17  ARG n 
1 18  VAL n 
1 19  VAL n 
1 20  GLY n 
1 21  SER n 
1 22  ARG n 
1 23  ARG n 
1 24  ARG n 
1 25  PRO n 
1 26  PRO n 
1 27  ARG n 
1 28  LYS n 
1 29  LEU n 
1 30  VAL n 
1 31  PRO n 
1 32  LEU n 
1 33  ALA n 
1 34  TYR n 
1 35  LYS n 
1 36  GLN n 
1 37  PHE n 
1 38  SER n 
1 39  PRO n 
1 40  ASN n 
1 41  VAL n 
1 42  PRO n 
1 43  GLU n 
1 44  LYS n 
1 45  THR n 
1 46  LEU n 
1 47  GLY n 
1 48  ALA n 
1 49  SER n 
1 50  GLY n 
1 51  ARG n 
1 52  TYR n 
1 53  GLU n 
1 54  GLY n 
1 55  LYS n 
1 56  ILE n 
1 57  ALA n 
1 58  ARG n 
1 59  SER n 
1 60  SER n 
1 61  GLU n 
1 62  ARG n 
1 63  PHE n 
1 64  LYS n 
1 65  GLU n 
1 66  LEU n 
1 67  THR n 
1 68  PRO n 
1 69  ASN n 
1 70  TYR n 
1 71  ASN n 
1 72  PRO n 
1 73  ASP n 
1 74  ILE n 
1 75  ILE n 
1 76  PHE n 
1 77  LYS n 
1 78  ASP n 
1 79  GLU n 
1 80  GLU n 
1 81  ASN n 
1 82  THR n 
1 83  GLY n 
1 84  ALA n 
1 85  GLU n 
1 86  ARG n 
1 87  LEU n 
1 88  MET n 
1 89  THR n 
1 90  GLN n 
1 91  ARG n 
1 92  CYS n 
1 93  LYS n 
1 94  ASP n 
1 95  ARG n 
1 96  LEU n 
1 97  ASN n 
1 98  SER n 
1 99  LEU n 
1 100 ALA n 
1 101 ILE n 
1 102 SER n 
1 103 VAL n 
1 104 MET n 
1 105 ASN n 
1 106 GLN n 
1 107 TRP n 
1 108 PRO n 
1 109 GLY n 
1 110 VAL n 
1 111 LYS n 
1 112 LEU n 
1 113 ARG n 
1 114 VAL n 
1 115 THR n 
1 116 GLU n 
1 117 GLY n 
1 118 TRP n 
1 119 ASP n 
1 120 GLU n 
1 121 ASP n 
1 122 GLY n 
1 123 HIS n 
1 124 HIS n 
1 125 SER n 
1 126 GLU n 
1 127 GLU n 
1 128 SER n 
1 129 LEU n 
1 130 HIS n 
1 131 TYR n 
1 132 GLU n 
1 133 GLY n 
1 134 ARG n 
1 135 ALA n 
1 136 VAL n 
1 137 ASP n 
1 138 ILE n 
1 139 THR n 
1 140 THR n 
1 141 SER n 
1 142 ASP n 
1 143 ARG n 
1 144 ASP n 
1 145 ARG n 
1 146 ASN n 
1 147 LYS n 
1 148 TYR n 
1 149 GLY n 
1 150 LEU n 
1 151 LEU n 
1 152 ALA n 
1 153 ARG n 
1 154 LEU n 
1 155 ALA n 
1 156 VAL n 
1 157 GLU n 
1 158 ALA n 
1 159 GLY n 
1 160 PHE n 
1 161 ASP n 
1 162 TRP n 
1 163 VAL n 
1 164 TYR n 
1 165 TYR n 
1 166 GLU n 
1 167 SER n 
1 168 LYS n 
1 169 ALA n 
1 170 HIS n 
1 171 VAL n 
1 172 HIS n 
1 173 CYS n 
1 174 SER n 
1 175 VAL n 
1 176 LYS n 
1 177 SER n 
1 178 GLU n 
1 179 HIS n 
1 180 SER n 
1 181 ALA n 
1 182 ALA n 
1 183 ALA n 
1 184 LYS n 
1 185 THR n 
1 186 GLY n 
1 187 GLY n 
# 
_entity_src_gen.entity_id                          1 
_entity_src_gen.pdbx_src_id                        1 
_entity_src_gen.pdbx_alt_source_flag               sample 
_entity_src_gen.pdbx_seq_type                      ? 
_entity_src_gen.pdbx_beg_seq_num                   ? 
_entity_src_gen.pdbx_end_seq_num                   ? 
_entity_src_gen.gene_src_common_name               human 
_entity_src_gen.gene_src_genus                     ? 
_entity_src_gen.pdbx_gene_src_gene                 IHH 
_entity_src_gen.gene_src_species                   ? 
_entity_src_gen.gene_src_strain                    ? 
_entity_src_gen.gene_src_tissue                    ? 
_entity_src_gen.gene_src_tissue_fraction           ? 
_entity_src_gen.gene_src_details                   ? 
_entity_src_gen.pdbx_gene_src_fragment             ? 
_entity_src_gen.pdbx_gene_src_scientific_name      'Homo sapiens' 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id     9606 
_entity_src_gen.pdbx_gene_src_variant              ? 
_entity_src_gen.pdbx_gene_src_cell_line            ? 
_entity_src_gen.pdbx_gene_src_atcc                 ? 
_entity_src_gen.pdbx_gene_src_organ                ? 
_entity_src_gen.pdbx_gene_src_organelle            ? 
_entity_src_gen.pdbx_gene_src_cell                 ? 
_entity_src_gen.pdbx_gene_src_cellular_location    ? 
_entity_src_gen.host_org_common_name               ? 
_entity_src_gen.pdbx_host_org_scientific_name      'Escherichia coli' 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id     562 
_entity_src_gen.host_org_genus                     ? 
_entity_src_gen.pdbx_host_org_gene                 ? 
_entity_src_gen.pdbx_host_org_organ                ? 
_entity_src_gen.host_org_species                   ? 
_entity_src_gen.pdbx_host_org_tissue               ? 
_entity_src_gen.pdbx_host_org_tissue_fraction      ? 
_entity_src_gen.pdbx_host_org_strain               Rosseta 
_entity_src_gen.pdbx_host_org_variant              ? 
_entity_src_gen.pdbx_host_org_cell_line            ? 
_entity_src_gen.pdbx_host_org_atcc                 ? 
_entity_src_gen.pdbx_host_org_culture_collection   ? 
_entity_src_gen.pdbx_host_org_cell                 ? 
_entity_src_gen.pdbx_host_org_organelle            ? 
_entity_src_gen.pdbx_host_org_cellular_location    ? 
_entity_src_gen.pdbx_host_org_vector_type          plasmid 
_entity_src_gen.pdbx_host_org_vector               ? 
_entity_src_gen.host_org_details                   ? 
_entity_src_gen.expression_system_id               ? 
_entity_src_gen.plasmid_name                       pET28a 
_entity_src_gen.plasmid_details                    ? 
_entity_src_gen.pdbx_description                   ? 
# 
_struct_ref.id                         1 
_struct_ref.db_name                    UNP 
_struct_ref.db_code                    IHH_HUMAN 
_struct_ref.pdbx_db_accession          Q14623 
_struct_ref.entity_id                  1 
_struct_ref.pdbx_seq_one_letter_code   
;CGPGRVVGSRRRPPRKLVPLAYKQFSPNVPEKTLGASGRYEGKIARSSERFKELTPNYNPDIIFKDEENTGADRLMTQRC
KDRLNSLAISVMNQWPGVKLRVTEGWDEDGHHSEESLHYEGRAVDITTSDRDRNKYGLLARLAVEAGFDWVYYESKAHVH
CSVKSEHSAAAKTGG
;
_struct_ref.pdbx_align_begin           28 
_struct_ref.pdbx_db_isoform            ? 
# 
_struct_ref_seq.align_id                      1 
_struct_ref_seq.ref_id                        1 
_struct_ref_seq.pdbx_PDB_id_code              3K7J 
_struct_ref_seq.pdbx_strand_id                B 
_struct_ref_seq.seq_align_beg                 13 
_struct_ref_seq.pdbx_seq_align_beg_ins_code   ? 
_struct_ref_seq.seq_align_end                 187 
_struct_ref_seq.pdbx_seq_align_end_ins_code   ? 
_struct_ref_seq.pdbx_db_accession             Q14623 
_struct_ref_seq.db_align_beg                  28 
_struct_ref_seq.pdbx_db_align_beg_ins_code    ? 
_struct_ref_seq.db_align_end                  202 
_struct_ref_seq.pdbx_db_align_end_ins_code    ? 
_struct_ref_seq.pdbx_auth_seq_align_beg       28 
_struct_ref_seq.pdbx_auth_seq_align_end       202 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 3K7J MET B 1  ? UNP Q14623 ?   ?   'INITIATING METHIONINE' 16  1  
1 3K7J ARG B 2  ? UNP Q14623 ?   ?   'EXPRESSION TAG'        17  2  
1 3K7J GLY B 3  ? UNP Q14623 ?   ?   'EXPRESSION TAG'        18  3  
1 3K7J SER B 4  ? UNP Q14623 ?   ?   'EXPRESSION TAG'        19  4  
1 3K7J HIS B 5  ? UNP Q14623 ?   ?   'EXPRESSION TAG'        20  5  
1 3K7J HIS B 6  ? UNP Q14623 ?   ?   'EXPRESSION TAG'        21  6  
1 3K7J HIS B 7  ? UNP Q14623 ?   ?   'EXPRESSION TAG'        22  7  
1 3K7J HIS B 8  ? UNP Q14623 ?   ?   'EXPRESSION TAG'        23  8  
1 3K7J HIS B 9  ? UNP Q14623 ?   ?   'EXPRESSION TAG'        24  9  
1 3K7J HIS B 10 ? UNP Q14623 ?   ?   'EXPRESSION TAG'        25  10 
1 3K7J GLY B 11 ? UNP Q14623 ?   ?   'EXPRESSION TAG'        26  11 
1 3K7J SER B 12 ? UNP Q14623 ?   ?   'EXPRESSION TAG'        27  12 
1 3K7J GLU B 85 ? UNP Q14623 ASP 100 'ENGINEERED MUTATION'   100 13 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
ALA 'L-peptide linking' y ALANINE         ? 'C3 H7 N O2'     89.093  
ARG 'L-peptide linking' y ARGININE        ? 'C6 H15 N4 O2 1' 175.209 
ASN 'L-peptide linking' y ASPARAGINE      ? 'C4 H8 N2 O3'    132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4'     133.103 
CO3 non-polymer         . 'CARBONATE ION' ? 'C O3 -2'        60.009  
CYS 'L-peptide linking' y CYSTEINE        ? 'C3 H7 N O2 S'   121.158 
GLN 'L-peptide linking' y GLUTAMINE       ? 'C5 H10 N2 O3'   146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4'     147.129 
GLY 'peptide linking'   y GLYCINE         ? 'C2 H5 N O2'     75.067  
HIS 'L-peptide linking' y HISTIDINE       ? 'C6 H10 N3 O2 1' 156.162 
HOH non-polymer         . WATER           ? 'H2 O'           18.015  
ILE 'L-peptide linking' y ISOLEUCINE      ? 'C6 H13 N O2'    131.173 
LEU 'L-peptide linking' y LEUCINE         ? 'C6 H13 N O2'    131.173 
LYS 'L-peptide linking' y LYSINE          ? 'C6 H15 N2 O2 1' 147.195 
MET 'L-peptide linking' y METHIONINE      ? 'C5 H11 N O2 S'  149.211 
PHE 'L-peptide linking' y PHENYLALANINE   ? 'C9 H11 N O2'    165.189 
PRO 'L-peptide linking' y PROLINE         ? 'C5 H9 N O2'     115.130 
SER 'L-peptide linking' y SERINE          ? 'C3 H7 N O3'     105.093 
SO4 non-polymer         . 'SULFATE ION'   ? 'O4 S -2'        96.063  
THR 'L-peptide linking' y THREONINE       ? 'C4 H9 N O3'     119.119 
TRP 'L-peptide linking' y TRYPTOPHAN      ? 'C11 H12 N2 O2'  204.225 
TYR 'L-peptide linking' y TYROSINE        ? 'C9 H11 N O3'    181.189 
VAL 'L-peptide linking' y VALINE          ? 'C5 H11 N O2'    117.146 
ZN  non-polymer         . 'ZINC ION'      ? 'Zn 2'           65.409  
# 
_exptl.entry_id          3K7J 
_exptl.method            'X-RAY DIFFRACTION' 
_exptl.crystals_number   1 
# 
_exptl_crystal.id                    1 
_exptl_crystal.density_meas          ? 
_exptl_crystal.density_Matthews      1.81 
_exptl_crystal.density_percent_sol   31.99 
_exptl_crystal.description           ? 
_exptl_crystal.F_000                 ? 
_exptl_crystal.preparation           ? 
# 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, SITTING DROP' 
_exptl_crystal_grow.temp            289 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.pH              8.0 
_exptl_crystal_grow.pdbx_details    '30% PEG 4000, 0.2M (NH4)2SO4, pH 8.0, VAPOR DIFFUSION, SITTING DROP, temperature 289K' 
_exptl_crystal_grow.pdbx_pH_range   . 
# 
_diffrn.id                     1 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.crystal_id             1 
# 
_diffrn_detector.diffrn_id              1 
_diffrn_detector.detector               'IMAGE PLATE' 
_diffrn_detector.type                   'MAR scanner 345 mm plate' 
_diffrn_detector.pdbx_collection_date   2009-02-08 
_diffrn_detector.details                ? 
# 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.monochromator                    ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.54178 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.diffrn_id                   1 
_diffrn_source.source                      'ROTATING ANODE' 
_diffrn_source.type                        'RIGAKU MICROMAX-007 HF' 
_diffrn_source.pdbx_synchrotron_site       ? 
_diffrn_source.pdbx_synchrotron_beamline   ? 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_wavelength_list        1.54178 
# 
_reflns.entry_id                     3K7J 
_reflns.observed_criterion_sigma_I   ? 
_reflns.observed_criterion_sigma_F   ? 
_reflns.d_resolution_low             24.73 
_reflns.d_resolution_high            1.90 
_reflns.number_obs                   11849 
_reflns.number_all                   ? 
_reflns.percent_possible_obs         98.8 
_reflns.pdbx_Rmerge_I_obs            0.079 
_reflns.pdbx_Rsym_value              ? 
_reflns.pdbx_netI_over_sigmaI        10.7 
_reflns.B_iso_Wilson_estimate        23.67 
_reflns.pdbx_redundancy              3.1 
_reflns.R_free_details               ? 
_reflns.limit_h_max                  ? 
_reflns.limit_h_min                  ? 
_reflns.limit_k_max                  ? 
_reflns.limit_k_min                  ? 
_reflns.limit_l_max                  ? 
_reflns.limit_l_min                  ? 
_reflns.observed_criterion_F_max     ? 
_reflns.observed_criterion_F_min     ? 
_reflns.pdbx_chi_squared             ? 
_reflns.pdbx_scaling_rejects         ? 
_reflns.pdbx_diffrn_id               1 
_reflns.pdbx_ordinal                 1 
# 
_reflns_shell.d_res_high             1.90 
_reflns_shell.d_res_low              2.00 
_reflns_shell.percent_possible_all   97.5 
_reflns_shell.Rmerge_I_obs           0.079 
_reflns_shell.pdbx_Rsym_value        ? 
_reflns_shell.meanI_over_sigI_obs    2.4 
_reflns_shell.pdbx_redundancy        3.1 
_reflns_shell.percent_possible_obs   ? 
_reflns_shell.number_unique_all      1680 
_reflns_shell.number_measured_all    ? 
_reflns_shell.number_measured_obs    ? 
_reflns_shell.number_unique_obs      ? 
_reflns_shell.pdbx_chi_squared       ? 
_reflns_shell.pdbx_diffrn_id         ? 
_reflns_shell.pdbx_ordinal           1 
# 
_refine.entry_id                                 3K7J 
_refine.ls_number_reflns_obs                     11833 
_refine.ls_number_reflns_all                     ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.35 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.ls_d_res_low                             18.721 
_refine.ls_d_res_high                            1.900 
_refine.ls_percent_reflns_obs                    98.79 
_refine.ls_R_factor_obs                          0.2035 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_R_work                       0.1999 
_refine.ls_R_factor_R_free                       0.2757 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_percent_reflns_R_free                 4.81 
_refine.ls_number_reflns_R_free                  569 
_refine.ls_number_reflns_R_work                  11264 
_refine.ls_number_parameters                     ? 
_refine.ls_number_restraints                     ? 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.B_iso_mean                               26.239 
_refine.aniso_B[1][1]                            -2.708 
_refine.aniso_B[2][2]                            6.847 
_refine.aniso_B[3][3]                            -4.139 
_refine.aniso_B[1][2]                            -0.000 
_refine.aniso_B[1][3]                            -7.897 
_refine.aniso_B[2][3]                            -0.000 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_ksol                 0.443 
_refine.solvent_model_param_bsol                 50.547 
_refine.pdbx_solvent_vdw_probe_radii             1.11 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.90 
_refine.pdbx_ls_cross_valid_method               THROUGHOUT 
_refine.details                                  ? 
_refine.pdbx_starting_model                      'PDB ENTRY 1VHH' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_R_Free_selection_details            RANDOM 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.overall_SU_ML                            0.24 
_refine.overall_SU_B                             ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   0.808 
_refine.B_iso_max                                59.32 
_refine.B_iso_min                                14.64 
_refine.pdbx_overall_phase_error                 26.460 
_refine.occupancy_max                            1.00 
_refine.occupancy_min                            0.49 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.pdbx_diffrn_id                           1 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
# 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.cycle_id                         LAST 
_refine_hist.pdbx_number_atoms_protein        1181 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
_refine_hist.pdbx_number_atoms_ligand         30 
_refine_hist.number_atoms_solvent             102 
_refine_hist.number_atoms_total               1313 
_refine_hist.d_res_high                       1.900 
_refine_hist.d_res_low                        18.721 
# 
loop_
_refine_ls_restr.type 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.weight 
_refine_ls_restr.number 
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.pdbx_restraint_function 
f_bond_d           0.006  ? ? 1231 'X-RAY DIFFRACTION' ? 
f_angle_d          0.886  ? ? 1661 'X-RAY DIFFRACTION' ? 
f_dihedral_angle_d 16.786 ? ? 450  'X-RAY DIFFRACTION' ? 
f_chiral_restr     0.064  ? ? 170  'X-RAY DIFFRACTION' ? 
f_plane_restr      0.004  ? ? 211  'X-RAY DIFFRACTION' ? 
# 
loop_
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.pdbx_refine_id 
. 1.9000 2.0910  2761 0.2235 98.00 0.2728 . . 144 . . . . 'X-RAY DIFFRACTION' 
. 2.0910 2.3930  2785 0.2006 99.00 0.2964 . . 148 . . . . 'X-RAY DIFFRACTION' 
. 2.3930 3.0130  2825 0.2093 99.00 0.2851 . . 141 . . . . 'X-RAY DIFFRACTION' 
. 3.0130 18.7220 2893 0.1882 99.00 0.2486 . . 136 . . . . 'X-RAY DIFFRACTION' 
# 
_struct.entry_id                  3K7J 
_struct.title                     'Crystal structure of the D100E mutant of the Indian Hedgehog N-terminal signalling domain' 
_struct.pdbx_descriptor           'Indian hedgehog protein' 
_struct.pdbx_model_details        ? 
_struct.pdbx_CASP_flag            ? 
_struct.pdbx_model_type_details   ? 
# 
_struct_keywords.entry_id        3K7J 
_struct_keywords.pdbx_keywords   'SIGNALING PROTEIN' 
_struct_keywords.text            
;alpha+beta sandwich, Autocatalytic cleavage, Cell membrane, Developmental protein, Disease mutation, Glycoprotein, Hydrolase, Lipoprotein, Membrane, Palmitate, Protease, Secreted, SIGNALING PROTEIN
;
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 3 ? 
F N N 3 ? 
G N N 3 ? 
H N N 4 ? 
I N N 5 ? 
# 
_struct_biol.id        1 
_struct_biol.details   ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 1 GLU A 61  ? LEU A 66  ? GLU B 76  LEU B 81  5 ? 6  
HELX_P HELX_P2 2 THR A 89  ? TRP A 107 ? THR B 104 TRP B 122 1 ? 19 
HELX_P HELX_P3 3 SER A 128 ? GLY A 133 ? SER B 143 GLY B 148 5 ? 6  
HELX_P HELX_P4 4 ASP A 144 ? ASN A 146 ? ASP B 159 ASN B 161 5 ? 3  
HELX_P HELX_P5 5 LYS A 147 ? ALA A 158 ? LYS B 162 ALA B 173 1 ? 12 
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
metalc1 metalc ? ? A HIS 130 NE2 ? ? ? 1_555 B ZN  . ZN ? ? B HIS 145  B ZN  1001 1_555 ? ? ? ? ? ? ? 2.067 ? 
metalc2 metalc ? ? A ASP 137 OD1 ? ? ? 1_555 B ZN  . ZN ? ? B ASP 152  B ZN  1001 1_555 ? ? ? ? ? ? ? 2.077 ? 
metalc3 metalc ? ? A HIS 172 ND1 ? ? ? 1_555 B ZN  . ZN ? ? B HIS 187  B ZN  1001 1_555 ? ? ? ? ? ? ? 2.293 ? 
metalc4 metalc ? ? B ZN  .   ZN  ? ? ? 1_555 I HOH . O  ? ? B ZN  1001 B HOH 295  1_555 ? ? ? ? ? ? ? 2.187 ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_mon_prot_cis.pdbx_id                1 
_struct_mon_prot_cis.label_comp_id          SER 
_struct_mon_prot_cis.label_seq_id           38 
_struct_mon_prot_cis.label_asym_id          A 
_struct_mon_prot_cis.label_alt_id           . 
_struct_mon_prot_cis.pdbx_PDB_ins_code      ? 
_struct_mon_prot_cis.auth_comp_id           SER 
_struct_mon_prot_cis.auth_seq_id            53 
_struct_mon_prot_cis.auth_asym_id           B 
_struct_mon_prot_cis.pdbx_label_comp_id_2   PRO 
_struct_mon_prot_cis.pdbx_label_seq_id_2    39 
_struct_mon_prot_cis.pdbx_label_asym_id_2   A 
_struct_mon_prot_cis.pdbx_PDB_ins_code_2    ? 
_struct_mon_prot_cis.pdbx_auth_comp_id_2    PRO 
_struct_mon_prot_cis.pdbx_auth_seq_id_2     54 
_struct_mon_prot_cis.pdbx_auth_asym_id_2    B 
_struct_mon_prot_cis.pdbx_PDB_model_num     1 
_struct_mon_prot_cis.pdbx_omega_angle       1.97 
# 
loop_
_struct_sheet.id 
_struct_sheet.type 
_struct_sheet.number_strands 
_struct_sheet.details 
A ? 6 ? 
B ? 2 ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
A 1 2 ? anti-parallel 
A 2 3 ? anti-parallel 
A 3 4 ? anti-parallel 
A 4 5 ? anti-parallel 
A 5 6 ? parallel      
B 1 2 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
A 1 PHE A 37  ? SER A 38  ? PHE B 52  SER B 53  
A 2 TRP A 162 ? SER A 167 ? TRP B 177 SER B 182 
A 3 HIS A 170 ? SER A 174 ? HIS B 185 SER B 189 
A 4 ALA A 135 ? THR A 140 ? ALA B 150 THR B 155 
A 5 LEU A 112 ? GLU A 116 ? LEU B 127 GLU B 131 
A 6 ILE A 74  ? PHE A 76  ? ILE B 89  PHE B 91  
B 1 THR A 67  ? PRO A 68  ? THR B 82  PRO B 83  
B 2 LEU A 87  ? MET A 88  ? LEU B 102 MET B 103 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
A 1 2 N SER A 38  ? N SER B 53  O VAL A 163 ? O VAL B 178 
A 2 3 N TYR A 164 ? N TYR B 179 O HIS A 172 ? O HIS B 187 
A 3 4 O CYS A 173 ? O CYS B 188 N VAL A 136 ? N VAL B 151 
A 4 5 O THR A 139 ? O THR B 154 N ARG A 113 ? N ARG B 128 
A 5 6 O VAL A 114 ? O VAL B 129 N ILE A 75  ? N ILE B 90  
B 1 2 N THR A 67  ? N THR B 82  O MET A 88  ? O MET B 103 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE ZN B 1001' 
AC2 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE SO4 B 1'   
AC3 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE SO4 B 2'   
AC4 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE SO4 B 3'   
AC5 Software ? ? ? ? 9 'BINDING SITE FOR RESIDUE SO4 B 6'   
AC6 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SO4 B 7'   
AC7 Software ? ? ? ? 9 'BINDING SITE FOR RESIDUE CO3 B 203' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 5 HIS A 130 ? HIS B 145  . ? 1_555 ? 
2  AC1 5 ASP A 137 ? ASP B 152  . ? 1_555 ? 
3  AC1 5 HIS A 172 ? HIS B 187  . ? 1_555 ? 
4  AC1 5 CO3 H .   ? CO3 B 203  . ? 1_555 ? 
5  AC1 5 HOH I .   ? HOH B 295  . ? 1_555 ? 
6  AC2 3 GLN A 36  ? GLN B 51   . ? 1_555 ? 
7  AC2 3 SER A 38  ? SER B 53   . ? 1_555 ? 
8  AC2 3 ARG A 153 ? ARG B 168  . ? 1_555 ? 
9  AC3 4 TYR A 52  ? TYR B 67   . ? 1_555 ? 
10 AC3 4 GLY A 54  ? GLY B 69   . ? 1_555 ? 
11 AC3 4 LYS A 55  ? LYS B 70   . ? 1_555 ? 
12 AC3 4 ARG A 145 ? ARG B 160  . ? 4_545 ? 
13 AC4 7 HOH I .   ? HOH B 14   . ? 4_545 ? 
14 AC4 7 ARG A 51  ? ARG B 66   . ? 1_555 ? 
15 AC4 7 LYS A 77  ? LYS B 92   . ? 4_545 ? 
16 AC4 7 ARG A 113 ? ARG B 128  . ? 4_545 ? 
17 AC4 7 ARG A 143 ? ARG B 158  . ? 4_545 ? 
18 AC4 7 HOH I .   ? HOH B 221  . ? 1_555 ? 
19 AC4 7 HOH I .   ? HOH B 270  . ? 4_545 ? 
20 AC5 9 LYS A 77  ? LYS B 92   . ? 1_555 ? 
21 AC5 9 GLN A 90  ? GLN B 105  . ? 4_556 ? 
22 AC5 9 LYS A 93  ? LYS B 108  . ? 4_556 ? 
23 AC5 9 ARG A 113 ? ARG B 128  . ? 1_555 ? 
24 AC5 9 ARG A 143 ? ARG B 158  . ? 1_555 ? 
25 AC5 9 HOH I .   ? HOH B 207  . ? 1_555 ? 
26 AC5 9 HOH I .   ? HOH B 214  . ? 4_556 ? 
27 AC5 9 HOH I .   ? HOH B 229  . ? 1_555 ? 
28 AC5 9 HOH I .   ? HOH B 270  . ? 1_555 ? 
29 AC6 5 THR A 45  ? THR B 60   . ? 4_555 ? 
30 AC6 5 LEU A 46  ? LEU B 61   . ? 4_555 ? 
31 AC6 5 ARG A 51  ? ARG B 66   . ? 4_555 ? 
32 AC6 5 LYS A 77  ? LYS B 92   . ? 1_555 ? 
33 AC6 5 HOH I .   ? HOH B 278  . ? 1_555 ? 
34 AC7 9 HOH I .   ? HOH B 11   . ? 1_555 ? 
35 AC7 9 HIS A 124 ? HIS B 139  . ? 1_555 ? 
36 AC7 9 SER A 125 ? SER B 140  . ? 1_555 ? 
37 AC7 9 SER A 128 ? SER B 143  . ? 1_555 ? 
38 AC7 9 HIS A 130 ? HIS B 145  . ? 1_555 ? 
39 AC7 9 GLU A 166 ? GLU B 181  . ? 1_555 ? 
40 AC7 9 HOH I .   ? HOH B 258  . ? 1_555 ? 
41 AC7 9 HOH I .   ? HOH B 295  . ? 1_555 ? 
42 AC7 9 ZN  B .   ? ZN  B 1001 . ? 1_555 ? 
# 
_database_PDB_matrix.entry_id          3K7J 
_database_PDB_matrix.origx[1][1]       1.000000 
_database_PDB_matrix.origx[1][2]       0.000000 
_database_PDB_matrix.origx[1][3]       0.000000 
_database_PDB_matrix.origx[2][1]       0.000000 
_database_PDB_matrix.origx[2][2]       1.000000 
_database_PDB_matrix.origx[2][3]       0.000000 
_database_PDB_matrix.origx[3][1]       0.000000 
_database_PDB_matrix.origx[3][2]       0.000000 
_database_PDB_matrix.origx[3][3]       1.000000 
_database_PDB_matrix.origx_vector[1]   0.00000 
_database_PDB_matrix.origx_vector[2]   0.00000 
_database_PDB_matrix.origx_vector[3]   0.00000 
# 
_atom_sites.entry_id                    3K7J 
_atom_sites.fract_transf_matrix[1][1]   0.011882 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   -0.000006 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.019084 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.028852 
_atom_sites.fract_transf_vector[1]      0.00000 
_atom_sites.fract_transf_vector[2]      0.00000 
_atom_sites.fract_transf_vector[3]      0.00000 
# 
loop_
_atom_type.symbol 
C  
N  
O  
S  
ZN 
# 
loop_
_atom_site.group_PDB 
_atom_site.id 
_atom_site.type_symbol 
_atom_site.label_atom_id 
_atom_site.label_alt_id 
_atom_site.label_comp_id 
_atom_site.label_asym_id 
_atom_site.label_entity_id 
_atom_site.label_seq_id 
_atom_site.pdbx_PDB_ins_code 
_atom_site.Cartn_x 
_atom_site.Cartn_y 
_atom_site.Cartn_z 
_atom_site.occupancy 
_atom_site.B_iso_or_equiv 
_atom_site.pdbx_formal_charge 
_atom_site.auth_seq_id 
_atom_site.auth_comp_id 
_atom_site.auth_asym_id 
_atom_site.auth_atom_id 
_atom_site.pdbx_PDB_model_num 
ATOM   1    N  N   . PRO A 1 26  ? 49.802 -7.554  14.413  1.00 32.76 ? 41   PRO B N   1 
ATOM   2    C  CA  . PRO A 1 26  ? 48.813 -6.497  14.181  1.00 36.70 ? 41   PRO B CA  1 
ATOM   3    C  C   . PRO A 1 26  ? 48.835 -6.033  12.731  1.00 30.26 ? 41   PRO B C   1 
ATOM   4    O  O   . PRO A 1 26  ? 49.878 -6.107  12.079  1.00 29.99 ? 41   PRO B O   1 
ATOM   5    C  CB  . PRO A 1 26  ? 49.293 -5.351  15.088  1.00 31.04 ? 41   PRO B CB  1 
ATOM   6    C  CG  . PRO A 1 26  ? 50.431 -5.907  15.895  1.00 32.64 ? 41   PRO B CG  1 
ATOM   7    C  CD  . PRO A 1 26  ? 50.993 -7.037  15.105  1.00 31.51 ? 41   PRO B CD  1 
ATOM   8    N  N   . ARG A 1 27  ? 47.699 -5.551  12.238  1.00 28.55 ? 42   ARG B N   1 
ATOM   9    C  CA  . ARG A 1 27  ? 47.609 -5.081  10.858  1.00 32.70 ? 42   ARG B CA  1 
ATOM   10   C  C   . ARG A 1 27  ? 47.237 -3.601  10.776  1.00 26.49 ? 42   ARG B C   1 
ATOM   11   O  O   . ARG A 1 27  ? 46.468 -3.092  11.591  1.00 24.75 ? 42   ARG B O   1 
ATOM   12   C  CB  . ARG A 1 27  ? 46.602 -5.925  10.063  1.00 32.62 ? 42   ARG B CB  1 
ATOM   13   C  CG  . ARG A 1 27  ? 47.123 -7.292  9.620   1.00 37.45 ? 42   ARG B CG  1 
ATOM   14   C  CD  . ARG A 1 27  ? 47.438 -8.213  10.804  1.00 50.51 ? 42   ARG B CD  1 
ATOM   15   N  NE  . ARG A 1 27  ? 46.238 -8.618  11.538  1.00 57.22 ? 42   ARG B NE  1 
ATOM   16   C  CZ  . ARG A 1 27  ? 45.602 -9.772  11.357  1.00 56.55 ? 42   ARG B CZ  1 
ATOM   17   N  NH1 . ARG A 1 27  ? 46.051 -10.648 10.467  1.00 51.98 ? 42   ARG B NH1 1 
ATOM   18   N  NH2 . ARG A 1 27  ? 44.516 -10.053 12.069  1.00 59.32 ? 42   ARG B NH2 1 
ATOM   19   N  N   . LYS A 1 28  ? 47.801 -2.915  9.790   1.00 23.15 ? 43   LYS B N   1 
ATOM   20   C  CA  . LYS A 1 28  ? 47.417 -1.545  9.503   1.00 25.50 ? 43   LYS B CA  1 
ATOM   21   C  C   . LYS A 1 28  ? 45.943 -1.534  9.099   1.00 24.98 ? 43   LYS B C   1 
ATOM   22   O  O   . LYS A 1 28  ? 45.526 -2.325  8.252   1.00 23.24 ? 43   LYS B O   1 
ATOM   23   C  CB  . LYS A 1 28  ? 48.281 -0.983  8.370   1.00 26.61 ? 43   LYS B CB  1 
ATOM   24   C  CG  . LYS A 1 28  ? 47.967 0.455   7.991   1.00 24.93 ? 43   LYS B CG  1 
ATOM   25   C  CD  . LYS A 1 28  ? 48.700 0.864   6.720   1.00 27.71 ? 43   LYS B CD  1 
ATOM   26   C  CE  . LYS A 1 28  ? 48.715 2.370   6.569   1.00 33.76 ? 43   LYS B CE  1 
ATOM   27   N  NZ  . LYS A 1 28  ? 47.339 2.932   6.720   1.00 37.08 ? 43   LYS B NZ  1 
ATOM   28   N  N   . LEU A 1 29  ? 45.155 -0.674  9.737   1.00 25.33 ? 44   LEU B N   1 
ATOM   29   C  CA  . LEU A 1 29  ? 43.758 -0.463  9.356   1.00 25.53 ? 44   LEU B CA  1 
ATOM   30   C  C   . LEU A 1 29  ? 43.697 0.588   8.257   1.00 27.45 ? 44   LEU B C   1 
ATOM   31   O  O   . LEU A 1 29  ? 43.940 1.768   8.509   1.00 30.80 ? 44   LEU B O   1 
ATOM   32   C  CB  . LEU A 1 29  ? 42.925 0.008   10.554  1.00 26.37 ? 44   LEU B CB  1 
ATOM   33   C  CG  . LEU A 1 29  ? 42.532 -1.008  11.629  1.00 31.68 ? 44   LEU B CG  1 
ATOM   34   C  CD1 . LEU A 1 29  ? 41.836 -0.314  12.806  1.00 23.83 ? 44   LEU B CD1 1 
ATOM   35   C  CD2 . LEU A 1 29  ? 41.648 -2.103  11.038  1.00 26.95 ? 44   LEU B CD2 1 
ATOM   36   N  N   . VAL A 1 30  ? 43.383 0.153   7.039   1.00 21.03 ? 45   VAL B N   1 
ATOM   37   C  CA  . VAL A 1 30  ? 43.369 1.033   5.876   1.00 24.66 ? 45   VAL B CA  1 
ATOM   38   C  C   . VAL A 1 30  ? 41.949 1.556   5.620   1.00 21.91 ? 45   VAL B C   1 
ATOM   39   O  O   . VAL A 1 30  ? 41.024 0.772   5.428   1.00 24.12 ? 45   VAL B O   1 
ATOM   40   C  CB  . VAL A 1 30  ? 43.878 0.295   4.613   1.00 24.30 ? 45   VAL B CB  1 
ATOM   41   C  CG1 . VAL A 1 30  ? 43.887 1.224   3.417   1.00 23.47 ? 45   VAL B CG1 1 
ATOM   42   C  CG2 . VAL A 1 30  ? 45.277 -0.271  4.853   1.00 27.65 ? 45   VAL B CG2 1 
ATOM   43   N  N   . PRO A 1 31  ? 41.776 2.885   5.629   1.00 19.84 ? 46   PRO B N   1 
ATOM   44   C  CA  . PRO A 1 31  ? 40.450 3.474   5.395   1.00 22.91 ? 46   PRO B CA  1 
ATOM   45   C  C   . PRO A 1 31  ? 39.973 3.115   4.006   1.00 20.88 ? 46   PRO B C   1 
ATOM   46   O  O   . PRO A 1 31  ? 40.806 3.008   3.111   1.00 19.35 ? 46   PRO B O   1 
ATOM   47   C  CB  . PRO A 1 31  ? 40.717 4.983   5.439   1.00 20.11 ? 46   PRO B CB  1 
ATOM   48   C  CG  . PRO A 1 31  ? 42.065 5.132   6.090   1.00 27.73 ? 46   PRO B CG  1 
ATOM   49   C  CD  . PRO A 1 31  ? 42.829 3.908   5.708   1.00 22.59 ? 46   PRO B CD  1 
ATOM   50   N  N   . LEU A 1 32  ? 38.671 2.921   3.825   1.00 19.72 ? 47   LEU B N   1 
ATOM   51   C  CA  . LEU A 1 32  ? 38.132 2.796   2.480   1.00 21.94 ? 47   LEU B CA  1 
ATOM   52   C  C   . LEU A 1 32  ? 38.212 4.144   1.781   1.00 20.94 ? 47   LEU B C   1 
ATOM   53   O  O   . LEU A 1 32  ? 38.032 5.190   2.405   1.00 21.96 ? 47   LEU B O   1 
ATOM   54   C  CB  . LEU A 1 32  ? 36.686 2.297   2.493   1.00 17.01 ? 47   LEU B CB  1 
ATOM   55   C  CG  . LEU A 1 32  ? 36.473 0.783   2.534   1.00 23.08 ? 47   LEU B CG  1 
ATOM   56   C  CD1 . LEU A 1 32  ? 36.975 0.163   3.842   1.00 22.05 ? 47   LEU B CD1 1 
ATOM   57   C  CD2 . LEU A 1 32  ? 35.000 0.431   2.285   1.00 19.35 ? 47   LEU B CD2 1 
ATOM   58   N  N   . ALA A 1 33  ? 38.501 4.105   0.483   1.00 20.49 ? 48   ALA B N   1 
ATOM   59   C  CA  . ALA A 1 33  ? 38.452 5.286   -0.362  1.00 20.20 ? 48   ALA B CA  1 
ATOM   60   C  C   . ALA A 1 33  ? 37.009 5.656   -0.719  1.00 22.49 ? 48   ALA B C   1 
ATOM   61   O  O   . ALA A 1 33  ? 36.108 4.813   -0.687  1.00 19.77 ? 48   ALA B O   1 
ATOM   62   C  CB  . ALA A 1 33  ? 39.267 5.051   -1.631  1.00 23.99 ? 48   ALA B CB  1 
ATOM   63   N  N   . TYR A 1 34  ? 36.793 6.922   -1.061  1.00 25.00 ? 49   TYR B N   1 
ATOM   64   C  CA  . TYR A 1 34  ? 35.473 7.368   -1.496  1.00 23.64 ? 49   TYR B CA  1 
ATOM   65   C  C   . TYR A 1 34  ? 35.006 6.505   -2.671  1.00 21.60 ? 49   TYR B C   1 
ATOM   66   O  O   . TYR A 1 34  ? 35.742 6.316   -3.641  1.00 24.83 ? 49   TYR B O   1 
ATOM   67   C  CB  . TYR A 1 34  ? 35.505 8.857   -1.866  1.00 23.65 ? 49   TYR B CB  1 
ATOM   68   C  CG  . TYR A 1 34  ? 34.219 9.388   -2.471  1.00 26.06 ? 49   TYR B CG  1 
ATOM   69   C  CD1 . TYR A 1 34  ? 33.017 9.320   -1.777  1.00 24.48 ? 49   TYR B CD1 1 
ATOM   70   C  CD2 . TYR A 1 34  ? 34.212 9.974   -3.732  1.00 31.55 ? 49   TYR B CD2 1 
ATOM   71   C  CE1 . TYR A 1 34  ? 31.842 9.805   -2.329  1.00 31.21 ? 49   TYR B CE1 1 
ATOM   72   C  CE2 . TYR A 1 34  ? 33.043 10.464  -4.290  1.00 28.09 ? 49   TYR B CE2 1 
ATOM   73   C  CZ  . TYR A 1 34  ? 31.860 10.379  -3.585  1.00 30.19 ? 49   TYR B CZ  1 
ATOM   74   O  OH  . TYR A 1 34  ? 30.689 10.866  -4.140  1.00 29.39 ? 49   TYR B OH  1 
ATOM   75   N  N   . LYS A 1 35  ? 33.805 5.947   -2.549  1.00 18.71 ? 50   LYS B N   1 
ATOM   76   C  CA  . LYS A 1 35  ? 33.208 5.088   -3.583  1.00 27.49 ? 50   LYS B CA  1 
ATOM   77   C  C   . LYS A 1 35  ? 33.703 3.634   -3.583  1.00 23.59 ? 50   LYS B C   1 
ATOM   78   O  O   . LYS A 1 35  ? 33.289 2.826   -4.415  1.00 20.99 ? 50   LYS B O   1 
ATOM   79   C  CB  . LYS A 1 35  ? 33.357 5.710   -4.978  1.00 26.16 ? 50   LYS B CB  1 
ATOM   80   C  CG  . LYS A 1 35  ? 32.514 6.955   -5.189  1.00 24.37 ? 50   LYS B CG  1 
ATOM   81   C  CD  . LYS A 1 35  ? 31.035 6.660   -4.982  1.00 31.27 ? 50   LYS B CD  1 
ATOM   82   C  CE  . LYS A 1 35  ? 30.162 7.780   -5.531  1.00 32.26 ? 50   LYS B CE  1 
ATOM   83   N  NZ  . LYS A 1 35  ? 28.740 7.614   -5.113  1.00 34.30 ? 50   LYS B NZ  1 
ATOM   84   N  N   . GLN A 1 36  ? 34.570 3.289   -2.644  1.00 20.91 ? 51   GLN B N   1 
ATOM   85   C  CA  . GLN A 1 36  ? 35.009 1.904   -2.522  1.00 22.18 ? 51   GLN B CA  1 
ATOM   86   C  C   . GLN A 1 36  ? 33.967 1.086   -1.777  1.00 18.87 ? 51   GLN B C   1 
ATOM   87   O  O   . GLN A 1 36  ? 33.311 1.588   -0.870  1.00 19.21 ? 51   GLN B O   1 
ATOM   88   C  CB  . GLN A 1 36  ? 36.351 1.816   -1.785  1.00 18.57 ? 51   GLN B CB  1 
ATOM   89   C  CG  . GLN A 1 36  ? 36.755 0.402   -1.374  1.00 18.19 ? 51   GLN B CG  1 
ATOM   90   C  CD  . GLN A 1 36  ? 38.127 0.365   -0.694  1.00 23.06 ? 51   GLN B CD  1 
ATOM   91   O  OE1 . GLN A 1 36  ? 38.722 1.408   -0.432  1.00 21.19 ? 51   GLN B OE1 1 
ATOM   92   N  NE2 . GLN A 1 36  ? 38.623 -0.836  -0.406  1.00 20.49 ? 51   GLN B NE2 1 
ATOM   93   N  N   . PHE A 1 37  ? 33.822 -0.174  -2.161  1.00 18.44 ? 52   PHE B N   1 
ATOM   94   C  CA  . PHE A 1 37  ? 33.018 -1.111  -1.388  1.00 21.84 ? 52   PHE B CA  1 
ATOM   95   C  C   . PHE A 1 37  ? 33.821 -2.377  -1.080  1.00 20.12 ? 52   PHE B C   1 
ATOM   96   O  O   . PHE A 1 37  ? 34.693 -2.764  -1.854  1.00 21.45 ? 52   PHE B O   1 
ATOM   97   C  CB  . PHE A 1 37  ? 31.679 -1.429  -2.081  1.00 20.55 ? 52   PHE B CB  1 
ATOM   98   C  CG  . PHE A 1 37  ? 31.791 -1.635  -3.574  1.00 20.45 ? 52   PHE B CG  1 
ATOM   99   C  CD1 . PHE A 1 37  ? 31.592 -0.575  -4.453  1.00 21.33 ? 52   PHE B CD1 1 
ATOM   100  C  CD2 . PHE A 1 37  ? 32.083 -2.884  -4.094  1.00 21.27 ? 52   PHE B CD2 1 
ATOM   101  C  CE1 . PHE A 1 37  ? 31.691 -0.759  -5.825  1.00 24.29 ? 52   PHE B CE1 1 
ATOM   102  C  CE2 . PHE A 1 37  ? 32.183 -3.077  -5.468  1.00 24.56 ? 52   PHE B CE2 1 
ATOM   103  C  CZ  . PHE A 1 37  ? 31.983 -2.011  -6.334  1.00 23.41 ? 52   PHE B CZ  1 
ATOM   104  N  N   . SER A 1 38  ? 33.529 -2.986  0.069   1.00 20.82 ? 53   SER B N   1 
ATOM   105  C  CA  . SER A 1 38  ? 34.228 -4.172  0.556   1.00 20.55 ? 53   SER B CA  1 
ATOM   106  C  C   . SER A 1 38  ? 33.213 -5.188  1.095   1.00 20.73 ? 53   SER B C   1 
ATOM   107  O  O   . SER A 1 38  ? 32.396 -4.856  1.948   1.00 20.50 ? 53   SER B O   1 
ATOM   108  C  CB  . SER A 1 38  ? 35.236 -3.778  1.649   1.00 24.70 ? 53   SER B CB  1 
ATOM   109  O  OG  . SER A 1 38  ? 35.773 -4.915  2.307   1.00 25.53 ? 53   SER B OG  1 
ATOM   110  N  N   . PRO A 1 39  ? 33.254 -6.429  0.586   1.00 24.40 ? 54   PRO B N   1 
ATOM   111  C  CA  . PRO A 1 39  ? 34.231 -6.877  -0.416  1.00 25.71 ? 54   PRO B CA  1 
ATOM   112  C  C   . PRO A 1 39  ? 34.002 -6.206  -1.770  1.00 21.00 ? 54   PRO B C   1 
ATOM   113  O  O   . PRO A 1 39  ? 32.953 -5.589  -1.998  1.00 21.34 ? 54   PRO B O   1 
ATOM   114  C  CB  . PRO A 1 39  ? 33.973 -8.385  -0.514  1.00 26.56 ? 54   PRO B CB  1 
ATOM   115  C  CG  . PRO A 1 39  ? 32.555 -8.559  -0.079  1.00 27.06 ? 54   PRO B CG  1 
ATOM   116  C  CD  . PRO A 1 39  ? 32.271 -7.475  0.920   1.00 23.63 ? 54   PRO B CD  1 
ATOM   117  N  N   . ASN A 1 40  ? 34.988 -6.317  -2.652  1.00 21.46 ? 55   ASN B N   1 
ATOM   118  C  CA  . ASN A 1 40  ? 34.961 -5.608  -3.927  0.95 23.44 ? 55   ASN B CA  1 
ATOM   119  C  C   . ASN A 1 40  ? 34.122 -6.366  -4.955  1.00 24.84 ? 55   ASN B C   1 
ATOM   120  O  O   . ASN A 1 40  ? 34.612 -6.754  -6.022  1.00 26.14 ? 55   ASN B O   1 
ATOM   121  C  CB  . ASN A 1 40  ? 36.386 -5.370  -4.440  1.00 24.51 ? 55   ASN B CB  1 
ATOM   122  C  CG  . ASN A 1 40  ? 36.453 -4.312  -5.535  0.73 25.13 ? 55   ASN B CG  1 
ATOM   123  O  OD1 . ASN A 1 40  ? 35.536 -3.504  -5.701  1.00 27.90 ? 55   ASN B OD1 1 
ATOM   124  N  ND2 . ASN A 1 40  ? 37.547 -4.312  -6.283  1.00 25.57 ? 55   ASN B ND2 1 
ATOM   125  N  N   . VAL A 1 41  ? 32.857 -6.575  -4.605  1.00 21.98 ? 56   VAL B N   1 
ATOM   126  C  CA  . VAL A 1 41  ? 31.861 -7.172  -5.492  1.00 26.81 ? 56   VAL B CA  1 
ATOM   127  C  C   . VAL A 1 41  ? 30.511 -6.478  -5.265  1.00 24.91 ? 56   VAL B C   1 
ATOM   128  O  O   . VAL A 1 41  ? 30.331 -5.779  -4.259  1.00 23.08 ? 56   VAL B O   1 
ATOM   129  C  CB  . VAL A 1 41  ? 31.726 -8.697  -5.256  1.00 27.36 ? 56   VAL B CB  1 
ATOM   130  C  CG1 . VAL A 1 41  ? 33.036 -9.404  -5.591  1.00 25.77 ? 56   VAL B CG1 1 
ATOM   131  C  CG2 . VAL A 1 41  ? 31.309 -8.990  -3.811  1.00 25.60 ? 56   VAL B CG2 1 
ATOM   132  N  N   . PRO A 1 42  ? 29.565 -6.649  -6.206  1.00 24.44 ? 57   PRO B N   1 
ATOM   133  C  CA  . PRO A 1 42  ? 28.226 -6.055  -6.075  1.00 24.90 ? 57   PRO B CA  1 
ATOM   134  C  C   . PRO A 1 42  ? 27.535 -6.498  -4.789  1.00 24.93 ? 57   PRO B C   1 
ATOM   135  O  O   . PRO A 1 42  ? 27.715 -7.642  -4.355  1.00 24.81 ? 57   PRO B O   1 
ATOM   136  C  CB  . PRO A 1 42  ? 27.481 -6.595  -7.297  1.00 22.90 ? 57   PRO B CB  1 
ATOM   137  C  CG  . PRO A 1 42  ? 28.554 -6.853  -8.300  1.00 24.12 ? 57   PRO B CG  1 
ATOM   138  C  CD  . PRO A 1 42  ? 29.744 -7.324  -7.506  1.00 25.25 ? 57   PRO B CD  1 
ATOM   139  N  N   . GLU A 1 43  ? 26.767 -5.596  -4.184  1.00 23.46 ? 58   GLU B N   1 
ATOM   140  C  CA  . GLU A 1 43  ? 26.181 -5.842  -2.867  1.00 22.82 ? 58   GLU B CA  1 
ATOM   141  C  C   . GLU A 1 43  ? 25.362 -7.133  -2.791  1.00 25.94 ? 58   GLU B C   1 
ATOM   142  O  O   . GLU A 1 43  ? 25.413 -7.863  -1.785  1.00 22.31 ? 58   GLU B O   1 
ATOM   143  C  CB  . GLU A 1 43  ? 25.310 -4.662  -2.441  1.00 22.64 ? 58   GLU B CB  1 
ATOM   144  C  CG  . GLU A 1 43  ? 24.754 -4.803  -1.033  1.00 23.03 ? 58   GLU B CG  1 
ATOM   145  C  CD  . GLU A 1 43  ? 23.910 -3.618  -0.608  1.00 23.26 ? 58   GLU B CD  1 
ATOM   146  O  OE1 . GLU A 1 43  ? 23.362 -2.910  -1.485  1.00 24.57 ? 58   GLU B OE1 1 
ATOM   147  O  OE2 . GLU A 1 43  ? 23.782 -3.404  0.612   1.00 19.94 ? 58   GLU B OE2 1 
ATOM   148  N  N   . LYS A 1 44  ? 24.609 -7.407  -3.853  1.00 21.41 ? 59   LYS B N   1 
ATOM   149  C  CA  . LYS A 1 44  ? 23.693 -8.542  -3.877  1.00 24.07 ? 59   LYS B CA  1 
ATOM   150  C  C   . LYS A 1 44  ? 24.353 -9.889  -4.165  1.00 24.94 ? 59   LYS B C   1 
ATOM   151  O  O   . LYS A 1 44  ? 23.671 -10.903 -4.277  1.00 26.33 ? 59   LYS B O   1 
ATOM   152  C  CB  . LYS A 1 44  ? 22.554 -8.291  -4.873  1.00 25.61 ? 59   LYS B CB  1 
ATOM   153  C  CG  . LYS A 1 44  ? 21.292 -7.699  -4.252  1.00 24.55 ? 59   LYS B CG  1 
ATOM   154  C  CD  . LYS A 1 44  ? 21.598 -6.677  -3.167  1.00 28.50 ? 59   LYS B CD  1 
ATOM   155  C  CE  . LYS A 1 44  ? 20.496 -5.628  -3.070  1.00 30.22 ? 59   LYS B CE  1 
ATOM   156  N  NZ  . LYS A 1 44  ? 20.682 -4.515  -4.049  1.00 31.37 ? 59   LYS B NZ  1 
ATOM   157  N  N   . THR A 1 45  ? 25.674 -9.919  -4.277  1.00 26.14 ? 60   THR B N   1 
ATOM   158  C  CA  . THR A 1 45  ? 26.328 -11.182 -4.589  1.00 30.07 ? 60   THR B CA  1 
ATOM   159  C  C   . THR A 1 45  ? 26.439 -12.057 -3.340  1.00 28.59 ? 60   THR B C   1 
ATOM   160  O  O   . THR A 1 45  ? 26.403 -11.556 -2.216  1.00 27.06 ? 60   THR B O   1 
ATOM   161  C  CB  . THR A 1 45  ? 27.679 -10.977 -5.279  1.00 30.91 ? 60   THR B CB  1 
ATOM   162  O  OG1 . THR A 1 45  ? 28.524 -10.167 -4.454  1.00 27.21 ? 60   THR B OG1 1 
ATOM   163  C  CG2 . THR A 1 45  ? 27.473 -10.278 -6.623  1.00 31.53 ? 60   THR B CG2 1 
ATOM   164  N  N   . LEU A 1 46  ? 26.547 -13.365 -3.546  1.00 28.65 ? 61   LEU B N   1 
ATOM   165  C  CA  . LEU A 1 46  ? 26.515 -14.325 -2.443  1.00 28.55 ? 61   LEU B CA  1 
ATOM   166  C  C   . LEU A 1 46  ? 27.674 -14.179 -1.464  1.00 29.71 ? 61   LEU B C   1 
ATOM   167  O  O   . LEU A 1 46  ? 27.532 -14.484 -0.278  1.00 29.18 ? 61   LEU B O   1 
ATOM   168  C  CB  . LEU A 1 46  ? 26.453 -15.755 -2.978  1.00 28.97 ? 61   LEU B CB  1 
ATOM   169  C  CG  . LEU A 1 46  ? 25.139 -16.082 -3.686  1.00 28.10 ? 61   LEU B CG  1 
ATOM   170  C  CD1 . LEU A 1 46  ? 25.148 -17.510 -4.218  1.00 28.75 ? 61   LEU B CD1 1 
ATOM   171  C  CD2 . LEU A 1 46  ? 23.965 -15.853 -2.742  1.00 32.66 ? 61   LEU B CD2 1 
ATOM   172  N  N   . GLY A 1 47  ? 28.819 -13.723 -1.959  1.00 29.23 ? 62   GLY B N   1 
ATOM   173  C  CA  . GLY A 1 47  ? 29.960 -13.475 -1.095  1.00 31.70 ? 62   GLY B CA  1 
ATOM   174  C  C   . GLY A 1 47  ? 29.794 -12.199 -0.291  1.00 30.12 ? 62   GLY B C   1 
ATOM   175  O  O   . GLY A 1 47  ? 30.587 -11.914 0.608   1.00 25.75 ? 62   GLY B O   1 
ATOM   176  N  N   . ALA A 1 48  ? 28.756 -11.430 -0.623  1.00 28.23 ? 63   ALA B N   1 
ATOM   177  C  CA  . ALA A 1 48  ? 28.480 -10.151 0.029   1.00 25.26 ? 63   ALA B CA  1 
ATOM   178  C  C   . ALA A 1 48  ? 27.236 -10.218 0.917   1.00 23.10 ? 63   ALA B C   1 
ATOM   179  O  O   . ALA A 1 48  ? 27.154 -11.038 1.827   1.00 23.05 ? 63   ALA B O   1 
ATOM   180  C  CB  . ALA A 1 48  ? 28.321 -9.050  -1.020  1.00 27.94 ? 63   ALA B CB  1 
ATOM   181  N  N   . SER A 1 49  ? 26.264 -9.351  0.654   1.00 21.46 ? 64   SER B N   1 
ATOM   182  C  CA  . SER A 1 49  ? 25.044 -9.346  1.457   1.00 23.22 ? 64   SER B CA  1 
ATOM   183  C  C   . SER A 1 49  ? 23.901 -10.169 0.850   1.00 21.38 ? 64   SER B C   1 
ATOM   184  O  O   . SER A 1 49  ? 22.819 -10.251 1.428   1.00 27.84 ? 64   SER B O   1 
ATOM   185  C  CB  . SER A 1 49  ? 24.587 -7.918  1.758   1.00 22.20 ? 64   SER B CB  1 
ATOM   186  O  OG  . SER A 1 49  ? 25.495 -7.282  2.647   1.00 20.82 ? 64   SER B OG  1 
ATOM   187  N  N   . GLY A 1 50  ? 24.141 -10.780 -0.305  1.00 22.90 ? 65   GLY B N   1 
ATOM   188  C  CA  . GLY A 1 50  ? 23.134 -11.632 -0.922  1.00 27.56 ? 65   GLY B CA  1 
ATOM   189  C  C   . GLY A 1 50  ? 21.952 -10.930 -1.591  1.00 23.05 ? 65   GLY B C   1 
ATOM   190  O  O   . GLY A 1 50  ? 21.895 -9.702  -1.684  1.00 22.25 ? 65   GLY B O   1 
ATOM   191  N  N   . ARG A 1 51  ? 20.991 -11.729 -2.042  1.00 24.30 ? 66   ARG B N   1 
ATOM   192  C  CA  . ARG A 1 51  ? 19.866 -11.230 -2.843  1.00 25.79 ? 66   ARG B CA  1 
ATOM   193  C  C   . ARG A 1 51  ? 18.882 -10.334 -2.085  1.00 26.48 ? 66   ARG B C   1 
ATOM   194  O  O   . ARG A 1 51  ? 18.699 -10.468 -0.871  1.00 26.43 ? 66   ARG B O   1 
ATOM   195  C  CB  . ARG A 1 51  ? 19.093 -12.399 -3.468  1.00 24.58 ? 66   ARG B CB  1 
ATOM   196  C  CG  . ARG A 1 51  ? 19.958 -13.542 -3.983  1.00 23.82 ? 66   ARG B CG  1 
ATOM   197  C  CD  . ARG A 1 51  ? 21.034 -13.061 -4.936  1.00 31.38 ? 66   ARG B CD  1 
ATOM   198  N  NE  . ARG A 1 51  ? 21.631 -14.159 -5.693  1.00 32.41 ? 66   ARG B NE  1 
ATOM   199  C  CZ  . ARG A 1 51  ? 22.811 -14.097 -6.306  1.00 35.62 ? 66   ARG B CZ  1 
ATOM   200  N  NH1 . ARG A 1 51  ? 23.539 -12.985 -6.245  1.00 30.62 ? 66   ARG B NH1 1 
ATOM   201  N  NH2 . ARG A 1 51  ? 23.266 -15.152 -6.973  1.00 33.69 ? 66   ARG B NH2 1 
ATOM   202  N  N   . TYR A 1 52  ? 18.261 -9.421  -2.829  1.00 26.57 ? 67   TYR B N   1 
ATOM   203  C  CA  . TYR A 1 52  ? 17.134 -8.624  -2.358  1.00 26.74 ? 67   TYR B CA  1 
ATOM   204  C  C   . TYR A 1 52  ? 15.915 -9.531  -2.205  1.00 30.50 ? 67   TYR B C   1 
ATOM   205  O  O   . TYR A 1 52  ? 15.612 -10.320 -3.102  1.00 28.39 ? 67   TYR B O   1 
ATOM   206  C  CB  . TYR A 1 52  ? 16.839 -7.523  -3.379  1.00 29.41 ? 67   TYR B CB  1 
ATOM   207  C  CG  . TYR A 1 52  ? 15.644 -6.646  -3.069  1.00 29.38 ? 67   TYR B CG  1 
ATOM   208  C  CD1 . TYR A 1 52  ? 15.641 -5.813  -1.958  1.00 28.69 ? 67   TYR B CD1 1 
ATOM   209  C  CD2 . TYR A 1 52  ? 14.523 -6.638  -3.900  1.00 33.23 ? 67   TYR B CD2 1 
ATOM   210  C  CE1 . TYR A 1 52  ? 14.556 -4.996  -1.674  1.00 28.16 ? 67   TYR B CE1 1 
ATOM   211  C  CE2 . TYR A 1 52  ? 13.433 -5.823  -3.625  1.00 34.20 ? 67   TYR B CE2 1 
ATOM   212  C  CZ  . TYR A 1 52  ? 13.459 -5.003  -2.504  1.00 34.42 ? 67   TYR B CZ  1 
ATOM   213  O  OH  . TYR A 1 52  ? 12.394 -4.185  -2.204  1.00 30.59 ? 67   TYR B OH  1 
ATOM   214  N  N   . GLU A 1 53  ? 15.222 -9.433  -1.073  1.00 29.59 ? 68   GLU B N   1 
ATOM   215  C  CA  . GLU A 1 53  ? 14.079 -10.310 -0.813  1.00 31.77 ? 68   GLU B CA  1 
ATOM   216  C  C   . GLU A 1 53  ? 12.726 -9.587  -0.819  1.00 31.48 ? 68   GLU B C   1 
ATOM   217  O  O   . GLU A 1 53  ? 11.695 -10.190 -0.519  1.00 32.66 ? 68   GLU B O   1 
ATOM   218  C  CB  . GLU A 1 53  ? 14.277 -11.082 0.497   1.00 32.31 ? 68   GLU B CB  1 
ATOM   219  C  CG  . GLU A 1 53  ? 15.432 -12.091 0.463   1.00 29.33 ? 68   GLU B CG  1 
ATOM   220  C  CD  . GLU A 1 53  ? 15.753 -12.676 1.841   1.00 30.36 ? 68   GLU B CD  1 
ATOM   221  O  OE1 . GLU A 1 53  ? 16.705 -13.479 1.948   1.00 30.60 ? 68   GLU B OE1 1 
ATOM   222  O  OE2 . GLU A 1 53  ? 15.059 -12.331 2.821   1.00 35.58 ? 68   GLU B OE2 1 
ATOM   223  N  N   . GLY A 1 54  ? 12.733 -8.302  -1.162  1.00 29.70 ? 69   GLY B N   1 
ATOM   224  C  CA  . GLY A 1 54  ? 11.507 -7.524  -1.245  1.00 31.37 ? 69   GLY B CA  1 
ATOM   225  C  C   . GLY A 1 54  ? 11.270 -6.658  -0.021  1.00 31.33 ? 69   GLY B C   1 
ATOM   226  O  O   . GLY A 1 54  ? 11.792 -6.944  1.057   1.00 28.73 ? 69   GLY B O   1 
ATOM   227  N  N   . LYS A 1 55  ? 10.476 -5.603  -0.193  1.00 30.06 ? 70   LYS B N   1 
ATOM   228  C  CA  . LYS A 1 55  ? 10.163 -4.673  0.891   0.97 31.78 ? 70   LYS B CA  1 
ATOM   229  C  C   . LYS A 1 55  ? 9.452  -5.370  2.042   1.00 31.80 ? 70   LYS B C   1 
ATOM   230  O  O   . LYS A 1 55  ? 8.643  -6.276  1.826   1.00 27.06 ? 70   LYS B O   1 
ATOM   231  C  CB  . LYS A 1 55  ? 9.291  -3.519  0.380   1.00 30.17 ? 70   LYS B CB  1 
ATOM   232  C  CG  . LYS A 1 55  ? 9.967  -2.634  -0.654  1.00 32.53 ? 70   LYS B CG  1 
ATOM   233  C  CD  . LYS A 1 55  ? 9.209  -1.325  -0.845  1.00 34.58 ? 70   LYS B CD  1 
ATOM   234  C  CE  . LYS A 1 55  ? 10.110 -0.257  -1.452  1.00 31.89 ? 70   LYS B CE  1 
ATOM   235  N  NZ  . LYS A 1 55  ? 9.485  1.084   -1.406  0.85 32.02 ? 70   LYS B NZ  1 
ATOM   236  N  N   . ILE A 1 56  ? 9.766  -4.947  3.264   1.00 32.99 ? 71   ILE B N   1 
ATOM   237  C  CA  . ILE A 1 56  ? 9.062  -5.419  4.452   1.00 31.81 ? 71   ILE B CA  1 
ATOM   238  C  C   . ILE A 1 56  ? 8.151  -4.311  4.961   1.00 34.14 ? 71   ILE B C   1 
ATOM   239  O  O   . ILE A 1 56  ? 8.617  -3.223  5.312   1.00 26.04 ? 71   ILE B O   1 
ATOM   240  C  CB  . ILE A 1 56  ? 10.033 -5.842  5.581   1.00 34.56 ? 71   ILE B CB  1 
ATOM   241  C  CG1 . ILE A 1 56  ? 10.771 -7.128  5.199   1.00 31.28 ? 71   ILE B CG1 1 
ATOM   242  C  CG2 . ILE A 1 56  ? 9.276  -6.027  6.895   1.00 36.10 ? 71   ILE B CG2 1 
ATOM   243  C  CD1 . ILE A 1 56  ? 11.670 -7.689  6.291   1.00 33.25 ? 71   ILE B CD1 1 
ATOM   244  N  N   . ALA A 1 57  ? 6.849  -4.579  4.972   1.00 33.57 ? 72   ALA B N   1 
ATOM   245  C  CA  . ALA A 1 57  ? 5.882  -3.628  5.503   1.00 37.90 ? 72   ALA B CA  1 
ATOM   246  C  C   . ALA A 1 57  ? 5.558  -3.977  6.952   1.00 36.36 ? 72   ALA B C   1 
ATOM   247  O  O   . ALA A 1 57  ? 5.743  -5.119  7.374   1.00 35.10 ? 72   ALA B O   1 
ATOM   248  C  CB  . ALA A 1 57  ? 4.611  -3.626  4.651   1.00 35.87 ? 72   ALA B CB  1 
ATOM   249  N  N   . ARG A 1 58  ? 5.086  -2.990  7.709   1.00 39.41 ? 73   ARG B N   1 
ATOM   250  C  CA  . ARG A 1 58  ? 4.653  -3.212  9.088   1.00 39.82 ? 73   ARG B CA  1 
ATOM   251  C  C   . ARG A 1 58  ? 3.737  -4.431  9.184   1.00 41.39 ? 73   ARG B C   1 
ATOM   252  O  O   . ARG A 1 58  ? 3.752  -5.162  10.178  1.00 39.99 ? 73   ARG B O   1 
ATOM   253  C  CB  . ARG A 1 58  ? 3.910  -1.981  9.612   1.00 40.96 ? 73   ARG B CB  1 
ATOM   254  C  CG  . ARG A 1 58  ? 4.778  -0.750  9.829   1.00 42.28 ? 73   ARG B CG  1 
ATOM   255  C  CD  . ARG A 1 58  ? 5.268  -0.664  11.266  1.00 49.35 ? 73   ARG B CD  1 
ATOM   256  N  NE  . ARG A 1 58  ? 5.988  0.581   11.532  1.00 49.25 ? 73   ARG B NE  1 
ATOM   257  C  CZ  . ARG A 1 58  ? 6.593  0.867   12.683  1.00 49.85 ? 73   ARG B CZ  1 
ATOM   258  N  NH1 . ARG A 1 58  ? 6.568  -0.003  13.685  1.00 51.56 ? 73   ARG B NH1 1 
ATOM   259  N  NH2 . ARG A 1 58  ? 7.225  2.025   12.834  1.00 51.64 ? 73   ARG B NH2 1 
ATOM   260  N  N   . SER A 1 59  ? 2.945  -4.644  8.136   1.00 41.59 ? 74   SER B N   1 
ATOM   261  C  CA  . SER A 1 59  ? 1.923  -5.687  8.130   1.00 42.34 ? 74   SER B CA  1 
ATOM   262  C  C   . SER A 1 59  ? 2.467  -7.063  7.749   1.00 42.37 ? 74   SER B C   1 
ATOM   263  O  O   . SER A 1 59  ? 1.776  -8.071  7.891   1.00 47.30 ? 74   SER B O   1 
ATOM   264  C  CB  . SER A 1 59  ? 0.787  -5.299  7.180   1.00 43.62 ? 74   SER B CB  1 
ATOM   265  O  OG  . SER A 1 59  ? 1.295  -4.909  5.915   1.00 43.01 ? 74   SER B OG  1 
ATOM   266  N  N   . SER A 1 60  ? 3.700  -7.100  7.260   1.00 39.34 ? 75   SER B N   1 
ATOM   267  C  CA  . SER A 1 60  ? 4.328  -8.358  6.872   1.00 38.35 ? 75   SER B CA  1 
ATOM   268  C  C   . SER A 1 60  ? 4.590  -9.294  8.049   1.00 40.18 ? 75   SER B C   1 
ATOM   269  O  O   . SER A 1 60  ? 4.839  -8.851  9.175   1.00 36.83 ? 75   SER B O   1 
ATOM   270  C  CB  . SER A 1 60  ? 5.643  -8.090  6.142   1.00 37.21 ? 75   SER B CB  1 
ATOM   271  O  OG  . SER A 1 60  ? 5.398  -7.749  4.794   1.00 44.23 ? 75   SER B OG  1 
ATOM   272  N  N   . GLU A 1 61  ? 4.526  -10.593 7.771   1.00 35.58 ? 76   GLU B N   1 
ATOM   273  C  CA  . GLU A 1 61  ? 4.968  -11.606 8.713   1.00 38.96 ? 76   GLU B CA  1 
ATOM   274  C  C   . GLU A 1 61  ? 6.477  -11.448 8.926   1.00 38.66 ? 76   GLU B C   1 
ATOM   275  O  O   . GLU A 1 61  ? 6.986  -11.666 10.030  1.00 35.23 ? 76   GLU B O   1 
ATOM   276  C  CB  . GLU A 1 61  ? 4.648  -13.000 8.169   1.00 38.37 ? 76   GLU B CB  1 
ATOM   277  C  CG  . GLU A 1 61  ? 5.102  -14.148 9.065   1.00 39.09 ? 76   GLU B CG  1 
ATOM   278  C  CD  . GLU A 1 61  ? 4.599  -15.503 8.584   1.00 36.14 ? 76   GLU B CD  1 
ATOM   279  O  OE1 . GLU A 1 61  ? 5.439  -16.382 8.291   1.00 41.18 ? 76   GLU B OE1 1 
ATOM   280  O  OE2 . GLU A 1 61  ? 3.366  -15.689 8.504   1.00 38.50 ? 76   GLU B OE2 1 
ATOM   281  N  N   . ARG A 1 62  ? 7.171  -11.058 7.854   1.00 36.34 ? 77   ARG B N   1 
ATOM   282  C  CA  . ARG A 1 62  ? 8.614  -10.829 7.871   1.00 37.44 ? 77   ARG B CA  1 
ATOM   283  C  C   . ARG A 1 62  ? 8.993  -9.610  8.708   1.00 33.30 ? 77   ARG B C   1 
ATOM   284  O  O   . ARG A 1 62  ? 10.152 -9.454  9.089   1.00 34.97 ? 77   ARG B O   1 
ATOM   285  C  CB  . ARG A 1 62  ? 9.156  -10.677 6.441   1.00 35.34 ? 77   ARG B CB  1 
ATOM   286  C  CG  . ARG A 1 62  ? 9.227  -11.983 5.655   1.00 38.57 ? 77   ARG B CG  1 
ATOM   287  C  CD  . ARG A 1 62  ? 9.322  -11.761 4.136   1.00 33.40 ? 77   ARG B CD  1 
ATOM   288  N  NE  . ARG A 1 62  ? 10.579 -11.128 3.741   1.00 39.15 ? 77   ARG B NE  1 
ATOM   289  C  CZ  . ARG A 1 62  ? 10.666 -9.955  3.121   1.00 37.39 ? 77   ARG B CZ  1 
ATOM   290  N  NH1 . ARG A 1 62  ? 9.569  -9.281  2.815   1.00 34.52 ? 77   ARG B NH1 1 
ATOM   291  N  NH2 . ARG A 1 62  ? 11.855 -9.455  2.804   1.00 37.81 ? 77   ARG B NH2 1 
ATOM   292  N  N   . PHE A 1 63  ? 8.024  -8.743  8.986   1.00 32.92 ? 78   PHE B N   1 
ATOM   293  C  CA  . PHE A 1 63  ? 8.260  -7.615  9.886   1.00 35.40 ? 78   PHE B CA  1 
ATOM   294  C  C   . PHE A 1 63  ? 8.660  -8.096  11.282  1.00 34.75 ? 78   PHE B C   1 
ATOM   295  O  O   . PHE A 1 63  ? 9.259  -7.354  12.062  1.00 29.93 ? 78   PHE B O   1 
ATOM   296  C  CB  . PHE A 1 63  ? 7.021  -6.724  9.981   1.00 33.82 ? 78   PHE B CB  1 
ATOM   297  C  CG  . PHE A 1 63  ? 7.157  -5.604  10.972  1.00 34.76 ? 78   PHE B CG  1 
ATOM   298  C  CD1 . PHE A 1 63  ? 7.893  -4.472  10.660  1.00 35.48 ? 78   PHE B CD1 1 
ATOM   299  C  CD2 . PHE A 1 63  ? 6.548  -5.683  12.220  1.00 32.84 ? 78   PHE B CD2 1 
ATOM   300  C  CE1 . PHE A 1 63  ? 8.024  -3.436  11.576  1.00 34.82 ? 78   PHE B CE1 1 
ATOM   301  C  CE2 . PHE A 1 63  ? 6.673  -4.653  13.136  1.00 34.05 ? 78   PHE B CE2 1 
ATOM   302  C  CZ  . PHE A 1 63  ? 7.413  -3.528  12.813  1.00 34.98 ? 78   PHE B CZ  1 
ATOM   303  N  N   . LYS A 1 64  ? 8.325  -9.343  11.597  1.00 32.45 ? 79   LYS B N   1 
ATOM   304  C  CA  . LYS A 1 64  ? 8.618  -9.870  12.926  1.00 35.18 ? 79   LYS B CA  1 
ATOM   305  C  C   . LYS A 1 64  ? 10.061 -10.350 13.055  1.00 35.61 ? 79   LYS B C   1 
ATOM   306  O  O   . LYS A 1 64  ? 10.474 -10.812 14.112  1.00 30.88 ? 79   LYS B O   1 
ATOM   307  C  CB  . LYS A 1 64  ? 7.616  -10.955 13.319  1.00 30.40 ? 79   LYS B CB  1 
ATOM   308  C  CG  . LYS A 1 64  ? 6.178  -10.441 13.278  1.00 35.19 ? 79   LYS B CG  1 
ATOM   309  C  CD  . LYS A 1 64  ? 5.275  -11.136 14.282  1.00 38.65 ? 79   LYS B CD  1 
ATOM   310  C  CE  . LYS A 1 64  ? 4.645  -12.372 13.681  1.00 37.80 ? 79   LYS B CE  1 
ATOM   311  N  NZ  . LYS A 1 64  ? 5.686  -13.394 13.398  1.00 32.18 ? 79   LYS B NZ  1 
ATOM   312  N  N   . GLU A 1 65  ? 10.827 -10.216 11.977  1.00 35.62 ? 80   GLU B N   1 
ATOM   313  C  CA  . GLU A 1 65  ? 12.255 -10.509 12.017  1.00 35.51 ? 80   GLU B CA  1 
ATOM   314  C  C   . GLU A 1 65  ? 13.054 -9.244  12.314  1.00 31.78 ? 80   GLU B C   1 
ATOM   315  O  O   . GLU A 1 65  ? 14.270 -9.302  12.500  1.00 31.65 ? 80   GLU B O   1 
ATOM   316  C  CB  . GLU A 1 65  ? 12.719 -11.134 10.698  1.00 38.25 ? 80   GLU B CB  1 
ATOM   317  C  CG  . GLU A 1 65  ? 12.216 -12.551 10.479  1.00 41.60 ? 80   GLU B CG  1 
ATOM   318  C  CD  . GLU A 1 65  ? 12.553 -13.085 9.102   1.00 48.44 ? 80   GLU B CD  1 
ATOM   319  O  OE1 . GLU A 1 65  ? 12.666 -14.323 8.955   1.00 49.33 ? 80   GLU B OE1 1 
ATOM   320  O  OE2 . GLU A 1 65  ? 12.700 -12.268 8.167   1.00 46.29 ? 80   GLU B OE2 1 
ATOM   321  N  N   . LEU A 1 66  ? 12.367 -8.104  12.348  1.00 28.12 ? 81   LEU B N   1 
ATOM   322  C  CA  . LEU A 1 66  ? 13.005 -6.837  12.684  1.00 28.43 ? 81   LEU B CA  1 
ATOM   323  C  C   . LEU A 1 66  ? 12.922 -6.585  14.187  1.00 30.82 ? 81   LEU B C   1 
ATOM   324  O  O   . LEU A 1 66  ? 11.864 -6.757  14.799  1.00 28.08 ? 81   LEU B O   1 
ATOM   325  C  CB  . LEU A 1 66  ? 12.369 -5.673  11.922  1.00 25.60 ? 81   LEU B CB  1 
ATOM   326  C  CG  . LEU A 1 66  ? 12.398 -5.718  10.392  1.00 25.64 ? 81   LEU B CG  1 
ATOM   327  C  CD1 . LEU A 1 66  ? 12.010 -4.364  9.821   1.00 26.77 ? 81   LEU B CD1 1 
ATOM   328  C  CD2 . LEU A 1 66  ? 13.767 -6.138  9.883   1.00 23.72 ? 81   LEU B CD2 1 
ATOM   329  N  N   . THR A 1 67  ? 14.051 -6.198  14.772  1.00 29.46 ? 82   THR B N   1 
ATOM   330  C  CA  . THR A 1 67  ? 14.146 -5.914  16.205  1.00 34.47 ? 82   THR B CA  1 
ATOM   331  C  C   . THR A 1 67  ? 14.627 -4.481  16.409  1.00 28.12 ? 82   THR B C   1 
ATOM   332  O  O   . THR A 1 67  ? 15.475 -4.003  15.661  1.00 30.97 ? 82   THR B O   1 
ATOM   333  C  CB  . THR A 1 67  ? 15.157 -6.862  16.905  1.00 36.95 ? 82   THR B CB  1 
ATOM   334  O  OG1 . THR A 1 67  ? 14.930 -8.214  16.489  1.00 37.66 ? 82   THR B OG1 1 
ATOM   335  C  CG2 . THR A 1 67  ? 15.025 -6.769  18.414  1.00 30.51 ? 82   THR B CG2 1 
ATOM   336  N  N   . PRO A 1 68  ? 14.081 -3.780  17.413  1.00 33.90 ? 83   PRO B N   1 
ATOM   337  C  CA  . PRO A 1 68  ? 14.583 -2.427  17.674  1.00 33.29 ? 83   PRO B CA  1 
ATOM   338  C  C   . PRO A 1 68  ? 15.931 -2.454  18.397  1.00 28.44 ? 83   PRO B C   1 
ATOM   339  O  O   . PRO A 1 68  ? 16.139 -3.269  19.298  1.00 31.68 ? 83   PRO B O   1 
ATOM   340  C  CB  . PRO A 1 68  ? 13.511 -1.827  18.583  1.00 34.81 ? 83   PRO B CB  1 
ATOM   341  C  CG  . PRO A 1 68  ? 12.901 -3.001  19.268  1.00 36.87 ? 83   PRO B CG  1 
ATOM   342  C  CD  . PRO A 1 68  ? 12.954 -4.141  18.291  1.00 36.87 ? 83   PRO B CD  1 
ATOM   343  N  N   . ASN A 1 69  ? 16.835 -1.571  17.993  1.00 26.73 ? 84   ASN B N   1 
ATOM   344  C  CA  . ASN A 1 69  ? 18.130 -1.443  18.652  1.00 29.06 ? 84   ASN B CA  1 
ATOM   345  C  C   . ASN A 1 69  ? 18.128 -0.222  19.576  1.00 25.84 ? 84   ASN B C   1 
ATOM   346  O  O   . ASN A 1 69  ? 17.977 0.908   19.117  1.00 26.35 ? 84   ASN B O   1 
ATOM   347  C  CB  . ASN A 1 69  ? 19.257 -1.354  17.610  1.00 25.14 ? 84   ASN B CB  1 
ATOM   348  C  CG  . ASN A 1 69  ? 20.640 -1.575  18.219  1.00 29.32 ? 84   ASN B CG  1 
ATOM   349  O  OD1 . ASN A 1 69  ? 20.859 -1.275  19.384  1.00 27.78 ? 84   ASN B OD1 1 
ATOM   350  N  ND2 . ASN A 1 69  ? 21.571 -2.105  17.429  1.00 22.28 ? 84   ASN B ND2 1 
ATOM   351  N  N   . TYR A 1 70  ? 18.267 -0.453  20.880  1.00 29.90 ? 85   TYR B N   1 
ATOM   352  C  CA  . TYR A 1 70  ? 18.262 0.644   21.853  1.00 26.47 ? 85   TYR B CA  1 
ATOM   353  C  C   . TYR A 1 70  ? 19.626 0.890   22.497  1.00 30.98 ? 85   TYR B C   1 
ATOM   354  O  O   . TYR A 1 70  ? 19.710 1.468   23.583  1.00 29.96 ? 85   TYR B O   1 
ATOM   355  C  CB  . TYR A 1 70  ? 17.217 0.399   22.943  1.00 33.65 ? 85   TYR B CB  1 
ATOM   356  C  CG  . TYR A 1 70  ? 15.795 0.510   22.447  1.00 29.98 ? 85   TYR B CG  1 
ATOM   357  C  CD1 . TYR A 1 70  ? 15.232 1.750   22.175  1.00 32.42 ? 85   TYR B CD1 1 
ATOM   358  C  CD2 . TYR A 1 70  ? 15.019 -0.623  22.251  1.00 32.50 ? 85   TYR B CD2 1 
ATOM   359  C  CE1 . TYR A 1 70  ? 13.933 1.855   21.717  1.00 35.40 ? 85   TYR B CE1 1 
ATOM   360  C  CE2 . TYR A 1 70  ? 13.718 -0.527  21.797  1.00 35.28 ? 85   TYR B CE2 1 
ATOM   361  C  CZ  . TYR A 1 70  ? 13.181 0.714   21.531  1.00 35.25 ? 85   TYR B CZ  1 
ATOM   362  O  OH  . TYR A 1 70  ? 11.886 0.814   21.076  1.00 43.64 ? 85   TYR B OH  1 
ATOM   363  N  N   . ASN A 1 71  ? 20.685 0.448   21.827  1.00 28.78 ? 86   ASN B N   1 
ATOM   364  C  CA  . ASN A 1 71  ? 22.052 0.673   22.298  1.00 25.18 ? 86   ASN B CA  1 
ATOM   365  C  C   . ASN A 1 71  ? 22.299 2.129   22.691  1.00 24.44 ? 86   ASN B C   1 
ATOM   366  O  O   . ASN A 1 71  ? 22.283 3.012   21.838  1.00 23.45 ? 86   ASN B O   1 
ATOM   367  C  CB  . ASN A 1 71  ? 23.051 0.250   21.216  1.00 23.75 ? 86   ASN B CB  1 
ATOM   368  C  CG  . ASN A 1 71  ? 24.470 0.116   21.749  1.00 26.09 ? 86   ASN B CG  1 
ATOM   369  O  OD1 . ASN A 1 71  ? 24.864 0.806   22.692  1.00 26.82 ? 86   ASN B OD1 1 
ATOM   370  N  ND2 . ASN A 1 71  ? 25.245 -0.767  21.135  1.00 24.60 ? 86   ASN B ND2 1 
ATOM   371  N  N   . PRO A 1 72  ? 22.537 2.384   23.992  1.00 27.86 ? 87   PRO B N   1 
ATOM   372  C  CA  . PRO A 1 72  ? 22.782 3.746   24.488  1.00 26.78 ? 87   PRO B CA  1 
ATOM   373  C  C   . PRO A 1 72  ? 24.079 4.349   23.936  1.00 28.06 ? 87   PRO B C   1 
ATOM   374  O  O   . PRO A 1 72  ? 24.302 5.552   24.072  1.00 29.29 ? 87   PRO B O   1 
ATOM   375  C  CB  . PRO A 1 72  ? 22.930 3.561   26.012  1.00 24.48 ? 87   PRO B CB  1 
ATOM   376  C  CG  . PRO A 1 72  ? 22.544 2.152   26.306  1.00 31.59 ? 87   PRO B CG  1 
ATOM   377  C  CD  . PRO A 1 72  ? 22.724 1.368   25.041  1.00 27.69 ? 87   PRO B CD  1 
ATOM   378  N  N   . ASP A 1 73  ? 24.936 3.522   23.349  1.00 26.82 ? 88   ASP B N   1 
ATOM   379  C  CA  . ASP A 1 73  ? 26.200 4.017   22.811  1.00 27.90 ? 88   ASP B CA  1 
ATOM   380  C  C   . ASP A 1 73  ? 26.133 4.326   21.326  1.00 24.75 ? 88   ASP B C   1 
ATOM   381  O  O   . ASP A 1 73  ? 27.164 4.548   20.696  1.00 23.35 ? 88   ASP B O   1 
ATOM   382  C  CB  . ASP A 1 73  ? 27.332 3.020   23.066  1.00 23.77 ? 88   ASP B CB  1 
ATOM   383  C  CG  . ASP A 1 73  ? 27.622 2.849   24.527  1.00 28.27 ? 88   ASP B CG  1 
ATOM   384  O  OD1 . ASP A 1 73  ? 27.450 3.830   25.275  1.00 28.67 ? 88   ASP B OD1 1 
ATOM   385  O  OD2 . ASP A 1 73  ? 28.013 1.735   24.923  1.00 28.17 ? 88   ASP B OD2 1 
ATOM   386  N  N   . ILE A 1 74  ? 24.923 4.327   20.770  1.00 26.76 ? 89   ILE B N   1 
ATOM   387  C  CA  . ILE A 1 74  ? 24.727 4.667   19.359  1.00 25.42 ? 89   ILE B CA  1 
ATOM   388  C  C   . ILE A 1 74  ? 23.785 5.855   19.259  1.00 24.88 ? 89   ILE B C   1 
ATOM   389  O  O   . ILE A 1 74  ? 22.744 5.879   19.916  1.00 26.21 ? 89   ILE B O   1 
ATOM   390  C  CB  . ILE A 1 74  ? 24.118 3.494   18.559  1.00 23.07 ? 89   ILE B CB  1 
ATOM   391  C  CG1 . ILE A 1 74  ? 25.011 2.258   18.640  1.00 20.16 ? 89   ILE B CG1 1 
ATOM   392  C  CG2 . ILE A 1 74  ? 23.879 3.899   17.089  1.00 23.39 ? 89   ILE B CG2 1 
ATOM   393  C  CD1 . ILE A 1 74  ? 24.444 1.025   17.944  1.00 20.00 ? 89   ILE B CD1 1 
ATOM   394  N  N   . ILE A 1 75  ? 24.158 6.844   18.453  1.00 23.88 ? 90   ILE B N   1 
ATOM   395  C  CA  . ILE A 1 75  ? 23.302 8.000   18.212  1.00 22.01 ? 90   ILE B CA  1 
ATOM   396  C  C   . ILE A 1 75  ? 22.386 7.699   17.031  1.00 24.34 ? 90   ILE B C   1 
ATOM   397  O  O   . ILE A 1 75  ? 22.834 7.214   15.993  1.00 24.85 ? 90   ILE B O   1 
ATOM   398  C  CB  . ILE A 1 75  ? 24.119 9.273   17.894  1.00 24.85 ? 90   ILE B CB  1 
ATOM   399  C  CG1 . ILE A 1 75  ? 25.132 9.574   19.010  1.00 25.61 ? 90   ILE B CG1 1 
ATOM   400  C  CG2 . ILE A 1 75  ? 23.183 10.464  17.650  1.00 23.97 ? 90   ILE B CG2 1 
ATOM   401  C  CD1 . ILE A 1 75  ? 24.501 10.041  20.330  1.00 27.78 ? 90   ILE B CD1 1 
ATOM   402  N  N   . PHE A 1 76  ? 21.103 7.981   17.197  1.00 24.92 ? 91   PHE B N   1 
ATOM   403  C  CA  . PHE A 1 76  ? 20.127 7.740   16.140  1.00 28.63 ? 91   PHE B CA  1 
ATOM   404  C  C   . PHE A 1 76  ? 19.529 9.069   15.688  1.00 28.79 ? 91   PHE B C   1 
ATOM   405  O  O   . PHE A 1 76  ? 18.844 9.745   16.459  1.00 30.16 ? 91   PHE B O   1 
ATOM   406  C  CB  . PHE A 1 76  ? 19.037 6.781   16.624  1.00 24.62 ? 91   PHE B CB  1 
ATOM   407  C  CG  . PHE A 1 76  ? 19.465 5.341   16.647  1.00 26.10 ? 91   PHE B CG  1 
ATOM   408  C  CD1 . PHE A 1 76  ? 19.409 4.573   15.491  1.00 29.14 ? 91   PHE B CD1 1 
ATOM   409  C  CD2 . PHE A 1 76  ? 19.923 4.751   17.818  1.00 29.40 ? 91   PHE B CD2 1 
ATOM   410  C  CE1 . PHE A 1 76  ? 19.801 3.247   15.502  1.00 26.09 ? 91   PHE B CE1 1 
ATOM   411  C  CE2 . PHE A 1 76  ? 20.320 3.421   17.837  1.00 24.84 ? 91   PHE B CE2 1 
ATOM   412  C  CZ  . PHE A 1 76  ? 20.255 2.668   16.675  1.00 26.22 ? 91   PHE B CZ  1 
ATOM   413  N  N   . LYS A 1 77  ? 19.816 9.447   14.447  1.00 28.02 ? 92   LYS B N   1 
ATOM   414  C  CA  . LYS A 1 77  ? 19.373 10.729  13.909  1.00 28.35 ? 92   LYS B CA  1 
ATOM   415  C  C   . LYS A 1 77  ? 17.856 10.887  14.017  1.00 31.17 ? 92   LYS B C   1 
ATOM   416  O  O   . LYS A 1 77  ? 17.368 11.787  14.707  1.00 35.83 ? 92   LYS B O   1 
ATOM   417  C  CB  . LYS A 1 77  ? 19.815 10.874  12.452  1.00 27.17 ? 92   LYS B CB  1 
ATOM   418  C  CG  . LYS A 1 77  ? 19.448 12.208  11.819  1.00 30.55 ? 92   LYS B CG  1 
ATOM   419  C  CD  . LYS A 1 77  ? 19.578 12.145  10.299  1.00 30.09 ? 92   LYS B CD  1 
ATOM   420  C  CE  . LYS A 1 77  ? 18.994 13.389  9.652   1.00 33.37 ? 92   LYS B CE  1 
ATOM   421  N  NZ  . LYS A 1 77  ? 19.803 14.606  9.941   1.00 36.78 ? 92   LYS B NZ  1 
ATOM   422  N  N   . ALA A 1 84  ? 12.714 2.770   14.151  1.00 26.20 ? 99   ALA B N   1 
ATOM   423  C  CA  . ALA A 1 84  ? 12.573 2.905   12.693  1.00 31.23 ? 99   ALA B CA  1 
ATOM   424  C  C   . ALA A 1 84  ? 13.950 2.830   12.025  1.00 28.39 ? 99   ALA B C   1 
ATOM   425  O  O   . ALA A 1 84  ? 14.264 1.854   11.342  1.00 22.54 ? 99   ALA B O   1 
ATOM   426  C  CB  . ALA A 1 84  ? 11.884 4.194   12.347  1.00 29.46 ? 99   ALA B CB  1 
ATOM   427  N  N   . GLU A 1 85  ? 14.764 3.866   12.227  1.00 25.47 ? 100  GLU B N   1 
ATOM   428  C  CA  . GLU A 1 85  ? 16.207 3.743   12.039  1.00 25.09 ? 100  GLU B CA  1 
ATOM   429  C  C   . GLU A 1 85  ? 16.715 2.643   12.969  1.00 25.71 ? 100  GLU B C   1 
ATOM   430  O  O   . GLU A 1 85  ? 17.791 2.077   12.756  1.00 25.38 ? 100  GLU B O   1 
ATOM   431  C  CB  . GLU A 1 85  ? 16.919 5.051   12.405  1.00 31.22 ? 100  GLU B CB  1 
ATOM   432  C  CG  . GLU A 1 85  ? 16.869 6.148   11.353  1.00 24.65 ? 100  GLU B CG  1 
ATOM   433  C  CD  . GLU A 1 85  ? 17.383 7.487   11.885  1.00 35.91 ? 100  GLU B CD  1 
ATOM   434  O  OE1 . GLU A 1 85  ? 17.497 7.650   13.126  1.00 33.77 ? 100  GLU B OE1 1 
ATOM   435  O  OE2 . GLU A 1 85  ? 17.666 8.385   11.063  1.00 36.47 ? 100  GLU B OE2 1 
ATOM   436  N  N   . ARG A 1 86  ? 15.940 2.362   14.015  1.00 26.65 ? 101  ARG B N   1 
ATOM   437  C  CA  . ARG A 1 86  ? 16.309 1.361   15.016  1.00 24.86 ? 101  ARG B CA  1 
ATOM   438  C  C   . ARG A 1 86  ? 15.925 -0.057  14.602  1.00 25.44 ? 101  ARG B C   1 
ATOM   439  O  O   . ARG A 1 86  ? 16.442 -1.026  15.154  1.00 22.27 ? 101  ARG B O   1 
ATOM   440  C  CB  . ARG A 1 86  ? 15.660 1.673   16.371  1.00 25.83 ? 101  ARG B CB  1 
ATOM   441  C  CG  . ARG A 1 86  ? 16.127 2.957   17.034  1.00 27.79 ? 101  ARG B CG  1 
ATOM   442  C  CD  . ARG A 1 86  ? 15.486 3.136   18.415  1.00 28.08 ? 101  ARG B CD  1 
ATOM   443  N  NE  . ARG A 1 86  ? 15.892 4.396   19.034  1.00 29.20 ? 101  ARG B NE  1 
ATOM   444  C  CZ  . ARG A 1 86  ? 16.990 4.552   19.768  1.00 30.51 ? 101  ARG B CZ  1 
ATOM   445  N  NH1 . ARG A 1 86  ? 17.795 3.522   19.991  1.00 27.70 ? 101  ARG B NH1 1 
ATOM   446  N  NH2 . ARG A 1 86  ? 17.282 5.740   20.284  1.00 38.48 ? 101  ARG B NH2 1 
ATOM   447  N  N   . LEU A 1 87  ? 15.015 -0.184  13.637  1.00 27.01 ? 102  LEU B N   1 
ATOM   448  C  CA  . LEU A 1 87  ? 14.510 -1.505  13.257  1.00 26.12 ? 102  LEU B CA  1 
ATOM   449  C  C   . LEU A 1 87  ? 15.398 -2.213  12.232  1.00 27.15 ? 102  LEU B C   1 
ATOM   450  O  O   . LEU A 1 87  ? 15.601 -1.723  11.117  1.00 28.12 ? 102  LEU B O   1 
ATOM   451  C  CB  . LEU A 1 87  ? 13.056 -1.422  12.765  1.00 28.80 ? 102  LEU B CB  1 
ATOM   452  C  CG  . LEU A 1 87  ? 12.023 -1.183  13.871  1.00 29.16 ? 102  LEU B CG  1 
ATOM   453  C  CD1 . LEU A 1 87  ? 10.671 -0.808  13.276  1.00 33.85 ? 102  LEU B CD1 1 
ATOM   454  C  CD2 . LEU A 1 87  ? 11.905 -2.403  14.784  1.00 27.22 ? 102  LEU B CD2 1 
ATOM   455  N  N   . MET A 1 88  ? 15.918 -3.376  12.621  1.00 27.75 ? 103  MET B N   1 
ATOM   456  C  CA  . MET A 1 88  ? 16.886 -4.104  11.806  1.00 24.89 ? 103  MET B CA  1 
ATOM   457  C  C   . MET A 1 88  ? 16.884 -5.581  12.189  1.00 24.32 ? 103  MET B C   1 
ATOM   458  O  O   . MET A 1 88  ? 16.371 -5.954  13.247  1.00 22.50 ? 103  MET B O   1 
ATOM   459  C  CB  . MET A 1 88  ? 18.288 -3.512  12.010  1.00 23.02 ? 103  MET B CB  1 
ATOM   460  C  CG  . MET A 1 88  ? 18.770 -3.594  13.453  1.00 22.33 ? 103  MET B CG  1 
ATOM   461  S  SD  . MET A 1 88  ? 20.229 -2.581  13.796  1.00 26.31 ? 103  MET B SD  1 
ATOM   462  C  CE  . MET A 1 88  ? 19.568 -0.922  13.682  1.00 23.02 ? 103  MET B CE  1 
ATOM   463  N  N   . THR A 1 89  ? 17.456 -6.419  11.330  1.00 21.95 ? 104  THR B N   1 
ATOM   464  C  CA  . THR A 1 89  ? 17.556 -7.845  11.618  1.00 24.73 ? 104  THR B CA  1 
ATOM   465  C  C   . THR A 1 89  ? 18.513 -8.120  12.783  1.00 23.41 ? 104  THR B C   1 
ATOM   466  O  O   . THR A 1 89  ? 19.286 -7.244  13.189  1.00 22.45 ? 104  THR B O   1 
ATOM   467  C  CB  . THR A 1 89  ? 18.033 -8.644  10.392  1.00 25.56 ? 104  THR B CB  1 
ATOM   468  O  OG1 . THR A 1 89  ? 19.324 -8.178  9.987   1.00 22.14 ? 104  THR B OG1 1 
ATOM   469  C  CG2 . THR A 1 89  ? 17.048 -8.511  9.233   1.00 21.44 ? 104  THR B CG2 1 
ATOM   470  N  N   . GLN A 1 90  ? 18.456 -9.333  13.324  1.00 25.29 ? 105  GLN B N   1 
ATOM   471  C  CA  . GLN A 1 90  ? 19.348 -9.715  14.420  1.00 21.91 ? 105  GLN B CA  1 
ATOM   472  C  C   . GLN A 1 90  ? 20.813 -9.593  13.983  1.00 23.56 ? 105  GLN B C   1 
ATOM   473  O  O   . GLN A 1 90  ? 21.641 -9.015  14.689  1.00 22.54 ? 105  GLN B O   1 
ATOM   474  C  CB  . GLN A 1 90  ? 19.029 -11.139 14.900  1.00 23.64 ? 105  GLN B CB  1 
ATOM   475  C  CG  . GLN A 1 90  ? 19.809 -11.598 16.134  1.00 22.64 ? 105  GLN B CG  1 
ATOM   476  C  CD  . GLN A 1 90  ? 19.601 -10.689 17.332  1.00 23.99 ? 105  GLN B CD  1 
ATOM   477  O  OE1 . GLN A 1 90  ? 18.479 -10.518 17.813  1.00 23.04 ? 105  GLN B OE1 1 
ATOM   478  N  NE2 . GLN A 1 90  ? 20.684 -10.090 17.814  1.00 23.38 ? 105  GLN B NE2 1 
ATOM   479  N  N   . ARG A 1 91  ? 21.130 -10.113 12.802  1.00 26.52 ? 106  ARG B N   1 
ATOM   480  C  CA  . ARG A 1 91  ? 22.508 -10.071 12.321  1.00 23.27 ? 106  ARG B CA  1 
ATOM   481  C  C   . ARG A 1 91  ? 22.995 -8.630  12.181  1.00 23.87 ? 106  ARG B C   1 
ATOM   482  O  O   . ARG A 1 91  ? 24.133 -8.304  12.540  1.00 21.80 ? 106  ARG B O   1 
ATOM   483  C  CB  . ARG A 1 91  ? 22.636 -10.829 11.000  1.00 26.90 ? 106  ARG B CB  1 
ATOM   484  C  CG  . ARG A 1 91  ? 24.059 -10.998 10.516  1.00 25.58 ? 106  ARG B CG  1 
ATOM   485  C  CD  . ARG A 1 91  ? 24.068 -11.687 9.164   1.00 25.65 ? 106  ARG B CD  1 
ATOM   486  N  NE  . ARG A 1 91  ? 25.401 -11.735 8.585   1.00 26.06 ? 106  ARG B NE  1 
ATOM   487  C  CZ  . ARG A 1 91  ? 26.280 -12.701 8.832   1.00 34.79 ? 106  ARG B CZ  1 
ATOM   488  N  NH1 . ARG A 1 91  ? 25.958 -13.701 9.647   1.00 35.86 ? 106  ARG B NH1 1 
ATOM   489  N  NH2 . ARG A 1 91  ? 27.478 -12.671 8.265   1.00 29.69 ? 106  ARG B NH2 1 
ATOM   490  N  N   . CYS A 1 92  ? 22.124 -7.764  11.676  1.00 18.31 ? 107  CYS B N   1 
ATOM   491  C  CA  . CYS A 1 92  ? 22.450 -6.353  11.537  1.00 20.17 ? 107  CYS B CA  1 
ATOM   492  C  C   . CYS A 1 92  ? 22.649 -5.714  12.914  1.00 20.36 ? 107  CYS B C   1 
ATOM   493  O  O   . CYS A 1 92  ? 23.550 -4.897  13.119  1.00 23.57 ? 107  CYS B O   1 
ATOM   494  C  CB  . CYS A 1 92  ? 21.342 -5.627  10.768  1.00 24.63 ? 107  CYS B CB  1 
ATOM   495  S  SG  . CYS A 1 92  ? 21.725 -3.913  10.384  1.00 20.77 ? 107  CYS B SG  1 
ATOM   496  N  N   . LYS A 1 93  ? 21.807 -6.101  13.860  1.00 20.22 ? 108  LYS B N   1 
ATOM   497  C  CA  . LYS A 1 93  ? 21.942 -5.645  15.239  1.00 21.60 ? 108  LYS B CA  1 
ATOM   498  C  C   . LYS A 1 93  ? 23.311 -6.042  15.818  1.00 20.83 ? 108  LYS B C   1 
ATOM   499  O  O   . LYS A 1 93  ? 24.034 -5.204  16.371  1.00 19.52 ? 108  LYS B O   1 
ATOM   500  C  CB  . LYS A 1 93  ? 20.794 -6.226  16.069  1.00 22.02 ? 108  LYS B CB  1 
ATOM   501  C  CG  . LYS A 1 93  ? 20.694 -5.736  17.496  1.00 28.23 ? 108  LYS B CG  1 
ATOM   502  C  CD  . LYS A 1 93  ? 19.354 -6.156  18.089  1.00 32.54 ? 108  LYS B CD  1 
ATOM   503  C  CE  . LYS A 1 93  ? 19.312 -5.972  19.598  1.00 35.98 ? 108  LYS B CE  1 
ATOM   504  N  NZ  . LYS A 1 93  ? 17.909 -6.082  20.099  1.00 39.90 ? 108  LYS B NZ  1 
ATOM   505  N  N   . ASP A 1 94  ? 23.668 -7.315  15.675  1.00 20.59 ? 109  ASP B N   1 
ATOM   506  C  CA  . ASP A 1 94  ? 24.930 -7.823  16.207  1.00 21.42 ? 109  ASP B CA  1 
ATOM   507  C  C   . ASP A 1 94  ? 26.123 -7.068  15.616  1.00 24.84 ? 109  ASP B C   1 
ATOM   508  O  O   . ASP A 1 94  ? 27.009 -6.624  16.345  1.00 19.72 ? 109  ASP B O   1 
ATOM   509  C  CB  . ASP A 1 94  ? 25.072 -9.324  15.934  1.00 23.87 ? 109  ASP B CB  1 
ATOM   510  C  CG  . ASP A 1 94  ? 24.082 -10.172 16.726  1.00 22.21 ? 109  ASP B CG  1 
ATOM   511  O  OD1 . ASP A 1 94  ? 23.528 -9.690  17.737  1.00 24.86 ? 109  ASP B OD1 1 
ATOM   512  O  OD2 . ASP A 1 94  ? 23.861 -11.336 16.336  1.00 26.36 ? 109  ASP B OD2 1 
ATOM   513  N  N   . ARG A 1 95  ? 26.140 -6.914  14.293  1.00 22.96 ? 110  ARG B N   1 
ATOM   514  C  CA  . ARG A 1 95  ? 27.237 -6.209  13.630  1.00 22.52 ? 110  ARG B CA  1 
ATOM   515  C  C   . ARG A 1 95  ? 27.328 -4.742  14.041  1.00 19.95 ? 110  ARG B C   1 
ATOM   516  O  O   . ARG A 1 95  ? 28.431 -4.203  14.206  1.00 21.47 ? 110  ARG B O   1 
ATOM   517  C  CB  . ARG A 1 95  ? 27.128 -6.316  12.102  1.00 22.28 ? 110  ARG B CB  1 
ATOM   518  C  CG  . ARG A 1 95  ? 27.134 -7.730  11.576  1.00 22.34 ? 110  ARG B CG  1 
ATOM   519  C  CD  . ARG A 1 95  ? 28.153 -8.588  12.302  1.00 27.56 ? 110  ARG B CD  1 
ATOM   520  N  NE  . ARG A 1 95  ? 28.384 -9.842  11.596  1.00 31.60 ? 110  ARG B NE  1 
ATOM   521  C  CZ  . ARG A 1 95  ? 27.788 -10.992 11.891  1.00 33.19 ? 110  ARG B CZ  1 
ATOM   522  N  NH1 . ARG A 1 95  ? 26.918 -11.061 12.891  1.00 32.85 ? 110  ARG B NH1 1 
ATOM   523  N  NH2 . ARG A 1 95  ? 28.069 -12.080 11.185  1.00 35.04 ? 110  ARG B NH2 1 
ATOM   524  N  N   . LEU A 1 96  ? 26.175 -4.091  14.181  1.00 19.41 ? 111  LEU B N   1 
ATOM   525  C  CA  . LEU A 1 96  ? 26.129 -2.686  14.566  1.00 20.32 ? 111  LEU B CA  1 
ATOM   526  C  C   . LEU A 1 96  ? 26.648 -2.495  15.991  1.00 22.82 ? 111  LEU B C   1 
ATOM   527  O  O   . LEU A 1 96  ? 27.410 -1.565  16.271  1.00 19.88 ? 111  LEU B O   1 
ATOM   528  C  CB  . LEU A 1 96  ? 24.699 -2.152  14.475  1.00 19.27 ? 111  LEU B CB  1 
ATOM   529  C  CG  . LEU A 1 96  ? 24.531 -0.630  14.433  1.00 22.09 ? 111  LEU B CG  1 
ATOM   530  C  CD1 . LEU A 1 96  ? 25.105 -0.041  13.136  1.00 17.93 ? 111  LEU B CD1 1 
ATOM   531  C  CD2 . LEU A 1 96  ? 23.065 -0.240  14.603  1.00 23.40 ? 111  LEU B CD2 1 
ATOM   532  N  N   . ASN A 1 97  ? 26.222 -3.373  16.893  1.00 22.07 ? 112  ASN B N   1 
ATOM   533  C  CA  . ASN A 1 97  ? 26.637 -3.277  18.291  1.00 24.39 ? 112  ASN B CA  1 
ATOM   534  C  C   . ASN A 1 97  ? 28.132 -3.505  18.446  1.00 21.36 ? 112  ASN B C   1 
ATOM   535  O  O   . ASN A 1 97  ? 28.775 -2.892  19.297  1.00 25.08 ? 112  ASN B O   1 
ATOM   536  C  CB  . ASN A 1 97  ? 25.838 -4.248  19.169  1.00 20.42 ? 112  ASN B CB  1 
ATOM   537  C  CG  . ASN A 1 97  ? 24.395 -3.834  19.319  1.00 21.87 ? 112  ASN B CG  1 
ATOM   538  O  OD1 . ASN A 1 97  ? 24.067 -2.651  19.211  1.00 26.28 ? 112  ASN B OD1 1 
ATOM   539  N  ND2 . ASN A 1 97  ? 23.519 -4.802  19.557  1.00 23.53 ? 112  ASN B ND2 1 
ATOM   540  N  N   . SER A 1 98  ? 28.683 -4.378  17.609  1.00 23.45 ? 113  SER B N   1 
ATOM   541  C  CA  . SER A 1 98  ? 30.116 -4.620  17.593  0.88 22.94 ? 113  SER B CA  1 
ATOM   542  C  C   . SER A 1 98  ? 30.831 -3.368  17.084  1.00 25.76 ? 113  SER B C   1 
ATOM   543  O  O   . SER A 1 98  ? 31.879 -2.983  17.609  1.00 18.31 ? 113  SER B O   1 
ATOM   544  C  CB  . SER A 1 98  ? 30.439 -5.840  16.721  1.00 23.24 ? 113  SER B CB  1 
ATOM   545  O  OG  . SER A 1 98  ? 31.833 -6.059  16.610  0.80 25.12 ? 113  SER B OG  1 
ATOM   546  N  N   . LEU A 1 99  ? 30.250 -2.721  16.073  1.00 19.18 ? 114  LEU B N   1 
ATOM   547  C  CA  . LEU A 1 99  ? 30.832 -1.501  15.530  1.00 19.60 ? 114  LEU B CA  1 
ATOM   548  C  C   . LEU A 1 99  ? 30.820 -0.368  16.557  1.00 17.03 ? 114  LEU B C   1 
ATOM   549  O  O   . LEU A 1 99  ? 31.767 0.413   16.631  1.00 18.49 ? 114  LEU B O   1 
ATOM   550  C  CB  . LEU A 1 99  ? 30.103 -1.065  14.254  1.00 19.72 ? 114  LEU B CB  1 
ATOM   551  C  CG  . LEU A 1 99  ? 30.656 0.163   13.526  1.00 21.12 ? 114  LEU B CG  1 
ATOM   552  C  CD1 . LEU A 1 99  ? 32.167 0.034   13.259  1.00 15.48 ? 114  LEU B CD1 1 
ATOM   553  C  CD2 . LEU A 1 99  ? 29.876 0.381   12.224  1.00 19.45 ? 114  LEU B CD2 1 
ATOM   554  N  N   . ALA A 1 100 ? 29.743 -0.289  17.337  1.00 19.16 ? 115  ALA B N   1 
ATOM   555  C  CA  . ALA A 1 100 ? 29.589 0.739   18.367  1.00 19.95 ? 115  ALA B CA  1 
ATOM   556  C  C   . ALA A 1 100 ? 30.788 0.785   19.316  1.00 19.33 ? 115  ALA B C   1 
ATOM   557  O  O   . ALA A 1 100 ? 31.261 1.864   19.689  1.00 19.59 ? 115  ALA B O   1 
ATOM   558  C  CB  . ALA A 1 100 ? 28.317 0.508   19.150  1.00 18.42 ? 115  ALA B CB  1 
ATOM   559  N  N   . ILE A 1 101 ? 31.260 -0.392  19.714  1.00 18.93 ? 116  ILE B N   1 
ATOM   560  C  CA  . ILE A 1 101 ? 32.436 -0.495  20.590  1.00 19.35 ? 116  ILE B CA  1 
ATOM   561  C  C   . ILE A 1 101 ? 33.697 -0.020  19.874  1.00 17.52 ? 116  ILE B C   1 
ATOM   562  O  O   . ILE A 1 101 ? 34.442 0.819   20.386  1.00 20.17 ? 116  ILE B O   1 
ATOM   563  C  CB  . ILE A 1 101 ? 32.635 -1.944  21.084  1.00 19.37 ? 116  ILE B CB  1 
ATOM   564  C  CG1 . ILE A 1 101 ? 31.461 -2.365  21.975  1.00 24.43 ? 116  ILE B CG1 1 
ATOM   565  C  CG2 . ILE A 1 101 ? 33.982 -2.103  21.819  1.00 21.55 ? 116  ILE B CG2 1 
ATOM   566  C  CD1 . ILE A 1 101 ? 31.323 -3.870  22.150  1.00 21.88 ? 116  ILE B CD1 1 
ATOM   567  N  N   . SER A 1 102 ? 33.926 -0.547  18.676  1.00 18.93 ? 117  SER B N   1 
ATOM   568  C  CA  . SER A 1 102 ? 35.142 -0.238  17.929  1.00 20.75 ? 117  SER B CA  1 
ATOM   569  C  C   . SER A 1 102 ? 35.313 1.238   17.581  1.00 21.37 ? 117  SER B C   1 
ATOM   570  O  O   . SER A 1 102 ? 36.435 1.750   17.600  1.00 18.44 ? 117  SER B O   1 
ATOM   571  C  CB  . SER A 1 102 ? 35.259 -1.113  16.682  1.00 20.99 ? 117  SER B CB  1 
ATOM   572  O  OG  . SER A 1 102 ? 35.596 -2.441  17.059  1.00 29.44 ? 117  SER B OG  1 
ATOM   573  N  N   . VAL A 1 103 ? 34.209 1.915   17.270  1.00 16.67 ? 118  VAL B N   1 
ATOM   574  C  CA  . VAL A 1 103 ? 34.241 3.355   17.024  1.00 22.13 ? 118  VAL B CA  1 
ATOM   575  C  C   . VAL A 1 103 ? 34.704 4.125   18.272  1.00 18.64 ? 118  VAL B C   1 
ATOM   576  O  O   . VAL A 1 103 ? 35.551 5.020   18.186  1.00 15.91 ? 118  VAL B O   1 
ATOM   577  C  CB  . VAL A 1 103 ? 32.862 3.881   16.545  1.00 18.65 ? 118  VAL B CB  1 
ATOM   578  C  CG1 . VAL A 1 103 ? 32.776 5.401   16.655  1.00 17.86 ? 118  VAL B CG1 1 
ATOM   579  C  CG2 . VAL A 1 103 ? 32.584 3.409   15.103  1.00 17.14 ? 118  VAL B CG2 1 
ATOM   580  N  N   . MET A 1 104 ? 34.154 3.778   19.429  1.00 19.36 ? 119  MET B N   1 
ATOM   581  C  CA  . MET A 1 104 ? 34.529 4.486   20.662  1.00 22.24 ? 119  MET B CA  1 
ATOM   582  C  C   . MET A 1 104 ? 36.001 4.241   21.019  1.00 21.15 ? 119  MET B C   1 
ATOM   583  O  O   . MET A 1 104 ? 36.649 5.096   21.628  1.00 20.22 ? 119  MET B O   1 
ATOM   584  C  CB  . MET A 1 104 ? 33.611 4.111   21.828  1.00 20.98 ? 119  MET B CB  1 
ATOM   585  C  CG  . MET A 1 104 ? 32.150 4.526   21.638  1.00 24.68 ? 119  MET B CG  1 
ATOM   586  S  SD  . MET A 1 104 ? 31.135 4.344   23.125  1.00 27.98 ? 119  MET B SD  1 
ATOM   587  C  CE  . MET A 1 104 ? 31.246 2.570   23.374  1.00 26.74 ? 119  MET B CE  1 
ATOM   588  N  N   . ASN A 1 105 ? 36.516 3.078   20.628  1.00 18.88 ? 120  ASN B N   1 
ATOM   589  C  CA  . ASN A 1 105 ? 37.944 2.788   20.739  1.00 21.36 ? 120  ASN B CA  1 
ATOM   590  C  C   . ASN A 1 105 ? 38.775 3.632   19.778  1.00 24.33 ? 120  ASN B C   1 
ATOM   591  O  O   . ASN A 1 105 ? 39.747 4.263   20.188  1.00 20.65 ? 120  ASN B O   1 
ATOM   592  C  CB  . ASN A 1 105 ? 38.223 1.306   20.496  1.00 21.69 ? 120  ASN B CB  1 
ATOM   593  C  CG  . ASN A 1 105 ? 37.868 0.450   21.689  1.00 21.50 ? 120  ASN B CG  1 
ATOM   594  O  OD1 . ASN A 1 105 ? 37.816 0.934   22.814  1.00 25.00 ? 120  ASN B OD1 1 
ATOM   595  N  ND2 . ASN A 1 105 ? 37.617 -0.828  21.449  1.00 21.22 ? 120  ASN B ND2 1 
ATOM   596  N  N   . GLN A 1 106 ? 38.389 3.640   18.500  1.00 21.66 ? 121  GLN B N   1 
ATOM   597  C  CA  . GLN A 1 106 ? 39.111 4.411   17.493  1.00 22.34 ? 121  GLN B CA  1 
ATOM   598  C  C   . GLN A 1 106 ? 39.236 5.883   17.863  1.00 20.84 ? 121  GLN B C   1 
ATOM   599  O  O   . GLN A 1 106 ? 40.316 6.465   17.757  1.00 20.67 ? 121  GLN B O   1 
ATOM   600  C  CB  . GLN A 1 106 ? 38.450 4.288   16.113  1.00 21.18 ? 121  GLN B CB  1 
ATOM   601  C  CG  . GLN A 1 106 ? 39.253 4.951   14.998  1.00 19.99 ? 121  GLN B CG  1 
ATOM   602  C  CD  . GLN A 1 106 ? 40.631 4.319   14.818  1.00 25.51 ? 121  GLN B CD  1 
ATOM   603  O  OE1 . GLN A 1 106 ? 40.748 3.178   14.380  1.00 26.40 ? 121  GLN B OE1 1 
ATOM   604  N  NE2 . GLN A 1 106 ? 41.680 5.064   15.156  1.00 23.37 ? 121  GLN B NE2 1 
ATOM   605  N  N   . TRP A 1 107 ? 38.124 6.478   18.279  1.00 22.44 ? 122  TRP B N   1 
ATOM   606  C  CA  . TRP A 1 107 ? 38.058 7.905   18.578  1.00 23.77 ? 122  TRP B CA  1 
ATOM   607  C  C   . TRP A 1 107 ? 37.430 8.132   19.957  1.00 24.30 ? 122  TRP B C   1 
ATOM   608  O  O   . TRP A 1 107 ? 36.221 8.349   20.066  1.00 22.14 ? 122  TRP B O   1 
ATOM   609  C  CB  . TRP A 1 107 ? 37.216 8.640   17.526  1.00 21.71 ? 122  TRP B CB  1 
ATOM   610  C  CG  . TRP A 1 107 ? 37.712 8.540   16.090  1.00 22.94 ? 122  TRP B CG  1 
ATOM   611  C  CD1 . TRP A 1 107 ? 38.790 9.184   15.550  1.00 22.05 ? 122  TRP B CD1 1 
ATOM   612  C  CD2 . TRP A 1 107 ? 37.118 7.785   15.015  1.00 22.08 ? 122  TRP B CD2 1 
ATOM   613  N  NE1 . TRP A 1 107 ? 38.916 8.864   14.214  1.00 22.27 ? 122  TRP B NE1 1 
ATOM   614  C  CE2 . TRP A 1 107 ? 37.905 8.008   13.862  1.00 21.18 ? 122  TRP B CE2 1 
ATOM   615  C  CE3 . TRP A 1 107 ? 36.004 6.939   14.919  1.00 20.62 ? 122  TRP B CE3 1 
ATOM   616  C  CZ2 . TRP A 1 107 ? 37.610 7.421   12.625  1.00 20.15 ? 122  TRP B CZ2 1 
ATOM   617  C  CZ3 . TRP A 1 107 ? 35.715 6.347   13.685  1.00 20.81 ? 122  TRP B CZ3 1 
ATOM   618  C  CH2 . TRP A 1 107 ? 36.515 6.594   12.559  1.00 21.07 ? 122  TRP B CH2 1 
ATOM   619  N  N   . PRO A 1 108 ? 38.244 8.067   21.020  1.00 25.28 ? 123  PRO B N   1 
ATOM   620  C  CA  . PRO A 1 108 ? 37.702 8.297   22.365  1.00 23.43 ? 123  PRO B CA  1 
ATOM   621  C  C   . PRO A 1 108 ? 36.840 9.561   22.425  1.00 23.94 ? 123  PRO B C   1 
ATOM   622  O  O   . PRO A 1 108 ? 37.279 10.619  21.977  1.00 26.45 ? 123  PRO B O   1 
ATOM   623  C  CB  . PRO A 1 108 ? 38.968 8.458   23.215  1.00 29.78 ? 123  PRO B CB  1 
ATOM   624  C  CG  . PRO A 1 108 ? 39.963 7.558   22.536  1.00 25.76 ? 123  PRO B CG  1 
ATOM   625  C  CD  . PRO A 1 108 ? 39.667 7.680   21.052  1.00 25.25 ? 123  PRO B CD  1 
ATOM   626  N  N   . GLY A 1 109 ? 35.631 9.447   22.966  1.00 24.41 ? 124  GLY B N   1 
ATOM   627  C  CA  . GLY A 1 109 ? 34.716 10.574  23.048  1.00 24.28 ? 124  GLY B CA  1 
ATOM   628  C  C   . GLY A 1 109 ? 33.743 10.671  21.877  1.00 23.43 ? 124  GLY B C   1 
ATOM   629  O  O   . GLY A 1 109 ? 32.799 11.455  21.908  1.00 21.95 ? 124  GLY B O   1 
ATOM   630  N  N   . VAL A 1 110 ? 33.975 9.873   20.841  1.00 25.31 ? 125  VAL B N   1 
ATOM   631  C  CA  . VAL A 1 110 ? 33.097 9.855   19.673  1.00 23.54 ? 125  VAL B CA  1 
ATOM   632  C  C   . VAL A 1 110 ? 32.298 8.558   19.675  1.00 20.53 ? 125  VAL B C   1 
ATOM   633  O  O   . VAL A 1 110 ? 32.791 7.522   20.133  1.00 19.17 ? 125  VAL B O   1 
ATOM   634  C  CB  . VAL A 1 110 ? 33.908 9.987   18.356  1.00 21.53 ? 125  VAL B CB  1 
ATOM   635  C  CG1 . VAL A 1 110 ? 32.989 9.937   17.143  1.00 23.16 ? 125  VAL B CG1 1 
ATOM   636  C  CG2 . VAL A 1 110 ? 34.718 11.278  18.357  1.00 20.08 ? 125  VAL B CG2 1 
ATOM   637  N  N   . LYS A 1 111 ? 31.064 8.624   19.178  1.00 22.39 ? 126  LYS B N   1 
ATOM   638  C  CA  . LYS A 1 111 ? 30.189 7.458   19.095  1.00 20.54 ? 126  LYS B CA  1 
ATOM   639  C  C   . LYS A 1 111 ? 29.773 7.167   17.655  1.00 22.00 ? 126  LYS B C   1 
ATOM   640  O  O   . LYS A 1 111 ? 29.848 8.029   16.783  1.00 19.05 ? 126  LYS B O   1 
ATOM   641  C  CB  . LYS A 1 111 ? 28.926 7.665   19.938  1.00 20.54 ? 126  LYS B CB  1 
ATOM   642  C  CG  . LYS A 1 111 ? 29.168 7.622   21.454  1.00 23.29 ? 126  LYS B CG  1 
ATOM   643  C  CD  . LYS A 1 111 ? 27.858 7.444   22.209  1.00 24.68 ? 126  LYS B CD  1 
ATOM   644  C  CE  . LYS A 1 111 ? 28.046 7.664   23.702  1.00 32.68 ? 126  LYS B CE  1 
ATOM   645  N  NZ  . LYS A 1 111 ? 26.876 7.183   24.489  1.00 40.55 ? 126  LYS B NZ  1 
ATOM   646  N  N   . LEU A 1 112 ? 29.334 5.938   17.421  1.00 25.31 ? 127  LEU B N   1 
ATOM   647  C  CA  . LEU A 1 112 ? 28.707 5.569   16.157  1.00 20.64 ? 127  LEU B CA  1 
ATOM   648  C  C   . LEU A 1 112 ? 27.364 6.292   16.057  1.00 24.65 ? 127  LEU B C   1 
ATOM   649  O  O   . LEU A 1 112 ? 26.701 6.513   17.076  1.00 21.47 ? 127  LEU B O   1 
ATOM   650  C  CB  . LEU A 1 112 ? 28.503 4.058   16.111  1.00 20.23 ? 127  LEU B CB  1 
ATOM   651  C  CG  . LEU A 1 112 ? 27.742 3.432   14.942  1.00 22.92 ? 127  LEU B CG  1 
ATOM   652  C  CD1 . LEU A 1 112 ? 28.527 3.622   13.653  1.00 21.09 ? 127  LEU B CD1 1 
ATOM   653  C  CD2 . LEU A 1 112 ? 27.504 1.956   15.220  1.00 16.56 ? 127  LEU B CD2 1 
ATOM   654  N  N   . ARG A 1 113 ? 26.974 6.660   14.833  1.00 21.56 ? 128  ARG B N   1 
ATOM   655  C  CA  . ARG A 1 113 ? 25.710 7.360   14.583  1.00 20.38 ? 128  ARG B CA  1 
ATOM   656  C  C   . ARG A 1 113 ? 25.008 6.772   13.361  1.00 20.70 ? 128  ARG B C   1 
ATOM   657  O  O   . ARG A 1 113 ? 25.637 6.551   12.325  1.00 19.93 ? 128  ARG B O   1 
ATOM   658  C  CB  . ARG A 1 113 ? 25.956 8.861   14.372  1.00 18.90 ? 128  ARG B CB  1 
ATOM   659  C  CG  . ARG A 1 113 ? 24.711 9.698   14.018  1.00 18.49 ? 128  ARG B CG  1 
ATOM   660  C  CD  . ARG A 1 113 ? 25.040 11.186  14.143  1.00 20.23 ? 128  ARG B CD  1 
ATOM   661  N  NE  . ARG A 1 113 ? 24.013 12.072  13.593  1.00 20.61 ? 128  ARG B NE  1 
ATOM   662  C  CZ  . ARG A 1 113 ? 24.005 12.547  12.351  1.00 26.27 ? 128  ARG B CZ  1 
ATOM   663  N  NH1 . ARG A 1 113 ? 24.963 12.205  11.500  1.00 22.16 ? 128  ARG B NH1 1 
ATOM   664  N  NH2 . ARG A 1 113 ? 23.022 13.354  11.952  1.00 25.31 ? 128  ARG B NH2 1 
ATOM   665  N  N   . VAL A 1 114 ? 23.710 6.513   13.495  1.00 20.62 ? 129  VAL B N   1 
ATOM   666  C  CA  . VAL A 1 114 ? 22.901 6.000   12.388  1.00 23.79 ? 129  VAL B CA  1 
ATOM   667  C  C   . VAL A 1 114 ? 21.986 7.100   11.840  1.00 23.00 ? 129  VAL B C   1 
ATOM   668  O  O   . VAL A 1 114 ? 21.240 7.735   12.593  1.00 22.39 ? 129  VAL B O   1 
ATOM   669  C  CB  . VAL A 1 114 ? 22.058 4.783   12.820  1.00 19.80 ? 129  VAL B CB  1 
ATOM   670  C  CG1 . VAL A 1 114 ? 21.228 4.241   11.643  1.00 20.53 ? 129  VAL B CG1 1 
ATOM   671  C  CG2 . VAL A 1 114 ? 22.959 3.689   13.387  1.00 23.42 ? 129  VAL B CG2 1 
ATOM   672  N  N   . THR A 1 115 ? 22.054 7.331   10.530  1.00 20.65 ? 130  THR B N   1 
ATOM   673  C  CA  . THR A 1 115 ? 21.225 8.357   9.900   1.00 23.90 ? 130  THR B CA  1 
ATOM   674  C  C   . THR A 1 115 ? 20.112 7.771   9.028   1.00 22.61 ? 130  THR B C   1 
ATOM   675  O  O   . THR A 1 115 ? 19.239 8.502   8.550   1.00 21.76 ? 130  THR B O   1 
ATOM   676  C  CB  . THR A 1 115 ? 22.062 9.336   9.063   1.00 22.98 ? 130  THR B CB  1 
ATOM   677  O  OG1 . THR A 1 115 ? 22.744 8.618   8.029   1.00 18.04 ? 130  THR B OG1 1 
ATOM   678  C  CG2 . THR A 1 115 ? 23.077 10.063  9.958   1.00 20.95 ? 130  THR B CG2 1 
ATOM   679  N  N   . GLU A 1 116 ? 20.163 6.460   8.817   1.00 20.62 ? 131  GLU B N   1 
ATOM   680  C  CA  . GLU A 1 116 ? 19.102 5.734   8.112   1.00 23.21 ? 131  GLU B CA  1 
ATOM   681  C  C   . GLU A 1 116 ? 19.206 4.239   8.406   1.00 22.14 ? 131  GLU B C   1 
ATOM   682  O  O   . GLU A 1 116 ? 20.297 3.661   8.390   1.00 22.09 ? 131  GLU B O   1 
ATOM   683  C  CB  . GLU A 1 116 ? 19.171 5.969   6.594   1.00 20.17 ? 131  GLU B CB  1 
ATOM   684  C  CG  . GLU A 1 116 ? 18.215 5.081   5.752   1.00 21.91 ? 131  GLU B CG  1 
ATOM   685  C  CD  . GLU A 1 116 ? 16.784 5.622   5.651   1.00 25.13 ? 131  GLU B CD  1 
ATOM   686  O  OE1 . GLU A 1 116 ? 16.256 6.172   6.646   1.00 23.84 ? 131  GLU B OE1 1 
ATOM   687  O  OE2 . GLU A 1 116 ? 16.171 5.470   4.570   1.00 27.79 ? 131  GLU B OE2 1 
ATOM   688  N  N   . GLY A 1 117 ? 18.070 3.623   8.694   1.00 21.63 ? 132  GLY B N   1 
ATOM   689  C  CA  . GLY A 1 117 ? 18.009 2.184   8.865   1.00 21.09 ? 132  GLY B CA  1 
ATOM   690  C  C   . GLY A 1 117 ? 16.960 1.597   7.938   1.00 20.77 ? 132  GLY B C   1 
ATOM   691  O  O   . GLY A 1 117 ? 17.078 1.677   6.708   1.00 20.12 ? 132  GLY B O   1 
ATOM   692  N  N   . TRP A 1 118 ? 15.938 1.003   8.535   1.00 16.96 ? 133  TRP B N   1 
ATOM   693  C  CA  . TRP A 1 118 ? 14.792 0.500   7.785   1.00 22.09 ? 133  TRP B CA  1 
ATOM   694  C  C   . TRP A 1 118 ? 13.997 1.650   7.154   1.00 23.20 ? 133  TRP B C   1 
ATOM   695  O  O   . TRP A 1 118 ? 13.587 2.597   7.833   1.00 24.56 ? 133  TRP B O   1 
ATOM   696  C  CB  . TRP A 1 118 ? 13.906 -0.357  8.694   1.00 21.56 ? 133  TRP B CB  1 
ATOM   697  C  CG  . TRP A 1 118 ? 12.673 -0.928  8.036   1.00 25.57 ? 133  TRP B CG  1 
ATOM   698  C  CD1 . TRP A 1 118 ? 12.603 -1.584  6.839   1.00 24.94 ? 133  TRP B CD1 1 
ATOM   699  C  CD2 . TRP A 1 118 ? 11.347 -0.923  8.570   1.00 29.55 ? 133  TRP B CD2 1 
ATOM   700  N  NE1 . TRP A 1 118 ? 11.303 -1.975  6.585   1.00 28.88 ? 133  TRP B NE1 1 
ATOM   701  C  CE2 . TRP A 1 118 ? 10.515 -1.584  7.637   1.00 32.08 ? 133  TRP B CE2 1 
ATOM   702  C  CE3 . TRP A 1 118 ? 10.778 -0.421  9.748   1.00 31.32 ? 133  TRP B CE3 1 
ATOM   703  C  CZ2 . TRP A 1 118 ? 9.145  -1.747  7.842   1.00 33.29 ? 133  TRP B CZ2 1 
ATOM   704  C  CZ3 . TRP A 1 118 ? 9.418  -0.587  9.951   1.00 40.10 ? 133  TRP B CZ3 1 
ATOM   705  C  CH2 . TRP A 1 118 ? 8.616  -1.246  9.002   1.00 36.84 ? 133  TRP B CH2 1 
ATOM   706  N  N   . ASP A 1 119 ? 13.805 1.562   5.843   1.00 20.26 ? 134  ASP B N   1 
ATOM   707  C  CA  . ASP A 1 119 ? 13.054 2.562   5.097   1.00 23.91 ? 134  ASP B CA  1 
ATOM   708  C  C   . ASP A 1 119 ? 11.705 1.976   4.659   1.00 24.14 ? 134  ASP B C   1 
ATOM   709  O  O   . ASP A 1 119 ? 11.650 0.977   3.935   1.00 21.86 ? 134  ASP B O   1 
ATOM   710  C  CB  . ASP A 1 119 ? 13.866 3.046   3.886   1.00 21.69 ? 134  ASP B CB  1 
ATOM   711  C  CG  . ASP A 1 119 ? 13.095 4.044   3.005   1.00 27.10 ? 134  ASP B CG  1 
ATOM   712  O  OD1 . ASP A 1 119 ? 12.157 4.702   3.498   1.00 23.38 ? 134  ASP B OD1 1 
ATOM   713  O  OD2 . ASP A 1 119 ? 13.441 4.174   1.812   1.00 24.46 ? 134  ASP B OD2 1 
ATOM   714  N  N   . GLU A 1 120 ? 10.621 2.596   5.112   1.00 26.08 ? 135  GLU B N   1 
ATOM   715  C  CA  . GLU A 1 120 ? 9.286  2.239   4.621   1.00 30.68 ? 135  GLU B CA  1 
ATOM   716  C  C   . GLU A 1 120 ? 8.805  3.115   3.459   1.00 31.76 ? 135  GLU B C   1 
ATOM   717  O  O   . GLU A 1 120 ? 7.680  2.941   2.988   1.00 36.86 ? 135  GLU B O   1 
ATOM   718  C  CB  . GLU A 1 120 ? 8.260  2.320   5.752   1.00 32.63 ? 135  GLU B CB  1 
ATOM   719  C  CG  . GLU A 1 120 ? 8.690  1.615   7.029   1.00 36.20 ? 135  GLU B CG  1 
ATOM   720  C  CD  . GLU A 1 120 ? 7.776  1.923   8.198   1.00 42.74 ? 135  GLU B CD  1 
ATOM   721  O  OE1 . GLU A 1 120 ? 6.540  1.821   8.033   1.00 44.97 ? 135  GLU B OE1 1 
ATOM   722  O  OE2 . GLU A 1 120 ? 8.296  2.261   9.284   1.00 41.45 ? 135  GLU B OE2 1 
ATOM   723  N  N   . ASP A 1 121 ? 9.645  4.037   2.989   1.00 31.85 ? 136  ASP B N   1 
ATOM   724  C  CA  . ASP A 1 121 ? 9.176  5.135   2.120   1.00 32.24 ? 136  ASP B CA  1 
ATOM   725  C  C   . ASP A 1 121 ? 9.862  5.265   0.756   1.00 32.64 ? 136  ASP B C   1 
ATOM   726  O  O   . ASP A 1 121 ? 9.829  6.338   0.142   1.00 32.97 ? 136  ASP B O   1 
ATOM   727  C  CB  . ASP A 1 121 ? 9.313  6.476   2.859   1.00 38.50 ? 136  ASP B CB  1 
ATOM   728  C  CG  . ASP A 1 121 ? 8.598  6.486   4.204   1.00 41.23 ? 136  ASP B CG  1 
ATOM   729  O  OD1 . ASP A 1 121 ? 7.388  6.178   4.235   1.00 40.22 ? 136  ASP B OD1 1 
ATOM   730  O  OD2 . ASP A 1 121 ? 9.245  6.815   5.226   1.00 41.84 ? 136  ASP B OD2 1 
ATOM   731  N  N   . GLY A 1 122 ? 10.477 4.188   0.280   1.00 31.95 ? 137  GLY B N   1 
ATOM   732  C  CA  . GLY A 1 122 ? 11.114 4.187   -1.030  1.00 27.42 ? 137  GLY B CA  1 
ATOM   733  C  C   . GLY A 1 122 ? 12.134 5.284   -1.316  1.00 29.82 ? 137  GLY B C   1 
ATOM   734  O  O   . GLY A 1 122 ? 12.173 5.810   -2.422  1.00 27.69 ? 137  GLY B O   1 
ATOM   735  N  N   . HIS A 1 123 ? 12.975 5.614   -0.335  1.00 26.71 ? 138  HIS B N   1 
ATOM   736  C  CA  . HIS A 1 123 ? 13.972 6.678   -0.488  1.00 29.79 ? 138  HIS B CA  1 
ATOM   737  C  C   . HIS A 1 123 ? 15.318 6.201   -1.048  1.00 25.20 ? 138  HIS B C   1 
ATOM   738  O  O   . HIS A 1 123 ? 16.307 6.932   -1.008  1.00 27.45 ? 138  HIS B O   1 
ATOM   739  C  CB  . HIS A 1 123 ? 14.210 7.400   0.846   1.00 28.62 ? 138  HIS B CB  1 
ATOM   740  C  CG  . HIS A 1 123 ? 13.011 8.135   1.358   1.00 29.95 ? 138  HIS B CG  1 
ATOM   741  N  ND1 . HIS A 1 123 ? 12.584 8.045   2.665   1.00 29.67 ? 138  HIS B ND1 1 
ATOM   742  C  CD2 . HIS A 1 123 ? 12.143 8.968   0.735   1.00 30.03 ? 138  HIS B CD2 1 
ATOM   743  C  CE1 . HIS A 1 123 ? 11.509 8.795   2.827   1.00 33.16 ? 138  HIS B CE1 1 
ATOM   744  N  NE2 . HIS A 1 123 ? 11.218 9.364   1.671   1.00 30.15 ? 138  HIS B NE2 1 
ATOM   745  N  N   . HIS A 1 124 ? 15.356 4.981   -1.568  1.00 23.91 ? 139  HIS B N   1 
ATOM   746  C  CA  . HIS A 1 124 ? 16.582 4.447   -2.146  1.00 22.83 ? 139  HIS B CA  1 
ATOM   747  C  C   . HIS A 1 124 ? 16.330 3.846   -3.524  1.00 31.93 ? 139  HIS B C   1 
ATOM   748  O  O   . HIS A 1 124 ? 15.326 4.163   -4.171  1.00 25.68 ? 139  HIS B O   1 
ATOM   749  C  CB  . HIS A 1 124 ? 17.225 3.443   -1.190  1.00 23.96 ? 139  HIS B CB  1 
ATOM   750  C  CG  . HIS A 1 124 ? 17.420 3.996   0.186   1.00 24.12 ? 139  HIS B CG  1 
ATOM   751  N  ND1 . HIS A 1 124 ? 18.499 4.782   0.523   1.00 22.98 ? 139  HIS B ND1 1 
ATOM   752  C  CD2 . HIS A 1 124 ? 16.645 3.922   1.294   1.00 21.83 ? 139  HIS B CD2 1 
ATOM   753  C  CE1 . HIS A 1 124 ? 18.394 5.151   1.787   1.00 23.58 ? 139  HIS B CE1 1 
ATOM   754  N  NE2 . HIS A 1 124 ? 17.277 4.644   2.277   1.00 23.66 ? 139  HIS B NE2 1 
ATOM   755  N  N   . SER A 1 125 ? 17.252 3.005   -3.981  1.00 29.65 ? 140  SER B N   1 
ATOM   756  C  CA  . SER A 1 125 ? 17.130 2.419   -5.308  0.49 31.85 ? 140  SER B CA  1 
ATOM   757  C  C   . SER A 1 125 ? 15.980 1.421   -5.332  1.00 33.89 ? 140  SER B C   1 
ATOM   758  O  O   . SER A 1 125 ? 15.419 1.091   -4.284  1.00 34.73 ? 140  SER B O   1 
ATOM   759  C  CB  . SER A 1 125 ? 18.445 1.759   -5.731  1.00 32.06 ? 140  SER B CB  1 
ATOM   760  O  OG  . SER A 1 125 ? 18.981 0.956   -4.687  0.60 31.44 ? 140  SER B OG  1 
ATOM   761  N  N   . GLU A 1 126 ? 15.636 0.955   -6.530  1.00 35.91 ? 141  GLU B N   1 
ATOM   762  C  CA  . GLU A 1 126 ? 14.558 -0.011  -6.740  1.00 31.56 ? 141  GLU B CA  1 
ATOM   763  C  C   . GLU A 1 126 ? 14.519 -1.147  -5.718  1.00 33.61 ? 141  GLU B C   1 
ATOM   764  O  O   . GLU A 1 126 ? 13.445 -1.505  -5.220  1.00 32.35 ? 141  GLU B O   1 
ATOM   765  C  CB  . GLU A 1 126 ? 14.667 -0.611  -8.144  1.00 37.33 ? 141  GLU B CB  1 
ATOM   766  C  CG  . GLU A 1 126 ? 13.913 0.167   -9.218  1.00 39.54 ? 141  GLU B CG  1 
ATOM   767  C  CD  . GLU A 1 126 ? 12.413 -0.005  -9.108  1.00 43.22 ? 141  GLU B CD  1 
ATOM   768  O  OE1 . GLU A 1 126 ? 11.723 0.997   -8.822  1.00 48.38 ? 141  GLU B OE1 1 
ATOM   769  O  OE2 . GLU A 1 126 ? 11.924 -1.141  -9.299  1.00 48.06 ? 141  GLU B OE2 1 
ATOM   770  N  N   . GLU A 1 127 ? 15.687 -1.719  -5.427  1.00 29.52 ? 142  GLU B N   1 
ATOM   771  C  CA  . GLU A 1 127 ? 15.779 -2.906  -4.580  1.00 28.32 ? 142  GLU B CA  1 
ATOM   772  C  C   . GLU A 1 127 ? 16.822 -2.746  -3.464  1.00 29.29 ? 142  GLU B C   1 
ATOM   773  O  O   . GLU A 1 127 ? 17.818 -3.475  -3.402  1.00 29.65 ? 142  GLU B O   1 
ATOM   774  C  CB  . GLU A 1 127 ? 16.080 -4.138  -5.440  1.00 31.29 ? 142  GLU B CB  1 
ATOM   775  C  CG  . GLU A 1 127 ? 15.021 -4.394  -6.519  1.00 32.85 ? 142  GLU B CG  1 
ATOM   776  C  CD  . GLU A 1 127 ? 15.286 -5.644  -7.345  1.00 37.98 ? 142  GLU B CD  1 
ATOM   777  O  OE1 . GLU A 1 127 ? 14.374 -6.060  -8.094  1.00 35.23 ? 142  GLU B OE1 1 
ATOM   778  O  OE2 . GLU A 1 127 ? 16.399 -6.209  -7.251  1.00 36.51 ? 142  GLU B OE2 1 
ATOM   779  N  N   . SER A 1 128 ? 16.571 -1.797  -2.572  1.00 28.25 ? 143  SER B N   1 
ATOM   780  C  CA  . SER A 1 128 ? 17.488 -1.498  -1.474  1.00 21.62 ? 143  SER B CA  1 
ATOM   781  C  C   . SER A 1 128 ? 17.314 -2.445  -0.281  1.00 22.42 ? 143  SER B C   1 
ATOM   782  O  O   . SER A 1 128 ? 16.188 -2.766  0.109   1.00 20.36 ? 143  SER B O   1 
ATOM   783  C  CB  . SER A 1 128 ? 17.286 -0.052  -1.027  1.00 26.32 ? 143  SER B CB  1 
ATOM   784  O  OG  . SER A 1 128 ? 18.064 0.251   0.116   1.00 21.64 ? 143  SER B OG  1 
ATOM   785  N  N   . LEU A 1 129 ? 18.428 -2.888  0.302   1.00 20.31 ? 144  LEU B N   1 
ATOM   786  C  CA  . LEU A 1 129 ? 18.354 -3.693  1.520   1.00 21.51 ? 144  LEU B CA  1 
ATOM   787  C  C   . LEU A 1 129 ? 17.827 -2.862  2.698   1.00 21.92 ? 144  LEU B C   1 
ATOM   788  O  O   . LEU A 1 129 ? 17.461 -3.406  3.742   1.00 21.79 ? 144  LEU B O   1 
ATOM   789  C  CB  . LEU A 1 129 ? 19.703 -4.363  1.845   1.00 20.43 ? 144  LEU B CB  1 
ATOM   790  C  CG  . LEU A 1 129 ? 20.217 -5.376  0.809   1.00 20.60 ? 144  LEU B CG  1 
ATOM   791  C  CD1 . LEU A 1 129 ? 21.496 -6.070  1.275   1.00 23.80 ? 144  LEU B CD1 1 
ATOM   792  C  CD2 . LEU A 1 129 ? 19.145 -6.413  0.472   1.00 21.76 ? 144  LEU B CD2 1 
ATOM   793  N  N   . HIS A 1 130 ? 17.784 -1.542  2.530   1.00 20.26 ? 145  HIS B N   1 
ATOM   794  C  CA  . HIS A 1 130 ? 17.124 -0.693  3.519   1.00 20.57 ? 145  HIS B CA  1 
ATOM   795  C  C   . HIS A 1 130 ? 15.656 -1.072  3.686   1.00 21.61 ? 145  HIS B C   1 
ATOM   796  O  O   . HIS A 1 130 ? 15.093 -0.928  4.772   1.00 20.60 ? 145  HIS B O   1 
ATOM   797  C  CB  . HIS A 1 130 ? 17.219 0.781   3.134   1.00 20.09 ? 145  HIS B CB  1 
ATOM   798  C  CG  . HIS A 1 130 ? 18.542 1.403   3.452   1.00 22.82 ? 145  HIS B CG  1 
ATOM   799  N  ND1 . HIS A 1 130 ? 18.899 1.769   4.732   1.00 16.94 ? 145  HIS B ND1 1 
ATOM   800  C  CD2 . HIS A 1 130 ? 19.595 1.719   2.661   1.00 20.24 ? 145  HIS B CD2 1 
ATOM   801  C  CE1 . HIS A 1 130 ? 20.113 2.289   4.718   1.00 19.88 ? 145  HIS B CE1 1 
ATOM   802  N  NE2 . HIS A 1 130 ? 20.559 2.269   3.474   1.00 21.17 ? 145  HIS B NE2 1 
ATOM   803  N  N   . TYR A 1 131 ? 15.043 -1.561  2.610   1.00 20.80 ? 146  TYR B N   1 
ATOM   804  C  CA  . TYR A 1 131 ? 13.609 -1.853  2.616   1.00 23.56 ? 146  TYR B CA  1 
ATOM   805  C  C   . TYR A 1 131 ? 13.278 -3.082  3.461   1.00 24.82 ? 146  TYR B C   1 
ATOM   806  O  O   . TYR A 1 131 ? 12.124 -3.289  3.836   1.00 24.06 ? 146  TYR B O   1 
ATOM   807  C  CB  . TYR A 1 131 ? 13.048 -2.011  1.188   1.00 25.38 ? 146  TYR B CB  1 
ATOM   808  C  CG  . TYR A 1 131 ? 13.253 -0.808  0.284   1.00 25.94 ? 146  TYR B CG  1 
ATOM   809  C  CD1 . TYR A 1 131 ? 13.294 0.487   0.807   1.00 24.86 ? 146  TYR B CD1 1 
ATOM   810  C  CD2 . TYR A 1 131 ? 13.386 -0.963  -1.096  1.00 24.48 ? 146  TYR B CD2 1 
ATOM   811  C  CE1 . TYR A 1 131 ? 13.481 1.588   -0.018  1.00 22.06 ? 146  TYR B CE1 1 
ATOM   812  C  CE2 . TYR A 1 131 ? 13.575 0.138   -1.930  1.00 22.57 ? 146  TYR B CE2 1 
ATOM   813  C  CZ  . TYR A 1 131 ? 13.621 1.410   -1.382  1.00 21.01 ? 146  TYR B CZ  1 
ATOM   814  O  OH  . TYR A 1 131 ? 13.812 2.508   -2.192  1.00 22.70 ? 146  TYR B OH  1 
ATOM   815  N  N   . GLU A 1 132 ? 14.289 -3.889  3.772   1.00 25.09 ? 147  GLU B N   1 
ATOM   816  C  CA  . GLU A 1 132 ? 14.059 -5.076  4.596   1.00 26.90 ? 147  GLU B CA  1 
ATOM   817  C  C   . GLU A 1 132 ? 14.870 -5.116  5.901   1.00 23.43 ? 147  GLU B C   1 
ATOM   818  O  O   . GLU A 1 132 ? 15.048 -6.179  6.489   1.00 24.76 ? 147  GLU B O   1 
ATOM   819  C  CB  . GLU A 1 132 ? 14.271 -6.358  3.782   1.00 27.30 ? 147  GLU B CB  1 
ATOM   820  C  CG  . GLU A 1 132 ? 15.468 -6.315  2.853   1.00 27.45 ? 147  GLU B CG  1 
ATOM   821  C  CD  . GLU A 1 132 ? 15.702 -7.631  2.136   1.00 27.45 ? 147  GLU B CD  1 
ATOM   822  O  OE1 . GLU A 1 132 ? 15.678 -8.687  2.806   1.00 29.88 ? 147  GLU B OE1 1 
ATOM   823  O  OE2 . GLU A 1 132 ? 15.925 -7.607  0.907   1.00 25.92 ? 147  GLU B OE2 1 
ATOM   824  N  N   . GLY A 1 133 ? 15.345 -3.959  6.352   1.00 24.90 ? 148  GLY B N   1 
ATOM   825  C  CA  . GLY A 1 133 ? 16.023 -3.858  7.632   1.00 24.39 ? 148  GLY B CA  1 
ATOM   826  C  C   . GLY A 1 133 ? 17.358 -4.584  7.659   1.00 23.71 ? 148  GLY B C   1 
ATOM   827  O  O   . GLY A 1 133 ? 17.762 -5.145  8.681   1.00 23.74 ? 148  GLY B O   1 
ATOM   828  N  N   . ARG A 1 134 ? 18.047 -4.569  6.524   1.00 19.91 ? 149  ARG B N   1 
ATOM   829  C  CA  . ARG A 1 134 ? 19.344 -5.216  6.417   1.00 21.65 ? 149  ARG B CA  1 
ATOM   830  C  C   . ARG A 1 134 ? 20.442 -4.224  6.047   1.00 20.89 ? 149  ARG B C   1 
ATOM   831  O  O   . ARG A 1 134 ? 21.530 -4.624  5.648   1.00 22.08 ? 149  ARG B O   1 
ATOM   832  C  CB  . ARG A 1 134 ? 19.300 -6.381  5.418   1.00 22.07 ? 149  ARG B CB  1 
ATOM   833  C  CG  . ARG A 1 134 ? 18.468 -7.562  5.916   1.00 25.59 ? 149  ARG B CG  1 
ATOM   834  C  CD  . ARG A 1 134 ? 18.887 -8.878  5.292   1.00 25.03 ? 149  ARG B CD  1 
ATOM   835  N  NE  . ARG A 1 134 ? 18.243 -9.115  4.006   1.00 30.03 ? 149  ARG B NE  1 
ATOM   836  C  CZ  . ARG A 1 134 ? 18.884 -9.238  2.848   1.00 27.99 ? 149  ARG B CZ  1 
ATOM   837  N  NH1 . ARG A 1 134 ? 20.206 -9.149  2.799   1.00 24.36 ? 149  ARG B NH1 1 
ATOM   838  N  NH2 . ARG A 1 134 ? 18.194 -9.458  1.737   1.00 28.87 ? 149  ARG B NH2 1 
ATOM   839  N  N   . ALA A 1 135 ? 20.160 -2.933  6.188   1.00 20.58 ? 150  ALA B N   1 
ATOM   840  C  CA  . ALA A 1 135 ? 21.175 -1.921  5.901   1.00 22.20 ? 150  ALA B CA  1 
ATOM   841  C  C   . ALA A 1 135 ? 21.058 -0.677  6.775   1.00 20.46 ? 150  ALA B C   1 
ATOM   842  O  O   . ALA A 1 135 ? 19.962 -0.270  7.169   1.00 19.18 ? 150  ALA B O   1 
ATOM   843  C  CB  . ALA A 1 135 ? 21.152 -1.539  4.413   1.00 20.75 ? 150  ALA B CB  1 
ATOM   844  N  N   . VAL A 1 136 ? 22.204 -0.069  7.060   1.00 18.57 ? 151  VAL B N   1 
ATOM   845  C  CA  . VAL A 1 136 ? 22.255 1.174   7.811   1.00 21.27 ? 151  VAL B CA  1 
ATOM   846  C  C   . VAL A 1 136 ? 23.233 2.139   7.162   1.00 18.97 ? 151  VAL B C   1 
ATOM   847  O  O   . VAL A 1 136 ? 24.285 1.734   6.669   1.00 21.60 ? 151  VAL B O   1 
ATOM   848  C  CB  . VAL A 1 136 ? 22.683 0.957   9.290   1.00 21.05 ? 151  VAL B CB  1 
ATOM   849  C  CG1 . VAL A 1 136 ? 21.593 0.245   10.067  1.00 19.91 ? 151  VAL B CG1 1 
ATOM   850  C  CG2 . VAL A 1 136 ? 24.007 0.188   9.371   1.00 25.30 ? 151  VAL B CG2 1 
ATOM   851  N  N   . ASP A 1 137 ? 22.877 3.416   7.157   1.00 20.30 ? 152  ASP B N   1 
ATOM   852  C  CA  . ASP A 1 137 ? 23.821 4.453   6.778   1.00 20.41 ? 152  ASP B CA  1 
ATOM   853  C  C   . ASP A 1 137 ? 24.344 5.043   8.055   1.00 17.21 ? 152  ASP B C   1 
ATOM   854  O  O   . ASP A 1 137 ? 23.572 5.340   8.960   1.00 18.58 ? 152  ASP B O   1 
ATOM   855  C  CB  . ASP A 1 137 ? 23.155 5.531   5.927   1.00 19.23 ? 152  ASP B CB  1 
ATOM   856  C  CG  . ASP A 1 137 ? 22.666 4.991   4.616   1.00 22.62 ? 152  ASP B CG  1 
ATOM   857  O  OD1 . ASP A 1 137 ? 23.308 4.050   4.119   1.00 19.89 ? 152  ASP B OD1 1 
ATOM   858  O  OD2 . ASP A 1 137 ? 21.653 5.496   4.093   1.00 22.38 ? 152  ASP B OD2 1 
ATOM   859  N  N   . ILE A 1 138 ? 25.658 5.203   8.130   1.00 20.49 ? 153  ILE B N   1 
ATOM   860  C  CA  . ILE A 1 138 ? 26.285 5.587   9.386   1.00 22.31 ? 153  ILE B CA  1 
ATOM   861  C  C   . ILE A 1 138 ? 27.277 6.723   9.233   1.00 17.41 ? 153  ILE B C   1 
ATOM   862  O  O   . ILE A 1 138 ? 27.882 6.905   8.175   1.00 16.73 ? 153  ILE B O   1 
ATOM   863  C  CB  . ILE A 1 138 ? 26.999 4.381   10.063  1.00 18.87 ? 153  ILE B CB  1 
ATOM   864  C  CG1 . ILE A 1 138 ? 28.194 3.913   9.224   1.00 17.39 ? 153  ILE B CG1 1 
ATOM   865  C  CG2 . ILE A 1 138 ? 26.017 3.250   10.319  1.00 19.68 ? 153  ILE B CG2 1 
ATOM   866  C  CD1 . ILE A 1 138 ? 29.036 2.834   9.900   1.00 19.69 ? 153  ILE B CD1 1 
ATOM   867  N  N   . THR A 1 139 ? 27.422 7.485   10.317  1.00 18.65 ? 154  THR B N   1 
ATOM   868  C  CA  . THR A 1 139 ? 28.488 8.471   10.471  1.00 20.18 ? 154  THR B CA  1 
ATOM   869  C  C   . THR A 1 139 ? 29.101 8.366   11.872  1.00 18.85 ? 154  THR B C   1 
ATOM   870  O  O   . THR A 1 139 ? 28.689 7.533   12.685  1.00 17.05 ? 154  THR B O   1 
ATOM   871  C  CB  . THR A 1 139 ? 27.944 9.904   10.342  1.00 16.60 ? 154  THR B CB  1 
ATOM   872  O  OG1 . THR A 1 139 ? 27.200 10.243  11.522  1.00 17.91 ? 154  THR B OG1 1 
ATOM   873  C  CG2 . THR A 1 139 ? 27.048 10.042  9.105   1.00 21.97 ? 154  THR B CG2 1 
ATOM   874  N  N   . THR A 1 140 ? 30.083 9.220   12.152  1.00 19.38 ? 155  THR B N   1 
ATOM   875  C  CA  . THR A 1 140 ? 30.474 9.472   13.534  1.00 20.81 ? 155  THR B CA  1 
ATOM   876  C  C   . THR A 1 140 ? 29.547 10.533  14.135  1.00 18.35 ? 155  THR B C   1 
ATOM   877  O  O   . THR A 1 140 ? 28.930 11.322  13.405  1.00 18.91 ? 155  THR B O   1 
ATOM   878  C  CB  . THR A 1 140 ? 31.950 9.922   13.652  1.00 20.25 ? 155  THR B CB  1 
ATOM   879  O  OG1 . THR A 1 140 ? 32.214 10.945  12.686  1.00 19.74 ? 155  THR B OG1 1 
ATOM   880  C  CG2 . THR A 1 140 ? 32.899 8.741   13.414  1.00 18.08 ? 155  THR B CG2 1 
ATOM   881  N  N   . SER A 1 141 ? 29.448 10.542  15.462  1.00 23.23 ? 156  SER B N   1 
ATOM   882  C  CA  . SER A 1 141 ? 28.599 11.499  16.179  1.00 22.70 ? 156  SER B CA  1 
ATOM   883  C  C   . SER A 1 141 ? 28.981 12.955  15.918  1.00 21.55 ? 156  SER B C   1 
ATOM   884  O  O   . SER A 1 141 ? 28.125 13.847  15.956  1.00 22.23 ? 156  SER B O   1 
ATOM   885  C  CB  . SER A 1 141 ? 28.610 11.214  17.692  1.00 20.88 ? 156  SER B CB  1 
ATOM   886  O  OG  . SER A 1 141 ? 29.933 11.097  18.190  1.00 19.12 ? 156  SER B OG  1 
ATOM   887  N  N   . ASP A 1 142 ? 30.262 13.196  15.646  1.00 21.36 ? 157  ASP B N   1 
ATOM   888  C  CA  . ASP A 1 142 ? 30.738 14.557  15.422  1.00 21.40 ? 157  ASP B CA  1 
ATOM   889  C  C   . ASP A 1 142 ? 30.549 15.031  13.973  1.00 23.26 ? 157  ASP B C   1 
ATOM   890  O  O   . ASP A 1 142 ? 30.855 16.176  13.640  1.00 20.50 ? 157  ASP B O   1 
ATOM   891  C  CB  . ASP A 1 142 ? 32.197 14.713  15.891  1.00 24.91 ? 157  ASP B CB  1 
ATOM   892  C  CG  . ASP A 1 142 ? 33.170 13.850  15.106  1.00 24.61 ? 157  ASP B CG  1 
ATOM   893  O  OD1 . ASP A 1 142 ? 32.736 13.061  14.232  1.00 24.45 ? 157  ASP B OD1 1 
ATOM   894  O  OD2 . ASP A 1 142 ? 34.385 13.966  15.368  1.00 26.20 ? 157  ASP B OD2 1 
ATOM   895  N  N   . ARG A 1 143 ? 30.004 14.159  13.128  1.00 22.77 ? 158  ARG B N   1 
ATOM   896  C  CA  . ARG A 1 143 ? 29.827 14.473  11.715  1.00 20.55 ? 158  ARG B CA  1 
ATOM   897  C  C   . ARG A 1 143 ? 31.113 14.993  11.068  1.00 22.56 ? 158  ARG B C   1 
ATOM   898  O  O   . ARG A 1 143 ? 31.082 15.879  10.209  1.00 21.58 ? 158  ARG B O   1 
ATOM   899  C  CB  . ARG A 1 143 ? 28.641 15.435  11.505  1.00 21.36 ? 158  ARG B CB  1 
ATOM   900  C  CG  . ARG A 1 143 ? 27.280 14.788  11.798  1.00 22.80 ? 158  ARG B CG  1 
ATOM   901  C  CD  . ARG A 1 143 ? 26.102 15.758  11.627  1.00 27.64 ? 158  ARG B CD  1 
ATOM   902  N  NE  . ARG A 1 143 ? 25.798 16.033  10.227  1.00 27.35 ? 158  ARG B NE  1 
ATOM   903  C  CZ  . ARG A 1 143 ? 26.102 17.166  9.600   1.00 31.15 ? 158  ARG B CZ  1 
ATOM   904  N  NH1 . ARG A 1 143 ? 26.725 18.147  10.249  1.00 31.57 ? 158  ARG B NH1 1 
ATOM   905  N  NH2 . ARG A 1 143 ? 25.783 17.321  8.322   1.00 29.89 ? 158  ARG B NH2 1 
ATOM   906  N  N   . ASP A 1 144 ? 32.245 14.431  11.483  1.00 22.01 ? 159  ASP B N   1 
ATOM   907  C  CA  . ASP A 1 144 ? 33.522 14.722  10.847  1.00 23.50 ? 159  ASP B CA  1 
ATOM   908  C  C   . ASP A 1 144 ? 33.713 13.825  9.622   1.00 23.13 ? 159  ASP B C   1 
ATOM   909  O  O   . ASP A 1 144 ? 34.160 12.681  9.731   1.00 20.54 ? 159  ASP B O   1 
ATOM   910  C  CB  . ASP A 1 144 ? 34.680 14.524  11.828  1.00 23.77 ? 159  ASP B CB  1 
ATOM   911  C  CG  . ASP A 1 144 ? 36.020 14.908  11.222  1.00 25.39 ? 159  ASP B CG  1 
ATOM   912  O  OD1 . ASP A 1 144 ? 36.027 15.488  10.110  1.00 22.70 ? 159  ASP B OD1 1 
ATOM   913  O  OD2 . ASP A 1 144 ? 37.060 14.638  11.856  1.00 24.13 ? 159  ASP B OD2 1 
ATOM   914  N  N   . ARG A 1 145 ? 33.389 14.358  8.449   1.00 21.05 ? 160  ARG B N   1 
ATOM   915  C  CA  . ARG A 1 145 ? 33.379 13.553  7.234   1.00 22.79 ? 160  ARG B CA  1 
ATOM   916  C  C   . ARG A 1 145 ? 34.759 12.986  6.897   1.00 21.78 ? 160  ARG B C   1 
ATOM   917  O  O   . ARG A 1 145 ? 34.869 12.001  6.173   1.00 24.35 ? 160  ARG B O   1 
ATOM   918  C  CB  . ARG A 1 145 ? 32.819 14.363  6.063   1.00 22.67 ? 160  ARG B CB  1 
ATOM   919  C  CG  . ARG A 1 145 ? 31.316 14.629  6.171   1.00 25.01 ? 160  ARG B CG  1 
ATOM   920  C  CD  . ARG A 1 145 ? 30.814 15.464  4.992   1.00 28.76 ? 160  ARG B CD  1 
ATOM   921  N  NE  . ARG A 1 145 ? 31.299 16.837  5.091   1.00 33.36 ? 160  ARG B NE  1 
ATOM   922  C  CZ  . ARG A 1 145 ? 30.703 17.782  5.809   1.00 37.39 ? 160  ARG B CZ  1 
ATOM   923  N  NH1 . ARG A 1 145 ? 29.591 17.503  6.485   1.00 35.53 ? 160  ARG B NH1 1 
ATOM   924  N  NH2 . ARG A 1 145 ? 31.216 19.004  5.853   1.00 38.86 ? 160  ARG B NH2 1 
ATOM   925  N  N   . ASN A 1 146 ? 35.806 13.609  7.423   1.00 21.63 ? 161  ASN B N   1 
ATOM   926  C  CA  . ASN A 1 146 ? 37.167 13.102  7.240   1.00 25.31 ? 161  ASN B CA  1 
ATOM   927  C  C   . ASN A 1 146 ? 37.419 11.766  7.942   1.00 21.21 ? 161  ASN B C   1 
ATOM   928  O  O   . ASN A 1 146 ? 38.352 11.050  7.592   1.00 20.36 ? 161  ASN B O   1 
ATOM   929  C  CB  . ASN A 1 146 ? 38.206 14.141  7.676   1.00 27.09 ? 161  ASN B CB  1 
ATOM   930  C  CG  . ASN A 1 146 ? 38.336 15.274  6.683   1.00 34.39 ? 161  ASN B CG  1 
ATOM   931  O  OD1 . ASN A 1 146 ? 38.107 15.093  5.481   1.00 38.67 ? 161  ASN B OD1 1 
ATOM   932  N  ND2 . ASN A 1 146 ? 38.698 16.453  7.173   1.00 38.28 ? 161  ASN B ND2 1 
ATOM   933  N  N   . LYS A 1 147 ? 36.569 11.431  8.910   1.00 20.93 ? 162  LYS B N   1 
ATOM   934  C  CA  . LYS A 1 147 ? 36.657 10.159  9.627   1.00 21.53 ? 162  LYS B CA  1 
ATOM   935  C  C   . LYS A 1 147 ? 35.970 8.977   8.898   1.00 20.86 ? 162  LYS B C   1 
ATOM   936  O  O   . LYS A 1 147 ? 36.192 7.811   9.245   1.00 18.69 ? 162  LYS B O   1 
ATOM   937  C  CB  . LYS A 1 147 ? 36.041 10.305  11.024  1.00 19.10 ? 162  LYS B CB  1 
ATOM   938  C  CG  . LYS A 1 147 ? 36.876 11.119  12.025  1.00 20.70 ? 162  LYS B CG  1 
ATOM   939  C  CD  . LYS A 1 147 ? 36.252 11.037  13.416  1.00 21.42 ? 162  LYS B CD  1 
ATOM   940  C  CE  . LYS A 1 147 ? 37.025 11.860  14.451  1.00 21.76 ? 162  LYS B CE  1 
ATOM   941  N  NZ  . LYS A 1 147 ? 36.854 13.330  14.239  1.00 19.65 ? 162  LYS B NZ  1 
ATOM   942  N  N   . TYR A 1 148 ? 35.150 9.281   7.897   1.00 17.71 ? 163  TYR B N   1 
ATOM   943  C  CA  . TYR A 1 148 ? 34.233 8.275   7.335   1.00 20.49 ? 163  TYR B CA  1 
ATOM   944  C  C   . TYR A 1 148 ? 34.904 7.109   6.604   1.00 17.52 ? 163  TYR B C   1 
ATOM   945  O  O   . TYR A 1 148 ? 34.413 5.983   6.656   1.00 18.46 ? 163  TYR B O   1 
ATOM   946  C  CB  . TYR A 1 148 ? 33.160 8.916   6.445   1.00 19.70 ? 163  TYR B CB  1 
ATOM   947  C  CG  . TYR A 1 148 ? 32.224 9.871   7.161   1.00 20.62 ? 163  TYR B CG  1 
ATOM   948  C  CD1 . TYR A 1 148 ? 32.339 10.107  8.531   1.00 21.16 ? 163  TYR B CD1 1 
ATOM   949  C  CD2 . TYR A 1 148 ? 31.201 10.513  6.467   1.00 21.53 ? 163  TYR B CD2 1 
ATOM   950  C  CE1 . TYR A 1 148 ? 31.478 10.981  9.183   1.00 18.21 ? 163  TYR B CE1 1 
ATOM   951  C  CE2 . TYR A 1 148 ? 30.334 11.379  7.104   1.00 20.66 ? 163  TYR B CE2 1 
ATOM   952  C  CZ  . TYR A 1 148 ? 30.479 11.617  8.465   1.00 20.68 ? 163  TYR B CZ  1 
ATOM   953  O  OH  . TYR A 1 148 ? 29.611 12.478  9.102   1.00 21.45 ? 163  TYR B OH  1 
ATOM   954  N  N   . GLY A 1 149 ? 36.003 7.379   5.905   1.00 18.15 ? 164  GLY B N   1 
ATOM   955  C  CA  . GLY A 1 149 ? 36.764 6.312   5.277   1.00 19.82 ? 164  GLY B CA  1 
ATOM   956  C  C   . GLY A 1 149 ? 37.255 5.286   6.293   1.00 17.22 ? 164  GLY B C   1 
ATOM   957  O  O   . GLY A 1 149 ? 37.194 4.073   6.065   1.00 14.64 ? 164  GLY B O   1 
ATOM   958  N  N   . LEU A 1 150 ? 37.749 5.773   7.424   1.00 20.47 ? 165  LEU B N   1 
ATOM   959  C  CA  . LEU A 1 150 ? 38.216 4.884   8.487   1.00 18.98 ? 165  LEU B CA  1 
ATOM   960  C  C   . LEU A 1 150 ? 37.025 4.195   9.159   1.00 16.37 ? 165  LEU B C   1 
ATOM   961  O  O   . LEU A 1 150 ? 37.095 3.019   9.495   1.00 17.23 ? 165  LEU B O   1 
ATOM   962  C  CB  . LEU A 1 150 ? 39.079 5.642   9.505   1.00 17.79 ? 165  LEU B CB  1 
ATOM   963  C  CG  . LEU A 1 150 ? 39.680 4.816   10.647  1.00 20.88 ? 165  LEU B CG  1 
ATOM   964  C  CD1 . LEU A 1 150 ? 40.324 3.529   10.131  1.00 21.37 ? 165  LEU B CD1 1 
ATOM   965  C  CD2 . LEU A 1 150 ? 40.681 5.641   11.479  1.00 21.33 ? 165  LEU B CD2 1 
ATOM   966  N  N   . LEU A 1 151 ? 35.923 4.921   9.325   1.00 18.19 ? 166  LEU B N   1 
ATOM   967  C  CA  . LEU A 1 151 ? 34.704 4.340   9.888   1.00 18.50 ? 166  LEU B CA  1 
ATOM   968  C  C   . LEU A 1 151 ? 34.259 3.151   9.047   1.00 19.40 ? 166  LEU B C   1 
ATOM   969  O  O   . LEU A 1 151 ? 33.811 2.132   9.572   1.00 17.48 ? 166  LEU B O   1 
ATOM   970  C  CB  . LEU A 1 151 ? 33.577 5.384   9.972   1.00 17.89 ? 166  LEU B CB  1 
ATOM   971  C  CG  . LEU A 1 151 ? 32.176 4.865   10.335  1.00 17.26 ? 166  LEU B CG  1 
ATOM   972  C  CD1 . LEU A 1 151 ? 32.122 4.322   11.761  1.00 22.13 ? 166  LEU B CD1 1 
ATOM   973  C  CD2 . LEU A 1 151 ? 31.117 5.949   10.152  1.00 19.98 ? 166  LEU B CD2 1 
ATOM   974  N  N   . ALA A 1 152 ? 34.385 3.293   7.731   1.00 16.67 ? 167  ALA B N   1 
ATOM   975  C  CA  . ALA A 1 152 ? 34.033 2.225   6.818   1.00 18.20 ? 167  ALA B CA  1 
ATOM   976  C  C   . ALA A 1 152 ? 34.897 0.992   7.077   1.00 18.81 ? 167  ALA B C   1 
ATOM   977  O  O   . ALA A 1 152 ? 34.398 -0.133  7.065   1.00 16.99 ? 167  ALA B O   1 
ATOM   978  C  CB  . ALA A 1 152 ? 34.170 2.703   5.359   1.00 16.03 ? 167  ALA B CB  1 
ATOM   979  N  N   . ARG A 1 153 ? 36.188 1.201   7.313   1.00 16.78 ? 168  ARG B N   1 
ATOM   980  C  CA  . ARG A 1 153 ? 37.083 0.081   7.592   1.00 16.16 ? 168  ARG B CA  1 
ATOM   981  C  C   . ARG A 1 153 ? 36.662 -0.637  8.879   1.00 15.56 ? 168  ARG B C   1 
ATOM   982  O  O   . ARG A 1 153 ? 36.624 -1.870  8.931   1.00 20.71 ? 168  ARG B O   1 
ATOM   983  C  CB  . ARG A 1 153 ? 38.539 0.543   7.673   1.00 20.16 ? 168  ARG B CB  1 
ATOM   984  C  CG  . ARG A 1 153 ? 39.503 -0.558  8.124   1.00 23.28 ? 168  ARG B CG  1 
ATOM   985  C  CD  . ARG A 1 153 ? 39.301 -1.807  7.280   1.00 20.16 ? 168  ARG B CD  1 
ATOM   986  N  NE  . ARG A 1 153 ? 39.691 -1.581  5.893   1.00 20.71 ? 168  ARG B NE  1 
ATOM   987  C  CZ  . ARG A 1 153 ? 39.413 -2.409  4.887   1.00 27.87 ? 168  ARG B CZ  1 
ATOM   988  N  NH1 . ARG A 1 153 ? 38.734 -3.526  5.106   1.00 27.17 ? 168  ARG B NH1 1 
ATOM   989  N  NH2 . ARG A 1 153 ? 39.810 -2.115  3.659   1.00 28.92 ? 168  ARG B NH2 1 
ATOM   990  N  N   . LEU A 1 154 ? 36.328 0.140   9.907   1.00 16.76 ? 169  LEU B N   1 
ATOM   991  C  CA  . LEU A 1 154 ? 35.847 -0.427  11.168  1.00 17.91 ? 169  LEU B CA  1 
ATOM   992  C  C   . LEU A 1 154 ? 34.591 -1.257  10.937  1.00 18.45 ? 169  LEU B C   1 
ATOM   993  O  O   . LEU A 1 154 ? 34.394 -2.283  11.577  1.00 17.10 ? 169  LEU B O   1 
ATOM   994  C  CB  . LEU A 1 154 ? 35.571 0.675   12.194  1.00 16.19 ? 169  LEU B CB  1 
ATOM   995  C  CG  . LEU A 1 154 ? 36.790 1.473   12.671  1.00 19.44 ? 169  LEU B CG  1 
ATOM   996  C  CD1 . LEU A 1 154 ? 36.374 2.584   13.625  1.00 19.90 ? 169  LEU B CD1 1 
ATOM   997  C  CD2 . LEU A 1 154 ? 37.806 0.546   13.327  1.00 18.70 ? 169  LEU B CD2 1 
ATOM   998  N  N   . ALA A 1 155 ? 33.737 -0.801  10.022  1.00 17.05 ? 170  ALA B N   1 
ATOM   999  C  CA  . ALA A 1 155 ? 32.500 -1.519  9.713   1.00 18.53 ? 170  ALA B CA  1 
ATOM   1000 C  C   . ALA A 1 155 ? 32.771 -2.900  9.116   1.00 16.79 ? 170  ALA B C   1 
ATOM   1001 O  O   . ALA A 1 155 ? 32.105 -3.875  9.463   1.00 19.06 ? 170  ALA B O   1 
ATOM   1002 C  CB  . ALA A 1 155 ? 31.610 -0.684  8.780   1.00 16.03 ? 170  ALA B CB  1 
ATOM   1003 N  N   . VAL A 1 156 ? 33.744 -2.974  8.213   1.00 16.92 ? 171  VAL B N   1 
ATOM   1004 C  CA  . VAL A 1 156 ? 34.175 -4.243  7.641   1.00 19.60 ? 171  VAL B CA  1 
ATOM   1005 C  C   . VAL A 1 156 ? 34.755 -5.158  8.722   1.00 21.30 ? 171  VAL B C   1 
ATOM   1006 O  O   . VAL A 1 156 ? 34.466 -6.353  8.759   1.00 21.71 ? 171  VAL B O   1 
ATOM   1007 C  CB  . VAL A 1 156 ? 35.288 -4.052  6.599   1.00 20.63 ? 171  VAL B CB  1 
ATOM   1008 C  CG1 . VAL A 1 156 ? 35.866 -5.410  6.201   1.00 20.32 ? 171  VAL B CG1 1 
ATOM   1009 C  CG2 . VAL A 1 156 ? 34.784 -3.265  5.378   1.00 15.61 ? 171  VAL B CG2 1 
ATOM   1010 N  N   . GLU A 1 157 ? 35.588 -4.589  9.587   1.00 18.13 ? 172  GLU B N   1 
ATOM   1011 C  CA  . GLU A 1 157 ? 36.211 -5.359  10.665  1.00 22.72 ? 172  GLU B CA  1 
ATOM   1012 C  C   . GLU A 1 157 ? 35.152 -5.864  11.640  1.00 22.52 ? 172  GLU B C   1 
ATOM   1013 O  O   . GLU A 1 157 ? 35.314 -6.920  12.249  1.00 19.88 ? 172  GLU B O   1 
ATOM   1014 C  CB  . GLU A 1 157 ? 37.262 -4.520  11.419  1.00 21.67 ? 172  GLU B CB  1 
ATOM   1015 C  CG  . GLU A 1 157 ? 38.417 -4.028  10.550  1.00 25.20 ? 172  GLU B CG  1 
ATOM   1016 C  CD  . GLU A 1 157 ? 39.122 -5.162  9.824   1.00 34.26 ? 172  GLU B CD  1 
ATOM   1017 O  OE1 . GLU A 1 157 ? 39.195 -5.129  8.572   1.00 33.87 ? 172  GLU B OE1 1 
ATOM   1018 O  OE2 . GLU A 1 157 ? 39.591 -6.095  10.511  1.00 33.98 ? 172  GLU B OE2 1 
ATOM   1019 N  N   . ALA A 1 158 ? 34.066 -5.105  11.776  1.00 21.27 ? 173  ALA B N   1 
ATOM   1020 C  CA  . ALA A 1 158 ? 32.992 -5.463  12.697  1.00 17.71 ? 173  ALA B CA  1 
ATOM   1021 C  C   . ALA A 1 158 ? 32.082 -6.560  12.129  1.00 20.64 ? 173  ALA B C   1 
ATOM   1022 O  O   . ALA A 1 158 ? 31.172 -7.045  12.814  1.00 24.14 ? 173  ALA B O   1 
ATOM   1023 C  CB  . ALA A 1 158 ? 32.184 -4.227  13.084  1.00 19.27 ? 173  ALA B CB  1 
ATOM   1024 N  N   . GLY A 1 159 ? 32.325 -6.952  10.881  1.00 18.64 ? 174  GLY B N   1 
ATOM   1025 C  CA  . GLY A 1 159 ? 31.614 -8.079  10.299  1.00 19.85 ? 174  GLY B CA  1 
ATOM   1026 C  C   . GLY A 1 159 ? 30.421 -7.774  9.406   1.00 23.34 ? 174  GLY B C   1 
ATOM   1027 O  O   . GLY A 1 159 ? 29.719 -8.693  8.979   1.00 22.52 ? 174  GLY B O   1 
ATOM   1028 N  N   . PHE A 1 160 ? 30.172 -6.505  9.104   1.00 20.43 ? 175  PHE B N   1 
ATOM   1029 C  CA  . PHE A 1 160 ? 29.132 -6.210  8.122   1.00 22.44 ? 175  PHE B CA  1 
ATOM   1030 C  C   . PHE A 1 160 ? 29.485 -6.911  6.810   1.00 21.92 ? 175  PHE B C   1 
ATOM   1031 O  O   . PHE A 1 160 ? 30.644 -6.914  6.390   1.00 21.52 ? 175  PHE B O   1 
ATOM   1032 C  CB  . PHE A 1 160 ? 28.978 -4.709  7.911   1.00 21.57 ? 175  PHE B CB  1 
ATOM   1033 C  CG  . PHE A 1 160 ? 28.110 -4.045  8.931   1.00 20.57 ? 175  PHE B CG  1 
ATOM   1034 C  CD1 . PHE A 1 160 ? 26.730 -4.179  8.875   1.00 20.56 ? 175  PHE B CD1 1 
ATOM   1035 C  CD2 . PHE A 1 160 ? 28.666 -3.273  9.940   1.00 21.42 ? 175  PHE B CD2 1 
ATOM   1036 C  CE1 . PHE A 1 160 ? 25.919 -3.560  9.809   1.00 24.48 ? 175  PHE B CE1 1 
ATOM   1037 C  CE2 . PHE A 1 160 ? 27.860 -2.655  10.883  1.00 23.41 ? 175  PHE B CE2 1 
ATOM   1038 C  CZ  . PHE A 1 160 ? 26.493 -2.794  10.820  1.00 19.94 ? 175  PHE B CZ  1 
ATOM   1039 N  N   . ASP A 1 161 ? 28.492 -7.529  6.173   1.00 21.61 ? 176  ASP B N   1 
ATOM   1040 C  CA  . ASP A 1 161 ? 28.754 -8.355  4.997   1.00 17.71 ? 176  ASP B CA  1 
ATOM   1041 C  C   . ASP A 1 161 ? 29.060 -7.526  3.740   1.00 18.99 ? 176  ASP B C   1 
ATOM   1042 O  O   . ASP A 1 161 ? 29.636 -8.031  2.775   1.00 21.12 ? 176  ASP B O   1 
ATOM   1043 C  CB  . ASP A 1 161 ? 27.573 -9.305  4.752   1.00 21.19 ? 176  ASP B CB  1 
ATOM   1044 C  CG  . ASP A 1 161 ? 27.366 -10.272 5.901   1.00 24.71 ? 176  ASP B CG  1 
ATOM   1045 O  OD1 . ASP A 1 161 ? 28.294 -11.066 6.188   1.00 26.38 ? 176  ASP B OD1 1 
ATOM   1046 O  OD2 . ASP A 1 161 ? 26.288 -10.227 6.528   1.00 22.10 ? 176  ASP B OD2 1 
ATOM   1047 N  N   . TRP A 1 162 ? 28.669 -6.258  3.755   1.00 21.23 ? 177  TRP B N   1 
ATOM   1048 C  CA  . TRP A 1 162 ? 28.986 -5.351  2.657   1.00 20.36 ? 177  TRP B CA  1 
ATOM   1049 C  C   . TRP A 1 162 ? 29.101 -3.940  3.205   1.00 16.55 ? 177  TRP B C   1 
ATOM   1050 O  O   . TRP A 1 162 ? 28.268 -3.500  3.984   1.00 17.44 ? 177  TRP B O   1 
ATOM   1051 C  CB  . TRP A 1 162 ? 27.925 -5.413  1.552   1.00 19.79 ? 177  TRP B CB  1 
ATOM   1052 C  CG  . TRP A 1 162 ? 28.418 -4.925  0.199   1.00 22.09 ? 177  TRP B CG  1 
ATOM   1053 C  CD1 . TRP A 1 162 ? 29.372 -5.512  -0.590  1.00 22.54 ? 177  TRP B CD1 1 
ATOM   1054 C  CD2 . TRP A 1 162 ? 27.969 -3.765  -0.516  1.00 20.21 ? 177  TRP B CD2 1 
ATOM   1055 N  NE1 . TRP A 1 162 ? 29.546 -4.785  -1.744  1.00 19.53 ? 177  TRP B NE1 1 
ATOM   1056 C  CE2 . TRP A 1 162 ? 28.695 -3.712  -1.726  1.00 22.26 ? 177  TRP B CE2 1 
ATOM   1057 C  CE3 . TRP A 1 162 ? 27.020 -2.768  -0.253  1.00 17.99 ? 177  TRP B CE3 1 
ATOM   1058 C  CZ2 . TRP A 1 162 ? 28.500 -2.700  -2.676  1.00 21.55 ? 177  TRP B CZ2 1 
ATOM   1059 C  CZ3 . TRP A 1 162 ? 26.830 -1.766  -1.192  1.00 20.11 ? 177  TRP B CZ3 1 
ATOM   1060 C  CH2 . TRP A 1 162 ? 27.567 -1.740  -2.390  1.00 22.66 ? 177  TRP B CH2 1 
ATOM   1061 N  N   . VAL A 1 163 ? 30.157 -3.246  2.807   1.00 20.39 ? 178  VAL B N   1 
ATOM   1062 C  CA  . VAL A 1 163 ? 30.401 -1.889  3.273   1.00 17.71 ? 178  VAL B CA  1 
ATOM   1063 C  C   . VAL A 1 163 ? 30.761 -1.031  2.075   1.00 19.18 ? 178  VAL B C   1 
ATOM   1064 O  O   . VAL A 1 163 ? 31.664 -1.363  1.305   1.00 18.79 ? 178  VAL B O   1 
ATOM   1065 C  CB  . VAL A 1 163 ? 31.517 -1.823  4.351   1.00 20.14 ? 178  VAL B CB  1 
ATOM   1066 C  CG1 . VAL A 1 163 ? 31.881 -0.371  4.658   1.00 16.30 ? 178  VAL B CG1 1 
ATOM   1067 C  CG2 . VAL A 1 163 ? 31.077 -2.544  5.622   1.00 18.29 ? 178  VAL B CG2 1 
ATOM   1068 N  N   . TYR A 1 164 ? 30.025 0.065   1.922   1.00 18.93 ? 179  TYR B N   1 
ATOM   1069 C  CA  . TYR A 1 164 ? 30.150 0.933   0.762   1.00 21.03 ? 179  TYR B CA  1 
ATOM   1070 C  C   . TYR A 1 164 ? 30.274 2.388   1.230   1.00 18.13 ? 179  TYR B C   1 
ATOM   1071 O  O   . TYR A 1 164 ? 29.351 2.947   1.822   1.00 22.06 ? 179  TYR B O   1 
ATOM   1072 C  CB  . TYR A 1 164 ? 28.931 0.711   -0.150  1.00 21.62 ? 179  TYR B CB  1 
ATOM   1073 C  CG  . TYR A 1 164 ? 28.854 1.541   -1.417  1.00 21.40 ? 179  TYR B CG  1 
ATOM   1074 C  CD1 . TYR A 1 164 ? 29.996 1.902   -2.124  1.00 20.60 ? 179  TYR B CD1 1 
ATOM   1075 C  CD2 . TYR A 1 164 ? 27.616 1.928   -1.929  1.00 23.40 ? 179  TYR B CD2 1 
ATOM   1076 C  CE1 . TYR A 1 164 ? 29.904 2.657   -3.302  1.00 19.92 ? 179  TYR B CE1 1 
ATOM   1077 C  CE2 . TYR A 1 164 ? 27.514 2.672   -3.090  1.00 25.58 ? 179  TYR B CE2 1 
ATOM   1078 C  CZ  . TYR A 1 164 ? 28.654 3.036   -3.775  1.00 28.72 ? 179  TYR B CZ  1 
ATOM   1079 O  OH  . TYR A 1 164 ? 28.527 3.778   -4.934  1.00 23.73 ? 179  TYR B OH  1 
ATOM   1080 N  N   . TYR A 1 165 ? 31.447 2.973   1.009   1.00 20.22 ? 180  TYR B N   1 
ATOM   1081 C  CA  . TYR A 1 165 ? 31.677 4.385   1.284   1.00 20.14 ? 180  TYR B CA  1 
ATOM   1082 C  C   . TYR A 1 165 ? 30.958 5.144   0.164   1.00 22.74 ? 180  TYR B C   1 
ATOM   1083 O  O   . TYR A 1 165 ? 31.593 5.784   -0.680  1.00 20.49 ? 180  TYR B O   1 
ATOM   1084 C  CB  . TYR A 1 165 ? 33.184 4.673   1.277   1.00 18.62 ? 180  TYR B CB  1 
ATOM   1085 C  CG  . TYR A 1 165 ? 33.613 6.050   1.770   1.00 18.59 ? 180  TYR B CG  1 
ATOM   1086 C  CD1 . TYR A 1 165 ? 32.688 7.057   2.012   1.00 21.30 ? 180  TYR B CD1 1 
ATOM   1087 C  CD2 . TYR A 1 165 ? 34.959 6.342   1.960   1.00 22.73 ? 180  TYR B CD2 1 
ATOM   1088 C  CE1 . TYR A 1 165 ? 33.096 8.314   2.450   1.00 23.18 ? 180  TYR B CE1 1 
ATOM   1089 C  CE2 . TYR A 1 165 ? 35.373 7.585   2.394   1.00 20.32 ? 180  TYR B CE2 1 
ATOM   1090 C  CZ  . TYR A 1 165 ? 34.443 8.566   2.636   1.00 19.89 ? 180  TYR B CZ  1 
ATOM   1091 O  OH  . TYR A 1 165 ? 34.869 9.799   3.061   1.00 21.41 ? 180  TYR B OH  1 
ATOM   1092 N  N   . GLU A 1 166 ? 29.627 5.042   0.184   1.00 24.31 ? 181  GLU B N   1 
ATOM   1093 C  CA  . GLU A 1 166 ? 28.730 5.491   -0.889  1.00 26.97 ? 181  GLU B CA  1 
ATOM   1094 C  C   . GLU A 1 166 ? 28.744 7.003   -1.119  1.00 27.79 ? 181  GLU B C   1 
ATOM   1095 O  O   . GLU A 1 166 ? 28.704 7.474   -2.256  1.00 28.22 ? 181  GLU B O   1 
ATOM   1096 C  CB  . GLU A 1 166 ? 27.294 5.022   -0.583  1.00 28.63 ? 181  GLU B CB  1 
ATOM   1097 C  CG  . GLU A 1 166 ? 26.239 5.452   -1.608  1.00 28.70 ? 181  GLU B CG  1 
ATOM   1098 C  CD  . GLU A 1 166 ? 24.814 5.072   -1.212  1.00 31.75 ? 181  GLU B CD  1 
ATOM   1099 O  OE1 . GLU A 1 166 ? 23.931 5.079   -2.104  1.00 34.11 ? 181  GLU B OE1 1 
ATOM   1100 O  OE2 . GLU A 1 166 ? 24.568 4.781   -0.018  1.00 27.98 ? 181  GLU B OE2 1 
ATOM   1101 N  N   . SER A 1 167 ? 28.797 7.761   -0.032  1.00 24.05 ? 182  SER B N   1 
ATOM   1102 C  CA  . SER A 1 167 ? 28.662 9.207   -0.107  1.00 26.39 ? 182  SER B CA  1 
ATOM   1103 C  C   . SER A 1 167 ? 29.555 9.847   0.949   1.00 27.79 ? 182  SER B C   1 
ATOM   1104 O  O   . SER A 1 167 ? 29.925 9.198   1.922   1.00 24.57 ? 182  SER B O   1 
ATOM   1105 C  CB  . SER A 1 167 ? 27.185 9.586   0.086   1.00 31.29 ? 182  SER B CB  1 
ATOM   1106 O  OG  . SER A 1 167 ? 27.007 10.747  0.875   1.00 23.23 ? 182  SER B OG  1 
ATOM   1107 N  N   . LYS A 1 168 ? 29.919 11.110  0.747   1.00 27.31 ? 183  LYS B N   1 
ATOM   1108 C  CA  . LYS A 1 168 ? 30.683 11.842  1.754   1.00 28.86 ? 183  LYS B CA  1 
ATOM   1109 C  C   . LYS A 1 168 ? 29.822 12.092  2.987   1.00 28.15 ? 183  LYS B C   1 
ATOM   1110 O  O   . LYS A 1 168 ? 30.328 12.448  4.043   1.00 27.34 ? 183  LYS B O   1 
ATOM   1111 C  CB  . LYS A 1 168 ? 31.177 13.174  1.195   1.00 26.51 ? 183  LYS B CB  1 
ATOM   1112 C  CG  . LYS A 1 168 ? 32.015 13.052  -0.068  1.00 32.20 ? 183  LYS B CG  1 
ATOM   1113 C  CD  . LYS A 1 168 ? 33.495 12.921  0.236   1.00 31.52 ? 183  LYS B CD  1 
ATOM   1114 C  CE  . LYS A 1 168 ? 34.289 12.839  -1.062  1.00 33.71 ? 183  LYS B CE  1 
ATOM   1115 N  NZ  . LYS A 1 168 ? 35.756 12.976  -0.827  1.00 35.38 ? 183  LYS B NZ  1 
ATOM   1116 N  N   . ALA A 1 169 ? 28.511 11.909  2.840   1.00 29.82 ? 184  ALA B N   1 
ATOM   1117 C  CA  . ALA A 1 169 ? 27.577 12.112  3.945   1.00 25.07 ? 184  ALA B CA  1 
ATOM   1118 C  C   . ALA A 1 169 ? 27.448 10.896  4.869   1.00 25.22 ? 184  ALA B C   1 
ATOM   1119 O  O   . ALA A 1 169 ? 27.012 11.036  6.014   1.00 26.00 ? 184  ALA B O   1 
ATOM   1120 C  CB  . ALA A 1 169 ? 26.210 12.511  3.420   1.00 28.37 ? 184  ALA B CB  1 
ATOM   1121 N  N   . HIS A 1 170 ? 27.814 9.712   4.386   1.00 24.31 ? 185  HIS B N   1 
ATOM   1122 C  CA  . HIS A 1 170 ? 27.601 8.486   5.169   1.00 26.08 ? 185  HIS B CA  1 
ATOM   1123 C  C   . HIS A 1 170 ? 28.215 7.244   4.530   1.00 24.13 ? 185  HIS B C   1 
ATOM   1124 O  O   . HIS A 1 170 ? 28.453 7.202   3.318   1.00 23.96 ? 185  HIS B O   1 
ATOM   1125 C  CB  . HIS A 1 170 ? 26.101 8.220   5.325   1.00 22.56 ? 185  HIS B CB  1 
ATOM   1126 C  CG  . HIS A 1 170 ? 25.454 7.737   4.065   1.00 27.59 ? 185  HIS B CG  1 
ATOM   1127 N  ND1 . HIS A 1 170 ? 24.579 8.508   3.330   1.00 31.85 ? 185  HIS B ND1 1 
ATOM   1128 C  CD2 . HIS A 1 170 ? 25.578 6.566   3.394   1.00 25.23 ? 185  HIS B CD2 1 
ATOM   1129 C  CE1 . HIS A 1 170 ? 24.188 7.832   2.266   1.00 26.64 ? 185  HIS B CE1 1 
ATOM   1130 N  NE2 . HIS A 1 170 ? 24.781 6.651   2.280   1.00 29.89 ? 185  HIS B NE2 1 
ATOM   1131 N  N   . VAL A 1 171 ? 28.430 6.220   5.352   1.00 22.61 ? 186  VAL B N   1 
ATOM   1132 C  CA  . VAL A 1 171 ? 28.829 4.905   4.872   1.00 20.44 ? 186  VAL B CA  1 
ATOM   1133 C  C   . VAL A 1 171 ? 27.623 3.953   4.898   1.00 18.74 ? 186  VAL B C   1 
ATOM   1134 O  O   . VAL A 1 171 ? 26.864 3.918   5.869   1.00 18.14 ? 186  VAL B O   1 
ATOM   1135 C  CB  . VAL A 1 171 ? 29.956 4.297   5.745   1.00 20.21 ? 186  VAL B CB  1 
ATOM   1136 C  CG1 . VAL A 1 171 ? 30.418 2.984   5.159   1.00 18.90 ? 186  VAL B CG1 1 
ATOM   1137 C  CG2 . VAL A 1 171 ? 31.125 5.260   5.876   1.00 20.34 ? 186  VAL B CG2 1 
ATOM   1138 N  N   . HIS A 1 172 ? 27.453 3.181   3.831   1.00 17.10 ? 187  HIS B N   1 
ATOM   1139 C  CA  . HIS A 1 172 ? 26.360 2.202   3.743   1.00 18.08 ? 187  HIS B CA  1 
ATOM   1140 C  C   . HIS A 1 172 ? 26.846 0.801   4.142   1.00 17.45 ? 187  HIS B C   1 
ATOM   1141 O  O   . HIS A 1 172 ? 27.791 0.275   3.564   1.00 17.53 ? 187  HIS B O   1 
ATOM   1142 C  CB  . HIS A 1 172 ? 25.769 2.214   2.321   1.00 19.15 ? 187  HIS B CB  1 
ATOM   1143 C  CG  . HIS A 1 172 ? 24.884 1.044   2.006   1.00 19.38 ? 187  HIS B CG  1 
ATOM   1144 N  ND1 . HIS A 1 172 ? 23.507 1.109   2.072   1.00 25.37 ? 187  HIS B ND1 1 
ATOM   1145 C  CD2 . HIS A 1 172 ? 25.178 -0.206  1.578   1.00 22.54 ? 187  HIS B CD2 1 
ATOM   1146 C  CE1 . HIS A 1 172 ? 22.994 -0.055  1.717   1.00 17.49 ? 187  HIS B CE1 1 
ATOM   1147 N  NE2 . HIS A 1 172 ? 23.988 -0.872  1.415   1.00 19.52 ? 187  HIS B NE2 1 
ATOM   1148 N  N   . CYS A 1 173 ? 26.210 0.212   5.149   1.00 17.92 ? 188  CYS B N   1 
ATOM   1149 C  CA  . CYS A 1 173 ? 26.601 -1.106  5.641   1.00 19.87 ? 188  CYS B CA  1 
ATOM   1150 C  C   . CYS A 1 173 ? 25.399 -2.041  5.623   1.00 19.93 ? 188  CYS B C   1 
ATOM   1151 O  O   . CYS A 1 173 ? 24.317 -1.670  6.072   1.00 18.61 ? 188  CYS B O   1 
ATOM   1152 C  CB  . CYS A 1 173 ? 27.145 -1.006  7.072   1.00 17.25 ? 188  CYS B CB  1 
ATOM   1153 S  SG  . CYS A 1 173 ? 28.400 0.267   7.320   1.00 19.79 ? 188  CYS B SG  1 
ATOM   1154 N  N   . SER A 1 174 ? 25.589 -3.256  5.121   1.00 18.81 ? 189  SER B N   1 
ATOM   1155 C  CA  . SER A 1 174 ? 24.486 -4.207  5.057   1.00 18.58 ? 189  SER B CA  1 
ATOM   1156 C  C   . SER A 1 174 ? 24.932 -5.617  5.423   1.00 18.43 ? 189  SER B C   1 
ATOM   1157 O  O   . SER A 1 174 ? 26.128 -5.898  5.500   1.00 22.40 ? 189  SER B O   1 
ATOM   1158 C  CB  . SER A 1 174 ? 23.834 -4.187  3.662   1.00 19.90 ? 189  SER B CB  1 
ATOM   1159 O  OG  . SER A 1 174 ? 24.719 -4.696  2.675   1.00 18.99 ? 189  SER B OG  1 
ATOM   1160 N  N   . VAL A 1 175 ? 23.964 -6.501  5.649   1.00 17.94 ? 190  VAL B N   1 
ATOM   1161 C  CA  . VAL A 1 175 ? 24.256 -7.887  6.002   1.00 22.13 ? 190  VAL B CA  1 
ATOM   1162 C  C   . VAL A 1 175 ? 23.353 -8.850  5.233   1.00 20.87 ? 190  VAL B C   1 
ATOM   1163 O  O   . VAL A 1 175 ? 22.280 -8.466  4.751   1.00 22.90 ? 190  VAL B O   1 
ATOM   1164 C  CB  . VAL A 1 175 ? 24.090 -8.157  7.531   1.00 21.86 ? 190  VAL B CB  1 
ATOM   1165 C  CG1 . VAL A 1 175 ? 25.013 -7.262  8.350   1.00 24.29 ? 190  VAL B CG1 1 
ATOM   1166 C  CG2 . VAL A 1 175 ? 22.630 -7.977  7.958   1.00 25.79 ? 190  VAL B CG2 1 
ATOM   1167 N  N   . LYS A 1 176 ? 23.796 -10.096 5.118   1.00 23.06 ? 191  LYS B N   1 
ATOM   1168 C  CA  . LYS A 1 176 ? 22.974 -11.162 4.558   1.00 20.73 ? 191  LYS B CA  1 
ATOM   1169 C  C   . LYS A 1 176 ? 21.790 -11.431 5.473   1.00 25.19 ? 191  LYS B C   1 
ATOM   1170 O  O   . LYS A 1 176 ? 21.715 -10.907 6.583   1.00 25.05 ? 191  LYS B O   1 
ATOM   1171 C  CB  . LYS A 1 176 ? 23.770 -12.466 4.448   1.00 24.52 ? 191  LYS B CB  1 
ATOM   1172 C  CG  . LYS A 1 176 ? 25.273 -12.325 4.421   1.00 28.53 ? 191  LYS B CG  1 
ATOM   1173 C  CD  . LYS A 1 176 ? 25.936 -13.682 4.677   1.00 31.03 ? 191  LYS B CD  1 
ATOM   1174 C  CE  . LYS A 1 176 ? 27.464 -13.578 4.724   1.00 36.85 ? 191  LYS B CE  1 
ATOM   1175 N  NZ  . LYS A 1 176 ? 28.076 -13.210 3.406   1.00 37.65 ? 191  LYS B NZ  1 
ATOM   1176 N  N   . SER A 1 177 ? 20.870 -12.272 5.014   1.00 24.78 ? 192  SER B N   1 
ATOM   1177 C  CA  . SER A 1 177 ? 19.791 -12.734 5.878   1.00 24.88 ? 192  SER B CA  1 
ATOM   1178 C  C   . SER A 1 177 ? 20.080 -14.143 6.407   1.00 31.67 ? 192  SER B C   1 
ATOM   1179 O  O   . SER A 1 177 ? 19.271 -14.729 7.135   1.00 36.19 ? 192  SER B O   1 
ATOM   1180 C  CB  . SER A 1 177 ? 18.449 -12.686 5.143   1.00 27.43 ? 192  SER B CB  1 
ATOM   1181 O  OG  . SER A 1 177 ? 18.600 -13.107 3.802   1.00 27.23 ? 192  SER B OG  1 
HETATM 1182 ZN ZN  . ZN  B 2 .   ? 22.312 2.981   2.643   1.00 22.26 ? 1001 ZN  B ZN  1 
HETATM 1183 S  S   . SO4 C 3 .   ? 39.114 -5.063  1.313   1.00 54.12 ? 1    SO4 B S   1 
HETATM 1184 O  O1  . SO4 C 3 .   ? 38.184 -5.582  0.302   1.00 39.77 ? 1    SO4 B O1  1 
HETATM 1185 O  O2  . SO4 C 3 .   ? 39.069 -5.877  2.530   1.00 43.97 ? 1    SO4 B O2  1 
HETATM 1186 O  O3  . SO4 C 3 .   ? 40.477 -5.067  0.787   1.00 47.37 ? 1    SO4 B O3  1 
HETATM 1187 O  O4  . SO4 C 3 .   ? 38.723 -3.696  1.647   1.00 39.09 ? 1    SO4 B O4  1 
HETATM 1188 S  S   . SO4 D 3 .   ? 9.325  -5.040  -3.733  1.00 42.44 ? 2    SO4 B S   1 
HETATM 1189 O  O1  . SO4 D 3 .   ? 8.550  -5.405  -2.550  1.00 39.38 ? 2    SO4 B O1  1 
HETATM 1190 O  O2  . SO4 D 3 .   ? 9.310  -3.590  -3.915  1.00 45.55 ? 2    SO4 B O2  1 
HETATM 1191 O  O3  . SO4 D 3 .   ? 10.701 -5.484  -3.553  1.00 47.97 ? 2    SO4 B O3  1 
HETATM 1192 O  O4  . SO4 D 3 .   ? 8.771  -5.703  -4.912  1.00 46.54 ? 2    SO4 B O4  1 
HETATM 1193 S  S   . SO4 E 3 .   ? 18.215 -12.286 -8.197  1.00 26.18 ? 3    SO4 B S   1 
HETATM 1194 O  O1  . SO4 E 3 .   ? 17.064 -12.850 -8.897  1.00 27.06 ? 3    SO4 B O1  1 
HETATM 1195 O  O2  . SO4 E 3 .   ? 17.777 -11.243 -7.274  1.00 27.76 ? 3    SO4 B O2  1 
HETATM 1196 O  O3  . SO4 E 3 .   ? 18.874 -13.361 -7.461  1.00 29.72 ? 3    SO4 B O3  1 
HETATM 1197 O  O4  . SO4 E 3 .   ? 19.147 -11.733 -9.172  1.00 32.71 ? 3    SO4 B O4  1 
HETATM 1198 S  S   . SO4 F 3 .   ? 21.623 16.636  13.076  1.00 33.38 ? 6    SO4 B S   1 
HETATM 1199 O  O1  . SO4 F 3 .   ? 22.947 16.824  12.488  1.00 31.83 ? 6    SO4 B O1  1 
HETATM 1200 O  O2  . SO4 F 3 .   ? 20.611 16.980  12.068  1.00 31.51 ? 6    SO4 B O2  1 
HETATM 1201 O  O3  . SO4 F 3 .   ? 21.463 15.241  13.488  1.00 31.59 ? 6    SO4 B O3  1 
HETATM 1202 O  O4  . SO4 F 3 .   ? 21.483 17.511  14.244  1.00 30.87 ? 6    SO4 B O4  1 
HETATM 1203 S  S   . SO4 G 3 .   ? 15.462 12.103  7.674   1.00 52.84 ? 7    SO4 B S   1 
HETATM 1204 O  O1  . SO4 G 3 .   ? 15.663 10.784  8.271   1.00 45.62 ? 7    SO4 B O1  1 
HETATM 1205 O  O2  . SO4 G 3 .   ? 15.483 11.995  6.212   1.00 37.44 ? 7    SO4 B O2  1 
HETATM 1206 O  O3  . SO4 G 3 .   ? 14.172 12.643  8.102   1.00 47.41 ? 7    SO4 B O3  1 
HETATM 1207 O  O4  . SO4 G 3 .   ? 16.524 12.999  8.133   1.00 45.89 ? 7    SO4 B O4  1 
HETATM 1208 C  C   . CO3 H 4 .   ? 20.973 1.777   -1.362  1.00 24.41 ? 203  CO3 B C   1 
HETATM 1209 O  O1  . CO3 H 4 .   ? 21.704 2.266   -2.325  1.00 30.19 ? 203  CO3 B O1  1 
HETATM 1210 O  O2  . CO3 H 4 .   ? 20.871 2.407   -0.237  1.00 24.34 ? 203  CO3 B O2  1 
HETATM 1211 O  O3  . CO3 H 4 .   ? 20.345 0.653   -1.499  1.00 25.16 ? 203  CO3 B O3  1 
HETATM 1212 O  O   . HOH I 5 .   ? 32.537 -6.107  4.313   1.00 19.86 ? 4    HOH B O   1 
HETATM 1213 O  O   . HOH I 5 .   ? 39.071 8.296   7.341   1.00 17.68 ? 5    HOH B O   1 
HETATM 1214 O  O   . HOH I 5 .   ? 24.093 -1.922  -3.883  1.00 25.86 ? 8    HOH B O   1 
HETATM 1215 O  O   . HOH I 5 .   ? 16.003 -11.124 12.579  1.00 24.89 ? 9    HOH B O   1 
HETATM 1216 O  O   . HOH I 5 .   ? 37.343 -3.176  -1.486  1.00 24.55 ? 10   HOH B O   1 
HETATM 1217 O  O   . HOH I 5 .   ? 21.061 -1.691  -0.432  1.00 23.23 ? 11   HOH B O   1 
HETATM 1218 O  O   . HOH I 5 .   ? 33.238 -8.004  7.179   1.00 22.47 ? 12   HOH B O   1 
HETATM 1219 O  O   . HOH I 5 .   ? 35.181 -1.136  -4.457  1.00 26.09 ? 13   HOH B O   1 
HETATM 1220 O  O   . HOH I 5 .   ? 27.380 13.288  7.585   1.00 24.49 ? 14   HOH B O   1 
HETATM 1221 O  O   . HOH I 5 .   ? 35.550 -2.696  14.022  1.00 20.25 ? 15   HOH B O   1 
HETATM 1222 O  O   . HOH I 5 .   ? 29.611 4.166   19.511  1.00 20.36 ? 204  HOH B O   1 
HETATM 1223 O  O   . HOH I 5 .   ? 24.109 -5.460  -6.202  1.00 22.21 ? 205  HOH B O   1 
HETATM 1224 O  O   . HOH I 5 .   ? 37.417 -7.735  -1.871  1.00 27.84 ? 206  HOH B O   1 
HETATM 1225 O  O   . HOH I 5 .   ? 21.938 13.234  15.330  1.00 25.45 ? 207  HOH B O   1 
HETATM 1226 O  O   . HOH I 5 .   ? 19.808 -10.417 8.391   1.00 23.73 ? 208  HOH B O   1 
HETATM 1227 O  O   . HOH I 5 .   ? 29.651 -3.056  -8.951  1.00 26.42 ? 209  HOH B O   1 
HETATM 1228 O  O   . HOH I 5 .   ? 30.944 -10.414 2.907   1.00 21.76 ? 210  HOH B O   1 
HETATM 1229 O  O   . HOH I 5 .   ? 15.378 4.478   8.845   1.00 24.63 ? 211  HOH B O   1 
HETATM 1230 O  O   . HOH I 5 .   ? 18.666 -3.011  21.916  1.00 36.18 ? 212  HOH B O   1 
HETATM 1231 O  O   . HOH I 5 .   ? 10.083 -0.090  1.953   1.00 25.13 ? 213  HOH B O   1 
HETATM 1232 O  O   . HOH I 5 .   ? 23.194 -11.514 19.999  1.00 22.81 ? 214  HOH B O   1 
HETATM 1233 O  O   . HOH I 5 .   ? 36.962 9.958   4.832   1.00 21.52 ? 215  HOH B O   1 
HETATM 1234 O  O   . HOH I 5 .   ? 39.377 7.588   2.536   1.00 23.72 ? 216  HOH B O   1 
HETATM 1235 O  O   . HOH I 5 .   ? 27.788 -1.904  21.525  1.00 24.26 ? 217  HOH B O   1 
HETATM 1236 O  O   . HOH I 5 .   ? 26.032 -3.249  -5.467  1.00 29.90 ? 218  HOH B O   1 
HETATM 1237 O  O   . HOH I 5 .   ? 31.640 -4.900  -8.696  1.00 22.61 ? 219  HOH B O   1 
HETATM 1238 O  O   . HOH I 5 .   ? 20.067 12.477  17.286  1.00 25.00 ? 220  HOH B O   1 
HETATM 1239 O  O   . HOH I 5 .   ? 17.842 -15.383 -6.628  1.00 22.97 ? 221  HOH B O   1 
HETATM 1240 O  O   . HOH I 5 .   ? 33.655 17.197  8.228   1.00 25.90 ? 222  HOH B O   1 
HETATM 1241 O  O   . HOH I 5 .   ? 16.597 -12.746 17.421  1.00 21.11 ? 223  HOH B O   1 
HETATM 1242 O  O   . HOH I 5 .   ? 38.942 -0.131  16.648  1.00 29.69 ? 224  HOH B O   1 
HETATM 1243 O  O   . HOH I 5 .   ? 35.212 15.343  17.395  1.00 25.13 ? 225  HOH B O   1 
HETATM 1244 O  O   . HOH I 5 .   ? 6.256  -6.512  2.981   1.00 35.78 ? 226  HOH B O   1 
HETATM 1245 O  O   . HOH I 5 .   ? 10.873 4.658   7.090   1.00 29.70 ? 227  HOH B O   1 
HETATM 1246 O  O   . HOH I 5 .   ? 30.931 11.096  -6.950  1.00 37.26 ? 228  HOH B O   1 
HETATM 1247 O  O   . HOH I 5 .   ? 24.844 17.052  14.632  1.00 26.31 ? 229  HOH B O   1 
HETATM 1248 O  O   . HOH I 5 .   ? 41.174 8.696   9.296   1.00 29.45 ? 230  HOH B O   1 
HETATM 1249 O  O   . HOH I 5 .   ? 46.512 4.651   4.991   1.00 32.12 ? 231  HOH B O   1 
HETATM 1250 O  O   . HOH I 5 .   ? 23.672 -8.027  19.605  1.00 25.03 ? 232  HOH B O   1 
HETATM 1251 O  O   . HOH I 5 .   ? 21.093 -14.430 -0.781  1.00 25.67 ? 233  HOH B O   1 
HETATM 1252 O  O   . HOH I 5 .   ? 29.737 1.402   26.855  1.00 26.34 ? 234  HOH B O   1 
HETATM 1253 O  O   . HOH I 5 .   ? 30.571 -11.910 5.027   1.00 34.24 ? 235  HOH B O   1 
HETATM 1254 O  O   . HOH I 5 .   ? 27.451 16.481  15.036  1.00 23.48 ? 236  HOH B O   1 
HETATM 1255 O  O   . HOH I 5 .   ? 42.917 -2.716  6.822   1.00 27.48 ? 237  HOH B O   1 
HETATM 1256 O  O   . HOH I 5 .   ? 34.431 -4.472  -8.078  1.00 29.47 ? 238  HOH B O   1 
HETATM 1257 O  O   . HOH I 5 .   ? 13.078 -14.154 2.236   1.00 32.03 ? 239  HOH B O   1 
HETATM 1258 O  O   . HOH I 5 .   ? 21.328 -12.755 1.999   1.00 26.70 ? 240  HOH B O   1 
HETATM 1259 O  O   . HOH I 5 .   ? 33.262 11.677  4.016   1.00 24.92 ? 241  HOH B O   1 
HETATM 1260 O  O   . HOH I 5 .   ? 12.039 1.468   16.773  1.00 32.48 ? 242  HOH B O   1 
HETATM 1261 O  O   . HOH I 5 .   ? 27.687 15.675  5.837   1.00 33.80 ? 243  HOH B O   1 
HETATM 1262 O  O   . HOH I 5 .   ? 39.715 14.363  10.995  1.00 26.44 ? 244  HOH B O   1 
HETATM 1263 O  O   . HOH I 5 .   ? 20.289 8.795   19.852  1.00 30.40 ? 245  HOH B O   1 
HETATM 1264 O  O   . HOH I 5 .   ? 19.359 -11.879 11.141  1.00 26.74 ? 246  HOH B O   1 
HETATM 1265 O  O   . HOH I 5 .   ? 9.412  -5.784  14.299  1.00 34.48 ? 247  HOH B O   1 
HETATM 1266 O  O   . HOH I 5 .   ? 20.243 4.581   21.202  1.00 32.13 ? 248  HOH B O   1 
HETATM 1267 O  O   . HOH I 5 .   ? 30.130 18.389  9.518   1.00 30.29 ? 249  HOH B O   1 
HETATM 1268 O  O   . HOH I 5 .   ? 30.696 -0.523  25.191  1.00 31.55 ? 250  HOH B O   1 
HETATM 1269 O  O   . HOH I 5 .   ? 20.102 7.563   3.835   1.00 28.19 ? 251  HOH B O   1 
HETATM 1270 O  O   . HOH I 5 .   ? 40.867 0.107   2.559   1.00 31.61 ? 252  HOH B O   1 
HETATM 1271 O  O   . HOH I 5 .   ? 33.969 -4.729  15.868  1.00 27.84 ? 253  HOH B O   1 
HETATM 1272 O  O   . HOH I 5 .   ? 34.672 1.070   23.335  1.00 30.53 ? 254  HOH B O   1 
HETATM 1273 O  O   . HOH I 5 .   ? 41.011 1.089   15.716  1.00 31.71 ? 255  HOH B O   1 
HETATM 1274 O  O   . HOH I 5 .   ? 36.734 -8.830  -6.412  1.00 36.82 ? 256  HOH B O   1 
HETATM 1275 O  O   . HOH I 5 .   ? 20.437 5.482   -1.747  1.00 28.78 ? 257  HOH B O   1 
HETATM 1276 O  O   . HOH I 5 .   ? 23.766 0.991   -1.458  1.00 30.04 ? 258  HOH B O   1 
HETATM 1277 O  O   . HOH I 5 .   ? 3.045  -4.620  13.066  1.00 39.90 ? 259  HOH B O   1 
HETATM 1278 O  O   . HOH I 5 .   ? 21.874 7.033   22.225  1.00 34.44 ? 260  HOH B O   1 
HETATM 1279 O  O   . HOH I 5 .   ? 40.785 2.804   22.157  1.00 25.56 ? 261  HOH B O   1 
HETATM 1280 O  O   . HOH I 5 .   ? 33.013 7.685   22.917  1.00 27.52 ? 262  HOH B O   1 
HETATM 1281 O  O   . HOH I 5 .   ? 9.027  5.208   8.825   1.00 35.54 ? 263  HOH B O   1 
HETATM 1282 O  O   . HOH I 5 .   ? 21.145 9.168   5.740   1.00 25.60 ? 264  HOH B O   1 
HETATM 1283 O  O   . HOH I 5 .   ? 14.216 6.779   -4.411  1.00 31.07 ? 265  HOH B O   1 
HETATM 1284 O  O   . HOH I 5 .   ? 5.806  -11.183 5.059   1.00 38.50 ? 266  HOH B O   1 
HETATM 1285 O  O   . HOH I 5 .   ? 19.107 -13.041 0.306   1.00 27.50 ? 267  HOH B O   1 
HETATM 1286 O  O   . HOH I 5 .   ? 25.193 -12.646 14.316  1.00 35.46 ? 268  HOH B O   1 
HETATM 1287 O  O   . HOH I 5 .   ? 40.107 8.546   4.895   1.00 27.18 ? 269  HOH B O   1 
HETATM 1288 O  O   . HOH I 5 .   ? 22.459 17.195  9.697   1.00 33.49 ? 270  HOH B O   1 
HETATM 1289 O  O   . HOH I 5 .   ? 29.076 -0.171  23.146  1.00 27.26 ? 271  HOH B O   1 
HETATM 1290 O  O   . HOH I 5 .   ? 24.479 7.947   -1.754  1.00 33.90 ? 272  HOH B O   1 
HETATM 1291 O  O   . HOH I 5 .   ? 11.536 4.885   15.148  1.00 38.34 ? 273  HOH B O   1 
HETATM 1292 O  O   . HOH I 5 .   ? 27.445 -7.921  18.610  1.00 26.70 ? 274  HOH B O   1 
HETATM 1293 O  O   . HOH I 5 .   ? 31.974 -6.692  -10.653 1.00 29.22 ? 275  HOH B O   1 
HETATM 1294 O  O   . HOH I 5 .   ? 17.947 -12.277 8.250   1.00 34.18 ? 276  HOH B O   1 
HETATM 1295 O  O   . HOH I 5 .   ? 28.523 0.314   29.054  1.00 27.23 ? 277  HOH B O   1 
HETATM 1296 O  O   . HOH I 5 .   ? 16.476 8.420   8.482   1.00 28.49 ? 278  HOH B O   1 
HETATM 1297 O  O   . HOH I 5 .   ? 35.326 18.073  6.079   1.00 38.47 ? 279  HOH B O   1 
HETATM 1298 O  O   . HOH I 5 .   ? 15.397 -12.519 14.810  1.00 30.98 ? 280  HOH B O   1 
HETATM 1299 O  O   . HOH I 5 .   ? 27.660 10.329  -6.041  1.00 36.16 ? 281  HOH B O   1 
HETATM 1300 O  O   . HOH I 5 .   ? 32.944 17.716  13.050  1.00 31.07 ? 282  HOH B O   1 
HETATM 1301 O  O   . HOH I 5 .   ? 33.819 -10.277 3.262   1.00 32.46 ? 283  HOH B O   1 
HETATM 1302 O  O   . HOH I 5 .   ? 26.181 -0.133  25.290  1.00 33.78 ? 284  HOH B O   1 
HETATM 1303 O  O   . HOH I 5 .   ? 33.656 17.384  18.097  1.00 35.78 ? 285  HOH B O   1 
HETATM 1304 O  O   . HOH I 5 .   ? 26.541 3.421   -6.639  1.00 31.07 ? 286  HOH B O   1 
HETATM 1305 O  O   . HOH I 5 .   ? 43.868 3.791   10.249  1.00 26.58 ? 287  HOH B O   1 
HETATM 1306 O  O   . HOH I 5 .   ? 34.687 -7.762  3.725   1.00 32.24 ? 288  HOH B O   1 
HETATM 1307 O  O   . HOH I 5 .   ? 29.244 -7.025  -11.905 1.00 33.28 ? 289  HOH B O   1 
HETATM 1308 O  O   . HOH I 5 .   ? 28.464 -2.242  -6.819  1.00 31.39 ? 290  HOH B O   1 
HETATM 1309 O  O   . HOH I 5 .   ? 38.980 8.865   -0.768  1.00 34.38 ? 291  HOH B O   1 
HETATM 1310 O  O   . HOH I 5 .   ? 14.061 -14.178 13.275  1.00 35.30 ? 292  HOH B O   1 
HETATM 1311 O  O   . HOH I 5 .   ? 40.497 9.433   12.143  1.00 33.29 ? 293  HOH B O   1 
HETATM 1312 O  O   . HOH I 5 .   ? 40.314 -2.992  -3.057  1.00 34.59 ? 294  HOH B O   1 
HETATM 1313 O  O   . HOH I 5 .   ? 22.189 4.205   0.835   1.00 20.77 ? 295  HOH B O   1 
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   MET 1   16  ?   ?   ?   B . n 
A 1 2   ARG 2   17  ?   ?   ?   B . n 
A 1 3   GLY 3   18  ?   ?   ?   B . n 
A 1 4   SER 4   19  ?   ?   ?   B . n 
A 1 5   HIS 5   20  ?   ?   ?   B . n 
A 1 6   HIS 6   21  ?   ?   ?   B . n 
A 1 7   HIS 7   22  ?   ?   ?   B . n 
A 1 8   HIS 8   23  ?   ?   ?   B . n 
A 1 9   HIS 9   24  ?   ?   ?   B . n 
A 1 10  HIS 10  25  ?   ?   ?   B . n 
A 1 11  GLY 11  26  ?   ?   ?   B . n 
A 1 12  SER 12  27  ?   ?   ?   B . n 
A 1 13  CYS 13  28  ?   ?   ?   B . n 
A 1 14  GLY 14  29  ?   ?   ?   B . n 
A 1 15  PRO 15  30  ?   ?   ?   B . n 
A 1 16  GLY 16  31  ?   ?   ?   B . n 
A 1 17  ARG 17  32  ?   ?   ?   B . n 
A 1 18  VAL 18  33  ?   ?   ?   B . n 
A 1 19  VAL 19  34  ?   ?   ?   B . n 
A 1 20  GLY 20  35  ?   ?   ?   B . n 
A 1 21  SER 21  36  ?   ?   ?   B . n 
A 1 22  ARG 22  37  ?   ?   ?   B . n 
A 1 23  ARG 23  38  ?   ?   ?   B . n 
A 1 24  ARG 24  39  ?   ?   ?   B . n 
A 1 25  PRO 25  40  ?   ?   ?   B . n 
A 1 26  PRO 26  41  41  PRO PRO B . n 
A 1 27  ARG 27  42  42  ARG ARG B . n 
A 1 28  LYS 28  43  43  LYS LYS B . n 
A 1 29  LEU 29  44  44  LEU LEU B . n 
A 1 30  VAL 30  45  45  VAL VAL B . n 
A 1 31  PRO 31  46  46  PRO PRO B . n 
A 1 32  LEU 32  47  47  LEU LEU B . n 
A 1 33  ALA 33  48  48  ALA ALA B . n 
A 1 34  TYR 34  49  49  TYR TYR B . n 
A 1 35  LYS 35  50  50  LYS LYS B . n 
A 1 36  GLN 36  51  51  GLN GLN B . n 
A 1 37  PHE 37  52  52  PHE PHE B . n 
A 1 38  SER 38  53  53  SER SER B . n 
A 1 39  PRO 39  54  54  PRO PRO B . n 
A 1 40  ASN 40  55  55  ASN ASN B . n 
A 1 41  VAL 41  56  56  VAL VAL B . n 
A 1 42  PRO 42  57  57  PRO PRO B . n 
A 1 43  GLU 43  58  58  GLU GLU B . n 
A 1 44  LYS 44  59  59  LYS LYS B . n 
A 1 45  THR 45  60  60  THR THR B . n 
A 1 46  LEU 46  61  61  LEU LEU B . n 
A 1 47  GLY 47  62  62  GLY GLY B . n 
A 1 48  ALA 48  63  63  ALA ALA B . n 
A 1 49  SER 49  64  64  SER SER B . n 
A 1 50  GLY 50  65  65  GLY GLY B . n 
A 1 51  ARG 51  66  66  ARG ARG B . n 
A 1 52  TYR 52  67  67  TYR TYR B . n 
A 1 53  GLU 53  68  68  GLU GLU B . n 
A 1 54  GLY 54  69  69  GLY GLY B . n 
A 1 55  LYS 55  70  70  LYS LYS B . n 
A 1 56  ILE 56  71  71  ILE ILE B . n 
A 1 57  ALA 57  72  72  ALA ALA B . n 
A 1 58  ARG 58  73  73  ARG ARG B . n 
A 1 59  SER 59  74  74  SER SER B . n 
A 1 60  SER 60  75  75  SER SER B . n 
A 1 61  GLU 61  76  76  GLU GLU B . n 
A 1 62  ARG 62  77  77  ARG ARG B . n 
A 1 63  PHE 63  78  78  PHE PHE B . n 
A 1 64  LYS 64  79  79  LYS LYS B . n 
A 1 65  GLU 65  80  80  GLU GLU B . n 
A 1 66  LEU 66  81  81  LEU LEU B . n 
A 1 67  THR 67  82  82  THR THR B . n 
A 1 68  PRO 68  83  83  PRO PRO B . n 
A 1 69  ASN 69  84  84  ASN ASN B . n 
A 1 70  TYR 70  85  85  TYR TYR B . n 
A 1 71  ASN 71  86  86  ASN ASN B . n 
A 1 72  PRO 72  87  87  PRO PRO B . n 
A 1 73  ASP 73  88  88  ASP ASP B . n 
A 1 74  ILE 74  89  89  ILE ILE B . n 
A 1 75  ILE 75  90  90  ILE ILE B . n 
A 1 76  PHE 76  91  91  PHE PHE B . n 
A 1 77  LYS 77  92  92  LYS LYS B . n 
A 1 78  ASP 78  93  ?   ?   ?   B . n 
A 1 79  GLU 79  94  ?   ?   ?   B . n 
A 1 80  GLU 80  95  ?   ?   ?   B . n 
A 1 81  ASN 81  96  ?   ?   ?   B . n 
A 1 82  THR 82  97  ?   ?   ?   B . n 
A 1 83  GLY 83  98  ?   ?   ?   B . n 
A 1 84  ALA 84  99  99  ALA ALA B . n 
A 1 85  GLU 85  100 100 GLU GLU B . n 
A 1 86  ARG 86  101 101 ARG ARG B . n 
A 1 87  LEU 87  102 102 LEU LEU B . n 
A 1 88  MET 88  103 103 MET MET B . n 
A 1 89  THR 89  104 104 THR THR B . n 
A 1 90  GLN 90  105 105 GLN GLN B . n 
A 1 91  ARG 91  106 106 ARG ARG B . n 
A 1 92  CYS 92  107 107 CYS CYS B . n 
A 1 93  LYS 93  108 108 LYS LYS B . n 
A 1 94  ASP 94  109 109 ASP ASP B . n 
A 1 95  ARG 95  110 110 ARG ARG B . n 
A 1 96  LEU 96  111 111 LEU LEU B . n 
A 1 97  ASN 97  112 112 ASN ASN B . n 
A 1 98  SER 98  113 113 SER SER B . n 
A 1 99  LEU 99  114 114 LEU LEU B . n 
A 1 100 ALA 100 115 115 ALA ALA B . n 
A 1 101 ILE 101 116 116 ILE ILE B . n 
A 1 102 SER 102 117 117 SER SER B . n 
A 1 103 VAL 103 118 118 VAL VAL B . n 
A 1 104 MET 104 119 119 MET MET B . n 
A 1 105 ASN 105 120 120 ASN ASN B . n 
A 1 106 GLN 106 121 121 GLN GLN B . n 
A 1 107 TRP 107 122 122 TRP TRP B . n 
A 1 108 PRO 108 123 123 PRO PRO B . n 
A 1 109 GLY 109 124 124 GLY GLY B . n 
A 1 110 VAL 110 125 125 VAL VAL B . n 
A 1 111 LYS 111 126 126 LYS LYS B . n 
A 1 112 LEU 112 127 127 LEU LEU B . n 
A 1 113 ARG 113 128 128 ARG ARG B . n 
A 1 114 VAL 114 129 129 VAL VAL B . n 
A 1 115 THR 115 130 130 THR THR B . n 
A 1 116 GLU 116 131 131 GLU GLU B . n 
A 1 117 GLY 117 132 132 GLY GLY B . n 
A 1 118 TRP 118 133 133 TRP TRP B . n 
A 1 119 ASP 119 134 134 ASP ASP B . n 
A 1 120 GLU 120 135 135 GLU GLU B . n 
A 1 121 ASP 121 136 136 ASP ASP B . n 
A 1 122 GLY 122 137 137 GLY GLY B . n 
A 1 123 HIS 123 138 138 HIS HIS B . n 
A 1 124 HIS 124 139 139 HIS HIS B . n 
A 1 125 SER 125 140 140 SER SER B . n 
A 1 126 GLU 126 141 141 GLU GLU B . n 
A 1 127 GLU 127 142 142 GLU GLU B . n 
A 1 128 SER 128 143 143 SER SER B . n 
A 1 129 LEU 129 144 144 LEU LEU B . n 
A 1 130 HIS 130 145 145 HIS HIS B . n 
A 1 131 TYR 131 146 146 TYR TYR B . n 
A 1 132 GLU 132 147 147 GLU GLU B . n 
A 1 133 GLY 133 148 148 GLY GLY B . n 
A 1 134 ARG 134 149 149 ARG ARG B . n 
A 1 135 ALA 135 150 150 ALA ALA B . n 
A 1 136 VAL 136 151 151 VAL VAL B . n 
A 1 137 ASP 137 152 152 ASP ASP B . n 
A 1 138 ILE 138 153 153 ILE ILE B . n 
A 1 139 THR 139 154 154 THR THR B . n 
A 1 140 THR 140 155 155 THR THR B . n 
A 1 141 SER 141 156 156 SER SER B . n 
A 1 142 ASP 142 157 157 ASP ASP B . n 
A 1 143 ARG 143 158 158 ARG ARG B . n 
A 1 144 ASP 144 159 159 ASP ASP B . n 
A 1 145 ARG 145 160 160 ARG ARG B . n 
A 1 146 ASN 146 161 161 ASN ASN B . n 
A 1 147 LYS 147 162 162 LYS LYS B . n 
A 1 148 TYR 148 163 163 TYR TYR B . n 
A 1 149 GLY 149 164 164 GLY GLY B . n 
A 1 150 LEU 150 165 165 LEU LEU B . n 
A 1 151 LEU 151 166 166 LEU LEU B . n 
A 1 152 ALA 152 167 167 ALA ALA B . n 
A 1 153 ARG 153 168 168 ARG ARG B . n 
A 1 154 LEU 154 169 169 LEU LEU B . n 
A 1 155 ALA 155 170 170 ALA ALA B . n 
A 1 156 VAL 156 171 171 VAL VAL B . n 
A 1 157 GLU 157 172 172 GLU GLU B . n 
A 1 158 ALA 158 173 173 ALA ALA B . n 
A 1 159 GLY 159 174 174 GLY GLY B . n 
A 1 160 PHE 160 175 175 PHE PHE B . n 
A 1 161 ASP 161 176 176 ASP ASP B . n 
A 1 162 TRP 162 177 177 TRP TRP B . n 
A 1 163 VAL 163 178 178 VAL VAL B . n 
A 1 164 TYR 164 179 179 TYR TYR B . n 
A 1 165 TYR 165 180 180 TYR TYR B . n 
A 1 166 GLU 166 181 181 GLU GLU B . n 
A 1 167 SER 167 182 182 SER SER B . n 
A 1 168 LYS 168 183 183 LYS LYS B . n 
A 1 169 ALA 169 184 184 ALA ALA B . n 
A 1 170 HIS 170 185 185 HIS HIS B . n 
A 1 171 VAL 171 186 186 VAL VAL B . n 
A 1 172 HIS 172 187 187 HIS HIS B . n 
A 1 173 CYS 173 188 188 CYS CYS B . n 
A 1 174 SER 174 189 189 SER SER B . n 
A 1 175 VAL 175 190 190 VAL VAL B . n 
A 1 176 LYS 176 191 191 LYS LYS B . n 
A 1 177 SER 177 192 192 SER SER B . n 
A 1 178 GLU 178 193 ?   ?   ?   B . n 
A 1 179 HIS 179 194 ?   ?   ?   B . n 
A 1 180 SER 180 195 ?   ?   ?   B . n 
A 1 181 ALA 181 196 ?   ?   ?   B . n 
A 1 182 ALA 182 197 ?   ?   ?   B . n 
A 1 183 ALA 183 198 ?   ?   ?   B . n 
A 1 184 LYS 184 199 ?   ?   ?   B . n 
A 1 185 THR 185 200 ?   ?   ?   B . n 
A 1 186 GLY 186 201 ?   ?   ?   B . n 
A 1 187 GLY 187 202 ?   ?   ?   B . n 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F,G,H,I 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1 NE2 ? A HIS 130 ? B HIS 145 ? 1_555 ZN ? B ZN . ? B ZN 1001 ? 1_555 OD1 ? A ASP 137 ? B ASP 152 ? 1_555 107.4 ? 
2 NE2 ? A HIS 130 ? B HIS 145 ? 1_555 ZN ? B ZN . ? B ZN 1001 ? 1_555 ND1 ? A HIS 172 ? B HIS 187 ? 1_555 105.1 ? 
3 OD1 ? A ASP 137 ? B ASP 152 ? 1_555 ZN ? B ZN . ? B ZN 1001 ? 1_555 ND1 ? A HIS 172 ? B HIS 187 ? 1_555 110.3 ? 
4 NE2 ? A HIS 130 ? B HIS 145 ? 1_555 ZN ? B ZN . ? B ZN 1001 ? 1_555 O   ? I HOH .   ? B HOH 295 ? 1_555 118.5 ? 
5 OD1 ? A ASP 137 ? B ASP 152 ? 1_555 ZN ? B ZN . ? B ZN 1001 ? 1_555 O   ? I HOH .   ? B HOH 295 ? 1_555 109.1 ? 
6 ND1 ? A HIS 172 ? B HIS 187 ? 1_555 ZN ? B ZN . ? B ZN 1001 ? 1_555 O   ? I HOH .   ? B HOH 295 ? 1_555 106.3 ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2011-01-26 
2 'Structure model' 1 1 2011-07-13 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
# 
_pdbx_audit_revision_group.ordinal             1 
_pdbx_audit_revision_group.revision_ordinal    2 
_pdbx_audit_revision_group.data_content_type   'Structure model' 
_pdbx_audit_revision_group.group               'Version format compliance' 
# 
loop_
_software.name 
_software.classification 
_software.version 
_software.citation_id 
_software.pdbx_ordinal 
MAR345dtb 'data collection' .                 ? 1 
MOLREP    phasing           .                 ? 2 
PHENIX    refinement        '(phenix.refine)' ? 3 
MOSFLM    'data reduction'  .                 ? 4 
SCALA     'data scaling'    .                 ? 5 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 LYS B 50 ? ? 80.54   2.08    
2 1 ALA B 63 ? ? -109.54 -123.09 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 B MET 16  ? A MET 1   
2  1 Y 1 B ARG 17  ? A ARG 2   
3  1 Y 1 B GLY 18  ? A GLY 3   
4  1 Y 1 B SER 19  ? A SER 4   
5  1 Y 1 B HIS 20  ? A HIS 5   
6  1 Y 1 B HIS 21  ? A HIS 6   
7  1 Y 1 B HIS 22  ? A HIS 7   
8  1 Y 1 B HIS 23  ? A HIS 8   
9  1 Y 1 B HIS 24  ? A HIS 9   
10 1 Y 1 B HIS 25  ? A HIS 10  
11 1 Y 1 B GLY 26  ? A GLY 11  
12 1 Y 1 B SER 27  ? A SER 12  
13 1 Y 1 B CYS 28  ? A CYS 13  
14 1 Y 1 B GLY 29  ? A GLY 14  
15 1 Y 1 B PRO 30  ? A PRO 15  
16 1 Y 1 B GLY 31  ? A GLY 16  
17 1 Y 1 B ARG 32  ? A ARG 17  
18 1 Y 1 B VAL 33  ? A VAL 18  
19 1 Y 1 B VAL 34  ? A VAL 19  
20 1 Y 1 B GLY 35  ? A GLY 20  
21 1 Y 1 B SER 36  ? A SER 21  
22 1 Y 1 B ARG 37  ? A ARG 22  
23 1 Y 1 B ARG 38  ? A ARG 23  
24 1 Y 1 B ARG 39  ? A ARG 24  
25 1 Y 1 B PRO 40  ? A PRO 25  
26 1 Y 1 B ASP 93  ? A ASP 78  
27 1 Y 1 B GLU 94  ? A GLU 79  
28 1 Y 1 B GLU 95  ? A GLU 80  
29 1 Y 1 B ASN 96  ? A ASN 81  
30 1 Y 1 B THR 97  ? A THR 82  
31 1 Y 1 B GLY 98  ? A GLY 83  
32 1 Y 1 B GLU 193 ? A GLU 178 
33 1 Y 1 B HIS 194 ? A HIS 179 
34 1 Y 1 B SER 195 ? A SER 180 
35 1 Y 1 B ALA 196 ? A ALA 181 
36 1 Y 1 B ALA 197 ? A ALA 182 
37 1 Y 1 B ALA 198 ? A ALA 183 
38 1 Y 1 B LYS 199 ? A LYS 184 
39 1 Y 1 B THR 200 ? A THR 185 
40 1 Y 1 B GLY 201 ? A GLY 186 
41 1 Y 1 B GLY 202 ? A GLY 187 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'ZINC ION'      ZN  
3 'SULFATE ION'   SO4 
4 'CARBONATE ION' CO3 
5 water           HOH 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 ZN  1   1001 1001 ZN  ZN  B . 
C 3 SO4 1   1    1    SO4 SO4 B . 
D 3 SO4 1   2    2    SO4 SO4 B . 
E 3 SO4 1   3    3    SO4 SO4 B . 
F 3 SO4 1   6    6    SO4 SO4 B . 
G 3 SO4 1   7    7    SO4 SO4 B . 
H 4 CO3 1   203  1    CO3 CO3 B . 
I 5 HOH 1   4    4    HOH HOH B . 
I 5 HOH 2   5    5    HOH HOH B . 
I 5 HOH 3   8    8    HOH HOH B . 
I 5 HOH 4   9    9    HOH HOH B . 
I 5 HOH 5   10   10   HOH HOH B . 
I 5 HOH 6   11   11   HOH HOH B . 
I 5 HOH 7   12   12   HOH HOH B . 
I 5 HOH 8   13   13   HOH HOH B . 
I 5 HOH 9   14   14   HOH HOH B . 
I 5 HOH 10  15   15   HOH HOH B . 
I 5 HOH 11  204  1    HOH HOH B . 
I 5 HOH 12  205  2    HOH HOH B . 
I 5 HOH 13  206  3    HOH HOH B . 
I 5 HOH 14  207  6    HOH HOH B . 
I 5 HOH 15  208  7    HOH HOH B . 
I 5 HOH 16  209  16   HOH HOH B . 
I 5 HOH 17  210  17   HOH HOH B . 
I 5 HOH 18  211  18   HOH HOH B . 
I 5 HOH 19  212  19   HOH HOH B . 
I 5 HOH 20  213  20   HOH HOH B . 
I 5 HOH 21  214  21   HOH HOH B . 
I 5 HOH 22  215  22   HOH HOH B . 
I 5 HOH 23  216  23   HOH HOH B . 
I 5 HOH 24  217  24   HOH HOH B . 
I 5 HOH 25  218  25   HOH HOH B . 
I 5 HOH 26  219  26   HOH HOH B . 
I 5 HOH 27  220  27   HOH HOH B . 
I 5 HOH 28  221  28   HOH HOH B . 
I 5 HOH 29  222  29   HOH HOH B . 
I 5 HOH 30  223  30   HOH HOH B . 
I 5 HOH 31  224  31   HOH HOH B . 
I 5 HOH 32  225  32   HOH HOH B . 
I 5 HOH 33  226  34   HOH HOH B . 
I 5 HOH 34  227  35   HOH HOH B . 
I 5 HOH 35  228  36   HOH HOH B . 
I 5 HOH 36  229  38   HOH HOH B . 
I 5 HOH 37  230  39   HOH HOH B . 
I 5 HOH 38  231  40   HOH HOH B . 
I 5 HOH 39  232  41   HOH HOH B . 
I 5 HOH 40  233  42   HOH HOH B . 
I 5 HOH 41  234  43   HOH HOH B . 
I 5 HOH 42  235  44   HOH HOH B . 
I 5 HOH 43  236  45   HOH HOH B . 
I 5 HOH 44  237  46   HOH HOH B . 
I 5 HOH 45  238  47   HOH HOH B . 
I 5 HOH 46  239  48   HOH HOH B . 
I 5 HOH 47  240  49   HOH HOH B . 
I 5 HOH 48  241  51   HOH HOH B . 
I 5 HOH 49  242  52   HOH HOH B . 
I 5 HOH 50  243  53   HOH HOH B . 
I 5 HOH 51  244  54   HOH HOH B . 
I 5 HOH 52  245  55   HOH HOH B . 
I 5 HOH 53  246  56   HOH HOH B . 
I 5 HOH 54  247  57   HOH HOH B . 
I 5 HOH 55  248  58   HOH HOH B . 
I 5 HOH 56  249  59   HOH HOH B . 
I 5 HOH 57  250  60   HOH HOH B . 
I 5 HOH 58  251  61   HOH HOH B . 
I 5 HOH 59  252  62   HOH HOH B . 
I 5 HOH 60  253  63   HOH HOH B . 
I 5 HOH 61  254  64   HOH HOH B . 
I 5 HOH 62  255  65   HOH HOH B . 
I 5 HOH 63  256  66   HOH HOH B . 
I 5 HOH 64  257  67   HOH HOH B . 
I 5 HOH 65  258  68   HOH HOH B . 
I 5 HOH 66  259  69   HOH HOH B . 
I 5 HOH 67  260  70   HOH HOH B . 
I 5 HOH 68  261  71   HOH HOH B . 
I 5 HOH 69  262  74   HOH HOH B . 
I 5 HOH 70  263  75   HOH HOH B . 
I 5 HOH 71  264  76   HOH HOH B . 
I 5 HOH 72  265  78   HOH HOH B . 
I 5 HOH 73  266  79   HOH HOH B . 
I 5 HOH 74  267  80   HOH HOH B . 
I 5 HOH 75  268  81   HOH HOH B . 
I 5 HOH 76  269  82   HOH HOH B . 
I 5 HOH 77  270  84   HOH HOH B . 
I 5 HOH 78  271  85   HOH HOH B . 
I 5 HOH 79  272  86   HOH HOH B . 
I 5 HOH 80  273  87   HOH HOH B . 
I 5 HOH 81  274  88   HOH HOH B . 
I 5 HOH 82  275  90   HOH HOH B . 
I 5 HOH 83  276  92   HOH HOH B . 
I 5 HOH 84  277  93   HOH HOH B . 
I 5 HOH 85  278  94   HOH HOH B . 
I 5 HOH 86  279  95   HOH HOH B . 
I 5 HOH 87  280  96   HOH HOH B . 
I 5 HOH 88  281  99   HOH HOH B . 
I 5 HOH 89  282  100  HOH HOH B . 
I 5 HOH 90  283  103  HOH HOH B . 
I 5 HOH 91  284  104  HOH HOH B . 
I 5 HOH 92  285  108  HOH HOH B . 
I 5 HOH 93  286  109  HOH HOH B . 
I 5 HOH 94  287  111  HOH HOH B . 
I 5 HOH 95  288  112  HOH HOH B . 
I 5 HOH 96  289  113  HOH HOH B . 
I 5 HOH 97  290  115  HOH HOH B . 
I 5 HOH 98  291  127  HOH HOH B . 
I 5 HOH 99  292  128  HOH HOH B . 
I 5 HOH 100 293  130  HOH HOH B . 
I 5 HOH 101 294  131  HOH HOH B . 
I 5 HOH 102 295  132  HOH HOH B . 
#